data_6W75
# 
_entry.id   6W75 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.337 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6W75         
WWPDB D_1000247758 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB         'NSP10 - NSP16, different space group' 6W4H           unspecified 
TargetTrack .                                      CSGID-IDP51000 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6W75 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-18 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Minasov, G.'                                                   1  ? 
'Shuvalova, L.'                                                 2  ? 
'Rosas-Lemus, M.'                                               3  ? 
'Kiryukhina, O.'                                                4  ? 
'Wiersum, G.'                                                   5  ? 
'Godzik, A.'                                                    6  ? 
'Jaroszewski, L.'                                               7  ? 
'Stogios, P.J.'                                                 8  ? 
'Skarina, T.'                                                   9  ? 
'Satchell, K.J.F.'                                              10 ? 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 11 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Sci.Signal. ? ? 1937-9145 ? ? 13 ? ? ? 
;High-resolution structures of the SARS-CoV-2 2'- O -methyltransferase reveal strategies for structure-based inhibitor design.
;
2020 ? 10.1126/scisignal.abe1202 32994211 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv     ? ? ?         ? ? ?  ? ? ? 
'The crystal structure of nsp10-nsp16 heterodimer from SARS-CoV-2 in complex with S-adenosylmethionine.'                        
2020 ? 10.1101/2020.04.17.047498 32511376 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rosas-Lemus, M.'  1  0000-0002-6243-0271 
primary 'Minasov, G.'      2  0000-0001-5460-3462 
primary 'Shuvalova, L.'    3  0000-0003-1702-6998 
primary 'Inniss, N.L.'     4  0000-0002-1510-7412 
primary 'Kiryukhina, O.'   5  0000-0001-5962-8423 
primary 'Brunzelle, J.'    6  0000-0001-9197-0018 
primary 'Satchell, K.J.F.' 7  0000-0003-3274-7611 
1       'Rosas-Lemus, M.'  8  ?                   
1       'Minasov, G.'      9  ?                   
1       'Shuvalova, L.'    10 ?                   
1       'Inniss, N.L.'     11 ?                   
1       'Kiryukhina, O.'   12 ?                   
1       'Wiersum, G.'      13 ?                   
1       'Kim, Y.'          14 ?                   
1       'Jedrzejczak, R.'  15 ?                   
1       'Maltseva, N.I.'   16 ?                   
1       'Endres, M.'       17 ?                   
1       'Jaroszewski, L.'  18 ?                   
1       'Godzik, A.'       19 ?                   
1       'Joachimiak, A.'   20 ?                   
1       'Satchell, K.J.F.' 21 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6W75 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     166.245 
_cell.length_a_esd                 ? 
_cell.length_b                     166.245 
_cell.length_b_esd                 ? 
_cell.length_c                     98.279 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6W75 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man "2'-O-methyltransferase"    33627.504 2   2.1.1.- ? 'UNP residues 6799-7096' ? 
2 polymer     man 'Non-structural protein 10' 15075.190 2   ?       ? 'UNP residues 4254-4392' ? 
3 non-polymer syn 'SODIUM ION'                22.990    7   ?       ? ?                        ? 
4 non-polymer syn S-ADENOSYLMETHIONINE        398.437   2   ?       ? ?                        ? 
5 non-polymer syn 'FORMIC ACID'               46.025    20  ?       ? ?                        ? 
6 non-polymer syn 'ZINC ION'                  65.409    4   ?       ? ?                        ? 
7 water       nat water                       18.015    745 ?       ? ?                        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Non-structural protein 16,nsp16,SARS-CoV-2 NSP16'      
2 'nsp10,Growth factor-like peptide,GFL,SARS-CoV-2 NSP10' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNASSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKG
VAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFI
QQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPI
QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
;SNASSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKG
VAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFI
QQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPI
QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
A,C CSGID-IDP51000 
2 'polypeptide(L)' no no 
;SNAAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC
RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
;SNAAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC
RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
B,D CSGID-IDP51000 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   SER n 
1 5   SER n 
1 6   GLN n 
1 7   ALA n 
1 8   TRP n 
1 9   GLN n 
1 10  PRO n 
1 11  GLY n 
1 12  VAL n 
1 13  ALA n 
1 14  MET n 
1 15  PRO n 
1 16  ASN n 
1 17  LEU n 
1 18  TYR n 
1 19  LYS n 
1 20  MET n 
1 21  GLN n 
1 22  ARG n 
1 23  MET n 
1 24  LEU n 
1 25  LEU n 
1 26  GLU n 
1 27  LYS n 
1 28  CYS n 
1 29  ASP n 
1 30  LEU n 
1 31  GLN n 
1 32  ASN n 
1 33  TYR n 
1 34  GLY n 
1 35  ASP n 
1 36  SER n 
1 37  ALA n 
1 38  THR n 
1 39  LEU n 
1 40  PRO n 
1 41  LYS n 
1 42  GLY n 
1 43  ILE n 
1 44  MET n 
1 45  MET n 
1 46  ASN n 
1 47  VAL n 
1 48  ALA n 
1 49  LYS n 
1 50  TYR n 
1 51  THR n 
1 52  GLN n 
1 53  LEU n 
1 54  CYS n 
1 55  GLN n 
1 56  TYR n 
1 57  LEU n 
1 58  ASN n 
1 59  THR n 
1 60  LEU n 
1 61  THR n 
1 62  LEU n 
1 63  ALA n 
1 64  VAL n 
1 65  PRO n 
1 66  TYR n 
1 67  ASN n 
1 68  MET n 
1 69  ARG n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  PHE n 
1 74  GLY n 
1 75  ALA n 
1 76  GLY n 
1 77  SER n 
1 78  ASP n 
1 79  LYS n 
1 80  GLY n 
1 81  VAL n 
1 82  ALA n 
1 83  PRO n 
1 84  GLY n 
1 85  THR n 
1 86  ALA n 
1 87  VAL n 
1 88  LEU n 
1 89  ARG n 
1 90  GLN n 
1 91  TRP n 
1 92  LEU n 
1 93  PRO n 
1 94  THR n 
1 95  GLY n 
1 96  THR n 
1 97  LEU n 
1 98  LEU n 
1 99  VAL n 
1 100 ASP n 
1 101 SER n 
1 102 ASP n 
1 103 LEU n 
1 104 ASN n 
1 105 ASP n 
1 106 PHE n 
1 107 VAL n 
1 108 SER n 
1 109 ASP n 
1 110 ALA n 
1 111 ASP n 
1 112 SER n 
1 113 THR n 
1 114 LEU n 
1 115 ILE n 
1 116 GLY n 
1 117 ASP n 
1 118 CYS n 
1 119 ALA n 
1 120 THR n 
1 121 VAL n 
1 122 HIS n 
1 123 THR n 
1 124 ALA n 
1 125 ASN n 
1 126 LYS n 
1 127 TRP n 
1 128 ASP n 
1 129 LEU n 
1 130 ILE n 
1 131 ILE n 
1 132 SER n 
1 133 ASP n 
1 134 MET n 
1 135 TYR n 
1 136 ASP n 
1 137 PRO n 
1 138 LYS n 
1 139 THR n 
1 140 LYS n 
1 141 ASN n 
1 142 VAL n 
1 143 THR n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 ASP n 
1 148 SER n 
1 149 LYS n 
1 150 GLU n 
1 151 GLY n 
1 152 PHE n 
1 153 PHE n 
1 154 THR n 
1 155 TYR n 
1 156 ILE n 
1 157 CYS n 
1 158 GLY n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 GLN n 
1 163 LYS n 
1 164 LEU n 
1 165 ALA n 
1 166 LEU n 
1 167 GLY n 
1 168 GLY n 
1 169 SER n 
1 170 VAL n 
1 171 ALA n 
1 172 ILE n 
1 173 LYS n 
1 174 ILE n 
1 175 THR n 
1 176 GLU n 
1 177 HIS n 
1 178 SER n 
1 179 TRP n 
1 180 ASN n 
1 181 ALA n 
1 182 ASP n 
1 183 LEU n 
1 184 TYR n 
1 185 LYS n 
1 186 LEU n 
1 187 MET n 
1 188 GLY n 
1 189 HIS n 
1 190 PHE n 
1 191 ALA n 
1 192 TRP n 
1 193 TRP n 
1 194 THR n 
1 195 ALA n 
1 196 PHE n 
1 197 VAL n 
1 198 THR n 
1 199 ASN n 
1 200 VAL n 
1 201 ASN n 
1 202 ALA n 
1 203 SER n 
1 204 SER n 
1 205 SER n 
1 206 GLU n 
1 207 ALA n 
1 208 PHE n 
1 209 LEU n 
1 210 ILE n 
1 211 GLY n 
1 212 CYS n 
1 213 ASN n 
1 214 TYR n 
1 215 LEU n 
1 216 GLY n 
1 217 LYS n 
1 218 PRO n 
1 219 ARG n 
1 220 GLU n 
1 221 GLN n 
1 222 ILE n 
1 223 ASP n 
1 224 GLY n 
1 225 TYR n 
1 226 VAL n 
1 227 MET n 
1 228 HIS n 
1 229 ALA n 
1 230 ASN n 
1 231 TYR n 
1 232 ILE n 
1 233 PHE n 
1 234 TRP n 
1 235 ARG n 
1 236 ASN n 
1 237 THR n 
1 238 ASN n 
1 239 PRO n 
1 240 ILE n 
1 241 GLN n 
1 242 LEU n 
1 243 SER n 
1 244 SER n 
1 245 TYR n 
1 246 SER n 
1 247 LEU n 
1 248 PHE n 
1 249 ASP n 
1 250 MET n 
1 251 SER n 
1 252 LYS n 
1 253 PHE n 
1 254 PRO n 
1 255 LEU n 
1 256 LYS n 
1 257 LEU n 
1 258 ARG n 
1 259 GLY n 
1 260 THR n 
1 261 ALA n 
1 262 VAL n 
1 263 MET n 
1 264 SER n 
1 265 LEU n 
1 266 LYS n 
1 267 GLU n 
1 268 GLY n 
1 269 GLN n 
1 270 ILE n 
1 271 ASN n 
1 272 ASP n 
1 273 MET n 
1 274 ILE n 
1 275 LEU n 
1 276 SER n 
1 277 LEU n 
1 278 LEU n 
1 279 SER n 
1 280 LYS n 
1 281 GLY n 
1 282 ARG n 
1 283 LEU n 
1 284 ILE n 
1 285 ILE n 
1 286 ARG n 
1 287 GLU n 
1 288 ASN n 
1 289 ASN n 
1 290 ARG n 
1 291 VAL n 
1 292 VAL n 
1 293 ILE n 
1 294 SER n 
1 295 SER n 
1 296 ASP n 
1 297 VAL n 
1 298 LEU n 
1 299 VAL n 
1 300 ASN n 
1 301 ASN n 
2 1   SER n 
2 2   ASN n 
2 3   ALA n 
2 4   ALA n 
2 5   GLY n 
2 6   ASN n 
2 7   ALA n 
2 8   THR n 
2 9   GLU n 
2 10  VAL n 
2 11  PRO n 
2 12  ALA n 
2 13  ASN n 
2 14  SER n 
2 15  THR n 
2 16  VAL n 
2 17  LEU n 
2 18  SER n 
2 19  PHE n 
2 20  CYS n 
2 21  ALA n 
2 22  PHE n 
2 23  ALA n 
2 24  VAL n 
2 25  ASP n 
2 26  ALA n 
2 27  ALA n 
2 28  LYS n 
2 29  ALA n 
2 30  TYR n 
2 31  LYS n 
2 32  ASP n 
2 33  TYR n 
2 34  LEU n 
2 35  ALA n 
2 36  SER n 
2 37  GLY n 
2 38  GLY n 
2 39  GLN n 
2 40  PRO n 
2 41  ILE n 
2 42  THR n 
2 43  ASN n 
2 44  CYS n 
2 45  VAL n 
2 46  LYS n 
2 47  MET n 
2 48  LEU n 
2 49  CYS n 
2 50  THR n 
2 51  HIS n 
2 52  THR n 
2 53  GLY n 
2 54  THR n 
2 55  GLY n 
2 56  GLN n 
2 57  ALA n 
2 58  ILE n 
2 59  THR n 
2 60  VAL n 
2 61  THR n 
2 62  PRO n 
2 63  GLU n 
2 64  ALA n 
2 65  ASN n 
2 66  MET n 
2 67  ASP n 
2 68  GLN n 
2 69  GLU n 
2 70  SER n 
2 71  PHE n 
2 72  GLY n 
2 73  GLY n 
2 74  ALA n 
2 75  SER n 
2 76  CYS n 
2 77  CYS n 
2 78  LEU n 
2 79  TYR n 
2 80  CYS n 
2 81  ARG n 
2 82  CYS n 
2 83  HIS n 
2 84  ILE n 
2 85  ASP n 
2 86  HIS n 
2 87  PRO n 
2 88  ASN n 
2 89  PRO n 
2 90  LYS n 
2 91  GLY n 
2 92  PHE n 
2 93  CYS n 
2 94  ASP n 
2 95  LEU n 
2 96  LYS n 
2 97  GLY n 
2 98  LYS n 
2 99  TYR n 
2 100 VAL n 
2 101 GLN n 
2 102 ILE n 
2 103 PRO n 
2 104 THR n 
2 105 THR n 
2 106 CYS n 
2 107 ALA n 
2 108 ASN n 
2 109 ASP n 
2 110 PRO n 
2 111 VAL n 
2 112 GLY n 
2 113 PHE n 
2 114 THR n 
2 115 LEU n 
2 116 LYS n 
2 117 ASN n 
2 118 THR n 
2 119 VAL n 
2 120 CYS n 
2 121 THR n 
2 122 VAL n 
2 123 CYS n 
2 124 GLY n 
2 125 MET n 
2 126 TRP n 
2 127 LYS n 
2 128 GLY n 
2 129 TYR n 
2 130 GLY n 
2 131 CYS n 
2 132 SER n 
2 133 CYS n 
2 134 ASP n 
2 135 GLN n 
2 136 LEU n 
2 137 ARG n 
2 138 GLU n 
2 139 PRO n 
2 140 MET n 
2 141 LEU n 
2 142 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 301 2019-nCoV ? 'rep, 1a-1b' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 
2697049 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' magic ? ? ? ? ? ? plasmid ? ? ? pMCSG53 ? ? 
2 1 sample 'Biological sequence' 1 142 2019-nCoV ? 'rep, 1a-1b' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 
2697049 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' magic ? ? ? ? ? ? plasmid ? ? ? pMCSG53 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP R1AB_SARS2 P0DTD1 ? 1 
;SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAP
GTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK
LALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS
SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
6799 
2 UNP R1AB_SARS2 P0DTD1 ? 2 
;AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCH
IDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
4254 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6W75 A 4 ? 301 ? P0DTD1 6799 ? 7096 ? 6799 7096 
2 2 6W75 B 4 ? 142 ? P0DTD1 4254 ? 4392 ? 4254 4392 
3 1 6W75 C 4 ? 301 ? P0DTD1 6799 ? 7096 ? 6799 7096 
4 2 6W75 D 4 ? 142 ? P0DTD1 4254 ? 4392 ? 4254 4392 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6W75 SER A 1 ? UNP P0DTD1 ? ? 'expression tag' 6796 1  
1 6W75 ASN A 2 ? UNP P0DTD1 ? ? 'expression tag' 6797 2  
1 6W75 ALA A 3 ? UNP P0DTD1 ? ? 'expression tag' 6798 3  
2 6W75 SER B 1 ? UNP P0DTD1 ? ? 'expression tag' 4251 4  
2 6W75 ASN B 2 ? UNP P0DTD1 ? ? 'expression tag' 4252 5  
2 6W75 ALA B 3 ? UNP P0DTD1 ? ? 'expression tag' 4253 6  
3 6W75 SER C 1 ? UNP P0DTD1 ? ? 'expression tag' 6796 7  
3 6W75 ASN C 2 ? UNP P0DTD1 ? ? 'expression tag' 6797 8  
3 6W75 ALA C 3 ? UNP P0DTD1 ? ? 'expression tag' 6798 9  
4 6W75 SER D 1 ? UNP P0DTD1 ? ? 'expression tag' 4251 10 
4 6W75 ASN D 2 ? UNP P0DTD1 ? ? 'expression tag' 4252 11 
4 6W75 ALA D 3 ? UNP P0DTD1 ? ? 'expression tag' 4253 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
FMT non-polymer         . 'FORMIC ACID'        ? 'C H2 O2'         46.025  
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6W75 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.87 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.25 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;9.7 mg/mL 1:1 nsp10/nsp16 in 0.5 M sodium chloride, 0.01 M Tris, pH 7.5, 2 mM SAM, 1 mM TCEP, 5% glycerol against ComPAS screen F10 (0.4 M potassium/sodium tartrate), cryoprotectant: 4 M sodium formate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      Be 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-03-07 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'diamond(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            28.4 
_reflns.entry_id                         6W75 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.95 
_reflns.d_resolution_low                 30.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       113483 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.0 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.6 
_reflns.pdbx_Rmerge_I_obs                0.077 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.077 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            25.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.025 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.083 
_reflns.pdbx_Rpim_I_all                  0.030 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5592 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.742 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.6 
_reflns_shell.pdbx_Rsym_value             0.742 
_reflns_shell.pdbx_chi_squared            1.001 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.795 
_reflns_shell.pdbx_Rpim_I_all             0.285 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.880 
_reflns_shell.pdbx_CC_star                0.968 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.578 
_refine.aniso_B[1][2]                            0.289 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            0.578 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -1.876 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               33.856 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.960 
_refine.details                                  'Hydrogens have been added in their riding positions' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6W75 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.951 
_refine.ls_d_res_low                             29.925 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     113455 
_refine.ls_number_reflns_R_free                  5610 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.893 
_refine.ls_percent_reflns_R_free                 4.945 
_refine.ls_R_factor_all                          0.158 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.1745 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1573 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 6W4H' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.098 
_refine.pdbx_overall_ESU_R_Free                  0.092 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             4.427 
_refine.overall_SU_ML                            0.065 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6384 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             745 
_refine_hist.number_atoms_total               7254 
_refine_hist.d_res_high                       1.951 
_refine_hist.d_res_low                        29.925 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  0.013  7038  ? r_bond_refined_d               ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  6370  ? r_bond_other_d                 ? ? 
'X-RAY DIFFRACTION' ? 1.286  1.640  9579  ? r_angle_refined_deg            ? ? 
'X-RAY DIFFRACTION' ? 0.329  1.578  14856 ? r_angle_other_deg              ? ? 
'X-RAY DIFFRACTION' ? 3.157  5.000  905   ? r_dihedral_angle_1_deg         ? ? 
'X-RAY DIFFRACTION' ? 27.895 23.654 312   ? r_dihedral_angle_2_deg         ? ? 
'X-RAY DIFFRACTION' ? 8.996  15.000 1173  ? r_dihedral_angle_3_deg         ? ? 
'X-RAY DIFFRACTION' ? 7.019  15.000 25    ? r_dihedral_angle_4_deg         ? ? 
'X-RAY DIFFRACTION' ? 0.058  0.200  931   ? r_chiral_restr                 ? ? 
'X-RAY DIFFRACTION' ? 0.055  0.020  8046  ? r_gen_planes_refined           ? ? 
'X-RAY DIFFRACTION' ? 0.051  0.020  1443  ? r_gen_planes_other             ? ? 
'X-RAY DIFFRACTION' ? 0.203  0.200  1430  ? r_nbd_refined                  ? ? 
'X-RAY DIFFRACTION' ? 0.170  0.200  6053  ? r_symmetry_nbd_other           ? ? 
'X-RAY DIFFRACTION' ? 0.170  0.200  3399  ? r_nbtor_refined                ? ? 
'X-RAY DIFFRACTION' ? 0.095  0.200  2573  ? r_symmetry_nbtor_other         ? ? 
'X-RAY DIFFRACTION' ? 0.142  0.200  662   ? r_xyhbond_nbd_refined          ? ? 
'X-RAY DIFFRACTION' ? 0.118  0.200  2     ? r_symmetry_xyhbond_nbd_other   ? ? 
'X-RAY DIFFRACTION' ? 0.147  0.200  19    ? r_metal_ion_refined            ? ? 
'X-RAY DIFFRACTION' ? 0.149  0.200  42    ? r_symmetry_nbd_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.234  0.200  117   ? r_nbd_other                    ? ? 
'X-RAY DIFFRACTION' ? 0.135  0.200  41    ? r_symmetry_xyhbond_nbd_refined ? ? 
'X-RAY DIFFRACTION' ? 1.310  2.101  3524  ? r_mcbond_it                    ? ? 
'X-RAY DIFFRACTION' ? 1.310  2.101  3525  ? r_mcbond_other                 ? ? 
'X-RAY DIFFRACTION' ? 2.194  3.138  4461  ? r_mcangle_it                   ? ? 
'X-RAY DIFFRACTION' ? 2.194  3.139  4462  ? r_mcangle_other                ? ? 
'X-RAY DIFFRACTION' ? 1.971  2.339  3514  ? r_scbond_it                    ? ? 
'X-RAY DIFFRACTION' ? 1.914  2.311  3474  ? r_scbond_other                 ? ? 
'X-RAY DIFFRACTION' ? 2.853  3.399  5118  ? r_scangle_it                   ? ? 
'X-RAY DIFFRACTION' ? 2.853  3.399  5119  ? r_scangle_other                ? ? 
'X-RAY DIFFRACTION' ? 6.614  26.586 8297  ? r_lrange_it                    ? ? 
'X-RAY DIFFRACTION' ? 6.425  25.668 8095  ? r_lrange_other                 ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.951 2.001  8299 . 428 7819 99.3734  . 0.216 . 0.232 . 0.215 . . . . . 0.178 . 20 . 0.906 0.902 
'X-RAY DIFFRACTION' 2.001 2.056  8118 . 381 7737 100.0000 . 0.197 . 0.210 . 0.196 . . . . . 0.162 . 20 . 0.925 0.918 
'X-RAY DIFFRACTION' 2.056 2.115  7846 . 383 7463 100.0000 . 0.175 . 0.185 . 0.175 . . . . . 0.144 . 20 . 0.946 0.941 
'X-RAY DIFFRACTION' 2.115 2.180  7658 . 394 7264 100.0000 . 0.167 . 0.188 . 0.166 . . . . . 0.139 . 20 . 0.950 0.944 
'X-RAY DIFFRACTION' 2.180 2.251  7415 . 347 7068 100.0000 . 0.159 . 0.172 . 0.158 . . . . . 0.134 . 20 . 0.957 0.954 
'X-RAY DIFFRACTION' 2.251 2.329  7182 . 352 6830 100.0000 . 0.144 . 0.162 . 0.143 . . . . . 0.122 . 20 . 0.968 0.965 
'X-RAY DIFFRACTION' 2.329 2.417  6951 . 340 6611 100.0000 . 0.147 . 0.170 . 0.146 . . . . . 0.125 . 20 . 0.967 0.962 
'X-RAY DIFFRACTION' 2.417 2.515  6685 . 365 6320 100.0000 . 0.148 . 0.179 . 0.146 . . . . . 0.129 . 20 . 0.968 0.963 
'X-RAY DIFFRACTION' 2.515 2.626  6417 . 318 6099 100.0000 . 0.154 . 0.169 . 0.153 . . . . . 0.136 . 20 . 0.967 0.966 
'X-RAY DIFFRACTION' 2.626 2.753  6143 . 282 5861 100.0000 . 0.163 . 0.180 . 0.162 . . . . . 0.148 . 20 . 0.963 0.959 
'X-RAY DIFFRACTION' 2.753 2.900  5843 . 263 5580 100.0000 . 0.166 . 0.184 . 0.165 . . . . . 0.157 . 20 . 0.960 0.956 
'X-RAY DIFFRACTION' 2.900 3.074  5570 . 308 5262 100.0000 . 0.172 . 0.196 . 0.170 . . . . . 0.167 . 20 . 0.960 0.952 
'X-RAY DIFFRACTION' 3.074 3.284  5196 . 231 4965 100.0000 . 0.164 . 0.172 . 0.164 . . . . . 0.166 . 20 . 0.967 0.962 
'X-RAY DIFFRACTION' 3.284 3.544  4880 . 244 4636 100.0000 . 0.151 . 0.166 . 0.150 . . . . . 0.158 . 20 . 0.971 0.968 
'X-RAY DIFFRACTION' 3.544 3.876  4505 . 268 4237 100.0000 . 0.135 . 0.155 . 0.133 . . . . . 0.143 . 20 . 0.979 0.977 
'X-RAY DIFFRACTION' 3.876 4.325  4080 . 214 3866 100.0000 . 0.129 . 0.140 . 0.128 . . . . . 0.145 . 20 . 0.976 0.975 
'X-RAY DIFFRACTION' 4.325 4.977  3665 . 153 3512 100.0000 . 0.131 . 0.159 . 0.130 . . . . . 0.150 . 20 . 0.978 0.973 
'X-RAY DIFFRACTION' 4.977 6.054  3087 . 142 2945 100.0000 . 0.179 . 0.189 . 0.179 . . . . . 0.201 . 20 . 0.970 0.965 
'X-RAY DIFFRACTION' 6.054 8.391  2460 . 119 2341 100.0000 . 0.177 . 0.202 . 0.176 . . . . . 0.203 . 20 . 0.965 0.962 
'X-RAY DIFFRACTION' 8.391 29.925 1509 . 78  1429 99.8675  . 0.198 . 0.188 . 0.198 . . . . . 0.251 . 20 . 0.962 0.963 
# 
_struct.entry_id                     6W75 
_struct.title                        '1.95 Angstrom Resolution Crystal Structure of NSP10 - NSP16 Complex from SARS-CoV-2' 
_struct.pdbx_descriptor              'nsp16, nsp10' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6W75 
_struct_keywords.text            
'Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, nsp16, nsp10, complex, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 6 ? 
Q  N N 6 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 3 ? 
KA N N 5 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 15  ? MET A 20  ? PRO A 6810 MET A 6815 1 ? 6  
HELX_P HELX_P2  AA2 MET A 44  ? ASN A 58  ? MET A 6839 ASN A 6853 1 ? 15 
HELX_P HELX_P3  AA3 ALA A 82  ? LEU A 92  ? ALA A 6877 LEU A 6887 1 ? 11 
HELX_P HELX_P4  AA4 ASP A 117 ? ALA A 119 ? ASP A 6912 ALA A 6914 5 ? 3  
HELX_P HELX_P5  AA5 PRO A 137 ? VAL A 142 ? PRO A 6932 VAL A 6937 1 ? 6  
HELX_P HELX_P6  AA6 GLY A 151 ? LYS A 163 ? GLY A 6946 LYS A 6958 1 ? 13 
HELX_P HELX_P7  AA7 ASN A 180 ? GLY A 188 ? ASN A 6975 GLY A 6983 1 ? 9  
HELX_P HELX_P8  AA8 VAL A 200 ? ALA A 202 ? VAL A 6995 ALA A 6997 5 ? 3  
HELX_P HELX_P9  AA9 ASP A 223 ? ASN A 238 ? ASP A 7018 ASN A 7033 1 ? 16 
HELX_P HELX_P10 AB1 SER A 244 ? ASP A 249 ? SER A 7039 ASP A 7044 5 ? 6  
HELX_P HELX_P11 AB2 LYS A 266 ? ILE A 270 ? LYS A 7061 ILE A 7065 5 ? 5  
HELX_P HELX_P12 AB3 ASN A 271 ? LYS A 280 ? ASN A 7066 LYS A 7075 1 ? 10 
HELX_P HELX_P13 AB4 ASP B 25  ? SER B 36  ? ASP B 4275 SER B 4286 1 ? 12 
HELX_P HELX_P14 AB5 ALA B 74  ? CYS B 76  ? ALA B 4324 CYS B 4326 5 ? 3  
HELX_P HELX_P15 AB6 CYS B 77  ? HIS B 83  ? CYS B 4327 HIS B 4333 1 ? 7  
HELX_P HELX_P16 AB7 THR B 105 ? ALA B 107 ? THR B 4355 ALA B 4357 5 ? 3  
HELX_P HELX_P17 AB8 ASP B 109 ? ASN B 117 ? ASP B 4359 ASN B 4367 1 ? 9  
HELX_P HELX_P18 AB9 SER C 4   ? GLN C 9   ? SER C 6799 GLN C 6804 5 ? 6  
HELX_P HELX_P19 AC1 PRO C 15  ? MET C 20  ? PRO C 6810 MET C 6815 1 ? 6  
HELX_P HELX_P20 AC2 MET C 44  ? ASN C 58  ? MET C 6839 ASN C 6853 1 ? 15 
HELX_P HELX_P21 AC3 ALA C 82  ? LEU C 92  ? ALA C 6877 LEU C 6887 1 ? 11 
HELX_P HELX_P22 AC4 ASP C 117 ? ALA C 119 ? ASP C 6912 ALA C 6914 5 ? 3  
HELX_P HELX_P23 AC5 GLY C 151 ? LYS C 163 ? GLY C 6946 LYS C 6958 1 ? 13 
HELX_P HELX_P24 AC6 ASN C 180 ? GLY C 188 ? ASN C 6975 GLY C 6983 1 ? 9  
HELX_P HELX_P25 AC7 ASP C 223 ? ASN C 238 ? ASP C 7018 ASN C 7033 1 ? 16 
HELX_P HELX_P26 AC8 SER C 244 ? ASP C 249 ? SER C 7039 ASP C 7044 5 ? 6  
HELX_P HELX_P27 AC9 LYS C 266 ? ILE C 270 ? LYS C 7061 ILE C 7065 5 ? 5  
HELX_P HELX_P28 AD1 ASN C 271 ? LYS C 280 ? ASN C 7066 LYS C 7075 1 ? 10 
HELX_P HELX_P29 AD2 ASP D 25  ? SER D 36  ? ASP D 4275 SER D 4286 1 ? 12 
HELX_P HELX_P30 AD3 ALA D 74  ? CYS D 76  ? ALA D 4324 CYS D 4326 5 ? 3  
HELX_P HELX_P31 AD4 CYS D 77  ? HIS D 83  ? CYS D 4327 HIS D 4333 1 ? 7  
HELX_P HELX_P32 AD5 THR D 105 ? ALA D 107 ? THR D 4355 ALA D 4357 5 ? 3  
HELX_P HELX_P33 AD6 ASP D 109 ? ASN D 117 ? ASP D 4359 ASN D 4367 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A  ARG 89  O   A ? ? 1_555 E  NA  . NA ? ? A ARG 6884 A NA  7101 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc2  metalc ? ? A  ARG 89  O   B ? ? 1_555 E  NA  . NA ? ? A ARG 6884 A NA  7101 1_555 ? ? ? ? ? ? ? 2.741 ? ? 
metalc3  metalc ? ? A  GLN 90  O   ? ? ? 1_555 E  NA  . NA ? ? A GLN 6885 A NA  7101 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc4  metalc ? ? A  LEU 92  O   ? ? ? 1_555 E  NA  . NA ? ? A LEU 6887 A NA  7101 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc5  metalc ? ? E  NA  .   NA  ? ? ? 1_555 LA HOH . O  ? ? A NA  7101 A HOH 7392 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc6  metalc ? ? E  NA  .   NA  ? ? ? 1_555 MA HOH . O  ? ? A NA  7101 B HOH 4504 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc7  metalc ? ? B  CYS 77  SG  ? ? ? 1_555 P  ZN  . ZN ? ? B CYS 4327 B ZN  4401 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc8  metalc ? ? B  CYS 80  SG  ? ? ? 1_555 P  ZN  . ZN ? ? B CYS 4330 B ZN  4401 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc9  metalc ? ? B  HIS 86  NE2 ? ? ? 1_555 P  ZN  . ZN ? ? B HIS 4336 B ZN  4401 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc10 metalc ? ? B  CYS 93  SG  ? ? ? 1_555 P  ZN  . ZN ? ? B CYS 4343 B ZN  4401 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc11 metalc ? ? B  THR 105 O   ? ? ? 1_555 R  NA  . NA ? ? B THR 4355 B NA  4403 1_555 ? ? ? ? ? ? ? 2.833 ? ? 
metalc12 metalc ? ? B  ASN 108 OD1 ? ? ? 1_555 R  NA  . NA ? ? B ASN 4358 B NA  4403 1_555 ? ? ? ? ? ? ? 3.017 ? ? 
metalc13 metalc ? ? B  CYS 120 SG  ? ? ? 1_555 Q  ZN  . ZN ? ? B CYS 4370 B ZN  4402 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc14 metalc ? ? B  CYS 123 SG  ? ? ? 1_555 Q  ZN  . ZN ? ? B CYS 4373 B ZN  4402 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc15 metalc ? ? B  CYS 131 SG  ? ? ? 1_555 Q  ZN  . ZN ? ? B CYS 4381 B ZN  4402 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc16 metalc ? ? B  CYS 133 SG  ? ? ? 1_555 Q  ZN  . ZN ? ? B CYS 4383 B ZN  4402 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc17 metalc ? ? R  NA  .   NA  ? ? ? 1_555 MA HOH . O  ? ? B NA  4403 B HOH 4529 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc18 metalc ? ? R  NA  .   NA  ? ? ? 1_555 MA HOH . O  ? ? B NA  4403 B HOH 4544 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc19 metalc ? ? R  NA  .   NA  ? ? ? 1_555 MA HOH . O  ? ? B NA  4403 B HOH 4584 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc20 metalc ? ? R  NA  .   NA  ? ? ? 1_555 MA HOH . O  B ? B NA  4403 B HOH 4589 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc21 metalc ? ? R  NA  .   NA  ? ? ? 1_555 MA HOH . O  A ? B NA  4403 B HOH 4589 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc22 metalc ? ? C  ASN 58  O   ? ? ? 1_555 T  NA  . NA ? ? C ASN 6853 C NA  7102 1_555 ? ? ? ? ? ? ? 2.668 ? ? 
metalc23 metalc ? ? C  LEU 60  O   ? ? ? 1_555 T  NA  . NA ? ? C LEU 6855 C NA  7102 1_555 ? ? ? ? ? ? ? 2.514 ? ? 
metalc24 metalc ? ? C  ARG 89  O   A ? ? 1_555 S  NA  . NA ? ? C ARG 6884 C NA  7101 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc25 metalc ? ? C  ARG 89  O   B ? ? 1_555 S  NA  . NA ? ? C ARG 6884 C NA  7101 1_555 ? ? ? ? ? ? ? 2.749 ? ? 
metalc26 metalc ? ? C  GLN 90  O   ? ? ? 1_555 S  NA  . NA ? ? C GLN 6885 C NA  7101 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc27 metalc ? ? C  LEU 92  O   ? ? ? 1_555 S  NA  . NA ? ? C LEU 6887 C NA  7101 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc28 metalc ? ? C  ILE 115 O   ? ? ? 1_555 V  NA  . NA ? ? C ILE 6910 C NA  7104 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc29 metalc ? ? C  GLN 161 O   ? ? ? 1_555 U  NA  . NA ? ? C GLN 6956 C NA  7103 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc30 metalc ? ? C  TYR 214 OH  ? ? ? 1_555 U  NA  . NA ? ? C TYR 7009 C NA  7103 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc31 metalc ? ? C  SER 295 OG  ? ? ? 1_555 V  NA  . NA ? ? C SER 7090 C NA  7104 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc32 metalc ? ? S  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7101 C HOH 7381 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc33 metalc ? ? S  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7101 C HOH 7436 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc34 metalc ? ? T  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7102 C HOH 7294 1_555 ? ? ? ? ? ? ? 2.577 ? ? 
metalc35 metalc ? ? T  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7102 C HOH 7418 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc36 metalc ? ? T  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7102 C HOH 7429 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc37 metalc ? ? T  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7102 C HOH 7442 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc38 metalc ? ? U  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7103 C HOH 7226 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc39 metalc ? ? U  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7103 C HOH 7434 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc40 metalc ? ? U  NA  .   NA  ? ? ? 1_555 NA HOH . O  B ? C NA  7103 C HOH 7439 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc41 metalc ? ? U  NA  .   NA  ? ? ? 1_555 NA HOH . O  A ? C NA  7103 C HOH 7477 1_555 ? ? ? ? ? ? ? 2.668 ? ? 
metalc42 metalc ? ? V  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7104 C HOH 7241 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc43 metalc ? ? V  NA  .   NA  ? ? ? 1_555 NA HOH . O  ? ? C NA  7104 C HOH 7309 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc44 metalc ? ? D  CYS 77  SG  ? ? ? 1_555 HA ZN  . ZN ? ? D CYS 4327 D ZN  4401 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc45 metalc ? ? D  CYS 80  SG  ? ? ? 1_555 HA ZN  . ZN ? ? D CYS 4330 D ZN  4401 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc46 metalc ? ? D  HIS 86  NE2 ? ? ? 1_555 HA ZN  . ZN ? ? D HIS 4336 D ZN  4401 1_555 ? ? ? ? ? ? ? 2.109 ? ? 
metalc47 metalc ? ? D  CYS 93  SG  ? ? ? 1_555 HA ZN  . ZN ? ? D CYS 4343 D ZN  4401 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc48 metalc ? ? D  THR 114 O   ? ? ? 1_555 JA NA  . NA ? ? D THR 4364 D NA  4403 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc49 metalc ? ? D  ASN 117 O   ? ? ? 1_555 JA NA  . NA ? ? D ASN 4367 D NA  4403 1_555 ? ? ? ? ? ? ? 2.585 ? ? 
metalc50 metalc ? ? D  CYS 120 SG  ? ? ? 1_555 IA ZN  . ZN ? ? D CYS 4370 D ZN  4402 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc51 metalc ? ? D  CYS 123 SG  ? ? ? 1_555 IA ZN  . ZN ? ? D CYS 4373 D ZN  4402 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc52 metalc ? ? D  CYS 131 SG  ? ? ? 1_555 IA ZN  . ZN ? ? D CYS 4381 D ZN  4402 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc53 metalc ? ? D  CYS 133 SG  ? ? ? 1_555 IA ZN  . ZN ? ? D CYS 4383 D ZN  4402 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc54 metalc ? ? JA NA  .   NA  ? ? ? 1_555 OA HOH . O  ? ? D NA  4403 D HOH 4511 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc55 metalc ? ? JA NA  .   NA  ? ? ? 1_555 OA HOH . O  ? ? D NA  4403 D HOH 4575 1_555 ? ? ? ? ? ? ? 3.111 ? ? 
metalc56 metalc ? ? JA NA  .   NA  ? ? ? 1_555 OA HOH . O  A ? D NA  4403 D HOH 4576 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 3 ? 
AA6 ? 8 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? parallel      
AA6 5 6 ? parallel      
AA6 6 7 ? parallel      
AA6 7 8 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 11  ? ALA A 13  ? GLY A 6806 ALA A 6808 
AA1 2 PHE A 190 ? THR A 198 ? PHE A 6985 THR A 6993 
AA1 3 ALA A 207 ? TYR A 214 ? ALA A 7002 TYR A 7009 
AA1 4 LEU A 164 ? ILE A 174 ? LEU A 6959 ILE A 6969 
AA1 5 TRP A 127 ? SER A 132 ? TRP A 6922 SER A 6927 
AA1 6 ARG A 69  ? PHE A 73  ? ARG A 6864 PHE A 6868 
AA1 7 LEU A 97  ? ASP A 102 ? LEU A 6892 ASP A 6897 
AA1 8 SER A 112 ? ILE A 115 ? SER A 6907 ILE A 6910 
AA2 1 VAL A 121 ? THR A 123 ? VAL A 6916 THR A 6918 
AA2 2 VAL A 292 ? SER A 295 ? VAL A 7087 SER A 7090 
AA2 3 VAL C 297 ? LEU C 298 ? VAL C 7092 LEU C 7093 
AA3 1 ALA A 261 ? MET A 263 ? ALA A 7056 MET A 7058 
AA3 2 LEU A 283 ? ILE A 285 ? LEU A 7078 ILE A 7080 
AA4 1 VAL A 297 ? LEU A 298 ? VAL A 7092 LEU A 7093 
AA4 2 VAL C 292 ? SER C 295 ? VAL C 7087 SER C 7090 
AA4 3 VAL C 121 ? THR C 123 ? VAL C 6916 THR C 6918 
AA5 1 ILE B 58  ? THR B 59  ? ILE B 4308 THR B 4309 
AA5 2 TYR B 99  ? PRO B 103 ? TYR B 4349 PRO B 4353 
AA5 3 GLN B 68  ? GLY B 72  ? GLN B 4318 GLY B 4322 
AA6 1 GLY C 11  ? ALA C 13  ? GLY C 6806 ALA C 6808 
AA6 2 PHE C 190 ? THR C 198 ? PHE C 6985 THR C 6993 
AA6 3 ALA C 207 ? TYR C 214 ? ALA C 7002 TYR C 7009 
AA6 4 LEU C 164 ? ILE C 174 ? LEU C 6959 ILE C 6969 
AA6 5 TRP C 127 ? SER C 132 ? TRP C 6922 SER C 6927 
AA6 6 ARG C 69  ? PHE C 73  ? ARG C 6864 PHE C 6868 
AA6 7 LEU C 97  ? ASP C 102 ? LEU C 6892 ASP C 6897 
AA6 8 SER C 112 ? ILE C 115 ? SER C 6907 ILE C 6910 
AA7 1 ALA C 261 ? MET C 263 ? ALA C 7056 MET C 7058 
AA7 2 LEU C 283 ? ILE C 285 ? LEU C 7078 ILE C 7080 
AA8 1 ILE D 58  ? THR D 59  ? ILE D 4308 THR D 4309 
AA8 2 TYR D 99  ? PRO D 103 ? TYR D 4349 PRO D 4353 
AA8 3 GLN D 68  ? GLY D 72  ? GLN D 4318 GLY D 4322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 12  ? N VAL A 6807 O VAL A 197 ? O VAL A 6992 
AA1 2 3 N TRP A 192 ? N TRP A 6987 O CYS A 212 ? O CYS A 7007 
AA1 3 4 O LEU A 209 ? O LEU A 7004 N ILE A 172 ? N ILE A 6967 
AA1 4 5 O ALA A 165 ? O ALA A 6960 N TRP A 127 ? N TRP A 6922 
AA1 5 6 O ILE A 131 ? O ILE A 6926 N PHE A 73  ? N PHE A 6868 
AA1 6 7 N VAL A 70  ? N VAL A 6865 O LEU A 97  ? O LEU A 6892 
AA1 7 8 N ASP A 100 ? N ASP A 6895 O LEU A 114 ? O LEU A 6909 
AA2 1 2 N HIS A 122 ? N HIS A 6917 O SER A 294 ? O SER A 7089 
AA2 2 3 N ILE A 293 ? N ILE A 7088 O VAL C 297 ? O VAL C 7092 
AA3 1 2 N MET A 263 ? N MET A 7058 O ILE A 284 ? O ILE A 7079 
AA4 1 2 N VAL A 297 ? N VAL A 7092 O ILE C 293 ? O ILE C 7088 
AA4 2 3 O SER C 294 ? O SER C 7089 N HIS C 122 ? N HIS C 6917 
AA5 1 2 N THR B 59  ? N THR B 4309 O TYR B 99  ? O TYR B 4349 
AA5 2 3 O ILE B 102 ? O ILE B 4352 N GLU B 69  ? N GLU B 4319 
AA6 1 2 N VAL C 12  ? N VAL C 6807 O VAL C 197 ? O VAL C 6992 
AA6 2 3 N TRP C 192 ? N TRP C 6987 O CYS C 212 ? O CYS C 7007 
AA6 3 4 O LEU C 209 ? O LEU C 7004 N ILE C 172 ? N ILE C 6967 
AA6 4 5 O ALA C 165 ? O ALA C 6960 N TRP C 127 ? N TRP C 6922 
AA6 5 6 O ILE C 131 ? O ILE C 6926 N PHE C 73  ? N PHE C 6868 
AA6 6 7 N VAL C 70  ? N VAL C 6865 O LEU C 97  ? O LEU C 6892 
AA6 7 8 N ASP C 100 ? N ASP C 6895 O LEU C 114 ? O LEU C 6909 
AA7 1 2 N MET C 263 ? N MET C 7058 O ILE C 284 ? O ILE C 7079 
AA8 1 2 N THR D 59  ? N THR D 4309 O TYR D 99  ? O TYR D 4349 
AA8 2 3 O ILE D 102 ? O ILE D 4352 N GLU D 69  ? N GLU D 4319 
# 
_atom_sites.entry_id                    6W75 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.006015 
_atom_sites.fract_transf_matrix[1][2]   0.003473 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006946 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010175 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
C  2.310  20.844 1.020 10.208 1.589 0.569  0.865 51.651  0.216   
H  0.493  10.511 0.323 26.126 0.140 3.142  0.041 57.800  0.003   
N  12.222 0.006  3.135 9.893  2.014 28.997 1.167 0.583   -11.538 
NA 4.766  3.285  3.176 8.842  1.268 0.314  1.114 129.424 0.733   
O  3.049  13.277 2.287 5.701  1.546 0.324  0.867 32.909  0.251   
S  6.905  1.468  5.203 22.215 1.438 0.254  1.586 56.172  1.049   
ZN 14.082 3.266  7.036 0.233  5.165 10.316 2.411 58.710  0.995   
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A  1 5   ? 85.936  47.464  1.228   1.000 55.345  ? 6800 SER A N     1 
ATOM   2    C  CA    . SER A  1 5   ? 85.109  46.360  1.773   1.000 50.611  ? 6800 SER A CA    1 
ATOM   3    C  C     . SER A  1 5   ? 85.375  45.068  0.992   1.000 47.684  ? 6800 SER A C     1 
ATOM   4    O  O     . SER A  1 5   ? 85.544  45.113  -0.239  1.000 50.516  ? 6800 SER A O     1 
ATOM   5    C  CB    . SER A  1 5   ? 83.646  46.701  1.756   1.000 52.233  ? 6800 SER A CB    1 
ATOM   6    O  OG    . SER A  1 5   ? 82.869  45.612  2.233   1.000 48.446  ? 6800 SER A OG    1 
ATOM   7    N  N     A GLN A  1 6   ? 85.367  43.942  1.698   0.600 43.837  ? 6801 GLN A N     1 
ATOM   8    N  N     B GLN A  1 6   ? 85.382  43.949  1.717   0.400 44.049  ? 6801 GLN A N     1 
ATOM   9    C  CA    A GLN A  1 6   ? 85.626  42.615  1.084   0.600 40.626  ? 6801 GLN A CA    1 
ATOM   10   C  CA    B GLN A  1 6   ? 85.630  42.597  1.154   0.400 40.774  ? 6801 GLN A CA    1 
ATOM   11   C  C     A GLN A  1 6   ? 84.290  41.933  0.762   0.600 38.105  ? 6801 GLN A C     1 
ATOM   12   C  C     B GLN A  1 6   ? 84.293  41.915  0.828   0.400 38.458  ? 6801 GLN A C     1 
ATOM   13   O  O     A GLN A  1 6   ? 84.323  40.833  0.190   0.600 34.832  ? 6801 GLN A O     1 
ATOM   14   O  O     B GLN A  1 6   ? 84.328  40.770  0.344   0.400 36.158  ? 6801 GLN A O     1 
ATOM   15   C  CB    A GLN A  1 6   ? 86.512  41.817  2.039   0.600 39.810  ? 6801 GLN A CB    1 
ATOM   16   C  CB    B GLN A  1 6   ? 86.451  41.806  2.174   0.400 40.029  ? 6801 GLN A CB    1 
ATOM   17   C  CG    A GLN A  1 6   ? 87.905  42.421  2.189   0.600 41.671  ? 6801 GLN A CG    1 
ATOM   18   C  CG    B GLN A  1 6   ? 85.833  41.803  3.567   0.400 41.093  ? 6801 GLN A CG    1 
ATOM   19   C  CD    A GLN A  1 6   ? 88.656  41.910  3.394   0.600 40.754  ? 6801 GLN A CD    1 
ATOM   20   C  CD    B GLN A  1 6   ? 86.769  41.302  4.641   0.400 41.107  ? 6801 GLN A CD    1 
ATOM   21   O  OE1   A GLN A  1 6   ? 88.089  41.717  4.468   0.600 45.272  ? 6801 GLN A OE1   1 
ATOM   22   O  OE1   B GLN A  1 6   ? 87.959  41.099  4.413   0.400 45.119  ? 6801 GLN A OE1   1 
ATOM   23   N  NE2   A GLN A  1 6   ? 89.959  41.750  3.241   0.600 39.162  ? 6801 GLN A NE2   1 
ATOM   24   N  NE2   B GLN A  1 6   ? 86.242  41.125  5.841   0.400 40.748  ? 6801 GLN A NE2   1 
ATOM   25   N  N     . ALA A  1 7   ? 83.170  42.617  1.036   1.000 37.547  ? 6802 ALA A N     1 
ATOM   26   C  CA    . ALA A  1 7   ? 81.813  42.052  0.823   1.000 37.025  ? 6802 ALA A CA    1 
ATOM   27   C  C     . ALA A  1 7   ? 81.501  41.772  -0.652  1.000 34.632  ? 6802 ALA A C     1 
ATOM   28   O  O     . ALA A  1 7   ? 80.585  40.967  -0.882  1.000 34.613  ? 6802 ALA A O     1 
ATOM   29   C  CB    . ALA A  1 7   ? 80.776  42.971  1.418   1.000 40.054  ? 6802 ALA A CB    1 
ATOM   30   N  N     . TRP A  1 8   ? 82.178  42.426  -1.605  1.000 32.950  ? 6803 TRP A N     1 
ATOM   31   C  CA    . TRP A  1 8   ? 81.886  42.155  -3.041  1.000 32.577  ? 6803 TRP A CA    1 
ATOM   32   C  C     . TRP A  1 8   ? 82.869  41.124  -3.595  1.000 30.213  ? 6803 TRP A C     1 
ATOM   33   O  O     . TRP A  1 8   ? 82.723  40.756  -4.773  1.000 29.997  ? 6803 TRP A O     1 
ATOM   34   C  CB    . TRP A  1 8   ? 81.839  43.428  -3.895  1.000 35.105  ? 6803 TRP A CB    1 
ATOM   35   C  CG    . TRP A  1 8   ? 80.597  44.221  -3.639  1.000 36.047  ? 6803 TRP A CG    1 
ATOM   36   C  CD1   . TRP A  1 8   ? 79.389  44.077  -4.253  1.000 36.956  ? 6803 TRP A CD1   1 
ATOM   37   C  CD2   . TRP A  1 8   ? 80.424  45.242  -2.646  1.000 36.618  ? 6803 TRP A CD2   1 
ATOM   38   N  NE1   . TRP A  1 8   ? 78.476  44.944  -3.716  1.000 38.234  ? 6803 TRP A NE1   1 
ATOM   39   C  CE2   . TRP A  1 8   ? 79.084  45.677  -2.732  1.000 37.976  ? 6803 TRP A CE2   1 
ATOM   40   C  CE3   . TRP A  1 8   ? 81.267  45.828  -1.697  1.000 37.373  ? 6803 TRP A CE3   1 
ATOM   41   C  CZ2   . TRP A  1 8   ? 78.574  46.680  -1.912  1.000 39.439  ? 6803 TRP A CZ2   1 
ATOM   42   C  CZ3   . TRP A  1 8   ? 80.761  46.821  -0.886  1.000 38.706  ? 6803 TRP A CZ3   1 
ATOM   43   C  CH2   . TRP A  1 8   ? 79.434  47.237  -0.994  1.000 40.131  ? 6803 TRP A CH2   1 
ATOM   44   N  N     . GLN A  1 9   ? 83.804  40.660  -2.764  1.000 28.190  ? 6804 GLN A N     1 
ATOM   45   C  CA    . GLN A  1 9   ? 84.746  39.593  -3.191  1.000 27.393  ? 6804 GLN A CA    1 
ATOM   46   C  C     . GLN A  1 9   ? 84.037  38.263  -2.970  1.000 24.872  ? 6804 GLN A C     1 
ATOM   47   O  O     . GLN A  1 9   ? 83.034  38.208  -2.254  1.000 24.473  ? 6804 GLN A O     1 
ATOM   48   C  CB    . GLN A  1 9   ? 86.039  39.602  -2.361  1.000 28.514  ? 6804 GLN A CB    1 
ATOM   49   C  CG    . GLN A  1 9   ? 86.824  40.907  -2.427  1.000 31.240  ? 6804 GLN A CG    1 
ATOM   50   C  CD    . GLN A  1 9   ? 87.983  40.960  -1.459  1.000 33.414  ? 6804 GLN A CD    1 
ATOM   51   O  OE1   . GLN A  1 9   ? 88.278  40.011  -0.714  1.000 35.314  ? 6804 GLN A OE1   1 
ATOM   52   N  NE2   . GLN A  1 9   ? 88.659  42.096  -1.457  1.000 34.369  ? 6804 GLN A NE2   1 
ATOM   53   N  N     . PRO A  1 10  ? 84.509  37.158  -3.585  1.000 23.597  ? 6805 PRO A N     1 
ATOM   54   C  CA    . PRO A  1 10  ? 83.937  35.839  -3.315  1.000 22.773  ? 6805 PRO A CA    1 
ATOM   55   C  C     . PRO A  1 10  ? 84.259  35.369  -1.888  1.000 21.705  ? 6805 PRO A C     1 
ATOM   56   O  O     . PRO A  1 10  ? 83.591  34.499  -1.367  1.000 21.970  ? 6805 PRO A O     1 
ATOM   57   C  CB    . PRO A  1 10  ? 84.612  34.928  -4.353  1.000 22.555  ? 6805 PRO A CB    1 
ATOM   58   C  CG    . PRO A  1 10  ? 85.870  35.657  -4.744  1.000 23.221  ? 6805 PRO A CG    1 
ATOM   59   C  CD    . PRO A  1 10  ? 85.521  37.130  -4.652  1.000 24.154  ? 6805 PRO A CD    1 
ATOM   60   N  N     . GLY A  1 11  ? 85.277  35.974  -1.280  1.000 21.414  ? 6806 GLY A N     1 
ATOM   61   C  CA    . GLY A  1 11  ? 85.689  35.571  0.076   1.000 21.255  ? 6806 GLY A CA    1 
ATOM   62   C  C     . GLY A  1 11  ? 86.950  36.297  0.484   1.000 21.156  ? 6806 GLY A C     1 
ATOM   63   O  O     . GLY A  1 11  ? 87.305  37.278  -0.187  1.000 21.915  ? 6806 GLY A O     1 
ATOM   64   N  N     . VAL A  1 12  ? 87.635  35.792  1.502   1.000 20.860  ? 6807 VAL A N     1 
ATOM   65   C  CA    . VAL A  1 12  ? 88.864  36.476  1.987   1.000 21.629  ? 6807 VAL A CA    1 
ATOM   66   C  C     . VAL A  1 12  ? 89.956  35.427  2.197   1.000 21.055  ? 6807 VAL A C     1 
ATOM   67   O  O     . VAL A  1 12  ? 89.673  34.385  2.835   1.000 19.972  ? 6807 VAL A O     1 
ATOM   68   C  CB    . VAL A  1 12  ? 88.589  37.253  3.289   1.000 22.676  ? 6807 VAL A CB    1 
ATOM   69   C  CG1   . VAL A  1 12  ? 89.812  38.038  3.736   1.000 24.070  ? 6807 VAL A CG1   1 
ATOM   70   C  CG2   . VAL A  1 12  ? 87.392  38.183  3.150   1.000 25.021  ? 6807 VAL A CG2   1 
ATOM   71   N  N     . ALA A  1 13  ? 91.140  35.700  1.648   1.000 20.768  ? 6808 ALA A N     1 
ATOM   72   C  CA    . ALA A  1 13  ? 92.323  34.830  1.808   1.000 21.282  ? 6808 ALA A CA    1 
ATOM   73   C  C     . ALA A  1 13  ? 93.133  35.335  3.009   1.000 21.948  ? 6808 ALA A C     1 
ATOM   74   O  O     . ALA A  1 13  ? 93.215  36.553  3.203   1.000 22.301  ? 6808 ALA A O     1 
ATOM   75   C  CB    . ALA A  1 13  ? 93.150  34.859  0.553   1.000 22.247  ? 6808 ALA A CB    1 
ATOM   76   N  N     . MET A  1 14  ? 93.684  34.416  3.788   1.000 22.376  ? 6809 MET A N     1 
ATOM   77   C  CA    . MET A  1 14  ? 94.503  34.774  4.966   1.000 22.907  ? 6809 MET A CA    1 
ATOM   78   C  C     . MET A  1 14  ? 95.697  35.623  4.536   1.000 23.460  ? 6809 MET A C     1 
ATOM   79   O  O     . MET A  1 14  ? 96.481  35.199  3.687   1.000 24.147  ? 6809 MET A O     1 
ATOM   80   C  CB    . MET A  1 14  ? 95.028  33.502  5.627   1.000 23.363  ? 6809 MET A CB    1 
ATOM   81   C  CG    . MET A  1 14  ? 95.795  33.762  6.891   1.000 23.947  ? 6809 MET A CG    1 
ATOM   82   S  SD    . MET A  1 14  ? 96.256  32.232  7.689   1.000 26.943  ? 6809 MET A SD    1 
ATOM   83   C  CE    . MET A  1 14  ? 97.466  31.576  6.547   1.000 29.481  ? 6809 MET A CE    1 
ATOM   84   N  N     . PRO A  1 15  ? 95.859  36.857  5.062   1.000 23.391  ? 6810 PRO A N     1 
ATOM   85   C  CA    . PRO A  1 15  ? 97.028  37.676  4.730   1.000 24.639  ? 6810 PRO A CA    1 
ATOM   86   C  C     . PRO A  1 15  ? 98.349  36.939  5.009   1.000 24.997  ? 6810 PRO A C     1 
ATOM   87   O  O     . PRO A  1 15  ? 98.425  36.204  5.976   1.000 24.385  ? 6810 PRO A O     1 
ATOM   88   C  CB    . PRO A  1 15  ? 96.842  38.906  5.629   1.000 25.932  ? 6810 PRO A CB    1 
ATOM   89   C  CG    . PRO A  1 15  ? 95.337  39.031  5.734   1.000 24.981  ? 6810 PRO A CG    1 
ATOM   90   C  CD    . PRO A  1 15  ? 94.866  37.596  5.858   1.000 23.552  ? 6810 PRO A CD    1 
ATOM   91   N  N     . ASN A  1 16  ? 99.352  37.152  4.153   1.000 25.284  ? 6811 ASN A N     1 
ATOM   92   C  CA    . ASN A  1 16  ? 100.661 36.460  4.287   1.000 26.386  ? 6811 ASN A CA    1 
ATOM   93   C  C     . ASN A  1 16  ? 101.319 36.679  5.657   1.000 27.034  ? 6811 ASN A C     1 
ATOM   94   O  O     . ASN A  1 16  ? 101.973 35.745  6.144   1.000 27.121  ? 6811 ASN A O     1 
ATOM   95   C  CB    . ASN A  1 16  ? 101.645 36.884  3.190   1.000 27.705  ? 6811 ASN A CB    1 
ATOM   96   C  CG    . ASN A  1 16  ? 101.359 36.257  1.840   1.000 29.535  ? 6811 ASN A CG    1 
ATOM   97   O  OD1   . ASN A  1 16  ? 100.705 35.217  1.757   1.000 28.446  ? 6811 ASN A OD1   1 
ATOM   98   N  ND2   . ASN A  1 16  ? 101.876 36.862  0.782   1.000 29.722  ? 6811 ASN A ND2   1 
ATOM   99   N  N     A LEU A  1 17  ? 101.140 37.857  6.265   0.600 27.736  ? 6812 LEU A N     1 
ATOM   100  N  N     B LEU A  1 17  ? 101.131 37.852  6.272   0.400 27.437  ? 6812 LEU A N     1 
ATOM   101  C  CA    A LEU A  1 17  ? 101.813 38.154  7.562   0.600 28.829  ? 6812 LEU A CA    1 
ATOM   102  C  CA    B LEU A  1 17  ? 101.829 38.150  7.556   0.400 28.267  ? 6812 LEU A CA    1 
ATOM   103  C  C     A LEU A  1 17  ? 101.445 37.113  8.626   0.600 28.022  ? 6812 LEU A C     1 
ATOM   104  C  C     B LEU A  1 17  ? 101.443 37.128  8.635   0.400 27.685  ? 6812 LEU A C     1 
ATOM   105  O  O     A LEU A  1 17  ? 102.317 36.804  9.459   0.600 27.777  ? 6812 LEU A O     1 
ATOM   106  O  O     B LEU A  1 17  ? 102.295 36.855  9.500   0.400 27.765  ? 6812 LEU A O     1 
ATOM   107  C  CB    A LEU A  1 17  ? 101.471 39.580  8.015   0.600 29.920  ? 6812 LEU A CB    1 
ATOM   108  C  CB    B LEU A  1 17  ? 101.531 39.590  7.991   0.400 28.857  ? 6812 LEU A CB    1 
ATOM   109  C  CG    A LEU A  1 17  ? 102.323 40.684  7.392   0.600 32.162  ? 6812 LEU A CG    1 
ATOM   110  C  CG    B LEU A  1 17  ? 102.315 40.081  9.210   0.400 29.689  ? 6812 LEU A CG    1 
ATOM   111  C  CD1   A LEU A  1 17  ? 101.721 42.060  7.635   0.600 33.218  ? 6812 LEU A CD1   1 
ATOM   112  C  CD1   B LEU A  1 17  ? 103.809 39.864  9.028   0.400 30.651  ? 6812 LEU A CD1   1 
ATOM   113  C  CD2   A LEU A  1 17  ? 103.744 40.630  7.932   0.600 34.022  ? 6812 LEU A CD2   1 
ATOM   114  C  CD2   B LEU A  1 17  ? 102.028 41.549  9.492   0.400 31.091  ? 6812 LEU A CD2   1 
ATOM   115  N  N     . TYR A  1 18  ? 100.231 36.562  8.570   1.000 27.153  ? 6813 TYR A N     1 
ATOM   116  C  CA    . TYR A  1 18  ? 99.805  35.547  9.574   1.000 26.671  ? 6813 TYR A CA    1 
ATOM   117  C  C     . TYR A  1 18  ? 100.676 34.294  9.484   1.000 27.949  ? 6813 TYR A C     1 
ATOM   118  O  O     . TYR A  1 18  ? 100.945 33.698  10.532  1.000 28.912  ? 6813 TYR A O     1 
ATOM   119  C  CB    . TYR A  1 18  ? 98.328  35.189  9.421   1.000 25.691  ? 6813 TYR A CB    1 
ATOM   120  C  CG    . TYR A  1 18  ? 97.417  36.290  9.877   1.000 26.083  ? 6813 TYR A CG    1 
ATOM   121  C  CD1   . TYR A  1 18  ? 97.174  36.492  11.224  1.000 26.260  ? 6813 TYR A CD1   1 
ATOM   122  C  CD2   . TYR A  1 18  ? 96.834  37.156  8.971   1.000 26.583  ? 6813 TYR A CD2   1 
ATOM   123  C  CE1   . TYR A  1 18  ? 96.363  37.522  11.662  1.000 26.372  ? 6813 TYR A CE1   1 
ATOM   124  C  CE2   . TYR A  1 18  ? 96.017  38.188  9.393   1.000 26.761  ? 6813 TYR A CE2   1 
ATOM   125  C  CZ    . TYR A  1 18  ? 95.775  38.367  10.740  1.000 26.570  ? 6813 TYR A CZ    1 
ATOM   126  O  OH    . TYR A  1 18  ? 94.969  39.382  11.159  1.000 27.670  ? 6813 TYR A OH    1 
ATOM   127  N  N     . LYS A  1 19  ? 101.118 33.936  8.277   1.000 29.128  ? 6814 LYS A N     1 
ATOM   128  C  CA    . LYS A  1 19  ? 101.945 32.724  8.055   1.000 29.417  ? 6814 LYS A CA    1 
ATOM   129  C  C     . LYS A  1 19  ? 103.299 32.833  8.757   1.000 31.038  ? 6814 LYS A C     1 
ATOM   130  O  O     . LYS A  1 19  ? 103.905 31.777  9.030   1.000 31.249  ? 6814 LYS A O     1 
ATOM   131  C  CB    . LYS A  1 19  ? 102.234 32.551  6.564   1.000 30.728  ? 6814 LYS A CB    1 
ATOM   132  C  CG    . LYS A  1 19  ? 101.027 32.475  5.649   1.000 30.135  ? 6814 LYS A CG    1 
ATOM   133  C  CD    . LYS A  1 19  ? 101.469 32.336  4.210   1.000 31.705  ? 6814 LYS A CD    1 
ATOM   134  C  CE    . LYS A  1 19  ? 100.336 32.291  3.212   1.000 31.742  ? 6814 LYS A CE    1 
ATOM   135  N  NZ    . LYS A  1 19  ? 100.857 32.366  1.821   1.000 32.072  ? 6814 LYS A NZ    1 
ATOM   136  N  N     . MET A  1 20  ? 103.748 34.055  9.043   1.000 30.699  ? 6815 MET A N     1 
ATOM   137  C  CA    . MET A  1 20  ? 105.089 34.257  9.638   1.000 33.080  ? 6815 MET A CA    1 
ATOM   138  C  C     . MET A  1 20  ? 104.996 34.455  11.155  1.000 31.141  ? 6815 MET A C     1 
ATOM   139  O  O     . MET A  1 20  ? 106.041 34.668  11.770  1.000 30.441  ? 6815 MET A O     1 
ATOM   140  C  CB    . MET A  1 20  ? 105.760 35.464  8.982   1.000 37.339  ? 6815 MET A CB    1 
ATOM   141  C  CG    . MET A  1 20  ? 105.937 35.278  7.480   1.000 40.747  ? 6815 MET A CG    1 
ATOM   142  S  SD    . MET A  1 20  ? 106.697 36.711  6.720   1.000 51.567  ? 6815 MET A SD    1 
ATOM   143  C  CE    . MET A  1 20  ? 105.363 37.886  6.876   1.000 50.183  ? 6815 MET A CE    1 
ATOM   144  N  N     . GLN A  1 21  ? 103.806 34.314  11.740  1.000 28.984  ? 6816 GLN A N     1 
ATOM   145  C  CA    . GLN A  1 21  ? 103.678 34.502  13.210  1.000 28.916  ? 6816 GLN A CA    1 
ATOM   146  C  C     . GLN A  1 21  ? 103.878 33.155  13.921  1.000 28.332  ? 6816 GLN A C     1 
ATOM   147  O  O     . GLN A  1 21  ? 104.016 32.114  13.241  1.000 26.572  ? 6816 GLN A O     1 
ATOM   148  C  CB    . GLN A  1 21  ? 102.337 35.166  13.543  1.000 28.398  ? 6816 GLN A CB    1 
ATOM   149  C  CG    . GLN A  1 21  ? 102.108 36.457  12.759  1.000 28.816  ? 6816 GLN A CG    1 
ATOM   150  C  CD    . GLN A  1 21  ? 103.304 37.376  12.826  1.000 30.999  ? 6816 GLN A CD    1 
ATOM   151  O  OE1   . GLN A  1 21  ? 103.865 37.589  13.897  1.000 32.149  ? 6816 GLN A OE1   1 
ATOM   152  N  NE2   . GLN A  1 21  ? 103.708 37.927  11.681  1.000 29.555  ? 6816 GLN A NE2   1 
ATOM   153  N  N     A ARG A  1 22  ? 103.915 33.179  15.254  0.500 28.673  ? 6817 ARG A N     1 
ATOM   154  N  N     B ARG A  1 22  ? 103.912 33.206  15.255  0.500 28.887  ? 6817 ARG A N     1 
ATOM   155  C  CA    A ARG A  1 22  ? 104.051 31.924  16.036  0.500 29.445  ? 6817 ARG A CA    1 
ATOM   156  C  CA    B ARG A  1 22  ? 104.122 32.036  16.147  0.500 29.853  ? 6817 ARG A CA    1 
ATOM   157  C  C     A ARG A  1 22  ? 103.030 32.000  17.173  0.500 28.358  ? 6817 ARG A C     1 
ATOM   158  C  C     B ARG A  1 22  ? 103.018 32.050  17.209  0.500 28.495  ? 6817 ARG A C     1 
ATOM   159  O  O     A ARG A  1 22  ? 103.422 32.164  18.341  0.500 28.232  ? 6817 ARG A O     1 
ATOM   160  O  O     B ARG A  1 22  ? 103.347 32.219  18.394  0.500 28.131  ? 6817 ARG A O     1 
ATOM   161  C  CB    A ARG A  1 22  ? 105.494 31.710  16.500  0.500 31.944  ? 6817 ARG A CB    1 
ATOM   162  C  CB    B ARG A  1 22  ? 105.501 32.151  16.807  0.500 32.844  ? 6817 ARG A CB    1 
ATOM   163  C  CG    A ARG A  1 22  ? 105.808 30.257  16.819  0.500 33.788  ? 6817 ARG A CG    1 
ATOM   164  C  CG    B ARG A  1 22  ? 106.659 32.298  15.828  0.500 35.693  ? 6817 ARG A CG    1 
ATOM   165  C  CD    A ARG A  1 22  ? 107.295 29.949  16.863  0.500 36.403  ? 6817 ARG A CD    1 
ATOM   166  C  CD    B ARG A  1 22  ? 107.962 32.698  16.508  0.500 39.125  ? 6817 ARG A CD    1 
ATOM   167  N  NE    A ARG A  1 22  ? 107.523 28.521  16.683  0.500 37.564  ? 6817 ARG A NE    1 
ATOM   168  N  NE    B ARG A  1 22  ? 108.330 31.837  17.626  0.500 40.643  ? 6817 ARG A NE    1 
ATOM   169  C  CZ    A ARG A  1 22  ? 107.642 27.935  15.494  0.500 38.333  ? 6817 ARG A CZ    1 
ATOM   170  C  CZ    B ARG A  1 22  ? 108.114 32.130  18.904  0.500 41.621  ? 6817 ARG A CZ    1 
ATOM   171  N  NH1   A ARG A  1 22  ? 107.841 26.630  15.405  0.500 39.239  ? 6817 ARG A NH1   1 
ATOM   172  N  NH1   B ARG A  1 22  ? 107.549 33.278  19.238  0.500 41.440  ? 6817 ARG A NH1   1 
ATOM   173  N  NH2   A ARG A  1 22  ? 107.559 28.660  14.394  0.500 38.184  ? 6817 ARG A NH2   1 
ATOM   174  N  NH2   B ARG A  1 22  ? 108.479 31.281  19.846  0.500 43.192  ? 6817 ARG A NH2   1 
ATOM   175  N  N     . MET A  1 23  ? 101.756 31.895  16.800  1.000 27.317  ? 6818 MET A N     1 
ATOM   176  C  CA    . MET A  1 23  ? 100.634 31.979  17.762  1.000 28.076  ? 6818 MET A CA    1 
ATOM   177  C  C     . MET A  1 23  ? 100.452 30.669  18.522  1.000 28.409  ? 6818 MET A C     1 
ATOM   178  O  O     . MET A  1 23  ? 100.803 29.603  17.993  1.000 27.797  ? 6818 MET A O     1 
ATOM   179  C  CB    . MET A  1 23  ? 99.326  32.316  17.041  1.000 28.577  ? 6818 MET A CB    1 
ATOM   180  C  CG    . MET A  1 23  ? 99.400  33.591  16.226  1.000 30.072  ? 6818 MET A CG    1 
ATOM   181  S  SD    . MET A  1 23  ? 99.990  35.009  17.170  1.000 35.591  ? 6818 MET A SD    1 
ATOM   182  C  CE    . MET A  1 23  ? 98.775  35.065  18.488  1.000 34.658  ? 6818 MET A CE    1 
ATOM   183  N  N     . LEU A  1 24  ? 99.972  30.799  19.757  1.000 29.553  ? 6819 LEU A N     1 
ATOM   184  C  CA    . LEU A  1 24  ? 99.592  29.642  20.595  1.000 28.323  ? 6819 LEU A CA    1 
ATOM   185  C  C     . LEU A  1 24  ? 98.143  29.310  20.223  1.000 26.487  ? 6819 LEU A C     1 
ATOM   186  O  O     . LEU A  1 24  ? 97.354  30.248  20.008  1.000 24.654  ? 6819 LEU A O     1 
ATOM   187  C  CB    . LEU A  1 24  ? 99.716  30.024  22.068  1.000 29.822  ? 6819 LEU A CB    1 
ATOM   188  C  CG    . LEU A  1 24  ? 99.537  28.876  23.057  1.000 31.157  ? 6819 LEU A CG    1 
ATOM   189  C  CD1   . LEU A  1 24  ? 100.624 27.830  22.871  1.000 33.466  ? 6819 LEU A CD1   1 
ATOM   190  C  CD2   . LEU A  1 24  ? 99.553  29.397  24.478  1.000 33.184  ? 6819 LEU A CD2   1 
ATOM   191  N  N     . LEU A  1 25  ? 97.809  28.030  20.132  1.000 26.376  ? 6820 LEU A N     1 
ATOM   192  C  CA    . LEU A  1 25  ? 96.437  27.628  19.746  1.000 27.010  ? 6820 LEU A CA    1 
ATOM   193  C  C     . LEU A  1 25  ? 95.441  27.975  20.855  1.000 27.443  ? 6820 LEU A C     1 
ATOM   194  O  O     . LEU A  1 25  ? 95.802  27.929  22.056  1.000 29.179  ? 6820 LEU A O     1 
ATOM   195  C  CB    . LEU A  1 25  ? 96.423  26.119  19.484  1.000 29.345  ? 6820 LEU A CB    1 
ATOM   196  C  CG    . LEU A  1 25  ? 95.085  25.538  19.025  1.000 30.654  ? 6820 LEU A CG    1 
ATOM   197  C  CD1   . LEU A  1 25  ? 94.711  26.053  17.648  1.000 30.476  ? 6820 LEU A CD1   1 
ATOM   198  C  CD2   . LEU A  1 25  ? 95.132  24.018  19.015  1.000 34.618  ? 6820 LEU A CD2   1 
ATOM   199  N  N     . GLU A  1 26  ? 94.235  28.342  20.452  1.000 26.530  ? 6821 GLU A N     1 
ATOM   200  C  CA    . GLU A  1 26  ? 93.132  28.554  21.413  1.000 28.165  ? 6821 GLU A CA    1 
ATOM   201  C  C     . GLU A  1 26  ? 91.826  28.458  20.630  1.000 26.021  ? 6821 GLU A C     1 
ATOM   202  O  O     . GLU A  1 26  ? 91.872  28.210  19.405  1.000 24.850  ? 6821 GLU A O     1 
ATOM   203  C  CB    . GLU A  1 26  ? 93.299  29.832  22.238  1.000 31.477  ? 6821 GLU A CB    1 
ATOM   204  C  CG    . GLU A  1 26  ? 93.202  31.116  21.455  1.000 34.602  ? 6821 GLU A CG    1 
ATOM   205  C  CD    . GLU A  1 26  ? 93.400  32.318  22.365  1.000 40.196  ? 6821 GLU A CD    1 
ATOM   206  O  OE1   . GLU A  1 26  ? 94.401  32.324  23.132  1.000 42.043  ? 6821 GLU A OE1   1 
ATOM   207  O  OE2   . GLU A  1 26  ? 92.504  33.183  22.387  1.000 43.385  ? 6821 GLU A OE2   1 
ATOM   208  N  N     . LYS A  1 27  ? 90.711  28.577  21.335  1.000 25.928  ? 6822 LYS A N     1 
ATOM   209  C  CA    . LYS A  1 27  ? 89.384  28.437  20.708  1.000 26.256  ? 6822 LYS A CA    1 
ATOM   210  C  C     . LYS A  1 27  ? 89.179  29.465  19.593  1.000 25.077  ? 6822 LYS A C     1 
ATOM   211  O  O     . LYS A  1 27  ? 89.662  30.618  19.723  1.000 23.251  ? 6822 LYS A O     1 
ATOM   212  C  CB    . LYS A  1 27  ? 88.289  28.638  21.755  1.000 29.212  ? 6822 LYS A CB    1 
ATOM   213  C  CG    . LYS A  1 27  ? 86.875  28.514  21.215  1.000 31.853  ? 6822 LYS A CG    1 
ATOM   214  C  CD    . LYS A  1 27  ? 85.803  28.616  22.266  1.000 34.854  ? 6822 LYS A CD    1 
ATOM   215  C  CE    . LYS A  1 27  ? 84.437  28.258  21.727  1.000 37.709  ? 6822 LYS A CE    1 
ATOM   216  N  NZ    . LYS A  1 27  ? 84.085  29.102  20.562  1.000 40.132  ? 6822 LYS A NZ    1 
ATOM   217  N  N     . CYS A  1 28  ? 88.518  29.022  18.527  1.000 24.479  ? 6823 CYS A N     1 
ATOM   218  C  CA    . CYS A  1 28  ? 88.077  29.927  17.441  1.000 25.115  ? 6823 CYS A CA    1 
ATOM   219  C  C     . CYS A  1 28  ? 86.721  30.492  17.883  1.000 27.467  ? 6823 CYS A C     1 
ATOM   220  O  O     . CYS A  1 28  ? 85.787  29.686  18.062  1.000 28.985  ? 6823 CYS A O     1 
ATOM   221  C  CB    . CYS A  1 28  ? 87.958  29.197  16.112  1.000 25.078  ? 6823 CYS A CB    1 
ATOM   222  S  SG    . CYS A  1 28  ? 87.542  30.313  14.743  1.000 25.251  ? 6823 CYS A SG    1 
ATOM   223  N  N     . ASP A  1 29  ? 86.643  31.805  18.111  1.000 28.358  ? 6824 ASP A N     1 
ATOM   224  C  CA    . ASP A  1 29  ? 85.414  32.487  18.604  1.000 30.891  ? 6824 ASP A CA    1 
ATOM   225  C  C     . ASP A  1 29  ? 85.044  33.563  17.576  1.000 30.054  ? 6824 ASP A C     1 
ATOM   226  O  O     . ASP A  1 29  ? 85.639  34.656  17.615  1.000 29.456  ? 6824 ASP A O     1 
ATOM   227  C  CB    . ASP A  1 29  ? 85.687  33.048  20.004  1.000 35.712  ? 6824 ASP A CB    1 
ATOM   228  C  CG    . ASP A  1 29  ? 84.478  33.588  20.752  1.000 42.307  ? 6824 ASP A CG    1 
ATOM   229  O  OD1   . ASP A  1 29  ? 83.336  33.265  20.360  1.000 46.009  ? 6824 ASP A OD1   1 
ATOM   230  O  OD2   . ASP A  1 29  ? 84.693  34.315  21.745  1.000 51.330  ? 6824 ASP A OD2   1 
ATOM   231  N  N     . LEU A  1 30  ? 84.121  33.257  16.670  1.000 29.082  ? 6825 LEU A N     1 
ATOM   232  C  CA    . LEU A  1 30  ? 83.787  34.219  15.584  1.000 30.275  ? 6825 LEU A CA    1 
ATOM   233  C  C     . LEU A  1 30  ? 82.741  35.236  16.042  1.000 32.592  ? 6825 LEU A C     1 
ATOM   234  O  O     . LEU A  1 30  ? 81.694  34.815  16.541  1.000 31.851  ? 6825 LEU A O     1 
ATOM   235  C  CB    . LEU A  1 30  ? 83.293  33.432  14.371  1.000 28.871  ? 6825 LEU A CB    1 
ATOM   236  C  CG    . LEU A  1 30  ? 84.317  32.458  13.799  1.000 27.081  ? 6825 LEU A CG    1 
ATOM   237  C  CD1   . LEU A  1 30  ? 83.735  31.683  12.630  1.000 26.961  ? 6825 LEU A CD1   1 
ATOM   238  C  CD2   . LEU A  1 30  ? 85.577  33.202  13.384  1.000 26.590  ? 6825 LEU A CD2   1 
ATOM   239  N  N     . GLN A  1 31  ? 83.017  36.519  15.799  1.000 37.434  ? 6826 GLN A N     1 
ATOM   240  C  CA    . GLN A  1 31  ? 82.086  37.616  16.172  1.000 44.580  ? 6826 GLN A CA    1 
ATOM   241  C  C     . GLN A  1 31  ? 80.797  37.489  15.356  1.000 46.316  ? 6826 GLN A C     1 
ATOM   242  O  O     . GLN A  1 31  ? 79.716  37.673  15.942  1.000 48.615  ? 6826 GLN A O     1 
ATOM   243  C  CB    . GLN A  1 31  ? 82.726  38.982  15.911  1.000 50.229  ? 6826 GLN A CB    1 
ATOM   244  C  CG    . GLN A  1 31  ? 81.839  40.148  16.334  1.000 58.376  ? 6826 GLN A CG    1 
ATOM   245  C  CD    . GLN A  1 31  ? 82.479  41.497  16.121  1.000 63.615  ? 6826 GLN A CD    1 
ATOM   246  O  OE1   . GLN A  1 31  ? 83.554  41.612  15.538  1.000 68.842  ? 6826 GLN A OE1   1 
ATOM   247  N  NE2   . GLN A  1 31  ? 81.813  42.539  16.592  1.000 71.075  ? 6826 GLN A NE2   1 
ATOM   248  N  N     . ASN A  1 32  ? 80.928  37.133  14.072  1.000 46.757  ? 6827 ASN A N     1 
ATOM   249  C  CA    . ASN A  1 32  ? 79.787  37.034  13.117  1.000 50.219  ? 6827 ASN A CA    1 
ATOM   250  C  C     . ASN A  1 32  ? 79.211  35.617  13.125  1.000 52.850  ? 6827 ASN A C     1 
ATOM   251  O  O     . ASN A  1 32  ? 78.550  35.251  12.139  1.000 52.407  ? 6827 ASN A O     1 
ATOM   252  C  CB    . ASN A  1 32  ? 80.211  37.468  11.708  1.000 47.383  ? 6827 ASN A CB    1 
ATOM   253  C  CG    . ASN A  1 32  ? 80.693  38.906  11.679  1.000 47.890  ? 6827 ASN A CG    1 
ATOM   254  O  OD1   . ASN A  1 32  ? 80.646  39.600  12.695  1.000 44.890  ? 6827 ASN A OD1   1 
ATOM   255  N  ND2   . ASN A  1 32  ? 81.158  39.363  10.528  1.000 47.539  ? 6827 ASN A ND2   1 
ATOM   256  N  N     . TYR A  1 33  ? 79.450  34.870  14.208  1.000 52.762  ? 6828 TYR A N     1 
ATOM   257  C  CA    . TYR A  1 33  ? 78.922  33.490  14.359  1.000 57.096  ? 6828 TYR A CA    1 
ATOM   258  C  C     . TYR A  1 33  ? 77.395  33.556  14.320  1.000 59.284  ? 6828 TYR A C     1 
ATOM   259  O  O     . TYR A  1 33  ? 76.841  34.572  14.765  1.000 59.634  ? 6828 TYR A O     1 
ATOM   260  C  CB    . TYR A  1 33  ? 79.445  32.885  15.664  1.000 63.620  ? 6828 TYR A CB    1 
ATOM   261  C  CG    . TYR A  1 33  ? 78.849  31.559  16.059  1.000 71.123  ? 6828 TYR A CG    1 
ATOM   262  C  CD1   . TYR A  1 33  ? 79.393  30.365  15.609  1.000 74.816  ? 6828 TYR A CD1   1 
ATOM   263  C  CD2   . TYR A  1 33  ? 77.764  31.496  16.919  1.000 75.898  ? 6828 TYR A CD2   1 
ATOM   264  C  CE1   . TYR A  1 33  ? 78.859  29.142  15.983  1.000 77.744  ? 6828 TYR A CE1   1 
ATOM   265  C  CE2   . TYR A  1 33  ? 77.218  30.282  17.303  1.000 79.705  ? 6828 TYR A CE2   1 
ATOM   266  C  CZ    . TYR A  1 33  ? 77.768  29.101  16.834  1.000 81.434  ? 6828 TYR A CZ    1 
ATOM   267  O  OH    . TYR A  1 33  ? 77.236  27.901  17.208  1.000 88.353  ? 6828 TYR A OH    1 
ATOM   268  N  N     . GLY A  1 34  ? 76.741  32.532  13.768  1.000 62.330  ? 6829 GLY A N     1 
ATOM   269  C  CA    . GLY A  1 34  ? 75.265  32.533  13.720  1.000 69.185  ? 6829 GLY A CA    1 
ATOM   270  C  C     . GLY A  1 34  ? 74.716  33.371  12.574  1.000 71.042  ? 6829 GLY A C     1 
ATOM   271  O  O     . GLY A  1 34  ? 73.640  33.000  12.066  1.000 81.208  ? 6829 GLY A O     1 
ATOM   272  N  N     . ASP A  1 35  ? 75.390  34.474  12.202  1.000 68.085  ? 6830 ASP A N     1 
ATOM   273  C  CA    . ASP A  1 35  ? 74.927  35.310  11.057  1.000 64.300  ? 6830 ASP A CA    1 
ATOM   274  C  C     . ASP A  1 35  ? 74.716  34.419  9.824   1.000 64.040  ? 6830 ASP A C     1 
ATOM   275  O  O     . ASP A  1 35  ? 75.163  33.243  9.839   1.000 60.003  ? 6830 ASP A O     1 
ATOM   276  C  CB    . ASP A  1 35  ? 75.906  36.434  10.687  1.000 63.122  ? 6830 ASP A CB    1 
ATOM   277  C  CG    . ASP A  1 35  ? 75.881  37.672  11.573  1.000 63.512  ? 6830 ASP A CG    1 
ATOM   278  O  OD1   . ASP A  1 35  ? 75.167  37.657  12.595  1.000 63.406  ? 6830 ASP A OD1   1 
ATOM   279  O  OD2   . ASP A  1 35  ? 76.562  38.659  11.208  1.000 56.865  ? 6830 ASP A OD2   1 
ATOM   280  N  N     . SER A  1 36  ? 74.064  34.972  8.796   1.000 63.204  ? 6831 SER A N     1 
ATOM   281  C  CA    . SER A  1 36  ? 73.796  34.230  7.536   1.000 60.584  ? 6831 SER A CA    1 
ATOM   282  C  C     . SER A  1 36  ? 73.721  35.202  6.359   1.000 57.115  ? 6831 SER A C     1 
ATOM   283  O  O     . SER A  1 36  ? 73.204  36.332  6.536   1.000 58.147  ? 6831 SER A O     1 
ATOM   284  C  CB    . SER A  1 36  ? 72.546  33.404  7.643   1.000 61.273  ? 6831 SER A CB    1 
ATOM   285  O  OG    . SER A  1 36  ? 72.729  32.345  8.571   1.000 64.396  ? 6831 SER A OG    1 
ATOM   286  N  N     . ALA A  1 37  ? 74.265  34.776  5.217   1.000 50.150  ? 6832 ALA A N     1 
ATOM   287  C  CA    . ALA A  1 37  ? 74.231  35.585  3.982   1.000 47.942  ? 6832 ALA A CA    1 
ATOM   288  C  C     . ALA A  1 37  ? 72.852  35.414  3.336   1.000 45.737  ? 6832 ALA A C     1 
ATOM   289  O  O     . ALA A  1 37  ? 72.127  34.477  3.722   1.000 43.029  ? 6832 ALA A O     1 
ATOM   290  C  CB    . ALA A  1 37  ? 75.337  35.143  3.055   1.000 46.239  ? 6832 ALA A CB    1 
ATOM   291  N  N     . THR A  1 38  ? 72.486  36.307  2.421   1.000 46.101  ? 6833 THR A N     1 
ATOM   292  C  CA    . THR A  1 38  ? 71.187  36.155  1.722   1.000 45.642  ? 6833 THR A CA    1 
ATOM   293  C  C     . THR A  1 38  ? 71.426  35.252  0.511   1.000 39.544  ? 6833 THR A C     1 
ATOM   294  O  O     . THR A  1 38  ? 71.975  35.757  -0.479  1.000 41.479  ? 6833 THR A O     1 
ATOM   295  C  CB    . THR A  1 38  ? 70.610  37.513  1.311   1.000 49.438  ? 6833 THR A CB    1 
ATOM   296  O  OG1   . THR A  1 38  ? 70.585  38.338  2.475   1.000 53.567  ? 6833 THR A OG1   1 
ATOM   297  C  CG2   . THR A  1 38  ? 69.228  37.403  0.705   1.000 50.686  ? 6833 THR A CG2   1 
ATOM   298  N  N     . LEU A  1 39  ? 71.072  33.970  0.605   1.000 36.016  ? 6834 LEU A N     1 
ATOM   299  C  CA    . LEU A  1 39  ? 71.294  33.063  -0.557  1.000 35.038  ? 6834 LEU A CA    1 
ATOM   300  C  C     . LEU A  1 39  ? 70.304  33.407  -1.667  1.000 32.965  ? 6834 LEU A C     1 
ATOM   301  O  O     . LEU A  1 39  ? 69.140  33.677  -1.389  1.000 33.478  ? 6834 LEU A O     1 
ATOM   302  C  CB    . LEU A  1 39  ? 71.124  31.602  -0.129  1.000 35.577  ? 6834 LEU A CB    1 
ATOM   303  C  CG    . LEU A  1 39  ? 72.212  31.038  0.785   1.000 35.814  ? 6834 LEU A CG    1 
ATOM   304  C  CD1   . LEU A  1 39  ? 71.889  29.613  1.188   1.000 35.688  ? 6834 LEU A CD1   1 
ATOM   305  C  CD2   . LEU A  1 39  ? 73.568  31.094  0.107   1.000 36.529  ? 6834 LEU A CD2   1 
ATOM   306  N  N     . PRO A  1 40  ? 70.728  33.438  -2.952  1.000 30.614  ? 6835 PRO A N     1 
ATOM   307  C  CA    . PRO A  1 40  ? 69.790  33.678  -4.044  1.000 30.923  ? 6835 PRO A CA    1 
ATOM   308  C  C     . PRO A  1 40  ? 68.691  32.606  -3.969  1.000 30.788  ? 6835 PRO A C     1 
ATOM   309  O  O     . PRO A  1 40  ? 68.964  31.520  -3.477  1.000 30.206  ? 6835 PRO A O     1 
ATOM   310  C  CB    . PRO A  1 40  ? 70.656  33.571  -5.306  1.000 30.414  ? 6835 PRO A CB    1 
ATOM   311  C  CG    . PRO A  1 40  ? 72.056  33.874  -4.815  1.000 29.574  ? 6835 PRO A CG    1 
ATOM   312  C  CD    . PRO A  1 40  ? 72.111  33.284  -3.425  1.000 29.547  ? 6835 PRO A CD    1 
ATOM   313  N  N     . LYS A  1 41  ? 67.501  32.928  -4.472  1.000 31.430  ? 6836 LYS A N     1 
ATOM   314  C  CA    . LYS A  1 41  ? 66.318  32.029  -4.422  1.000 33.272  ? 6836 LYS A CA    1 
ATOM   315  C  C     . LYS A  1 41  ? 66.640  30.622  -4.948  1.000 31.522  ? 6836 LYS A C     1 
ATOM   316  O  O     . LYS A  1 41  ? 67.185  30.508  -6.062  1.000 30.268  ? 6836 LYS A O     1 
ATOM   317  C  CB    . LYS A  1 41  ? 65.183  32.635  -5.254  1.000 36.101  ? 6836 LYS A CB    1 
ATOM   318  C  CG    . LYS A  1 41  ? 63.883  31.851  -5.251  1.000 38.859  ? 6836 LYS A CG    1 
ATOM   319  C  CD    . LYS A  1 41  ? 62.846  32.431  -6.188  1.000 42.391  ? 6836 LYS A CD    1 
ATOM   320  C  CE    . LYS A  1 41  ? 61.502  31.754  -6.064  1.000 45.501  ? 6836 LYS A CE    1 
ATOM   321  N  NZ    . LYS A  1 41  ? 61.594  30.310  -6.371  1.000 47.444  ? 6836 LYS A NZ    1 
ATOM   322  N  N     . GLY A  1 42  ? 66.300  29.596  -4.156  1.000 31.153  ? 6837 GLY A N     1 
ATOM   323  C  CA    . GLY A  1 42  ? 66.465  28.177  -4.538  1.000 30.398  ? 6837 GLY A CA    1 
ATOM   324  C  C     . GLY A  1 42  ? 67.911  27.723  -4.664  1.000 28.354  ? 6837 GLY A C     1 
ATOM   325  O  O     . GLY A  1 42  ? 68.112  26.605  -5.127  1.000 27.676  ? 6837 GLY A O     1 
ATOM   326  N  N     . ILE A  1 43  ? 68.884  28.546  -4.274  1.000 27.143  ? 6838 ILE A N     1 
ATOM   327  C  CA    . ILE A  1 43  ? 70.314  28.130  -4.382  1.000 26.193  ? 6838 ILE A CA    1 
ATOM   328  C  C     . ILE A  1 43  ? 70.766  27.489  -3.062  1.000 26.067  ? 6838 ILE A C     1 
ATOM   329  O  O     . ILE A  1 43  ? 70.638  28.127  -2.008  1.000 26.473  ? 6838 ILE A O     1 
ATOM   330  C  CB    . ILE A  1 43  ? 71.215  29.312  -4.783  1.000 25.345  ? 6838 ILE A CB    1 
ATOM   331  C  CG1   . ILE A  1 43  ? 70.850  29.851  -6.169  1.000 26.012  ? 6838 ILE A CG1   1 
ATOM   332  C  CG2   . ILE A  1 43  ? 72.684  28.921  -4.705  1.000 24.618  ? 6838 ILE A CG2   1 
ATOM   333  C  CD1   . ILE A  1 43  ? 71.002  28.849  -7.293  1.000 25.898  ? 6838 ILE A CD1   1 
ATOM   334  N  N     . MET A  1 44  ? 71.300  26.275  -3.157  1.000 25.326  ? 6839 MET A N     1 
ATOM   335  C  CA    . MET A  1 44  ? 71.825  25.511  -2.000  1.000 25.792  ? 6839 MET A CA    1 
ATOM   336  C  C     . MET A  1 44  ? 73.095  26.182  -1.473  1.000 25.434  ? 6839 MET A C     1 
ATOM   337  O  O     . MET A  1 44  ? 73.869  26.734  -2.291  1.000 23.214  ? 6839 MET A O     1 
ATOM   338  C  CB    . MET A  1 44  ? 72.193  24.086  -2.424  1.000 26.373  ? 6839 MET A CB    1 
ATOM   339  C  CG    . MET A  1 44  ? 71.024  23.266  -2.916  1.000 28.734  ? 6839 MET A CG    1 
ATOM   340  S  SD    . MET A  1 44  ? 71.582  21.654  -3.528  1.000 30.709  ? 6839 MET A SD    1 
ATOM   341  C  CE    . MET A  1 44  ? 70.011  20.885  -3.920  1.000 31.181  ? 6839 MET A CE    1 
ATOM   342  N  N     . MET A  1 45  ? 73.329  26.074  -0.167  1.000 25.122  ? 6840 MET A N     1 
ATOM   343  C  CA    . MET A  1 45  ? 74.543  26.659  0.454   1.000 25.015  ? 6840 MET A CA    1 
ATOM   344  C  C     . MET A  1 45  ? 75.796  26.139  -0.258  1.000 23.891  ? 6840 MET A C     1 
ATOM   345  O  O     . MET A  1 45  ? 76.702  26.948  -0.525  1.000 22.025  ? 6840 MET A O     1 
ATOM   346  C  CB    . MET A  1 45  ? 74.623  26.289  1.939   1.000 27.442  ? 6840 MET A CB    1 
ATOM   347  C  CG    . MET A  1 45  ? 75.983  26.575  2.569   1.000 29.366  ? 6840 MET A CG    1 
ATOM   348  S  SD    . MET A  1 45  ? 76.463  28.330  2.525   1.000 33.537  ? 6840 MET A SD    1 
ATOM   349  C  CE    . MET A  1 45  ? 75.297  29.002  3.701   1.000 36.958  ? 6840 MET A CE    1 
ATOM   350  N  N     . ASN A  1 46  ? 75.847  24.840  -0.561  1.000 23.531  ? 6841 ASN A N     1 
ATOM   351  C  CA    . ASN A  1 46  ? 77.081  24.278  -1.174  1.000 24.127  ? 6841 ASN A CA    1 
ATOM   352  C  C     . ASN A  1 46  ? 77.245  24.762  -2.617  1.000 22.621  ? 6841 ASN A C     1 
ATOM   353  O  O     . ASN A  1 46  ? 78.391  24.824  -3.070  1.000 22.452  ? 6841 ASN A O     1 
ATOM   354  C  CB    . ASN A  1 46  ? 77.151  22.769  -0.958  1.000 26.516  ? 6841 ASN A CB    1 
ATOM   355  C  CG    . ASN A  1 46  ? 77.488  22.454  0.486   1.000 29.095  ? 6841 ASN A CG    1 
ATOM   356  O  OD1   . ASN A  1 46  ? 78.087  23.275  1.177   1.000 33.963  ? 6841 ASN A OD1   1 
ATOM   357  N  ND2   . ASN A  1 46  ? 77.104  21.286  0.960   1.000 30.809  ? 6841 ASN A ND2   1 
ATOM   358  N  N     . VAL A  1 47  ? 76.165  25.050  -3.334  1.000 22.048  ? 6842 VAL A N     1 
ATOM   359  C  CA    . VAL A  1 47  ? 76.370  25.636  -4.693  1.000 21.406  ? 6842 VAL A CA    1 
ATOM   360  C  C     . VAL A  1 47  ? 77.001  27.022  -4.497  1.000 21.100  ? 6842 VAL A C     1 
ATOM   361  O  O     . VAL A  1 47  ? 77.971  27.351  -5.209  1.000 20.916  ? 6842 VAL A O     1 
ATOM   362  C  CB    . VAL A  1 47  ? 75.061  25.700  -5.503  1.000 21.864  ? 6842 VAL A CB    1 
ATOM   363  C  CG1   . VAL A  1 47  ? 75.158  26.648  -6.691  1.000 22.043  ? 6842 VAL A CG1   1 
ATOM   364  C  CG2   . VAL A  1 47  ? 74.615  24.323  -5.953  1.000 22.553  ? 6842 VAL A CG2   1 
ATOM   365  N  N     . ALA A  1 48  ? 76.493  27.790  -3.532  1.000 20.997  ? 6843 ALA A N     1 
ATOM   366  C  CA    . ALA A  1 48  ? 77.026  29.148  -3.281  1.000 21.025  ? 6843 ALA A CA    1 
ATOM   367  C  C     . ALA A  1 48  ? 78.491  29.067  -2.839  1.000 20.986  ? 6843 ALA A C     1 
ATOM   368  O  O     . ALA A  1 48  ? 79.319  29.836  -3.358  1.000 21.092  ? 6843 ALA A O     1 
ATOM   369  C  CB    . ALA A  1 48  ? 76.176  29.838  -2.243  1.000 21.464  ? 6843 ALA A CB    1 
ATOM   370  N  N     . LYS A  1 49  ? 78.799  28.127  -1.947  1.000 21.199  ? 6844 LYS A N     1 
ATOM   371  C  CA    . LYS A  1 49  ? 80.164  27.983  -1.385  1.000 21.275  ? 6844 LYS A CA    1 
ATOM   372  C  C     . LYS A  1 49  ? 81.152  27.578  -2.485  1.000 20.469  ? 6844 LYS A C     1 
ATOM   373  O  O     . LYS A  1 49  ? 82.202  28.223  -2.593  1.000 20.136  ? 6844 LYS A O     1 
ATOM   374  C  CB    . LYS A  1 49  ? 80.124  26.964  -0.247  1.000 21.998  ? 6844 LYS A CB    1 
ATOM   375  C  CG    . LYS A  1 49  ? 81.457  26.682  0.423   1.000 23.594  ? 6844 LYS A CG    1 
ATOM   376  C  CD    . LYS A  1 49  ? 81.403  25.494  1.369   1.000 23.174  ? 6844 LYS A CD    1 
ATOM   377  C  CE    . LYS A  1 49  ? 80.333  25.621  2.432   1.000 24.101  ? 6844 LYS A CE    1 
ATOM   378  N  NZ    . LYS A  1 49  ? 80.396  24.495  3.393   1.000 24.123  ? 6844 LYS A NZ    1 
ATOM   379  N  N     . TYR A  1 50  ? 80.835  26.542  -3.258  1.000 20.191  ? 6845 TYR A N     1 
ATOM   380  C  CA    . TYR A  1 50  ? 81.761  26.140  -4.346  1.000 20.513  ? 6845 TYR A CA    1 
ATOM   381  C  C     . TYR A  1 50  ? 81.872  27.243  -5.398  1.000 20.529  ? 6845 TYR A C     1 
ATOM   382  O  O     . TYR A  1 50  ? 82.965  27.421  -5.950  1.000 21.142  ? 6845 TYR A O     1 
ATOM   383  C  CB    . TYR A  1 50  ? 81.312  24.833  -4.985  1.000 21.074  ? 6845 TYR A CB    1 
ATOM   384  C  CG    . TYR A  1 50  ? 81.762  23.594  -4.261  1.000 21.013  ? 6845 TYR A CG    1 
ATOM   385  C  CD1   . TYR A  1 50  ? 81.197  23.226  -3.057  1.000 21.626  ? 6845 TYR A CD1   1 
ATOM   386  C  CD2   . TYR A  1 50  ? 82.693  22.741  -4.831  1.000 22.003  ? 6845 TYR A CD2   1 
ATOM   387  C  CE1   . TYR A  1 50  ? 81.587  22.068  -2.404  1.000 22.518  ? 6845 TYR A CE1   1 
ATOM   388  C  CE2   . TYR A  1 50  ? 83.086  21.570  -4.201  1.000 22.164  ? 6845 TYR A CE2   1 
ATOM   389  C  CZ    . TYR A  1 50  ? 82.533  21.236  -2.977  1.000 22.637  ? 6845 TYR A CZ    1 
ATOM   390  O  OH    . TYR A  1 50  ? 82.869  20.066  -2.353  1.000 23.346  ? 6845 TYR A OH    1 
ATOM   391  N  N     . THR A  1 51  ? 80.785  27.976  -5.643  1.000 20.715  ? 6846 THR A N     1 
ATOM   392  C  CA    . THR A  1 51  ? 80.856  29.055  -6.666  1.000 20.664  ? 6846 THR A CA    1 
ATOM   393  C  C     . THR A  1 51  ? 81.882  30.097  -6.205  1.000 20.659  ? 6846 THR A C     1 
ATOM   394  O  O     . THR A  1 51  ? 82.717  30.518  -7.030  1.000 20.153  ? 6846 THR A O     1 
ATOM   395  C  CB    . THR A  1 51  ? 79.466  29.632  -6.957  1.000 20.962  ? 6846 THR A CB    1 
ATOM   396  O  OG1   . THR A  1 51  ? 78.662  28.616  -7.563  1.000 21.173  ? 6846 THR A OG1   1 
ATOM   397  C  CG2   . THR A  1 51  ? 79.518  30.829  -7.878  1.000 21.909  ? 6846 THR A CG2   1 
ATOM   398  N  N     . GLN A  1 52  ? 81.863  30.453  -4.918  1.000 20.760  ? 6847 GLN A N     1 
ATOM   399  C  CA    . GLN A  1 52  ? 82.817  31.472  -4.416  1.000 20.532  ? 6847 GLN A CA    1 
ATOM   400  C  C     . GLN A  1 52  ? 84.231  30.892  -4.412  1.000 20.440  ? 6847 GLN A C     1 
ATOM   401  O  O     . GLN A  1 52  ? 85.161  31.644  -4.740  1.000 20.316  ? 6847 GLN A O     1 
ATOM   402  C  CB    . GLN A  1 52  ? 82.367  32.018  -3.064  1.000 20.481  ? 6847 GLN A CB    1 
ATOM   403  C  CG    . GLN A  1 52  ? 81.194  32.978  -3.193  1.000 21.210  ? 6847 GLN A CG    1 
ATOM   404  C  CD    . GLN A  1 52  ? 80.765  33.590  -1.885  1.000 21.415  ? 6847 GLN A CD    1 
ATOM   405  O  OE1   . GLN A  1 52  ? 80.906  32.988  -0.820  1.000 21.083  ? 6847 GLN A OE1   1 
ATOM   406  N  NE2   . GLN A  1 52  ? 80.177  34.776  -1.974  1.000 22.234  ? 6847 GLN A NE2   1 
ATOM   407  N  N     . LEU A  1 53  ? 84.391  29.622  -4.032  1.000 20.416  ? 6848 LEU A N     1 
ATOM   408  C  CA    . LEU A  1 53  ? 85.744  28.999  -4.085  1.000 20.731  ? 6848 LEU A CA    1 
ATOM   409  C  C     . LEU A  1 53  ? 86.285  29.091  -5.519  1.000 21.258  ? 6848 LEU A C     1 
ATOM   410  O  O     . LEU A  1 53  ? 87.439  29.549  -5.705  1.000 21.937  ? 6848 LEU A O     1 
ATOM   411  C  CB    . LEU A  1 53  ? 85.641  27.542  -3.640  1.000 20.629  ? 6848 LEU A CB    1 
ATOM   412  C  CG    . LEU A  1 53  ? 86.922  26.723  -3.779  1.000 21.302  ? 6848 LEU A CG    1 
ATOM   413  C  CD1   . LEU A  1 53  ? 88.062  27.338  -2.977  1.000 21.487  ? 6848 LEU A CD1   1 
ATOM   414  C  CD2   . LEU A  1 53  ? 86.672  25.284  -3.361  1.000 21.201  ? 6848 LEU A CD2   1 
ATOM   415  N  N     . CYS A  1 54  ? 85.472  28.691  -6.500  1.000 21.006  ? 6849 CYS A N     1 
ATOM   416  C  CA    . CYS A  1 54  ? 85.910  28.747  -7.922  1.000 21.414  ? 6849 CYS A CA    1 
ATOM   417  C  C     . CYS A  1 54  ? 86.158  30.198  -8.355  1.000 21.840  ? 6849 CYS A C     1 
ATOM   418  O  O     . CYS A  1 54  ? 87.129  30.430  -9.101  1.000 22.105  ? 6849 CYS A O     1 
ATOM   419  C  CB    . CYS A  1 54  ? 84.900  28.050  -8.822  1.000 22.481  ? 6849 CYS A CB    1 
ATOM   420  S  SG    . CYS A  1 54  ? 84.833  26.260  -8.538  1.000 22.946  ? 6849 CYS A SG    1 
ATOM   421  N  N     . GLN A  1 55  ? 85.328  31.140  -7.901  1.000 21.955  ? 6850 GLN A N     1 
ATOM   422  C  CA    . GLN A  1 55  ? 85.546  32.571  -8.251  1.000 22.916  ? 6850 GLN A CA    1 
ATOM   423  C  C     . GLN A  1 55  ? 86.926  33.003  -7.746  1.000 22.799  ? 6850 GLN A C     1 
ATOM   424  O  O     . GLN A  1 55  ? 87.611  33.754  -8.465  1.000 22.974  ? 6850 GLN A O     1 
ATOM   425  C  CB    . GLN A  1 55  ? 84.442  33.455  -7.668  1.000 23.268  ? 6850 GLN A CB    1 
ATOM   426  C  CG    . GLN A  1 55  ? 83.134  33.381  -8.442  1.000 23.379  ? 6850 GLN A CG    1 
ATOM   427  C  CD    . GLN A  1 55  ? 82.049  34.201  -7.793  1.000 23.979  ? 6850 GLN A CD    1 
ATOM   428  O  OE1   . GLN A  1 55  ? 82.010  34.347  -6.576  1.000 23.817  ? 6850 GLN A OE1   1 
ATOM   429  N  NE2   . GLN A  1 55  ? 81.149  34.742  -8.602  1.000 24.390  ? 6850 GLN A NE2   1 
ATOM   430  N  N     . TYR A  1 56  ? 87.333  32.507  -6.577  1.000 21.313  ? 6851 TYR A N     1 
ATOM   431  C  CA    . TYR A  1 56  ? 88.660  32.883  -6.028  1.000 21.537  ? 6851 TYR A CA    1 
ATOM   432  C  C     . TYR A  1 56  ? 89.775  32.127  -6.771  1.000 21.691  ? 6851 TYR A C     1 
ATOM   433  O  O     . TYR A  1 56  ? 90.792  32.751  -7.078  1.000 21.653  ? 6851 TYR A O     1 
ATOM   434  C  CB    . TYR A  1 56  ? 88.712  32.649  -4.520  1.000 21.520  ? 6851 TYR A CB    1 
ATOM   435  C  CG    . TYR A  1 56  ? 90.068  32.939  -3.937  1.000 21.860  ? 6851 TYR A CG    1 
ATOM   436  C  CD1   . TYR A  1 56  ? 90.529  34.239  -3.812  1.000 22.659  ? 6851 TYR A CD1   1 
ATOM   437  C  CD2   . TYR A  1 56  ? 90.909  31.911  -3.557  1.000 21.953  ? 6851 TYR A CD2   1 
ATOM   438  C  CE1   . TYR A  1 56  ? 91.793  34.510  -3.311  1.000 23.337  ? 6851 TYR A CE1   1 
ATOM   439  C  CE2   . TYR A  1 56  ? 92.175  32.165  -3.058  1.000 22.103  ? 6851 TYR A CE2   1 
ATOM   440  C  CZ    . TYR A  1 56  ? 92.620  33.465  -2.934  1.000 22.844  ? 6851 TYR A CZ    1 
ATOM   441  O  OH    . TYR A  1 56  ? 93.869  33.703  -2.429  1.000 23.193  ? 6851 TYR A OH    1 
ATOM   442  N  N     . LEU A  1 57  ? 89.577  30.838  -7.068  1.000 21.421  ? 6852 LEU A N     1 
ATOM   443  C  CA    . LEU A  1 57  ? 90.615  30.043  -7.779  1.000 22.599  ? 6852 LEU A CA    1 
ATOM   444  C  C     . LEU A  1 57  ? 90.908  30.683  -9.143  1.000 23.280  ? 6852 LEU A C     1 
ATOM   445  O  O     . LEU A  1 57  ? 92.072  30.594  -9.588  1.000 23.420  ? 6852 LEU A O     1 
ATOM   446  C  CB    . LEU A  1 57  ? 90.161  28.587  -7.921  1.000 21.870  ? 6852 LEU A CB    1 
ATOM   447  C  CG    . LEU A  1 57  ? 90.064  27.792  -6.621  1.000 21.840  ? 6852 LEU A CG    1 
ATOM   448  C  CD1   . LEU A  1 57  ? 89.495  26.406  -6.872  1.000 21.734  ? 6852 LEU A CD1   1 
ATOM   449  C  CD2   . LEU A  1 57  ? 91.419  27.681  -5.940  1.000 22.479  ? 6852 LEU A CD2   1 
ATOM   450  N  N     . ASN A  1 58  ? 89.914  31.350  -9.742  1.000 23.874  ? 6853 ASN A N     1 
ATOM   451  C  CA    . ASN A  1 58  ? 90.107  32.046  -11.045 1.000 25.500  ? 6853 ASN A CA    1 
ATOM   452  C  C     . ASN A  1 58  ? 91.201  33.112  -10.942 1.000 26.549  ? 6853 ASN A C     1 
ATOM   453  O  O     . ASN A  1 58  ? 91.805  33.416  -11.979 1.000 28.357  ? 6853 ASN A O     1 
ATOM   454  C  CB    . ASN A  1 58  ? 88.837  32.742  -11.547 1.000 26.346  ? 6853 ASN A CB    1 
ATOM   455  C  CG    . ASN A  1 58  ? 87.839  31.809  -12.197 1.000 26.483  ? 6853 ASN A CG    1 
ATOM   456  O  OD1   . ASN A  1 58  ? 88.208  30.753  -12.701 1.000 26.506  ? 6853 ASN A OD1   1 
ATOM   457  N  ND2   . ASN A  1 58  ? 86.585  32.226  -12.252 1.000 26.799  ? 6853 ASN A ND2   1 
ATOM   458  N  N     . THR A  1 59  ? 91.431  33.672  -9.749  1.000 26.578  ? 6854 THR A N     1 
ATOM   459  C  CA    . THR A  1 59  ? 92.420  34.775  -9.586  1.000 27.747  ? 6854 THR A CA    1 
ATOM   460  C  C     . THR A  1 59  ? 93.839  34.229  -9.368  1.000 27.377  ? 6854 THR A C     1 
ATOM   461  O  O     . THR A  1 59  ? 94.758  35.054  -9.305  1.000 27.330  ? 6854 THR A O     1 
ATOM   462  C  CB    . THR A  1 59  ? 92.030  35.669  -8.401  1.000 27.644  ? 6854 THR A CB    1 
ATOM   463  O  OG1   . THR A  1 59  ? 92.285  34.952  -7.197  1.000 27.006  ? 6854 THR A OG1   1 
ATOM   464  C  CG2   . THR A  1 59  ? 90.581  36.100  -8.445  1.000 28.698  ? 6854 THR A CG2   1 
ATOM   465  N  N     . LEU A  1 60  ? 94.010  32.905  -9.287  1.000 26.737  ? 6855 LEU A N     1 
ATOM   466  C  CA    . LEU A  1 60  ? 95.338  32.293  -9.003  1.000 27.986  ? 6855 LEU A CA    1 
ATOM   467  C  C     . LEU A  1 60  ? 95.987  31.772  -10.294 1.000 30.924  ? 6855 LEU A C     1 
ATOM   468  O  O     . LEU A  1 60  ? 95.296  31.688  -11.334 1.000 36.966  ? 6855 LEU A O     1 
ATOM   469  C  CB    . LEU A  1 60  ? 95.158  31.155  -7.992  1.000 26.867  ? 6855 LEU A CB    1 
ATOM   470  C  CG    . LEU A  1 60  ? 94.442  31.520  -6.688  1.000 26.211  ? 6855 LEU A CG    1 
ATOM   471  C  CD1   . LEU A  1 60  ? 94.400  30.320  -5.753  1.000 25.598  ? 6855 LEU A CD1   1 
ATOM   472  C  CD2   . LEU A  1 60  ? 95.105  32.707  -5.999  1.000 26.718  ? 6855 LEU A CD2   1 
ATOM   473  N  N     . THR A  1 61  ? 97.243  31.332  -10.198 1.000 29.549  ? 6856 THR A N     1 
ATOM   474  C  CA    . THR A  1 61  ? 97.989  30.821  -11.377 1.000 30.690  ? 6856 THR A CA    1 
ATOM   475  C  C     . THR A  1 61  ? 97.768  29.310  -11.520 1.000 28.909  ? 6856 THR A C     1 
ATOM   476  O  O     . THR A  1 61  ? 98.763  28.566  -11.582 1.000 28.584  ? 6856 THR A O     1 
ATOM   477  C  CB    . THR A  1 61  ? 99.469  31.197  -11.251 1.000 32.275  ? 6856 THR A CB    1 
ATOM   478  O  OG1   . THR A  1 61  ? 99.969  30.566  -10.073 1.000 32.748  ? 6856 THR A OG1   1 
ATOM   479  C  CG2   . THR A  1 61  ? 99.682  32.693  -11.167 1.000 33.741  ? 6856 THR A CG2   1 
ATOM   480  N  N     . LEU A  1 62  ? 96.509  28.873  -11.566 1.000 28.356  ? 6857 LEU A N     1 
ATOM   481  C  CA    . LEU A  1 62  ? 96.227  27.430  -11.760 1.000 28.364  ? 6857 LEU A CA    1 
ATOM   482  C  C     . LEU A  1 62  ? 96.697  26.981  -13.146 1.000 28.605  ? 6857 LEU A C     1 
ATOM   483  O  O     . LEU A  1 62  ? 96.437  27.705  -14.126 1.000 28.927  ? 6857 LEU A O     1 
ATOM   484  C  CB    . LEU A  1 62  ? 94.726  27.138  -11.675 1.000 29.697  ? 6857 LEU A CB    1 
ATOM   485  C  CG    . LEU A  1 62  ? 94.057  27.236  -10.308 1.000 32.883  ? 6857 LEU A CG    1 
ATOM   486  C  CD1   . LEU A  1 62  ? 92.706  26.527  -10.360 1.000 34.332  ? 6857 LEU A CD1   1 
ATOM   487  C  CD2   . LEU A  1 62  ? 94.917  26.625  -9.219  1.000 33.353  ? 6857 LEU A CD2   1 
ATOM   488  N  N     . ALA A  1 63  ? 97.343  25.818  -13.207 1.000 28.229  ? 6858 ALA A N     1 
ATOM   489  C  CA    . ALA A  1 63  ? 97.681  25.207  -14.510 1.000 29.177  ? 6858 ALA A CA    1 
ATOM   490  C  C     . ALA A  1 63  ? 96.372  24.634  -15.056 1.000 28.722  ? 6858 ALA A C     1 
ATOM   491  O  O     . ALA A  1 63  ? 95.651  24.000  -14.273 1.000 27.113  ? 6858 ALA A O     1 
ATOM   492  C  CB    . ALA A  1 63  ? 98.718  24.133  -14.344 1.000 29.411  ? 6858 ALA A CB    1 
ATOM   493  N  N     . VAL A  1 64  ? 96.063  24.892  -16.327 1.000 29.480  ? 6859 VAL A N     1 
ATOM   494  C  CA    . VAL A  1 64  ? 94.796  24.399  -16.944 1.000 29.203  ? 6859 VAL A CA    1 
ATOM   495  C  C     . VAL A  1 64  ? 95.150  23.765  -18.280 1.000 30.858  ? 6859 VAL A C     1 
ATOM   496  O  O     . VAL A  1 64  ? 95.009  24.396  -19.325 1.000 30.791  ? 6859 VAL A O     1 
ATOM   497  C  CB    . VAL A  1 64  ? 93.770  25.532  -17.133 1.000 29.700  ? 6859 VAL A CB    1 
ATOM   498  C  CG1   . VAL A  1 64  ? 92.451  24.997  -17.675 1.000 29.740  ? 6859 VAL A CG1   1 
ATOM   499  C  CG2   . VAL A  1 64  ? 93.541  26.317  -15.850 1.000 28.711  ? 6859 VAL A CG2   1 
ATOM   500  N  N     . PRO A  1 65  ? 95.671  22.523  -18.285 1.000 31.281  ? 6860 PRO A N     1 
ATOM   501  C  CA    . PRO A  1 65  ? 96.025  21.860  -19.533 1.000 33.418  ? 6860 PRO A CA    1 
ATOM   502  C  C     . PRO A  1 65  ? 94.801  21.348  -20.297 1.000 33.993  ? 6860 PRO A C     1 
ATOM   503  O  O     . PRO A  1 65  ? 93.716  21.351  -19.747 1.000 32.631  ? 6860 PRO A O     1 
ATOM   504  C  CB    . PRO A  1 65  ? 96.867  20.654  -19.081 1.000 33.902  ? 6860 PRO A CB    1 
ATOM   505  C  CG    . PRO A  1 65  ? 96.395  20.359  -17.669 1.000 32.063  ? 6860 PRO A CG    1 
ATOM   506  C  CD    . PRO A  1 65  ? 95.935  21.688  -17.100 1.000 31.271  ? 6860 PRO A CD    1 
ATOM   507  N  N     . TYR A  1 66  ? 94.993  21.027  -21.577 1.000 36.257  ? 6861 TYR A N     1 
ATOM   508  C  CA    . TYR A  1 66  ? 93.912  20.346  -22.328 1.000 37.714  ? 6861 TYR A CA    1 
ATOM   509  C  C     . TYR A  1 66  ? 93.820  18.955  -21.682 1.000 37.779  ? 6861 TYR A C     1 
ATOM   510  O  O     . TYR A  1 66  ? 94.862  18.469  -21.207 1.000 40.924  ? 6861 TYR A O     1 
ATOM   511  C  CB    . TYR A  1 66  ? 94.244  20.273  -23.822 1.000 38.912  ? 6861 TYR A CB    1 
ATOM   512  C  CG    . TYR A  1 66  ? 94.517  21.592  -24.504 1.000 39.467  ? 6861 TYR A CG    1 
ATOM   513  C  CD1   . TYR A  1 66  ? 93.484  22.452  -24.834 1.000 40.272  ? 6861 TYR A CD1   1 
ATOM   514  C  CD2   . TYR A  1 66  ? 95.798  21.951  -24.886 1.000 40.320  ? 6861 TYR A CD2   1 
ATOM   515  C  CE1   . TYR A  1 66  ? 93.719  23.658  -25.475 1.000 41.055  ? 6861 TYR A CE1   1 
ATOM   516  C  CE2   . TYR A  1 66  ? 96.051  23.148  -25.538 1.000 41.896  ? 6861 TYR A CE2   1 
ATOM   517  C  CZ    . TYR A  1 66  ? 95.006  24.006  -25.835 1.000 42.064  ? 6861 TYR A CZ    1 
ATOM   518  O  OH    . TYR A  1 66  ? 95.238  25.192  -26.467 1.000 42.979  ? 6861 TYR A OH    1 
ATOM   519  N  N     . ASN A  1 67  ? 92.646  18.340  -21.611 1.000 39.525  ? 6862 ASN A N     1 
ATOM   520  C  CA    . ASN A  1 67  ? 92.571  16.993  -20.970 1.000 40.724  ? 6862 ASN A CA    1 
ATOM   521  C  C     . ASN A  1 67  ? 92.964  17.114  -19.490 1.000 37.751  ? 6862 ASN A C     1 
ATOM   522  O  O     . ASN A  1 67  ? 93.644  16.204  -18.958 1.000 36.362  ? 6862 ASN A O     1 
ATOM   523  C  CB    . ASN A  1 67  ? 93.459  15.977  -21.693 1.000 44.837  ? 6862 ASN A CB    1 
ATOM   524  C  CG    . ASN A  1 67  ? 93.159  15.916  -23.175 1.000 50.165  ? 6862 ASN A CG    1 
ATOM   525  O  OD1   . ASN A  1 67  ? 91.995  15.918  -23.577 1.000 54.360  ? 6862 ASN A OD1   1 
ATOM   526  N  ND2   . ASN A  1 67  ? 94.200  15.860  -23.988 1.000 52.936  ? 6862 ASN A ND2   1 
ATOM   527  N  N     . MET A  1 68  ? 92.559  18.210  -18.855 1.000 34.916  ? 6863 MET A N     1 
ATOM   528  C  CA    . MET A  1 68  ? 92.856  18.430  -17.420 1.000 33.292  ? 6863 MET A CA    1 
ATOM   529  C  C     . MET A  1 68  ? 92.196  17.311  -16.606 1.000 31.537  ? 6863 MET A C     1 
ATOM   530  O  O     . MET A  1 68  ? 91.121  16.838  -17.025 1.000 32.291  ? 6863 MET A O     1 
ATOM   531  C  CB    . MET A  1 68  ? 92.306  19.789  -16.993 1.000 32.979  ? 6863 MET A CB    1 
ATOM   532  C  CG    . MET A  1 68  ? 92.607  20.174  -15.571 1.000 32.925  ? 6863 MET A CG    1 
ATOM   533  S  SD    . MET A  1 68  ? 91.941  21.822  -15.315 1.000 34.024  ? 6863 MET A SD    1 
ATOM   534  C  CE    . MET A  1 68  ? 92.429  22.132  -13.621 1.000 33.578  ? 6863 MET A CE    1 
ATOM   535  N  N     . ARG A  1 69  ? 92.840  16.899  -15.512 1.000 29.371  ? 6864 ARG A N     1 
ATOM   536  C  CA    . ARG A  1 69  ? 92.339  15.819  -14.624 1.000 28.848  ? 6864 ARG A CA    1 
ATOM   537  C  C     . ARG A  1 69  ? 92.031  16.386  -13.238 1.000 27.282  ? 6864 ARG A C     1 
ATOM   538  O  O     . ARG A  1 69  ? 92.976  16.857  -12.567 1.000 28.108  ? 6864 ARG A O     1 
ATOM   539  C  CB    . ARG A  1 69  ? 93.395  14.727  -14.506 1.000 29.918  ? 6864 ARG A CB    1 
ATOM   540  C  CG    . ARG A  1 69  ? 93.796  14.116  -15.835 1.000 31.719  ? 6864 ARG A CG    1 
ATOM   541  C  CD    . ARG A  1 69  ? 94.978  13.220  -15.597 1.000 33.044  ? 6864 ARG A CD    1 
ATOM   542  N  NE    . ARG A  1 69  ? 95.352  12.483  -16.782 1.000 35.135  ? 6864 ARG A NE    1 
ATOM   543  C  CZ    . ARG A  1 69  ? 96.359  11.632  -16.833 1.000 36.002  ? 6864 ARG A CZ    1 
ATOM   544  N  NH1   . ARG A  1 69  ? 97.092  11.414  -15.756 1.000 35.459  ? 6864 ARG A NH1   1 
ATOM   545  N  NH2   . ARG A  1 69  ? 96.627  10.997  -17.959 1.000 37.090  ? 6864 ARG A NH2   1 
ATOM   546  N  N     . VAL A  1 70  ? 90.771  16.283  -12.814 1.000 25.560  ? 6865 VAL A N     1 
ATOM   547  C  CA    . VAL A  1 70  ? 90.334  16.834  -11.501 1.000 23.937  ? 6865 VAL A CA    1 
ATOM   548  C  C     . VAL A  1 70  ? 89.667  15.732  -10.677 1.000 23.621  ? 6865 VAL A C     1 
ATOM   549  O  O     . VAL A  1 70  ? 88.802  15.011  -11.226 1.000 23.286  ? 6865 VAL A O     1 
ATOM   550  C  CB    . VAL A  1 70  ? 89.369  18.018  -11.696 1.000 23.894  ? 6865 VAL A CB    1 
ATOM   551  C  CG1   . VAL A  1 70  ? 88.932  18.612  -10.367 1.000 23.700  ? 6865 VAL A CG1   1 
ATOM   552  C  CG2   . VAL A  1 70  ? 89.970  19.089  -12.589 1.000 24.555  ? 6865 VAL A CG2   1 
ATOM   553  N  N     . ILE A  1 71  ? 90.063  15.616  -9.409  1.000 22.689  ? 6866 ILE A N     1 
ATOM   554  C  CA    . ILE A  1 71  ? 89.416  14.623  -8.509  1.000 22.973  ? 6866 ILE A CA    1 
ATOM   555  C  C     . ILE A  1 71  ? 88.798  15.395  -7.336  1.000 21.718  ? 6866 ILE A C     1 
ATOM   556  O  O     . ILE A  1 71  ? 89.438  16.354  -6.826  1.000 21.259  ? 6866 ILE A O     1 
ATOM   557  C  CB    . ILE A  1 71  ? 90.385  13.497  -8.108  1.000 24.123  ? 6866 ILE A CB    1 
ATOM   558  C  CG1   . ILE A  1 71  ? 89.655  12.415  -7.309  1.000 24.730  ? 6866 ILE A CG1   1 
ATOM   559  C  CG2   . ILE A  1 71  ? 91.598  14.041  -7.374  1.000 24.090  ? 6866 ILE A CG2   1 
ATOM   560  C  CD1   . ILE A  1 71  ? 90.408  11.115  -7.221  1.000 25.992  ? 6866 ILE A CD1   1 
ATOM   561  N  N     . HIS A  1 72  ? 87.564  15.027  -6.994  1.000 21.688  ? 6867 HIS A N     1 
ATOM   562  C  CA    . HIS A  1 72  ? 86.757  15.713  -5.956  1.000 21.150  ? 6867 HIS A CA    1 
ATOM   563  C  C     . HIS A  1 72  ? 86.349  14.739  -4.845  1.000 21.158  ? 6867 HIS A C     1 
ATOM   564  O  O     . HIS A  1 72  ? 85.477  13.881  -5.091  1.000 22.032  ? 6867 HIS A O     1 
ATOM   565  C  CB    . HIS A  1 72  ? 85.575  16.399  -6.647  1.000 21.086  ? 6867 HIS A CB    1 
ATOM   566  C  CG    . HIS A  1 72  ? 84.665  17.136  -5.725  1.000 21.014  ? 6867 HIS A CG    1 
ATOM   567  N  ND1   . HIS A  1 72  ? 83.318  17.265  -5.974  1.000 21.214  ? 6867 HIS A ND1   1 
ATOM   568  C  CD2   . HIS A  1 72  ? 84.895  17.742  -4.542  1.000 21.113  ? 6867 HIS A CD2   1 
ATOM   569  C  CE1   . HIS A  1 72  ? 82.763  17.965  -4.997  1.000 22.094  ? 6867 HIS A CE1   1 
ATOM   570  N  NE2   . HIS A  1 72  ? 83.704  18.259  -4.102  1.000 20.830  ? 6867 HIS A NE2   1 
ATOM   571  N  N     . PHE A  1 73  ? 86.950  14.904  -3.664  1.000 21.038  ? 6868 PHE A N     1 
ATOM   572  C  CA    . PHE A  1 73  ? 86.667  14.051  -2.482  1.000 21.445  ? 6868 PHE A CA    1 
ATOM   573  C  C     . PHE A  1 73  ? 85.615  14.739  -1.614  1.000 20.971  ? 6868 PHE A C     1 
ATOM   574  O  O     . PHE A  1 73  ? 85.628  15.988  -1.533  1.000 20.713  ? 6868 PHE A O     1 
ATOM   575  C  CB    . PHE A  1 73  ? 87.948  13.789  -1.688  1.000 21.996  ? 6868 PHE A CB    1 
ATOM   576  C  CG    . PHE A  1 73  ? 88.990  12.973  -2.409  1.000 23.417  ? 6868 PHE A CG    1 
ATOM   577  C  CD1   . PHE A  1 73  ? 88.887  11.592  -2.469  1.000 24.427  ? 6868 PHE A CD1   1 
ATOM   578  C  CD2   . PHE A  1 73  ? 90.099  13.577  -2.981  1.000 24.086  ? 6868 PHE A CD2   1 
ATOM   579  C  CE1   . PHE A  1 73  ? 89.857  10.837  -3.107  1.000 25.528  ? 6868 PHE A CE1   1 
ATOM   580  C  CE2   . PHE A  1 73  ? 91.068  12.820  -3.622  1.000 24.727  ? 6868 PHE A CE2   1 
ATOM   581  C  CZ    . PHE A  1 73  ? 90.943  11.453  -3.686  1.000 25.428  ? 6868 PHE A CZ    1 
ATOM   582  N  N     . GLY A  1 74  ? 84.759  13.949  -0.967  1.000 20.950  ? 6869 GLY A N     1 
ATOM   583  C  CA    . GLY A  1 74  ? 83.689  14.490  -0.108  1.000 21.825  ? 6869 GLY A CA    1 
ATOM   584  C  C     . GLY A  1 74  ? 82.645  15.185  -0.955  1.000 22.391  ? 6869 GLY A C     1 
ATOM   585  O  O     . GLY A  1 74  ? 82.134  16.225  -0.523  1.000 22.860  ? 6869 GLY A O     1 
ATOM   586  N  N     . ALA A  1 75  ? 82.333  14.603  -2.112  1.000 22.417  ? 6870 ALA A N     1 
ATOM   587  C  CA    . ALA A  1 75  ? 81.386  15.194  -3.082  1.000 23.608  ? 6870 ALA A CA    1 
ATOM   588  C  C     . ALA A  1 75  ? 79.929  14.812  -2.793  1.000 24.616  ? 6870 ALA A C     1 
ATOM   589  O  O     . ALA A  1 75  ? 79.040  15.410  -3.432  1.000 24.944  ? 6870 ALA A O     1 
ATOM   590  C  CB    . ALA A  1 75  ? 81.788  14.761  -4.464  1.000 23.961  ? 6870 ALA A CB    1 
ATOM   591  N  N     . GLY A  1 76  ? 79.685  13.860  -1.891  1.000 25.082  ? 6871 GLY A N     1 
ATOM   592  C  CA    . GLY A  1 76  ? 78.299  13.454  -1.598  1.000 26.966  ? 6871 GLY A CA    1 
ATOM   593  C  C     . GLY A  1 76  ? 77.643  14.363  -0.577  1.000 28.523  ? 6871 GLY A C     1 
ATOM   594  O  O     . GLY A  1 76  ? 78.297  15.309  -0.097  1.000 30.518  ? 6871 GLY A O     1 
ATOM   595  N  N     . SER A  1 77  ? 76.380  14.098  -0.268  1.000 30.887  ? 6872 SER A N     1 
ATOM   596  C  CA    . SER A  1 77  ? 75.635  14.898  0.733   1.000 33.014  ? 6872 SER A CA    1 
ATOM   597  C  C     . SER A  1 77  ? 74.466  14.068  1.256   1.000 34.151  ? 6872 SER A C     1 
ATOM   598  O  O     . SER A  1 77  ? 74.118  13.052  0.609   1.000 33.594  ? 6872 SER A O     1 
ATOM   599  C  CB    . SER A  1 77  ? 75.143  16.196  0.154   1.000 33.689  ? 6872 SER A CB    1 
ATOM   600  O  OG    . SER A  1 77  ? 74.138  15.970  -0.818  1.000 36.695  ? 6872 SER A OG    1 
ATOM   601  N  N     . ASP A  1 78  ? 73.890  14.494  2.379   1.000 35.985  ? 6873 ASP A N     1 
ATOM   602  C  CA    . ASP A  1 78  ? 72.708  13.793  2.941   1.000 39.047  ? 6873 ASP A CA    1 
ATOM   603  C  C     . ASP A  1 78  ? 71.541  13.935  1.954   1.000 37.572  ? 6873 ASP A C     1 
ATOM   604  O  O     . ASP A  1 78  ? 70.569  13.188  2.098   1.000 37.026  ? 6873 ASP A O     1 
ATOM   605  C  CB    . ASP A  1 78  ? 72.388  14.292  4.357   1.000 44.405  ? 6873 ASP A CB    1 
ATOM   606  C  CG    . ASP A  1 78  ? 72.174  15.793  4.473   1.000 48.959  ? 6873 ASP A CG    1 
ATOM   607  O  OD1   . ASP A  1 78  ? 72.194  16.479  3.428   1.000 53.327  ? 6873 ASP A OD1   1 
ATOM   608  O  OD2   . ASP A  1 78  ? 72.000  16.271  5.619   1.000 58.235  ? 6873 ASP A OD2   1 
ATOM   609  N  N     . LYS A  1 79  ? 71.664  14.824  0.957   1.000 35.465  ? 6874 LYS A N     1 
ATOM   610  C  CA    . LYS A  1 79  ? 70.589  15.027  -0.061  1.000 35.891  ? 6874 LYS A CA    1 
ATOM   611  C  C     . LYS A  1 79  ? 70.649  13.931  -1.136  1.000 33.795  ? 6874 LYS A C     1 
ATOM   612  O  O     . LYS A  1 79  ? 69.681  13.804  -1.889  1.000 35.487  ? 6874 LYS A O     1 
ATOM   613  C  CB    . LYS A  1 79  ? 70.748  16.377  -0.774  1.000 37.223  ? 6874 LYS A CB    1 
ATOM   614  C  CG    . LYS A  1 79  ? 70.743  17.621  0.104   1.000 37.843  ? 6874 LYS A CG    1 
ATOM   615  C  CD    . LYS A  1 79  ? 71.022  18.874  -0.698  1.000 39.332  ? 6874 LYS A CD    1 
ATOM   616  C  CE    . LYS A  1 79  ? 71.250  20.103  0.153   1.000 41.608  ? 6874 LYS A CE    1 
ATOM   617  N  NZ    . LYS A  1 79  ? 70.075  20.413  0.996   1.000 44.696  ? 6874 LYS A NZ    1 
ATOM   618  N  N     . GLY A  1 80  ? 71.766  13.207  -1.237  1.000 31.171  ? 6875 GLY A N     1 
ATOM   619  C  CA    . GLY A  1 80  ? 71.930  12.156  -2.262  1.000 30.107  ? 6875 GLY A CA    1 
ATOM   620  C  C     . GLY A  1 80  ? 72.366  12.716  -3.611  1.000 28.804  ? 6875 GLY A C     1 
ATOM   621  O  O     . GLY A  1 80  ? 72.370  11.946  -4.600  1.000 29.229  ? 6875 GLY A O     1 
ATOM   622  N  N     . VAL A  1 81  ? 72.715  14.006  -3.663  1.000 26.816  ? 6876 VAL A N     1 
ATOM   623  C  CA    . VAL A  1 81  ? 73.168  14.649  -4.928  1.000 26.776  ? 6876 VAL A CA    1 
ATOM   624  C  C     . VAL A  1 81  ? 74.544  15.279  -4.681  1.000 26.239  ? 6876 VAL A C     1 
ATOM   625  O  O     . VAL A  1 81  ? 75.038  15.191  -3.532  1.000 26.798  ? 6876 VAL A O     1 
ATOM   626  C  CB    . VAL A  1 81  ? 72.121  15.655  -5.449  1.000 26.765  ? 6876 VAL A CB    1 
ATOM   627  C  CG1   . VAL A  1 81  ? 70.854  14.940  -5.883  1.000 27.889  ? 6876 VAL A CG1   1 
ATOM   628  C  CG2   . VAL A  1 81  ? 71.807  16.743  -4.433  1.000 26.715  ? 6876 VAL A CG2   1 
ATOM   629  N  N     . ALA A  1 82  ? 75.136  15.895  -5.711  1.000 25.048  ? 6877 ALA A N     1 
ATOM   630  C  CA    . ALA A  1 82  ? 76.498  16.460  -5.594  1.000 23.878  ? 6877 ALA A CA    1 
ATOM   631  C  C     . ALA A  1 82  ? 76.504  17.907  -6.068  1.000 23.647  ? 6877 ALA A C     1 
ATOM   632  O  O     . ALA A  1 82  ? 76.886  18.181  -7.202  1.000 22.711  ? 6877 ALA A O     1 
ATOM   633  C  CB    . ALA A  1 82  ? 77.449  15.604  -6.394  1.000 24.406  ? 6877 ALA A CB    1 
ATOM   634  N  N     . PRO A  1 83  ? 76.080  18.869  -5.213  1.000 23.623  ? 6878 PRO A N     1 
ATOM   635  C  CA    . PRO A  1 83  ? 76.042  20.280  -5.589  1.000 23.419  ? 6878 PRO A CA    1 
ATOM   636  C  C     . PRO A  1 83  ? 77.426  20.801  -5.991  1.000 22.134  ? 6878 PRO A C     1 
ATOM   637  O  O     . PRO A  1 83  ? 77.545  21.402  -7.040  1.000 22.669  ? 6878 PRO A O     1 
ATOM   638  C  CB    . PRO A  1 83  ? 75.532  20.989  -4.325  1.000 23.820  ? 6878 PRO A CB    1 
ATOM   639  C  CG    . PRO A  1 83  ? 74.823  19.912  -3.541  1.000 24.296  ? 6878 PRO A CG    1 
ATOM   640  C  CD    . PRO A  1 83  ? 75.571  18.636  -3.855  1.000 24.014  ? 6878 PRO A CD    1 
ATOM   641  N  N     . GLY A  1 84  ? 78.438  20.506  -5.176  1.000 21.350  ? 6879 GLY A N     1 
ATOM   642  C  CA    . GLY A  1 84  ? 79.810  20.961  -5.459  1.000 21.366  ? 6879 GLY A CA    1 
ATOM   643  C  C     . GLY A  1 84  ? 80.311  20.429  -6.786  1.000 21.588  ? 6879 GLY A C     1 
ATOM   644  O  O     . GLY A  1 84  ? 80.927  21.211  -7.544  1.000 22.177  ? 6879 GLY A O     1 
ATOM   645  N  N     . THR A  1 85  ? 80.051  19.148  -7.068  1.000 21.802  ? 6880 THR A N     1 
ATOM   646  C  CA    . THR A  1 85  ? 80.496  18.559  -8.358  1.000 22.539  ? 6880 THR A CA    1 
ATOM   647  C  C     . THR A  1 85  ? 79.816  19.297  -9.520  1.000 22.307  ? 6880 THR A C     1 
ATOM   648  O  O     . THR A  1 85  ? 80.498  19.566  -10.523 1.000 22.279  ? 6880 THR A O     1 
ATOM   649  C  CB    . THR A  1 85  ? 80.216  17.057  -8.414  1.000 23.032  ? 6880 THR A CB    1 
ATOM   650  O  OG1   . THR A  1 85  ? 81.077  16.425  -7.464  1.000 22.889  ? 6880 THR A OG1   1 
ATOM   651  C  CG2   . THR A  1 85  ? 80.448  16.480  -9.789  1.000 24.291  ? 6880 THR A CG2   1 
ATOM   652  N  N     . ALA A  1 86  ? 78.524  19.606  -9.387  1.000 21.946  ? 6881 ALA A N     1 
ATOM   653  C  CA    . ALA A  1 86  ? 77.808  20.334  -10.461 1.000 22.731  ? 6881 ALA A CA    1 
ATOM   654  C  C     . ALA A  1 86  ? 78.478  21.697  -10.697 1.000 22.336  ? 6881 ALA A C     1 
ATOM   655  O  O     . ALA A  1 86  ? 78.594  22.104  -11.875 1.000 23.045  ? 6881 ALA A O     1 
ATOM   656  C  CB    . ALA A  1 86  ? 76.345  20.464  -10.116 1.000 23.194  ? 6881 ALA A CB    1 
ATOM   657  N  N     . VAL A  1 87  ? 78.906  22.378  -9.631  1.000 22.204  ? 6882 VAL A N     1 
ATOM   658  C  CA    . VAL A  1 87  ? 79.603  23.689  -9.797  1.000 22.138  ? 6882 VAL A CA    1 
ATOM   659  C  C     . VAL A  1 87  ? 80.975  23.455  -10.451 1.000 22.092  ? 6882 VAL A C     1 
ATOM   660  O  O     . VAL A  1 87  ? 81.313  24.204  -11.368 1.000 21.986  ? 6882 VAL A O     1 
ATOM   661  C  CB    . VAL A  1 87  ? 79.746  24.437  -8.462  1.000 21.942  ? 6882 VAL A CB    1 
ATOM   662  C  CG1   . VAL A  1 87  ? 80.609  25.682  -8.617  1.000 22.090  ? 6882 VAL A CG1   1 
ATOM   663  C  CG2   . VAL A  1 87  ? 78.394  24.785  -7.862  1.000 22.368  ? 6882 VAL A CG2   1 
ATOM   664  N  N     . LEU A  1 88  ? 81.752  22.476  -9.977  1.000 22.231  ? 6883 LEU A N     1 
ATOM   665  C  CA    . LEU A  1 88  ? 83.089  22.234  -10.592 1.000 22.831  ? 6883 LEU A CA    1 
ATOM   666  C  C     . LEU A  1 88  ? 82.940  21.952  -12.094 1.000 23.478  ? 6883 LEU A C     1 
ATOM   667  O  O     . LEU A  1 88  ? 83.759  22.456  -12.876 1.000 23.222  ? 6883 LEU A O     1 
ATOM   668  C  CB    . LEU A  1 88  ? 83.782  21.059  -9.898  1.000 22.733  ? 6883 LEU A CB    1 
ATOM   669  C  CG    . LEU A  1 88  ? 84.198  21.290  -8.452  1.000 22.724  ? 6883 LEU A CG    1 
ATOM   670  C  CD1   . LEU A  1 88  ? 84.790  20.028  -7.855  1.000 22.860  ? 6883 LEU A CD1   1 
ATOM   671  C  CD2   . LEU A  1 88  ? 85.192  22.447  -8.346  1.000 23.774  ? 6883 LEU A CD2   1 
ATOM   672  N  N     A ARG A  1 89  ? 81.931  21.163  -12.480 0.500 24.411  ? 6884 ARG A N     1 
ATOM   673  N  N     B ARG A  1 89  ? 81.928  21.156  -12.446 0.500 23.812  ? 6884 ARG A N     1 
ATOM   674  C  CA    A ARG A  1 89  ? 81.738  20.802  -13.913 0.500 26.337  ? 6884 ARG A CA    1 
ATOM   675  C  CA    B ARG A  1 89  ? 81.615  20.763  -13.845 0.500 25.288  ? 6884 ARG A CA    1 
ATOM   676  C  C     A ARG A  1 89  ? 81.294  22.039  -14.708 0.500 26.075  ? 6884 ARG A C     1 
ATOM   677  C  C     B ARG A  1 89  ? 81.334  22.034  -14.658 0.500 25.441  ? 6884 ARG A C     1 
ATOM   678  O  O     A ARG A  1 89  ? 81.590  22.095  -15.912 0.500 26.815  ? 6884 ARG A O     1 
ATOM   679  O  O     B ARG A  1 89  ? 81.857  22.150  -15.778 0.500 25.885  ? 6884 ARG A O     1 
ATOM   680  C  CB    A ARG A  1 89  ? 80.794  19.604  -14.036 0.500 28.268  ? 6884 ARG A CB    1 
ATOM   681  C  CB    B ARG A  1 89  ? 80.422  19.800  -13.799 0.500 26.368  ? 6884 ARG A CB    1 
ATOM   682  C  CG    A ARG A  1 89  ? 80.309  19.332  -15.450 0.500 31.405  ? 6884 ARG A CG    1 
ATOM   683  C  CG    B ARG A  1 89  ? 79.993  19.187  -15.123 0.500 28.149  ? 6884 ARG A CG    1 
ATOM   684  C  CD    A ARG A  1 89  ? 80.166  17.851  -15.706 0.500 33.390  ? 6884 ARG A CD    1 
ATOM   685  C  CD    B ARG A  1 89  ? 81.033  18.243  -15.666 0.500 29.019  ? 6884 ARG A CD    1 
ATOM   686  N  NE    A ARG A  1 89  ? 81.527  17.343  -15.751 0.500 36.616  ? 6884 ARG A NE    1 
ATOM   687  N  NE    B ARG A  1 89  ? 80.526  17.296  -16.653 0.500 30.087  ? 6884 ARG A NE    1 
ATOM   688  C  CZ    A ARG A  1 89  ? 81.888  16.131  -16.135 0.500 36.969  ? 6884 ARG A CZ    1 
ATOM   689  C  CZ    B ARG A  1 89  ? 81.265  16.323  -17.166 0.500 30.970  ? 6884 ARG A CZ    1 
ATOM   690  N  NH1   A ARG A  1 89  ? 80.985  15.254  -16.542 0.500 38.306  ? 6884 ARG A NH1   1 
ATOM   691  N  NH1   B ARG A  1 89  ? 80.762  15.482  -18.053 0.500 31.825  ? 6884 ARG A NH1   1 
ATOM   692  N  NH2   A ARG A  1 89  ? 83.169  15.819  -16.137 0.500 37.866  ? 6884 ARG A NH2   1 
ATOM   693  N  NH2   B ARG A  1 89  ? 82.520  16.195  -16.772 0.500 31.795  ? 6884 ARG A NH2   1 
ATOM   694  N  N     . GLN A  1 90  ? 80.603  22.979  -14.059 1.000 25.454  ? 6885 GLN A N     1 
ATOM   695  C  CA    . GLN A  1 90  ? 80.211  24.250  -14.722 1.000 25.140  ? 6885 GLN A CA    1 
ATOM   696  C  C     . GLN A  1 90  ? 81.464  25.105  -14.912 1.000 24.588  ? 6885 GLN A C     1 
ATOM   697  O  O     . GLN A  1 90  ? 81.646  25.673  -15.988 1.000 24.968  ? 6885 GLN A O     1 
ATOM   698  C  CB    . GLN A  1 90  ? 79.193  24.982  -13.844 1.000 24.820  ? 6885 GLN A CB    1 
ATOM   699  C  CG    . GLN A  1 90  ? 78.927  26.422  -14.261 1.000 25.382  ? 6885 GLN A CG    1 
ATOM   700  C  CD    . GLN A  1 90  ? 78.019  27.123  -13.280 1.000 25.252  ? 6885 GLN A CD    1 
ATOM   701  O  OE1   . GLN A  1 90  ? 77.795  26.642  -12.172 1.000 24.953  ? 6885 GLN A OE1   1 
ATOM   702  N  NE2   . GLN A  1 90  ? 77.489  28.269  -13.684 1.000 25.331  ? 6885 GLN A NE2   1 
ATOM   703  N  N     . TRP A  1 91  ? 82.300  25.150  -13.878 1.000 23.731  ? 6886 TRP A N     1 
ATOM   704  C  CA    . TRP A  1 91  ? 83.528  25.981  -13.821 1.000 23.815  ? 6886 TRP A CA    1 
ATOM   705  C  C     . TRP A  1 91  ? 84.617  25.471  -14.772 1.000 24.910  ? 6886 TRP A C     1 
ATOM   706  O  O     . TRP A  1 91  ? 85.185  26.291  -15.524 1.000 24.491  ? 6886 TRP A O     1 
ATOM   707  C  CB    . TRP A  1 91  ? 84.025  25.992  -12.369 1.000 22.929  ? 6886 TRP A CB    1 
ATOM   708  C  CG    . TRP A  1 91  ? 85.294  26.747  -12.143 1.000 22.844  ? 6886 TRP A CG    1 
ATOM   709  C  CD1   . TRP A  1 91  ? 85.503  28.076  -12.356 1.000 23.005  ? 6886 TRP A CD1   1 
ATOM   710  C  CD2   . TRP A  1 91  ? 86.503  26.242  -11.544 1.000 22.621  ? 6886 TRP A CD2   1 
ATOM   711  N  NE1   . TRP A  1 91  ? 86.773  28.421  -11.981 1.000 23.114  ? 6886 TRP A NE1   1 
ATOM   712  C  CE2   . TRP A  1 91  ? 87.404  27.324  -11.464 1.000 22.311  ? 6886 TRP A CE2   1 
ATOM   713  C  CE3   . TRP A  1 91  ? 86.913  24.987  -11.080 1.000 21.985  ? 6886 TRP A CE3   1 
ATOM   714  C  CZ2   . TRP A  1 91  ? 88.694  27.182  -10.951 1.000 22.645  ? 6886 TRP A CZ2   1 
ATOM   715  C  CZ3   . TRP A  1 91  ? 88.180  24.851  -10.558 1.000 21.643  ? 6886 TRP A CZ3   1 
ATOM   716  C  CH2   . TRP A  1 91  ? 89.061  25.929  -10.509 1.000 21.968  ? 6886 TRP A CH2   1 
ATOM   717  N  N     . LEU A  1 92  ? 84.898  24.170  -14.720 1.000 24.901  ? 6887 LEU A N     1 
ATOM   718  C  CA    . LEU A  1 92  ? 86.008  23.578  -15.508 1.000 25.880  ? 6887 LEU A CA    1 
ATOM   719  C  C     . LEU A  1 92  ? 85.698  23.565  -17.001 1.000 27.166  ? 6887 LEU A C     1 
ATOM   720  O  O     . LEU A  1 92  ? 84.537  23.477  -17.406 1.000 26.422  ? 6887 LEU A O     1 
ATOM   721  C  CB    . LEU A  1 92  ? 86.249  22.159  -14.994 1.000 25.543  ? 6887 LEU A CB    1 
ATOM   722  C  CG    . LEU A  1 92  ? 86.774  22.062  -13.562 1.000 24.965  ? 6887 LEU A CG    1 
ATOM   723  C  CD1   . LEU A  1 92  ? 86.559  20.658  -13.007 1.000 24.454  ? 6887 LEU A CD1   1 
ATOM   724  C  CD2   . LEU A  1 92  ? 88.244  22.457  -13.496 1.000 25.294  ? 6887 LEU A CD2   1 
ATOM   725  N  N     . PRO A  1 93  ? 86.737  23.677  -17.864 1.000 28.063  ? 6888 PRO A N     1 
ATOM   726  C  CA    . PRO A  1 93  ? 86.536  23.583  -19.305 1.000 29.696  ? 6888 PRO A CA    1 
ATOM   727  C  C     . PRO A  1 93  ? 85.777  22.286  -19.614 1.000 29.940  ? 6888 PRO A C     1 
ATOM   728  O  O     . PRO A  1 93  ? 85.979  21.283  -18.933 1.000 28.138  ? 6888 PRO A O     1 
ATOM   729  C  CB    . PRO A  1 93  ? 87.958  23.565  -19.884 1.000 30.414  ? 6888 PRO A CB    1 
ATOM   730  C  CG    . PRO A  1 93  ? 88.781  24.312  -18.840 1.000 29.562  ? 6888 PRO A CG    1 
ATOM   731  C  CD    . PRO A  1 93  ? 88.142  23.952  -17.509 1.000 28.064  ? 6888 PRO A CD    1 
ATOM   732  N  N     A THR A  1 94  ? 84.932  22.297  -20.642 0.500 31.390  ? 6889 THR A N     1 
ATOM   733  N  N     B THR A  1 94  ? 84.901  22.375  -20.618 0.500 31.129  ? 6889 THR A N     1 
ATOM   734  C  CA    A THR A  1 94  ? 84.103  21.102  -20.972 0.500 32.070  ? 6889 THR A CA    1 
ATOM   735  C  CA    B THR A  1 94  ? 84.120  21.215  -21.110 0.500 31.823  ? 6889 THR A CA    1 
ATOM   736  C  C     A THR A  1 94  ? 84.953  19.840  -21.214 0.500 31.894  ? 6889 THR A C     1 
ATOM   737  C  C     B THR A  1 94  ? 85.127  20.164  -21.579 0.500 31.835  ? 6889 THR A C     1 
ATOM   738  O  O     A THR A  1 94  ? 84.444  18.746  -20.919 0.500 32.142  ? 6889 THR A O     1 
ATOM   739  O  O     B THR A  1 94  ? 86.138  20.563  -22.198 0.500 31.877  ? 6889 THR A O     1 
ATOM   740  C  CB    A THR A  1 94  ? 83.201  21.404  -22.173 0.500 33.774  ? 6889 THR A CB    1 
ATOM   741  C  CB    B THR A  1 94  ? 83.155  21.643  -22.222 0.500 33.356  ? 6889 THR A CB    1 
ATOM   742  O  OG1   A THR A  1 94  ? 84.031  21.937  -23.203 0.500 34.813  ? 6889 THR A OG1   1 
ATOM   743  O  OG1   B THR A  1 94  ? 82.292  22.643  -21.678 0.500 33.253  ? 6889 THR A OG1   1 
ATOM   744  C  CG2   A THR A  1 94  ? 82.104  22.395  -21.852 0.500 33.791  ? 6889 THR A CG2   1 
ATOM   745  C  CG2   B THR A  1 94  ? 82.341  20.495  -22.778 0.500 33.992  ? 6889 THR A CG2   1 
ATOM   746  N  N     A GLY A  1 95  ? 86.196  19.975  -21.692 0.500 32.117  ? 6890 GLY A N     1 
ATOM   747  N  N     B GLY A  1 95  ? 84.876  18.893  -21.265 0.500 31.425  ? 6890 GLY A N     1 
ATOM   748  C  CA    A GLY A  1 95  ? 87.027  18.787  -22.000 0.500 32.046  ? 6890 GLY A CA    1 
ATOM   749  C  CA    B GLY A  1 95  ? 85.807  17.813  -21.635 0.500 31.914  ? 6890 GLY A CA    1 
ATOM   750  C  C     A GLY A  1 95  ? 87.745  18.205  -20.789 0.500 30.952  ? 6890 GLY A C     1 
ATOM   751  C  C     B GLY A  1 95  ? 86.766  17.526  -20.496 0.500 31.285  ? 6890 GLY A C     1 
ATOM   752  O  O     A GLY A  1 95  ? 88.441  17.181  -20.950 0.500 30.673  ? 6890 GLY A O     1 
ATOM   753  O  O     B GLY A  1 95  ? 87.465  16.495  -20.549 0.500 31.144  ? 6890 GLY A O     1 
ATOM   754  N  N     A THR A  1 96  ? 87.563  18.803  -19.611 0.500 29.762  ? 6891 THR A N     1 
ATOM   755  N  N     B THR A  1 96  ? 86.805  18.422  -19.502 0.500 30.447  ? 6891 THR A N     1 
ATOM   756  C  CA    A THR A  1 96  ? 88.243  18.328  -18.376 0.500 29.341  ? 6891 THR A CA    1 
ATOM   757  C  CA    B THR A  1 96  ? 87.689  18.234  -18.325 0.500 29.756  ? 6891 THR A CA    1 
ATOM   758  C  C     A THR A  1 96  ? 87.607  17.028  -17.861 0.500 29.385  ? 6891 THR A C     1 
ATOM   759  C  C     B THR A  1 96  ? 87.321  16.924  -17.625 0.500 29.716  ? 6891 THR A C     1 
ATOM   760  O  O     A THR A  1 96  ? 86.335  16.895  -17.954 0.500 29.940  ? 6891 THR A O     1 
ATOM   761  O  O     B THR A  1 96  ? 86.101  16.734  -17.294 0.500 29.959  ? 6891 THR A O     1 
ATOM   762  C  CB    A THR A  1 96  ? 88.178  19.399  -17.281 0.500 28.400  ? 6891 THR A CB    1 
ATOM   763  C  CB    B THR A  1 96  ? 87.568  19.381  -17.316 0.500 28.814  ? 6891 THR A CB    1 
ATOM   764  O  OG1   A THR A  1 96  ? 88.887  20.546  -17.751 0.500 28.387  ? 6891 THR A OG1   1 
ATOM   765  O  OG1   B THR A  1 96  ? 88.034  20.590  -17.918 0.500 28.756  ? 6891 THR A OG1   1 
ATOM   766  C  CG2   A THR A  1 96  ? 88.753  18.928  -15.964 0.500 28.103  ? 6891 THR A CG2   1 
ATOM   767  C  CG2   B THR A  1 96  ? 88.352  19.115  -16.051 0.500 28.453  ? 6891 THR A CG2   1 
ATOM   768  N  N     A LEU A  1 97  ? 88.456  16.104  -17.365 0.500 29.320  ? 6892 LEU A N     1 
ATOM   769  N  N     B LEU A  1 97  ? 88.324  16.062  -17.404 0.500 29.911  ? 6892 LEU A N     1 
ATOM   770  C  CA    A LEU A  1 97  ? 87.949  14.844  -16.754 0.500 29.602  ? 6892 LEU A CA    1 
ATOM   771  C  CA    B LEU A  1 97  ? 88.050  14.789  -16.695 0.500 30.212  ? 6892 LEU A CA    1 
ATOM   772  C  C     A LEU A  1 97  ? 87.721  15.120  -15.265 0.500 28.207  ? 6892 LEU A C     1 
ATOM   773  C  C     B LEU A  1 97  ? 87.736  15.118  -15.234 0.500 28.546  ? 6892 LEU A C     1 
ATOM   774  O  O     A LEU A  1 97  ? 88.643  15.651  -14.617 0.500 27.856  ? 6892 LEU A O     1 
ATOM   775  O  O     B LEU A  1 97  ? 88.617  15.694  -14.569 0.500 28.189  ? 6892 LEU A O     1 
ATOM   776  C  CB    A LEU A  1 97  ? 88.953  13.705  -16.955 0.500 31.023  ? 6892 LEU A CB    1 
ATOM   777  C  CB    B LEU A  1 97  ? 89.280  13.884  -16.768 0.500 31.821  ? 6892 LEU A CB    1 
ATOM   778  C  CG    A LEU A  1 97  ? 89.246  13.331  -18.404 0.500 32.998  ? 6892 LEU A CG    1 
ATOM   779  C  CG    B LEU A  1 97  ? 89.014  12.432  -16.392 0.500 33.120  ? 6892 LEU A CG    1 
ATOM   780  C  CD1   A LEU A  1 97  ? 90.231  12.171  -18.467 0.500 34.523  ? 6892 LEU A CD1   1 
ATOM   781  C  CD1   B LEU A  1 97  ? 88.445  11.691  -17.588 0.500 35.010  ? 6892 LEU A CD1   1 
ATOM   782  C  CD2   A LEU A  1 97  ? 87.963  12.986  -19.147 0.500 34.121  ? 6892 LEU A CD2   1 
ATOM   783  C  CD2   B LEU A  1 97  ? 90.280  11.749  -15.915 0.500 33.849  ? 6892 LEU A CD2   1 
ATOM   784  N  N     . LEU A  1 98  ? 86.533  14.779  -14.764 1.000 28.044  ? 6893 LEU A N     1 
ATOM   785  C  CA    . LEU A  1 98  ? 86.148  15.042  -13.354 1.000 26.726  ? 6893 LEU A CA    1 
ATOM   786  C  C     . LEU A  1 98  ? 85.681  13.744  -12.700 1.000 26.286  ? 6893 LEU A C     1 
ATOM   787  O  O     . LEU A  1 98  ? 84.686  13.140  -13.166 1.000 25.987  ? 6893 LEU A O     1 
ATOM   788  C  CB    . LEU A  1 98  ? 85.046  16.104  -13.325 1.000 26.572  ? 6893 LEU A CB    1 
ATOM   789  C  CG    . LEU A  1 98  ? 84.519  16.485  -11.944 1.000 25.783  ? 6893 LEU A CG    1 
ATOM   790  C  CD1   . LEU A  1 98  ? 85.634  16.984  -11.035 1.000 25.896  ? 6893 LEU A CD1   1 
ATOM   791  C  CD2   . LEU A  1 98  ? 83.427  17.532  -12.070 1.000 25.881  ? 6893 LEU A CD2   1 
ATOM   792  N  N     . VAL A  1 99  ? 86.423  13.322  -11.682 1.000 25.711  ? 6894 VAL A N     1 
ATOM   793  C  CA    . VAL A  1 99  ? 86.078  12.113  -10.891 1.000 26.168  ? 6894 VAL A CA    1 
ATOM   794  C  C     . VAL A  1 99  ? 85.733  12.583  -9.481  1.000 25.332  ? 6894 VAL A C     1 
ATOM   795  O  O     . VAL A  1 99  ? 86.435  13.484  -8.972  1.000 24.923  ? 6894 VAL A O     1 
ATOM   796  C  CB    . VAL A  1 99  ? 87.237  11.105  -10.899 1.000 26.953  ? 6894 VAL A CB    1 
ATOM   797  C  CG1   . VAL A  1 99  ? 87.039  9.995   -9.879  1.000 27.291  ? 6894 VAL A CG1   1 
ATOM   798  C  CG2   . VAL A  1 99  ? 87.441  10.548  -12.295 1.000 27.839  ? 6894 VAL A CG2   1 
ATOM   799  N  N     . ASP A  1 100 ? 84.662  12.046  -8.903  1.000 25.053  ? 6895 ASP A N     1 
ATOM   800  C  CA    . ASP A  1 100 ? 84.321  12.463  -7.523  1.000 24.604  ? 6895 ASP A CA    1 
ATOM   801  C  C     . ASP A  1 100 ? 84.167  11.211  -6.653  1.000 25.516  ? 6895 ASP A C     1 
ATOM   802  O  O     . ASP A  1 100 ? 84.139  10.081  -7.190  1.000 25.525  ? 6895 ASP A O     1 
ATOM   803  C  CB    . ASP A  1 100 ? 83.155  13.454  -7.478  1.000 24.446  ? 6895 ASP A CB    1 
ATOM   804  C  CG    . ASP A  1 100 ? 81.811  12.921  -7.922  1.000 25.045  ? 6895 ASP A CG    1 
ATOM   805  O  OD1   . ASP A  1 100 ? 81.734  11.729  -8.251  1.000 25.912  ? 6895 ASP A OD1   1 
ATOM   806  O  OD2   . ASP A  1 100 ? 80.847  13.726  -7.932  1.000 25.294  ? 6895 ASP A OD2   1 
ATOM   807  N  N     . SER A  1 101 ? 84.082  11.429  -5.346  1.000 25.842  ? 6896 SER A N     1 
ATOM   808  C  CA    . SER A  1 101 ? 84.070  10.303  -4.394  1.000 27.521  ? 6896 SER A CA    1 
ATOM   809  C  C     . SER A  1 101 ? 83.432  10.728  -3.078  1.000 26.553  ? 6896 SER A C     1 
ATOM   810  O  O     . SER A  1 101 ? 83.456  11.948  -2.754  1.000 24.717  ? 6896 SER A O     1 
ATOM   811  C  CB    . SER A  1 101 ? 85.487  9.830   -4.174  1.000 29.668  ? 6896 SER A CB    1 
ATOM   812  O  OG    . SER A  1 101 ? 85.527  8.719   -3.294  1.000 36.485  ? 6896 SER A OG    1 
ATOM   813  N  N     . ASP A  1 102 ? 82.886  9.744   -2.367  1.000 26.457  ? 6897 ASP A N     1 
ATOM   814  C  CA    . ASP A  1 102 ? 82.287  9.986   -1.036  1.000 27.012  ? 6897 ASP A CA    1 
ATOM   815  C  C     . ASP A  1 102 ? 82.070  8.637   -0.356  1.000 27.839  ? 6897 ASP A C     1 
ATOM   816  O  O     . ASP A  1 102 ? 81.982  7.613   -1.058  1.000 26.791  ? 6897 ASP A O     1 
ATOM   817  C  CB    . ASP A  1 102 ? 80.973  10.761  -1.133  1.000 26.870  ? 6897 ASP A CB    1 
ATOM   818  C  CG    . ASP A  1 102 ? 80.537  11.363  0.190   1.000 27.520  ? 6897 ASP A CG    1 
ATOM   819  O  OD1   . ASP A  1 102 ? 80.041  10.600  1.053   1.000 29.870  ? 6897 ASP A OD1   1 
ATOM   820  O  OD2   . ASP A  1 102 ? 80.781  12.578  0.384   1.000 26.394  ? 6897 ASP A OD2   1 
ATOM   821  N  N     A LEU A  1 103 ? 82.004  8.667   0.971   0.600 28.395  ? 6898 LEU A N     1 
ATOM   822  N  N     B LEU A  1 103 ? 82.033  8.647   0.982   0.400 28.104  ? 6898 LEU A N     1 
ATOM   823  C  CA    A LEU A  1 103 ? 81.769  7.470   1.812   0.600 30.089  ? 6898 LEU A CA    1 
ATOM   824  C  CA    B LEU A  1 103 ? 81.748  7.435   1.796   0.400 29.609  ? 6898 LEU A CA    1 
ATOM   825  C  C     A LEU A  1 103 ? 80.382  6.883   1.513   0.600 30.848  ? 6898 LEU A C     1 
ATOM   826  C  C     B LEU A  1 103 ? 80.386  6.863   1.410   0.400 30.554  ? 6898 LEU A C     1 
ATOM   827  O  O     A LEU A  1 103 ? 80.254  5.656   1.531   0.600 31.669  ? 6898 LEU A O     1 
ATOM   828  O  O     B LEU A  1 103 ? 80.280  5.637   1.266   0.400 31.427  ? 6898 LEU A O     1 
ATOM   829  C  CB    A LEU A  1 103 ? 81.881  7.925   3.271   0.600 30.456  ? 6898 LEU A CB    1 
ATOM   830  C  CB    B LEU A  1 103 ? 81.697  7.807   3.283   0.400 29.728  ? 6898 LEU A CB    1 
ATOM   831  C  CG    A LEU A  1 103 ? 81.563  6.879   4.333   0.600 32.038  ? 6898 LEU A CG    1 
ATOM   832  C  CG    B LEU A  1 103 ? 83.016  7.820   4.045   0.400 29.625  ? 6898 LEU A CG    1 
ATOM   833  C  CD1   A LEU A  1 103 ? 82.517  5.699   4.235   0.600 33.817  ? 6898 LEU A CD1   1 
ATOM   834  C  CD1   B LEU A  1 103 ? 82.823  8.412   5.435   0.400 29.791  ? 6898 LEU A CD1   1 
ATOM   835  C  CD2   A LEU A  1 103 ? 81.620  7.504   5.721   0.600 32.171  ? 6898 LEU A CD2   1 
ATOM   836  C  CD2   B LEU A  1 103 ? 83.592  6.421   4.140   0.400 30.560  ? 6898 LEU A CD2   1 
ATOM   837  N  N     . ASN A  1 104 ? 79.400  7.744   1.227   1.000 30.484  ? 6899 ASN A N     1 
ATOM   838  C  CA    . ASN A  1 104 ? 77.992  7.324   0.995   1.000 31.796  ? 6899 ASN A CA    1 
ATOM   839  C  C     . ASN A  1 104 ? 77.577  7.489   -0.470  1.000 31.521  ? 6899 ASN A C     1 
ATOM   840  O  O     . ASN A  1 104 ? 78.100  8.394   -1.145  1.000 29.284  ? 6899 ASN A O     1 
ATOM   841  C  CB    . ASN A  1 104 ? 77.082  8.141   1.914   1.000 32.692  ? 6899 ASN A CB    1 
ATOM   842  C  CG    . ASN A  1 104 ? 77.530  8.067   3.361   1.000 34.689  ? 6899 ASN A CG    1 
ATOM   843  O  OD1   . ASN A  1 104 ? 77.735  6.976   3.893   1.000 35.324  ? 6899 ASN A OD1   1 
ATOM   844  N  ND2   . ASN A  1 104 ? 77.704  9.219   3.995   1.000 32.944  ? 6899 ASN A ND2   1 
ATOM   845  N  N     A ASP A  1 105 ? 76.661  6.634   -0.933  0.600 32.035  ? 6900 ASP A N     1 
ATOM   846  N  N     B ASP A  1 105 ? 76.620  6.659   -0.904  0.400 32.009  ? 6900 ASP A N     1 
ATOM   847  C  CA    A ASP A  1 105 ? 76.191  6.674   -2.342  0.600 32.708  ? 6900 ASP A CA    1 
ATOM   848  C  CA    B ASP A  1 105 ? 76.055  6.676   -2.280  0.400 32.457  ? 6900 ASP A CA    1 
ATOM   849  C  C     A ASP A  1 105 ? 75.512  8.025   -2.607  0.600 31.423  ? 6900 ASP A C     1 
ATOM   850  C  C     B ASP A  1 105 ? 75.476  8.057   -2.596  0.400 31.196  ? 6900 ASP A C     1 
ATOM   851  O  O     A ASP A  1 105 ? 74.915  8.605   -1.671  0.600 31.161  ? 6900 ASP A O     1 
ATOM   852  O  O     B ASP A  1 105 ? 74.912  8.694   -1.678  0.400 30.800  ? 6900 ASP A O     1 
ATOM   853  C  CB    A ASP A  1 105 ? 75.270  5.493   -2.662  0.600 35.634  ? 6900 ASP A CB    1 
ATOM   854  C  CB    B ASP A  1 105 ? 74.925  5.654   -2.441  0.400 34.868  ? 6900 ASP A CB    1 
ATOM   855  C  CG    A ASP A  1 105 ? 74.997  5.303   -4.146  0.600 36.788  ? 6900 ASP A CG    1 
ATOM   856  C  CG    B ASP A  1 105 ? 75.359  4.202   -2.383  0.400 36.380  ? 6900 ASP A CG    1 
ATOM   857  O  OD1   A ASP A  1 105 ? 75.754  5.875   -4.970  0.600 35.953  ? 6900 ASP A OD1   1 
ATOM   858  O  OD1   B ASP A  1 105 ? 76.463  3.902   -2.872  0.400 36.785  ? 6900 ASP A OD1   1 
ATOM   859  O  OD2   A ASP A  1 105 ? 74.029  4.586   -4.471  0.600 40.083  ? 6900 ASP A OD2   1 
ATOM   860  O  OD2   B ASP A  1 105 ? 74.588  3.386   -1.843  0.400 39.167  ? 6900 ASP A OD2   1 
ATOM   861  N  N     . PHE A  1 106 ? 75.627  8.501   -3.846  1.000 30.221  ? 6901 PHE A N     1 
ATOM   862  C  CA    . PHE A  1 106 ? 75.048  9.792   -4.278  1.000 29.242  ? 6901 PHE A CA    1 
ATOM   863  C  C     . PHE A  1 106 ? 74.991  9.778   -5.805  1.000 29.626  ? 6901 PHE A C     1 
ATOM   864  O  O     . PHE A  1 106 ? 75.676  8.931   -6.401  1.000 29.211  ? 6901 PHE A O     1 
ATOM   865  C  CB    . PHE A  1 106 ? 75.854  10.968  -3.717  1.000 27.080  ? 6901 PHE A CB    1 
ATOM   866  C  CG    . PHE A  1 106 ? 77.268  11.083  -4.225  1.000 26.514  ? 6901 PHE A CG    1 
ATOM   867  C  CD1   . PHE A  1 106 ? 78.278  10.278  -3.720  1.000 26.664  ? 6901 PHE A CD1   1 
ATOM   868  C  CD2   . PHE A  1 106 ? 77.603  12.037  -5.176  1.000 26.630  ? 6901 PHE A CD2   1 
ATOM   869  C  CE1   . PHE A  1 106 ? 79.580  10.396  -4.182  1.000 25.919  ? 6901 PHE A CE1   1 
ATOM   870  C  CE2   . PHE A  1 106 ? 78.908  12.154  -5.636  1.000 26.013  ? 6901 PHE A CE2   1 
ATOM   871  C  CZ    . PHE A  1 106 ? 79.894  11.338  -5.135  1.000 25.733  ? 6901 PHE A CZ    1 
ATOM   872  N  N     . VAL A  1 107 ? 74.166  10.659  -6.374  1.000 29.534  ? 6902 VAL A N     1 
ATOM   873  C  CA    . VAL A  1 107 ? 73.972  10.834  -7.844  1.000 30.619  ? 6902 VAL A CA    1 
ATOM   874  C  C     . VAL A  1 107 ? 74.851  12.022  -8.265  1.000 28.855  ? 6902 VAL A C     1 
ATOM   875  O  O     . VAL A  1 107 ? 74.691  13.088  -7.664  1.000 26.775  ? 6902 VAL A O     1 
ATOM   876  C  CB    . VAL A  1 107 ? 72.479  11.063  -8.151  1.000 32.397  ? 6902 VAL A CB    1 
ATOM   877  C  CG1   . VAL A  1 107 ? 72.237  11.502  -9.582  1.000 34.657  ? 6902 VAL A CG1   1 
ATOM   878  C  CG2   . VAL A  1 107 ? 71.655  9.834   -7.815  1.000 34.820  ? 6902 VAL A CG2   1 
ATOM   879  N  N     . SER A  1 108 ? 75.668  11.859  -9.309  1.000 27.749  ? 6903 SER A N     1 
ATOM   880  C  CA    . SER A  1 108 ? 76.661  12.900  -9.666  1.000 27.851  ? 6903 SER A CA    1 
ATOM   881  C  C     . SER A  1 108 ? 76.726  13.182  -11.168 1.000 28.024  ? 6903 SER A C     1 
ATOM   882  O  O     . SER A  1 108 ? 76.370  12.298  -11.971 1.000 27.136  ? 6903 SER A O     1 
ATOM   883  C  CB    . SER A  1 108 ? 78.014  12.459  -9.161  1.000 27.994  ? 6903 SER A CB    1 
ATOM   884  O  OG    . SER A  1 108 ? 79.044  13.270  -9.685  1.000 27.412  ? 6903 SER A OG    1 
ATOM   885  N  N     . ASP A  1 109 ? 77.223  14.377  -11.501 1.000 26.515  ? 6904 ASP A N     1 
ATOM   886  C  CA    . ASP A  1 109 ? 77.468  14.839  -12.889 1.000 27.585  ? 6904 ASP A CA    1 
ATOM   887  C  C     . ASP A  1 109 ? 78.923  14.536  -13.269 1.000 27.168  ? 6904 ASP A C     1 
ATOM   888  O  O     . ASP A  1 109 ? 79.307  14.825  -14.416 1.000 26.349  ? 6904 ASP A O     1 
ATOM   889  C  CB    . ASP A  1 109 ? 77.132  16.325  -13.015 1.000 27.611  ? 6904 ASP A CB    1 
ATOM   890  C  CG    . ASP A  1 109 ? 75.637  16.587  -12.952 1.000 29.205  ? 6904 ASP A CG    1 
ATOM   891  O  OD1   . ASP A  1 109 ? 74.920  16.033  -13.821 1.000 29.370  ? 6904 ASP A OD1   1 
ATOM   892  O  OD2   . ASP A  1 109 ? 75.189  17.293  -11.994 1.000 29.012  ? 6904 ASP A OD2   1 
ATOM   893  N  N     . ALA A  1 110 ? 79.693  13.938  -12.354 1.000 25.732  ? 6905 ALA A N     1 
ATOM   894  C  CA    . ALA A  1 110 ? 81.107  13.632  -12.654 1.000 26.198  ? 6905 ALA A CA    1 
ATOM   895  C  C     . ALA A  1 110 ? 81.192  12.529  -13.719 1.000 27.350  ? 6905 ALA A C     1 
ATOM   896  O  O     . ALA A  1 110 ? 80.229  11.751  -13.867 1.000 28.038  ? 6905 ALA A O     1 
ATOM   897  C  CB    . ALA A  1 110 ? 81.831  13.227  -11.392 1.000 26.201  ? 6905 ALA A CB    1 
ATOM   898  N  N     . ASP A  1 111 ? 82.318  12.481  -14.427 1.000 27.490  ? 6906 ASP A N     1 
ATOM   899  C  CA    . ASP A  1 111 ? 82.581  11.437  -15.450 1.000 28.910  ? 6906 ASP A CA    1 
ATOM   900  C  C     . ASP A  1 111 ? 82.568  10.065  -14.768 1.000 29.360  ? 6906 ASP A C     1 
ATOM   901  O  O     . ASP A  1 111 ? 82.088  9.103   -15.375 1.000 30.311  ? 6906 ASP A O     1 
ATOM   902  C  CB    . ASP A  1 111 ? 83.900  11.727  -16.163 1.000 29.674  ? 6906 ASP A CB    1 
ATOM   903  C  CG    . ASP A  1 111 ? 83.847  13.030  -16.933 1.000 30.844  ? 6906 ASP A CG    1 
ATOM   904  O  OD1   . ASP A  1 111 ? 82.938  13.165  -17.763 1.000 31.750  ? 6906 ASP A OD1   1 
ATOM   905  O  OD2   . ASP A  1 111 ? 84.644  13.943  -16.612 1.000 29.819  ? 6906 ASP A OD2   1 
ATOM   906  N  N     A SER A  1 112 ? 83.120  9.983   -13.552 0.700 28.801  ? 6907 SER A N     1 
ATOM   907  N  N     B SER A  1 112 ? 83.092  9.994   -13.542 0.300 28.607  ? 6907 SER A N     1 
ATOM   908  C  CA    A SER A  1 112 ? 83.125  8.717   -12.770 0.700 29.392  ? 6907 SER A CA    1 
ATOM   909  C  CA    B SER A  1 112 ? 83.104  8.721   -12.777 0.300 28.983  ? 6907 SER A CA    1 
ATOM   910  C  C     A SER A  1 112 ? 82.926  9.048   -11.288 0.700 28.402  ? 6907 SER A C     1 
ATOM   911  C  C     B SER A  1 112 ? 82.938  9.038   -11.288 0.300 28.269  ? 6907 SER A C     1 
ATOM   912  O  O     A SER A  1 112 ? 83.370  10.126  -10.860 0.700 27.108  ? 6907 SER A O     1 
ATOM   913  O  O     B SER A  1 112 ? 83.420  10.101  -10.856 0.300 27.253  ? 6907 SER A O     1 
ATOM   914  C  CB    A SER A  1 112 ? 84.389  7.914   -12.987 0.700 30.169  ? 6907 SER A CB    1 
ATOM   915  C  CB    B SER A  1 112 ? 84.354  7.929   -13.052 0.300 29.423  ? 6907 SER A CB    1 
ATOM   916  O  OG    A SER A  1 112 ? 84.534  7.535   -14.347 0.700 31.799  ? 6907 SER A OG    1 
ATOM   917  O  OG    B SER A  1 112 ? 84.283  6.653   -12.439 0.300 29.880  ? 6907 SER A OG    1 
ATOM   918  N  N     . THR A  1 113 ? 82.271  8.149   -10.548 1.000 28.795  ? 6908 THR A N     1 
ATOM   919  C  CA    . THR A  1 113 ? 82.009  8.353   -9.099  1.000 28.554  ? 6908 THR A CA    1 
ATOM   920  C  C     . THR A  1 113 ? 82.436  7.100   -8.339  1.000 29.438  ? 6908 THR A C     1 
ATOM   921  O  O     . THR A  1 113 ? 82.026  6.011   -8.753  1.000 28.803  ? 6908 THR A O     1 
ATOM   922  C  CB    . THR A  1 113 ? 80.527  8.668   -8.861  1.000 29.178  ? 6908 THR A CB    1 
ATOM   923  O  OG1   . THR A  1 113 ? 80.251  9.905   -9.517  1.000 28.057  ? 6908 THR A OG1   1 
ATOM   924  C  CG2   . THR A  1 113 ? 80.156  8.769   -7.399  1.000 29.681  ? 6908 THR A CG2   1 
ATOM   925  N  N     . LEU A  1 114 ? 83.236  7.272   -7.288  1.000 29.014  ? 6909 LEU A N     1 
ATOM   926  C  CA    . LEU A  1 114 ? 83.701  6.140   -6.444  1.000 30.682  ? 6909 LEU A CA    1 
ATOM   927  C  C     . LEU A  1 114 ? 83.045  6.251   -5.072  1.000 30.342  ? 6909 LEU A C     1 
ATOM   928  O  O     . LEU A  1 114 ? 83.162  7.330   -4.458  1.000 27.719  ? 6909 LEU A O     1 
ATOM   929  C  CB    . LEU A  1 114 ? 85.221  6.203   -6.319  1.000 31.934  ? 6909 LEU A CB    1 
ATOM   930  C  CG    . LEU A  1 114 ? 85.982  6.136   -7.639  1.000 33.973  ? 6909 LEU A CG    1 
ATOM   931  C  CD1   . LEU A  1 114 ? 87.469  6.304   -7.401  1.000 36.014  ? 6909 LEU A CD1   1 
ATOM   932  C  CD2   . LEU A  1 114 ? 85.698  4.837   -8.361  1.000 35.209  ? 6909 LEU A CD2   1 
ATOM   933  N  N     . ILE A  1 115 ? 82.415  5.168   -4.607  1.000 31.002  ? 6910 ILE A N     1 
ATOM   934  C  CA    . ILE A  1 115 ? 81.728  5.180   -3.285  1.000 31.220  ? 6910 ILE A CA    1 
ATOM   935  C  C     . ILE A  1 115 ? 82.559  4.352   -2.299  1.000 32.527  ? 6910 ILE A C     1 
ATOM   936  O  O     . ILE A  1 115 ? 82.917  3.204   -2.634  1.000 33.249  ? 6910 ILE A O     1 
ATOM   937  C  CB    . ILE A  1 115 ? 80.282  4.661   -3.402  1.000 33.112  ? 6910 ILE A CB    1 
ATOM   938  C  CG1   . ILE A  1 115 ? 79.477  5.432   -4.452  1.000 32.912  ? 6910 ILE A CG1   1 
ATOM   939  C  CG2   . ILE A  1 115 ? 79.593  4.670   -2.043  1.000 33.934  ? 6910 ILE A CG2   1 
ATOM   940  C  CD1   . ILE A  1 115 ? 79.376  6.913   -4.187  1.000 31.839  ? 6910 ILE A CD1   1 
ATOM   941  N  N     . GLY A  1 116 ? 82.835  4.923   -1.126  1.000 31.342  ? 6911 GLY A N     1 
ATOM   942  C  CA    . GLY A  1 116 ? 83.615  4.235   -0.081  1.000 31.867  ? 6911 GLY A CA    1 
ATOM   943  C  C     . GLY A  1 116 ? 84.576  5.189   0.606   1.000 30.895  ? 6911 GLY A C     1 
ATOM   944  O  O     . GLY A  1 116 ? 84.676  6.354   0.171   1.000 27.923  ? 6911 GLY A O     1 
ATOM   945  N  N     . ASP A  1 117 ? 85.235  4.710   1.659   1.000 31.531  ? 6912 ASP A N     1 
ATOM   946  C  CA    . ASP A  1 117 ? 86.238  5.517   2.398   1.000 32.330  ? 6912 ASP A CA    1 
ATOM   947  C  C     . ASP A  1 117 ? 87.308  5.944   1.387   1.000 31.267  ? 6912 ASP A C     1 
ATOM   948  O  O     . ASP A  1 117 ? 87.714  5.091   0.578   1.000 30.546  ? 6912 ASP A O     1 
ATOM   949  C  CB    . ASP A  1 117 ? 86.780  4.705   3.579   1.000 35.243  ? 6912 ASP A CB    1 
ATOM   950  C  CG    . ASP A  1 117 ? 87.721  5.454   4.506   1.000 36.978  ? 6912 ASP A CG    1 
ATOM   951  O  OD1   . ASP A  1 117 ? 88.313  6.456   4.080   1.000 36.704  ? 6912 ASP A OD1   1 
ATOM   952  O  OD2   . ASP A  1 117 ? 87.846  5.023   5.658   1.000 44.717  ? 6912 ASP A OD2   1 
ATOM   953  N  N     . CYS A  1 118 ? 87.736  7.213   1.421   1.000 29.206  ? 6913 CYS A N     1 
ATOM   954  C  CA    . CYS A  1 118 ? 88.764  7.677   0.453   1.000 29.436  ? 6913 CYS A CA    1 
ATOM   955  C  C     . CYS A  1 118 ? 90.023  6.804   0.578   1.000 30.358  ? 6913 CYS A C     1 
ATOM   956  O  O     . CYS A  1 118 ? 90.756  6.681   -0.423  1.000 30.226  ? 6913 CYS A O     1 
ATOM   957  C  CB    . CYS A  1 118 ? 89.096  9.150   0.656   1.000 29.168  ? 6913 CYS A CB    1 
ATOM   958  S  SG    . CYS A  1 118 ? 89.799  9.487   2.289   1.000 29.829  ? 6913 CYS A SG    1 
ATOM   959  N  N     . ALA A  1 119 ? 90.236  6.184   1.745   1.000 30.370  ? 6914 ALA A N     1 
ATOM   960  C  CA    . ALA A  1 119 ? 91.415  5.309   1.942   1.000 31.495  ? 6914 ALA A CA    1 
ATOM   961  C  C     . ALA A  1 119 ? 91.343  4.096   1.000   1.000 32.182  ? 6914 ALA A C     1 
ATOM   962  O  O     . ALA A  1 119 ? 92.394  3.467   0.790   1.000 33.433  ? 6914 ALA A O     1 
ATOM   963  C  CB    . ALA A  1 119 ? 91.505  4.878   3.386   1.000 32.730  ? 6914 ALA A CB    1 
ATOM   964  N  N     . THR A  1 120 ? 90.159  3.803   0.442   1.000 32.472  ? 6915 THR A N     1 
ATOM   965  C  CA    . THR A  1 120 ? 89.955  2.641   -0.468  1.000 33.200  ? 6915 THR A CA    1 
ATOM   966  C  C     . THR A  1 120 ? 90.137  3.055   -1.934  1.000 33.661  ? 6915 THR A C     1 
ATOM   967  O  O     . THR A  1 120 ? 90.067  2.167   -2.801  1.000 33.850  ? 6915 THR A O     1 
ATOM   968  C  CB    . THR A  1 120 ? 88.560  2.019   -0.320  1.000 33.384  ? 6915 THR A CB    1 
ATOM   969  O  OG1   . THR A  1 120 ? 87.580  2.940   -0.793  1.000 32.355  ? 6915 THR A OG1   1 
ATOM   970  C  CG2   . THR A  1 120 ? 88.244  1.598   1.099   1.000 35.053  ? 6915 THR A CG2   1 
ATOM   971  N  N     . VAL A  1 121 ? 90.348  4.343   -2.196  1.000 33.301  ? 6916 VAL A N     1 
ATOM   972  C  CA    . VAL A  1 121 ? 90.494  4.846   -3.595  1.000 34.368  ? 6916 VAL A CA    1 
ATOM   973  C  C     . VAL A  1 121 ? 91.930  4.625   -4.080  1.000 36.778  ? 6916 VAL A C     1 
ATOM   974  O  O     . VAL A  1 121 ? 92.869  5.040   -3.363  1.000 34.995  ? 6916 VAL A O     1 
ATOM   975  C  CB    . VAL A  1 121 ? 90.100  6.329   -3.693  1.000 33.546  ? 6916 VAL A CB    1 
ATOM   976  C  CG1   . VAL A  1 121 ? 90.479  6.928   -5.040  1.000 33.904  ? 6916 VAL A CG1   1 
ATOM   977  C  CG2   . VAL A  1 121 ? 88.622  6.530   -3.401  1.000 33.564  ? 6916 VAL A CG2   1 
ATOM   978  N  N     . HIS A  1 122 ? 92.071  4.006   -5.260  1.000 38.563  ? 6917 HIS A N     1 
ATOM   979  C  CA    . HIS A  1 122 ? 93.389  3.741   -5.895  1.000 44.012  ? 6917 HIS A CA    1 
ATOM   980  C  C     . HIS A  1 122 ? 93.409  4.354   -7.292  1.000 44.580  ? 6917 HIS A C     1 
ATOM   981  O  O     . HIS A  1 122 ? 92.350  4.384   -7.941  1.000 44.254  ? 6917 HIS A O     1 
ATOM   982  C  CB    . HIS A  1 122 ? 93.684  2.240   -6.054  1.000 50.622  ? 6917 HIS A CB    1 
ATOM   983  C  CG    . HIS A  1 122 ? 93.598  1.455   -4.793  1.000 55.861  ? 6917 HIS A CG    1 
ATOM   984  N  ND1   . HIS A  1 122 ? 94.535  1.577   -3.785  1.000 61.347  ? 6917 HIS A ND1   1 
ATOM   985  C  CD2   . HIS A  1 122 ? 92.723  0.508   -4.394  1.000 59.218  ? 6917 HIS A CD2   1 
ATOM   986  C  CE1   . HIS A  1 122 ? 94.222  0.760   -2.799  1.000 62.474  ? 6917 HIS A CE1   1 
ATOM   987  N  NE2   . HIS A  1 122 ? 93.117  0.091   -3.151  1.000 62.630  ? 6917 HIS A NE2   1 
ATOM   988  N  N     . THR A  1 123 ? 94.578  4.819   -7.722  1.000 44.670  ? 6918 THR A N     1 
ATOM   989  C  CA    . THR A  1 123 ? 94.730  5.369   -9.088  1.000 44.777  ? 6918 THR A CA    1 
ATOM   990  C  C     . THR A  1 123 ? 96.193  5.236   -9.499  1.000 45.227  ? 6918 THR A C     1 
ATOM   991  O  O     . THR A  1 123 ? 97.071  5.464   -8.646  1.000 45.770  ? 6918 THR A O     1 
ATOM   992  C  CB    . THR A  1 123 ? 94.235  6.813   -9.209  1.000 44.005  ? 6918 THR A CB    1 
ATOM   993  O  OG1   . THR A  1 123 ? 94.443  7.165   -10.575 1.000 47.085  ? 6918 THR A OG1   1 
ATOM   994  C  CG2   . THR A  1 123 ? 94.948  7.793   -8.304  1.000 43.916  ? 6918 THR A CG2   1 
ATOM   995  N  N     . ALA A  1 124 ? 96.424  4.817   -10.742 1.000 45.551  ? 6919 ALA A N     1 
ATOM   996  C  CA    . ALA A  1 124 ? 97.793  4.693   -11.286 1.000 46.829  ? 6919 ALA A CA    1 
ATOM   997  C  C     . ALA A  1 124 ? 98.213  6.021   -11.931 1.000 45.228  ? 6919 ALA A C     1 
ATOM   998  O  O     . ALA A  1 124 ? 99.361  6.104   -12.378 1.000 48.840  ? 6919 ALA A O     1 
ATOM   999  C  CB    . ALA A  1 124 ? 97.829  3.568   -12.294 1.000 49.456  ? 6919 ALA A CB    1 
ATOM   1000 N  N     . ASN A  1 125 ? 97.348  7.042   -11.905 1.000 42.931  ? 6920 ASN A N     1 
ATOM   1001 C  CA    . ASN A  1 125 ? 97.659  8.316   -12.609 1.000 40.771  ? 6920 ASN A CA    1 
ATOM   1002 C  C     . ASN A  1 125 ? 97.813  9.500   -11.656 1.000 37.661  ? 6920 ASN A C     1 
ATOM   1003 O  O     . ASN A  1 125 ? 97.375  9.412   -10.488 1.000 34.089  ? 6920 ASN A O     1 
ATOM   1004 C  CB    . ASN A  1 125 ? 96.560  8.679   -13.602 1.000 42.816  ? 6920 ASN A CB    1 
ATOM   1005 C  CG    . ASN A  1 125 ? 96.105  7.477   -14.390 1.000 46.577  ? 6920 ASN A CG    1 
ATOM   1006 O  OD1   . ASN A  1 125 ? 95.482  6.577   -13.830 1.000 49.544  ? 6920 ASN A OD1   1 
ATOM   1007 N  ND2   . ASN A  1 125 ? 96.390  7.466   -15.682 1.000 49.083  ? 6920 ASN A ND2   1 
ATOM   1008 N  N     . LYS A  1 126 ? 98.435  10.561  -12.174 1.000 36.686  ? 6921 LYS A N     1 
ATOM   1009 C  CA    . LYS A  1 126 ? 98.605  11.844  -11.452 1.000 35.186  ? 6921 LYS A CA    1 
ATOM   1010 C  C     . LYS A  1 126 ? 97.457  12.761  -11.883 1.000 33.258  ? 6921 LYS A C     1 
ATOM   1011 O  O     . LYS A  1 126 ? 96.939  12.595  -13.026 1.000 33.534  ? 6921 LYS A O     1 
ATOM   1012 C  CB    . LYS A  1 126 ? 99.998  12.428  -11.693 1.000 37.412  ? 6921 LYS A CB    1 
ATOM   1013 C  CG    . LYS A  1 126 ? 101.130 11.643  -11.044 1.000 40.041  ? 6921 LYS A CG    1 
ATOM   1014 C  CD    . LYS A  1 126 ? 102.468 12.330  -11.135 1.000 43.339  ? 6921 LYS A CD    1 
ATOM   1015 C  CE    . LYS A  1 126 ? 103.601 11.513  -10.552 1.000 45.513  ? 6921 LYS A CE    1 
ATOM   1016 N  NZ    . LYS A  1 126 ? 103.441 11.329  -9.093  1.000 47.800  ? 6921 LYS A NZ    1 
ATOM   1017 N  N     . TRP A  1 127 ? 97.088  13.687  -10.997 1.000 30.433  ? 6922 TRP A N     1 
ATOM   1018 C  CA    . TRP A  1 127 ? 95.943  14.610  -11.178 1.000 28.980  ? 6922 TRP A CA    1 
ATOM   1019 C  C     . TRP A  1 127 ? 96.452  16.051  -11.229 1.000 27.863  ? 6922 TRP A C     1 
ATOM   1020 O  O     . TRP A  1 127 ? 97.562  16.308  -10.735 1.000 27.907  ? 6922 TRP A O     1 
ATOM   1021 C  CB    . TRP A  1 127 ? 94.916  14.338  -10.066 1.000 28.991  ? 6922 TRP A CB    1 
ATOM   1022 C  CG    . TRP A  1 127 ? 94.385  12.943  -10.196 1.000 29.829  ? 6922 TRP A CG    1 
ATOM   1023 C  CD1   . TRP A  1 127 ? 95.012  11.790  -9.824  1.000 31.407  ? 6922 TRP A CD1   1 
ATOM   1024 C  CD2   . TRP A  1 127 ? 93.168  12.541  -10.850 1.000 29.810  ? 6922 TRP A CD2   1 
ATOM   1025 N  NE1   . TRP A  1 127 ? 94.269  10.701  -10.194 1.000 32.460  ? 6922 TRP A NE1   1 
ATOM   1026 C  CE2   . TRP A  1 127 ? 93.125  11.132  -10.811 1.000 31.890  ? 6922 TRP A CE2   1 
ATOM   1027 C  CE3   . TRP A  1 127 ? 92.110  13.230  -11.450 1.000 30.145  ? 6922 TRP A CE3   1 
ATOM   1028 C  CZ2   . TRP A  1 127 ? 92.064  10.405  -11.345 1.000 32.378  ? 6922 TRP A CZ2   1 
ATOM   1029 C  CZ3   . TRP A  1 127 ? 91.060  12.511  -11.976 1.000 30.018  ? 6922 TRP A CZ3   1 
ATOM   1030 C  CH2   . TRP A  1 127 ? 91.040  11.119  -11.924 1.000 31.606  ? 6922 TRP A CH2   1 
ATOM   1031 N  N     . ASP A  1 128 ? 95.668  16.939  -11.829 1.000 26.849  ? 6923 ASP A N     1 
ATOM   1032 C  CA    . ASP A  1 128 ? 96.082  18.350  -12.019 1.000 27.313  ? 6923 ASP A CA    1 
ATOM   1033 C  C     . ASP A  1 128 ? 95.459  19.217  -10.926 1.000 25.601  ? 6923 ASP A C     1 
ATOM   1034 O  O     . ASP A  1 128 ? 95.996  20.291  -10.652 1.000 25.785  ? 6923 ASP A O     1 
ATOM   1035 C  CB    . ASP A  1 128 ? 95.675  18.811  -13.417 1.000 28.404  ? 6923 ASP A CB    1 
ATOM   1036 C  CG    . ASP A  1 128 ? 96.262  17.937  -14.506 1.000 30.216  ? 6923 ASP A CG    1 
ATOM   1037 O  OD1   . ASP A  1 128 ? 97.414  17.490  -14.332 1.000 31.379  ? 6923 ASP A OD1   1 
ATOM   1038 O  OD2   . ASP A  1 128 ? 95.533  17.645  -15.478 1.000 31.925  ? 6923 ASP A OD2   1 
ATOM   1039 N  N     . LEU A  1 129 ? 94.353  18.751  -10.347 1.000 24.447  ? 6924 LEU A N     1 
ATOM   1040 C  CA    . LEU A  1 129 ? 93.646  19.536  -9.315  1.000 23.431  ? 6924 LEU A CA    1 
ATOM   1041 C  C     . LEU A  1 129 ? 92.912  18.576  -8.388  1.000 23.038  ? 6924 LEU A C     1 
ATOM   1042 O  O     . LEU A  1 129 ? 92.220  17.669  -8.894  1.000 22.484  ? 6924 LEU A O     1 
ATOM   1043 C  CB    . LEU A  1 129 ? 92.658  20.483  -9.998  1.000 23.942  ? 6924 LEU A CB    1 
ATOM   1044 C  CG    . LEU A  1 129 ? 91.812  21.353  -9.075  1.000 23.885  ? 6924 LEU A CG    1 
ATOM   1045 C  CD1   . LEU A  1 129 ? 92.683  22.310  -8.285  1.000 24.920  ? 6924 LEU A CD1   1 
ATOM   1046 C  CD2   . LEU A  1 129 ? 90.774  22.132  -9.870  1.000 24.872  ? 6924 LEU A CD2   1 
ATOM   1047 N  N     . ILE A  1 130 ? 93.106  18.766  -7.087  1.000 21.875  ? 6925 ILE A N     1 
ATOM   1048 C  CA    . ILE A  1 130 ? 92.409  17.958  -6.055  1.000 21.865  ? 6925 ILE A CA    1 
ATOM   1049 C  C     . ILE A  1 130 ? 91.530  18.903  -5.256  1.000 21.247  ? 6925 ILE A C     1 
ATOM   1050 O  O     . ILE A  1 130 ? 92.061  19.909  -4.739  1.000 22.203  ? 6925 ILE A O     1 
ATOM   1051 C  CB    . ILE A  1 130 ? 93.397  17.244  -5.120  1.000 22.259  ? 6925 ILE A CB    1 
ATOM   1052 C  CG1   . ILE A  1 130 ? 94.359  16.341  -5.886  1.000 23.473  ? 6925 ILE A CG1   1 
ATOM   1053 C  CG2   . ILE A  1 130 ? 92.642  16.482  -4.039  1.000 22.492  ? 6925 ILE A CG2   1 
ATOM   1054 C  CD1   . ILE A  1 130 ? 95.521  15.875  -5.045  1.000 24.236  ? 6925 ILE A CD1   1 
ATOM   1055 N  N     . ILE A  1 131 ? 90.243  18.590  -5.182  1.000 21.077  ? 6926 ILE A N     1 
ATOM   1056 C  CA    . ILE A  1 131 ? 89.292  19.364  -4.344  1.000 20.774  ? 6926 ILE A CA    1 
ATOM   1057 C  C     . ILE A  1 131 ? 88.793  18.404  -3.269  1.000 21.193  ? 6926 ILE A C     1 
ATOM   1058 O  O     . ILE A  1 131 ? 88.447  17.257  -3.629  1.000 22.535  ? 6926 ILE A O     1 
ATOM   1059 C  CB    . ILE A  1 131 ? 88.113  19.919  -5.161  1.000 20.625  ? 6926 ILE A CB    1 
ATOM   1060 C  CG1   . ILE A  1 131 ? 88.569  20.714  -6.388  1.000 21.132  ? 6926 ILE A CG1   1 
ATOM   1061 C  CG2   . ILE A  1 131 ? 87.185  20.729  -4.262  1.000 20.298  ? 6926 ILE A CG2   1 
ATOM   1062 C  CD1   . ILE A  1 131 ? 89.338  21.968  -6.071  1.000 21.333  ? 6926 ILE A CD1   1 
ATOM   1063 N  N     . SER A  1 132 ? 88.811  18.834  -2.009  1.000 20.139  ? 6927 SER A N     1 
ATOM   1064 C  CA    . SER A  1 132 ? 88.257  17.999  -0.918  1.000 20.031  ? 6927 SER A CA    1 
ATOM   1065 C  C     . SER A  1 132 ? 87.297  18.805  -0.042  1.000 19.756  ? 6927 SER A C     1 
ATOM   1066 O  O     . SER A  1 132 ? 87.671  19.891  0.431   1.000 19.311  ? 6927 SER A O     1 
ATOM   1067 C  CB    . SER A  1 132 ? 89.331  17.395  -0.063  1.000 20.246  ? 6927 SER A CB    1 
ATOM   1068 O  OG    . SER A  1 132 ? 88.738  16.706  1.027   1.000 19.986  ? 6927 SER A OG    1 
ATOM   1069 N  N     . ASP A  1 133 ? 86.113  18.250  0.182   1.000 20.346  ? 6928 ASP A N     1 
ATOM   1070 C  CA    . ASP A  1 133 ? 85.130  18.845  1.116   1.000 21.526  ? 6928 ASP A CA    1 
ATOM   1071 C  C     . ASP A  1 133 ? 84.849  17.788  2.189   1.000 21.550  ? 6928 ASP A C     1 
ATOM   1072 O  O     . ASP A  1 133 ? 83.841  17.915  2.896   1.000 22.200  ? 6928 ASP A O     1 
ATOM   1073 C  CB    . ASP A  1 133 ? 83.857  19.301  0.401   1.000 22.678  ? 6928 ASP A CB    1 
ATOM   1074 C  CG    . ASP A  1 133 ? 83.013  20.232  1.250   1.000 25.226  ? 6928 ASP A CG    1 
ATOM   1075 O  OD1   . ASP A  1 133 ? 83.612  20.967  2.072   1.000 26.303  ? 6928 ASP A OD1   1 
ATOM   1076 O  OD2   . ASP A  1 133 ? 81.765  20.194  1.115   1.000 26.704  ? 6928 ASP A OD2   1 
ATOM   1077 N  N     . MET A  1 134 ? 85.738  16.793  2.316   1.000 21.389  ? 6929 MET A N     1 
ATOM   1078 C  CA    . MET A  1 134 ? 85.532  15.736  3.336   1.000 22.180  ? 6929 MET A CA    1 
ATOM   1079 C  C     . MET A  1 134 ? 85.487  16.366  4.732   1.000 23.140  ? 6929 MET A C     1 
ATOM   1080 O  O     . MET A  1 134 ? 86.266  17.301  5.023   1.000 22.349  ? 6929 MET A O     1 
ATOM   1081 C  CB    . MET A  1 134 ? 86.605  14.642  3.277   1.000 23.077  ? 6929 MET A CB    1 
ATOM   1082 C  CG    . MET A  1 134 ? 86.474  13.765  2.044   1.000 23.699  ? 6929 MET A CG    1 
ATOM   1083 S  SD    . MET A  1 134 ? 87.622  12.363  2.006   1.000 24.528  ? 6929 MET A SD    1 
ATOM   1084 C  CE    . MET A  1 134 ? 89.180  13.215  1.773   1.000 23.926  ? 6929 MET A CE    1 
ATOM   1085 N  N     . TYR A  1 135 ? 84.585  15.847  5.552   1.000 24.851  ? 6930 TYR A N     1 
ATOM   1086 C  CA    . TYR A  1 135 ? 84.371  16.330  6.933   1.000 26.834  ? 6930 TYR A CA    1 
ATOM   1087 C  C     . TYR A  1 135 ? 83.647  15.221  7.693   1.000 30.771  ? 6930 TYR A C     1 
ATOM   1088 O  O     . TYR A  1 135 ? 82.652  14.704  7.165   1.000 29.857  ? 6930 TYR A O     1 
ATOM   1089 C  CB    . TYR A  1 135 ? 83.567  17.626  6.918   1.000 26.877  ? 6930 TYR A CB    1 
ATOM   1090 C  CG    . TYR A  1 135 ? 83.316  18.227  8.278   1.000 28.044  ? 6930 TYR A CG    1 
ATOM   1091 C  CD1   . TYR A  1 135 ? 84.260  19.034  8.889   1.000 27.676  ? 6930 TYR A CD1   1 
ATOM   1092 C  CD2   . TYR A  1 135 ? 82.124  18.004  8.945   1.000 31.490  ? 6930 TYR A CD2   1 
ATOM   1093 C  CE1   . TYR A  1 135 ? 84.031  19.601  10.134  1.000 29.160  ? 6930 TYR A CE1   1 
ATOM   1094 C  CE2   . TYR A  1 135 ? 81.881  18.557  10.195  1.000 33.449  ? 6930 TYR A CE2   1 
ATOM   1095 C  CZ    . TYR A  1 135 ? 82.834  19.369  10.788  1.000 32.825  ? 6930 TYR A CZ    1 
ATOM   1096 O  OH    . TYR A  1 135 ? 82.597  19.914  12.019  1.000 34.494  ? 6930 TYR A OH    1 
ATOM   1097 N  N     . ASP A  1 136 ? 84.173  14.853  8.857   1.000 34.510  ? 6931 ASP A N     1 
ATOM   1098 C  CA    . ASP A  1 136 ? 83.578  13.774  9.691   1.000 41.166  ? 6931 ASP A CA    1 
ATOM   1099 C  C     . ASP A  1 136 ? 82.516  14.390  10.593  1.000 46.425  ? 6931 ASP A C     1 
ATOM   1100 O  O     . ASP A  1 136 ? 82.826  15.260  11.406  1.000 44.264  ? 6931 ASP A O     1 
ATOM   1101 C  CB    . ASP A  1 136 ? 84.664  13.048  10.484  1.000 42.580  ? 6931 ASP A CB    1 
ATOM   1102 C  CG    . ASP A  1 136 ? 84.162  11.862  11.298  1.000 46.857  ? 6931 ASP A CG    1 
ATOM   1103 O  OD1   . ASP A  1 136 ? 82.953  11.826  11.620  1.000 45.081  ? 6931 ASP A OD1   1 
ATOM   1104 O  OD2   . ASP A  1 136 ? 84.983  10.972  11.574  1.000 49.232  ? 6931 ASP A OD2   1 
ATOM   1105 N  N     . PRO A  1 137 ? 81.238  13.952  10.498  1.000 65.017  ? 6932 PRO A N     1 
ATOM   1106 C  CA    . PRO A  1 137 ? 80.170  14.519  11.326  1.000 69.115  ? 6932 PRO A CA    1 
ATOM   1107 C  C     . PRO A  1 137 ? 80.447  14.390  12.834  1.000 71.936  ? 6932 PRO A C     1 
ATOM   1108 O  O     . PRO A  1 137 ? 79.960  15.216  13.586  1.000 76.128  ? 6932 PRO A O     1 
ATOM   1109 C  CB    . PRO A  1 137 ? 78.915  13.724  10.923  1.000 73.785  ? 6932 PRO A CB    1 
ATOM   1110 C  CG    . PRO A  1 137 ? 79.447  12.465  10.256  1.000 74.833  ? 6932 PRO A CG    1 
ATOM   1111 C  CD    . PRO A  1 137 ? 80.758  12.873  9.620   1.000 71.252  ? 6932 PRO A CD    1 
ATOM   1112 N  N     . LYS A  1 138 ? 81.261  13.400  13.223  1.000 75.951  ? 6933 LYS A N     1 
ATOM   1113 C  CA    . LYS A  1 138 ? 81.609  13.146  14.650  1.000 78.285  ? 6933 LYS A CA    1 
ATOM   1114 C  C     . LYS A  1 138 ? 82.554  14.238  15.172  1.000 75.702  ? 6933 LYS A C     1 
ATOM   1115 O  O     . LYS A  1 138 ? 82.880  14.203  16.378  1.000 74.340  ? 6933 LYS A O     1 
ATOM   1116 C  CB    . LYS A  1 138 ? 82.249  11.762  14.808  1.000 82.967  ? 6933 LYS A CB    1 
ATOM   1117 C  CG    . LYS A  1 138 ? 81.356  10.588  14.427  1.000 91.372  ? 6933 LYS A CG    1 
ATOM   1118 C  CD    . LYS A  1 138 ? 82.014  9.238   14.608  1.000 98.561  ? 6933 LYS A CD    1 
ATOM   1119 C  CE    . LYS A  1 138 ? 81.098  8.089   14.243  1.000 107.458 ? 6933 LYS A CE    1 
ATOM   1120 N  NZ    . LYS A  1 138 ? 81.749  6.777   14.471  1.000 116.459 ? 6933 LYS A NZ    1 
ATOM   1121 N  N     . THR A  1 139 ? 82.977  15.162  14.301  1.000 73.093  ? 6934 THR A N     1 
ATOM   1122 C  CA    . THR A  1 139 ? 83.891  16.266  14.707  1.000 71.833  ? 6934 THR A CA    1 
ATOM   1123 C  C     . THR A  1 139 ? 83.143  17.246  15.627  1.000 75.647  ? 6934 THR A C     1 
ATOM   1124 O  O     . THR A  1 139 ? 83.822  17.892  16.453  1.000 78.221  ? 6934 THR A O     1 
ATOM   1125 C  CB    . THR A  1 139 ? 84.502  16.957  13.478  1.000 68.306  ? 6934 THR A CB    1 
ATOM   1126 O  OG1   . THR A  1 139 ? 85.279  16.000  12.757  1.000 65.117  ? 6934 THR A OG1   1 
ATOM   1127 C  CG2   . THR A  1 139 ? 85.390  18.129  13.828  1.000 65.774  ? 6934 THR A CG2   1 
ATOM   1128 N  N     . LYS A  1 140 ? 81.810  17.341  15.502  1.000 81.511  ? 6935 LYS A N     1 
ATOM   1129 C  CA    . LYS A  1 140 ? 81.000  18.262  16.354  1.000 88.153  ? 6935 LYS A CA    1 
ATOM   1130 C  C     . LYS A  1 140 ? 80.131  17.478  17.346  1.000 92.263  ? 6935 LYS A C     1 
ATOM   1131 O  O     . LYS A  1 140 ? 79.697  18.093  18.339  1.000 95.305  ? 6935 LYS A O     1 
ATOM   1132 C  CB    . LYS A  1 140 ? 80.103  19.172  15.508  1.000 93.648  ? 6935 LYS A CB    1 
ATOM   1133 C  CG    . LYS A  1 140 ? 80.818  20.286  14.758  1.000 95.277  ? 6935 LYS A CG    1 
ATOM   1134 C  CD    . LYS A  1 140 ? 79.870  21.178  13.985  1.000 101.125 ? 6935 LYS A CD    1 
ATOM   1135 C  CE    . LYS A  1 140 ? 80.559  22.342  13.307  1.000 105.617 ? 6935 LYS A CE    1 
ATOM   1136 N  NZ    . LYS A  1 140 ? 79.597  23.172  12.543  1.000 112.716 ? 6935 LYS A NZ    1 
ATOM   1137 N  N     . ASN A  1 141 ? 79.863  16.193  17.081  1.000 99.176  ? 6936 ASN A N     1 
ATOM   1138 C  CA    . ASN A  1 141 ? 79.025  15.365  17.997  1.000 103.943 ? 6936 ASN A CA    1 
ATOM   1139 C  C     . ASN A  1 141 ? 79.696  15.281  19.373  1.000 105.850 ? 6936 ASN A C     1 
ATOM   1140 O  O     . ASN A  1 141 ? 78.965  15.217  20.383  1.000 109.944 ? 6936 ASN A O     1 
ATOM   1141 C  CB    . ASN A  1 141 ? 78.761  13.962  17.442  1.000 107.993 ? 6936 ASN A CB    1 
ATOM   1142 C  CG    . ASN A  1 141 ? 77.878  13.957  16.211  1.000 110.289 ? 6936 ASN A CG    1 
ATOM   1143 O  OD1   . ASN A  1 141 ? 77.326  14.986  15.828  1.000 109.096 ? 6936 ASN A OD1   1 
ATOM   1144 N  ND2   . ASN A  1 141 ? 77.727  12.796  15.593  1.000 114.509 ? 6936 ASN A ND2   1 
ATOM   1145 N  N     . VAL A  1 142 ? 81.034  15.278  19.399  1.000 101.719 ? 6937 VAL A N     1 
ATOM   1146 C  CA    . VAL A  1 142 ? 81.827  15.215  20.665  1.000 101.982 ? 6937 VAL A CA    1 
ATOM   1147 C  C     . VAL A  1 142 ? 83.059  16.111  20.495  1.000 94.280  ? 6937 VAL A C     1 
ATOM   1148 O  O     . VAL A  1 142 ? 83.874  15.836  19.590  1.000 93.377  ? 6937 VAL A O     1 
ATOM   1149 C  CB    . VAL A  1 142 ? 82.204  13.766  21.047  1.000 105.731 ? 6937 VAL A CB    1 
ATOM   1150 C  CG1   . VAL A  1 142 ? 82.903  13.018  19.918  1.000 104.769 ? 6937 VAL A CG1   1 
ATOM   1151 C  CG2   . VAL A  1 142 ? 83.040  13.715  22.320  1.000 106.244 ? 6937 VAL A CG2   1 
ATOM   1152 N  N     . THR A  1 143 ? 83.162  17.166  21.311  1.000 87.672  ? 6938 THR A N     1 
ATOM   1153 C  CA    . THR A  1 143 ? 84.327  18.087  21.224  1.000 83.389  ? 6938 THR A CA    1 
ATOM   1154 C  C     . THR A  1 143 ? 85.482  17.461  22.020  1.000 77.082  ? 6938 THR A C     1 
ATOM   1155 O  O     . THR A  1 143 ? 85.242  16.987  23.154  1.000 82.348  ? 6938 THR A O     1 
ATOM   1156 C  CB    . THR A  1 143 ? 83.952  19.513  21.655  1.000 88.219  ? 6938 THR A CB    1 
ATOM   1157 O  OG1   . THR A  1 143 ? 85.054  20.361  21.331  1.000 87.692  ? 6938 THR A OG1   1 
ATOM   1158 C  CG2   . THR A  1 143 ? 83.602  19.634  23.124  1.000 93.057  ? 6938 THR A CG2   1 
ATOM   1159 N  N     . LYS A  1 144 ? 86.678  17.456  21.424  1.000 63.699  ? 6939 LYS A N     1 
ATOM   1160 C  CA    . LYS A  1 144 ? 87.899  16.850  22.017  1.000 56.539  ? 6939 LYS A CA    1 
ATOM   1161 C  C     . LYS A  1 144 ? 89.041  17.867  21.968  1.000 49.211  ? 6939 LYS A C     1 
ATOM   1162 O  O     . LYS A  1 144 ? 88.915  18.872  21.208  1.000 41.686  ? 6939 LYS A O     1 
ATOM   1163 C  CB    . LYS A  1 144 ? 88.337  15.649  21.169  1.000 59.155  ? 6939 LYS A CB    1 
ATOM   1164 C  CG    . LYS A  1 144 ? 87.250  14.636  20.830  1.000 62.236  ? 6939 LYS A CG    1 
ATOM   1165 C  CD    . LYS A  1 144 ? 86.753  13.837  22.010  1.000 70.354  ? 6939 LYS A CD    1 
ATOM   1166 C  CE    . LYS A  1 144 ? 87.815  12.928  22.589  1.000 76.427  ? 6939 LYS A CE    1 
ATOM   1167 N  NZ    . LYS A  1 144 ? 87.282  12.115  23.707  1.000 84.398  ? 6939 LYS A NZ    1 
ATOM   1168 N  N     A GLU A  1 145 ? 90.096  17.656  22.761  0.600 43.800  ? 6940 GLU A N     1 
ATOM   1169 N  N     B GLU A  1 145 ? 90.118  17.612  22.734  0.400 43.344  ? 6940 GLU A N     1 
ATOM   1170 C  CA    A GLU A  1 145 ? 91.263  18.578  22.705  0.600 41.887  ? 6940 GLU A CA    1 
ATOM   1171 C  CA    B GLU A  1 145 ? 91.320  18.486  22.661  0.400 40.731  ? 6940 GLU A CA    1 
ATOM   1172 C  C     A GLU A  1 145 ? 91.632  18.719  21.221  0.600 38.944  ? 6940 GLU A C     1 
ATOM   1173 C  C     B GLU A  1 145 ? 91.592  18.717  21.175  0.400 38.135  ? 6940 GLU A C     1 
ATOM   1174 O  O     A GLU A  1 145 ? 91.660  17.688  20.520  0.600 37.710  ? 6940 GLU A O     1 
ATOM   1175 O  O     B GLU A  1 145 ? 91.503  17.733  20.411  0.400 37.264  ? 6940 GLU A O     1 
ATOM   1176 C  CB    A GLU A  1 145 ? 92.339  18.058  23.654  0.600 43.948  ? 6940 GLU A CB    1 
ATOM   1177 C  CB    B GLU A  1 145 ? 92.558  17.846  23.292  0.400 41.205  ? 6940 GLU A CB    1 
ATOM   1178 C  CG    A GLU A  1 145 ? 91.836  18.054  25.087  0.600 45.864  ? 6940 GLU A CG    1 
ATOM   1179 C  CG    B GLU A  1 145 ? 93.815  18.679  23.083  0.400 40.334  ? 6940 GLU A CG    1 
ATOM   1180 C  CD    A GLU A  1 145 ? 92.557  17.134  26.046  0.600 47.755  ? 6940 GLU A CD    1 
ATOM   1181 C  CD    B GLU A  1 145 ? 95.137  17.983  23.363  0.400 41.889  ? 6940 GLU A CD    1 
ATOM   1182 O  OE1   A GLU A  1 145 ? 91.876  16.554  26.908  0.600 47.067  ? 6940 GLU A OE1   1 
ATOM   1183 O  OE1   B GLU A  1 145 ? 95.136  16.950  24.070  0.400 43.112  ? 6940 GLU A OE1   1 
ATOM   1184 O  OE2   A GLU A  1 145 ? 93.788  17.016  25.943  0.600 51.131  ? 6940 GLU A OE2   1 
ATOM   1185 O  OE2   B GLU A  1 145 ? 96.164  18.457  22.835  0.400 40.125  ? 6940 GLU A OE2   1 
ATOM   1186 N  N     . ASN A  1 146 ? 91.898  19.950  20.774  1.000 35.455  ? 6941 ASN A N     1 
ATOM   1187 C  CA    . ASN A  1 146 ? 92.093  20.224  19.329  1.000 32.914  ? 6941 ASN A CA    1 
ATOM   1188 C  C     . ASN A  1 146 ? 93.468  19.785  18.797  1.000 32.556  ? 6941 ASN A C     1 
ATOM   1189 O  O     . ASN A  1 146 ? 94.299  20.652  18.480  1.000 31.795  ? 6941 ASN A O     1 
ATOM   1190 C  CB    . ASN A  1 146 ? 91.775  21.684  19.022  1.000 30.792  ? 6941 ASN A CB    1 
ATOM   1191 C  CG    . ASN A  1 146 ? 91.521  21.879  17.549  1.000 28.817  ? 6941 ASN A CG    1 
ATOM   1192 O  OD1   . ASN A  1 146 ? 91.429  20.892  16.814  1.000 27.674  ? 6941 ASN A OD1   1 
ATOM   1193 N  ND2   . ASN A  1 146 ? 91.370  23.125  17.123  1.000 27.111  ? 6941 ASN A ND2   1 
ATOM   1194 N  N     A ASP A  1 147 ? 93.676  18.469  18.670  0.600 33.268  ? 6942 ASP A N     1 
ATOM   1195 N  N     B ASP A  1 147 ? 93.683  18.473  18.663  0.400 33.178  ? 6942 ASP A N     1 
ATOM   1196 C  CA    A ASP A  1 147 ? 94.946  17.927  18.113  0.600 34.186  ? 6942 ASP A CA    1 
ATOM   1197 C  CA    B ASP A  1 147 ? 94.976  17.987  18.113  0.400 33.810  ? 6942 ASP A CA    1 
ATOM   1198 C  C     A ASP A  1 147 ? 94.779  17.717  16.603  0.600 32.459  ? 6942 ASP A C     1 
ATOM   1199 C  C     B ASP A  1 147 ? 94.788  17.717  16.615  0.400 32.325  ? 6942 ASP A C     1 
ATOM   1200 O  O     A ASP A  1 147 ? 93.628  17.793  16.104  0.600 31.428  ? 6942 ASP A O     1 
ATOM   1201 O  O     B ASP A  1 147 ? 93.625  17.742  16.141  0.400 31.572  ? 6942 ASP A O     1 
ATOM   1202 C  CB    A ASP A  1 147 ? 95.351  16.609  18.784  0.600 37.090  ? 6942 ASP A CB    1 
ATOM   1203 C  CB    B ASP A  1 147 ? 95.495  16.760  18.867  0.400 36.342  ? 6942 ASP A CB    1 
ATOM   1204 C  CG    A ASP A  1 147 ? 95.917  16.746  20.189  0.600 39.891  ? 6942 ASP A CG    1 
ATOM   1205 C  CG    B ASP A  1 147 ? 94.589  15.546  18.780  0.400 37.545  ? 6942 ASP A CG    1 
ATOM   1206 O  OD1   A ASP A  1 147 ? 96.622  17.749  20.452  0.600 40.494  ? 6942 ASP A OD1   1 
ATOM   1207 O  OD1   B ASP A  1 147 ? 93.481  15.683  18.234  0.400 37.290  ? 6942 ASP A OD1   1 
ATOM   1208 O  OD2   A ASP A  1 147 ? 95.649  15.843  21.013  0.600 42.342  ? 6942 ASP A OD2   1 
ATOM   1209 O  OD2   B ASP A  1 147 ? 95.006  14.473  19.258  0.400 42.205  ? 6942 ASP A OD2   1 
ATOM   1210 N  N     . SER A  1 148 ? 95.898  17.503  15.904  1.000 31.856  ? 6943 SER A N     1 
ATOM   1211 C  CA    . SER A  1 148 ? 95.883  17.208  14.453  1.000 29.920  ? 6943 SER A CA    1 
ATOM   1212 C  C     . SER A  1 148 ? 95.022  15.951  14.240  1.000 30.888  ? 6943 SER A C     1 
ATOM   1213 O  O     . SER A  1 148 ? 95.181  14.996  15.035  1.000 30.352  ? 6943 SER A O     1 
ATOM   1214 C  CB    . SER A  1 148 ? 97.296  17.020  13.979  1.000 29.842  ? 6943 SER A CB    1 
ATOM   1215 O  OG    . SER A  1 148 ? 97.347  16.772  12.596  1.000 27.608  ? 6943 SER A OG    1 
ATOM   1216 N  N     . LYS A  1 149 ? 94.129  15.961  13.246  1.000 28.651  ? 6944 LYS A N     1 
ATOM   1217 C  CA    . LYS A  1 149 ? 93.211  14.820  12.980  1.000 30.189  ? 6944 LYS A CA    1 
ATOM   1218 C  C     . LYS A  1 149 ? 93.877  13.905  11.942  1.000 31.458  ? 6944 LYS A C     1 
ATOM   1219 O  O     . LYS A  1 149 ? 94.411  14.443  10.947  1.000 29.767  ? 6944 LYS A O     1 
ATOM   1220 C  CB    . LYS A  1 149 ? 91.832  15.353  12.572  1.000 29.096  ? 6944 LYS A CB    1 
ATOM   1221 C  CG    . LYS A  1 149 ? 91.178  16.302  13.582  1.000 28.354  ? 6944 LYS A CG    1 
ATOM   1222 C  CD    . LYS A  1 149 ? 91.018  15.702  14.976  1.000 30.076  ? 6944 LYS A CD    1 
ATOM   1223 C  CE    . LYS A  1 149 ? 90.193  16.560  15.919  1.000 29.941  ? 6944 LYS A CE    1 
ATOM   1224 N  NZ    . LYS A  1 149 ? 90.806  17.892  16.144  1.000 29.493  ? 6944 LYS A NZ    1 
ATOM   1225 N  N     . GLU A  1 150 ? 93.776  12.584  12.130  1.000 33.929  ? 6945 GLU A N     1 
ATOM   1226 C  CA    . GLU A  1 150 ? 94.505  11.609  11.270  1.000 38.978  ? 6945 GLU A CA    1 
ATOM   1227 C  C     . GLU A  1 150 ? 93.588  10.582  10.599  1.000 41.089  ? 6945 GLU A C     1 
ATOM   1228 O  O     . GLU A  1 150 ? 93.993  9.408   10.528  1.000 50.913  ? 6945 GLU A O     1 
ATOM   1229 C  CB    . GLU A  1 150 ? 95.523  10.841  12.116  1.000 42.817  ? 6945 GLU A CB    1 
ATOM   1230 C  CG    . GLU A  1 150 ? 96.535  11.740  12.799  1.000 47.359  ? 6945 GLU A CG    1 
ATOM   1231 C  CD    . GLU A  1 150 ? 97.484  11.020  13.740  1.000 55.147  ? 6945 GLU A CD    1 
ATOM   1232 O  OE1   . GLU A  1 150 ? 98.178  11.715  14.515  1.000 62.032  ? 6945 GLU A OE1   1 
ATOM   1233 O  OE2   . GLU A  1 150 ? 97.531  9.766   13.696  1.000 58.725  ? 6945 GLU A OE2   1 
ATOM   1234 N  N     . GLY A  1 151 ? 92.414  10.979  10.125  1.000 38.714  ? 6946 GLY A N     1 
ATOM   1235 C  CA    . GLY A  1 151 ? 91.567  10.019  9.385   1.000 35.326  ? 6946 GLY A CA    1 
ATOM   1236 C  C     . GLY A  1 151 ? 91.773  10.198  7.890   1.000 31.758  ? 6946 GLY A C     1 
ATOM   1237 O  O     . GLY A  1 151 ? 92.853  9.852   7.392   1.000 31.753  ? 6946 GLY A O     1 
ATOM   1238 N  N     . PHE A  1 152 ? 90.820  10.832  7.208   1.000 28.942  ? 6947 PHE A N     1 
ATOM   1239 C  CA    . PHE A  1 152 ? 90.970  11.052  5.748   1.000 27.262  ? 6947 PHE A CA    1 
ATOM   1240 C  C     . PHE A  1 152 ? 92.136  12.015  5.470   1.000 26.059  ? 6947 PHE A C     1 
ATOM   1241 O  O     . PHE A  1 152 ? 92.668  11.971  4.355   1.000 26.913  ? 6947 PHE A O     1 
ATOM   1242 C  CB    . PHE A  1 152 ? 89.664  11.563  5.140   1.000 26.730  ? 6947 PHE A CB    1 
ATOM   1243 C  CG    . PHE A  1 152 ? 89.163  12.856  5.732   1.000 25.781  ? 6947 PHE A CG    1 
ATOM   1244 C  CD1   . PHE A  1 152 ? 89.730  14.067  5.370   1.000 25.226  ? 6947 PHE A CD1   1 
ATOM   1245 C  CD2   . PHE A  1 152 ? 88.099  12.864  6.620   1.000 27.100  ? 6947 PHE A CD2   1 
ATOM   1246 C  CE1   . PHE A  1 152 ? 89.260  15.258  5.902   1.000 24.529  ? 6947 PHE A CE1   1 
ATOM   1247 C  CE2   . PHE A  1 152 ? 87.622  14.059  7.142   1.000 26.629  ? 6947 PHE A CE2   1 
ATOM   1248 C  CZ    . PHE A  1 152 ? 88.204  15.251  6.785   1.000 25.477  ? 6947 PHE A CZ    1 
ATOM   1249 N  N     . PHE A  1 153 ? 92.546  12.839  6.440   1.000 24.519  ? 6948 PHE A N     1 
ATOM   1250 C  CA    . PHE A  1 153 ? 93.680  13.763  6.154   1.000 24.961  ? 6948 PHE A CA    1 
ATOM   1251 C  C     . PHE A  1 153 ? 94.972  12.981  5.864   1.000 25.851  ? 6948 PHE A C     1 
ATOM   1252 O  O     . PHE A  1 153 ? 95.775  13.457  5.048   1.000 25.518  ? 6948 PHE A O     1 
ATOM   1253 C  CB    . PHE A  1 153 ? 93.896  14.791  7.266   1.000 24.094  ? 6948 PHE A CB    1 
ATOM   1254 C  CG    . PHE A  1 153 ? 92.878  15.902  7.305   1.000 23.389  ? 6948 PHE A CG    1 
ATOM   1255 C  CD1   . PHE A  1 153 ? 92.837  16.854  6.296   1.000 23.216  ? 6948 PHE A CD1   1 
ATOM   1256 C  CD2   . PHE A  1 153 ? 92.004  16.037  8.372   1.000 23.765  ? 6948 PHE A CD2   1 
ATOM   1257 C  CE1   . PHE A  1 153 ? 91.907  17.881  6.324   1.000 22.530  ? 6948 PHE A CE1   1 
ATOM   1258 C  CE2   . PHE A  1 153 ? 91.085  17.076  8.406   1.000 22.544  ? 6948 PHE A CE2   1 
ATOM   1259 C  CZ    . PHE A  1 153 ? 91.051  18.004  7.394   1.000 22.453  ? 6948 PHE A CZ    1 
ATOM   1260 N  N     A THR A  1 154 ? 95.202  11.842  6.532   0.600 27.439  ? 6949 THR A N     1 
ATOM   1261 N  N     B THR A  1 154 ? 95.165  11.837  6.529   0.400 27.265  ? 6949 THR A N     1 
ATOM   1262 C  CA    A THR A  1 154 ? 96.445  11.073  6.226   0.600 29.036  ? 6949 THR A CA    1 
ATOM   1263 C  CA    B THR A  1 154 ? 96.370  10.995  6.294   0.400 28.784  ? 6949 THR A CA    1 
ATOM   1264 C  C     A THR A  1 154 ? 96.392  10.621  4.757   0.600 28.941  ? 6949 THR A C     1 
ATOM   1265 C  C     B THR A  1 154 ? 96.393  10.545  4.823   0.400 28.880  ? 6949 THR A C     1 
ATOM   1266 O  O     A THR A  1 154 ? 97.455  10.740  4.044   0.600 29.875  ? 6949 THR A O     1 
ATOM   1267 O  O     B THR A  1 154 ? 97.518  10.535  4.188   0.400 29.842  ? 6949 THR A O     1 
ATOM   1268 C  CB    A THR A  1 154 ? 96.669  9.897   7.188   0.600 30.822  ? 6949 THR A CB    1 
ATOM   1269 C  CB    B THR A  1 154 ? 96.390  9.788   7.237   0.400 30.236  ? 6949 THR A CB    1 
ATOM   1270 O  OG1   A THR A  1 154 ? 95.659  8.904   7.001   0.600 31.283  ? 6949 THR A OG1   1 
ATOM   1271 O  OG1   B THR A  1 154 ? 96.227  10.292  8.563   0.400 30.775  ? 6949 THR A OG1   1 
ATOM   1272 C  CG2   A THR A  1 154 ? 96.691  10.339  8.634   0.600 31.662  ? 6949 THR A CG2   1 
ATOM   1273 C  CG2   B THR A  1 154 ? 97.659  8.973   7.120   0.400 31.478  ? 6949 THR A CG2   1 
ATOM   1274 N  N     . TYR A  1 155 ? 95.209  10.163  4.305   1.000 28.375  ? 6950 TYR A N     1 
ATOM   1275 C  CA    . TYR A  1 155 ? 95.079  9.731   2.892   1.000 29.067  ? 6950 TYR A CA    1 
ATOM   1276 C  C     . TYR A  1 155 ? 95.385  10.913  1.965   1.000 27.852  ? 6950 TYR A C     1 
ATOM   1277 O  O     . TYR A  1 155 ? 96.173  10.738  1.025   1.000 27.614  ? 6950 TYR A O     1 
ATOM   1278 C  CB    . TYR A  1 155 ? 93.681  9.184   2.603   1.000 29.928  ? 6950 TYR A CB    1 
ATOM   1279 C  CG    . TYR A  1 155 ? 93.484  8.818   1.159   1.000 30.805  ? 6950 TYR A CG    1 
ATOM   1280 C  CD1   . TYR A  1 155 ? 93.947  7.608   0.671   1.000 32.242  ? 6950 TYR A CD1   1 
ATOM   1281 C  CD2   . TYR A  1 155 ? 92.874  9.692   0.272   1.000 30.804  ? 6950 TYR A CD2   1 
ATOM   1282 C  CE1   . TYR A  1 155 ? 93.799  7.267   -0.662  1.000 33.465  ? 6950 TYR A CE1   1 
ATOM   1283 C  CE2   . TYR A  1 155 ? 92.713  9.361   -1.065  1.000 31.270  ? 6950 TYR A CE2   1 
ATOM   1284 C  CZ    . TYR A  1 155 ? 93.180  8.147   -1.532  1.000 32.831  ? 6950 TYR A CZ    1 
ATOM   1285 O  OH    . TYR A  1 155 ? 93.022  7.804   -2.841  1.000 35.310  ? 6950 TYR A OH    1 
ATOM   1286 N  N     . ILE A  1 156 ? 94.770  12.075  2.229   1.000 27.030  ? 6951 ILE A N     1 
ATOM   1287 C  CA    . ILE A  1 156 ? 94.974  13.295  1.388   1.000 26.628  ? 6951 ILE A CA    1 
ATOM   1288 C  C     . ILE A  1 156 ? 96.464  13.643  1.326   1.000 26.423  ? 6951 ILE A C     1 
ATOM   1289 O  O     . ILE A  1 156 ? 96.938  13.931  0.222   1.000 25.867  ? 6951 ILE A O     1 
ATOM   1290 C  CB    . ILE A  1 156 ? 94.132  14.478  1.907   1.000 27.243  ? 6951 ILE A CB    1 
ATOM   1291 C  CG1   . ILE A  1 156 ? 92.643  14.249  1.655   1.000 28.870  ? 6951 ILE A CG1   1 
ATOM   1292 C  CG2   . ILE A  1 156 ? 94.595  15.795  1.307   1.000 27.053  ? 6951 ILE A CG2   1 
ATOM   1293 C  CD1   . ILE A  1 156 ? 92.277  14.166  0.191   1.000 32.255  ? 6951 ILE A CD1   1 
ATOM   1294 N  N     . CYS A  1 157 ? 97.164  13.635  2.467   1.000 26.368  ? 6952 CYS A N     1 
ATOM   1295 C  CA    . CYS A  1 157 ? 98.616  13.964  2.451   1.000 27.217  ? 6952 CYS A CA    1 
ATOM   1296 C  C     . CYS A  1 157 ? 99.356  12.987  1.528   1.000 27.719  ? 6952 CYS A C     1 
ATOM   1297 O  O     . CYS A  1 157 ? 100.185 13.446  0.718   1.000 28.165  ? 6952 CYS A O     1 
ATOM   1298 C  CB    . CYS A  1 157 ? 99.200  13.941  3.858   1.000 28.483  ? 6952 CYS A CB    1 
ATOM   1299 S  SG    . CYS A  1 157 ? 98.629  15.331  4.868   1.000 30.149  ? 6952 CYS A SG    1 
ATOM   1300 N  N     . GLY A  1 158 ? 99.050  11.694  1.640   1.000 27.851  ? 6953 GLY A N     1 
ATOM   1301 C  CA    . GLY A  1 158 ? 99.701  10.681  0.785   1.000 29.368  ? 6953 GLY A CA    1 
ATOM   1302 C  C     . GLY A  1 158 ? 99.334  10.882  -0.679  1.000 28.792  ? 6953 GLY A C     1 
ATOM   1303 O  O     . GLY A  1 158 ? 100.232 10.757  -1.541  1.000 28.392  ? 6953 GLY A O     1 
ATOM   1304 N  N     . PHE A  1 159 ? 98.058  11.184  -0.946  1.000 27.412  ? 6954 PHE A N     1 
ATOM   1305 C  CA    . PHE A  1 159 ? 97.567  11.390  -2.334  1.000 27.816  ? 6954 PHE A CA    1 
ATOM   1306 C  C     . PHE A  1 159 ? 98.295  12.592  -2.961  1.000 28.294  ? 6954 PHE A C     1 
ATOM   1307 O  O     . PHE A  1 159 ? 98.700  12.516  -4.141  1.000 28.360  ? 6954 PHE A O     1 
ATOM   1308 C  CB    . PHE A  1 159 ? 96.046  11.550  -2.322  1.000 27.194  ? 6954 PHE A CB    1 
ATOM   1309 C  CG    . PHE A  1 159 ? 95.400  11.385  -3.671  1.000 27.190  ? 6954 PHE A CG    1 
ATOM   1310 C  CD1   . PHE A  1 159 ? 95.285  12.458  -4.535  1.000 26.726  ? 6954 PHE A CD1   1 
ATOM   1311 C  CD2   . PHE A  1 159 ? 94.933  10.146  -4.083  1.000 28.153  ? 6954 PHE A CD2   1 
ATOM   1312 C  CE1   . PHE A  1 159 ? 94.710  12.298  -5.786  1.000 26.766  ? 6954 PHE A CE1   1 
ATOM   1313 C  CE2   . PHE A  1 159 ? 94.359  9.987   -5.333  1.000 28.141  ? 6954 PHE A CE2   1 
ATOM   1314 C  CZ    . PHE A  1 159 ? 94.249  11.066  -6.181  1.000 27.356  ? 6954 PHE A CZ    1 
ATOM   1315 N  N     . ILE A  1 160 ? 98.468  13.673  -2.193  1.000 28.647  ? 6955 ILE A N     1 
ATOM   1316 C  CA    . ILE A  1 160 ? 99.198  14.875  -2.696  1.000 29.338  ? 6955 ILE A CA    1 
ATOM   1317 C  C     . ILE A  1 160 ? 100.644 14.496  -3.037  1.000 31.520  ? 6955 ILE A C     1 
ATOM   1318 O  O     . ILE A  1 160 ? 101.117 14.881  -4.118  1.000 32.871  ? 6955 ILE A O     1 
ATOM   1319 C  CB    . ILE A  1 160 ? 99.152  16.023  -1.665  1.000 28.715  ? 6955 ILE A CB    1 
ATOM   1320 C  CG1   . ILE A  1 160 ? 97.736  16.589  -1.518  1.000 27.949  ? 6955 ILE A CG1   1 
ATOM   1321 C  CG2   . ILE A  1 160 ? 100.150 17.112  -2.030  1.000 28.928  ? 6955 ILE A CG2   1 
ATOM   1322 C  CD1   . ILE A  1 160 ? 97.574  17.597  -0.388  1.000 27.341  ? 6955 ILE A CD1   1 
ATOM   1323 N  N     . GLN A  1 161 ? 101.311 13.757  -2.153  1.000 32.339  ? 6956 GLN A N     1 
ATOM   1324 C  CA    . GLN A  1 161 ? 102.741 13.425  -2.365  1.000 35.198  ? 6956 GLN A CA    1 
ATOM   1325 C  C     . GLN A  1 161 ? 102.946 12.339  -3.428  1.000 35.170  ? 6956 GLN A C     1 
ATOM   1326 O  O     . GLN A  1 161 ? 104.077 12.240  -3.906  1.000 36.005  ? 6956 GLN A O     1 
ATOM   1327 C  CB    . GLN A  1 161 ? 103.363 12.999  -1.036  1.000 38.317  ? 6956 GLN A CB    1 
ATOM   1328 C  CG    . GLN A  1 161 ? 103.533 14.158  -0.071  1.000 40.460  ? 6956 GLN A CG    1 
ATOM   1329 C  CD    . GLN A  1 161 ? 104.129 13.703  1.235   1.000 43.720  ? 6956 GLN A CD    1 
ATOM   1330 O  OE1   . GLN A  1 161 ? 103.509 12.963  1.995   1.000 47.217  ? 6956 GLN A OE1   1 
ATOM   1331 N  NE2   . GLN A  1 161 ? 105.324 14.189  1.520   1.000 46.042  ? 6956 GLN A NE2   1 
ATOM   1332 N  N     . GLN A  1 162 ? 101.905 11.603  -3.831  1.000 34.968  ? 6957 GLN A N     1 
ATOM   1333 C  CA    . GLN A  1 162 ? 102.126 10.495  -4.808  1.000 36.997  ? 6957 GLN A CA    1 
ATOM   1334 C  C     . GLN A  1 162 ? 101.321 10.676  -6.099  1.000 34.448  ? 6957 GLN A C     1 
ATOM   1335 O  O     . GLN A  1 162 ? 101.822 10.234  -7.149  1.000 34.516  ? 6957 GLN A O     1 
ATOM   1336 C  CB    . GLN A  1 162 ? 101.709 9.161   -4.180  1.000 40.785  ? 6957 GLN A CB    1 
ATOM   1337 C  CG    . GLN A  1 162 ? 102.428 8.844   -2.875  1.000 45.096  ? 6957 GLN A CG    1 
ATOM   1338 C  CD    . GLN A  1 162 ? 101.792 7.685   -2.146  1.000 50.313  ? 6957 GLN A CD    1 
ATOM   1339 O  OE1   . GLN A  1 162 ? 101.316 6.726   -2.753  1.000 57.520  ? 6957 GLN A OE1   1 
ATOM   1340 N  NE2   . GLN A  1 162 ? 101.782 7.765   -0.824  1.000 52.649  ? 6957 GLN A NE2   1 
ATOM   1341 N  N     . LYS A  1 163 ? 100.153 11.324  -6.040  1.000 31.529  ? 6958 LYS A N     1 
ATOM   1342 C  CA    . LYS A  1 163 ? 99.257  11.384  -7.227  1.000 31.520  ? 6958 LYS A CA    1 
ATOM   1343 C  C     . LYS A  1 163 ? 98.981  12.817  -7.706  1.000 30.439  ? 6958 LYS A C     1 
ATOM   1344 O  O     . LYS A  1 163 ? 98.037  12.981  -8.508  1.000 31.523  ? 6958 LYS A O     1 
ATOM   1345 C  CB    . LYS A  1 163 ? 97.939  10.681  -6.882  1.000 31.616  ? 6958 LYS A CB    1 
ATOM   1346 C  CG    . LYS A  1 163 ? 98.082  9.262   -6.348  1.000 33.559  ? 6958 LYS A CG    1 
ATOM   1347 C  CD    . LYS A  1 163 ? 98.783  8.294   -7.281  1.000 36.433  ? 6958 LYS A CD    1 
ATOM   1348 C  CE    . LYS A  1 163 ? 98.953  6.926   -6.653  1.000 39.141  ? 6958 LYS A CE    1 
ATOM   1349 N  NZ    . LYS A  1 163 ? 99.586  5.962   -7.582  1.000 42.571  ? 6958 LYS A NZ    1 
ATOM   1350 N  N     . LEU A  1 164 ? 99.723  13.820  -7.232  1.000 29.072  ? 6959 LEU A N     1 
ATOM   1351 C  CA    . LEU A  1 164 ? 99.493  15.201  -7.739  1.000 27.523  ? 6959 LEU A CA    1 
ATOM   1352 C  C     . LEU A  1 164 ? 100.622 15.552  -8.710  1.000 27.752  ? 6959 LEU A C     1 
ATOM   1353 O  O     . LEU A  1 164 ? 101.788 15.436  -8.324  1.000 27.778  ? 6959 LEU A O     1 
ATOM   1354 C  CB    . LEU A  1 164 ? 99.436  16.200  -6.582  1.000 26.994  ? 6959 LEU A CB    1 
ATOM   1355 C  CG    . LEU A  1 164 ? 99.169  17.655  -6.970  1.000 26.094  ? 6959 LEU A CG    1 
ATOM   1356 C  CD1   . LEU A  1 164 ? 97.826  17.808  -7.662  1.000 25.868  ? 6959 LEU A CD1   1 
ATOM   1357 C  CD2   . LEU A  1 164 ? 99.235  18.560  -5.751  1.000 25.891  ? 6959 LEU A CD2   1 
ATOM   1358 N  N     . ALA A  1 165 ? 100.269 15.943  -9.934  1.000 28.207  ? 6960 ALA A N     1 
ATOM   1359 C  CA    . ALA A  1 165 ? 101.279 16.349  -10.933 1.000 28.753  ? 6960 ALA A CA    1 
ATOM   1360 C  C     . ALA A  1 165 ? 102.031 17.581  -10.432 1.000 28.964  ? 6960 ALA A C     1 
ATOM   1361 O  O     . ALA A  1 165 ? 101.414 18.405  -9.716  1.000 27.249  ? 6960 ALA A O     1 
ATOM   1362 C  CB    . ALA A  1 165 ? 100.597 16.653  -12.241 1.000 29.408  ? 6960 ALA A CB    1 
ATOM   1363 N  N     . LEU A  1 166 ? 103.324 17.685  -10.754 1.000 30.444  ? 6961 LEU A N     1 
ATOM   1364 C  CA    . LEU A  1 166 ? 104.051 18.927  -10.403 1.000 30.528  ? 6961 LEU A CA    1 
ATOM   1365 C  C     . LEU A  1 166 ? 103.342 20.044  -11.170 1.000 29.730  ? 6961 LEU A C     1 
ATOM   1366 O  O     . LEU A  1 166 ? 102.944 19.793  -12.330 1.000 30.073  ? 6961 LEU A O     1 
ATOM   1367 C  CB    . LEU A  1 166 ? 105.526 18.822  -10.784 1.000 33.361  ? 6961 LEU A CB    1 
ATOM   1368 C  CG    . LEU A  1 166 ? 106.323 17.740  -10.057 1.000 35.234  ? 6961 LEU A CG    1 
ATOM   1369 C  CD1   . LEU A  1 166 ? 107.750 17.700  -10.569 1.000 38.205  ? 6961 LEU A CD1   1 
ATOM   1370 C  CD2   . LEU A  1 166 ? 106.306 17.962  -8.559  1.000 35.467  ? 6961 LEU A CD2   1 
ATOM   1371 N  N     . GLY A  1 167 ? 103.164 21.203  -10.536 1.000 28.067  ? 6962 GLY A N     1 
ATOM   1372 C  CA    . GLY A  1 167 ? 102.404 22.317  -11.133 1.000 27.993  ? 6962 GLY A CA    1 
ATOM   1373 C  C     . GLY A  1 167 ? 100.924 22.224  -10.789 1.000 26.242  ? 6962 GLY A C     1 
ATOM   1374 O  O     . GLY A  1 167 ? 100.213 23.209  -11.008 1.000 26.958  ? 6962 GLY A O     1 
ATOM   1375 N  N     . GLY A  1 168 ? 100.476 21.081  -10.256 1.000 25.972  ? 6963 GLY A N     1 
ATOM   1376 C  CA    . GLY A  1 168 ? 99.061  20.889  -9.878  1.000 24.737  ? 6963 GLY A CA    1 
ATOM   1377 C  C     . GLY A  1 168 ? 98.696  21.680  -8.630  1.000 24.057  ? 6963 GLY A C     1 
ATOM   1378 O  O     . GLY A  1 168 ? 99.616  22.158  -7.924  1.000 23.616  ? 6963 GLY A O     1 
ATOM   1379 N  N     . SER A  1 169 ? 97.398  21.799  -8.348  1.000 22.906  ? 6964 SER A N     1 
ATOM   1380 C  CA    . SER A  1 169 ? 96.931  22.597  -7.188  1.000 22.391  ? 6964 SER A CA    1 
ATOM   1381 C  C     . SER A  1 169 ? 95.900  21.816  -6.367  1.000 21.515  ? 6964 SER A C     1 
ATOM   1382 O  O     . SER A  1 169 ? 95.345  20.821  -6.876  1.000 22.500  ? 6964 SER A O     1 
ATOM   1383 C  CB    . SER A  1 169 ? 96.378  23.927  -7.650  1.000 22.342  ? 6964 SER A CB    1 
ATOM   1384 O  OG    . SER A  1 169 ? 97.407  24.761  -8.187  1.000 23.225  ? 6964 SER A OG    1 
ATOM   1385 N  N     . VAL A  1 170 ? 95.635  22.287  -5.150  1.000 21.075  ? 6965 VAL A N     1 
ATOM   1386 C  CA    . VAL A  1 170 ? 94.645  21.622  -4.263  1.000 20.425  ? 6965 VAL A CA    1 
ATOM   1387 C  C     . VAL A  1 170 ? 93.830  22.689  -3.527  1.000 20.174  ? 6965 VAL A C     1 
ATOM   1388 O  O     . VAL A  1 170 ? 94.314  23.834  -3.374  1.000 19.935  ? 6965 VAL A O     1 
ATOM   1389 C  CB    . VAL A  1 170 ? 95.333  20.681  -3.251  1.000 21.058  ? 6965 VAL A CB    1 
ATOM   1390 C  CG1   . VAL A  1 170 ? 96.275  19.698  -3.927  1.000 22.255  ? 6965 VAL A CG1   1 
ATOM   1391 C  CG2   . VAL A  1 170 ? 96.080  21.444  -2.162  1.000 21.355  ? 6965 VAL A CG2   1 
ATOM   1392 N  N     . ALA A  1 171 ? 92.612  22.313  -3.143  1.000 19.691  ? 6966 ALA A N     1 
ATOM   1393 C  CA    . ALA A  1 171 ? 91.720  23.105  -2.271  1.000 18.983  ? 6966 ALA A CA    1 
ATOM   1394 C  C     . ALA A  1 171 ? 91.127  22.085  -1.301  1.000 19.248  ? 6966 ALA A C     1 
ATOM   1395 O  O     . ALA A  1 171 ? 90.315  21.232  -1.755  1.000 19.167  ? 6966 ALA A O     1 
ATOM   1396 C  CB    . ALA A  1 171 ? 90.681  23.848  -3.060  1.000 19.204  ? 6966 ALA A CB    1 
ATOM   1397 N  N     . ILE A  1 172 ? 91.586  22.115  -0.046  1.000 18.558  ? 6967 ILE A N     1 
ATOM   1398 C  CA    . ILE A  1 172 ? 91.196  21.094  0.964   1.000 19.396  ? 6967 ILE A CA    1 
ATOM   1399 C  C     . ILE A  1 172 ? 90.446  21.783  2.097   1.000 19.315  ? 6967 ILE A C     1 
ATOM   1400 O  O     . ILE A  1 172 ? 91.039  22.645  2.765   1.000 19.226  ? 6967 ILE A O     1 
ATOM   1401 C  CB    . ILE A  1 172 ? 92.425  20.334  1.497   1.000 20.283  ? 6967 ILE A CB    1 
ATOM   1402 C  CG1   . ILE A  1 172 ? 93.328  19.799  0.381   1.000 21.284  ? 6967 ILE A CG1   1 
ATOM   1403 C  CG2   . ILE A  1 172 ? 91.991  19.235  2.457   1.000 20.904  ? 6967 ILE A CG2   1 
ATOM   1404 C  CD1   . ILE A  1 172 ? 92.649  18.844  -0.580  1.000 22.350  ? 6967 ILE A CD1   1 
ATOM   1405 N  N     . LYS A  1 173 ? 89.211  21.358  2.327   1.000 19.242  ? 6968 LYS A N     1 
ATOM   1406 C  CA    . LYS A  1 173 ? 88.399  21.994  3.385   1.000 20.240  ? 6968 LYS A CA    1 
ATOM   1407 C  C     . LYS A  1 173 ? 88.901  21.602  4.777   1.000 20.044  ? 6968 LYS A C     1 
ATOM   1408 O  O     . LYS A  1 173 ? 89.149  20.402  5.031   1.000 19.288  ? 6968 LYS A O     1 
ATOM   1409 C  CB    . LYS A  1 173 ? 86.926  21.623  3.210   1.000 21.678  ? 6968 LYS A CB    1 
ATOM   1410 C  CG    . LYS A  1 173 ? 85.979  22.487  4.026   1.000 22.410  ? 6968 LYS A CG    1 
ATOM   1411 C  CD    . LYS A  1 173 ? 85.643  21.955  5.377   1.000 23.274  ? 6968 LYS A CD    1 
ATOM   1412 C  CE    . LYS A  1 173 ? 84.497  20.979  5.332   1.000 24.881  ? 6968 LYS A CE    1 
ATOM   1413 N  NZ    . LYS A  1 173 ? 83.275  21.606  4.773   1.000 26.179  ? 6968 LYS A NZ    1 
ATOM   1414 N  N     . ILE A  1 174 ? 89.044  22.613  5.631   1.000 20.260  ? 6969 ILE A N     1 
ATOM   1415 C  CA    . ILE A  1 174 ? 89.429  22.444  7.057   1.000 20.660  ? 6969 ILE A CA    1 
ATOM   1416 C  C     . ILE A  1 174 ? 88.461  23.283  7.889   1.000 20.509  ? 6969 ILE A C     1 
ATOM   1417 O  O     . ILE A  1 174 ? 87.716  24.105  7.317   1.000 18.965  ? 6969 ILE A O     1 
ATOM   1418 C  CB    . ILE A  1 174 ? 90.881  22.879  7.349   1.000 21.274  ? 6969 ILE A CB    1 
ATOM   1419 C  CG1   . ILE A  1 174 ? 91.080  24.380  7.107   1.000 21.767  ? 6969 ILE A CG1   1 
ATOM   1420 C  CG2   . ILE A  1 174 ? 91.875  22.029  6.572   1.000 21.593  ? 6969 ILE A CG2   1 
ATOM   1421 C  CD1   . ILE A  1 174 ? 92.305  24.951  7.770   1.000 22.913  ? 6969 ILE A CD1   1 
ATOM   1422 N  N     . THR A  1 175 ? 88.451  23.035  9.190   1.000 20.070  ? 6970 THR A N     1 
ATOM   1423 C  CA    . THR A  1 175 ? 87.666  23.855  10.140  1.000 20.283  ? 6970 THR A CA    1 
ATOM   1424 C  C     . THR A  1 175 ? 88.534  24.003  11.383  1.000 19.941  ? 6970 THR A C     1 
ATOM   1425 O  O     . THR A  1 175 ? 89.686  23.508  11.375  1.000 19.799  ? 6970 THR A O     1 
ATOM   1426 C  CB    . THR A  1 175 ? 86.323  23.224  10.525  1.000 21.223  ? 6970 THR A CB    1 
ATOM   1427 O  OG1   . THR A  1 175 ? 86.612  22.035  11.266  1.000 21.671  ? 6970 THR A OG1   1 
ATOM   1428 C  CG2   . THR A  1 175 ? 85.433  22.928  9.340   1.000 21.635  ? 6970 THR A CG2   1 
ATOM   1429 N  N     . GLU A  1 176 ? 88.005  24.641  12.415  1.000 20.461  ? 6971 GLU A N     1 
ATOM   1430 C  CA    . GLU A  1 176 ? 88.778  24.742  13.674  1.000 20.095  ? 6971 GLU A CA    1 
ATOM   1431 C  C     . GLU A  1 176 ? 89.199  23.337  14.128  1.000 20.709  ? 6971 GLU A C     1 
ATOM   1432 O  O     . GLU A  1 176 ? 90.379  23.167  14.483  1.000 21.343  ? 6971 GLU A O     1 
ATOM   1433 C  CB    . GLU A  1 176 ? 87.927  25.357  14.780  1.000 21.181  ? 6971 GLU A CB    1 
ATOM   1434 C  CG    . GLU A  1 176 ? 88.600  25.303  16.141  1.000 21.814  ? 6971 GLU A CG    1 
ATOM   1435 C  CD    . GLU A  1 176 ? 87.779  25.868  17.285  1.000 22.968  ? 6971 GLU A CD    1 
ATOM   1436 O  OE1   . GLU A  1 176 ? 86.578  26.120  17.076  1.000 22.862  ? 6971 GLU A OE1   1 
ATOM   1437 O  OE2   . GLU A  1 176 ? 88.354  26.055  18.388  1.000 22.678  ? 6971 GLU A OE2   1 
ATOM   1438 N  N     . HIS A  1 177 ? 88.266  22.380  14.110  1.000 20.596  ? 6972 HIS A N     1 
ATOM   1439 C  CA    . HIS A  1 177 ? 88.527  21.017  14.658  1.000 22.173  ? 6972 HIS A CA    1 
ATOM   1440 C  C     . HIS A  1 177 ? 88.912  20.003  13.575  1.000 22.076  ? 6972 HIS A C     1 
ATOM   1441 O  O     . HIS A  1 177 ? 89.513  18.973  13.946  1.000 22.929  ? 6972 HIS A O     1 
ATOM   1442 C  CB    . HIS A  1 177 ? 87.315  20.529  15.468  1.000 23.850  ? 6972 HIS A CB    1 
ATOM   1443 C  CG    . HIS A  1 177 ? 87.072  21.328  16.708  1.000 24.555  ? 6972 HIS A CG    1 
ATOM   1444 N  ND1   . HIS A  1 177 ? 87.751  21.076  17.881  1.000 26.288  ? 6972 HIS A ND1   1 
ATOM   1445 C  CD2   . HIS A  1 177 ? 86.237  22.361  16.965  1.000 24.979  ? 6972 HIS A CD2   1 
ATOM   1446 C  CE1   . HIS A  1 177 ? 87.352  21.930  18.810  1.000 26.651  ? 6972 HIS A CE1   1 
ATOM   1447 N  NE2   . HIS A  1 177 ? 86.417  22.721  18.280  1.000 25.003  ? 6972 HIS A NE2   1 
ATOM   1448 N  N     . SER A  1 178 ? 88.545  20.249  12.317  1.000 21.129  ? 6973 SER A N     1 
ATOM   1449 C  CA    . SER A  1 178 ? 88.878  19.314  11.213  1.000 20.893  ? 6973 SER A CA    1 
ATOM   1450 C  C     . SER A  1 178 ? 90.100  19.856  10.465  1.000 20.487  ? 6973 SER A C     1 
ATOM   1451 O  O     . SER A  1 178 ? 89.931  20.639  9.521   1.000 20.168  ? 6973 SER A O     1 
ATOM   1452 C  CB    . SER A  1 178 ? 87.697  19.109  10.300  1.000 21.069  ? 6973 SER A CB    1 
ATOM   1453 O  OG    . SER A  1 178 ? 87.981  18.123  9.328   1.000 20.858  ? 6973 SER A OG    1 
ATOM   1454 N  N     . TRP A  1 179 ? 91.290  19.444  10.897  1.000 20.953  ? 6974 TRP A N     1 
ATOM   1455 C  CA    . TRP A  1 179 ? 92.561  19.942  10.316  1.000 21.023  ? 6974 TRP A CA    1 
ATOM   1456 C  C     . TRP A  1 179 ? 93.652  18.905  10.564  1.000 21.811  ? 6974 TRP A C     1 
ATOM   1457 O  O     . TRP A  1 179 ? 93.442  18.002  11.403  1.000 22.429  ? 6974 TRP A O     1 
ATOM   1458 C  CB    . TRP A  1 179 ? 92.938  21.290  10.944  1.000 20.876  ? 6974 TRP A CB    1 
ATOM   1459 C  CG    . TRP A  1 179 ? 93.351  21.179  12.380  1.000 21.387  ? 6974 TRP A CG    1 
ATOM   1460 C  CD1   . TRP A  1 179 ? 92.526  21.050  13.460  1.000 21.867  ? 6974 TRP A CD1   1 
ATOM   1461 C  CD2   . TRP A  1 179 ? 94.696  21.159  12.899  1.000 22.173  ? 6974 TRP A CD2   1 
ATOM   1462 N  NE1   . TRP A  1 179 ? 93.260  20.954  14.609  1.000 22.484  ? 6974 TRP A NE1   1 
ATOM   1463 C  CE2   . TRP A  1 179 ? 94.593  21.017  14.301  1.000 22.934  ? 6974 TRP A CE2   1 
ATOM   1464 C  CE3   . TRP A  1 179 ? 95.970  21.236  12.325  1.000 22.240  ? 6974 TRP A CE3   1 
ATOM   1465 C  CZ2   . TRP A  1 179 ? 95.712  20.957  15.132  1.000 23.764  ? 6974 TRP A CZ2   1 
ATOM   1466 C  CZ3   . TRP A  1 179 ? 97.076  21.195  13.149  1.000 23.398  ? 6974 TRP A CZ3   1 
ATOM   1467 C  CH2   . TRP A  1 179 ? 96.947  21.059  14.531  1.000 24.006  ? 6974 TRP A CH2   1 
ATOM   1468 N  N     . ASN A  1 180 ? 94.800  19.085  9.918   1.000 22.170  ? 6975 ASN A N     1 
ATOM   1469 C  CA    . ASN A  1 180 ? 95.911  18.117  10.051  1.000 23.596  ? 6975 ASN A CA    1 
ATOM   1470 C  C     . ASN A  1 180 ? 97.227  18.886  9.926   1.000 23.937  ? 6975 ASN A C     1 
ATOM   1471 O  O     . ASN A  1 180 ? 97.352  19.690  8.994   1.000 22.843  ? 6975 ASN A O     1 
ATOM   1472 C  CB    . ASN A  1 180 ? 95.718  16.962  9.063   1.000 24.299  ? 6975 ASN A CB    1 
ATOM   1473 C  CG    . ASN A  1 180 ? 96.903  16.025  9.009   1.000 26.284  ? 6975 ASN A CG    1 
ATOM   1474 O  OD1   . ASN A  1 180 ? 97.919  16.342  8.390   1.000 27.330  ? 6975 ASN A OD1   1 
ATOM   1475 N  ND2   . ASN A  1 180 ? 96.752  14.846  9.590   1.000 27.001  ? 6975 ASN A ND2   1 
ATOM   1476 N  N     . ALA A  1 181 ? 98.142  18.665  10.872  1.000 24.553  ? 6976 ALA A N     1 
ATOM   1477 C  CA    . ALA A  1 181 ? 99.447  19.368  10.887  1.000 25.521  ? 6976 ALA A CA    1 
ATOM   1478 C  C     . ALA A  1 181 ? 100.268 19.011  9.640   1.000 25.898  ? 6976 ALA A C     1 
ATOM   1479 O  O     . ALA A  1 181 ? 100.929 19.910  9.092   1.000 24.880  ? 6976 ALA A O     1 
ATOM   1480 C  CB    . ALA A  1 181 ? 100.187 19.017  12.157  1.000 26.396  ? 6976 ALA A CB    1 
ATOM   1481 N  N     . ASP A  1 182 ? 100.237 17.744  9.218   1.000 26.999  ? 6977 ASP A N     1 
ATOM   1482 C  CA    . ASP A  1 182 ? 101.012 17.305  8.025   1.000 28.273  ? 6977 ASP A CA    1 
ATOM   1483 C  C     . ASP A  1 182 ? 100.482 18.004  6.768   1.000 26.393  ? 6977 ASP A C     1 
ATOM   1484 O  O     . ASP A  1 182 ? 101.298 18.279  5.872   1.000 26.617  ? 6977 ASP A O     1 
ATOM   1485 C  CB    . ASP A  1 182 ? 100.998 15.784  7.865   1.000 30.378  ? 6977 ASP A CB    1 
ATOM   1486 C  CG    . ASP A  1 182 ? 101.830 15.064  8.907   1.000 33.929  ? 6977 ASP A CG    1 
ATOM   1487 O  OD1   . ASP A  1 182 ? 102.741 15.697  9.465   1.000 34.836  ? 6977 ASP A OD1   1 
ATOM   1488 O  OD2   . ASP A  1 182 ? 101.541 13.880  9.163   1.000 39.813  ? 6977 ASP A OD2   1 
ATOM   1489 N  N     . LEU A  1 183 ? 99.177  18.267  6.697   1.000 25.559  ? 6978 LEU A N     1 
ATOM   1490 C  CA    . LEU A  1 183 ? 98.619  18.979  5.514   1.000 24.191  ? 6978 LEU A CA    1 
ATOM   1491 C  C     . LEU A  1 183 ? 99.161  20.414  5.482   1.000 23.731  ? 6978 LEU A C     1 
ATOM   1492 O  O     . LEU A  1 183 ? 99.529  20.879  4.384   1.000 22.822  ? 6978 LEU A O     1 
ATOM   1493 C  CB    . LEU A  1 183 ? 97.094  18.953  5.561   1.000 23.699  ? 6978 LEU A CB    1 
ATOM   1494 C  CG    . LEU A  1 183 ? 96.403  19.680  4.409   1.000 23.508  ? 6978 LEU A CG    1 
ATOM   1495 C  CD1   . LEU A  1 183 ? 96.849  19.112  3.074   1.000 24.305  ? 6978 LEU A CD1   1 
ATOM   1496 C  CD2   . LEU A  1 183 ? 94.893  19.605  4.563   1.000 23.430  ? 6978 LEU A CD2   1 
ATOM   1497 N  N     . TYR A  1 184 ? 99.164  21.116  6.621   1.000 23.328  ? 6979 TYR A N     1 
ATOM   1498 C  CA    . TYR A  1 184 ? 99.776  22.471  6.625   1.000 23.187  ? 6979 TYR A CA    1 
ATOM   1499 C  C     . TYR A  1 184 ? 101.250 22.378  6.212   1.000 24.611  ? 6979 TYR A C     1 
ATOM   1500 O  O     . TYR A  1 184 ? 101.704 23.251  5.446   1.000 24.061  ? 6979 TYR A O     1 
ATOM   1501 C  CB    . TYR A  1 184 ? 99.670  23.141  7.992   1.000 23.418  ? 6979 TYR A CB    1 
ATOM   1502 C  CG    . TYR A  1 184 ? 98.363  23.829  8.287   1.000 22.530  ? 6979 TYR A CG    1 
ATOM   1503 C  CD1   . TYR A  1 184 ? 98.101  25.086  7.768   1.000 22.169  ? 6979 TYR A CD1   1 
ATOM   1504 C  CD2   . TYR A  1 184 ? 97.450  23.296  9.185   1.000 22.783  ? 6979 TYR A CD2   1 
ATOM   1505 C  CE1   . TYR A  1 184 ? 96.947  25.777  8.095   1.000 21.784  ? 6979 TYR A CE1   1 
ATOM   1506 C  CE2   . TYR A  1 184 ? 96.278  23.965  9.506   1.000 22.067  ? 6979 TYR A CE2   1 
ATOM   1507 C  CZ    . TYR A  1 184 ? 96.027  25.212  8.957   1.000 21.951  ? 6979 TYR A CZ    1 
ATOM   1508 O  OH    . TYR A  1 184 ? 94.899  25.911  9.277   1.000 23.146  ? 6979 TYR A OH    1 
ATOM   1509 N  N     . LYS A  1 185 ? 101.982 21.379  6.724   1.000 26.041  ? 6980 LYS A N     1 
ATOM   1510 C  CA    . LYS A  1 185 ? 103.411 21.212  6.337   1.000 28.915  ? 6980 LYS A CA    1 
ATOM   1511 C  C     . LYS A  1 185 ? 103.504 21.063  4.807   1.000 27.687  ? 6980 LYS A C     1 
ATOM   1512 O  O     . LYS A  1 185 ? 104.385 21.717  4.200   1.000 26.774  ? 6980 LYS A O     1 
ATOM   1513 C  CB    . LYS A  1 185 ? 104.040 20.022  7.073   1.000 32.548  ? 6980 LYS A CB    1 
ATOM   1514 C  CG    . LYS A  1 185 ? 105.524 19.809  6.802   1.000 37.054  ? 6980 LYS A CG    1 
ATOM   1515 C  CD    . LYS A  1 185 ? 106.170 18.681  7.598   1.000 41.400  ? 6980 LYS A CD    1 
ATOM   1516 C  CE    . LYS A  1 185 ? 106.188 18.918  9.094   1.000 44.895  ? 6980 LYS A CE    1 
ATOM   1517 N  NZ    . LYS A  1 185 ? 106.922 20.157  9.465   1.000 47.234  ? 6980 LYS A NZ    1 
ATOM   1518 N  N     . LEU A  1 186 ? 102.592 20.291  4.204   1.000 27.223  ? 6981 LEU A N     1 
ATOM   1519 C  CA    . LEU A  1 186 ? 102.608 20.071  2.729   1.000 27.842  ? 6981 LEU A CA    1 
ATOM   1520 C  C     . LEU A  1 186 ? 102.301 21.366  1.976   1.000 25.969  ? 6981 LEU A C     1 
ATOM   1521 O  O     . LEU A  1 186 ? 102.693 21.443  0.805   1.000 25.892  ? 6981 LEU A O     1 
ATOM   1522 C  CB    . LEU A  1 186 ? 101.627 18.964  2.330   1.000 29.685  ? 6981 LEU A CB    1 
ATOM   1523 C  CG    . LEU A  1 186 ? 102.122 17.538  2.564   1.000 33.896  ? 6981 LEU A CG    1 
ATOM   1524 C  CD1   . LEU A  1 186 ? 101.064 16.521  2.145   1.000 34.433  ? 6981 LEU A CD1   1 
ATOM   1525 C  CD2   . LEU A  1 186 ? 103.423 17.288  1.808   1.000 35.664  ? 6981 LEU A CD2   1 
ATOM   1526 N  N     . MET A  1 187 ? 101.621 22.333  2.601   1.000 24.586  ? 6982 MET A N     1 
ATOM   1527 C  CA    . MET A  1 187 ? 101.367 23.616  1.891   1.000 24.783  ? 6982 MET A CA    1 
ATOM   1528 C  C     . MET A  1 187 ? 102.720 24.251  1.536   1.000 25.144  ? 6982 MET A C     1 
ATOM   1529 O  O     . MET A  1 187 ? 102.783 25.023  0.558   1.000 25.503  ? 6982 MET A O     1 
ATOM   1530 C  CB    . MET A  1 187 ? 100.562 24.597  2.746   1.000 24.727  ? 6982 MET A CB    1 
ATOM   1531 C  CG    . MET A  1 187 ? 99.096  24.240  2.943   1.000 24.982  ? 6982 MET A CG    1 
ATOM   1532 S  SD    . MET A  1 187 ? 98.147  24.096  1.404   1.000 26.293  ? 6982 MET A SD    1 
ATOM   1533 C  CE    . MET A  1 187 ? 98.130  22.320  1.203   1.000 26.602  ? 6982 MET A CE    1 
ATOM   1534 N  N     . GLY A  1 188 ? 103.768 23.915  2.293   1.000 25.636  ? 6983 GLY A N     1 
ATOM   1535 C  CA    . GLY A  1 188 ? 105.116 24.453  2.027   1.000 27.138  ? 6983 GLY A CA    1 
ATOM   1536 C  C     . GLY A  1 188 ? 105.763 23.813  0.809   1.000 28.077  ? 6983 GLY A C     1 
ATOM   1537 O  O     . GLY A  1 188 ? 106.866 24.255  0.450   1.000 29.558  ? 6983 GLY A O     1 
ATOM   1538 N  N     . HIS A  1 189 ? 105.099 22.813  0.205   1.000 27.601  ? 6984 HIS A N     1 
ATOM   1539 C  CA    . HIS A  1 189 ? 105.593 22.075  -0.991  1.000 28.844  ? 6984 HIS A CA    1 
ATOM   1540 C  C     . HIS A  1 189 ? 104.972 22.663  -2.268  1.000 28.332  ? 6984 HIS A C     1 
ATOM   1541 O  O     . HIS A  1 189 ? 105.151 22.061  -3.359  1.000 28.097  ? 6984 HIS A O     1 
ATOM   1542 C  CB    . HIS A  1 189 ? 105.284 20.576  -0.853  1.000 29.934  ? 6984 HIS A CB    1 
ATOM   1543 C  CG    . HIS A  1 189 ? 106.044 19.884  0.228   1.000 31.398  ? 6984 HIS A CG    1 
ATOM   1544 N  ND1   . HIS A  1 189 ? 106.710 18.693  0.008   1.000 33.629  ? 6984 HIS A ND1   1 
ATOM   1545 C  CD2   . HIS A  1 189 ? 106.292 20.227  1.512   1.000 32.169  ? 6984 HIS A CD2   1 
ATOM   1546 C  CE1   . HIS A  1 189 ? 107.303 18.312  1.123   1.000 34.297  ? 6984 HIS A CE1   1 
ATOM   1547 N  NE2   . HIS A  1 189 ? 107.068 19.241  2.058   1.000 33.213  ? 6984 HIS A NE2   1 
ATOM   1548 N  N     . PHE A  1 190 ? 104.258 23.786  -2.128  1.000 26.375  ? 6985 PHE A N     1 
ATOM   1549 C  CA    . PHE A  1 190 ? 103.637 24.494  -3.275  1.000 25.934  ? 6985 PHE A CA    1 
ATOM   1550 C  C     . PHE A  1 190 ? 104.354 25.831  -3.453  1.000 26.730  ? 6985 PHE A C     1 
ATOM   1551 O  O     . PHE A  1 190 ? 104.993 26.294  -2.479  1.000 25.644  ? 6985 PHE A O     1 
ATOM   1552 C  CB    . PHE A  1 190 ? 102.137 24.694  -3.056  1.000 24.426  ? 6985 PHE A CB    1 
ATOM   1553 C  CG    . PHE A  1 190 ? 101.334 23.421  -3.058  1.000 24.134  ? 6985 PHE A CG    1 
ATOM   1554 C  CD1   . PHE A  1 190 ? 101.289 22.607  -1.936  1.000 23.894  ? 6985 PHE A CD1   1 
ATOM   1555 C  CD2   . PHE A  1 190 ? 100.610 23.039  -4.176  1.000 23.677  ? 6985 PHE A CD2   1 
ATOM   1556 C  CE1   . PHE A  1 190 ? 100.559 21.428  -1.946  1.000 23.928  ? 6985 PHE A CE1   1 
ATOM   1557 C  CE2   . PHE A  1 190 ? 99.870  21.866  -4.175  1.000 23.195  ? 6985 PHE A CE2   1 
ATOM   1558 C  CZ    . PHE A  1 190 ? 99.834  21.070  -3.058  1.000 22.993  ? 6985 PHE A CZ    1 
ATOM   1559 N  N     . ALA A  1 191 ? 104.284 26.405  -4.659  1.000 26.890  ? 6986 ALA A N     1 
ATOM   1560 C  CA    . ALA A  1 191 ? 104.921 27.719  -4.910  1.000 27.883  ? 6986 ALA A CA    1 
ATOM   1561 C  C     . ALA A  1 191 ? 104.269 28.763  -3.999  1.000 27.805  ? 6986 ALA A C     1 
ATOM   1562 O  O     . ALA A  1 191 ? 104.968 29.697  -3.548  1.000 27.885  ? 6986 ALA A O     1 
ATOM   1563 C  CB    . ALA A  1 191 ? 104.778 28.100  -6.362  1.000 28.735  ? 6986 ALA A CB    1 
ATOM   1564 N  N     . TRP A  1 192 ? 102.978 28.581  -3.721  1.000 26.979  ? 6987 TRP A N     1 
ATOM   1565 C  CA    . TRP A  1 192 ? 102.221 29.521  -2.858  1.000 27.140  ? 6987 TRP A CA    1 
ATOM   1566 C  C     . TRP A  1 192 ? 101.021 28.797  -2.256  1.000 25.120  ? 6987 TRP A C     1 
ATOM   1567 O  O     . TRP A  1 192 ? 100.594 27.766  -2.815  1.000 24.140  ? 6987 TRP A O     1 
ATOM   1568 C  CB    . TRP A  1 192 ? 101.790 30.745  -3.670  1.000 30.132  ? 6987 TRP A CB    1 
ATOM   1569 C  CG    . TRP A  1 192 ? 101.026 31.780  -2.899  1.000 32.616  ? 6987 TRP A CG    1 
ATOM   1570 C  CD1   . TRP A  1 192 ? 101.535 32.806  -2.151  1.000 35.364  ? 6987 TRP A CD1   1 
ATOM   1571 C  CD2   . TRP A  1 192 ? 99.596  31.923  -2.849  1.000 33.084  ? 6987 TRP A CD2   1 
ATOM   1572 N  NE1   . TRP A  1 192 ? 100.521 33.562  -1.622  1.000 35.354  ? 6987 TRP A NE1   1 
ATOM   1573 C  CE2   . TRP A  1 192 ? 99.321  33.051  -2.045  1.000 34.797  ? 6987 TRP A CE2   1 
ATOM   1574 C  CE3   . TRP A  1 192 ? 98.527  31.200  -3.390  1.000 32.690  ? 6987 TRP A CE3   1 
ATOM   1575 C  CZ2   . TRP A  1 192 ? 98.018  33.471  -1.781  1.000 34.943  ? 6987 TRP A CZ2   1 
ATOM   1576 C  CZ3   . TRP A  1 192 ? 97.242  31.617  -3.123  1.000 32.508  ? 6987 TRP A CZ3   1 
ATOM   1577 C  CH2   . TRP A  1 192 ? 96.995  32.744  -2.346  1.000 32.108  ? 6987 TRP A CH2   1 
ATOM   1578 N  N     . TRP A  1 193 ? 100.491 29.333  -1.164  1.000 23.112  ? 6988 TRP A N     1 
ATOM   1579 C  CA    . TRP A  1 193 ? 99.326  28.693  -0.515  1.000 22.279  ? 6988 TRP A CA    1 
ATOM   1580 C  C     . TRP A  1 193 ? 98.573  29.743  0.288   1.000 22.180  ? 6988 TRP A C     1 
ATOM   1581 O  O     . TRP A  1 193 ? 99.151  30.834  0.534   1.000 21.923  ? 6988 TRP A O     1 
ATOM   1582 C  CB    . TRP A  1 193 ? 99.772  27.543  0.395   1.000 21.875  ? 6988 TRP A CB    1 
ATOM   1583 C  CG    . TRP A  1 193 ? 100.378 27.980  1.696   1.000 22.273  ? 6988 TRP A CG    1 
ATOM   1584 C  CD1   . TRP A  1 193 ? 101.678 28.327  1.930   1.000 23.082  ? 6988 TRP A CD1   1 
ATOM   1585 C  CD2   . TRP A  1 193 ? 99.705  28.105  2.961   1.000 21.490  ? 6988 TRP A CD2   1 
ATOM   1586 N  NE1   . TRP A  1 193 ? 101.848 28.684  3.241   1.000 22.629  ? 6988 TRP A NE1   1 
ATOM   1587 C  CE2   . TRP A  1 193 ? 100.661 28.544  3.901   1.000 22.165  ? 6988 TRP A CE2   1 
ATOM   1588 C  CE3   . TRP A  1 193 ? 98.389  27.905  3.391   1.000 20.915  ? 6988 TRP A CE3   1 
ATOM   1589 C  CZ2   . TRP A  1 193 ? 100.343 28.777  5.239   1.000 21.902  ? 6988 TRP A CZ2   1 
ATOM   1590 C  CZ3   . TRP A  1 193 ? 98.080  28.117  4.714   1.000 20.629  ? 6988 TRP A CZ3   1 
ATOM   1591 C  CH2   . TRP A  1 193 ? 99.044  28.549  5.624   1.000 21.381  ? 6988 TRP A CH2   1 
ATOM   1592 N  N     . THR A  1 194 ? 97.339  29.417  0.669   1.000 20.833  ? 6989 THR A N     1 
ATOM   1593 C  CA    . THR A  1 194 ? 96.578  30.306  1.573   1.000 20.802  ? 6989 THR A CA    1 
ATOM   1594 C  C     . THR A  1 194 ? 95.438  29.521  2.205   1.000 20.003  ? 6989 THR A C     1 
ATOM   1595 O  O     . THR A  1 194 ? 95.239  28.336  1.842   1.000 20.284  ? 6989 THR A O     1 
ATOM   1596 C  CB    . THR A  1 194 ? 96.011  31.530  0.844   1.000 20.982  ? 6989 THR A CB    1 
ATOM   1597 O  OG1   . THR A  1 194 ? 95.591  32.471  1.835   1.000 21.954  ? 6989 THR A OG1   1 
ATOM   1598 C  CG2   . THR A  1 194 ? 94.864  31.183  -0.080  1.000 20.700  ? 6989 THR A CG2   1 
ATOM   1599 N  N     . ALA A  1 195 ? 94.769  30.164  3.157   1.000 19.688  ? 6990 ALA A N     1 
ATOM   1600 C  CA    . ALA A  1 195 ? 93.531  29.643  3.763   1.000 19.459  ? 6990 ALA A CA    1 
ATOM   1601 C  C     . ALA A  1 195 ? 92.449  30.598  3.264   1.000 19.444  ? 6990 ALA A C     1 
ATOM   1602 O  O     . ALA A  1 195 ? 92.592  31.820  3.504   1.000 19.672  ? 6990 ALA A O     1 
ATOM   1603 C  CB    . ALA A  1 195 ? 93.616  29.594  5.265   1.000 19.523  ? 6990 ALA A CB    1 
ATOM   1604 N  N     . PHE A  1 196 ? 91.485  30.079  2.507   1.000 18.678  ? 6991 PHE A N     1 
ATOM   1605 C  CA    . PHE A  1 196 ? 90.430  30.936  1.915   1.000 18.819  ? 6991 PHE A CA    1 
ATOM   1606 C  C     . PHE A  1 196 ? 89.080  30.673  2.581   1.000 18.408  ? 6991 PHE A C     1 
ATOM   1607 O  O     . PHE A  1 196 ? 88.659  29.509  2.688   1.000 18.517  ? 6991 PHE A O     1 
ATOM   1608 C  CB    . PHE A  1 196 ? 90.338  30.698  0.407   1.000 19.353  ? 6991 PHE A CB    1 
ATOM   1609 C  CG    . PHE A  1 196 ? 89.226  31.450  -0.274  1.000 19.609  ? 6991 PHE A CG    1 
ATOM   1610 C  CD1   . PHE A  1 196 ? 89.346  32.806  -0.534  1.000 20.646  ? 6991 PHE A CD1   1 
ATOM   1611 C  CD2   . PHE A  1 196 ? 88.062  30.805  -0.654  1.000 20.335  ? 6991 PHE A CD2   1 
ATOM   1612 C  CE1   . PHE A  1 196 ? 88.319  33.506  -1.149  1.000 20.802  ? 6991 PHE A CE1   1 
ATOM   1613 C  CE2   . PHE A  1 196 ? 87.034  31.503  -1.271  1.000 20.779  ? 6991 PHE A CE2   1 
ATOM   1614 C  CZ    . PHE A  1 196 ? 87.163  32.852  -1.509  1.000 21.054  ? 6991 PHE A CZ    1 
ATOM   1615 N  N     . VAL A  1 197 ? 88.421  31.761  2.964   1.000 18.763  ? 6992 VAL A N     1 
ATOM   1616 C  CA    . VAL A  1 197 ? 87.089  31.729  3.619   1.000 19.267  ? 6992 VAL A CA    1 
ATOM   1617 C  C     . VAL A  1 197 ? 86.058  32.274  2.630   1.000 19.365  ? 6992 VAL A C     1 
ATOM   1618 O  O     . VAL A  1 197 ? 86.224  33.435  2.195   1.000 19.120  ? 6992 VAL A O     1 
ATOM   1619 C  CB    . VAL A  1 197 ? 87.100  32.555  4.918   1.000 19.825  ? 6992 VAL A CB    1 
ATOM   1620 C  CG1   . VAL A  1 197 ? 85.707  32.692  5.503   1.000 20.545  ? 6992 VAL A CG1   1 
ATOM   1621 C  CG2   . VAL A  1 197 ? 88.065  31.967  5.943   1.000 20.038  ? 6992 VAL A CG2   1 
ATOM   1622 N  N     . THR A  1 198 ? 85.049  31.471  2.288   1.000 18.931  ? 6993 THR A N     1 
ATOM   1623 C  CA    . THR A  1 198 ? 83.983  31.975  1.390   1.000 19.688  ? 6993 THR A CA    1 
ATOM   1624 C  C     . THR A  1 198 ? 83.160  33.010  2.167   1.000 20.298  ? 6993 THR A C     1 
ATOM   1625 O  O     . THR A  1 198 ? 82.903  32.799  3.380   1.000 19.754  ? 6993 THR A O     1 
ATOM   1626 C  CB    . THR A  1 198 ? 83.090  30.853  0.852   1.000 20.344  ? 6993 THR A CB    1 
ATOM   1627 O  OG1   . THR A  1 198 ? 82.326  30.314  1.933   1.000 21.647  ? 6993 THR A OG1   1 
ATOM   1628 C  CG2   . THR A  1 198 ? 83.881  29.765  0.159   1.000 20.405  ? 6993 THR A CG2   1 
ATOM   1629 N  N     . ASN A  1 199 ? 82.755  34.081  1.493   1.000 20.755  ? 6994 ASN A N     1 
ATOM   1630 C  CA    . ASN A  1 199 ? 81.931  35.122  2.156   1.000 21.766  ? 6994 ASN A CA    1 
ATOM   1631 C  C     . ASN A  1 199 ? 80.554  34.569  2.560   1.000 21.988  ? 6994 ASN A C     1 
ATOM   1632 O  O     . ASN A  1 199 ? 79.999  35.061  3.555   1.000 22.470  ? 6994 ASN A O     1 
ATOM   1633 C  CB    . ASN A  1 199 ? 81.783  36.371  1.281   1.000 22.666  ? 6994 ASN A CB    1 
ATOM   1634 C  CG    . ASN A  1 199 ? 82.906  37.370  1.474   1.000 23.275  ? 6994 ASN A CG    1 
ATOM   1635 O  OD1   . ASN A  1 199 ? 83.603  37.335  2.485   1.000 22.235  ? 6994 ASN A OD1   1 
ATOM   1636 N  ND2   . ASN A  1 199 ? 83.031  38.312  0.553   1.000 24.260  ? 6994 ASN A ND2   1 
ATOM   1637 N  N     A VAL A  1 200 ? 80.005  33.592  1.826   0.500 21.927  ? 6995 VAL A N     1 
ATOM   1638 N  N     B VAL A  1 200 ? 80.051  33.569  1.832   0.500 21.878  ? 6995 VAL A N     1 
ATOM   1639 C  CA    A VAL A  1 200 ? 78.654  33.063  2.195   0.500 22.789  ? 6995 VAL A CA    1 
ATOM   1640 C  CA    B VAL A  1 200 ? 78.692  33.029  2.127   0.500 22.734  ? 6995 VAL A CA    1 
ATOM   1641 C  C     A VAL A  1 200 ? 78.732  32.238  3.485   0.500 22.334  ? 6995 VAL A C     1 
ATOM   1642 C  C     B VAL A  1 200 ? 78.725  32.164  3.398   0.500 22.346  ? 6995 VAL A C     1 
ATOM   1643 O  O     A VAL A  1 200 ? 77.694  32.113  4.143   0.500 22.921  ? 6995 VAL A O     1 
ATOM   1644 O  O     B VAL A  1 200 ? 77.644  31.928  3.955   0.500 22.886  ? 6995 VAL A O     1 
ATOM   1645 C  CB    A VAL A  1 200 ? 78.007  32.221  1.076   0.500 23.317  ? 6995 VAL A CB    1 
ATOM   1646 C  CB    B VAL A  1 200 ? 78.130  32.244  0.925   0.500 23.216  ? 6995 VAL A CB    1 
ATOM   1647 C  CG1   A VAL A  1 200 ? 77.638  33.066  -0.128  0.500 24.078  ? 6995 VAL A CG1   1 
ATOM   1648 C  CG1   B VAL A  1 200 ? 78.746  30.855  0.816   0.500 22.384  ? 6995 VAL A CG1   1 
ATOM   1649 C  CG2   A VAL A  1 200 ? 78.870  31.031  0.678   0.500 22.495  ? 6995 VAL A CG2   1 
ATOM   1650 C  CG2   B VAL A  1 200 ? 76.616  32.143  0.989   0.500 24.236  ? 6995 VAL A CG2   1 
ATOM   1651 N  N     . ASN A  1 201 ? 79.901  31.692  3.829   1.000 21.518  ? 6996 ASN A N     1 
ATOM   1652 C  CA    . ASN A  1 201 ? 79.990  30.836  5.045   1.000 22.103  ? 6996 ASN A CA    1 
ATOM   1653 C  C     . ASN A  1 201 ? 80.989  31.407  6.054   1.000 22.366  ? 6996 ASN A C     1 
ATOM   1654 O  O     . ASN A  1 201 ? 81.508  30.612  6.876   1.000 22.263  ? 6996 ASN A O     1 
ATOM   1655 C  CB    . ASN A  1 201 ? 80.382  29.407  4.662   1.000 21.951  ? 6996 ASN A CB    1 
ATOM   1656 C  CG    . ASN A  1 201 ? 79.960  28.387  5.700   1.000 22.753  ? 6996 ASN A CG    1 
ATOM   1657 O  OD1   . ASN A  1 201 ? 78.972  28.596  6.395   1.000 23.655  ? 6996 ASN A OD1   1 
ATOM   1658 N  ND2   . ASN A  1 201 ? 80.662  27.268  5.766   1.000 21.788  ? 6996 ASN A ND2   1 
ATOM   1659 N  N     . ALA A  1 202 ? 81.157  32.734  6.065   1.000 23.192  ? 6997 ALA A N     1 
ATOM   1660 C  CA    . ALA A  1 202 ? 82.159  33.416  6.920   1.000 23.491  ? 6997 ALA A CA    1 
ATOM   1661 C  C     . ALA A  1 202 ? 81.812  33.289  8.410   1.000 24.182  ? 6997 ALA A C     1 
ATOM   1662 O  O     . ALA A  1 202 ? 82.681  33.624  9.242   1.000 23.018  ? 6997 ALA A O     1 
ATOM   1663 C  CB    . ALA A  1 202 ? 82.282  34.860  6.498   1.000 24.756  ? 6997 ALA A CB    1 
ATOM   1664 N  N     . SER A  1 203 ? 80.616  32.793  8.734   1.000 23.650  ? 6998 SER A N     1 
ATOM   1665 C  CA    . SER A  1 203 ? 80.214  32.610  10.152  1.000 24.648  ? 6998 SER A CA    1 
ATOM   1666 C  C     . SER A  1 203 ? 80.744  31.269  10.671  1.000 23.735  ? 6998 SER A C     1 
ATOM   1667 O  O     . SER A  1 203 ? 80.526  30.964  11.861  1.000 24.637  ? 6998 SER A O     1 
ATOM   1668 C  CB    . SER A  1 203 ? 78.718  32.698  10.303  1.000 26.275  ? 6998 SER A CB    1 
ATOM   1669 O  OG    . SER A  1 203 ? 78.092  31.741  9.462   1.000 27.552  ? 6998 SER A OG    1 
ATOM   1670 N  N     . SER A  1 204 ? 81.393  30.493  9.802   1.000 22.736  ? 6999 SER A N     1 
ATOM   1671 C  CA    . SER A  1 204 ? 81.982  29.182  10.178  1.000 22.596  ? 6999 SER A CA    1 
ATOM   1672 C  C     . SER A  1 204 ? 83.511  29.285  10.220  1.000 21.519  ? 6999 SER A C     1 
ATOM   1673 O  O     . SER A  1 204 ? 84.068  30.106  9.471   1.000 20.225  ? 6999 SER A O     1 
ATOM   1674 C  CB    . SER A  1 204 ? 81.556  28.105  9.202   1.000 22.615  ? 6999 SER A CB    1 
ATOM   1675 O  OG    . SER A  1 204 ? 82.285  26.908  9.419   1.000 22.192  ? 6999 SER A OG    1 
ATOM   1676 N  N     . SER A  1 205 ? 84.147  28.447  11.046  1.000 21.161  ? 7000 SER A N     1 
ATOM   1677 C  CA    . SER A  1 205 ? 85.629  28.353  11.136  1.000 20.950  ? 7000 SER A CA    1 
ATOM   1678 C  C     . SER A  1 205 ? 86.164  27.635  9.884   1.000 20.359  ? 7000 SER A C     1 
ATOM   1679 O  O     . SER A  1 205 ? 87.386  27.453  9.745   1.000 20.086  ? 7000 SER A O     1 
ATOM   1680 C  CB    . SER A  1 205 ? 86.038  27.627  12.389  1.000 21.140  ? 7000 SER A CB    1 
ATOM   1681 O  OG    . SER A  1 205 ? 85.583  26.280  12.366  1.000 21.660  ? 7000 SER A OG    1 
ATOM   1682 N  N     . GLU A  1 206 ? 85.257  27.215  9.012   1.000 20.256  ? 7001 GLU A N     1 
ATOM   1683 C  CA    . GLU A  1 206 ? 85.659  26.549  7.756   1.000 20.275  ? 7001 GLU A CA    1 
ATOM   1684 C  C     . GLU A  1 206 ? 86.569  27.454  6.926   1.000 19.809  ? 7001 GLU A C     1 
ATOM   1685 O  O     . GLU A  1 206 ? 86.386  28.693  6.931   1.000 19.555  ? 7001 GLU A O     1 
ATOM   1686 C  CB    . GLU A  1 206 ? 84.424  26.207  6.922   1.000 20.980  ? 7001 GLU A CB    1 
ATOM   1687 C  CG    . GLU A  1 206 ? 84.737  25.809  5.489   1.000 22.196  ? 7001 GLU A CG    1 
ATOM   1688 C  CD    . GLU A  1 206 ? 83.489  25.550  4.673   1.000 23.009  ? 7001 GLU A CD    1 
ATOM   1689 O  OE1   . GLU A  1 206 ? 82.918  24.450  4.806   1.000 23.301  ? 7001 GLU A OE1   1 
ATOM   1690 O  OE2   . GLU A  1 206 ? 83.007  26.516  4.036   1.000 23.818  ? 7001 GLU A OE2   1 
ATOM   1691 N  N     . ALA A  1 207 ? 87.505  26.819  6.232   1.000 19.569  ? 7002 ALA A N     1 
ATOM   1692 C  CA    . ALA A  1 207 ? 88.352  27.490  5.228   1.000 19.856  ? 7002 ALA A CA    1 
ATOM   1693 C  C     . ALA A  1 207 ? 88.819  26.420  4.241   1.000 19.754  ? 7002 ALA A C     1 
ATOM   1694 O  O     . ALA A  1 207 ? 88.738  25.218  4.581   1.000 19.624  ? 7002 ALA A O     1 
ATOM   1695 C  CB    . ALA A  1 207 ? 89.533  28.178  5.862   1.000 19.931  ? 7002 ALA A CB    1 
ATOM   1696 N  N     . PHE A  1 208 ? 89.222  26.847  3.051   1.000 19.396  ? 7003 PHE A N     1 
ATOM   1697 C  CA    . PHE A  1 208 ? 89.860  25.915  2.096   1.000 19.941  ? 7003 PHE A CA    1 
ATOM   1698 C  C     . PHE A  1 208 ? 91.363  26.191  2.105   1.000 20.022  ? 7003 PHE A C     1 
ATOM   1699 O  O     . PHE A  1 208 ? 91.752  27.367  1.898   1.000 19.017  ? 7003 PHE A O     1 
ATOM   1700 C  CB    . PHE A  1 208 ? 89.242  26.051  0.704   1.000 20.926  ? 7003 PHE A CB    1 
ATOM   1701 C  CG    . PHE A  1 208 ? 87.848  25.493  0.629   1.000 21.619  ? 7003 PHE A CG    1 
ATOM   1702 C  CD1   . PHE A  1 208 ? 86.753  26.278  0.943   1.000 22.580  ? 7003 PHE A CD1   1 
ATOM   1703 C  CD2   . PHE A  1 208 ? 87.638  24.163  0.296   1.000 22.464  ? 7003 PHE A CD2   1 
ATOM   1704 C  CE1   . PHE A  1 208 ? 85.471  25.751  0.905   1.000 23.800  ? 7003 PHE A CE1   1 
ATOM   1705 C  CE2   . PHE A  1 208 ? 86.355  23.644  0.240   1.000 22.743  ? 7003 PHE A CE2   1 
ATOM   1706 C  CZ    . PHE A  1 208 ? 85.275  24.434  0.561   1.000 23.343  ? 7003 PHE A CZ    1 
ATOM   1707 N  N     . LEU A  1 209 ? 92.159  25.181  2.466   1.000 20.445  ? 7004 LEU A N     1 
ATOM   1708 C  CA    . LEU A  1 209 ? 93.635  25.304  2.358   1.000 21.690  ? 7004 LEU A CA    1 
ATOM   1709 C  C     . LEU A  1 209 ? 93.957  25.110  0.884   1.000 21.594  ? 7004 LEU A C     1 
ATOM   1710 O  O     . LEU A  1 209 ? 93.706  23.993  0.357   1.000 21.420  ? 7004 LEU A O     1 
ATOM   1711 C  CB    . LEU A  1 209 ? 94.372  24.259  3.198   1.000 22.996  ? 7004 LEU A CB    1 
ATOM   1712 C  CG    . LEU A  1 209 ? 94.361  24.485  4.702   1.000 25.761  ? 7004 LEU A CG    1 
ATOM   1713 C  CD1   . LEU A  1 209 ? 95.290  23.483  5.382   1.000 26.440  ? 7004 LEU A CD1   1 
ATOM   1714 C  CD2   . LEU A  1 209 ? 94.782  25.910  5.040   1.000 26.382  ? 7004 LEU A CD2   1 
ATOM   1715 N  N     . ILE A  1 210 ? 94.419  26.176  0.244   1.000 21.092  ? 7005 ILE A N     1 
ATOM   1716 C  CA    . ILE A  1 210 ? 94.726  26.137  -1.210  1.000 21.279  ? 7005 ILE A CA    1 
ATOM   1717 C  C     . ILE A  1 210 ? 96.238  26.114  -1.409  1.000 22.266  ? 7005 ILE A C     1 
ATOM   1718 O  O     . ILE A  1 210 ? 96.924  27.014  -0.873  1.000 21.993  ? 7005 ILE A O     1 
ATOM   1719 C  CB    . ILE A  1 210 ? 94.062  27.332  -1.908  1.000 21.400  ? 7005 ILE A CB    1 
ATOM   1720 C  CG1   . ILE A  1 210 ? 92.542  27.270  -1.739  1.000 20.933  ? 7005 ILE A CG1   1 
ATOM   1721 C  CG2   . ILE A  1 210 ? 94.478  27.418  -3.376  1.000 22.809  ? 7005 ILE A CG2   1 
ATOM   1722 C  CD1   . ILE A  1 210 ? 91.825  28.523  -2.181  1.000 21.601  ? 7005 ILE A CD1   1 
ATOM   1723 N  N     . GLY A  1 211 ? 96.716  25.040  -2.034  1.000 21.748  ? 7006 GLY A N     1 
ATOM   1724 C  CA    . GLY A  1 211 ? 98.116  24.891  -2.458  1.000 23.249  ? 7006 GLY A CA    1 
ATOM   1725 C  C     . GLY A  1 211 ? 98.170  25.159  -3.952  1.000 23.766  ? 7006 GLY A C     1 
ATOM   1726 O  O     . GLY A  1 211 ? 97.479  24.439  -4.704  1.000 22.784  ? 7006 GLY A O     1 
ATOM   1727 N  N     . CYS A  1 212 ? 98.919  26.173  -4.369  1.000 25.241  ? 7007 CYS A N     1 
ATOM   1728 C  CA    . CYS A  1 212 ? 98.941  26.548  -5.803  1.000 27.860  ? 7007 CYS A CA    1 
ATOM   1729 C  C     . CYS A  1 212 ? 100.300 26.201  -6.423  1.000 27.435  ? 7007 CYS A C     1 
ATOM   1730 O  O     . CYS A  1 212 ? 101.319 26.741  -5.955  1.000 28.240  ? 7007 CYS A O     1 
ATOM   1731 C  CB    . CYS A  1 212 ? 98.610  28.031  -5.948  1.000 31.120  ? 7007 CYS A CB    1 
ATOM   1732 S  SG    . CYS A  1 212 ? 98.234  28.522  -7.649  1.000 39.682  ? 7007 CYS A SG    1 
ATOM   1733 N  N     . ASN A  1 213 ? 100.298 25.278  -7.393  1.000 27.091  ? 7008 ASN A N     1 
ATOM   1734 C  CA    . ASN A  1 213 ? 101.503 24.875  -8.170  1.000 27.298  ? 7008 ASN A CA    1 
ATOM   1735 C  C     . ASN A  1 213 ? 102.434 24.019  -7.294  1.000 27.057  ? 7008 ASN A C     1 
ATOM   1736 O  O     . ASN A  1 213 ? 103.378 24.567  -6.690  1.000 27.075  ? 7008 ASN A O     1 
ATOM   1737 C  CB    . ASN A  1 213 ? 102.172 26.108  -8.775  1.000 27.638  ? 7008 ASN A CB    1 
ATOM   1738 C  CG    . ASN A  1 213 ? 101.209 26.946  -9.593  1.000 28.693  ? 7008 ASN A CG    1 
ATOM   1739 O  OD1   . ASN A  1 213 ? 101.097 28.147  -9.363  1.000 29.502  ? 7008 ASN A OD1   1 
ATOM   1740 N  ND2   . ASN A  1 213 ? 100.463 26.321  -10.502 1.000 27.389  ? 7008 ASN A ND2   1 
ATOM   1741 N  N     . TYR A  1 214 ? 102.202 22.707  -7.306  1.000 27.185  ? 7009 TYR A N     1 
ATOM   1742 C  CA    . TYR A  1 214 ? 102.959 21.717  -6.495  1.000 27.877  ? 7009 TYR A CA    1 
ATOM   1743 C  C     . TYR A  1 214 ? 104.398 21.611  -7.017  1.000 29.467  ? 7009 TYR A C     1 
ATOM   1744 O  O     . TYR A  1 214 ? 104.595 21.431  -8.240  1.000 29.875  ? 7009 TYR A O     1 
ATOM   1745 C  CB    . TYR A  1 214 ? 102.198 20.387  -6.494  1.000 27.879  ? 7009 TYR A CB    1 
ATOM   1746 C  CG    . TYR A  1 214 ? 102.865 19.276  -5.725  1.000 29.091  ? 7009 TYR A CG    1 
ATOM   1747 C  CD1   . TYR A  1 214 ? 103.125 19.403  -4.371  1.000 29.664  ? 7009 TYR A CD1   1 
ATOM   1748 C  CD2   . TYR A  1 214 ? 103.155 18.065  -6.331  1.000 30.044  ? 7009 TYR A CD2   1 
ATOM   1749 C  CE1   . TYR A  1 214 ? 103.735 18.386  -3.656  1.000 31.102  ? 7009 TYR A CE1   1 
ATOM   1750 C  CE2   . TYR A  1 214 ? 103.745 17.031  -5.624  1.000 31.715  ? 7009 TYR A CE2   1 
ATOM   1751 C  CZ    . TYR A  1 214 ? 104.033 17.191  -4.283  1.000 32.112  ? 7009 TYR A CZ    1 
ATOM   1752 O  OH    . TYR A  1 214 ? 104.620 16.173  -3.587  1.000 35.028  ? 7009 TYR A OH    1 
ATOM   1753 N  N     . LEU A  1 215 ? 105.372 21.702  -6.107  1.000 30.348  ? 7010 LEU A N     1 
ATOM   1754 C  CA    . LEU A  1 215 ? 106.812 21.658  -6.482  1.000 32.970  ? 7010 LEU A CA    1 
ATOM   1755 C  C     . LEU A  1 215 ? 107.418 20.291  -6.138  1.000 34.629  ? 7010 LEU A C     1 
ATOM   1756 O  O     . LEU A  1 215 ? 108.558 20.034  -6.578  1.000 35.826  ? 7010 LEU A O     1 
ATOM   1757 C  CB    . LEU A  1 215 ? 107.549 22.788  -5.762  1.000 34.094  ? 7010 LEU A CB    1 
ATOM   1758 C  CG    . LEU A  1 215 ? 107.034 24.196  -6.053  1.000 34.386  ? 7010 LEU A CG    1 
ATOM   1759 C  CD1   . LEU A  1 215 ? 107.808 25.228  -5.249  1.000 36.216  ? 7010 LEU A CD1   1 
ATOM   1760 C  CD2   . LEU A  1 215 ? 107.109 24.511  -7.538  1.000 35.788  ? 7010 LEU A CD2   1 
ATOM   1761 N  N     . GLY A  1 216 ? 106.695 19.447  -5.396  1.000 34.131  ? 7011 GLY A N     1 
ATOM   1762 C  CA    . GLY A  1 216 ? 107.198 18.097  -5.062  1.000 36.816  ? 7011 GLY A CA    1 
ATOM   1763 C  C     . GLY A  1 216 ? 108.303 18.115  -4.016  1.000 39.861  ? 7011 GLY A C     1 
ATOM   1764 O  O     . GLY A  1 216 ? 108.912 17.055  -3.789  1.000 41.840  ? 7011 GLY A O     1 
ATOM   1765 N  N     . LYS A  1 217 ? 108.569 19.280  -3.423  1.000 40.591  ? 7012 LYS A N     1 
ATOM   1766 C  CA    . LYS A  1 217 ? 109.607 19.411  -2.370  1.000 43.999  ? 7012 LYS A CA    1 
ATOM   1767 C  C     . LYS A  1 217 ? 109.285 20.662  -1.565  1.000 42.991  ? 7012 LYS A C     1 
ATOM   1768 O  O     . LYS A  1 217 ? 108.595 21.551  -2.055  1.000 41.042  ? 7012 LYS A O     1 
ATOM   1769 C  CB    . LYS A  1 217 ? 111.014 19.477  -2.974  1.000 47.001  ? 7012 LYS A CB    1 
ATOM   1770 C  CG    . LYS A  1 217 ? 111.336 20.731  -3.775  1.000 49.480  ? 7012 LYS A CG    1 
ATOM   1771 C  CD    . LYS A  1 217 ? 112.741 20.704  -4.346  1.000 54.750  ? 7012 LYS A CD    1 
ATOM   1772 C  CE    . LYS A  1 217 ? 113.116 21.969  -5.085  1.000 56.882  ? 7012 LYS A CE    1 
ATOM   1773 N  NZ    . LYS A  1 217 ? 114.517 21.914  -5.569  1.000 60.854  ? 7012 LYS A NZ    1 
ATOM   1774 N  N     . PRO A  1 218 ? 109.787 20.788  -0.321  1.000 44.925  ? 7013 PRO A N     1 
ATOM   1775 C  CA    . PRO A  1 218 ? 109.475 21.953  0.497   1.000 43.926  ? 7013 PRO A CA    1 
ATOM   1776 C  C     . PRO A  1 218 ? 110.244 23.231  0.130   1.000 46.033  ? 7013 PRO A C     1 
ATOM   1777 O  O     . PRO A  1 218 ? 111.459 23.189  0.086   1.000 48.345  ? 7013 PRO A O     1 
ATOM   1778 C  CB    . PRO A  1 218 ? 109.870 21.485  1.906   1.000 45.151  ? 7013 PRO A CB    1 
ATOM   1779 C  CG    . PRO A  1 218 ? 110.991 20.500  1.675   1.000 46.890  ? 7013 PRO A CG    1 
ATOM   1780 C  CD    . PRO A  1 218 ? 110.654 19.818  0.366   1.000 46.365  ? 7013 PRO A CD    1 
ATOM   1781 N  N     . ARG A  1 219 ? 109.517 24.302  -0.203  1.000 43.799  ? 7014 ARG A N     1 
ATOM   1782 C  CA    . ARG A  1 219 ? 110.174 25.617  -0.419  1.000 46.122  ? 7014 ARG A CA    1 
ATOM   1783 C  C     . ARG A  1 219 ? 110.242 26.299  0.950   1.000 45.845  ? 7014 ARG A C     1 
ATOM   1784 O  O     . ARG A  1 219 ? 111.038 27.238  1.104   1.000 46.658  ? 7014 ARG A O     1 
ATOM   1785 C  CB    . ARG A  1 219 ? 109.443 26.520  -1.419  1.000 46.676  ? 7014 ARG A CB    1 
ATOM   1786 C  CG    . ARG A  1 219 ? 107.961 26.723  -1.137  1.000 48.153  ? 7014 ARG A CG    1 
ATOM   1787 C  CD    . ARG A  1 219 ? 107.437 28.034  -1.694  1.000 48.361  ? 7014 ARG A CD    1 
ATOM   1788 N  NE    . ARG A  1 219 ? 107.854 29.131  -0.832  1.000 51.967  ? 7014 ARG A NE    1 
ATOM   1789 C  CZ    . ARG A  1 219 ? 107.200 29.510  0.264   1.000 52.051  ? 7014 ARG A CZ    1 
ATOM   1790 N  NH1   . ARG A  1 219 ? 106.097 28.878  0.630   1.000 53.630  ? 7014 ARG A NH1   1 
ATOM   1791 N  NH2   . ARG A  1 219 ? 107.651 30.512  0.997   1.000 53.444  ? 7014 ARG A NH2   1 
ATOM   1792 N  N     . GLU A  1 220 ? 109.412 25.834  1.896   1.000 43.834  ? 7015 GLU A N     1 
ATOM   1793 C  CA    . GLU A  1 220 ? 109.385 26.398  3.272   1.000 43.357  ? 7015 GLU A CA    1 
ATOM   1794 C  C     . GLU A  1 220 ? 109.011 25.298  4.275   1.000 40.837  ? 7015 GLU A C     1 
ATOM   1795 O  O     . GLU A  1 220 ? 108.078 24.512  3.991   1.000 37.864  ? 7015 GLU A O     1 
ATOM   1796 C  CB    . GLU A  1 220 ? 108.386 27.557  3.349   1.000 45.251  ? 7015 GLU A CB    1 
ATOM   1797 C  CG    . GLU A  1 220 ? 108.224 28.150  4.741   1.000 48.196  ? 7015 GLU A CG    1 
ATOM   1798 C  CD    . GLU A  1 220 ? 109.439 28.855  5.328   1.000 53.452  ? 7015 GLU A CD    1 
ATOM   1799 O  OE1   . GLU A  1 220 ? 110.435 29.033  4.604   1.000 57.009  ? 7015 GLU A OE1   1 
ATOM   1800 O  OE2   . GLU A  1 220 ? 109.376 29.237  6.518   1.000 59.878  ? 7015 GLU A OE2   1 
ATOM   1801 N  N     . GLN A  1 221 ? 109.727 25.253  5.400   1.000 39.787  ? 7016 GLN A N     1 
ATOM   1802 C  CA    . GLN A  1 221 ? 109.438 24.284  6.487   1.000 40.397  ? 7016 GLN A CA    1 
ATOM   1803 C  C     . GLN A  1 221 ? 108.319 24.898  7.330   1.000 37.115  ? 7016 GLN A C     1 
ATOM   1804 O  O     . GLN A  1 221 ? 108.534 25.973  7.920   1.000 37.732  ? 7016 GLN A O     1 
ATOM   1805 C  CB    . GLN A  1 221 ? 110.693 23.991  7.316   1.000 44.626  ? 7016 GLN A CB    1 
ATOM   1806 C  CG    . GLN A  1 221 ? 111.858 23.459  6.488   1.000 50.635  ? 7016 GLN A CG    1 
ATOM   1807 C  CD    . GLN A  1 221 ? 111.579 22.119  5.846   1.000 55.257  ? 7016 GLN A CD    1 
ATOM   1808 O  OE1   . GLN A  1 221 ? 110.883 21.272  6.405   1.000 62.792  ? 7016 GLN A OE1   1 
ATOM   1809 N  NE2   . GLN A  1 221 ? 112.157 21.898  4.675   1.000 56.378  ? 7016 GLN A NE2   1 
ATOM   1810 N  N     . ILE A  1 222 ? 107.150 24.267  7.321   1.000 34.005  ? 7017 ILE A N     1 
ATOM   1811 C  CA    . ILE A  1 222 ? 105.986 24.788  8.087   1.000 31.613  ? 7017 ILE A CA    1 
ATOM   1812 C  C     . ILE A  1 222 ? 105.663 23.845  9.245   1.000 32.097  ? 7017 ILE A C     1 
ATOM   1813 O  O     . ILE A  1 222 ? 105.565 22.623  9.011   1.000 32.360  ? 7017 ILE A O     1 
ATOM   1814 C  CB    . ILE A  1 222 ? 104.769 24.959  7.157   1.000 30.292  ? 7017 ILE A CB    1 
ATOM   1815 C  CG1   . ILE A  1 222 ? 104.998 26.072  6.133   1.000 29.560  ? 7017 ILE A CG1   1 
ATOM   1816 C  CG2   . ILE A  1 222 ? 103.497 25.183  7.964   1.000 28.971  ? 7017 ILE A CG2   1 
ATOM   1817 C  CD1   . ILE A  1 222 ? 103.893 26.207  5.118   1.000 28.613  ? 7017 ILE A CD1   1 
ATOM   1818 N  N     . ASP A  1 223 ? 105.516 24.416  10.440  1.000 32.394  ? 7018 ASP A N     1 
ATOM   1819 C  CA    . ASP A  1 223 ? 105.055 23.675  11.640  1.000 32.274  ? 7018 ASP A CA    1 
ATOM   1820 C  C     . ASP A  1 223 ? 103.529 23.785  11.601  1.000 29.851  ? 7018 ASP A C     1 
ATOM   1821 O  O     . ASP A  1 223 ? 103.017 24.904  11.801  1.000 27.624  ? 7018 ASP A O     1 
ATOM   1822 C  CB    . ASP A  1 223 ? 105.681 24.245  12.915  1.000 34.623  ? 7018 ASP A CB    1 
ATOM   1823 C  CG    . ASP A  1 223 ? 105.191 23.591  14.198  1.000 36.297  ? 7018 ASP A CG    1 
ATOM   1824 O  OD1   . ASP A  1 223 ? 104.031 23.135  14.231  1.000 35.397  ? 7018 ASP A OD1   1 
ATOM   1825 O  OD2   . ASP A  1 223 ? 105.987 23.521  15.148  1.000 41.390  ? 7018 ASP A OD2   1 
ATOM   1826 N  N     . GLY A  1 224 ? 102.854 22.677  11.282  1.000 28.982  ? 7019 GLY A N     1 
ATOM   1827 C  CA    . GLY A  1 224 ? 101.387 22.622  11.141  1.000 27.927  ? 7019 GLY A CA    1 
ATOM   1828 C  C     . GLY A  1 224 ? 100.628 23.044  12.385  1.000 27.608  ? 7019 GLY A C     1 
ATOM   1829 O  O     . GLY A  1 224 ? 99.582  23.693  12.235  1.000 26.514  ? 7019 GLY A O     1 
ATOM   1830 N  N     A TYR A  1 225 ? 101.088 22.642  13.577  0.500 28.603  ? 7020 TYR A N     1 
ATOM   1831 N  N     B TYR A  1 225 ? 101.126 22.664  13.567  0.500 28.083  ? 7020 TYR A N     1 
ATOM   1832 C  CA    A TYR A  1 225 ? 100.392 23.050  14.829  0.500 29.108  ? 7020 TYR A CA    1 
ATOM   1833 C  CA    B TYR A  1 225 ? 100.470 23.005  14.858  0.500 28.350  ? 7020 TYR A CA    1 
ATOM   1834 C  C     A TYR A  1 225 ? 100.433 24.575  14.959  0.500 28.314  ? 7020 TYR A C     1 
ATOM   1835 C  C     B TYR A  1 225 ? 100.479 24.530  15.042  0.500 27.897  ? 7020 TYR A C     1 
ATOM   1836 O  O     A TYR A  1 225 ? 99.380  25.185  15.249  0.500 28.248  ? 7020 TYR A O     1 
ATOM   1837 O  O     B TYR A  1 225 ? 99.452  25.098  15.469  0.500 28.042  ? 7020 TYR A O     1 
ATOM   1838 C  CB    A TYR A  1 225 ? 100.981 22.354  16.060  0.500 31.546  ? 7020 TYR A CB    1 
ATOM   1839 C  CB    B TYR A  1 225 ? 101.144 22.240  16.001  0.500 30.122  ? 7020 TYR A CB    1 
ATOM   1840 C  CG    A TYR A  1 225 ? 100.377 21.008  16.371  0.500 32.917  ? 7020 TYR A CG    1 
ATOM   1841 C  CG    B TYR A  1 225 ? 101.029 20.737  15.892  0.500 30.650  ? 7020 TYR A CG    1 
ATOM   1842 C  CD1   A TYR A  1 225 ? 100.792 19.854  15.723  0.500 33.329  ? 7020 TYR A CD1   1 
ATOM   1843 C  CD1   B TYR A  1 225 ? 99.933  20.071  16.414  0.500 30.855  ? 7020 TYR A CD1   1 
ATOM   1844 C  CD2   A TYR A  1 225 ? 99.386  20.889  17.332  0.500 33.504  ? 7020 TYR A CD2   1 
ATOM   1845 C  CD2   B TYR A  1 225 ? 102.006 19.979  15.267  0.500 31.254  ? 7020 TYR A CD2   1 
ATOM   1846 C  CE1   A TYR A  1 225 ? 100.232 18.620  16.018  0.500 34.410  ? 7020 TYR A CE1   1 
ATOM   1847 C  CE1   B TYR A  1 225 ? 99.808  18.695  16.322  0.500 31.460  ? 7020 TYR A CE1   1 
ATOM   1848 C  CE2   A TYR A  1 225 ? 98.820  19.663  17.642  0.500 34.410  ? 7020 TYR A CE2   1 
ATOM   1849 C  CE2   B TYR A  1 225 ? 101.898 18.599  15.169  0.500 32.090  ? 7020 TYR A CE2   1 
ATOM   1850 C  CZ    A TYR A  1 225 ? 99.239  18.525  16.979  0.500 34.665  ? 7020 TYR A CZ    1 
ATOM   1851 C  CZ    B TYR A  1 225 ? 100.795 17.954  15.700  0.500 31.822  ? 7020 TYR A CZ    1 
ATOM   1852 O  OH    A TYR A  1 225 ? 98.672  17.319  17.286  0.500 36.433  ? 7020 TYR A OH    1 
ATOM   1853 O  OH    B TYR A  1 225 ? 100.664 16.599  15.604  0.500 33.120  ? 7020 TYR A OH    1 
ATOM   1854 N  N     . VAL A  1 226 ? 101.603 25.175  14.723  1.000 27.935  ? 7021 VAL A N     1 
ATOM   1855 C  CA    . VAL A  1 226 ? 101.713 26.659  14.809  1.000 27.325  ? 7021 VAL A CA    1 
ATOM   1856 C  C     . VAL A  1 226 ? 100.859 27.290  13.694  1.000 25.759  ? 7021 VAL A C     1 
ATOM   1857 O  O     . VAL A  1 226 ? 100.121 28.254  13.977  1.000 25.264  ? 7021 VAL A O     1 
ATOM   1858 C  CB    . VAL A  1 226 ? 103.184 27.102  14.712  1.000 29.338  ? 7021 VAL A CB    1 
ATOM   1859 C  CG1   . VAL A  1 226 ? 103.310 28.610  14.571  1.000 30.227  ? 7021 VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A  1 226 ? 104.004 26.589  15.893  1.000 31.302  ? 7021 VAL A CG2   1 
ATOM   1861 N  N     . MET A  1 227 ? 100.914 26.747  12.479  1.000 23.932  ? 7022 MET A N     1 
ATOM   1862 C  CA    . MET A  1 227 ? 100.180 27.396  11.360  1.000 22.821  ? 7022 MET A CA    1 
ATOM   1863 C  C     . MET A  1 227 ? 98.663  27.353  11.599  1.000 21.533  ? 7022 MET A C     1 
ATOM   1864 O  O     . MET A  1 227 ? 98.005  28.346  11.271  1.000 21.279  ? 7022 MET A O     1 
ATOM   1865 C  CB    . MET A  1 227 ? 100.533 26.769  10.013  1.000 22.938  ? 7022 MET A CB    1 
ATOM   1866 C  CG    . MET A  1 227 ? 100.118 27.639  8.831   1.000 22.579  ? 7022 MET A CG    1 
ATOM   1867 S  SD    . MET A  1 227 ? 100.895 29.285  8.865   1.000 23.875  ? 7022 MET A SD    1 
ATOM   1868 C  CE    . MET A  1 227 ? 102.620 28.864  8.620   1.000 25.269  ? 7022 MET A CE    1 
ATOM   1869 N  N     . HIS A  1 228 ? 98.131  26.280  12.192  1.000 21.650  ? 7023 HIS A N     1 
ATOM   1870 C  CA    . HIS A  1 228 ? 96.667  26.258  12.469  1.000 20.627  ? 7023 HIS A CA    1 
ATOM   1871 C  C     . HIS A  1 228 ? 96.354  27.311  13.541  1.000 21.208  ? 7023 HIS A C     1 
ATOM   1872 O  O     . HIS A  1 228 ? 95.294  27.977  13.442  1.000 20.461  ? 7023 HIS A O     1 
ATOM   1873 C  CB    . HIS A  1 228 ? 96.196  24.853  12.862  1.000 20.613  ? 7023 HIS A CB    1 
ATOM   1874 C  CG    . HIS A  1 228 ? 94.712  24.714  12.861  1.000 19.992  ? 7023 HIS A CG    1 
ATOM   1875 N  ND1   . HIS A  1 228 ? 93.956  24.945  11.721  1.000 19.373  ? 7023 HIS A ND1   1 
ATOM   1876 C  CD2   . HIS A  1 228 ? 93.844  24.317  13.823  1.000 20.408  ? 7023 HIS A CD2   1 
ATOM   1877 C  CE1   . HIS A  1 228 ? 92.684  24.736  11.995  1.000 19.010  ? 7023 HIS A CE1   1 
ATOM   1878 N  NE2   . HIS A  1 228 ? 92.588  24.328  13.274  1.000 19.426  ? 7023 HIS A NE2   1 
ATOM   1879 N  N     . ALA A  1 229 ? 97.253  27.480  14.514  1.000 21.562  ? 7024 ALA A N     1 
ATOM   1880 C  CA    . ALA A  1 229 ? 97.036  28.509  15.557  1.000 22.065  ? 7024 ALA A CA    1 
ATOM   1881 C  C     . ALA A  1 229 ? 97.035  29.894  14.897  1.000 21.628  ? 7024 ALA A C     1 
ATOM   1882 O  O     . ALA A  1 229 ? 96.256  30.762  15.336  1.000 21.157  ? 7024 ALA A O     1 
ATOM   1883 C  CB    . ALA A  1 229 ? 98.089  28.407  16.640  1.000 23.420  ? 7024 ALA A CB    1 
ATOM   1884 N  N     . ASN A  1 230 ? 97.892  30.085  13.888  1.000 21.272  ? 7025 ASN A N     1 
ATOM   1885 C  CA    . ASN A  1 230 ? 97.994  31.376  13.156  1.000 21.179  ? 7025 ASN A CA    1 
ATOM   1886 C  C     . ASN A  1 230 ? 96.679  31.609  12.399  1.000 20.594  ? 7025 ASN A C     1 
ATOM   1887 O  O     . ASN A  1 230 ? 96.189  32.756  12.391  1.000 20.539  ? 7025 ASN A O     1 
ATOM   1888 C  CB    . ASN A  1 230 ? 99.181  31.387  12.188  1.000 22.057  ? 7025 ASN A CB    1 
ATOM   1889 C  CG    . ASN A  1 230 ? 100.538 31.388  12.861  1.000 23.029  ? 7025 ASN A CG    1 
ATOM   1890 O  OD1   . ASN A  1 230 ? 100.663 31.720  14.040  1.000 24.317  ? 7025 ASN A OD1   1 
ATOM   1891 N  ND2   . ASN A  1 230 ? 101.578 31.075  12.100  1.000 22.460  ? 7025 ASN A ND2   1 
ATOM   1892 N  N     . TYR A  1 231 ? 96.135  30.541  11.807  1.000 20.239  ? 7026 TYR A N     1 
ATOM   1893 C  CA    . TYR A  1 231 ? 94.853  30.596  11.062  1.000 20.183  ? 7026 TYR A CA    1 
ATOM   1894 C  C     . TYR A  1 231 ? 93.726  31.018  12.012  1.000 20.472  ? 7026 TYR A C     1 
ATOM   1895 O  O     . TYR A  1 231 ? 92.948  31.931  11.678  1.000 20.402  ? 7026 TYR A O     1 
ATOM   1896 C  CB    . TYR A  1 231 ? 94.553  29.254  10.377  1.000 20.038  ? 7026 TYR A CB    1 
ATOM   1897 C  CG    . TYR A  1 231 ? 93.120  29.156  9.932   1.000 19.748  ? 7026 TYR A CG    1 
ATOM   1898 C  CD1   . TYR A  1 231 ? 92.666  29.910  8.866   1.000 19.781  ? 7026 TYR A CD1   1 
ATOM   1899 C  CD2   . TYR A  1 231 ? 92.202  28.377  10.620  1.000 19.842  ? 7026 TYR A CD2   1 
ATOM   1900 C  CE1   . TYR A  1 231 ? 91.335  29.901  8.494   1.000 20.161  ? 7026 TYR A CE1   1 
ATOM   1901 C  CE2   . TYR A  1 231 ? 90.868  28.342  10.248  1.000 19.817  ? 7026 TYR A CE2   1 
ATOM   1902 C  CZ    . TYR A  1 231 ? 90.430  29.115  9.188   1.000 19.845  ? 7026 TYR A CZ    1 
ATOM   1903 O  OH    . TYR A  1 231 ? 89.112  29.136  8.823   1.000 19.651  ? 7026 TYR A OH    1 
ATOM   1904 N  N     A ILE A  1 232 ? 93.654  30.366  13.175  0.600 21.152  ? 7027 ILE A N     1 
ATOM   1905 N  N     B ILE A  1 232 ? 93.648  30.382  13.184  0.400 20.906  ? 7027 ILE A N     1 
ATOM   1906 C  CA    A ILE A  1 232 ? 92.605  30.683  14.192  0.600 21.639  ? 7027 ILE A CA    1 
ATOM   1907 C  CA    B ILE A  1 232 ? 92.564  30.703  14.164  0.400 21.212  ? 7027 ILE A CA    1 
ATOM   1908 C  C     A ILE A  1 232 ? 92.755  32.142  14.639  0.600 21.649  ? 7027 ILE A C     1 
ATOM   1909 C  C     B ILE A  1 232 ? 92.744  32.134  14.703  0.400 21.568  ? 7027 ILE A C     1 
ATOM   1910 O  O     A ILE A  1 232 ? 91.700  32.854  14.726  0.600 22.209  ? 7027 ILE A O     1 
ATOM   1911 O  O     B ILE A  1 232 ? 91.685  32.813  14.916  0.400 22.100  ? 7027 ILE A O     1 
ATOM   1912 C  CB    A ILE A  1 232 ? 92.684  29.711  15.384  0.600 22.448  ? 7027 ILE A CB    1 
ATOM   1913 C  CB    B ILE A  1 232 ? 92.506  29.636  15.273  0.400 21.576  ? 7027 ILE A CB    1 
ATOM   1914 C  CG1   A ILE A  1 232 ? 92.416  28.268  14.951  0.600 22.896  ? 7027 ILE A CG1   1 
ATOM   1915 C  CG1   B ILE A  1 232 ? 92.110  28.277  14.688  0.400 21.391  ? 7027 ILE A CG1   1 
ATOM   1916 C  CG2   A ILE A  1 232 ? 91.744  30.149  16.499  0.600 22.914  ? 7027 ILE A CG2   1 
ATOM   1917 C  CG2   B ILE A  1 232 ? 91.564  30.064  16.387  0.400 22.107  ? 7027 ILE A CG2   1 
ATOM   1918 C  CD1   A ILE A  1 232 ? 91.084  28.066  14.262  0.600 22.795  ? 7027 ILE A CD1   1 
ATOM   1919 C  CD1   B ILE A  1 232 ? 92.030  27.159  15.702  0.400 21.690  ? 7027 ILE A CD1   1 
ATOM   1920 N  N     . PHE A  1 233 ? 94.011  32.573  14.875  1.000 22.127  ? 7028 PHE A N     1 
ATOM   1921 C  CA    . PHE A  1 233 ? 94.269  33.972  15.314  1.000 22.732  ? 7028 PHE A CA    1 
ATOM   1922 C  C     . PHE A  1 233 ? 93.682  34.921  14.259  1.000 21.204  ? 7028 PHE A C     1 
ATOM   1923 O  O     . PHE A  1 233 ? 92.979  35.868  14.630  1.000 21.250  ? 7028 PHE A O     1 
ATOM   1924 C  CB    . PHE A  1 233 ? 95.759  34.206  15.568  1.000 24.327  ? 7028 PHE A CB    1 
ATOM   1925 C  CG    . PHE A  1 233 ? 96.154  35.641  15.832  1.000 25.851  ? 7028 PHE A CG    1 
ATOM   1926 C  CD1   . PHE A  1 233 ? 95.667  36.321  16.932  1.000 29.343  ? 7028 PHE A CD1   1 
ATOM   1927 C  CD2   . PHE A  1 233 ? 97.089  36.278  15.038  1.000 27.619  ? 7028 PHE A CD2   1 
ATOM   1928 C  CE1   . PHE A  1 233 ? 96.066  37.623  17.209  1.000 30.284  ? 7028 PHE A CE1   1 
ATOM   1929 C  CE2   . PHE A  1 233 ? 97.490  37.579  15.310  1.000 29.663  ? 7028 PHE A CE2   1 
ATOM   1930 C  CZ    . PHE A  1 233 ? 96.976  38.250  16.395  1.000 30.395  ? 7028 PHE A CZ    1 
ATOM   1931 N  N     . TRP A  1 234 ? 93.947  34.656  12.982  1.000 21.251  ? 7029 TRP A N     1 
ATOM   1932 C  CA    . TRP A  1 234 ? 93.362  35.491  11.896  1.000 21.133  ? 7029 TRP A CA    1 
ATOM   1933 C  C     . TRP A  1 234 ? 91.824  35.491  11.991  1.000 20.840  ? 7029 TRP A C     1 
ATOM   1934 O  O     . TRP A  1 234 ? 91.235  36.578  12.008  1.000 21.454  ? 7029 TRP A O     1 
ATOM   1935 C  CB    . TRP A  1 234 ? 93.834  35.004  10.525  1.000 20.880  ? 7029 TRP A CB    1 
ATOM   1936 C  CG    . TRP A  1 234 ? 93.083  35.619  9.386   1.000 20.453  ? 7029 TRP A CG    1 
ATOM   1937 C  CD1   . TRP A  1 234 ? 92.901  36.949  9.144   1.000 21.134  ? 7029 TRP A CD1   1 
ATOM   1938 C  CD2   . TRP A  1 234 ? 92.443  34.925  8.305   1.000 20.061  ? 7029 TRP A CD2   1 
ATOM   1939 N  NE1   . TRP A  1 234 ? 92.169  37.126  8.004   1.000 20.792  ? 7029 TRP A NE1   1 
ATOM   1940 C  CE2   . TRP A  1 234 ? 91.889  35.906  7.458   1.000 20.427  ? 7029 TRP A CE2   1 
ATOM   1941 C  CE3   . TRP A  1 234 ? 92.311  33.577  7.953   1.000 20.279  ? 7029 TRP A CE3   1 
ATOM   1942 C  CZ2   . TRP A  1 234 ? 91.183  35.578  6.304   1.000 20.507  ? 7029 TRP A CZ2   1 
ATOM   1943 C  CZ3   . TRP A  1 234 ? 91.612  33.254  6.811   1.000 20.322  ? 7029 TRP A CZ3   1 
ATOM   1944 C  CH2   . TRP A  1 234 ? 91.063  34.243  5.998   1.000 20.336  ? 7029 TRP A CH2   1 
ATOM   1945 N  N     . ARG A  1 235 ? 91.203  34.310  12.070  1.000 20.349  ? 7030 ARG A N     1 
ATOM   1946 C  CA    . ARG A  1 235 ? 89.719  34.229  12.118  1.000 20.664  ? 7030 ARG A CA    1 
ATOM   1947 C  C     . ARG A  1 235 ? 89.174  34.945  13.356  1.000 21.200  ? 7030 ARG A C     1 
ATOM   1948 O  O     . ARG A  1 235 ? 88.125  35.605  13.234  1.000 20.736  ? 7030 ARG A O     1 
ATOM   1949 C  CB    . ARG A  1 235 ? 89.257  32.772  12.102  1.000 20.172  ? 7030 ARG A CB    1 
ATOM   1950 C  CG    . ARG A  1 235 ? 89.593  32.018  10.828  1.000 19.904  ? 7030 ARG A CG    1 
ATOM   1951 C  CD    . ARG A  1 235 ? 89.132  32.707  9.560   1.000 20.493  ? 7030 ARG A CD    1 
ATOM   1952 N  NE    . ARG A  1 235 ? 87.747  33.141  9.625   1.000 20.939  ? 7030 ARG A NE    1 
ATOM   1953 C  CZ    . ARG A  1 235 ? 86.691  32.365  9.404   1.000 21.443  ? 7030 ARG A CZ    1 
ATOM   1954 N  NH1   . ARG A  1 235 ? 86.839  31.086  9.110   1.000 20.483  ? 7030 ARG A NH1   1 
ATOM   1955 N  NH2   . ARG A  1 235 ? 85.478  32.875  9.491   1.000 23.027  ? 7030 ARG A NH2   1 
ATOM   1956 N  N     . ASN A  1 236 ? 89.861  34.826  14.496  1.000 21.855  ? 7031 ASN A N     1 
ATOM   1957 C  CA    . ASN A  1 236 ? 89.398  35.479  15.751  1.000 22.878  ? 7031 ASN A CA    1 
ATOM   1958 C  C     . ASN A  1 236 ? 89.542  37.001  15.719  1.000 23.857  ? 7031 ASN A C     1 
ATOM   1959 O  O     . ASN A  1 236 ? 88.772  37.659  16.432  1.000 23.689  ? 7031 ASN A O     1 
ATOM   1960 C  CB    . ASN A  1 236 ? 90.200  35.011  16.967  1.000 23.995  ? 7031 ASN A CB    1 
ATOM   1961 C  CG    . ASN A  1 236 ? 89.807  33.625  17.414  1.000 24.174  ? 7031 ASN A CG    1 
ATOM   1962 O  OD1   . ASN A  1 236 ? 88.772  33.124  16.986  1.000 25.421  ? 7031 ASN A OD1   1 
ATOM   1963 N  ND2   . ASN A  1 236 ? 90.587  33.032  18.303  1.000 24.033  ? 7031 ASN A ND2   1 
ATOM   1964 N  N     . THR A  1 237 ? 90.476  37.540  14.934  1.000 23.777  ? 7032 THR A N     1 
ATOM   1965 C  CA    . THR A  1 237 ? 90.760  39.001  15.040  1.000 25.428  ? 7032 THR A CA    1 
ATOM   1966 C  C     . THR A  1 237 ? 90.353  39.813  13.809  1.000 27.188  ? 7032 THR A C     1 
ATOM   1967 O  O     . THR A  1 237 ? 90.401  41.056  13.905  1.000 29.346  ? 7032 THR A O     1 
ATOM   1968 C  CB    . THR A  1 237 ? 92.243  39.212  15.358  1.000 26.057  ? 7032 THR A CB    1 
ATOM   1969 O  OG1   . THR A  1 237 ? 93.001  38.587  14.326  1.000 24.280  ? 7032 THR A OG1   1 
ATOM   1970 C  CG2   . THR A  1 237 ? 92.617  38.644  16.711  1.000 26.964  ? 7032 THR A CG2   1 
ATOM   1971 N  N     . ASN A  1 238 ? 90.045  39.184  12.685  1.000 38.954  ? 7033 ASN A N     1 
ATOM   1972 C  CA    . ASN A  1 238 ? 89.598  39.996  11.525  1.000 40.647  ? 7033 ASN A CA    1 
ATOM   1973 C  C     . ASN A  1 238 ? 88.256  39.422  11.100  1.000 38.049  ? 7033 ASN A C     1 
ATOM   1974 O  O     . ASN A  1 238 ? 88.203  38.458  10.347  1.000 36.818  ? 7033 ASN A O     1 
ATOM   1975 C  CB    . ASN A  1 238 ? 90.701  40.145  10.463  1.000 42.986  ? 7033 ASN A CB    1 
ATOM   1976 C  CG    . ASN A  1 238 ? 91.692  41.250  10.807  1.000 48.551  ? 7033 ASN A CG    1 
ATOM   1977 O  OD1   . ASN A  1 238 ? 92.903  41.079  10.689  1.000 56.023  ? 7033 ASN A OD1   1 
ATOM   1978 N  ND2   . ASN A  1 238 ? 91.200  42.387  11.275  1.000 50.315  ? 7033 ASN A ND2   1 
ATOM   1979 N  N     . PRO A  1 239 ? 87.141  39.963  11.644  1.000 39.018  ? 7034 PRO A N     1 
ATOM   1980 C  CA    . PRO A  1 239 ? 85.807  39.473  11.321  1.000 39.224  ? 7034 PRO A CA    1 
ATOM   1981 C  C     . PRO A  1 239 ? 85.520  39.612  9.825   1.000 37.048  ? 7034 PRO A C     1 
ATOM   1982 O  O     . PRO A  1 239 ? 85.934  40.589  9.241   1.000 37.883  ? 7034 PRO A O     1 
ATOM   1983 C  CB    . PRO A  1 239 ? 84.835  40.363  12.111  1.000 41.643  ? 7034 PRO A CB    1 
ATOM   1984 C  CG    . PRO A  1 239 ? 85.693  41.056  13.149  1.000 44.280  ? 7034 PRO A CG    1 
ATOM   1985 C  CD    . PRO A  1 239 ? 87.103  41.086  12.590  1.000 42.665  ? 7034 PRO A CD    1 
ATOM   1986 N  N     . ILE A  1 240 ? 84.888  38.593  9.250   1.000 35.034  ? 7035 ILE A N     1 
ATOM   1987 C  CA    . ILE A  1 240 ? 84.505  38.604  7.813   1.000 33.311  ? 7035 ILE A CA    1 
ATOM   1988 C  C     . ILE A  1 240 ? 82.982  38.754  7.751   1.000 34.003  ? 7035 ILE A C     1 
ATOM   1989 O  O     . ILE A  1 240 ? 82.281  37.968  8.417   1.000 35.171  ? 7035 ILE A O     1 
ATOM   1990 C  CB    . ILE A  1 240 ? 85.039  37.342  7.112   1.000 31.604  ? 7035 ILE A CB    1 
ATOM   1991 C  CG1   . ILE A  1 240 ? 86.566  37.286  7.208   1.000 31.147  ? 7035 ILE A CG1   1 
ATOM   1992 C  CG2   . ILE A  1 240 ? 84.563  37.279  5.670   1.000 30.797  ? 7035 ILE A CG2   1 
ATOM   1993 C  CD1   . ILE A  1 240 ? 87.169  35.983  6.760   1.000 29.867  ? 7035 ILE A CD1   1 
ATOM   1994 N  N     . GLN A  1 241 ? 82.519  39.804  7.072   1.000 34.233  ? 7036 GLN A N     1 
ATOM   1995 C  CA    . GLN A  1 241 ? 81.070  40.091  6.909   1.000 35.371  ? 7036 GLN A CA    1 
ATOM   1996 C  C     . GLN A  1 241 ? 80.453  39.019  6.003   1.000 32.104  ? 7036 GLN A C     1 
ATOM   1997 O  O     . GLN A  1 241 ? 81.016  38.771  4.932   1.000 30.630  ? 7036 GLN A O     1 
ATOM   1998 C  CB    . GLN A  1 241 ? 80.899  41.507  6.339   1.000 38.546  ? 7036 GLN A CB    1 
ATOM   1999 C  CG    . GLN A  1 241 ? 79.520  41.806  5.751   1.000 41.375  ? 7036 GLN A CG    1 
ATOM   2000 C  CD    . GLN A  1 241 ? 79.358  43.238  5.286   1.000 44.894  ? 7036 GLN A CD    1 
ATOM   2001 O  OE1   . GLN A  1 241 ? 79.970  44.164  5.814   1.000 48.377  ? 7036 GLN A OE1   1 
ATOM   2002 N  NE2   . GLN A  1 241 ? 78.492  43.440  4.307   1.000 46.235  ? 7036 GLN A NE2   1 
ATOM   2003 N  N     . LEU A  1 242 ? 79.379  38.372  6.454   1.000 31.502  ? 7037 LEU A N     1 
ATOM   2004 C  CA    . LEU A  1 242 ? 78.666  37.392  5.595   1.000 30.519  ? 7037 LEU A CA    1 
ATOM   2005 C  C     . LEU A  1 242 ? 78.223  38.112  4.319   1.000 30.205  ? 7037 LEU A C     1 
ATOM   2006 O  O     . LEU A  1 242 ? 77.718  39.243  4.436   1.000 30.804  ? 7037 LEU A O     1 
ATOM   2007 C  CB    . LEU A  1 242 ? 77.456  36.831  6.343   1.000 31.657  ? 7037 LEU A CB    1 
ATOM   2008 C  CG    . LEU A  1 242 ? 77.755  35.731  7.359   1.000 32.085  ? 7037 LEU A CG    1 
ATOM   2009 C  CD1   . LEU A  1 242 ? 78.016  34.413  6.657   1.000 30.236  ? 7037 LEU A CD1   1 
ATOM   2010 C  CD2   . LEU A  1 242 ? 78.921  36.111  8.260   1.000 33.123  ? 7037 LEU A CD2   1 
ATOM   2011 N  N     . SER A  1 243 ? 78.405  37.484  3.158   1.000 28.241  ? 7038 SER A N     1 
ATOM   2012 C  CA    . SER A  1 243 ? 77.987  38.143  1.897   1.000 28.279  ? 7038 SER A CA    1 
ATOM   2013 C  C     . SER A  1 243 ? 77.788  37.134  0.769   1.000 26.544  ? 7038 SER A C     1 
ATOM   2014 O  O     . SER A  1 243 ? 78.629  36.220  0.603   1.000 25.399  ? 7038 SER A O     1 
ATOM   2015 C  CB    . SER A  1 243 ? 78.979  39.189  1.477   1.000 29.092  ? 7038 SER A CB    1 
ATOM   2016 O  OG    . SER A  1 243 ? 78.571  39.783  0.253   1.000 29.635  ? 7038 SER A OG    1 
ATOM   2017 N  N     . SER A  1 244 ? 76.718  37.334  0.007   1.000 26.935  ? 7039 SER A N     1 
ATOM   2018 C  CA    . SER A  1 244 ? 76.413  36.518  -1.191  1.000 26.782  ? 7039 SER A CA    1 
ATOM   2019 C  C     . SER A  1 244 ? 76.544  37.402  -2.440  1.000 26.771  ? 7039 SER A C     1 
ATOM   2020 O  O     . SER A  1 244 ? 76.246  36.914  -3.531  1.000 26.137  ? 7039 SER A O     1 
ATOM   2021 C  CB    . SER A  1 244 ? 75.033  35.953  -1.080  1.000 27.760  ? 7039 SER A CB    1 
ATOM   2022 O  OG    . SER A  1 244 ? 74.094  37.009  -1.002  1.000 30.116  ? 7039 SER A OG    1 
ATOM   2023 N  N     . TYR A  1 245 ? 77.006  38.646  -2.276  1.000 27.803  ? 7040 TYR A N     1 
ATOM   2024 C  CA    . TYR A  1 245 ? 77.065  39.613  -3.408  1.000 28.772  ? 7040 TYR A CA    1 
ATOM   2025 C  C     . TYR A  1 245 ? 77.783  39.038  -4.642  1.000 27.614  ? 7040 TYR A C     1 
ATOM   2026 O  O     . TYR A  1 245 ? 77.244  39.219  -5.741  1.000 27.187  ? 7040 TYR A O     1 
ATOM   2027 C  CB    . TYR A  1 245 ? 77.706  40.937  -2.993  1.000 30.491  ? 7040 TYR A CB    1 
ATOM   2028 C  CG    . TYR A  1 245 ? 77.043  41.663  -1.843  1.000 32.997  ? 7040 TYR A CG    1 
ATOM   2029 C  CD1   . TYR A  1 245 ? 75.719  41.430  -1.489  1.000 33.747  ? 7040 TYR A CD1   1 
ATOM   2030 C  CD2   . TYR A  1 245 ? 77.693  42.722  -1.227  1.000 34.808  ? 7040 TYR A CD2   1 
ATOM   2031 C  CE1   . TYR A  1 245 ? 75.115  42.128  -0.454  1.000 35.461  ? 7040 TYR A CE1   1 
ATOM   2032 C  CE2   . TYR A  1 245 ? 77.092  43.454  -0.216  1.000 37.290  ? 7040 TYR A CE2   1 
ATOM   2033 C  CZ    . TYR A  1 245 ? 75.795  43.159  0.170   1.000 37.498  ? 7040 TYR A CZ    1 
ATOM   2034 O  OH    . TYR A  1 245 ? 75.207  43.882  1.168   1.000 38.872  ? 7040 TYR A OH    1 
ATOM   2035 N  N     . SER A  1 246 ? 78.915  38.343  -4.487  1.000 26.116  ? 7041 SER A N     1 
ATOM   2036 C  CA    . SER A  1 246 ? 79.647  37.847  -5.690  1.000 26.217  ? 7041 SER A CA    1 
ATOM   2037 C  C     . SER A  1 246 ? 78.844  36.790  -6.470  1.000 26.350  ? 7041 SER A C     1 
ATOM   2038 O  O     . SER A  1 246 ? 79.178  36.556  -7.641  1.000 26.935  ? 7041 SER A O     1 
ATOM   2039 C  CB    . SER A  1 246 ? 80.999  37.289  -5.326  1.000 25.207  ? 7041 SER A CB    1 
ATOM   2040 O  OG    . SER A  1 246 ? 80.883  35.993  -4.775  1.000 23.142  ? 7041 SER A OG    1 
ATOM   2041 N  N     . LEU A  1 247 ? 77.827  36.186  -5.864  1.000 26.175  ? 7042 LEU A N     1 
ATOM   2042 C  CA    . LEU A  1 247 ? 77.050  35.121  -6.556  1.000 26.864  ? 7042 LEU A CA    1 
ATOM   2043 C  C     . LEU A  1 247 ? 76.184  35.708  -7.670  1.000 28.434  ? 7042 LEU A C     1 
ATOM   2044 O  O     . LEU A  1 247 ? 75.788  34.938  -8.569  1.000 27.886  ? 7042 LEU A O     1 
ATOM   2045 C  CB    . LEU A  1 247 ? 76.134  34.415  -5.552  1.000 27.321  ? 7042 LEU A CB    1 
ATOM   2046 C  CG    . LEU A  1 247 ? 76.798  33.789  -4.330  1.000 27.553  ? 7042 LEU A CG    1 
ATOM   2047 C  CD1   . LEU A  1 247 ? 75.751  33.125  -3.459  1.000 28.312  ? 7042 LEU A CD1   1 
ATOM   2048 C  CD2   . LEU A  1 247 ? 77.870  32.791  -4.729  1.000 26.723  ? 7042 LEU A CD2   1 
ATOM   2049 N  N     . PHE A  1 248 ? 75.912  37.013  -7.619  1.000 29.467  ? 7043 PHE A N     1 
ATOM   2050 C  CA    . PHE A  1 248 ? 74.974  37.635  -8.590  1.000 32.147  ? 7043 PHE A CA    1 
ATOM   2051 C  C     . PHE A  1 248 ? 75.675  38.033  -9.891  1.000 34.341  ? 7043 PHE A C     1 
ATOM   2052 O  O     . PHE A  1 248 ? 74.951  38.386  -10.824 1.000 37.942  ? 7043 PHE A O     1 
ATOM   2053 C  CB    . PHE A  1 248 ? 74.232  38.797  -7.928  1.000 32.847  ? 7043 PHE A CB    1 
ATOM   2054 C  CG    . PHE A  1 248 ? 73.214  38.349  -6.913  1.000 32.431  ? 7043 PHE A CG    1 
ATOM   2055 C  CD1   . PHE A  1 248 ? 73.565  38.142  -5.589  1.000 32.110  ? 7043 PHE A CD1   1 
ATOM   2056 C  CD2   . PHE A  1 248 ? 71.903  38.106  -7.292  1.000 33.803  ? 7043 PHE A CD2   1 
ATOM   2057 C  CE1   . PHE A  1 248 ? 72.626  37.708  -4.666  1.000 32.364  ? 7043 PHE A CE1   1 
ATOM   2058 C  CE2   . PHE A  1 248 ? 70.964  37.674  -6.368  1.000 34.120  ? 7043 PHE A CE2   1 
ATOM   2059 C  CZ    . PHE A  1 248 ? 71.328  37.478  -5.058  1.000 33.540  ? 7043 PHE A CZ    1 
ATOM   2060 N  N     . ASP A  1 249 ? 77.008  37.978  -9.960  1.000 34.993  ? 7044 ASP A N     1 
ATOM   2061 C  CA    . ASP A  1 249 ? 77.689  38.316  -11.243 1.000 36.373  ? 7044 ASP A CA    1 
ATOM   2062 C  C     . ASP A  1 249 ? 78.489  37.087  -11.685 1.000 33.549  ? 7044 ASP A C     1 
ATOM   2063 O  O     . ASP A  1 249 ? 79.604  36.876  -11.186 1.000 32.665  ? 7044 ASP A O     1 
ATOM   2064 C  CB    . ASP A  1 249 ? 78.551  39.574  -11.140 1.000 39.565  ? 7044 ASP A CB    1 
ATOM   2065 C  CG    . ASP A  1 249 ? 79.065  40.059  -12.488 1.000 41.440  ? 7044 ASP A CG    1 
ATOM   2066 O  OD1   . ASP A  1 249 ? 78.961  39.297  -13.475 1.000 41.609  ? 7044 ASP A OD1   1 
ATOM   2067 O  OD2   . ASP A  1 249 ? 79.531  41.206  -12.551 1.000 48.224  ? 7044 ASP A OD2   1 
ATOM   2068 N  N     . MET A  1 250 ? 77.917  36.312  -12.600 1.000 32.843  ? 7045 MET A N     1 
ATOM   2069 C  CA    . MET A  1 250 ? 78.541  35.049  -13.069 1.000 31.230  ? 7045 MET A CA    1 
ATOM   2070 C  C     . MET A  1 250 ? 79.154  35.229  -14.461 1.000 31.963  ? 7045 MET A C     1 
ATOM   2071 O  O     . MET A  1 250 ? 79.591  34.212  -15.028 1.000 30.564  ? 7045 MET A O     1 
ATOM   2072 C  CB    . MET A  1 250 ? 77.468  33.956  -13.112 1.000 31.533  ? 7045 MET A CB    1 
ATOM   2073 C  CG    . MET A  1 250 ? 76.961  33.561  -11.734 1.000 30.755  ? 7045 MET A CG    1 
ATOM   2074 S  SD    . MET A  1 250 ? 78.282  32.830  -10.739 1.000 28.343  ? 7045 MET A SD    1 
ATOM   2075 C  CE    . MET A  1 250 ? 78.505  31.270  -11.591 1.000 29.005  ? 7045 MET A CE    1 
ATOM   2076 N  N     . SER A  1 251 ? 79.253  36.472  -14.955 1.000 33.684  ? 7046 SER A N     1 
ATOM   2077 C  CA    . SER A  1 251 ? 79.756  36.719  -16.338 1.000 36.579  ? 7046 SER A CA    1 
ATOM   2078 C  C     . SER A  1 251 ? 81.191  36.199  -16.540 1.000 36.830  ? 7046 SER A C     1 
ATOM   2079 O  O     . SER A  1 251 ? 81.456  35.653  -17.616 1.000 40.009  ? 7046 SER A O     1 
ATOM   2080 C  CB    . SER A  1 251 ? 79.626  38.178  -16.731 1.000 37.892  ? 7046 SER A CB    1 
ATOM   2081 O  OG    . SER A  1 251 ? 80.317  39.019  -15.818 1.000 38.861  ? 7046 SER A OG    1 
ATOM   2082 N  N     . LYS A  1 252 ? 82.090  36.340  -15.570 1.000 36.413  ? 7047 LYS A N     1 
ATOM   2083 C  CA    . LYS A  1 252 ? 83.478  35.846  -15.816 1.000 38.730  ? 7047 LYS A CA    1 
ATOM   2084 C  C     . LYS A  1 252 ? 83.752  34.592  -14.978 1.000 35.056  ? 7047 LYS A C     1 
ATOM   2085 O  O     . LYS A  1 252 ? 84.914  34.397  -14.607 1.000 36.360  ? 7047 LYS A O     1 
ATOM   2086 C  CB    . LYS A  1 252 ? 84.482  36.962  -15.504 1.000 43.270  ? 7047 LYS A CB    1 
ATOM   2087 C  CG    . LYS A  1 252 ? 84.290  38.220  -16.343 1.000 48.533  ? 7047 LYS A CG    1 
ATOM   2088 C  CD    . LYS A  1 252 ? 85.285  39.320  -16.065 1.000 53.035  ? 7047 LYS A CD    1 
ATOM   2089 C  CE    . LYS A  1 252 ? 85.049  40.528  -16.948 1.000 57.652  ? 7047 LYS A CE    1 
ATOM   2090 N  NZ    . LYS A  1 252 ? 86.051  41.591  -16.702 1.000 62.336  ? 7047 LYS A NZ    1 
ATOM   2091 N  N     . PHE A  1 253 ? 82.750  33.723  -14.804 1.000 32.408  ? 7048 PHE A N     1 
ATOM   2092 C  CA    . PHE A  1 253 ? 82.905  32.552  -13.900 1.000 29.847  ? 7048 PHE A CA    1 
ATOM   2093 C  C     . PHE A  1 253 ? 83.761  31.431  -14.488 1.000 29.403  ? 7048 PHE A C     1 
ATOM   2094 O  O     . PHE A  1 253 ? 84.637  30.923  -13.790 1.000 27.689  ? 7048 PHE A O     1 
ATOM   2095 C  CB    . PHE A  1 253 ? 81.537  31.986  -13.502 1.000 28.317  ? 7048 PHE A CB    1 
ATOM   2096 C  CG    . PHE A  1 253 ? 81.629  30.819  -12.556 1.000 25.733  ? 7048 PHE A CG    1 
ATOM   2097 C  CD1   . PHE A  1 253 ? 82.070  31.006  -11.256 1.000 24.880  ? 7048 PHE A CD1   1 
ATOM   2098 C  CD2   . PHE A  1 253 ? 81.284  29.539  -12.957 1.000 25.215  ? 7048 PHE A CD2   1 
ATOM   2099 C  CE1   . PHE A  1 253 ? 82.173  29.935  -10.380 1.000 23.525  ? 7048 PHE A CE1   1 
ATOM   2100 C  CE2   . PHE A  1 253 ? 81.368  28.473  -12.074 1.000 24.837  ? 7048 PHE A CE2   1 
ATOM   2101 C  CZ    . PHE A  1 253 ? 81.815  28.675  -10.787 1.000 23.668  ? 7048 PHE A CZ    1 
ATOM   2102 N  N     . PRO A  1 254 ? 83.559  31.003  -15.757 1.000 30.765  ? 7049 PRO A N     1 
ATOM   2103 C  CA    . PRO A  1 254 ? 84.282  29.846  -16.290 1.000 30.858  ? 7049 PRO A CA    1 
ATOM   2104 C  C     . PRO A  1 254 ? 85.812  29.957  -16.191 1.000 30.463  ? 7049 PRO A C     1 
ATOM   2105 O  O     . PRO A  1 254 ? 86.350  31.013  -16.462 1.000 29.824  ? 7049 PRO A O     1 
ATOM   2106 C  CB    . PRO A  1 254 ? 83.847  29.763  -17.767 1.000 34.335  ? 7049 PRO A CB    1 
ATOM   2107 C  CG    . PRO A  1 254 ? 82.564  30.576  -17.844 1.000 34.524  ? 7049 PRO A CG    1 
ATOM   2108 C  CD    . PRO A  1 254 ? 82.693  31.634  -16.766 1.000 33.667  ? 7049 PRO A CD    1 
ATOM   2109 N  N     . LEU A  1 255 ? 86.458  28.875  -15.751 1.000 28.936  ? 7050 LEU A N     1 
ATOM   2110 C  CA    . LEU A  1 255 ? 87.940  28.832  -15.679 1.000 29.748  ? 7050 LEU A CA    1 
ATOM   2111 C  C     . LEU A  1 255 ? 88.465  28.962  -17.108 1.000 31.789  ? 7050 LEU A C     1 
ATOM   2112 O  O     . LEU A  1 255 ? 87.989  28.210  -17.962 1.000 32.151  ? 7050 LEU A O     1 
ATOM   2113 C  CB    . LEU A  1 255 ? 88.381  27.509  -15.044 1.000 28.394  ? 7050 LEU A CB    1 
ATOM   2114 C  CG    . LEU A  1 255 ? 89.889  27.281  -14.939 1.000 28.342  ? 7050 LEU A CG    1 
ATOM   2115 C  CD1   . LEU A  1 255 ? 90.558  28.372  -14.111 1.000 28.262  ? 7050 LEU A CD1   1 
ATOM   2116 C  CD2   . LEU A  1 255 ? 90.182  25.906  -14.352 1.000 27.845  ? 7050 LEU A CD2   1 
ATOM   2117 N  N     . LYS A  1 256 ? 89.405  29.875  -17.348 1.000 34.644  ? 7051 LYS A N     1 
ATOM   2118 C  CA    . LYS A  1 256 ? 89.927  30.057  -18.727 1.000 39.214  ? 7051 LYS A CA    1 
ATOM   2119 C  C     . LYS A  1 256 ? 90.808  28.866  -19.109 1.000 38.496  ? 7051 LYS A C     1 
ATOM   2120 O  O     . LYS A  1 256 ? 91.708  28.506  -18.324 1.000 35.177  ? 7051 LYS A O     1 
ATOM   2121 C  CB    . LYS A  1 256 ? 90.671  31.388  -18.833 1.000 45.359  ? 7051 LYS A CB    1 
ATOM   2122 C  CG    . LYS A  1 256 ? 89.799  32.602  -18.546 1.000 50.856  ? 7051 LYS A CG    1 
ATOM   2123 C  CD    . LYS A  1 256 ? 90.486  33.933  -18.756 1.000 57.061  ? 7051 LYS A CD    1 
ATOM   2124 C  CE    . LYS A  1 256 ? 89.565  35.102  -18.474 1.000 61.104  ? 7051 LYS A CE    1 
ATOM   2125 N  NZ    . LYS A  1 256 ? 90.198  36.396  -18.826 1.000 65.564  ? 7051 LYS A NZ    1 
ATOM   2126 N  N     . LEU A  1 257 ? 90.528  28.264  -20.268 1.000 39.410  ? 7052 LEU A N     1 
ATOM   2127 C  CA    . LEU A  1 257 ? 91.346  27.126  -20.762 1.000 40.022  ? 7052 LEU A CA    1 
ATOM   2128 C  C     . LEU A  1 257 ? 92.680  27.677  -21.285 1.000 40.760  ? 7052 LEU A C     1 
ATOM   2129 O  O     . LEU A  1 257 ? 92.743  28.086  -22.460 1.000 42.187  ? 7052 LEU A O     1 
ATOM   2130 C  CB    . LEU A  1 257 ? 90.567  26.385  -21.852 1.000 42.892  ? 7052 LEU A CB    1 
ATOM   2131 C  CG    . LEU A  1 257 ? 91.307  25.228  -22.521 1.000 44.375  ? 7052 LEU A CG    1 
ATOM   2132 C  CD1   . LEU A  1 257 ? 91.900  24.282  -21.490 1.000 43.248  ? 7052 LEU A CD1   1 
ATOM   2133 C  CD2   . LEU A  1 257 ? 90.386  24.481  -23.476 1.000 45.560  ? 7052 LEU A CD2   1 
ATOM   2134 N  N     . ARG A  1 258 ? 93.708  27.655  -20.436 1.000 38.914  ? 7053 ARG A N     1 
ATOM   2135 C  CA    . ARG A  1 258 ? 95.061  28.173  -20.769 1.000 39.649  ? 7053 ARG A CA    1 
ATOM   2136 C  C     . ARG A  1 258 ? 95.788  27.217  -21.719 1.000 39.128  ? 7053 ARG A C     1 
ATOM   2137 O  O     . ARG A  1 258 ? 96.692  27.676  -22.410 1.000 39.053  ? 7053 ARG A O     1 
ATOM   2138 C  CB    . ARG A  1 258 ? 95.904  28.304  -19.497 1.000 39.884  ? 7053 ARG A CB    1 
ATOM   2139 C  CG    . ARG A  1 258 ? 95.301  29.212  -18.439 1.000 41.214  ? 7053 ARG A CG    1 
ATOM   2140 C  CD    . ARG A  1 258 ? 96.173  29.291  -17.198 1.000 42.001  ? 7053 ARG A CD    1 
ATOM   2141 N  NE    . ARG A  1 258 ? 97.462  29.925  -17.446 1.000 46.349  ? 7053 ARG A NE    1 
ATOM   2142 C  CZ    . ARG A  1 258 ? 98.420  30.099  -16.526 1.000 48.591  ? 7053 ARG A CZ    1 
ATOM   2143 N  NH1   . ARG A  1 258 ? 98.254  29.673  -15.280 1.000 44.473  ? 7053 ARG A NH1   1 
ATOM   2144 N  NH2   . ARG A  1 258 ? 99.549  30.698  -16.865 1.000 50.659  ? 7053 ARG A NH2   1 
ATOM   2145 N  N     . GLY A  1 259 ? 95.437  25.930  -21.702 1.000 36.622  ? 7054 GLY A N     1 
ATOM   2146 C  CA    . GLY A  1 259 ? 96.143  24.955  -22.551 1.000 37.887  ? 7054 GLY A CA    1 
ATOM   2147 C  C     . GLY A  1 259 ? 97.575  24.784  -22.084 1.000 37.557  ? 7054 GLY A C     1 
ATOM   2148 O  O     . GLY A  1 259 ? 98.470  24.691  -22.933 1.000 38.627  ? 7054 GLY A O     1 
ATOM   2149 N  N     . THR A  1 260 ? 97.768  24.754  -20.763 1.000 35.042  ? 7055 THR A N     1 
ATOM   2150 C  CA    . THR A  1 260 ? 99.094  24.611  -20.112 1.000 34.920  ? 7055 THR A CA    1 
ATOM   2151 C  C     . THR A  1 260 ? 99.833  23.371  -20.616 1.000 36.162  ? 7055 THR A C     1 
ATOM   2152 O  O     . THR A  1 260 ? 99.223  22.293  -20.635 1.000 35.749  ? 7055 THR A O     1 
ATOM   2153 C  CB    . THR A  1 260 ? 98.940  24.485  -18.595 1.000 32.823  ? 7055 THR A CB    1 
ATOM   2154 O  OG1   . THR A  1 260 ? 98.182  25.618  -18.174 1.000 31.371  ? 7055 THR A OG1   1 
ATOM   2155 C  CG2   . THR A  1 260 ? 100.273 24.412  -17.883 1.000 33.214  ? 7055 THR A CG2   1 
ATOM   2156 N  N     . ALA A  1 261 ? 101.132 23.518  -20.883 1.000 37.864  ? 7056 ALA A N     1 
ATOM   2157 C  CA    . ALA A  1 261 ? 101.968 22.403  -21.378 1.000 39.733  ? 7056 ALA A CA    1 
ATOM   2158 C  C     . ALA A  1 261 ? 102.068 21.293  -20.328 1.000 39.210  ? 7056 ALA A C     1 
ATOM   2159 O  O     . ALA A  1 261 ? 102.163 21.600  -19.119 1.000 36.689  ? 7056 ALA A O     1 
ATOM   2160 C  CB    . ALA A  1 261 ? 103.337 22.910  -21.757 1.000 42.035  ? 7056 ALA A CB    1 
ATOM   2161 N  N     . VAL A  1 262 ? 102.042 20.049  -20.801 1.000 40.301  ? 7057 VAL A N     1 
ATOM   2162 C  CA    . VAL A  1 262 ? 102.176 18.831  -19.956 1.000 40.937  ? 7057 VAL A CA    1 
ATOM   2163 C  C     . VAL A  1 262 ? 103.403 18.068  -20.454 1.000 44.734  ? 7057 VAL A C     1 
ATOM   2164 O  O     . VAL A  1 262 ? 103.419 17.724  -21.644 1.000 45.326  ? 7057 VAL A O     1 
ATOM   2165 C  CB    . VAL A  1 262 ? 100.915 17.953  -20.037 1.000 40.919  ? 7057 VAL A CB    1 
ATOM   2166 C  CG1   . VAL A  1 262 ? 101.113 16.617  -19.335 1.000 40.936  ? 7057 VAL A CG1   1 
ATOM   2167 C  CG2   . VAL A  1 262 ? 99.685  18.675  -19.509 1.000 38.382  ? 7057 VAL A CG2   1 
ATOM   2168 N  N     . MET A  1 263 ? 104.391 17.835  -19.589 1.000 46.950  ? 7058 MET A N     1 
ATOM   2169 C  CA    . MET A  1 263 ? 105.617 17.097  -20.003 1.000 51.105  ? 7058 MET A CA    1 
ATOM   2170 C  C     . MET A  1 263 ? 105.895 15.972  -19.004 1.000 50.793  ? 7058 MET A C     1 
ATOM   2171 O  O     . MET A  1 263 ? 105.599 16.155  -17.805 1.000 45.526  ? 7058 MET A O     1 
ATOM   2172 C  CB    . MET A  1 263 ? 106.838 18.020  -20.039 1.000 55.250  ? 7058 MET A CB    1 
ATOM   2173 C  CG    . MET A  1 263 ? 106.695 19.201  -20.974 1.000 58.459  ? 7058 MET A CG    1 
ATOM   2174 S  SD    . MET A  1 263 ? 108.132 20.305  -20.884 1.000 64.198  ? 7058 MET A SD    1 
ATOM   2175 C  CE    . MET A  1 263 ? 109.429 19.221  -21.482 1.000 67.927  ? 7058 MET A CE    1 
ATOM   2176 N  N     . SER A  1 264 ? 106.452 14.861  -19.491 1.000 52.781  ? 7059 SER A N     1 
ATOM   2177 C  CA    . SER A  1 264 ? 106.803 13.706  -18.626 1.000 56.001  ? 7059 SER A CA    1 
ATOM   2178 C  C     . SER A  1 264 ? 108.305 13.743  -18.332 1.000 60.075  ? 7059 SER A C     1 
ATOM   2179 O  O     . SER A  1 264 ? 109.039 12.940  -18.922 1.000 65.945  ? 7059 SER A O     1 
ATOM   2180 C  CB    . SER A  1 264 ? 106.389 12.400  -19.261 1.000 56.792  ? 7059 SER A CB    1 
ATOM   2181 O  OG    . SER A  1 264 ? 106.989 12.238  -20.540 1.000 58.679  ? 7059 SER A OG    1 
ATOM   2182 N  N     . LEU A  1 265 ? 108.730 14.658  -17.459 1.000 62.464  ? 7060 LEU A N     1 
ATOM   2183 C  CA    . LEU A  1 265 ? 110.162 14.805  -17.082 1.000 68.437  ? 7060 LEU A CA    1 
ATOM   2184 C  C     . LEU A  1 265 ? 110.479 13.875  -15.905 1.000 72.971  ? 7060 LEU A C     1 
ATOM   2185 O  O     . LEU A  1 265 ? 109.571 13.626  -15.084 1.000 72.327  ? 7060 LEU A O     1 
ATOM   2186 C  CB    . LEU A  1 265 ? 110.448 16.265  -16.708 1.000 67.123  ? 7060 LEU A CB    1 
ATOM   2187 C  CG    . LEU A  1 265 ? 110.288 17.288  -17.834 1.000 67.450  ? 7060 LEU A CG    1 
ATOM   2188 C  CD1   . LEU A  1 265 ? 110.427 18.707  -17.304 1.000 65.921  ? 7060 LEU A CD1   1 
ATOM   2189 C  CD2   . LEU A  1 265 ? 111.292 17.035  -18.948 1.000 70.426  ? 7060 LEU A CD2   1 
ATOM   2190 N  N     . LYS A  1 266 ? 111.722 13.387  -15.842 1.000 81.484  ? 7061 LYS A N     1 
ATOM   2191 C  CA    . LYS A  1 266 ? 112.185 12.504  -14.737 1.000 87.422  ? 7061 LYS A CA    1 
ATOM   2192 C  C     . LYS A  1 266 ? 112.496 13.380  -13.518 1.000 90.370  ? 7061 LYS A C     1 
ATOM   2193 O  O     . LYS A  1 266 ? 112.603 14.610  -13.695 1.000 92.198  ? 7061 LYS A O     1 
ATOM   2194 C  CB    . LYS A  1 266 ? 113.434 11.724  -15.158 1.000 92.424  ? 7061 LYS A CB    1 
ATOM   2195 C  CG    . LYS A  1 266 ? 113.297 10.910  -16.438 1.000 95.883  ? 7061 LYS A CG    1 
ATOM   2196 C  CD    . LYS A  1 266 ? 114.564 10.163  -16.813 1.000 99.216  ? 7061 LYS A CD    1 
ATOM   2197 C  CE    . LYS A  1 266 ? 114.455 9.425   -18.131 1.000 102.285 ? 7061 LYS A CE    1 
ATOM   2198 N  NZ    . LYS A  1 266 ? 113.364 8.422   -18.116 1.000 101.430 ? 7061 LYS A NZ    1 
ATOM   2199 N  N     . GLU A  1 267 ? 112.653 12.769  -12.339 1.000 94.095  ? 7062 GLU A N     1 
ATOM   2200 C  CA    . GLU A  1 267 ? 112.957 13.531  -11.095 1.000 95.612  ? 7062 GLU A CA    1 
ATOM   2201 C  C     . GLU A  1 267 ? 114.352 14.167  -11.190 1.000 95.700  ? 7062 GLU A C     1 
ATOM   2202 O  O     . GLU A  1 267 ? 114.575 15.184  -10.504 1.000 96.442  ? 7062 GLU A O     1 
ATOM   2203 C  CB    . GLU A  1 267 ? 112.857 12.621  -9.868  1.000 98.734  ? 7062 GLU A CB    1 
ATOM   2204 C  CG    . GLU A  1 267 ? 111.446 12.134  -9.584  1.000 99.010  ? 7062 GLU A CG    1 
ATOM   2205 C  CD    . GLU A  1 267 ? 111.313 11.234  -8.366  1.000 101.640 ? 7062 GLU A CD    1 
ATOM   2206 O  OE1   . GLU A  1 267 ? 112.328 10.630  -7.962  1.000 104.126 ? 7062 GLU A OE1   1 
ATOM   2207 O  OE2   . GLU A  1 267 ? 110.199 11.158  -7.808  1.000 102.962 ? 7062 GLU A OE2   1 
ATOM   2208 N  N     . GLY A  1 268 ? 115.241 13.599  -12.013 1.000 95.477  ? 7063 GLY A N     1 
ATOM   2209 C  CA    . GLY A  1 268 ? 116.614 14.124  -12.167 1.000 95.595  ? 7063 GLY A CA    1 
ATOM   2210 C  C     . GLY A  1 268 ? 116.713 15.233  -13.204 1.000 94.078  ? 7063 GLY A C     1 
ATOM   2211 O  O     . GLY A  1 268 ? 117.831 15.741  -13.407 1.000 97.171  ? 7063 GLY A O     1 
ATOM   2212 N  N     . GLN A  1 269 ? 115.592 15.612  -13.827 1.000 90.466  ? 7064 GLN A N     1 
ATOM   2213 C  CA    . GLN A  1 269 ? 115.586 16.679  -14.869 1.000 88.432  ? 7064 GLN A CA    1 
ATOM   2214 C  C     . GLN A  1 269 ? 114.922 17.955  -14.327 1.000 84.392  ? 7064 GLN A C     1 
ATOM   2215 O  O     . GLN A  1 269 ? 114.928 18.979  -15.041 1.000 86.090  ? 7064 GLN A O     1 
ATOM   2216 C  CB    . GLN A  1 269 ? 114.864 16.185  -16.125 1.000 88.272  ? 7064 GLN A CB    1 
ATOM   2217 C  CG    . GLN A  1 269 ? 115.529 14.977  -16.770 1.000 90.736  ? 7064 GLN A CG    1 
ATOM   2218 C  CD    . GLN A  1 269 ? 114.743 14.427  -17.936 1.000 90.308  ? 7064 GLN A CD    1 
ATOM   2219 O  OE1   . GLN A  1 269 ? 113.594 14.793  -18.169 1.000 86.893  ? 7064 GLN A OE1   1 
ATOM   2220 N  NE2   . GLN A  1 269 ? 115.360 13.518  -18.673 1.000 94.527  ? 7064 GLN A NE2   1 
ATOM   2221 N  N     A ILE A  1 270 ? 114.376 17.891  -13.107 0.500 80.944  ? 7065 ILE A N     1 
ATOM   2222 N  N     B ILE A  1 270 ? 114.374 17.890  -13.107 0.500 80.536  ? 7065 ILE A N     1 
ATOM   2223 C  CA    A ILE A  1 270 ? 113.698 19.067  -12.482 0.500 77.507  ? 7065 ILE A CA    1 
ATOM   2224 C  CA    B ILE A  1 270 ? 113.699 19.066  -12.478 0.500 76.853  ? 7065 ILE A CA    1 
ATOM   2225 C  C     A ILE A  1 270 ? 114.766 20.055  -11.999 0.500 77.640  ? 7065 ILE A C     1 
ATOM   2226 C  C     B ILE A  1 270 ? 114.769 20.054  -11.999 0.500 77.278  ? 7065 ILE A C     1 
ATOM   2227 O  O     A ILE A  1 270 ? 115.288 19.858  -10.884 0.500 79.283  ? 7065 ILE A O     1 
ATOM   2228 O  O     B ILE A  1 270 ? 115.296 19.855  -10.887 0.500 78.964  ? 7065 ILE A O     1 
ATOM   2229 C  CB    A ILE A  1 270 ? 112.778 18.615  -11.330 0.500 75.000  ? 7065 ILE A CB    1 
ATOM   2230 C  CB    B ILE A  1 270 ? 112.780 18.620  -11.322 0.500 73.858  ? 7065 ILE A CB    1 
ATOM   2231 C  CG1   A ILE A  1 270 ? 111.839 17.488  -11.766 0.500 73.700  ? 7065 ILE A CG1   1 
ATOM   2232 C  CG1   B ILE A  1 270 ? 111.823 17.505  -11.750 0.500 72.068  ? 7065 ILE A CG1   1 
ATOM   2233 C  CG2   A ILE A  1 270 ? 112.014 19.797  -10.753 0.500 72.944  ? 7065 ILE A CG2   1 
ATOM   2234 C  CG2   B ILE A  1 270 ? 112.035 19.809  -10.736 0.500 71.869  ? 7065 ILE A CG2   1 
ATOM   2235 C  CD1   A ILE A  1 270 ? 110.976 16.948  -10.653 0.500 72.342  ? 7065 ILE A CD1   1 
ATOM   2236 C  CD1   B ILE A  1 270 ? 110.897 17.892  -12.876 0.500 71.003  ? 7065 ILE A CD1   1 
ATOM   2237 N  N     . ASN A  1 271 ? 115.066 21.074  -12.813 1.000 69.722  ? 7066 ASN A N     1 
ATOM   2238 C  CA    . ASN A  1 271 ? 116.078 22.109  -12.462 1.000 69.249  ? 7066 ASN A CA    1 
ATOM   2239 C  C     . ASN A  1 271 ? 115.351 23.368  -11.970 1.000 65.207  ? 7066 ASN A C     1 
ATOM   2240 O  O     . ASN A  1 271 ? 114.116 23.313  -11.812 1.000 63.533  ? 7066 ASN A O     1 
ATOM   2241 C  CB    . ASN A  1 271 ? 117.016 22.399  -13.638 1.000 70.508  ? 7066 ASN A CB    1 
ATOM   2242 C  CG    . ASN A  1 271 ? 116.303 22.950  -14.855 1.000 68.387  ? 7066 ASN A CG    1 
ATOM   2243 O  OD1   . ASN A  1 271 ? 115.268 23.601  -14.737 1.000 63.705  ? 7066 ASN A OD1   1 
ATOM   2244 N  ND2   . ASN A  1 271 ? 116.864 22.715  -16.029 1.000 69.831  ? 7066 ASN A ND2   1 
ATOM   2245 N  N     . ASP A  1 272 ? 116.092 24.463  -11.769 1.000 64.322  ? 7067 ASP A N     1 
ATOM   2246 C  CA    . ASP A  1 272 ? 115.518 25.743  -11.270 1.000 62.694  ? 7067 ASP A CA    1 
ATOM   2247 C  C     . ASP A  1 272 ? 114.628 26.380  -12.345 1.000 60.205  ? 7067 ASP A C     1 
ATOM   2248 O  O     . ASP A  1 272 ? 113.619 27.011  -11.961 1.000 57.153  ? 7067 ASP A O     1 
ATOM   2249 C  CB    . ASP A  1 272 ? 116.617 26.693  -10.785 1.000 65.685  ? 7067 ASP A CB    1 
ATOM   2250 C  CG    . ASP A  1 272 ? 117.329 26.207  -9.533  1.000 68.646  ? 7067 ASP A CG    1 
ATOM   2251 O  OD1   . ASP A  1 272 ? 116.793 25.296  -8.867  1.000 68.479  ? 7067 ASP A OD1   1 
ATOM   2252 O  OD2   . ASP A  1 272 ? 118.418 26.734  -9.238  1.000 73.341  ? 7067 ASP A OD2   1 
ATOM   2253 N  N     . MET A  1 273 ? 114.977 26.233  -13.629 1.000 59.594  ? 7068 MET A N     1 
ATOM   2254 C  CA    . MET A  1 273 ? 114.118 26.801  -14.706 1.000 59.533  ? 7068 MET A CA    1 
ATOM   2255 C  C     . MET A  1 273 ? 112.747 26.114  -14.678 1.000 52.839  ? 7068 MET A C     1 
ATOM   2256 O  O     . MET A  1 273 ? 111.740 26.810  -14.879 1.000 48.949  ? 7068 MET A O     1 
ATOM   2257 C  CB    . MET A  1 273 ? 114.719 26.605  -16.102 1.000 66.603  ? 7068 MET A CB    1 
ATOM   2258 C  CG    . MET A  1 273 ? 113.761 27.019  -17.211 1.000 70.113  ? 7068 MET A CG    1 
ATOM   2259 S  SD    . MET A  1 273 ? 114.404 26.742  -18.874 1.000 85.369  ? 7068 MET A SD    1 
ATOM   2260 C  CE    . MET A  1 273 ? 112.995 27.264  -19.851 1.000 83.805  ? 7068 MET A CE    1 
ATOM   2261 N  N     . ILE A  1 274 ? 112.731 24.791  -14.495 1.000 51.436  ? 7069 ILE A N     1 
ATOM   2262 C  CA    . ILE A  1 274 ? 111.461 24.009  -14.451 1.000 48.470  ? 7069 ILE A CA    1 
ATOM   2263 C  C     . ILE A  1 274 ? 110.652 24.457  -13.227 1.000 45.682  ? 7069 ILE A C     1 
ATOM   2264 O  O     . ILE A  1 274 ? 109.450 24.731  -13.397 1.000 43.965  ? 7069 ILE A O     1 
ATOM   2265 C  CB    . ILE A  1 274 ? 111.750 22.493  -14.448 1.000 50.149  ? 7069 ILE A CB    1 
ATOM   2266 C  CG1   . ILE A  1 274 ? 112.589 22.064  -15.657 1.000 53.414  ? 7069 ILE A CG1   1 
ATOM   2267 C  CG2   . ILE A  1 274 ? 110.462 21.694  -14.352 1.000 48.799  ? 7069 ILE A CG2   1 
ATOM   2268 C  CD1   . ILE A  1 274 ? 111.987 22.424  -16.997 1.000 53.092  ? 7069 ILE A CD1   1 
ATOM   2269 N  N     . LEU A  1 275 ? 111.291 24.543  -12.052 1.000 45.216  ? 7070 LEU A N     1 
ATOM   2270 C  CA    . LEU A  1 275 ? 110.585 24.985  -10.815 1.000 44.969  ? 7070 LEU A CA    1 
ATOM   2271 C  C     . LEU A  1 275 ? 109.965 26.364  -11.047 1.000 43.129  ? 7070 LEU A C     1 
ATOM   2272 O  O     . LEU A  1 275 ? 108.844 26.595  -10.565 1.000 40.451  ? 7070 LEU A O     1 
ATOM   2273 C  CB    . LEU A  1 275 ? 111.569 25.023  -9.642  1.000 46.251  ? 7070 LEU A CB    1 
ATOM   2274 C  CG    . LEU A  1 275 ? 112.087 23.666  -9.180  1.000 48.270  ? 7070 LEU A CG    1 
ATOM   2275 C  CD1   . LEU A  1 275 ? 113.152 23.834  -8.107  1.000 51.181  ? 7070 LEU A CD1   1 
ATOM   2276 C  CD2   . LEU A  1 275 ? 110.949 22.788  -8.677  1.000 47.067  ? 7070 LEU A CD2   1 
ATOM   2277 N  N     . SER A  1 276 ? 110.661 27.218  -11.799 1.000 44.311  ? 7071 SER A N     1 
ATOM   2278 C  CA    . SER A  1 276 ? 110.170 28.588  -12.094 1.000 43.577  ? 7071 SER A CA    1 
ATOM   2279 C  C     . SER A  1 276 ? 108.913 28.514  -12.971 1.000 40.879  ? 7071 SER A C     1 
ATOM   2280 O  O     . SER A  1 276 ? 107.964 29.266  -12.699 1.000 39.421  ? 7071 SER A O     1 
ATOM   2281 C  CB    . SER A  1 276 ? 111.253 29.417  -12.735 1.000 46.777  ? 7071 SER A CB    1 
ATOM   2282 O  OG    . SER A  1 276 ? 110.814 30.749  -12.921 1.000 49.070  ? 7071 SER A OG    1 
ATOM   2283 N  N     . LEU A  1 277 ? 108.909 27.643  -13.985 1.000 40.002  ? 7072 LEU A N     1 
ATOM   2284 C  CA    . LEU A  1 277 ? 107.716 27.506  -14.866 1.000 38.971  ? 7072 LEU A CA    1 
ATOM   2285 C  C     . LEU A  1 277 ? 106.554 26.921  -14.055 1.000 36.540  ? 7072 LEU A C     1 
ATOM   2286 O  O     . LEU A  1 277 ? 105.420 27.402  -14.220 1.000 35.884  ? 7072 LEU A O     1 
ATOM   2287 C  CB    . LEU A  1 277 ? 108.054 26.609  -16.059 1.000 40.011  ? 7072 LEU A CB    1 
ATOM   2288 C  CG    . LEU A  1 277 ? 109.021 27.206  -17.076 1.000 42.638  ? 7072 LEU A CG    1 
ATOM   2289 C  CD1   . LEU A  1 277 ? 109.358 26.186  -18.150 1.000 44.784  ? 7072 LEU A CD1   1 
ATOM   2290 C  CD2   . LEU A  1 277 ? 108.446 28.471  -17.695 1.000 43.264  ? 7072 LEU A CD2   1 
ATOM   2291 N  N     . LEU A  1 278 ? 106.832 25.905  -13.235 1.000 36.021  ? 7073 LEU A N     1 
ATOM   2292 C  CA    . LEU A  1 278 ? 105.780 25.292  -12.382 1.000 35.345  ? 7073 LEU A CA    1 
ATOM   2293 C  C     . LEU A  1 278 ? 105.149 26.371  -11.503 1.000 34.769  ? 7073 LEU A C     1 
ATOM   2294 O  O     . LEU A  1 278 ? 103.913 26.401  -11.408 1.000 33.488  ? 7073 LEU A O     1 
ATOM   2295 C  CB    . LEU A  1 278 ? 106.405 24.207  -11.500 1.000 35.789  ? 7073 LEU A CB    1 
ATOM   2296 C  CG    . LEU A  1 278 ? 106.932 22.975  -12.228 1.000 36.909  ? 7073 LEU A CG    1 
ATOM   2297 C  CD1   . LEU A  1 278 ? 107.694 22.072  -11.272 1.000 38.341  ? 7073 LEU A CD1   1 
ATOM   2298 C  CD2   . LEU A  1 278 ? 105.796 22.219  -12.895 1.000 36.012  ? 7073 LEU A CD2   1 
ATOM   2299 N  N     . SER A  1 279 ? 105.989 27.239  -10.931 1.000 36.581  ? 7074 SER A N     1 
ATOM   2300 C  CA    . SER A  1 279 ? 105.561 28.298  -9.978  1.000 37.813  ? 7074 SER A CA    1 
ATOM   2301 C  C     . SER A  1 279 ? 104.656 29.343  -10.638 1.000 38.626  ? 7074 SER A C     1 
ATOM   2302 O  O     . SER A  1 279 ? 103.911 29.998  -9.899  1.000 37.782  ? 7074 SER A O     1 
ATOM   2303 C  CB    . SER A  1 279 ? 106.765 28.942  -9.345  1.000 38.507  ? 7074 SER A CB    1 
ATOM   2304 O  OG    . SER A  1 279 ? 107.499 27.977  -8.601  1.000 39.563  ? 7074 SER A OG    1 
ATOM   2305 N  N     . LYS A  1 280 ? 104.700 29.467  -11.967 1.000 41.677  ? 7075 LYS A N     1 
ATOM   2306 C  CA    . LYS A  1 280 ? 103.879 30.483  -12.685 1.000 42.495  ? 7075 LYS A CA    1 
ATOM   2307 C  C     . LYS A  1 280 ? 102.619 29.851  -13.275 1.000 39.538  ? 7075 LYS A C     1 
ATOM   2308 O  O     . LYS A  1 280 ? 101.904 30.562  -13.999 1.000 41.533  ? 7075 LYS A O     1 
ATOM   2309 C  CB    . LYS A  1 280 ? 104.672 31.117  -13.833 1.000 47.170  ? 7075 LYS A CB    1 
ATOM   2310 C  CG    . LYS A  1 280 ? 105.881 31.950  -13.437 1.000 51.479  ? 7075 LYS A CG    1 
ATOM   2311 C  CD    . LYS A  1 280 ? 106.527 32.624  -14.636 1.000 55.847  ? 7075 LYS A CD    1 
ATOM   2312 C  CE    . LYS A  1 280 ? 107.733 33.467  -14.286 1.000 59.673  ? 7075 LYS A CE    1 
ATOM   2313 N  NZ    . LYS A  1 280 ? 108.835 32.643  -13.736 1.000 62.693  ? 7075 LYS A NZ    1 
ATOM   2314 N  N     . GLY A  1 281 ? 102.363 28.572  -12.993 1.000 36.189  ? 7076 GLY A N     1 
ATOM   2315 C  CA    . GLY A  1 281 ? 101.186 27.898  -13.572 1.000 35.883  ? 7076 GLY A CA    1 
ATOM   2316 C  C     . GLY A  1 281 ? 101.357 27.686  -15.068 1.000 36.425  ? 7076 GLY A C     1 
ATOM   2317 O  O     . GLY A  1 281 ? 100.340 27.539  -15.766 1.000 37.397  ? 7076 GLY A O     1 
ATOM   2318 N  N     . ARG A  1 282 ? 102.605 27.656  -15.542 1.000 36.581  ? 7077 ARG A N     1 
ATOM   2319 C  CA    . ARG A  1 282 ? 102.887 27.486  -16.995 1.000 38.671  ? 7077 ARG A CA    1 
ATOM   2320 C  C     . ARG A  1 282 ? 103.360 26.061  -17.313 1.000 36.939  ? 7077 ARG A C     1 
ATOM   2321 O  O     . ARG A  1 282 ? 103.726 25.826  -18.465 1.000 37.278  ? 7077 ARG A O     1 
ATOM   2322 C  CB    . ARG A  1 282 ? 103.922 28.523  -17.437 1.000 42.353  ? 7077 ARG A CB    1 
ATOM   2323 C  CG    . ARG A  1 282 ? 103.413 29.958  -17.375 1.000 46.457  ? 7077 ARG A CG    1 
ATOM   2324 C  CD    . ARG A  1 282 ? 104.514 30.965  -17.643 1.000 51.392  ? 7077 ARG A CD    1 
ATOM   2325 N  NE    . ARG A  1 282 ? 105.175 30.730  -18.924 1.000 57.933  ? 7077 ARG A NE    1 
ATOM   2326 C  CZ    . ARG A  1 282 ? 106.244 31.393  -19.363 1.000 60.344  ? 7077 ARG A CZ    1 
ATOM   2327 N  NH1   . ARG A  1 282 ? 106.794 32.345  -18.625 1.000 60.579  ? 7077 ARG A NH1   1 
ATOM   2328 N  NH2   . ARG A  1 282 ? 106.764 31.094  -20.541 1.000 64.154  ? 7077 ARG A NH2   1 
ATOM   2329 N  N     . LEU A  1 283 ? 103.313 25.128  -16.362 1.000 34.960  ? 7078 LEU A N     1 
ATOM   2330 C  CA    . LEU A  1 283 ? 103.787 23.762  -16.704 1.000 35.130  ? 7078 LEU A CA    1 
ATOM   2331 C  C     . LEU A  1 283 ? 103.165 22.719  -15.776 1.000 32.462  ? 7078 LEU A C     1 
ATOM   2332 O  O     . LEU A  1 283 ? 102.990 23.006  -14.582 1.000 31.232  ? 7078 LEU A O     1 
ATOM   2333 C  CB    . LEU A  1 283 ? 105.316 23.739  -16.600 1.000 37.230  ? 7078 LEU A CB    1 
ATOM   2334 C  CG    . LEU A  1 283 ? 105.996 22.401  -16.896 1.000 38.506  ? 7078 LEU A CG    1 
ATOM   2335 C  CD1   . LEU A  1 283 ? 105.718 21.945  -18.323 1.000 41.150  ? 7078 LEU A CD1   1 
ATOM   2336 C  CD2   . LEU A  1 283 ? 107.498 22.498  -16.664 1.000 40.265  ? 7078 LEU A CD2   1 
ATOM   2337 N  N     . ILE A  1 284 ? 102.831 21.560  -16.344 1.000 31.669  ? 7079 ILE A N     1 
ATOM   2338 C  CA    . ILE A  1 284 ? 102.314 20.376  -15.598 1.000 31.610  ? 7079 ILE A CA    1 
ATOM   2339 C  C     . ILE A  1 284 ? 103.275 19.225  -15.902 1.000 33.448  ? 7079 ILE A C     1 
ATOM   2340 O  O     . ILE A  1 284 ? 103.523 18.963  -17.105 1.000 34.090  ? 7079 ILE A O     1 
ATOM   2341 C  CB    . ILE A  1 284 ? 100.860 20.032  -15.983 1.000 31.853  ? 7079 ILE A CB    1 
ATOM   2342 C  CG1   . ILE A  1 284 ? 99.850  20.981  -15.335 1.000 31.880  ? 7079 ILE A CG1   1 
ATOM   2343 C  CG2   . ILE A  1 284 ? 100.533 18.587  -15.629 1.000 31.207  ? 7079 ILE A CG2   1 
ATOM   2344 C  CD1   . ILE A  1 284 ? 99.679  20.774  -13.844 1.000 31.743  ? 7079 ILE A CD1   1 
ATOM   2345 N  N     . ILE A  1 285 ? 103.832 18.600  -14.865 1.000 32.914  ? 7080 ILE A N     1 
ATOM   2346 C  CA    . ILE A  1 285 ? 104.760 17.456  -15.091 1.000 35.528  ? 7080 ILE A CA    1 
ATOM   2347 C  C     . ILE A  1 285 ? 104.074 16.175  -14.621 1.000 35.159  ? 7080 ILE A C     1 
ATOM   2348 O  O     . ILE A  1 285 ? 103.779 16.048  -13.414 1.000 34.889  ? 7080 ILE A O     1 
ATOM   2349 C  CB    . ILE A  1 285 ? 106.128 17.669  -14.415 1.000 37.620  ? 7080 ILE A CB    1 
ATOM   2350 C  CG1   . ILE A  1 285 ? 106.849 18.882  -15.009 1.000 39.901  ? 7080 ILE A CG1   1 
ATOM   2351 C  CG2   . ILE A  1 285 ? 106.972 16.408  -14.520 1.000 39.710  ? 7080 ILE A CG2   1 
ATOM   2352 C  CD1   . ILE A  1 285 ? 108.121 19.259  -14.290 1.000 41.670  ? 7080 ILE A CD1   1 
ATOM   2353 N  N     . ARG A  1 286 ? 103.802 15.296  -15.579 1.000 36.352  ? 7081 ARG A N     1 
ATOM   2354 C  CA    . ARG A  1 286 ? 103.185 13.969  -15.342 1.000 36.846  ? 7081 ARG A CA    1 
ATOM   2355 C  C     . ARG A  1 286 ? 103.101 13.243  -16.681 1.000 39.266  ? 7081 ARG A C     1 
ATOM   2356 O  O     . ARG A  1 286 ? 103.198 13.918  -17.736 1.000 37.235  ? 7081 ARG A O     1 
ATOM   2357 C  CB    . ARG A  1 286 ? 101.765 14.055  -14.770 1.000 34.295  ? 7081 ARG A CB    1 
ATOM   2358 C  CG    . ARG A  1 286 ? 100.767 14.803  -15.645 1.000 33.791  ? 7081 ARG A CG    1 
ATOM   2359 C  CD    . ARG A  1 286 ? 99.339  14.500  -15.225 1.000 32.489  ? 7081 ARG A CD    1 
ATOM   2360 N  NE    . ARG A  1 286 ? 98.326  15.357  -15.833 1.000 31.717  ? 7081 ARG A NE    1 
ATOM   2361 C  CZ    . ARG A  1 286 ? 97.795  15.187  -17.041 1.000 32.974  ? 7081 ARG A CZ    1 
ATOM   2362 N  NH1   . ARG A  1 286 ? 96.873  16.026  -17.474 1.000 32.742  ? 7081 ARG A NH1   1 
ATOM   2363 N  NH2   . ARG A  1 286 ? 98.197  14.201  -17.822 1.000 34.878  ? 7081 ARG A NH2   1 
ATOM   2364 N  N     . GLU A  1 287 ? 102.980 11.919  -16.626 1.000 42.859  ? 7082 GLU A N     1 
ATOM   2365 C  CA    . GLU A  1 287 ? 102.766 11.139  -17.863 1.000 47.507  ? 7082 GLU A CA    1 
ATOM   2366 C  C     . GLU A  1 287 ? 101.310 11.380  -18.263 1.000 46.818  ? 7082 GLU A C     1 
ATOM   2367 O  O     . GLU A  1 287 ? 100.576 12.017  -17.469 1.000 42.345  ? 7082 GLU A O     1 
ATOM   2368 C  CB    . GLU A  1 287 ? 103.110 9.667   -17.636 1.000 51.845  ? 7082 GLU A CB    1 
ATOM   2369 C  CG    . GLU A  1 287 ? 104.597 9.438   -17.413 1.000 56.784  ? 7082 GLU A CG    1 
ATOM   2370 C  CD    . GLU A  1 287 ? 105.022 7.983   -17.331 1.000 61.973  ? 7082 GLU A CD    1 
ATOM   2371 O  OE1   . GLU A  1 287 ? 104.137 7.111   -17.218 1.000 65.240  ? 7082 GLU A OE1   1 
ATOM   2372 O  OE2   . GLU A  1 287 ? 106.239 7.722   -17.405 1.000 68.139  ? 7082 GLU A OE2   1 
ATOM   2373 N  N     . ASN A  1 288 ? 100.924 10.956  -19.460 1.000 49.532  ? 7083 ASN A N     1 
ATOM   2374 C  CA    . ASN A  1 288 ? 99.521  11.144  -19.905 1.000 52.636  ? 7083 ASN A CA    1 
ATOM   2375 C  C     . ASN A  1 288 ? 99.000  9.774   -20.350 1.000 53.888  ? 7083 ASN A C     1 
ATOM   2376 O  O     . ASN A  1 288 ? 98.616  9.620   -21.518 1.000 55.487  ? 7083 ASN A O     1 
ATOM   2377 C  CB    . ASN A  1 288 ? 99.416  12.278  -20.926 1.000 55.956  ? 7083 ASN A CB    1 
ATOM   2378 C  CG    . ASN A  1 288 ? 97.984  12.592  -21.298 1.000 61.308  ? 7083 ASN A CG    1 
ATOM   2379 O  OD1   . ASN A  1 288 ? 97.363  13.472  -20.696 1.000 61.155  ? 7083 ASN A OD1   1 
ATOM   2380 N  ND2   . ASN A  1 288 ? 97.431  11.826  -22.226 1.000 60.206  ? 7083 ASN A ND2   1 
ATOM   2381 N  N     . ASN A  1 289 ? 99.034  8.818   -19.419 1.000 54.418  ? 7084 ASN A N     1 
ATOM   2382 C  CA    . ASN A  1 289 ? 98.559  7.427   -19.635 1.000 58.151  ? 7084 ASN A CA    1 
ATOM   2383 C  C     . ASN A  1 289 ? 97.039  7.391   -19.446 1.000 56.571  ? 7084 ASN A C     1 
ATOM   2384 O  O     . ASN A  1 289 ? 96.480  8.396   -18.973 1.000 56.708  ? 7084 ASN A O     1 
ATOM   2385 C  CB    . ASN A  1 289 ? 99.243  6.462   -18.664 1.000 58.481  ? 7084 ASN A CB    1 
ATOM   2386 C  CG    . ASN A  1 289 ? 100.753 6.509   -18.755 1.000 60.138  ? 7084 ASN A CG    1 
ATOM   2387 O  OD1   . ASN A  1 289 ? 101.310 6.672   -19.838 1.000 61.511  ? 7084 ASN A OD1   1 
ATOM   2388 N  ND2   . ASN A  1 289 ? 101.423 6.346   -17.625 1.000 58.261  ? 7084 ASN A ND2   1 
ATOM   2389 N  N     . ARG A  1 290 ? 96.408  6.268   -19.792 1.000 56.389  ? 7085 ARG A N     1 
ATOM   2390 C  CA    . ARG A  1 290 ? 94.937  6.113   -19.635 1.000 56.309  ? 7085 ARG A CA    1 
ATOM   2391 C  C     . ARG A  1 290 ? 94.580  6.317   -18.155 1.000 52.947  ? 7085 ARG A C     1 
ATOM   2392 O  O     . ARG A  1 290 ? 95.175  5.620   -17.304 1.000 50.318  ? 7085 ARG A O     1 
ATOM   2393 C  CB    . ARG A  1 290 ? 94.510  4.745   -20.184 1.000 61.057  ? 7085 ARG A CB    1 
ATOM   2394 C  CG    . ARG A  1 290 ? 95.230  3.559   -19.555 1.000 64.032  ? 7085 ARG A CG    1 
ATOM   2395 C  CD    . ARG A  1 290 ? 95.084  2.272   -20.351 1.000 70.413  ? 7085 ARG A CD    1 
ATOM   2396 N  NE    . ARG A  1 290 ? 93.699  1.858   -20.542 1.000 73.429  ? 7085 ARG A NE    1 
ATOM   2397 C  CZ    . ARG A  1 290 ? 93.000  1.091   -19.704 1.000 75.463  ? 7085 ARG A CZ    1 
ATOM   2398 N  NH1   . ARG A  1 290 ? 91.745  0.782   -19.992 1.000 77.797  ? 7085 ARG A NH1   1 
ATOM   2399 N  NH2   . ARG A  1 290 ? 93.543  0.637   -18.584 1.000 73.799  ? 7085 ARG A NH2   1 
ATOM   2400 N  N     . VAL A  1 291 ? 93.683  7.270   -17.864 1.000 49.904  ? 7086 VAL A N     1 
ATOM   2401 C  CA    . VAL A  1 291 ? 93.265  7.554   -16.457 1.000 45.372  ? 7086 VAL A CA    1 
ATOM   2402 C  C     . VAL A  1 291 ? 92.457  6.363   -15.934 1.000 43.953  ? 7086 VAL A C     1 
ATOM   2403 O  O     . VAL A  1 291 ? 91.322  6.158   -16.420 1.000 44.345  ? 7086 VAL A O     1 
ATOM   2404 C  CB    . VAL A  1 291 ? 92.473  8.867   -16.335 1.000 45.934  ? 7086 VAL A CB    1 
ATOM   2405 C  CG1   . VAL A  1 291 ? 91.973  9.076   -14.910 1.000 43.680  ? 7086 VAL A CG1   1 
ATOM   2406 C  CG2   . VAL A  1 291 ? 93.304  10.055  -16.797 1.000 47.432  ? 7086 VAL A CG2   1 
ATOM   2407 N  N     . VAL A  1 292 ? 93.031  5.651   -14.955 1.000 40.722  ? 7087 VAL A N     1 
ATOM   2408 C  CA    . VAL A  1 292 ? 92.438  4.429   -14.336 1.000 40.516  ? 7087 VAL A CA    1 
ATOM   2409 C  C     . VAL A  1 292 ? 92.290  4.640   -12.823 1.000 35.617  ? 7087 VAL A C     1 
ATOM   2410 O  O     . VAL A  1 292 ? 93.288  4.994   -12.158 1.000 35.879  ? 7087 VAL A O     1 
ATOM   2411 C  CB    . VAL A  1 292 ? 93.317  3.205   -14.639 1.000 44.624  ? 7087 VAL A CB    1 
ATOM   2412 C  CG1   . VAL A  1 292 ? 92.808  1.964   -13.931 1.000 46.705  ? 7087 VAL A CG1   1 
ATOM   2413 C  CG2   . VAL A  1 292 ? 93.437  2.966   -16.137 1.000 48.069  ? 7087 VAL A CG2   1 
ATOM   2414 N  N     A ILE A  1 293 ? 91.095  4.391   -12.288 0.500 32.856  ? 7088 ILE A N     1 
ATOM   2415 N  N     B ILE A  1 293 ? 91.075  4.412   -12.309 0.500 32.845  ? 7088 ILE A N     1 
ATOM   2416 C  CA    A ILE A  1 293 ? 90.881  4.564   -10.823 0.500 30.942  ? 7088 ILE A CA    1 
ATOM   2417 C  CA    B ILE A  1 293 ? 90.737  4.620   -10.870 0.500 30.962  ? 7088 ILE A CA    1 
ATOM   2418 C  C     A ILE A  1 293 ? 89.877  3.508   -10.355 0.500 30.218  ? 7088 ILE A C     1 
ATOM   2419 C  C     B ILE A  1 293 ? 89.880  3.455   -10.372 0.500 30.279  ? 7088 ILE A C     1 
ATOM   2420 O  O     A ILE A  1 293 ? 89.118  2.983   -11.194 0.500 30.899  ? 7088 ILE A O     1 
ATOM   2421 O  O     B ILE A  1 293 ? 89.207  2.812   -11.205 0.500 31.121  ? 7088 ILE A O     1 
ATOM   2422 C  CB    A ILE A  1 293 ? 90.423  6.002   -10.507 0.500 29.887  ? 7088 ILE A CB    1 
ATOM   2423 C  CB    B ILE A  1 293 ? 89.942  5.930   -10.704 0.500 29.979  ? 7088 ILE A CB    1 
ATOM   2424 C  CG1   A ILE A  1 293 ? 90.533  6.322   -9.014  0.500 29.125  ? 7088 ILE A CG1   1 
ATOM   2425 C  CG1   B ILE A  1 293 ? 88.522  5.761   -11.248 0.500 31.628  ? 7088 ILE A CG1   1 
ATOM   2426 C  CG2   A ILE A  1 293 ? 89.028  6.238   -11.053 0.500 30.891  ? 7088 ILE A CG2   1 
ATOM   2427 C  CG2   B ILE A  1 293 ? 90.659  7.105   -11.344 0.500 29.518  ? 7088 ILE A CG2   1 
ATOM   2428 C  CD1   A ILE A  1 293 ? 90.230  7.756   -8.657  0.500 28.711  ? 7088 ILE A CD1   1 
ATOM   2429 C  CD1   B ILE A  1 293 ? 87.659  7.002   -11.162 0.500 32.484  ? 7088 ILE A CD1   1 
ATOM   2430 N  N     . SER A  1 294 ? 89.884  3.212   -9.061  1.000 29.105  ? 7089 SER A N     1 
ATOM   2431 C  CA    . SER A  1 294 ? 88.989  2.178   -8.494  1.000 30.798  ? 7089 SER A CA    1 
ATOM   2432 C  C     . SER A  1 294 ? 88.850  2.395   -6.992  1.000 30.919  ? 7089 SER A C     1 
ATOM   2433 O  O     . SER A  1 294 ? 89.673  3.130   -6.405  1.000 28.417  ? 7089 SER A O     1 
ATOM   2434 C  CB    . SER A  1 294 ? 89.506  0.793   -8.769  1.000 32.616  ? 7089 SER A CB    1 
ATOM   2435 O  OG    . SER A  1 294 ? 90.733  0.591   -8.093  1.000 33.381  ? 7089 SER A OG    1 
ATOM   2436 N  N     A SER A  1 295 ? 87.823  1.769   -6.421  0.600 31.611  ? 7090 SER A N     1 
ATOM   2437 N  N     B SER A  1 295 ? 87.819  1.789   -6.397  0.400 31.850  ? 7090 SER A N     1 
ATOM   2438 C  CA    A SER A  1 295 ? 87.549  1.797   -4.965  0.600 32.491  ? 7090 SER A CA    1 
ATOM   2439 C  CA    B SER A  1 295 ? 87.598  1.853   -4.929  0.400 32.750  ? 7090 SER A CA    1 
ATOM   2440 C  C     A SER A  1 295 ? 87.509  0.355   -4.458  0.600 34.006  ? 7090 SER A C     1 
ATOM   2441 C  C     B SER A  1 295 ? 87.471  0.417   -4.410  0.400 34.286  ? 7090 SER A C     1 
ATOM   2442 O  O     A SER A  1 295 ? 86.766  -0.453  -5.047  0.600 34.000  ? 7090 SER A O     1 
ATOM   2443 O  O     B SER A  1 295 ? 86.627  -0.327  -4.947  0.400 34.431  ? 7090 SER A O     1 
ATOM   2444 C  CB    A SER A  1 295 ? 86.267  2.515   -4.651  0.600 32.486  ? 7090 SER A CB    1 
ATOM   2445 C  CB    B SER A  1 295 ? 86.396  2.692   -4.569  0.400 32.791  ? 7090 SER A CB    1 
ATOM   2446 O  OG    A SER A  1 295 ? 85.900  2.289   -3.300  0.600 33.499  ? 7090 SER A OG    1 
ATOM   2447 O  OG    B SER A  1 295 ? 85.194  2.102   -5.040  0.400 34.710  ? 7090 SER A OG    1 
ATOM   2448 N  N     . ASP A  1 296 ? 88.294  0.052   -3.423  1.000 35.410  ? 7091 ASP A N     1 
ATOM   2449 C  CA    . ASP A  1 296 ? 88.306  -1.318  -2.846  1.000 38.963  ? 7091 ASP A CA    1 
ATOM   2450 C  C     . ASP A  1 296 ? 86.922  -1.712  -2.342  1.000 40.563  ? 7091 ASP A C     1 
ATOM   2451 O  O     . ASP A  1 296 ? 86.173  -0.849  -1.870  1.000 39.728  ? 7091 ASP A O     1 
ATOM   2452 C  CB    . ASP A  1 296 ? 89.263  -1.451  -1.661  1.000 41.526  ? 7091 ASP A CB    1 
ATOM   2453 C  CG    . ASP A  1 296 ? 90.721  -1.333  -2.040  1.000 43.557  ? 7091 ASP A CG    1 
ATOM   2454 O  OD1   . ASP A  1 296 ? 91.042  -1.606  -3.215  1.000 46.212  ? 7091 ASP A OD1   1 
ATOM   2455 O  OD2   . ASP A  1 296 ? 91.520  -0.970  -1.155  1.000 52.764  ? 7091 ASP A OD2   1 
ATOM   2456 N  N     . VAL A  1 297 ? 86.614  -2.991  -2.492  1.000 44.749  ? 7092 VAL A N     1 
ATOM   2457 C  CA    . VAL A  1 297 ? 85.366  -3.606  -1.969  1.000 46.360  ? 7092 VAL A CA    1 
ATOM   2458 C  C     . VAL A  1 297 ? 85.832  -4.534  -0.846  1.000 46.709  ? 7092 VAL A C     1 
ATOM   2459 O  O     . VAL A  1 297 ? 86.726  -5.384  -1.126  1.000 43.514  ? 7092 VAL A O     1 
ATOM   2460 C  CB    . VAL A  1 297 ? 84.605  -4.359  -3.078  1.000 50.672  ? 7092 VAL A CB    1 
ATOM   2461 C  CG1   . VAL A  1 297 ? 83.455  -5.200  -2.536  1.000 53.047  ? 7092 VAL A CG1   1 
ATOM   2462 C  CG2   . VAL A  1 297 ? 84.118  -3.416  -4.168  1.000 50.958  ? 7092 VAL A CG2   1 
ATOM   2463 N  N     . LEU A  1 298 ? 85.393  -4.274  0.388   1.000 47.145  ? 7093 LEU A N     1 
ATOM   2464 C  CA    . LEU A  1 298 ? 85.727  -5.186  1.513   1.000 51.904  ? 7093 LEU A CA    1 
ATOM   2465 C  C     . LEU A  1 298 ? 84.801  -6.392  1.364   1.000 52.331  ? 7093 LEU A C     1 
ATOM   2466 O  O     . LEU A  1 298 ? 83.569  -6.188  1.325   1.000 51.402  ? 7093 LEU A O     1 
ATOM   2467 C  CB    . LEU A  1 298 ? 85.529  -4.490  2.864   1.000 56.143  ? 7093 LEU A CB    1 
ATOM   2468 C  CG    . LEU A  1 298 ? 85.702  -5.383  4.095   1.000 61.987  ? 7093 LEU A CG    1 
ATOM   2469 C  CD1   . LEU A  1 298 ? 87.105  -5.974  4.160   1.000 64.308  ? 7093 LEU A CD1   1 
ATOM   2470 C  CD2   . LEU A  1 298 ? 85.393  -4.615  5.374   1.000 65.539  ? 7093 LEU A CD2   1 
ATOM   2471 N  N     . VAL A  1 299 ? 85.369  -7.588  1.229   1.000 53.809  ? 7094 VAL A N     1 
ATOM   2472 C  CA    . VAL A  1 299 ? 84.506  -8.787  1.032   1.000 56.592  ? 7094 VAL A CA    1 
ATOM   2473 C  C     . VAL A  1 299 ? 84.449  -9.582  2.342   1.000 59.803  ? 7094 VAL A C     1 
ATOM   2474 O  O     . VAL A  1 299 ? 85.508  -9.788  2.971   1.000 59.536  ? 7094 VAL A O     1 
ATOM   2475 C  CB    . VAL A  1 299 ? 84.997  -9.620  -0.165  1.000 58.034  ? 7094 VAL A CB    1 
ATOM   2476 C  CG1   . VAL A  1 299 ? 84.963  -8.811  -1.452  1.000 56.619  ? 7094 VAL A CG1   1 
ATOM   2477 C  CG2   . VAL A  1 299 ? 86.391  -10.165 0.055   1.000 60.991  ? 7094 VAL A CG2   1 
ATOM   2478 N  N     . ASN A  1 300 ? 83.236  -9.968  2.743   1.000 62.936  ? 7095 ASN A N     1 
ATOM   2479 C  CA    . ASN A  1 300 ? 83.007  -10.745 3.990   1.000 66.870  ? 7095 ASN A CA    1 
ATOM   2480 C  C     . ASN A  1 300 ? 81.613  -11.384 3.915   1.000 69.399  ? 7095 ASN A C     1 
ATOM   2481 O  O     . ASN A  1 300 ? 80.840  -11.008 3.010   1.000 64.260  ? 7095 ASN A O     1 
ATOM   2482 C  CB    . ASN A  1 300 ? 83.233  -9.876  5.233   1.000 67.127  ? 7095 ASN A CB    1 
ATOM   2483 C  CG    . ASN A  1 300 ? 82.509  -8.547  5.187   1.000 66.946  ? 7095 ASN A CG    1 
ATOM   2484 O  OD1   . ASN A  1 300 ? 81.509  -8.395  4.488   1.000 67.935  ? 7095 ASN A OD1   1 
ATOM   2485 N  ND2   . ASN A  1 300 ? 83.007  -7.572  5.931   1.000 67.909  ? 7095 ASN A ND2   1 
ATOM   2486 N  N     . ASN A  1 301 ? 81.330  -12.337 4.809   1.000 75.489  ? 7096 ASN A N     1 
ATOM   2487 C  CA    . ASN A  1 301 ? 80.017  -13.036 4.846   1.000 79.997  ? 7096 ASN A CA    1 
ATOM   2488 C  C     . ASN A  1 301 ? 78.927  -12.061 5.307   1.000 84.969  ? 7096 ASN A C     1 
ATOM   2489 O  O     . ASN A  1 301 ? 79.188  -11.101 6.038   1.000 89.614  ? 7096 ASN A O     1 
ATOM   2490 C  CB    . ASN A  1 301 ? 80.076  -14.267 5.749   1.000 82.286  ? 7096 ASN A CB    1 
ATOM   2491 C  CG    . ASN A  1 301 ? 81.086  -15.286 5.271   1.000 83.741  ? 7096 ASN A CG    1 
ATOM   2492 O  OD1   . ASN A  1 301 ? 81.788  -15.888 6.078   1.000 86.094  ? 7096 ASN A OD1   1 
ATOM   2493 N  ND2   . ASN A  1 301 ? 81.201  -15.448 3.961   1.000 82.650  ? 7096 ASN A ND2   1 
ATOM   2494 O  OXT   . ASN A  1 301 ? 77.759  -12.221 4.949   1.000 89.556  ? 7096 ASN A OXT   1 
ATOM   2495 N  N     . ALA B  2 21  ? 58.908  -10.434 -20.129 1.000 77.098  ? 4271 ALA B N     1 
ATOM   2496 C  CA    . ALA B  2 21  ? 58.230  -9.246  -20.734 1.000 76.451  ? 4271 ALA B CA    1 
ATOM   2497 C  C     . ALA B  2 21  ? 57.981  -8.175  -19.664 1.000 73.949  ? 4271 ALA B C     1 
ATOM   2498 O  O     . ALA B  2 21  ? 57.828  -6.991  -20.045 1.000 73.891  ? 4271 ALA B O     1 
ATOM   2499 C  CB    . ALA B  2 21  ? 56.941  -9.668  -21.396 1.000 79.274  ? 4271 ALA B CB    1 
ATOM   2500 N  N     . PHE B  2 22  ? 57.945  -8.569  -18.383 1.000 70.256  ? 4272 PHE B N     1 
ATOM   2501 C  CA    . PHE B  2 22  ? 57.704  -7.589  -17.289 1.000 67.347  ? 4272 PHE B CA    1 
ATOM   2502 C  C     . PHE B  2 22  ? 58.779  -6.498  -17.318 1.000 66.012  ? 4272 PHE B C     1 
ATOM   2503 O  O     . PHE B  2 22  ? 59.972  -6.811  -17.488 1.000 66.879  ? 4272 PHE B O     1 
ATOM   2504 C  CB    . PHE B  2 22  ? 57.675  -8.258  -15.912 1.000 65.152  ? 4272 PHE B CB    1 
ATOM   2505 C  CG    . PHE B  2 22  ? 57.545  -7.279  -14.771 1.000 61.353  ? 4272 PHE B CG    1 
ATOM   2506 C  CD1   . PHE B  2 22  ? 56.348  -6.616  -14.539 1.000 60.272  ? 4272 PHE B CD1   1 
ATOM   2507 C  CD2   . PHE B  2 22  ? 58.615  -7.020  -13.927 1.000 58.921  ? 4272 PHE B CD2   1 
ATOM   2508 C  CE1   . PHE B  2 22  ? 56.231  -5.703  -13.500 1.000 59.249  ? 4272 PHE B CE1   1 
ATOM   2509 C  CE2   . PHE B  2 22  ? 58.493  -6.113  -12.883 1.000 57.486  ? 4272 PHE B CE2   1 
ATOM   2510 C  CZ    . PHE B  2 22  ? 57.303  -5.456  -12.671 1.000 57.755  ? 4272 PHE B CZ    1 
ATOM   2511 N  N     . ALA B  2 23  ? 58.347  -5.248  -17.153 1.000 64.950  ? 4273 ALA B N     1 
ATOM   2512 C  CA    . ALA B  2 23  ? 59.272  -4.094  -17.145 1.000 64.107  ? 4273 ALA B CA    1 
ATOM   2513 C  C     . ALA B  2 23  ? 58.686  -3.002  -16.247 1.000 62.240  ? 4273 ALA B C     1 
ATOM   2514 O  O     . ALA B  2 23  ? 57.523  -2.608  -16.479 1.000 62.564  ? 4273 ALA B O     1 
ATOM   2515 C  CB    . ALA B  2 23  ? 59.493  -3.600  -18.554 1.000 64.773  ? 4273 ALA B CB    1 
ATOM   2516 N  N     . VAL B  2 24  ? 59.454  -2.569  -15.243 1.000 60.756  ? 4274 VAL B N     1 
ATOM   2517 C  CA    . VAL B  2 24  ? 59.011  -1.489  -14.313 1.000 59.460  ? 4274 VAL B CA    1 
ATOM   2518 C  C     . VAL B  2 24  ? 58.906  -0.189  -15.123 1.000 57.587  ? 4274 VAL B C     1 
ATOM   2519 O  O     . VAL B  2 24  ? 59.864  0.121   -15.852 1.000 58.512  ? 4274 VAL B O     1 
ATOM   2520 C  CB    . VAL B  2 24  ? 59.980  -1.365  -13.120 1.000 60.757  ? 4274 VAL B CB    1 
ATOM   2521 C  CG1   . VAL B  2 24  ? 59.696  -0.140  -12.265 1.000 61.216  ? 4274 VAL B CG1   1 
ATOM   2522 C  CG2   . VAL B  2 24  ? 59.969  -2.627  -12.272 1.000 62.269  ? 4274 VAL B CG2   1 
ATOM   2523 N  N     . ASP B  2 25  ? 57.765  0.505   -15.039 1.000 55.910  ? 4275 ASP B N     1 
ATOM   2524 C  CA    . ASP B  2 25  ? 57.565  1.775   -15.792 1.000 54.913  ? 4275 ASP B CA    1 
ATOM   2525 C  C     . ASP B  2 25  ? 57.630  2.931   -14.785 1.000 52.112  ? 4275 ASP B C     1 
ATOM   2526 O  O     . ASP B  2 25  ? 56.565  3.417   -14.354 1.000 51.642  ? 4275 ASP B O     1 
ATOM   2527 C  CB    . ASP B  2 25  ? 56.265  1.737   -16.602 1.000 56.832  ? 4275 ASP B CB    1 
ATOM   2528 C  CG    . ASP B  2 25  ? 56.102  2.903   -17.565 1.000 57.440  ? 4275 ASP B CG    1 
ATOM   2529 O  OD1   . ASP B  2 25  ? 56.851  3.897   -17.431 1.000 56.612  ? 4275 ASP B OD1   1 
ATOM   2530 O  OD2   . ASP B  2 25  ? 55.249  2.798   -18.459 1.000 60.264  ? 4275 ASP B OD2   1 
ATOM   2531 N  N     . ALA B  2 26  ? 58.850  3.339   -14.424 1.000 50.344  ? 4276 ALA B N     1 
ATOM   2532 C  CA    . ALA B  2 26  ? 59.065  4.415   -13.427 1.000 47.746  ? 4276 ALA B CA    1 
ATOM   2533 C  C     . ALA B  2 26  ? 58.431  5.727   -13.910 1.000 46.286  ? 4276 ALA B C     1 
ATOM   2534 O  O     . ALA B  2 26  ? 57.783  6.398   -13.079 1.000 45.865  ? 4276 ALA B O     1 
ATOM   2535 C  CB    . ALA B  2 26  ? 60.543  4.569   -13.161 1.000 47.659  ? 4276 ALA B CB    1 
ATOM   2536 N  N     . ALA B  2 27  ? 58.606  6.068   -15.195 1.000 46.305  ? 4277 ALA B N     1 
ATOM   2537 C  CA    . ALA B  2 27  ? 58.052  7.327   -15.753 1.000 47.053  ? 4277 ALA B CA    1 
ATOM   2538 C  C     . ALA B  2 27  ? 56.557  7.417   -15.435 1.000 48.231  ? 4277 ALA B C     1 
ATOM   2539 O  O     . ALA B  2 27  ? 56.151  8.405   -14.799 1.000 46.141  ? 4277 ALA B O     1 
ATOM   2540 C  CB    . ALA B  2 27  ? 58.303  7.402   -17.240 1.000 48.782  ? 4277 ALA B CB    1 
ATOM   2541 N  N     . LYS B  2 28  ? 55.787  6.400   -15.840 1.000 51.553  ? 4278 LYS B N     1 
ATOM   2542 C  CA    . LYS B  2 28  ? 54.315  6.360   -15.613 1.000 53.472  ? 4278 LYS B CA    1 
ATOM   2543 C  C     . LYS B  2 28  ? 54.009  6.448   -14.114 1.000 50.121  ? 4278 LYS B C     1 
ATOM   2544 O  O     . LYS B  2 28  ? 53.072  7.190   -13.746 1.000 49.667  ? 4278 LYS B O     1 
ATOM   2545 C  CB    . LYS B  2 28  ? 53.725  5.076   -16.208 1.000 60.165  ? 4278 LYS B CB    1 
ATOM   2546 C  CG    . LYS B  2 28  ? 52.248  4.838   -15.916 1.000 65.205  ? 4278 LYS B CG    1 
ATOM   2547 C  CD    . LYS B  2 28  ? 51.734  3.517   -16.450 1.000 70.923  ? 4278 LYS B CD    1 
ATOM   2548 C  CE    . LYS B  2 28  ? 50.325  3.200   -15.991 1.000 76.557  ? 4278 LYS B CE    1 
ATOM   2549 N  NZ    . LYS B  2 28  ? 49.366  4.266   -16.368 1.000 80.261  ? 4278 LYS B NZ    1 
ATOM   2550 N  N     . ALA B  2 29  ? 54.763  5.712   -13.291 1.000 47.569  ? 4279 ALA B N     1 
ATOM   2551 C  CA    . ALA B  2 29  ? 54.550  5.698   -11.822 1.000 48.138  ? 4279 ALA B CA    1 
ATOM   2552 C  C     . ALA B  2 29  ? 54.743  7.105   -11.236 1.000 45.872  ? 4279 ALA B C     1 
ATOM   2553 O  O     . ALA B  2 29  ? 53.927  7.508   -10.381 1.000 45.731  ? 4279 ALA B O     1 
ATOM   2554 C  CB    . ALA B  2 29  ? 55.480  4.697   -11.175 1.000 47.698  ? 4279 ALA B CB    1 
ATOM   2555 N  N     . TYR B  2 30  ? 55.775  7.829   -11.676 1.000 46.212  ? 4280 TYR B N     1 
ATOM   2556 C  CA    . TYR B  2 30  ? 56.005  9.197   -11.136 1.000 44.875  ? 4280 TYR B CA    1 
ATOM   2557 C  C     . TYR B  2 30  ? 54.849  10.113  -11.563 1.000 45.101  ? 4280 TYR B C     1 
ATOM   2558 O  O     . TYR B  2 30  ? 54.351  10.872  -10.716 1.000 44.395  ? 4280 TYR B O     1 
ATOM   2559 C  CB    . TYR B  2 30  ? 57.372  9.738   -11.566 1.000 44.872  ? 4280 TYR B CB    1 
ATOM   2560 C  CG    . TYR B  2 30  ? 57.735  11.073  -10.958 1.000 43.911  ? 4280 TYR B CG    1 
ATOM   2561 C  CD1   . TYR B  2 30  ? 58.002  11.183  -9.603  1.000 44.634  ? 4280 TYR B CD1   1 
ATOM   2562 C  CD2   . TYR B  2 30  ? 57.850  12.217  -11.731 1.000 44.055  ? 4280 TYR B CD2   1 
ATOM   2563 C  CE1   . TYR B  2 30  ? 58.346  12.395  -9.027  1.000 44.559  ? 4280 TYR B CE1   1 
ATOM   2564 C  CE2   . TYR B  2 30  ? 58.200  13.437  -11.172 1.000 43.473  ? 4280 TYR B CE2   1 
ATOM   2565 C  CZ    . TYR B  2 30  ? 58.450  13.529  -9.814  1.000 43.423  ? 4280 TYR B CZ    1 
ATOM   2566 O  OH    . TYR B  2 30  ? 58.801  14.720  -9.243  1.000 41.681  ? 4280 TYR B OH    1 
ATOM   2567 N  N     . LYS B  2 31  ? 54.406  10.008  -12.819 1.000 47.689  ? 4281 LYS B N     1 
ATOM   2568 C  CA    . LYS B  2 31  ? 53.300  10.863  -13.335 1.000 50.417  ? 4281 LYS B CA    1 
ATOM   2569 C  C     . LYS B  2 31  ? 52.007  10.577  -12.555 1.000 51.531  ? 4281 LYS B C     1 
ATOM   2570 O  O     . LYS B  2 31  ? 51.312  11.550  -12.200 1.000 51.008  ? 4281 LYS B O     1 
ATOM   2571 C  CB    . LYS B  2 31  ? 53.151  10.652  -14.843 1.000 53.622  ? 4281 LYS B CB    1 
ATOM   2572 C  CG    . LYS B  2 31  ? 54.372  11.071  -15.650 1.000 54.686  ? 4281 LYS B CG    1 
ATOM   2573 C  CD    . LYS B  2 31  ? 54.314  10.681  -17.107 1.000 58.217  ? 4281 LYS B CD    1 
ATOM   2574 C  CE    . LYS B  2 31  ? 55.585  11.037  -17.848 1.000 59.547  ? 4281 LYS B CE    1 
ATOM   2575 N  NZ    . LYS B  2 31  ? 55.571  10.529  -19.239 1.000 62.507  ? 4281 LYS B NZ    1 
ATOM   2576 N  N     . ASP B  2 32  ? 51.698  9.300   -12.299 1.000 54.164  ? 4282 ASP B N     1 
ATOM   2577 C  CA    . ASP B  2 32  ? 50.481  8.934   -11.520 1.000 56.292  ? 4282 ASP B CA    1 
ATOM   2578 C  C     . ASP B  2 32  ? 50.619  9.483   -10.093 1.000 55.042  ? 4282 ASP B C     1 
ATOM   2579 O  O     . ASP B  2 32  ? 49.614  10.003  -9.559  1.000 55.745  ? 4282 ASP B O     1 
ATOM   2580 C  CB    . ASP B  2 32  ? 50.243  7.421   -11.540 1.000 59.694  ? 4282 ASP B CB    1 
ATOM   2581 C  CG    . ASP B  2 32  ? 49.864  6.880   -12.910 1.000 62.114  ? 4282 ASP B CG    1 
ATOM   2582 O  OD1   . ASP B  2 32  ? 49.371  7.672   -13.739 1.000 63.461  ? 4282 ASP B OD1   1 
ATOM   2583 O  OD2   . ASP B  2 32  ? 50.086  5.675   -13.145 1.000 66.133  ? 4282 ASP B OD2   1 
ATOM   2584 N  N     . TYR B  2 33  ? 51.815  9.359   -9.505  1.000 52.714  ? 4283 TYR B N     1 
ATOM   2585 C  CA    . TYR B  2 33  ? 52.111  9.886   -8.144  1.000 52.312  ? 4283 TYR B CA    1 
ATOM   2586 C  C     . TYR B  2 33  ? 51.821  11.395  -8.108  1.000 51.538  ? 4283 TYR B C     1 
ATOM   2587 O  O     . TYR B  2 33  ? 51.136  11.854  -7.171  1.000 51.200  ? 4283 TYR B O     1 
ATOM   2588 C  CB    . TYR B  2 33  ? 53.555  9.541   -7.766  1.000 52.282  ? 4283 TYR B CB    1 
ATOM   2589 C  CG    . TYR B  2 33  ? 54.122  10.288  -6.585  1.000 53.396  ? 4283 TYR B CG    1 
ATOM   2590 C  CD1   . TYR B  2 33  ? 53.921  9.854   -5.283  1.000 53.923  ? 4283 TYR B CD1   1 
ATOM   2591 C  CD2   . TYR B  2 33  ? 54.911  11.409  -6.780  1.000 53.028  ? 4283 TYR B CD2   1 
ATOM   2592 C  CE1   . TYR B  2 33  ? 54.462  10.537  -4.205  1.000 54.156  ? 4283 TYR B CE1   1 
ATOM   2593 C  CE2   . TYR B  2 33  ? 55.461  12.101  -5.715  1.000 52.944  ? 4283 TYR B CE2   1 
ATOM   2594 C  CZ    . TYR B  2 33  ? 55.238  11.663  -4.422  1.000 55.065  ? 4283 TYR B CZ    1 
ATOM   2595 O  OH    . TYR B  2 33  ? 55.781  12.353  -3.377  1.000 55.714  ? 4283 TYR B OH    1 
ATOM   2596 N  N     . LEU B  2 34  ? 52.321  12.136  -9.103  1.000 50.675  ? 4284 LEU B N     1 
ATOM   2597 C  CA    . LEU B  2 34  ? 52.093  13.607  -9.189  1.000 51.816  ? 4284 LEU B CA    1 
ATOM   2598 C  C     . LEU B  2 34  ? 50.594  13.893  -9.342  1.000 54.198  ? 4284 LEU B C     1 
ATOM   2599 O  O     . LEU B  2 34  ? 50.092  14.793  -8.642  1.000 53.910  ? 4284 LEU B O     1 
ATOM   2600 C  CB    . LEU B  2 34  ? 52.866  14.178  -10.381 1.000 51.716  ? 4284 LEU B CB    1 
ATOM   2601 C  CG    . LEU B  2 34  ? 54.388  14.129  -10.273 1.000 50.992  ? 4284 LEU B CG    1 
ATOM   2602 C  CD1   . LEU B  2 34  ? 55.028  14.609  -11.565 1.000 52.251  ? 4284 LEU B CD1   1 
ATOM   2603 C  CD2   . LEU B  2 34  ? 54.873  14.957  -9.093  1.000 51.819  ? 4284 LEU B CD2   1 
ATOM   2604 N  N     . ALA B  2 35  ? 49.919  13.154  -10.229 1.000 56.512  ? 4285 ALA B N     1 
ATOM   2605 C  CA    . ALA B  2 35  ? 48.468  13.352  -10.469 1.000 61.012  ? 4285 ALA B CA    1 
ATOM   2606 C  C     . ALA B  2 35  ? 47.681  13.110  -9.174  1.000 63.276  ? 4285 ALA B C     1 
ATOM   2607 O  O     . ALA B  2 35  ? 46.641  13.765  -8.997  1.000 65.468  ? 4285 ALA B O     1 
ATOM   2608 C  CB    . ALA B  2 35  ? 47.997  12.444  -11.579 1.000 61.658  ? 4285 ALA B CB    1 
ATOM   2609 N  N     . SER B  2 36  ? 48.180  12.228  -8.298  1.000 63.706  ? 4286 SER B N     1 
ATOM   2610 C  CA    . SER B  2 36  ? 47.500  11.909  -7.012  1.000 67.015  ? 4286 SER B CA    1 
ATOM   2611 C  C     . SER B  2 36  ? 47.800  12.971  -5.944  1.000 66.470  ? 4286 SER B C     1 
ATOM   2612 O  O     . SER B  2 36  ? 47.222  12.869  -4.845  1.000 68.443  ? 4286 SER B O     1 
ATOM   2613 C  CB    . SER B  2 36  ? 47.889  10.537  -6.527  1.000 69.075  ? 4286 SER B CB    1 
ATOM   2614 O  OG    . SER B  2 36  ? 47.473  9.541   -7.449  1.000 71.975  ? 4286 SER B OG    1 
ATOM   2615 N  N     . GLY B  2 37  ? 48.670  13.941  -6.249  1.000 63.308  ? 4287 GLY B N     1 
ATOM   2616 C  CA    . GLY B  2 37  ? 49.022  15.007  -5.288  1.000 62.889  ? 4287 GLY B CA    1 
ATOM   2617 C  C     . GLY B  2 37  ? 50.356  14.740  -4.608  1.000 61.199  ? 4287 GLY B C     1 
ATOM   2618 O  O     . GLY B  2 37  ? 50.647  15.412  -3.597  1.000 61.029  ? 4287 GLY B O     1 
ATOM   2619 N  N     . GLY B  2 38  ? 51.140  13.796  -5.144  1.000 58.658  ? 4288 GLY B N     1 
ATOM   2620 C  CA    . GLY B  2 38  ? 52.458  13.456  -4.575  1.000 56.757  ? 4288 GLY B CA    1 
ATOM   2621 C  C     . GLY B  2 38  ? 53.418  14.636  -4.629  1.000 54.108  ? 4288 GLY B C     1 
ATOM   2622 O  O     . GLY B  2 38  ? 53.326  15.431  -5.585  1.000 53.103  ? 4288 GLY B O     1 
ATOM   2623 N  N     . GLN B  2 39  ? 54.292  14.757  -3.625  1.000 53.959  ? 4289 GLN B N     1 
ATOM   2624 C  CA    . GLN B  2 39  ? 55.291  15.857  -3.556  1.000 52.821  ? 4289 GLN B CA    1 
ATOM   2625 C  C     . GLN B  2 39  ? 56.388  15.601  -4.591  1.000 46.859  ? 4289 GLN B C     1 
ATOM   2626 O  O     . GLN B  2 39  ? 57.018  14.548  -4.589  1.000 46.059  ? 4289 GLN B O     1 
ATOM   2627 C  CB    . GLN B  2 39  ? 55.868  15.942  -2.140  1.000 57.340  ? 4289 GLN B CB    1 
ATOM   2628 C  CG    . GLN B  2 39  ? 56.839  17.100  -1.934  1.000 61.292  ? 4289 GLN B CG    1 
ATOM   2629 C  CD    . GLN B  2 39  ? 57.407  17.134  -0.534  1.000 68.459  ? 4289 GLN B CD    1 
ATOM   2630 O  OE1   . GLN B  2 39  ? 57.183  16.234  0.278   1.000 73.604  ? 4289 GLN B OE1   1 
ATOM   2631 N  NE2   . GLN B  2 39  ? 58.164  18.179  -0.239  1.000 72.052  ? 4289 GLN B NE2   1 
ATOM   2632 N  N     . PRO B  2 40  ? 56.655  16.544  -5.519  1.000 49.642  ? 4290 PRO B N     1 
ATOM   2633 C  CA    . PRO B  2 40  ? 57.712  16.351  -6.511  1.000 46.108  ? 4290 PRO B CA    1 
ATOM   2634 C  C     . PRO B  2 40  ? 59.085  16.041  -5.894  1.000 42.854  ? 4290 PRO B C     1 
ATOM   2635 O  O     . PRO B  2 40  ? 59.338  16.477  -4.786  1.000 41.386  ? 4290 PRO B O     1 
ATOM   2636 C  CB    . PRO B  2 40  ? 57.782  17.706  -7.229  1.000 45.760  ? 4290 PRO B CB    1 
ATOM   2637 C  CG    . PRO B  2 40  ? 56.399  18.297  -7.049  1.000 48.285  ? 4290 PRO B CG    1 
ATOM   2638 C  CD    . PRO B  2 40  ? 55.947  17.822  -5.685  1.000 49.814  ? 4290 PRO B CD    1 
ATOM   2639 N  N     . ILE B  2 41  ? 59.912  15.273  -6.613  1.000 40.292  ? 4291 ILE B N     1 
ATOM   2640 C  CA    . ILE B  2 41  ? 61.300  14.967  -6.161  1.000 38.283  ? 4291 ILE B CA    1 
ATOM   2641 C  C     . ILE B  2 41  ? 61.984  16.308  -5.889  1.000 36.346  ? 4291 ILE B C     1 
ATOM   2642 O  O     . ILE B  2 41  ? 61.835  17.228  -6.713  1.000 34.266  ? 4291 ILE B O     1 
ATOM   2643 C  CB    . ILE B  2 41  ? 62.038  14.114  -7.210  1.000 38.438  ? 4291 ILE B CB    1 
ATOM   2644 C  CG1   . ILE B  2 41  ? 61.439  12.705  -7.267  1.000 40.023  ? 4291 ILE B CG1   1 
ATOM   2645 C  CG2   . ILE B  2 41  ? 63.536  14.091  -6.933  1.000 36.923  ? 4291 ILE B CG2   1 
ATOM   2646 C  CD1   . ILE B  2 41  ? 61.914  11.870  -8.427  1.000 40.531  ? 4291 ILE B CD1   1 
ATOM   2647 N  N     A THR B  2 42  ? 62.721  16.391  -4.778  0.700 35.755  ? 4292 THR B N     1 
ATOM   2648 N  N     B THR B  2 42  ? 62.705  16.413  -4.768  0.300 35.417  ? 4292 THR B N     1 
ATOM   2649 C  CA    A THR B  2 42  ? 63.382  17.656  -4.365  0.700 34.866  ? 4292 THR B CA    1 
ATOM   2650 C  CA    B THR B  2 42  ? 63.364  17.692  -4.391  0.300 34.219  ? 4292 THR B CA    1 
ATOM   2651 C  C     A THR B  2 42  ? 64.905  17.545  -4.492  0.700 32.713  ? 4292 THR B C     1 
ATOM   2652 C  C     B THR B  2 42  ? 64.888  17.549  -4.474  0.300 32.485  ? 4292 THR B C     1 
ATOM   2653 O  O     A THR B  2 42  ? 65.403  16.493  -4.953  0.700 30.927  ? 4292 THR B O     1 
ATOM   2654 O  O     B THR B  2 42  ? 65.369  16.472  -4.886  0.300 31.667  ? 4292 THR B O     1 
ATOM   2655 C  CB    A THR B  2 42  ? 62.995  18.011  -2.922  0.700 37.105  ? 4292 THR B CB    1 
ATOM   2656 C  CB    B THR B  2 42  ? 62.922  18.133  -2.988  0.300 35.499  ? 4292 THR B CB    1 
ATOM   2657 O  OG1   A THR B  2 42  ? 63.459  16.967  -2.063  0.700 37.243  ? 4292 THR B OG1   1 
ATOM   2658 O  OG1   B THR B  2 42  ? 63.396  19.460  -2.752  0.300 34.573  ? 4292 THR B OG1   1 
ATOM   2659 C  CG2   A THR B  2 42  ? 61.504  18.198  -2.739  0.700 39.396  ? 4292 THR B CG2   1 
ATOM   2660 C  CG2   B THR B  2 42  ? 63.412  17.203  -1.899  0.300 35.859  ? 4292 THR B CG2   1 
ATOM   2661 N  N     . ASN B  2 43  ? 65.599  18.621  -4.108  1.000 31.242  ? 4293 ASN B N     1 
ATOM   2662 C  CA    . ASN B  2 43  ? 67.082  18.679  -4.100  1.000 30.579  ? 4293 ASN B CA    1 
ATOM   2663 C  C     . ASN B  2 43  ? 67.654  18.591  -5.517  1.000 29.413  ? 4293 ASN B C     1 
ATOM   2664 O  O     . ASN B  2 43  ? 68.806  18.124  -5.647  1.000 28.381  ? 4293 ASN B O     1 
ATOM   2665 C  CB    . ASN B  2 43  ? 67.649  17.694  -3.074  1.000 32.054  ? 4293 ASN B CB    1 
ATOM   2666 C  CG    . ASN B  2 43  ? 67.280  18.128  -1.671  1.000 34.631  ? 4293 ASN B CG    1 
ATOM   2667 O  OD1   . ASN B  2 43  ? 67.247  19.324  -1.391  1.000 38.720  ? 4293 ASN B OD1   1 
ATOM   2668 N  ND2   . ASN B  2 43  ? 66.976  17.187  -0.797  1.000 36.327  ? 4293 ASN B ND2   1 
ATOM   2669 N  N     . CYS B  2 44  ? 66.879  18.992  -6.533  1.000 28.591  ? 4294 CYS B N     1 
ATOM   2670 C  CA    . CYS B  2 44  ? 67.487  19.139  -7.877  1.000 27.863  ? 4294 CYS B CA    1 
ATOM   2671 C  C     . CYS B  2 44  ? 68.484  20.295  -7.715  1.000 27.454  ? 4294 CYS B C     1 
ATOM   2672 O  O     . CYS B  2 44  ? 68.135  21.270  -7.019  1.000 27.859  ? 4294 CYS B O     1 
ATOM   2673 C  CB    . CYS B  2 44  ? 66.441  19.402  -8.953  1.000 29.852  ? 4294 CYS B CB    1 
ATOM   2674 S  SG    . CYS B  2 44  ? 65.248  18.048  -9.118  1.000 31.744  ? 4294 CYS B SG    1 
ATOM   2675 N  N     . VAL B  2 45  ? 69.679  20.184  -8.293  1.000 26.029  ? 4295 VAL B N     1 
ATOM   2676 C  CA    . VAL B  2 45  ? 70.751  21.192  -8.030  1.000 24.805  ? 4295 VAL B CA    1 
ATOM   2677 C  C     . VAL B  2 45  ? 70.641  22.374  -8.990  1.000 24.065  ? 4295 VAL B C     1 
ATOM   2678 O  O     . VAL B  2 45  ? 71.065  22.246  -10.150 1.000 23.942  ? 4295 VAL B O     1 
ATOM   2679 C  CB    . VAL B  2 45  ? 72.137  20.530  -8.097  1.000 24.526  ? 4295 VAL B CB    1 
ATOM   2680 C  CG1   . VAL B  2 45  ? 73.256  21.530  -7.846  1.000 23.903  ? 4295 VAL B CG1   1 
ATOM   2681 C  CG2   . VAL B  2 45  ? 72.225  19.370  -7.115  1.000 25.141  ? 4295 VAL B CG2   1 
ATOM   2682 N  N     . LYS B  2 46  ? 70.121  23.491  -8.488  1.000 24.627  ? 4296 LYS B N     1 
ATOM   2683 C  CA    . LYS B  2 46  ? 69.996  24.713  -9.317  1.000 25.820  ? 4296 LYS B CA    1 
ATOM   2684 C  C     . LYS B  2 46  ? 71.347  25.432  -9.348  1.000 24.491  ? 4296 LYS B C     1 
ATOM   2685 O  O     . LYS B  2 46  ? 71.962  25.619  -8.266  1.000 24.016  ? 4296 LYS B O     1 
ATOM   2686 C  CB    . LYS B  2 46  ? 68.895  25.631  -8.793  1.000 27.407  ? 4296 LYS B CB    1 
ATOM   2687 C  CG    . LYS B  2 46  ? 68.575  26.759  -9.761  1.000 30.030  ? 4296 LYS B CG    1 
ATOM   2688 C  CD    . LYS B  2 46  ? 67.269  27.456  -9.522  1.000 32.631  ? 4296 LYS B CD    1 
ATOM   2689 C  CE    . LYS B  2 46  ? 67.251  28.331  -8.297  1.000 33.848  ? 4296 LYS B CE    1 
ATOM   2690 N  NZ    . LYS B  2 46  ? 66.059  29.221  -8.310  1.000 35.716  ? 4296 LYS B NZ    1 
ATOM   2691 N  N     . MET B  2 47  ? 71.764  25.848  -10.541 1.000 23.700  ? 4297 MET B N     1 
ATOM   2692 C  CA    . MET B  2 47  ? 73.075  26.513  -10.711 1.000 24.138  ? 4297 MET B CA    1 
ATOM   2693 C  C     . MET B  2 47  ? 72.927  28.041  -10.749 1.000 25.161  ? 4297 MET B C     1 
ATOM   2694 O  O     . MET B  2 47  ? 71.840  28.556  -11.109 1.000 24.143  ? 4297 MET B O     1 
ATOM   2695 C  CB    . MET B  2 47  ? 73.721  26.078  -12.028 1.000 24.667  ? 4297 MET B CB    1 
ATOM   2696 C  CG    . MET B  2 47  ? 73.660  24.588  -12.291 1.000 24.553  ? 4297 MET B CG    1 
ATOM   2697 S  SD    . MET B  2 47  ? 74.307  23.598  -10.930 1.000 24.956  ? 4297 MET B SD    1 
ATOM   2698 C  CE    . MET B  2 47  ? 75.967  24.256  -10.780 1.000 24.891  ? 4297 MET B CE    1 
ATOM   2699 N  N     . LEU B  2 48  ? 73.993  28.731  -10.352 1.000 25.259  ? 4298 LEU B N     1 
ATOM   2700 C  CA    . LEU B  2 48  ? 74.057  30.200  -10.514 1.000 26.025  ? 4298 LEU B CA    1 
ATOM   2701 C  C     . LEU B  2 48  ? 74.511  30.453  -11.953 1.000 26.699  ? 4298 LEU B C     1 
ATOM   2702 O  O     . LEU B  2 48  ? 75.422  29.745  -12.419 1.000 26.664  ? 4298 LEU B O     1 
ATOM   2703 C  CB    . LEU B  2 48  ? 75.047  30.785  -9.509  1.000 25.952  ? 4298 LEU B CB    1 
ATOM   2704 C  CG    . LEU B  2 48  ? 74.554  30.805  -8.064  1.000 26.617  ? 4298 LEU B CG    1 
ATOM   2705 C  CD1   . LEU B  2 48  ? 75.717  30.945  -7.100  1.000 27.327  ? 4298 LEU B CD1   1 
ATOM   2706 C  CD2   . LEU B  2 48  ? 73.533  31.923  -7.867  1.000 27.512  ? 4298 LEU B CD2   1 
ATOM   2707 N  N     . CYS B  2 49  ? 73.847  31.364  -12.648 1.000 28.247  ? 4299 CYS B N     1 
ATOM   2708 C  CA    . CYS B  2 49  ? 74.240  31.695  -14.041 1.000 29.014  ? 4299 CYS B CA    1 
ATOM   2709 C  C     . CYS B  2 49  ? 73.727  33.099  -14.370 1.000 29.081  ? 4299 CYS B C     1 
ATOM   2710 O  O     . CYS B  2 49  ? 73.000  33.668  -13.541 1.000 28.201  ? 4299 CYS B O     1 
ATOM   2711 C  CB    . CYS B  2 49  ? 73.755  30.634  -15.023 1.000 30.437  ? 4299 CYS B CB    1 
ATOM   2712 S  SG    . CYS B  2 49  ? 71.964  30.368  -15.010 1.000 33.309  ? 4299 CYS B SG    1 
ATOM   2713 N  N     . THR B  2 50  ? 74.127  33.640  -15.518 1.000 29.822  ? 4300 THR B N     1 
ATOM   2714 C  CA    . THR B  2 50  ? 73.747  35.021  -15.922 1.000 30.492  ? 4300 THR B CA    1 
ATOM   2715 C  C     . THR B  2 50  ? 72.299  35.098  -16.409 1.000 30.601  ? 4300 THR B C     1 
ATOM   2716 O  O     . THR B  2 50  ? 71.749  36.214  -16.416 1.000 30.771  ? 4300 THR B O     1 
ATOM   2717 C  CB    . THR B  2 50  ? 74.664  35.507  -17.046 1.000 31.476  ? 4300 THR B CB    1 
ATOM   2718 O  OG1   . THR B  2 50  ? 74.463  34.602  -18.130 1.000 31.503  ? 4300 THR B OG1   1 
ATOM   2719 C  CG2   . THR B  2 50  ? 76.122  35.534  -16.644 1.000 31.708  ? 4300 THR B CG2   1 
ATOM   2720 N  N     . HIS B  2 51  ? 71.709  33.970  -16.804 1.000 29.695  ? 4301 HIS B N     1 
ATOM   2721 C  CA    . HIS B  2 51  ? 70.335  33.985  -17.382 1.000 31.363  ? 4301 HIS B CA    1 
ATOM   2722 C  C     . HIS B  2 51  ? 70.327  34.792  -18.691 1.000 32.426  ? 4301 HIS B C     1 
ATOM   2723 O  O     . HIS B  2 51  ? 69.297  35.427  -19.006 1.000 34.355  ? 4301 HIS B O     1 
ATOM   2724 C  CB    . HIS B  2 51  ? 69.309  34.445  -16.340 1.000 31.909  ? 4301 HIS B CB    1 
ATOM   2725 C  CG    . HIS B  2 51  ? 69.170  33.455  -15.237 1.000 30.788  ? 4301 HIS B CG    1 
ATOM   2726 N  ND1   . HIS B  2 51  ? 68.213  32.463  -15.263 1.000 31.036  ? 4301 HIS B ND1   1 
ATOM   2727 C  CD2   . HIS B  2 51  ? 69.895  33.259  -14.116 1.000 30.526  ? 4301 HIS B CD2   1 
ATOM   2728 C  CE1   . HIS B  2 51  ? 68.341  31.711  -14.191 1.000 30.639  ? 4301 HIS B CE1   1 
ATOM   2729 N  NE2   . HIS B  2 51  ? 69.372  32.167  -13.475 1.000 29.900  ? 4301 HIS B NE2   1 
ATOM   2730 N  N     . THR B  2 52  ? 71.438  34.744  -19.429 1.000 32.784  ? 4302 THR B N     1 
ATOM   2731 C  CA    . THR B  2 52  ? 71.571  35.403  -20.755 1.000 34.487  ? 4302 THR B CA    1 
ATOM   2732 C  C     . THR B  2 52  ? 72.065  34.340  -21.748 1.000 34.666  ? 4302 THR B C     1 
ATOM   2733 O  O     . THR B  2 52  ? 72.740  34.705  -22.724 1.000 36.142  ? 4302 THR B O     1 
ATOM   2734 C  CB    . THR B  2 52  ? 72.502  36.623  -20.699 1.000 35.145  ? 4302 THR B CB    1 
ATOM   2735 O  OG1   . THR B  2 52  ? 73.793  36.155  -20.316 1.000 33.472  ? 4302 THR B OG1   1 
ATOM   2736 C  CG2   . THR B  2 52  ? 72.035  37.707  -19.748 1.000 35.519  ? 4302 THR B CG2   1 
ATOM   2737 N  N     . GLY B  2 53  ? 71.727  33.074  -21.484 1.000 34.887  ? 4303 GLY B N     1 
ATOM   2738 C  CA    . GLY B  2 53  ? 72.154  31.926  -22.310 1.000 34.714  ? 4303 GLY B CA    1 
ATOM   2739 C  C     . GLY B  2 53  ? 71.268  31.691  -23.523 1.000 35.387  ? 4303 GLY B C     1 
ATOM   2740 O  O     . GLY B  2 53  ? 70.293  32.443  -23.714 1.000 36.017  ? 4303 GLY B O     1 
ATOM   2741 N  N     . THR B  2 54  ? 71.571  30.633  -24.280 1.000 35.584  ? 4304 THR B N     1 
ATOM   2742 C  CA    . THR B  2 54  ? 70.858  30.285  -25.541 1.000 37.521  ? 4304 THR B CA    1 
ATOM   2743 C  C     . THR B  2 54  ? 69.426  29.806  -25.279 1.000 37.256  ? 4304 THR B C     1 
ATOM   2744 O  O     . THR B  2 54  ? 68.606  29.887  -26.209 1.000 37.056  ? 4304 THR B O     1 
ATOM   2745 C  CB    . THR B  2 54  ? 71.606  29.180  -26.292 1.000 38.335  ? 4304 THR B CB    1 
ATOM   2746 O  OG1   . THR B  2 54  ? 71.578  28.024  -25.454 1.000 35.926  ? 4304 THR B OG1   1 
ATOM   2747 C  CG2   . THR B  2 54  ? 73.034  29.556  -26.630 1.000 39.146  ? 4304 THR B CG2   1 
ATOM   2748 N  N     . GLY B  2 55  ? 69.140  29.297  -24.081 1.000 35.301  ? 4305 GLY B N     1 
ATOM   2749 C  CA    . GLY B  2 55  ? 67.787  28.776  -23.799 1.000 36.374  ? 4305 GLY B CA    1 
ATOM   2750 C  C     . GLY B  2 55  ? 67.594  27.344  -24.307 1.000 36.907  ? 4305 GLY B C     1 
ATOM   2751 O  O     . GLY B  2 55  ? 66.439  26.810  -24.183 1.000 38.418  ? 4305 GLY B O     1 
ATOM   2752 N  N     . GLN B  2 56  ? 68.660  26.727  -24.853 1.000 36.637  ? 4306 GLN B N     1 
ATOM   2753 C  CA    . GLN B  2 56  ? 68.545  25.313  -25.311 1.000 37.754  ? 4306 GLN B CA    1 
ATOM   2754 C  C     . GLN B  2 56  ? 68.268  24.415  -24.092 1.000 35.300  ? 4306 GLN B C     1 
ATOM   2755 O  O     . GLN B  2 56  ? 68.692  24.770  -22.974 1.000 32.593  ? 4306 GLN B O     1 
ATOM   2756 C  CB    . GLN B  2 56  ? 69.780  24.887  -26.107 1.000 39.622  ? 4306 GLN B CB    1 
ATOM   2757 C  CG    . GLN B  2 56  ? 69.875  25.569  -27.466 1.000 44.001  ? 4306 GLN B CG    1 
ATOM   2758 C  CD    . GLN B  2 56  ? 70.940  24.963  -28.345 1.000 47.101  ? 4306 GLN B CD    1 
ATOM   2759 O  OE1   . GLN B  2 56  ? 72.080  24.764  -27.938 1.000 50.501  ? 4306 GLN B OE1   1 
ATOM   2760 N  NE2   . GLN B  2 56  ? 70.576  24.679  -29.580 1.000 50.747  ? 4306 GLN B NE2   1 
ATOM   2761 N  N     . ALA B  2 57  ? 67.611  23.277  -24.331 1.000 35.261  ? 4307 ALA B N     1 
ATOM   2762 C  CA    . ALA B  2 57  ? 67.145  22.336  -23.283 1.000 34.924  ? 4307 ALA B CA    1 
ATOM   2763 C  C     . ALA B  2 57  ? 68.284  21.691  -22.482 1.000 33.778  ? 4307 ALA B C     1 
ATOM   2764 O  O     . ALA B  2 57  ? 68.257  21.814  -21.250 1.000 33.095  ? 4307 ALA B O     1 
ATOM   2765 C  CB    . ALA B  2 57  ? 66.283  21.279  -23.926 1.000 36.943  ? 4307 ALA B CB    1 
ATOM   2766 N  N     . ILE B  2 58  ? 69.184  20.956  -23.139 1.000 34.366  ? 4308 ILE B N     1 
ATOM   2767 C  CA    . ILE B  2 58  ? 70.276  20.228  -22.421 1.000 33.474  ? 4308 ILE B CA    1 
ATOM   2768 C  C     . ILE B  2 58  ? 71.609  20.698  -23.000 1.000 33.129  ? 4308 ILE B C     1 
ATOM   2769 O  O     . ILE B  2 58  ? 71.809  20.537  -24.210 1.000 33.672  ? 4308 ILE B O     1 
ATOM   2770 C  CB    . ILE B  2 58  ? 70.085  18.704  -22.528 1.000 34.848  ? 4308 ILE B CB    1 
ATOM   2771 C  CG1   . ILE B  2 58  ? 68.682  18.281  -22.083 1.000 35.510  ? 4308 ILE B CG1   1 
ATOM   2772 C  CG2   . ILE B  2 58  ? 71.167  17.976  -21.743 1.000 34.055  ? 4308 ILE B CG2   1 
ATOM   2773 C  CD1   . ILE B  2 58  ? 68.358  16.831  -22.357 1.000 36.840  ? 4308 ILE B CD1   1 
ATOM   2774 N  N     . THR B  2 59  ? 72.488  21.226  -22.146 1.000 30.955  ? 4309 THR B N     1 
ATOM   2775 C  CA    . THR B  2 59  ? 73.741  21.860  -22.628 1.000 31.137  ? 4309 THR B CA    1 
ATOM   2776 C  C     . THR B  2 59  ? 74.941  21.457  -21.768 1.000 30.565  ? 4309 THR B C     1 
ATOM   2777 O  O     . THR B  2 59  ? 74.729  21.003  -20.626 1.000 29.747  ? 4309 THR B O     1 
ATOM   2778 C  CB    . THR B  2 59  ? 73.522  23.375  -22.657 1.000 31.825  ? 4309 THR B CB    1 
ATOM   2779 O  OG1   . THR B  2 59  ? 73.119  23.772  -21.345 1.000 30.436  ? 4309 THR B OG1   1 
ATOM   2780 C  CG2   . THR B  2 59  ? 72.463  23.788  -23.657 1.000 33.701  ? 4309 THR B CG2   1 
ATOM   2781 N  N     . VAL B  2 60  ? 76.152  21.689  -22.288 1.000 31.140  ? 4310 VAL B N     1 
ATOM   2782 C  CA    . VAL B  2 60  ? 77.423  21.287  -21.607 1.000 31.006  ? 4310 VAL B CA    1 
ATOM   2783 C  C     . VAL B  2 60  ? 77.706  22.242  -20.441 1.000 29.990  ? 4310 VAL B C     1 
ATOM   2784 O  O     . VAL B  2 60  ? 78.513  21.883  -19.553 1.000 27.712  ? 4310 VAL B O     1 
ATOM   2785 C  CB    . VAL B  2 60  ? 78.598  21.241  -22.602 1.000 33.085  ? 4310 VAL B CB    1 
ATOM   2786 C  CG1   . VAL B  2 60  ? 78.371  20.197  -23.689 1.000 35.529  ? 4310 VAL B CG1   1 
ATOM   2787 C  CG2   . VAL B  2 60  ? 78.885  22.602  -23.218 1.000 34.023  ? 4310 VAL B CG2   1 
ATOM   2788 N  N     . THR B  2 61  ? 77.063  23.410  -20.460 1.000 30.212  ? 4311 THR B N     1 
ATOM   2789 C  CA    . THR B  2 61  ? 77.210  24.431  -19.399 1.000 31.227  ? 4311 THR B CA    1 
ATOM   2790 C  C     . THR B  2 61  ? 75.860  25.123  -19.249 1.000 30.716  ? 4311 THR B C     1 
ATOM   2791 O  O     . THR B  2 61  ? 75.057  25.088  -20.180 1.000 31.348  ? 4311 THR B O     1 
ATOM   2792 C  CB    . THR B  2 61  ? 78.345  25.399  -19.752 1.000 33.430  ? 4311 THR B CB    1 
ATOM   2793 O  OG1   . THR B  2 61  ? 78.685  26.134  -18.581 1.000 36.351  ? 4311 THR B OG1   1 
ATOM   2794 C  CG2   . THR B  2 61  ? 77.980  26.341  -20.877 1.000 34.871  ? 4311 THR B CG2   1 
ATOM   2795 N  N     . PRO B  2 62  ? 75.542  25.730  -18.081 1.000 29.472  ? 4312 PRO B N     1 
ATOM   2796 C  CA    . PRO B  2 62  ? 74.262  26.424  -17.899 1.000 29.138  ? 4312 PRO B CA    1 
ATOM   2797 C  C     . PRO B  2 62  ? 73.968  27.426  -19.027 1.000 29.850  ? 4312 PRO B C     1 
ATOM   2798 O  O     . PRO B  2 62  ? 74.811  28.249  -19.327 1.000 29.964  ? 4312 PRO B O     1 
ATOM   2799 C  CB    . PRO B  2 62  ? 74.438  27.104  -16.537 1.000 28.530  ? 4312 PRO B CB    1 
ATOM   2800 C  CG    . PRO B  2 62  ? 75.332  26.132  -15.787 1.000 28.400  ? 4312 PRO B CG    1 
ATOM   2801 C  CD    . PRO B  2 62  ? 76.327  25.680  -16.838 1.000 29.598  ? 4312 PRO B CD    1 
ATOM   2802 N  N     . GLU B  2 63  ? 72.781  27.311  -19.629 1.000 30.661  ? 4313 GLU B N     1 
ATOM   2803 C  CA    . GLU B  2 63  ? 72.385  28.188  -20.764 1.000 31.569  ? 4313 GLU B CA    1 
ATOM   2804 C  C     . GLU B  2 63  ? 70.994  28.777  -20.528 1.000 31.712  ? 4313 GLU B C     1 
ATOM   2805 O  O     . GLU B  2 63  ? 70.346  29.161  -21.517 1.000 33.348  ? 4313 GLU B O     1 
ATOM   2806 C  CB    . GLU B  2 63  ? 72.445  27.392  -22.066 1.000 32.819  ? 4313 GLU B CB    1 
ATOM   2807 C  CG    . GLU B  2 63  ? 73.858  27.130  -22.541 1.000 33.509  ? 4313 GLU B CG    1 
ATOM   2808 C  CD    . GLU B  2 63  ? 74.603  28.356  -23.038 1.000 35.373  ? 4313 GLU B CD    1 
ATOM   2809 O  OE1   . GLU B  2 63  ? 73.977  29.435  -23.140 1.000 36.563  ? 4313 GLU B OE1   1 
ATOM   2810 O  OE2   . GLU B  2 63  ? 75.800  28.227  -23.343 1.000 36.059  ? 4313 GLU B OE2   1 
ATOM   2811 N  N     . ALA B  2 64  ? 70.583  28.901  -19.264 1.000 30.086  ? 4314 ALA B N     1 
ATOM   2812 C  CA    . ALA B  2 64  ? 69.250  29.467  -18.966 1.000 30.868  ? 4314 ALA B CA    1 
ATOM   2813 C  C     . ALA B  2 64  ? 69.123  30.878  -19.545 1.000 31.751  ? 4314 ALA B C     1 
ATOM   2814 O  O     . ALA B  2 64  ? 70.133  31.614  -19.566 1.000 29.802  ? 4314 ALA B O     1 
ATOM   2815 C  CB    . ALA B  2 64  ? 69.013  29.494  -17.478 1.000 30.571  ? 4314 ALA B CB    1 
ATOM   2816 N  N     . ASN B  2 65  ? 67.929  31.199  -20.048 1.000 33.038  ? 4315 ASN B N     1 
ATOM   2817 C  CA    . ASN B  2 65  ? 67.603  32.567  -20.519 1.000 34.950  ? 4315 ASN B CA    1 
ATOM   2818 C  C     . ASN B  2 65  ? 66.860  33.219  -19.343 1.000 35.626  ? 4315 ASN B C     1 
ATOM   2819 O  O     . ASN B  2 65  ? 66.842  32.612  -18.254 1.000 32.470  ? 4315 ASN B O     1 
ATOM   2820 C  CB    . ASN B  2 65  ? 66.877  32.556  -21.871 1.000 36.107  ? 4315 ASN B CB    1 
ATOM   2821 C  CG    . ASN B  2 65  ? 65.539  31.854  -21.826 1.000 36.630  ? 4315 ASN B CG    1 
ATOM   2822 O  OD1   . ASN B  2 65  ? 64.955  31.708  -20.758 1.000 35.775  ? 4315 ASN B OD1   1 
ATOM   2823 N  ND2   . ASN B  2 65  ? 65.034  31.452  -22.984 1.000 38.059  ? 4315 ASN B ND2   1 
ATOM   2824 N  N     A MET B  2 66  ? 66.241  34.385  -19.560 0.500 37.475  ? 4316 MET B N     1 
ATOM   2825 N  N     B MET B  2 66  ? 66.240  34.379  -19.568 0.500 37.468  ? 4316 MET B N     1 
ATOM   2826 C  CA    A MET B  2 66  ? 65.547  35.111  -18.458 0.500 38.996  ? 4316 MET B CA    1 
ATOM   2827 C  CA    B MET B  2 66  ? 65.533  35.129  -18.494 0.500 39.036  ? 4316 MET B CA    1 
ATOM   2828 C  C     A MET B  2 66  ? 64.308  34.342  -17.979 0.500 38.593  ? 4316 MET B C     1 
ATOM   2829 C  C     B MET B  2 66  ? 64.280  34.382  -18.011 0.500 38.659  ? 4316 MET B C     1 
ATOM   2830 O  O     A MET B  2 66  ? 63.856  34.629  -16.853 0.500 38.933  ? 4316 MET B O     1 
ATOM   2831 O  O     B MET B  2 66  ? 63.787  34.731  -16.922 0.500 39.092  ? 4316 MET B O     1 
ATOM   2832 C  CB    A MET B  2 66  ? 65.111  36.512  -18.905 0.500 42.361  ? 4316 MET B CB    1 
ATOM   2833 C  CB    B MET B  2 66  ? 65.133  36.513  -19.016 0.500 42.391  ? 4316 MET B CB    1 
ATOM   2834 C  CG    A MET B  2 66  ? 64.592  37.372  -17.757 0.500 44.085  ? 4316 MET B CG    1 
ATOM   2835 C  CG    B MET B  2 66  ? 64.212  36.458  -20.214 0.500 44.791  ? 4316 MET B CG    1 
ATOM   2836 S  SD    A MET B  2 66  ? 64.073  39.034  -18.268 0.500 47.762  ? 4316 MET B SD    1 
ATOM   2837 S  SD    B MET B  2 66  ? 64.102  38.042  -21.082 0.500 49.531  ? 4316 MET B SD    1 
ATOM   2838 C  CE    A MET B  2 66  ? 62.643  38.653  -19.278 0.500 49.978  ? 4316 MET B CE    1 
ATOM   2839 C  CE    B MET B  2 66  ? 63.558  39.130  -19.764 0.500 50.543  ? 4316 MET B CE    1 
ATOM   2840 N  N     . ASP B  2 67  ? 63.800  33.391  -18.772 1.000 37.947  ? 4317 ASP B N     1 
ATOM   2841 C  CA    . ASP B  2 67  ? 62.564  32.640  -18.398 1.000 38.228  ? 4317 ASP B CA    1 
ATOM   2842 C  C     . ASP B  2 67  ? 62.867  31.191  -18.000 1.000 35.520  ? 4317 ASP B C     1 
ATOM   2843 O  O     . ASP B  2 67  ? 61.912  30.378  -17.964 1.000 34.563  ? 4317 ASP B O     1 
ATOM   2844 C  CB    . ASP B  2 67  ? 61.568  32.676  -19.552 1.000 41.296  ? 4317 ASP B CB    1 
ATOM   2845 C  CG    . ASP B  2 67  ? 61.136  34.090  -19.897 1.000 43.575  ? 4317 ASP B CG    1 
ATOM   2846 O  OD1   . ASP B  2 67  ? 61.006  34.915  -18.960 1.000 44.246  ? 4317 ASP B OD1   1 
ATOM   2847 O  OD2   . ASP B  2 67  ? 61.001  34.368  -21.090 1.000 47.229  ? 4317 ASP B OD2   1 
ATOM   2848 N  N     . GLN B  2 68  ? 64.120  30.890  -17.658 1.000 33.049  ? 4318 GLN B N     1 
ATOM   2849 C  CA    . GLN B  2 68  ? 64.477  29.499  -17.287 1.000 31.564  ? 4318 GLN B CA    1 
ATOM   2850 C  C     . GLN B  2 68  ? 65.432  29.473  -16.094 1.000 30.469  ? 4318 GLN B C     1 
ATOM   2851 O  O     . GLN B  2 68  ? 66.040  30.510  -15.783 1.000 28.659  ? 4318 GLN B O     1 
ATOM   2852 C  CB    . GLN B  2 68  ? 65.221  28.817  -18.434 1.000 31.693  ? 4318 GLN B CB    1 
ATOM   2853 C  CG    . GLN B  2 68  ? 64.425  28.636  -19.719 1.000 32.899  ? 4318 GLN B CG    1 
ATOM   2854 C  CD    . GLN B  2 68  ? 65.360  28.257  -20.840 1.000 32.613  ? 4318 GLN B CD    1 
ATOM   2855 O  OE1   . GLN B  2 68  ? 66.529  28.636  -20.834 1.000 32.163  ? 4318 GLN B OE1   1 
ATOM   2856 N  NE2   . GLN B  2 68  ? 64.849  27.543  -21.828 1.000 33.007  ? 4318 GLN B NE2   1 
ATOM   2857 N  N     . GLU B  2 69  ? 65.532  28.299  -15.475 1.000 29.965  ? 4319 GLU B N     1 
ATOM   2858 C  CA    . GLU B  2 69  ? 66.505  28.002  -14.402 1.000 29.590  ? 4319 GLU B CA    1 
ATOM   2859 C  C     . GLU B  2 69  ? 67.378  26.870  -14.943 1.000 28.851  ? 4319 GLU B C     1 
ATOM   2860 O  O     . GLU B  2 69  ? 66.822  26.010  -15.667 1.000 29.928  ? 4319 GLU B O     1 
ATOM   2861 C  CB    . GLU B  2 69  ? 65.798  27.565  -13.118 1.000 30.991  ? 4319 GLU B CB    1 
ATOM   2862 C  CG    . GLU B  2 69  ? 65.005  28.663  -12.443 1.000 33.590  ? 4319 GLU B CG    1 
ATOM   2863 C  CD    . GLU B  2 69  ? 65.842  29.680  -11.689 1.000 35.467  ? 4319 GLU B CD    1 
ATOM   2864 O  OE1   . GLU B  2 69  ? 65.282  30.331  -10.786 1.000 37.202  ? 4319 GLU B OE1   1 
ATOM   2865 O  OE2   . GLU B  2 69  ? 67.061  29.798  -11.978 1.000 36.659  ? 4319 GLU B OE2   1 
ATOM   2866 N  N     . SER B  2 70  ? 68.679  26.894  -14.645 1.000 28.120  ? 4320 SER B N     1 
ATOM   2867 C  CA    . SER B  2 70  ? 69.617  25.822  -15.071 1.000 27.003  ? 4320 SER B CA    1 
ATOM   2868 C  C     . SER B  2 70  ? 69.880  24.909  -13.873 1.000 26.303  ? 4320 SER B C     1 
ATOM   2869 O  O     . SER B  2 70  ? 70.085  25.431  -12.753 1.000 26.345  ? 4320 SER B O     1 
ATOM   2870 C  CB    . SER B  2 70  ? 70.905  26.370  -15.620 1.000 27.219  ? 4320 SER B CB    1 
ATOM   2871 O  OG    . SER B  2 70  ? 70.689  27.053  -16.839 1.000 28.190  ? 4320 SER B OG    1 
ATOM   2872 N  N     . PHE B  2 71  ? 69.836  23.598  -14.103 1.000 25.733  ? 4321 PHE B N     1 
ATOM   2873 C  CA    . PHE B  2 71  ? 70.071  22.607  -13.026 1.000 24.837  ? 4321 PHE B CA    1 
ATOM   2874 C  C     . PHE B  2 71  ? 71.108  21.576  -13.464 1.000 24.679  ? 4321 PHE B C     1 
ATOM   2875 O  O     . PHE B  2 71  ? 71.213  21.327  -14.687 1.000 25.256  ? 4321 PHE B O     1 
ATOM   2876 C  CB    . PHE B  2 71  ? 68.790  21.821  -12.718 1.000 25.391  ? 4321 PHE B CB    1 
ATOM   2877 C  CG    . PHE B  2 71  ? 67.668  22.606  -12.095 1.000 25.858  ? 4321 PHE B CG    1 
ATOM   2878 C  CD1   . PHE B  2 71  ? 66.776  23.321  -12.878 1.000 26.712  ? 4321 PHE B CD1   1 
ATOM   2879 C  CD2   . PHE B  2 71  ? 67.474  22.593  -10.721 1.000 26.006  ? 4321 PHE B CD2   1 
ATOM   2880 C  CE1   . PHE B  2 71  ? 65.737  24.031  -12.297 1.000 27.457  ? 4321 PHE B CE1   1 
ATOM   2881 C  CE2   . PHE B  2 71  ? 66.433  23.303  -10.142 1.000 26.458  ? 4321 PHE B CE2   1 
ATOM   2882 C  CZ    . PHE B  2 71  ? 65.567  24.021  -10.933 1.000 27.411  ? 4321 PHE B CZ    1 
ATOM   2883 N  N     . GLY B  2 72  ? 71.883  21.046  -12.507 1.000 24.686  ? 4322 GLY B N     1 
ATOM   2884 C  CA    . GLY B  2 72  ? 72.755  19.895  -12.817 1.000 25.006  ? 4322 GLY B CA    1 
ATOM   2885 C  C     . GLY B  2 72  ? 71.862  18.780  -13.341 1.000 25.999  ? 4322 GLY B C     1 
ATOM   2886 O  O     . GLY B  2 72  ? 70.829  18.503  -12.698 1.000 26.625  ? 4322 GLY B O     1 
ATOM   2887 N  N     . GLY B  2 73  ? 72.220  18.172  -14.469 1.000 27.648  ? 4323 GLY B N     1 
ATOM   2888 C  CA    . GLY B  2 73  ? 71.345  17.186  -15.140 1.000 28.352  ? 4323 GLY B CA    1 
ATOM   2889 C  C     . GLY B  2 73  ? 71.058  15.931  -14.335 1.000 29.166  ? 4323 GLY B C     1 
ATOM   2890 O  O     . GLY B  2 73  ? 69.872  15.514  -14.289 1.000 29.542  ? 4323 GLY B O     1 
ATOM   2891 N  N     . ALA B  2 74  ? 72.095  15.317  -13.762 1.000 28.753  ? 4324 ALA B N     1 
ATOM   2892 C  CA    . ALA B  2 74  ? 71.915  14.055  -13.007 1.000 28.834  ? 4324 ALA B CA    1 
ATOM   2893 C  C     . ALA B  2 74  ? 70.837  14.228  -11.931 1.000 28.778  ? 4324 ALA B C     1 
ATOM   2894 O  O     . ALA B  2 74  ? 70.005  13.320  -11.782 1.000 29.760  ? 4324 ALA B O     1 
ATOM   2895 C  CB    . ALA B  2 74  ? 73.233  13.634  -12.407 1.000 28.484  ? 4324 ALA B CB    1 
ATOM   2896 N  N     . SER B  2 75  ? 70.825  15.377  -11.251 1.000 27.603  ? 4325 SER B N     1 
ATOM   2897 C  CA    . SER B  2 75  ? 69.867  15.613  -10.137 1.000 27.631  ? 4325 SER B CA    1 
ATOM   2898 C  C     . SER B  2 75  ? 68.432  15.748  -10.660 1.000 28.347  ? 4325 SER B C     1 
ATOM   2899 O  O     . SER B  2 75  ? 67.508  15.598  -9.842  1.000 29.882  ? 4325 SER B O     1 
ATOM   2900 C  CB    . SER B  2 75  ? 70.271  16.820  -9.304  1.000 27.228  ? 4325 SER B CB    1 
ATOM   2901 O  OG    . SER B  2 75  ? 70.070  18.040  -10.014 1.000 26.760  ? 4325 SER B OG    1 
ATOM   2902 N  N     . CYS B  2 76  ? 68.252  15.969  -11.968 1.000 29.062  ? 4326 CYS B N     1 
ATOM   2903 C  CA    . CYS B  2 76  ? 66.894  16.137  -12.557 1.000 30.517  ? 4326 CYS B CA    1 
ATOM   2904 C  C     . CYS B  2 76  ? 66.460  14.885  -13.328 1.000 32.424  ? 4326 CYS B C     1 
ATOM   2905 O  O     . CYS B  2 76  ? 65.406  14.928  -13.987 1.000 33.629  ? 4326 CYS B O     1 
ATOM   2906 C  CB    . CYS B  2 76  ? 66.868  17.328  -13.500 1.000 31.065  ? 4326 CYS B CB    1 
ATOM   2907 S  SG    . CYS B  2 76  ? 67.294  18.874  -12.669 1.000 31.400  ? 4326 CYS B SG    1 
ATOM   2908 N  N     . CYS B  2 77  ? 67.253  13.821  -13.264 1.000 32.247  ? 4327 CYS B N     1 
ATOM   2909 C  CA    . CYS B  2 77  ? 66.921  12.587  -14.012 1.000 33.553  ? 4327 CYS B CA    1 
ATOM   2910 C  C     . CYS B  2 77  ? 66.236  11.585  -13.085 1.000 34.211  ? 4327 CYS B C     1 
ATOM   2911 O  O     . CYS B  2 77  ? 66.859  11.190  -12.088 1.000 32.982  ? 4327 CYS B O     1 
ATOM   2912 C  CB    . CYS B  2 77  ? 68.182  11.989  -14.605 1.000 34.848  ? 4327 CYS B CB    1 
ATOM   2913 S  SG    . CYS B  2 77  ? 67.906  10.378  -15.383 1.000 36.984  ? 4327 CYS B SG    1 
ATOM   2914 N  N     . LEU B  2 78  ? 65.003  11.196  -13.415 1.000 35.269  ? 4328 LEU B N     1 
ATOM   2915 C  CA    . LEU B  2 78  ? 64.241  10.218  -12.589 1.000 37.505  ? 4328 LEU B CA    1 
ATOM   2916 C  C     . LEU B  2 78  ? 65.055  8.935   -12.391 1.000 37.543  ? 4328 LEU B C     1 
ATOM   2917 O  O     . LEU B  2 78  ? 65.071  8.409   -11.267 1.000 37.836  ? 4328 LEU B O     1 
ATOM   2918 C  CB    . LEU B  2 78  ? 62.926  9.878   -13.294 1.000 39.325  ? 4328 LEU B CB    1 
ATOM   2919 C  CG    . LEU B  2 78  ? 62.051  8.856   -12.567 1.000 42.002  ? 4328 LEU B CG    1 
ATOM   2920 C  CD1   . LEU B  2 78  ? 61.468  9.459   -11.297 1.000 42.531  ? 4328 LEU B CD1   1 
ATOM   2921 C  CD2   . LEU B  2 78  ? 60.941  8.343   -13.466 1.000 44.311  ? 4328 LEU B CD2   1 
ATOM   2922 N  N     . TYR B  2 79  ? 65.664  8.437   -13.468 1.000 38.623  ? 4329 TYR B N     1 
ATOM   2923 C  CA    . TYR B  2 79  ? 66.417  7.155   -13.445 1.000 39.189  ? 4329 TYR B CA    1 
ATOM   2924 C  C     . TYR B  2 79  ? 67.653  7.299   -12.551 1.000 38.083  ? 4329 TYR B C     1 
ATOM   2925 O  O     . TYR B  2 79  ? 67.885  6.395   -11.725 1.000 37.493  ? 4329 TYR B O     1 
ATOM   2926 C  CB    . TYR B  2 79  ? 66.689  6.726   -14.887 1.000 40.438  ? 4329 TYR B CB    1 
ATOM   2927 C  CG    . TYR B  2 79  ? 65.428  6.716   -15.712 1.000 42.863  ? 4329 TYR B CG    1 
ATOM   2928 C  CD1   . TYR B  2 79  ? 64.497  5.700   -15.575 1.000 45.313  ? 4329 TYR B CD1   1 
ATOM   2929 C  CD2   . TYR B  2 79  ? 65.125  7.758   -16.576 1.000 43.321  ? 4329 TYR B CD2   1 
ATOM   2930 C  CE1   . TYR B  2 79  ? 63.315  5.699   -16.296 1.000 47.318  ? 4329 TYR B CE1   1 
ATOM   2931 C  CE2   . TYR B  2 79  ? 63.949  7.771   -17.308 1.000 44.983  ? 4329 TYR B CE2   1 
ATOM   2932 C  CZ    . TYR B  2 79  ? 63.041  6.737   -17.168 1.000 47.520  ? 4329 TYR B CZ    1 
ATOM   2933 O  OH    . TYR B  2 79  ? 61.880  6.739   -17.881 1.000 49.976  ? 4329 TYR B OH    1 
ATOM   2934 N  N     . CYS B  2 80  ? 68.404  8.395   -12.703 1.000 36.227  ? 4330 CYS B N     1 
ATOM   2935 C  CA    . CYS B  2 80  ? 69.582  8.640   -11.829 1.000 35.452  ? 4330 CYS B CA    1 
ATOM   2936 C  C     . CYS B  2 80  ? 69.134  8.745   -10.365 1.000 34.569  ? 4330 CYS B C     1 
ATOM   2937 O  O     . CYS B  2 80  ? 69.721  8.054   -9.514  1.000 35.164  ? 4330 CYS B O     1 
ATOM   2938 C  CB    . CYS B  2 80  ? 70.314  9.926   -12.205 1.000 35.220  ? 4330 CYS B CB    1 
ATOM   2939 S  SG    . CYS B  2 80  ? 71.343  9.813   -13.694 1.000 36.561  ? 4330 CYS B SG    1 
ATOM   2940 N  N     . ARG B  2 81  ? 68.109  9.561   -10.099 1.000 33.718  ? 4331 ARG B N     1 
ATOM   2941 C  CA    . ARG B  2 81  ? 67.646  9.826   -8.710  1.000 33.595  ? 4331 ARG B CA    1 
ATOM   2942 C  C     . ARG B  2 81  ? 67.014  8.586   -8.066  1.000 36.225  ? 4331 ARG B C     1 
ATOM   2943 O  O     . ARG B  2 81  ? 67.236  8.387   -6.864  1.000 36.456  ? 4331 ARG B O     1 
ATOM   2944 C  CB    . ARG B  2 81  ? 66.666  11.001  -8.713  1.000 32.972  ? 4331 ARG B CB    1 
ATOM   2945 C  CG    . ARG B  2 81  ? 67.301  12.336  -9.073  1.000 31.203  ? 4331 ARG B CG    1 
ATOM   2946 C  CD    . ARG B  2 81  ? 68.356  12.782  -8.076  1.000 30.331  ? 4331 ARG B CD    1 
ATOM   2947 N  NE    . ARG B  2 81  ? 67.812  12.889  -6.728  1.000 30.667  ? 4331 ARG B NE    1 
ATOM   2948 C  CZ    . ARG B  2 81  ? 67.185  13.956  -6.240  1.000 30.506  ? 4331 ARG B CZ    1 
ATOM   2949 N  NH1   . ARG B  2 81  ? 67.005  15.035  -6.986  1.000 30.302  ? 4331 ARG B NH1   1 
ATOM   2950 N  NH2   . ARG B  2 81  ? 66.730  13.937  -5.000  1.000 31.340  ? 4331 ARG B NH2   1 
ATOM   2951 N  N     . CYS B  2 82  ? 66.260  7.789   -8.821  1.000 39.326  ? 4332 CYS B N     1 
ATOM   2952 C  CA    . CYS B  2 82  ? 65.597  6.598   -8.220  1.000 42.996  ? 4332 CYS B CA    1 
ATOM   2953 C  C     . CYS B  2 82  ? 66.524  5.378   -8.240  1.000 43.966  ? 4332 CYS B C     1 
ATOM   2954 O  O     . CYS B  2 82  ? 66.121  4.343   -7.672  1.000 44.344  ? 4332 CYS B O     1 
ATOM   2955 C  CB    . CYS B  2 82  ? 64.298  6.272   -8.943  1.000 45.128  ? 4332 CYS B CB    1 
ATOM   2956 S  SG    . CYS B  2 82  ? 63.024  7.534   -8.710  1.000 48.751  ? 4332 CYS B SG    1 
ATOM   2957 N  N     . HIS B  2 83  ? 67.708  5.506   -8.847  1.000 44.655  ? 4333 HIS B N     1 
ATOM   2958 C  CA    . HIS B  2 83  ? 68.683  4.385   -8.963  1.000 50.326  ? 4333 HIS B CA    1 
ATOM   2959 C  C     . HIS B  2 83  ? 68.027  3.249   -9.758  1.000 53.259  ? 4333 HIS B C     1 
ATOM   2960 O  O     . HIS B  2 83  ? 67.988  2.106   -9.262  1.000 56.251  ? 4333 HIS B O     1 
ATOM   2961 C  CB    . HIS B  2 83  ? 69.203  3.980   -7.576  1.000 53.809  ? 4333 HIS B CB    1 
ATOM   2962 C  CG    . HIS B  2 83  ? 69.838  5.120   -6.858  1.000 56.217  ? 4333 HIS B CG    1 
ATOM   2963 N  ND1   . HIS B  2 83  ? 71.178  5.431   -7.004  1.000 59.853  ? 4333 HIS B ND1   1 
ATOM   2964 C  CD2   . HIS B  2 83  ? 69.316  6.063   -6.042  1.000 59.254  ? 4333 HIS B CD2   1 
ATOM   2965 C  CE1   . HIS B  2 83  ? 71.461  6.500   -6.285  1.000 60.340  ? 4333 HIS B CE1   1 
ATOM   2966 N  NE2   . HIS B  2 83  ? 70.332  6.911   -5.691  1.000 60.037  ? 4333 HIS B NE2   1 
ATOM   2967 N  N     . ILE B  2 84  ? 67.521  3.594   -10.945 1.000 53.459  ? 4334 ILE B N     1 
ATOM   2968 C  CA    . ILE B  2 84  ? 66.827  2.671   -11.890 1.000 56.058  ? 4334 ILE B CA    1 
ATOM   2969 C  C     . ILE B  2 84  ? 67.580  2.710   -13.221 1.000 54.474  ? 4334 ILE B C     1 
ATOM   2970 O  O     . ILE B  2 84  ? 68.230  3.743   -13.499 1.000 52.120  ? 4334 ILE B O     1 
ATOM   2971 C  CB    . ILE B  2 84  ? 65.351  3.092   -12.064 1.000 59.235  ? 4334 ILE B CB    1 
ATOM   2972 C  CG1   . ILE B  2 84  ? 64.583  3.011   -10.742 1.000 61.155  ? 4334 ILE B CG1   1 
ATOM   2973 C  CG2   . ILE B  2 84  ? 64.674  2.274   -13.156 1.000 63.903  ? 4334 ILE B CG2   1 
ATOM   2974 C  CD1   . ILE B  2 84  ? 63.175  3.563   -10.812 1.000 61.527  ? 4334 ILE B CD1   1 
ATOM   2975 N  N     . ASP B  2 85  ? 67.498  1.629   -14.001 1.000 53.164  ? 4335 ASP B N     1 
ATOM   2976 C  CA    . ASP B  2 85  ? 68.154  1.565   -15.334 1.000 53.339  ? 4335 ASP B CA    1 
ATOM   2977 C  C     . ASP B  2 85  ? 67.537  2.626   -16.249 1.000 52.081  ? 4335 ASP B C     1 
ATOM   2978 O  O     . ASP B  2 85  ? 66.326  2.896   -16.112 1.000 51.169  ? 4335 ASP B O     1 
ATOM   2979 C  CB    . ASP B  2 85  ? 67.972  0.195   -16.000 1.000 56.962  ? 4335 ASP B CB    1 
ATOM   2980 C  CG    . ASP B  2 85  ? 68.678  -0.959  -15.312 1.000 58.383  ? 4335 ASP B CG    1 
ATOM   2981 O  OD1   . ASP B  2 85  ? 69.650  -0.702  -14.578 1.000 58.377  ? 4335 ASP B OD1   1 
ATOM   2982 O  OD2   . ASP B  2 85  ? 68.249  -2.109  -15.522 1.000 63.636  ? 4335 ASP B OD2   1 
ATOM   2983 N  N     . HIS B  2 86  ? 68.341  3.200   -17.145 1.000 51.048  ? 4336 HIS B N     1 
ATOM   2984 C  CA    . HIS B  2 86  ? 67.818  4.191   -18.124 1.000 51.509  ? 4336 HIS B CA    1 
ATOM   2985 C  C     . HIS B  2 86  ? 67.064  3.420   -19.204 1.000 54.926  ? 4336 HIS B C     1 
ATOM   2986 O  O     . HIS B  2 86  ? 67.565  2.413   -19.686 1.000 54.093  ? 4336 HIS B O     1 
ATOM   2987 C  CB    . HIS B  2 86  ? 68.957  5.073   -18.643 1.000 50.210  ? 4336 HIS B CB    1 
ATOM   2988 C  CG    . HIS B  2 86  ? 69.477  5.996   -17.596 1.000 47.180  ? 4336 HIS B CG    1 
ATOM   2989 N  ND1   . HIS B  2 86  ? 70.380  5.593   -16.630 1.000 46.304  ? 4336 HIS B ND1   1 
ATOM   2990 C  CD2   . HIS B  2 86  ? 69.191  7.290   -17.337 1.000 45.178  ? 4336 HIS B CD2   1 
ATOM   2991 C  CE1   . HIS B  2 86  ? 70.636  6.613   -15.830 1.000 45.278  ? 4336 HIS B CE1   1 
ATOM   2992 N  NE2   . HIS B  2 86  ? 69.915  7.656   -16.247 1.000 43.812  ? 4336 HIS B NE2   1 
ATOM   2993 N  N     . PRO B  2 87  ? 65.860  3.877   -19.624 1.000 58.167  ? 4337 PRO B N     1 
ATOM   2994 C  CA    . PRO B  2 87  ? 65.038  3.140   -20.591 1.000 64.440  ? 4337 PRO B CA    1 
ATOM   2995 C  C     . PRO B  2 87  ? 65.576  3.096   -22.031 1.000 68.090  ? 4337 PRO B C     1 
ATOM   2996 O  O     . PRO B  2 87  ? 64.912  3.586   -22.928 1.000 71.348  ? 4337 PRO B O     1 
ATOM   2997 C  CB    . PRO B  2 87  ? 63.700  3.897   -20.528 1.000 63.771  ? 4337 PRO B CB    1 
ATOM   2998 C  CG    . PRO B  2 87  ? 64.109  5.317   -20.209 1.000 60.530  ? 4337 PRO B CG    1 
ATOM   2999 C  CD    . PRO B  2 87  ? 65.248  5.154   -19.224 1.000 57.750  ? 4337 PRO B CD    1 
ATOM   3000 N  N     . ASN B  2 88  ? 66.749  2.486   -22.217 1.000 69.829  ? 4338 ASN B N     1 
ATOM   3001 C  CA    . ASN B  2 88  ? 67.360  2.340   -23.565 1.000 72.843  ? 4338 ASN B CA    1 
ATOM   3002 C  C     . ASN B  2 88  ? 68.414  1.237   -23.479 1.000 76.042  ? 4338 ASN B C     1 
ATOM   3003 O  O     . ASN B  2 88  ? 69.022  1.045   -22.427 1.000 73.514  ? 4338 ASN B O     1 
ATOM   3004 C  CB    . ASN B  2 88  ? 67.882  3.679   -24.099 1.000 70.308  ? 4338 ASN B CB    1 
ATOM   3005 C  CG    . ASN B  2 88  ? 69.002  4.267   -23.270 1.000 67.362  ? 4338 ASN B CG    1 
ATOM   3006 O  OD1   . ASN B  2 88  ? 70.000  3.602   -23.004 1.000 67.057  ? 4338 ASN B OD1   1 
ATOM   3007 N  ND2   . ASN B  2 88  ? 68.874  5.534   -22.910 1.000 65.446  ? 4338 ASN B ND2   1 
ATOM   3008 N  N     . PRO B  2 89  ? 68.647  0.470   -24.571 1.000 81.704  ? 4339 PRO B N     1 
ATOM   3009 C  CA    . PRO B  2 89  ? 69.605  -0.639  -24.555 1.000 84.589  ? 4339 PRO B CA    1 
ATOM   3010 C  C     . PRO B  2 89  ? 70.968  -0.338  -23.907 1.000 83.190  ? 4339 PRO B C     1 
ATOM   3011 O  O     . PRO B  2 89  ? 71.398  -1.124  -23.080 1.000 83.235  ? 4339 PRO B O     1 
ATOM   3012 C  CB    . PRO B  2 89  ? 69.797  -0.945  -26.050 1.000 88.581  ? 4339 PRO B CB    1 
ATOM   3013 C  CG    . PRO B  2 89  ? 68.473  -0.563  -26.680 1.000 89.109  ? 4339 PRO B CG    1 
ATOM   3014 C  CD    . PRO B  2 89  ? 67.998  0.635   -25.883 1.000 84.314  ? 4339 PRO B CD    1 
ATOM   3015 N  N     . LYS B  2 90  ? 71.600  0.777   -24.291 1.000 81.680  ? 4340 LYS B N     1 
ATOM   3016 C  CA    . LYS B  2 90  ? 72.940  1.162   -23.766 1.000 80.244  ? 4340 LYS B CA    1 
ATOM   3017 C  C     . LYS B  2 90  ? 72.851  1.639   -22.312 1.000 74.770  ? 4340 LYS B C     1 
ATOM   3018 O  O     . LYS B  2 90  ? 73.901  1.658   -21.643 1.000 72.962  ? 4340 LYS B O     1 
ATOM   3019 C  CB    . LYS B  2 90  ? 73.537  2.290   -24.610 1.000 82.050  ? 4340 LYS B CB    1 
ATOM   3020 C  CG    . LYS B  2 90  ? 73.733  1.973   -26.085 1.000 87.895  ? 4340 LYS B CG    1 
ATOM   3021 C  CD    . LYS B  2 90  ? 74.285  3.143   -26.867 1.000 89.874  ? 4340 LYS B CD    1 
ATOM   3022 C  CE    . LYS B  2 90  ? 74.498  2.834   -28.333 1.000 95.564  ? 4340 LYS B CE    1 
ATOM   3023 N  NZ    . LYS B  2 90  ? 75.029  4.011   -29.060 1.000 96.782  ? 4340 LYS B NZ    1 
ATOM   3024 N  N     . GLY B  2 91  ? 71.655  2.011   -21.844 1.000 71.433  ? 4341 GLY B N     1 
ATOM   3025 C  CA    . GLY B  2 91  ? 71.504  2.535   -20.472 1.000 67.495  ? 4341 GLY B CA    1 
ATOM   3026 C  C     . GLY B  2 91  ? 72.180  3.894   -20.344 1.000 62.987  ? 4341 GLY B C     1 
ATOM   3027 O  O     . GLY B  2 91  ? 72.627  4.234   -19.233 1.000 60.224  ? 4341 GLY B O     1 
ATOM   3028 N  N     . PHE B  2 92  ? 72.258  4.629   -21.460 1.000 62.278  ? 4342 PHE B N     1 
ATOM   3029 C  CA    . PHE B  2 92  ? 72.895  5.972   -21.524 1.000 59.307  ? 4342 PHE B CA    1 
ATOM   3030 C  C     . PHE B  2 92  ? 71.938  7.038   -20.980 1.000 53.572  ? 4342 PHE B C     1 
ATOM   3031 O  O     . PHE B  2 92  ? 70.714  6.938   -21.201 1.000 53.612  ? 4342 PHE B O     1 
ATOM   3032 C  CB    . PHE B  2 92  ? 73.318  6.286   -22.964 1.000 61.947  ? 4342 PHE B CB    1 
ATOM   3033 C  CG    . PHE B  2 92  ? 73.700  7.724   -23.220 1.000 63.101  ? 4342 PHE B CG    1 
ATOM   3034 C  CD1   . PHE B  2 92  ? 74.951  8.208   -22.864 1.000 62.942  ? 4342 PHE B CD1   1 
ATOM   3035 C  CD2   . PHE B  2 92  ? 72.808  8.595   -23.834 1.000 63.374  ? 4342 PHE B CD2   1 
ATOM   3036 C  CE1   . PHE B  2 92  ? 75.293  9.532   -23.099 1.000 62.554  ? 4342 PHE B CE1   1 
ATOM   3037 C  CE2   . PHE B  2 92  ? 73.153  9.917   -24.072 1.000 62.422  ? 4342 PHE B CE2   1 
ATOM   3038 C  CZ    . PHE B  2 92  ? 74.396  10.383  -23.705 1.000 61.362  ? 4342 PHE B CZ    1 
ATOM   3039 N  N     . CYS B  2 93  ? 72.496  8.033   -20.288 1.000 49.359  ? 4343 CYS B N     1 
ATOM   3040 C  CA    . CYS B  2 93  ? 71.693  9.151   -19.726 1.000 45.264  ? 4343 CYS B CA    1 
ATOM   3041 C  C     . CYS B  2 93  ? 71.972  10.427  -20.529 1.000 44.495  ? 4343 CYS B C     1 
ATOM   3042 O  O     . CYS B  2 93  ? 73.151  10.744  -20.733 1.000 45.601  ? 4343 CYS B O     1 
ATOM   3043 C  CB    . CYS B  2 93  ? 72.020  9.382   -18.258 1.000 42.872  ? 4343 CYS B CB    1 
ATOM   3044 S  SG    . CYS B  2 93  ? 70.942  10.617  -17.487 1.000 37.479  ? 4343 CYS B SG    1 
ATOM   3045 N  N     . ASP B  2 94  ? 70.922  11.117  -20.976 1.000 44.431  ? 4344 ASP B N     1 
ATOM   3046 C  CA    . ASP B  2 94  ? 71.096  12.376  -21.752 1.000 45.682  ? 4344 ASP B CA    1 
ATOM   3047 C  C     . ASP B  2 94  ? 71.203  13.588  -20.808 1.000 40.251  ? 4344 ASP B C     1 
ATOM   3048 O  O     . ASP B  2 94  ? 71.488  14.682  -21.315 1.000 39.809  ? 4344 ASP B O     1 
ATOM   3049 C  CB    . ASP B  2 94  ? 69.978  12.541  -22.786 1.000 50.547  ? 4344 ASP B CB    1 
ATOM   3050 C  CG    . ASP B  2 94  ? 68.570  12.371  -22.240 1.000 54.108  ? 4344 ASP B CG    1 
ATOM   3051 O  OD1   . ASP B  2 94  ? 68.397  12.462  -21.008 1.000 55.916  ? 4344 ASP B OD1   1 
ATOM   3052 O  OD2   . ASP B  2 94  ? 67.660  12.091  -23.053 1.000 60.855  ? 4344 ASP B OD2   1 
ATOM   3053 N  N     . LEU B  2 95  ? 71.034  13.404  -19.494 1.000 36.299  ? 4345 LEU B N     1 
ATOM   3054 C  CA    . LEU B  2 95  ? 71.094  14.559  -18.552 1.000 33.803  ? 4345 LEU B CA    1 
ATOM   3055 C  C     . LEU B  2 95  ? 72.392  14.557  -17.737 1.000 33.008  ? 4345 LEU B C     1 
ATOM   3056 O  O     . LEU B  2 95  ? 72.965  15.644  -17.541 1.000 30.527  ? 4345 LEU B O     1 
ATOM   3057 C  CB    . LEU B  2 95  ? 69.872  14.517  -17.628 1.000 33.005  ? 4345 LEU B CB    1 
ATOM   3058 C  CG    . LEU B  2 95  ? 68.534  14.851  -18.290 1.000 34.810  ? 4345 LEU B CG    1 
ATOM   3059 C  CD1   . LEU B  2 95  ? 67.360  14.426  -17.419 1.000 35.568  ? 4345 LEU B CD1   1 
ATOM   3060 C  CD2   . LEU B  2 95  ? 68.446  16.332  -18.618 1.000 35.546  ? 4345 LEU B CD2   1 
ATOM   3061 N  N     . LYS B  2 96  ? 72.825  13.389  -17.268 1.000 32.412  ? 4346 LYS B N     1 
ATOM   3062 C  CA    . LYS B  2 96  ? 74.023  13.292  -16.394 1.000 32.626  ? 4346 LYS B CA    1 
ATOM   3063 C  C     . LYS B  2 96  ? 75.240  13.966  -17.038 1.000 30.977  ? 4346 LYS B C     1 
ATOM   3064 O  O     . LYS B  2 96  ? 75.533  13.662  -18.188 1.000 30.973  ? 4346 LYS B O     1 
ATOM   3065 C  CB    . LYS B  2 96  ? 74.304  11.814  -16.114 1.000 35.856  ? 4346 LYS B CB    1 
ATOM   3066 C  CG    . LYS B  2 96  ? 75.521  11.510  -15.259 1.000 37.756  ? 4346 LYS B CG    1 
ATOM   3067 C  CD    . LYS B  2 96  ? 75.788  10.018  -15.198 1.000 41.696  ? 4346 LYS B CD    1 
ATOM   3068 C  CE    . LYS B  2 96  ? 77.051  9.662   -14.449 1.000 44.270  ? 4346 LYS B CE    1 
ATOM   3069 N  NZ    . LYS B  2 96  ? 76.951  10.037  -13.022 1.000 46.938  ? 4346 LYS B NZ    1 
ATOM   3070 N  N     . GLY B  2 97  ? 75.923  14.847  -16.297 1.000 29.176  ? 4347 GLY B N     1 
ATOM   3071 C  CA    . GLY B  2 97  ? 77.150  15.508  -16.790 1.000 29.894  ? 4347 GLY B CA    1 
ATOM   3072 C  C     . GLY B  2 97  ? 76.856  16.739  -17.625 1.000 29.118  ? 4347 GLY B C     1 
ATOM   3073 O  O     . GLY B  2 97  ? 77.807  17.370  -18.112 1.000 28.479  ? 4347 GLY B O     1 
ATOM   3074 N  N     . LYS B  2 98  ? 75.577  17.066  -17.768 1.000 28.988  ? 4348 LYS B N     1 
ATOM   3075 C  CA    . LYS B  2 98  ? 75.134  18.236  -18.556 1.000 30.965  ? 4348 LYS B CA    1 
ATOM   3076 C  C     . LYS B  2 98  ? 74.247  19.099  -17.660 1.000 28.989  ? 4348 LYS B C     1 
ATOM   3077 O  O     . LYS B  2 98  ? 74.117  18.771  -16.463 1.000 27.530  ? 4348 LYS B O     1 
ATOM   3078 C  CB    . LYS B  2 98  ? 74.445  17.771  -19.844 1.000 33.822  ? 4348 LYS B CB    1 
ATOM   3079 C  CG    . LYS B  2 98  ? 75.391  17.141  -20.859 1.000 37.455  ? 4348 LYS B CG    1 
ATOM   3080 C  CD    . LYS B  2 98  ? 74.760  16.852  -22.193 1.000 43.040  ? 4348 LYS B CD    1 
ATOM   3081 C  CE    . LYS B  2 98  ? 75.787  16.570  -23.271 1.000 47.856  ? 4348 LYS B CE    1 
ATOM   3082 N  NZ    . LYS B  2 98  ? 76.720  15.492  -22.867 1.000 50.367  ? 4348 LYS B NZ    1 
ATOM   3083 N  N     . TYR B  2 99  ? 73.705  20.171  -18.228 1.000 28.051  ? 4349 TYR B N     1 
ATOM   3084 C  CA    . TYR B  2 99  ? 72.831  21.136  -17.518 1.000 27.304  ? 4349 TYR B CA    1 
ATOM   3085 C  C     . TYR B  2 99  ? 71.498  21.175  -18.255 1.000 27.967  ? 4349 TYR B C     1 
ATOM   3086 O  O     . TYR B  2 99  ? 71.492  21.192  -19.500 1.000 29.321  ? 4349 TYR B O     1 
ATOM   3087 C  CB    . TYR B  2 99  ? 73.550  22.483  -17.387 1.000 27.387  ? 4349 TYR B CB    1 
ATOM   3088 C  CG    . TYR B  2 99  ? 74.795  22.327  -16.563 1.000 26.420  ? 4349 TYR B CG    1 
ATOM   3089 C  CD1   . TYR B  2 99  ? 75.990  21.968  -17.157 1.000 27.205  ? 4349 TYR B CD1   1 
ATOM   3090 C  CD2   . TYR B  2 99  ? 74.740  22.364  -15.179 1.000 25.809  ? 4349 TYR B CD2   1 
ATOM   3091 C  CE1   . TYR B  2 99  ? 77.119  21.704  -16.403 1.000 27.269  ? 4349 TYR B CE1   1 
ATOM   3092 C  CE2   . TYR B  2 99  ? 75.864  22.115  -14.408 1.000 25.598  ? 4349 TYR B CE2   1 
ATOM   3093 C  CZ    . TYR B  2 99  ? 77.054  21.772  -15.024 1.000 26.523  ? 4349 TYR B CZ    1 
ATOM   3094 O  OH    . TYR B  2 99  ? 78.173  21.509  -14.293 1.000 27.259  ? 4349 TYR B OH    1 
ATOM   3095 N  N     . VAL B  2 100 ? 70.408  21.079  -17.501 1.000 27.414  ? 4350 VAL B N     1 
ATOM   3096 C  CA    . VAL B  2 100 ? 69.071  21.123  -18.144 1.000 28.012  ? 4350 VAL B CA    1 
ATOM   3097 C  C     . VAL B  2 100 ? 68.428  22.468  -17.806 1.000 27.534  ? 4350 VAL B C     1 
ATOM   3098 O  O     . VAL B  2 100 ? 68.519  22.899  -16.642 1.000 27.476  ? 4350 VAL B O     1 
ATOM   3099 C  CB    . VAL B  2 100 ? 68.188  19.933  -17.732 1.000 28.525  ? 4350 VAL B CB    1 
ATOM   3100 C  CG1   . VAL B  2 100 ? 67.989  19.853  -16.233 1.000 28.695  ? 4350 VAL B CG1   1 
ATOM   3101 C  CG2   . VAL B  2 100 ? 66.857  19.968  -18.454 1.000 29.981  ? 4350 VAL B CG2   1 
ATOM   3102 N  N     . GLN B  2 101 ? 67.911  23.141  -18.832 1.000 27.865  ? 4351 GLN B N     1 
ATOM   3103 C  CA    . GLN B  2 101 ? 67.195  24.429  -18.658 1.000 28.525  ? 4351 GLN B CA    1 
ATOM   3104 C  C     . GLN B  2 101 ? 65.711  24.097  -18.467 1.000 29.775  ? 4351 GLN B C     1 
ATOM   3105 O  O     . GLN B  2 101 ? 65.146  23.394  -19.324 1.000 30.819  ? 4351 GLN B O     1 
ATOM   3106 C  CB    . GLN B  2 101 ? 67.464  25.349  -19.849 1.000 29.416  ? 4351 GLN B CB    1 
ATOM   3107 C  CG    . GLN B  2 101 ? 68.801  26.077  -19.784 1.000 29.341  ? 4351 GLN B CG    1 
ATOM   3108 C  CD    . GLN B  2 101 ? 70.012  25.179  -19.720 1.000 29.810  ? 4351 GLN B CD    1 
ATOM   3109 O  OE1   . GLN B  2 101 ? 70.830  25.290  -18.804 1.000 29.416  ? 4351 GLN B OE1   1 
ATOM   3110 N  NE2   . GLN B  2 101 ? 70.122  24.260  -20.668 1.000 30.110  ? 4351 GLN B NE2   1 
ATOM   3111 N  N     . ILE B  2 102 ? 65.121  24.573  -17.374 1.000 30.333  ? 4352 ILE B N     1 
ATOM   3112 C  CA    . ILE B  2 102 ? 63.694  24.299  -17.039 1.000 31.116  ? 4352 ILE B CA    1 
ATOM   3113 C  C     . ILE B  2 102 ? 62.962  25.635  -17.000 1.000 32.133  ? 4352 ILE B C     1 
ATOM   3114 O  O     . ILE B  2 102 ? 63.448  26.573  -16.376 1.000 31.156  ? 4352 ILE B O     1 
ATOM   3115 C  CB    . ILE B  2 102 ? 63.588  23.574  -15.677 1.000 31.139  ? 4352 ILE B CB    1 
ATOM   3116 C  CG1   . ILE B  2 102 ? 64.483  22.332  -15.575 1.000 30.680  ? 4352 ILE B CG1   1 
ATOM   3117 C  CG2   . ILE B  2 102 ? 62.140  23.253  -15.350 1.000 32.093  ? 4352 ILE B CG2   1 
ATOM   3118 C  CD1   . ILE B  2 102 ? 64.083  21.186  -16.486 1.000 31.787  ? 4352 ILE B CD1   1 
ATOM   3119 N  N     . PRO B  2 103 ? 61.785  25.782  -17.651 1.000 33.879  ? 4353 PRO B N     1 
ATOM   3120 C  CA    . PRO B  2 103 ? 61.035  27.034  -17.574 1.000 35.247  ? 4353 PRO B CA    1 
ATOM   3121 C  C     . PRO B  2 103 ? 60.781  27.362  -16.094 1.000 35.570  ? 4353 PRO B C     1 
ATOM   3122 O  O     . PRO B  2 103 ? 60.483  26.451  -15.339 1.000 34.092  ? 4353 PRO B O     1 
ATOM   3123 C  CB    . PRO B  2 103 ? 59.732  26.760  -18.342 1.000 37.335  ? 4353 PRO B CB    1 
ATOM   3124 C  CG    . PRO B  2 103 ? 60.050  25.563  -19.224 1.000 36.891  ? 4353 PRO B CG    1 
ATOM   3125 C  CD    . PRO B  2 103 ? 61.115  24.773  -18.486 1.000 34.719  ? 4353 PRO B CD    1 
ATOM   3126 N  N     . THR B  2 104 ? 60.903  28.637  -15.712 1.000 36.073  ? 4354 THR B N     1 
ATOM   3127 C  CA    . THR B  2 104 ? 60.731  29.027  -14.284 1.000 38.010  ? 4354 THR B CA    1 
ATOM   3128 C  C     . THR B  2 104 ? 59.375  28.548  -13.754 1.000 39.202  ? 4354 THR B C     1 
ATOM   3129 O  O     . THR B  2 104 ? 59.330  28.134  -12.582 1.000 40.322  ? 4354 THR B O     1 
ATOM   3130 C  CB    . THR B  2 104 ? 60.930  30.535  -14.093 1.000 38.706  ? 4354 THR B CB    1 
ATOM   3131 O  OG1   . THR B  2 104 ? 59.961  31.199  -14.900 1.000 42.798  ? 4354 THR B OG1   1 
ATOM   3132 C  CG2   . THR B  2 104 ? 62.319  30.989  -14.481 1.000 37.129  ? 4354 THR B CG2   1 
ATOM   3133 N  N     . THR B  2 105 ? 58.329  28.577  -14.582 1.000 40.748  ? 4355 THR B N     1 
ATOM   3134 C  CA    . THR B  2 105 ? 56.978  28.123  -14.150 1.000 43.849  ? 4355 THR B CA    1 
ATOM   3135 C  C     . THR B  2 105 ? 56.992  26.627  -13.793 1.000 42.412  ? 4355 THR B C     1 
ATOM   3136 O  O     . THR B  2 105 ? 56.061  26.197  -13.090 1.000 45.239  ? 4355 THR B O     1 
ATOM   3137 C  CB    . THR B  2 105 ? 55.925  28.388  -15.236 1.000 46.632  ? 4355 THR B CB    1 
ATOM   3138 O  OG1   . THR B  2 105 ? 56.344  27.691  -16.409 1.000 47.130  ? 4355 THR B OG1   1 
ATOM   3139 C  CG2   . THR B  2 105 ? 55.739  29.856  -15.554 1.000 48.812  ? 4355 THR B CG2   1 
ATOM   3140 N  N     . CYS B  2 106 ? 58.013  25.876  -14.224 1.000 39.829  ? 4356 CYS B N     1 
ATOM   3141 C  CA    . CYS B  2 106 ? 58.064  24.407  -13.966 1.000 39.499  ? 4356 CYS B CA    1 
ATOM   3142 C  C     . CYS B  2 106 ? 59.276  24.027  -13.101 1.000 37.478  ? 4356 CYS B C     1 
ATOM   3143 O  O     . CYS B  2 106 ? 59.438  22.816  -12.816 1.000 35.419  ? 4356 CYS B O     1 
ATOM   3144 C  CB    . CYS B  2 106 ? 58.135  23.642  -15.284 1.000 39.631  ? 4356 CYS B CB    1 
ATOM   3145 S  SG    . CYS B  2 106 ? 56.766  24.001  -16.417 1.000 43.559  ? 4356 CYS B SG    1 
ATOM   3146 N  N     . ALA B  2 107 ? 60.051  25.021  -12.651 1.000 36.579  ? 4357 ALA B N     1 
ATOM   3147 C  CA    . ALA B  2 107 ? 61.293  24.784  -11.872 1.000 36.124  ? 4357 ALA B CA    1 
ATOM   3148 C  C     . ALA B  2 107 ? 61.010  24.090  -10.530 1.000 37.015  ? 4357 ALA B C     1 
ATOM   3149 O  O     . ALA B  2 107 ? 61.985  23.652  -9.883  1.000 35.291  ? 4357 ALA B O     1 
ATOM   3150 C  CB    . ALA B  2 107 ? 62.016  26.092  -11.667 1.000 36.232  ? 4357 ALA B CB    1 
ATOM   3151 N  N     . ASN B  2 108 ? 59.745  24.009  -10.111 1.000 38.281  ? 4358 ASN B N     1 
ATOM   3152 C  CA    . ASN B  2 108 ? 59.414  23.323  -8.832  1.000 39.798  ? 4358 ASN B CA    1 
ATOM   3153 C  C     . ASN B  2 108 ? 59.469  21.798  -9.017  1.000 38.629  ? 4358 ASN B C     1 
ATOM   3154 O  O     . ASN B  2 108 ? 59.473  21.091  -7.995  1.000 39.147  ? 4358 ASN B O     1 
ATOM   3155 C  CB    . ASN B  2 108 ? 58.021  23.684  -8.321  1.000 43.396  ? 4358 ASN B CB    1 
ATOM   3156 C  CG    . ASN B  2 108 ? 56.947  23.330  -9.327  1.000 45.729  ? 4358 ASN B CG    1 
ATOM   3157 O  OD1   . ASN B  2 108 ? 57.024  23.737  -10.488 1.000 45.623  ? 4358 ASN B OD1   1 
ATOM   3158 N  ND2   . ASN B  2 108 ? 55.938  22.596  -8.885  1.000 47.616  ? 4358 ASN B ND2   1 
ATOM   3159 N  N     . ASP B  2 109 ? 59.447  21.307  -10.263 1.000 36.779  ? 4359 ASP B N     1 
ATOM   3160 C  CA    . ASP B  2 109 ? 59.490  19.837  -10.501 1.000 36.099  ? 4359 ASP B CA    1 
ATOM   3161 C  C     . ASP B  2 109 ? 60.313  19.565  -11.753 1.000 34.166  ? 4359 ASP B C     1 
ATOM   3162 O  O     . ASP B  2 109 ? 59.770  19.157  -12.775 1.000 35.197  ? 4359 ASP B O     1 
ATOM   3163 C  CB    . ASP B  2 109 ? 58.077  19.251  -10.611 1.000 38.461  ? 4359 ASP B CB    1 
ATOM   3164 C  CG    . ASP B  2 109 ? 58.021  17.737  -10.785 1.000 38.867  ? 4359 ASP B CG    1 
ATOM   3165 O  OD1   . ASP B  2 109 ? 59.030  17.059  -10.477 1.000 36.020  ? 4359 ASP B OD1   1 
ATOM   3166 O  OD2   . ASP B  2 109 ? 56.969  17.245  -11.235 1.000 40.755  ? 4359 ASP B OD2   1 
ATOM   3167 N  N     . PRO B  2 110 ? 61.648  19.774  -11.717 1.000 32.498  ? 4360 PRO B N     1 
ATOM   3168 C  CA    . PRO B  2 110 ? 62.490  19.526  -12.887 1.000 31.706  ? 4360 PRO B CA    1 
ATOM   3169 C  C     . PRO B  2 110 ? 62.439  18.063  -13.352 1.000 31.754  ? 4360 PRO B C     1 
ATOM   3170 O  O     . PRO B  2 110 ? 62.479  17.840  -14.547 1.000 31.663  ? 4360 PRO B O     1 
ATOM   3171 C  CB    . PRO B  2 110 ? 63.904  19.901  -12.421 1.000 30.674  ? 4360 PRO B CB    1 
ATOM   3172 C  CG    . PRO B  2 110 ? 63.674  20.819  -11.241 1.000 30.996  ? 4360 PRO B CG    1 
ATOM   3173 C  CD    . PRO B  2 110 ? 62.416  20.298  -10.579 1.000 31.670  ? 4360 PRO B CD    1 
ATOM   3174 N  N     . VAL B  2 111 ? 62.353  17.112  -12.418 1.000 31.558  ? 4361 VAL B N     1 
ATOM   3175 C  CA    . VAL B  2 111 ? 62.297  15.675  -12.823 1.000 32.399  ? 4361 VAL B CA    1 
ATOM   3176 C  C     . VAL B  2 111 ? 61.026  15.453  -13.649 1.000 33.582  ? 4361 VAL B C     1 
ATOM   3177 O  O     . VAL B  2 111 ? 61.119  14.818  -14.714 1.000 34.340  ? 4361 VAL B O     1 
ATOM   3178 C  CB    . VAL B  2 111 ? 62.352  14.725  -11.613 1.000 32.837  ? 4361 VAL B CB    1 
ATOM   3179 C  CG1   . VAL B  2 111 ? 62.151  13.275  -12.029 1.000 34.028  ? 4361 VAL B CG1   1 
ATOM   3180 C  CG2   . VAL B  2 111 ? 63.650  14.884  -10.844 1.000 31.896  ? 4361 VAL B CG2   1 
ATOM   3181 N  N     . GLY B  2 112 ? 59.888  15.954  -13.165 1.000 33.831  ? 4362 GLY B N     1 
ATOM   3182 C  CA    . GLY B  2 112 ? 58.619  15.802  -13.899 1.000 35.572  ? 4362 GLY B CA    1 
ATOM   3183 C  C     . GLY B  2 112 ? 58.670  16.507  -15.242 1.000 35.683  ? 4362 GLY B C     1 
ATOM   3184 O  O     . GLY B  2 112 ? 58.118  15.958  -16.215 1.000 36.482  ? 4362 GLY B O     1 
ATOM   3185 N  N     . PHE B  2 113 ? 59.341  17.663  -15.307 1.000 34.293  ? 4363 PHE B N     1 
ATOM   3186 C  CA    . PHE B  2 113 ? 59.410  18.423  -16.582 1.000 34.817  ? 4363 PHE B CA    1 
ATOM   3187 C  C     . PHE B  2 113 ? 60.190  17.640  -17.644 1.000 35.672  ? 4363 PHE B C     1 
ATOM   3188 O  O     . PHE B  2 113 ? 59.674  17.514  -18.769 1.000 36.508  ? 4363 PHE B O     1 
ATOM   3189 C  CB    . PHE B  2 113 ? 60.054  19.798  -16.410 1.000 33.884  ? 4363 PHE B CB    1 
ATOM   3190 C  CG    . PHE B  2 113 ? 60.015  20.608  -17.680 1.000 34.548  ? 4363 PHE B CG    1 
ATOM   3191 C  CD1   . PHE B  2 113 ? 58.909  21.386  -17.984 1.000 35.854  ? 4363 PHE B CD1   1 
ATOM   3192 C  CD2   . PHE B  2 113 ? 61.043  20.534  -18.605 1.000 34.182  ? 4363 PHE B CD2   1 
ATOM   3193 C  CE1   . PHE B  2 113 ? 58.856  22.112  -19.164 1.000 36.715  ? 4363 PHE B CE1   1 
ATOM   3194 C  CE2   . PHE B  2 113 ? 60.981  21.251  -19.790 1.000 35.016  ? 4363 PHE B CE2   1 
ATOM   3195 C  CZ    . PHE B  2 113 ? 59.891  22.044  -20.064 1.000 36.196  ? 4363 PHE B CZ    1 
ATOM   3196 N  N     . THR B  2 114 ? 61.372  17.121  -17.294 1.000 35.644  ? 4364 THR B N     1 
ATOM   3197 C  CA    . THR B  2 114 ? 62.213  16.382  -18.277 1.000 36.985  ? 4364 THR B CA    1 
ATOM   3198 C  C     . THR B  2 114 ? 61.490  15.118  -18.771 1.000 39.254  ? 4364 THR B C     1 
ATOM   3199 O  O     . THR B  2 114 ? 61.671  14.775  -19.950 1.000 39.983  ? 4364 THR B O     1 
ATOM   3200 C  CB    . THR B  2 114 ? 63.593  16.049  -17.693 1.000 37.450  ? 4364 THR B CB    1 
ATOM   3201 O  OG1   . THR B  2 114 ? 63.430  15.180  -16.571 1.000 39.938  ? 4364 THR B OG1   1 
ATOM   3202 C  CG2   . THR B  2 114 ? 64.355  17.288  -17.275 1.000 36.784  ? 4364 THR B CG2   1 
ATOM   3203 N  N     . LEU B  2 115 ? 60.705  14.464  -17.909 1.000 42.210  ? 4365 LEU B N     1 
ATOM   3204 C  CA    . LEU B  2 115 ? 59.975  13.220  -18.298 1.000 45.006  ? 4365 LEU B CA    1 
ATOM   3205 C  C     . LEU B  2 115 ? 58.842  13.523  -19.285 1.000 45.328  ? 4365 LEU B C     1 
ATOM   3206 O  O     . LEU B  2 115 ? 58.714  12.781  -20.273 1.000 46.716  ? 4365 LEU B O     1 
ATOM   3207 C  CB    . LEU B  2 115 ? 59.385  12.563  -17.046 1.000 47.021  ? 4365 LEU B CB    1 
ATOM   3208 C  CG    . LEU B  2 115 ? 60.357  11.776  -16.175 1.000 48.684  ? 4365 LEU B CG    1 
ATOM   3209 C  CD1   . LEU B  2 115 ? 59.713  11.420  -14.843 1.000 51.087  ? 4365 LEU B CD1   1 
ATOM   3210 C  CD2   . LEU B  2 115 ? 60.835  10.520  -16.892 1.000 50.040  ? 4365 LEU B CD2   1 
ATOM   3211 N  N     . LYS B  2 116 ? 58.039  14.547  -18.986 1.000 45.267  ? 4366 LYS B N     1 
ATOM   3212 C  CA    . LYS B  2 116 ? 56.835  14.925  -19.773 1.000 46.812  ? 4366 LYS B CA    1 
ATOM   3213 C  C     . LYS B  2 116 ? 57.176  15.718  -21.036 1.000 46.261  ? 4366 LYS B C     1 
ATOM   3214 O  O     . LYS B  2 116 ? 56.243  15.971  -21.821 1.000 50.138  ? 4366 LYS B O     1 
ATOM   3215 C  CB    . LYS B  2 116 ? 55.928  15.805  -18.908 1.000 47.417  ? 4366 LYS B CB    1 
ATOM   3216 C  CG    . LYS B  2 116 ? 55.411  15.150  -17.638 1.000 49.688  ? 4366 LYS B CG    1 
ATOM   3217 C  CD    . LYS B  2 116 ? 54.665  16.099  -16.734 1.000 50.841  ? 4366 LYS B CD    1 
ATOM   3218 C  CE    . LYS B  2 116 ? 54.132  15.417  -15.493 1.000 53.917  ? 4366 LYS B CE    1 
ATOM   3219 N  NZ    . LYS B  2 116 ? 53.473  16.384  -14.586 1.000 56.163  ? 4366 LYS B NZ    1 
ATOM   3220 N  N     . ASN B  2 117 ? 58.444  16.065  -21.257 1.000 43.269  ? 4367 ASN B N     1 
ATOM   3221 C  CA    . ASN B  2 117 ? 58.759  16.940  -22.417 1.000 41.786  ? 4367 ASN B CA    1 
ATOM   3222 C  C     . ASN B  2 117 ? 59.811  16.299  -23.320 1.000 40.880  ? 4367 ASN B C     1 
ATOM   3223 O  O     . ASN B  2 117 ? 60.468  15.328  -22.892 1.000 41.153  ? 4367 ASN B O     1 
ATOM   3224 C  CB    . ASN B  2 117 ? 59.103  18.347  -21.927 1.000 39.869  ? 4367 ASN B CB    1 
ATOM   3225 C  CG    . ASN B  2 117 ? 57.870  19.057  -21.408 1.000 42.022  ? 4367 ASN B CG    1 
ATOM   3226 O  OD1   . ASN B  2 117 ? 57.012  19.468  -22.191 1.000 43.727  ? 4367 ASN B OD1   1 
ATOM   3227 N  ND2   . ASN B  2 117 ? 57.769  19.207  -20.099 1.000 41.126  ? 4367 ASN B ND2   1 
ATOM   3228 N  N     . THR B  2 118 ? 59.941  16.852  -24.529 1.000 40.936  ? 4368 THR B N     1 
ATOM   3229 C  CA    . THR B  2 118 ? 60.850  16.326  -25.575 1.000 42.176  ? 4368 THR B CA    1 
ATOM   3230 C  C     . THR B  2 118 ? 61.696  17.456  -26.156 1.000 40.978  ? 4368 THR B C     1 
ATOM   3231 O  O     . THR B  2 118 ? 61.130  18.533  -26.443 1.000 40.048  ? 4368 THR B O     1 
ATOM   3232 C  CB    . THR B  2 118 ? 60.025  15.663  -26.686 1.000 44.937  ? 4368 THR B CB    1 
ATOM   3233 O  OG1   . THR B  2 118 ? 59.261  14.629  -26.064 1.000 48.118  ? 4368 THR B OG1   1 
ATOM   3234 C  CG2   . THR B  2 118 ? 60.864  15.099  -27.813 1.000 46.965  ? 4368 THR B CG2   1 
ATOM   3235 N  N     . VAL B  2 119 ? 62.993  17.199  -26.331 1.000 40.611  ? 4369 VAL B N     1 
ATOM   3236 C  CA    . VAL B  2 119 ? 63.913  18.202  -26.936 1.000 40.416  ? 4369 VAL B CA    1 
ATOM   3237 C  C     . VAL B  2 119 ? 63.778  18.114  -28.461 1.000 42.034  ? 4369 VAL B C     1 
ATOM   3238 O  O     . VAL B  2 119 ? 63.742  16.988  -28.997 1.000 41.889  ? 4369 VAL B O     1 
ATOM   3239 C  CB    . VAL B  2 119 ? 65.370  17.964  -26.495 1.000 41.507  ? 4369 VAL B CB    1 
ATOM   3240 C  CG1   . VAL B  2 119 ? 66.325  18.950  -27.152 1.000 41.997  ? 4369 VAL B CG1   1 
ATOM   3241 C  CG2   . VAL B  2 119 ? 65.516  18.006  -24.977 1.000 40.573  ? 4369 VAL B CG2   1 
ATOM   3242 N  N     . CYS B  2 120 ? 63.673  19.261  -29.128 1.000 41.881  ? 4370 CYS B N     1 
ATOM   3243 C  CA    . CYS B  2 120 ? 63.612  19.262  -30.608 1.000 44.348  ? 4370 CYS B CA    1 
ATOM   3244 C  C     . CYS B  2 120 ? 64.976  18.830  -31.147 1.000 46.226  ? 4370 CYS B C     1 
ATOM   3245 O  O     . CYS B  2 120 ? 65.984  19.471  -30.789 1.000 45.980  ? 4370 CYS B O     1 
ATOM   3246 C  CB    . CYS B  2 120 ? 63.251  20.637  -31.141 1.000 46.263  ? 4370 CYS B CB    1 
ATOM   3247 S  SG    . CYS B  2 120 ? 63.302  20.755  -32.947 1.000 47.667  ? 4370 CYS B SG    1 
ATOM   3248 N  N     . THR B  2 121 ? 64.993  17.786  -31.976 1.000 48.523  ? 4371 THR B N     1 
ATOM   3249 C  CA    . THR B  2 121 ? 66.253  17.250  -32.553 1.000 51.401  ? 4371 THR B CA    1 
ATOM   3250 C  C     . THR B  2 121 ? 66.839  18.232  -33.574 1.000 52.713  ? 4371 THR B C     1 
ATOM   3251 O  O     . THR B  2 121 ? 67.988  18.004  -33.994 1.000 56.479  ? 4371 THR B O     1 
ATOM   3252 C  CB    . THR B  2 121 ? 66.005  15.877  -33.190 1.000 55.338  ? 4371 THR B CB    1 
ATOM   3253 O  OG1   . THR B  2 121 ? 65.021  16.037  -34.211 1.000 57.282  ? 4371 THR B OG1   1 
ATOM   3254 C  CG2   . THR B  2 121 ? 65.534  14.842  -32.192 1.000 55.928  ? 4371 THR B CG2   1 
ATOM   3255 N  N     . VAL B  2 122 ? 66.097  19.287  -33.933 1.000 51.342  ? 4372 VAL B N     1 
ATOM   3256 C  CA    . VAL B  2 122 ? 66.577  20.267  -34.954 1.000 52.921  ? 4372 VAL B CA    1 
ATOM   3257 C  C     . VAL B  2 122 ? 67.191  21.496  -34.267 1.000 50.384  ? 4372 VAL B C     1 
ATOM   3258 O  O     . VAL B  2 122 ? 68.372  21.771  -34.539 1.000 51.792  ? 4372 VAL B O     1 
ATOM   3259 C  CB    . VAL B  2 122 ? 65.450  20.672  -35.927 1.000 54.569  ? 4372 VAL B CB    1 
ATOM   3260 C  CG1   . VAL B  2 122 ? 65.904  21.737  -36.916 1.000 56.328  ? 4372 VAL B CG1   1 
ATOM   3261 C  CG2   . VAL B  2 122 ? 64.885  19.471  -36.674 1.000 57.654  ? 4372 VAL B CG2   1 
ATOM   3262 N  N     . CYS B  2 123 ? 66.433  22.198  -33.414 1.000 47.211  ? 4373 CYS B N     1 
ATOM   3263 C  CA    . CYS B  2 123 ? 66.944  23.454  -32.787 1.000 46.604  ? 4373 CYS B CA    1 
ATOM   3264 C  C     . CYS B  2 123 ? 67.499  23.222  -31.371 1.000 44.403  ? 4373 CYS B C     1 
ATOM   3265 O  O     . CYS B  2 123 ? 68.145  24.145  -30.857 1.000 43.145  ? 4373 CYS B O     1 
ATOM   3266 C  CB    . CYS B  2 123 ? 65.863  24.530  -32.731 1.000 46.695  ? 4373 CYS B CB    1 
ATOM   3267 S  SG    . CYS B  2 123 ? 64.464  24.117  -31.655 1.000 43.695  ? 4373 CYS B SG    1 
ATOM   3268 N  N     . GLY B  2 124 ? 67.251  22.058  -30.763 1.000 42.987  ? 4374 GLY B N     1 
ATOM   3269 C  CA    . GLY B  2 124 ? 67.762  21.786  -29.402 1.000 42.237  ? 4374 GLY B CA    1 
ATOM   3270 C  C     . GLY B  2 124 ? 66.936  22.464  -28.318 1.000 40.805  ? 4374 GLY B C     1 
ATOM   3271 O  O     . GLY B  2 124 ? 67.358  22.420  -27.146 1.000 40.475  ? 4374 GLY B O     1 
ATOM   3272 N  N     . MET B  2 125 ? 65.807  23.081  -28.685 1.000 40.152  ? 4375 MET B N     1 
ATOM   3273 C  CA    . MET B  2 125 ? 64.916  23.737  -27.691 1.000 40.293  ? 4375 MET B CA    1 
ATOM   3274 C  C     . MET B  2 125 ? 63.826  22.741  -27.293 1.000 39.196  ? 4375 MET B C     1 
ATOM   3275 O  O     . MET B  2 125 ? 63.567  21.810  -28.086 1.000 38.042  ? 4375 MET B O     1 
ATOM   3276 C  CB    . MET B  2 125 ? 64.229  24.973  -28.281 1.000 43.595  ? 4375 MET B CB    1 
ATOM   3277 C  CG    . MET B  2 125 ? 65.171  25.957  -28.940 1.000 47.002  ? 4375 MET B CG    1 
ATOM   3278 S  SD    . MET B  2 125 ? 66.296  26.758  -27.788 1.000 49.162  ? 4375 MET B SD    1 
ATOM   3279 C  CE    . MET B  2 125 ? 65.154  27.729  -26.805 1.000 52.873  ? 4375 MET B CE    1 
ATOM   3280 N  N     . TRP B  2 126 ? 63.212  22.934  -26.120 1.000 37.641  ? 4376 TRP B N     1 
ATOM   3281 C  CA    . TRP B  2 126 ? 62.087  22.062  -25.686 1.000 37.870  ? 4376 TRP B CA    1 
ATOM   3282 C  C     . TRP B  2 126 ? 60.893  22.274  -26.619 1.000 40.920  ? 4376 TRP B C     1 
ATOM   3283 O  O     . TRP B  2 126 ? 60.658  23.435  -27.003 1.000 40.436  ? 4376 TRP B O     1 
ATOM   3284 C  CB    . TRP B  2 126 ? 61.652  22.371  -24.249 1.000 37.249  ? 4376 TRP B CB    1 
ATOM   3285 C  CG    . TRP B  2 126 ? 62.596  21.943  -23.173 1.000 34.900  ? 4376 TRP B CG    1 
ATOM   3286 C  CD1   . TRP B  2 126 ? 63.355  22.747  -22.374 1.000 34.862  ? 4376 TRP B CD1   1 
ATOM   3287 C  CD2   . TRP B  2 126 ? 62.873  20.593  -22.769 1.000 34.510  ? 4376 TRP B CD2   1 
ATOM   3288 N  NE1   . TRP B  2 126 ? 64.071  21.989  -21.487 1.000 34.721  ? 4376 TRP B NE1   1 
ATOM   3289 C  CE2   . TRP B  2 126 ? 63.802  20.664  -21.710 1.000 34.662  ? 4376 TRP B CE2   1 
ATOM   3290 C  CE3   . TRP B  2 126 ? 62.424  19.336  -23.193 1.000 36.059  ? 4376 TRP B CE3   1 
ATOM   3291 C  CZ2   . TRP B  2 126 ? 64.292  19.526  -21.076 1.000 35.449  ? 4376 TRP B CZ2   1 
ATOM   3292 C  CZ3   . TRP B  2 126 ? 62.906  18.210  -22.562 1.000 36.697  ? 4376 TRP B CZ3   1 
ATOM   3293 C  CH2   . TRP B  2 126 ? 63.828  18.307  -21.515 1.000 36.990  ? 4376 TRP B CH2   1 
ATOM   3294 N  N     . LYS B  2 127 ? 60.170  21.200  -26.947 1.000 42.840  ? 4377 LYS B N     1 
ATOM   3295 C  CA    . LYS B  2 127 ? 58.939  21.319  -27.773 1.000 46.588  ? 4377 LYS B CA    1 
ATOM   3296 C  C     . LYS B  2 127 ? 57.888  22.021  -26.908 1.000 46.855  ? 4377 LYS B C     1 
ATOM   3297 O  O     . LYS B  2 127 ? 57.707  21.596  -25.752 1.000 46.999  ? 4377 LYS B O     1 
ATOM   3298 C  CB    . LYS B  2 127 ? 58.449  19.941  -28.233 1.000 49.472  ? 4377 LYS B CB    1 
ATOM   3299 C  CG    . LYS B  2 127 ? 59.396  19.179  -29.152 1.000 52.539  ? 4377 LYS B CG    1 
ATOM   3300 C  CD    . LYS B  2 127 ? 59.618  19.836  -30.497 1.000 56.895  ? 4377 LYS B CD    1 
ATOM   3301 C  CE    . LYS B  2 127 ? 58.366  19.880  -31.348 1.000 62.374  ? 4377 LYS B CE    1 
ATOM   3302 N  NZ    . LYS B  2 127 ? 58.614  20.536  -32.653 1.000 66.204  ? 4377 LYS B NZ    1 
ATOM   3303 N  N     . GLY B  2 128 ? 57.280  23.092  -27.422 1.000 48.697  ? 4378 GLY B N     1 
ATOM   3304 C  CA    . GLY B  2 128 ? 56.255  23.843  -26.672 1.000 51.497  ? 4378 GLY B CA    1 
ATOM   3305 C  C     . GLY B  2 128 ? 56.858  24.813  -25.663 1.000 50.809  ? 4378 GLY B C     1 
ATOM   3306 O  O     . GLY B  2 128 ? 56.071  25.502  -24.983 1.000 53.467  ? 4378 GLY B O     1 
ATOM   3307 N  N     . TYR B  2 129 ? 58.194  24.874  -25.561 1.000 49.184  ? 4379 TYR B N     1 
ATOM   3308 C  CA    . TYR B  2 129 ? 58.861  25.802  -24.603 1.000 47.386  ? 4379 TYR B CA    1 
ATOM   3309 C  C     . TYR B  2 129 ? 60.161  26.360  -25.198 1.000 46.607  ? 4379 TYR B C     1 
ATOM   3310 O  O     . TYR B  2 129 ? 61.198  26.357  -24.487 1.000 47.295  ? 4379 TYR B O     1 
ATOM   3311 C  CB    . TYR B  2 129 ? 59.162  25.101  -23.276 1.000 45.768  ? 4379 TYR B CB    1 
ATOM   3312 C  CG    . TYR B  2 129 ? 57.963  24.629  -22.496 1.000 45.986  ? 4379 TYR B CG    1 
ATOM   3313 C  CD1   . TYR B  2 129 ? 57.306  25.474  -21.616 1.000 47.911  ? 4379 TYR B CD1   1 
ATOM   3314 C  CD2   . TYR B  2 129 ? 57.511  23.325  -22.601 1.000 46.129  ? 4379 TYR B CD2   1 
ATOM   3315 C  CE1   . TYR B  2 129 ? 56.220  25.041  -20.873 1.000 50.176  ? 4379 TYR B CE1   1 
ATOM   3316 C  CE2   . TYR B  2 129 ? 56.421  22.877  -21.871 1.000 48.578  ? 4379 TYR B CE2   1 
ATOM   3317 C  CZ    . TYR B  2 129 ? 55.775  23.738  -21.001 1.000 50.425  ? 4379 TYR B CZ    1 
ATOM   3318 O  OH    . TYR B  2 129 ? 54.702  23.305  -20.279 1.000 56.188  ? 4379 TYR B OH    1 
ATOM   3319 N  N     . GLY B  2 130 ? 60.113  26.830  -26.448 1.000 46.006  ? 4380 GLY B N     1 
ATOM   3320 C  CA    . GLY B  2 130 ? 61.306  27.409  -27.098 1.000 45.388  ? 4380 GLY B CA    1 
ATOM   3321 C  C     . GLY B  2 130 ? 61.398  27.046  -28.571 1.000 44.362  ? 4380 GLY B C     1 
ATOM   3322 O  O     . GLY B  2 130 ? 61.778  27.920  -29.369 1.000 44.973  ? 4380 GLY B O     1 
ATOM   3323 N  N     . CYS B  2 131 ? 61.062  25.803  -28.922 1.000 44.513  ? 4381 CYS B N     1 
ATOM   3324 C  CA    . CYS B  2 131 ? 61.153  25.358  -30.338 1.000 45.289  ? 4381 CYS B CA    1 
ATOM   3325 C  C     . CYS B  2 131 ? 60.159  26.152  -31.198 1.000 47.862  ? 4381 CYS B C     1 
ATOM   3326 O  O     . CYS B  2 131 ? 58.957  26.149  -30.879 1.000 47.153  ? 4381 CYS B O     1 
ATOM   3327 C  CB    . CYS B  2 131 ? 60.905  23.861  -30.469 1.000 45.421  ? 4381 CYS B CB    1 
ATOM   3328 S  SG    . CYS B  2 131 ? 60.905  23.272  -32.185 1.000 42.798  ? 4381 CYS B SG    1 
ATOM   3329 N  N     . SER B  2 132 ? 60.665  26.836  -32.224 1.000 51.012  ? 4382 SER B N     1 
ATOM   3330 C  CA    . SER B  2 132 ? 59.800  27.624  -33.140 1.000 56.936  ? 4382 SER B CA    1 
ATOM   3331 C  C     . SER B  2 132 ? 59.873  27.023  -34.549 1.000 59.039  ? 4382 SER B C     1 
ATOM   3332 O  O     . SER B  2 132 ? 59.586  27.747  -35.521 1.000 62.197  ? 4382 SER B O     1 
ATOM   3333 C  CB    . SER B  2 132 ? 60.183  29.083  -33.123 1.000 59.097  ? 4382 SER B CB    1 
ATOM   3334 O  OG    . SER B  2 132 ? 61.550  29.249  -33.466 1.000 60.853  ? 4382 SER B OG    1 
ATOM   3335 N  N     . CYS B  2 133 ? 60.217  25.735  -34.641 1.000 57.487  ? 4383 CYS B N     1 
ATOM   3336 C  CA    . CYS B  2 133 ? 60.338  25.038  -35.952 1.000 60.640  ? 4383 CYS B CA    1 
ATOM   3337 C  C     . CYS B  2 133 ? 58.968  24.881  -36.632 1.000 62.437  ? 4383 CYS B C     1 
ATOM   3338 O  O     . CYS B  2 133 ? 58.949  24.808  -37.868 1.000 63.900  ? 4383 CYS B O     1 
ATOM   3339 C  CB    . CYS B  2 133 ? 60.977  23.661  -35.784 1.000 59.775  ? 4383 CYS B CB    1 
ATOM   3340 S  SG    . CYS B  2 133 ? 62.737  23.703  -35.348 1.000 53.811  ? 4383 CYS B SG    1 
ATOM   3341 N  N     . ASP B  2 134 ? 57.876  24.862  -35.856 1.000 65.279  ? 4384 ASP B N     1 
ATOM   3342 C  CA    . ASP B  2 134 ? 56.505  24.628  -36.397 1.000 71.091  ? 4384 ASP B CA    1 
ATOM   3343 C  C     . ASP B  2 134 ? 55.689  25.921  -36.547 1.000 73.998  ? 4384 ASP B C     1 
ATOM   3344 O  O     . ASP B  2 134 ? 54.506  25.821  -36.930 1.000 77.838  ? 4384 ASP B O     1 
ATOM   3345 C  CB    . ASP B  2 134 ? 55.724  23.658  -35.503 1.000 72.949  ? 4384 ASP B CB    1 
ATOM   3346 C  CG    . ASP B  2 134 ? 56.262  22.237  -35.503 1.000 73.740  ? 4384 ASP B CG    1 
ATOM   3347 O  OD1   . ASP B  2 134 ? 56.674  21.763  -36.583 1.000 76.274  ? 4384 ASP B OD1   1 
ATOM   3348 O  OD2   . ASP B  2 134 ? 56.291  21.626  -34.418 1.000 75.363  ? 4384 ASP B OD2   1 
ATOM   3349 N  N     A GLN B  2 135 ? 56.292  27.082  -36.275 0.500 73.825  ? 4385 GLN B N     1 
ATOM   3350 N  N     B GLN B  2 135 ? 56.284  27.086  -36.261 0.500 72.950  ? 4385 GLN B N     1 
ATOM   3351 C  CA    A GLN B  2 135 ? 55.550  28.368  -36.390 0.500 71.241  ? 4385 GLN B CA    1 
ATOM   3352 C  CA    B GLN B  2 135 ? 55.528  28.363  -36.395 0.500 69.858  ? 4385 GLN B CA    1 
ATOM   3353 C  C     A GLN B  2 135 ? 55.442  28.770  -37.866 0.500 72.328  ? 4385 GLN B C     1 
ATOM   3354 C  C     B GLN B  2 135 ? 55.359  28.678  -37.885 0.500 70.812  ? 4385 GLN B C     1 
ATOM   3355 O  O     A GLN B  2 135 ? 56.384  28.482  -38.633 0.500 73.176  ? 4385 GLN B O     1 
ATOM   3356 O  O     B GLN B  2 135 ? 56.213  28.234  -38.681 0.500 71.939  ? 4385 GLN B O     1 
ATOM   3357 C  CB    A GLN B  2 135 ? 56.237  29.458  -35.568 0.500 68.401  ? 4385 GLN B CB    1 
ATOM   3358 C  CB    B GLN B  2 135 ? 56.242  29.537  -35.719 0.500 66.644  ? 4385 GLN B CB    1 
ATOM   3359 C  CG    A GLN B  2 135 ? 56.306  29.139  -34.081 0.500 68.230  ? 4385 GLN B CG    1 
ATOM   3360 C  CG    B GLN B  2 135 ? 57.434  30.070  -36.503 0.500 65.753  ? 4385 GLN B CG    1 
ATOM   3361 C  CD    A GLN B  2 135 ? 56.901  30.275  -33.287 0.500 66.302  ? 4385 GLN B CD    1 
ATOM   3362 C  CD    B GLN B  2 135 ? 58.020  31.316  -35.881 0.500 64.050  ? 4385 GLN B CD    1 
ATOM   3363 O  OE1   A GLN B  2 135 ? 57.235  31.327  -33.828 0.500 64.629  ? 4385 GLN B OE1   1 
ATOM   3364 O  OE1   B GLN B  2 135 ? 57.641  31.724  -34.786 0.500 61.666  ? 4385 GLN B OE1   1 
ATOM   3365 N  NE2   A GLN B  2 135 ? 57.023  30.073  -31.987 0.500 66.591  ? 4385 GLN B NE2   1 
ATOM   3366 N  NE2   B GLN B  2 135 ? 58.955  31.935  -36.583 0.500 63.852  ? 4385 GLN B NE2   1 
ATOM   3367 N  N     A LEU B  2 136 ? 54.323  29.403  -38.237 0.500 72.028  ? 4386 LEU B N     1 
ATOM   3368 N  N     B LEU B  2 136 ? 54.299  29.408  -38.242 0.500 70.226  ? 4386 LEU B N     1 
ATOM   3369 C  CA    A LEU B  2 136 ? 54.089  29.865  -39.631 0.500 73.084  ? 4386 LEU B CA    1 
ATOM   3370 C  CA    B LEU B  2 136 ? 54.092  29.781  -39.665 0.500 71.451  ? 4386 LEU B CA    1 
ATOM   3371 C  C     A LEU B  2 136 ? 55.369  30.525  -40.157 0.500 71.859  ? 4386 LEU B C     1 
ATOM   3372 C  C     B LEU B  2 136 ? 55.355  30.497  -40.161 0.500 70.827  ? 4386 LEU B C     1 
ATOM   3373 O  O     A LEU B  2 136 ? 56.140  31.052  -39.332 0.500 69.303  ? 4386 LEU B O     1 
ATOM   3374 O  O     B LEU B  2 136 ? 56.097  31.038  -39.318 0.500 68.198  ? 4386 LEU B O     1 
ATOM   3375 C  CB    A LEU B  2 136 ? 52.915  30.851  -39.631 0.500 72.177  ? 4386 LEU B CB    1 
ATOM   3376 C  CB    B LEU B  2 136 ? 52.840  30.657  -39.789 0.500 70.252  ? 4386 LEU B CB    1 
ATOM   3377 C  CG    A LEU B  2 136 ? 52.498  31.397  -40.997 0.500 73.403  ? 4386 LEU B CG    1 
ATOM   3378 C  CG    B LEU B  2 136 ? 51.528  29.978  -39.391 0.500 71.618  ? 4386 LEU B CG    1 
ATOM   3379 C  CD1   A LEU B  2 136 ? 52.084  30.269  -41.932 0.500 77.140  ? 4386 LEU B CD1   1 
ATOM   3380 C  CD1   B LEU B  2 136 ? 50.356  30.940  -39.506 0.500 71.340  ? 4386 LEU B CD1   1 
ATOM   3381 C  CD2   A LEU B  2 136 ? 51.371  32.407  -40.855 0.500 73.267  ? 4386 LEU B CD2   1 
ATOM   3382 C  CD2   B LEU B  2 136 ? 51.280  28.738  -40.236 0.500 75.076  ? 4386 LEU B CD2   1 
ATOM   3383 N  N     . ARG B  2 137 ? 55.587  30.467  -41.475 1.000 73.956  ? 4387 ARG B N     1 
ATOM   3384 C  CA    . ARG B  2 137 ? 56.776  31.079  -42.127 1.000 76.293  ? 4387 ARG B CA    1 
ATOM   3385 C  C     . ARG B  2 137 ? 56.825  32.589  -41.853 1.000 73.587  ? 4387 ARG B C     1 
ATOM   3386 O  O     . ARG B  2 137 ? 55.798  33.256  -42.097 1.000 73.636  ? 4387 ARG B O     1 
ATOM   3387 C  CB    . ARG B  2 137 ? 56.676  30.864  -43.642 1.000 82.456  ? 4387 ARG B CB    1 
ATOM   3388 C  CG    . ARG B  2 137 ? 56.588  29.408  -44.083 1.000 89.835  ? 4387 ARG B CG    1 
ATOM   3389 C  CD    . ARG B  2 137 ? 57.929  28.701  -44.081 1.000 94.634  ? 4387 ARG B CD    1 
ATOM   3390 N  NE    . ARG B  2 137 ? 58.841  29.328  -45.034 1.000 96.683  ? 4387 ARG B NE    1 
ATOM   3391 C  CZ    . ARG B  2 137 ? 58.860  29.089  -46.345 1.000 101.112 ? 4387 ARG B CZ    1 
ATOM   3392 N  NH1   . ARG B  2 137 ? 59.731  29.718  -47.118 1.000 101.616 ? 4387 ARG B NH1   1 
ATOM   3393 N  NH2   . ARG B  2 137 ? 58.008  28.233  -46.883 1.000 106.039 ? 4387 ARG B NH2   1 
ATOM   3394 N  N     . GLU B  2 138 ? 57.957  33.101  -41.352 1.000 71.264  ? 4388 GLU B N     1 
ATOM   3395 C  CA    . GLU B  2 138 ? 58.103  34.570  -41.143 1.000 67.495  ? 4388 GLU B CA    1 
ATOM   3396 C  C     . GLU B  2 138 ? 58.397  35.219  -42.491 1.000 65.408  ? 4388 GLU B C     1 
ATOM   3397 O  O     . GLU B  2 138 ? 58.974  34.571  -43.363 1.000 64.908  ? 4388 GLU B O     1 
ATOM   3398 C  CB    . GLU B  2 138 ? 59.274  34.941  -40.223 1.000 68.188  ? 4388 GLU B CB    1 
ATOM   3399 C  CG    . GLU B  2 138 ? 59.102  34.563  -38.762 1.000 69.897  ? 4388 GLU B CG    1 
ATOM   3400 C  CD    . GLU B  2 138 ? 60.226  35.015  -37.839 1.000 70.581  ? 4388 GLU B CD    1 
ATOM   3401 O  OE1   . GLU B  2 138 ? 61.005  35.910  -38.237 1.000 65.663  ? 4388 GLU B OE1   1 
ATOM   3402 O  OE2   . GLU B  2 138 ? 60.323  34.464  -36.718 1.000 72.644  ? 4388 GLU B OE2   1 
ATOM   3403 N  N     . PRO B  2 139 ? 57.981  36.489  -42.723 1.000 59.773  ? 4389 PRO B N     1 
ATOM   3404 C  CA    . PRO B  2 139 ? 58.354  37.199  -43.940 1.000 56.179  ? 4389 PRO B CA    1 
ATOM   3405 C  C     . PRO B  2 139 ? 59.863  37.418  -43.776 1.000 51.984  ? 4389 PRO B C     1 
ATOM   3406 O  O     . PRO B  2 139 ? 60.325  37.466  -42.647 1.000 49.812  ? 4389 PRO B O     1 
ATOM   3407 C  CB    . PRO B  2 139 ? 57.530  38.493  -43.922 1.000 56.696  ? 4389 PRO B CB    1 
ATOM   3408 C  CG    . PRO B  2 139 ? 57.227  38.704  -42.451 1.000 57.540  ? 4389 PRO B CG    1 
ATOM   3409 C  CD    . PRO B  2 139 ? 57.135  37.313  -41.847 1.000 58.849  ? 4389 PRO B CD    1 
ATOM   3410 N  N     . MET B  2 140 ? 60.590  37.498  -44.884 1.000 48.866  ? 4390 MET B N     1 
ATOM   3411 C  CA    . MET B  2 140 ? 62.066  37.648  -44.831 1.000 46.713  ? 4390 MET B CA    1 
ATOM   3412 C  C     . MET B  2 140 ? 62.413  39.043  -44.295 1.000 44.459  ? 4390 MET B C     1 
ATOM   3413 O  O     . MET B  2 140 ? 61.673  40.006  -44.599 1.000 41.054  ? 4390 MET B O     1 
ATOM   3414 C  CB    . MET B  2 140 ? 62.652  37.404  -46.225 1.000 47.511  ? 4390 MET B CB    1 
ATOM   3415 C  CG    . MET B  2 140 ? 62.345  35.997  -46.746 1.000 49.716  ? 4390 MET B CG    1 
ATOM   3416 S  SD    . MET B  2 140 ? 62.578  35.776  -48.539 1.000 51.245  ? 4390 MET B SD    1 
ATOM   3417 C  CE    . MET B  2 140 ? 64.299  36.256  -48.702 1.000 51.064  ? 4390 MET B CE    1 
ATOM   3418 N  N     . LEU B  2 141 ? 63.482  39.123  -43.496 1.000 44.487  ? 4391 LEU B N     1 
ATOM   3419 C  CA    . LEU B  2 141 ? 63.935  40.394  -42.872 1.000 45.167  ? 4391 LEU B CA    1 
ATOM   3420 C  C     . LEU B  2 141 ? 65.308  40.793  -43.420 1.000 46.183  ? 4391 LEU B C     1 
ATOM   3421 O  O     . LEU B  2 141 ? 66.209  39.929  -43.455 1.000 47.611  ? 4391 LEU B O     1 
ATOM   3422 C  CB    . LEU B  2 141 ? 64.009  40.196  -41.351 1.000 45.975  ? 4391 LEU B CB    1 
ATOM   3423 C  CG    . LEU B  2 141 ? 62.702  39.780  -40.677 1.000 46.288  ? 4391 LEU B CG    1 
ATOM   3424 C  CD1   . LEU B  2 141 ? 62.932  39.395  -39.220 1.000 48.203  ? 4391 LEU B CD1   1 
ATOM   3425 C  CD2   . LEU B  2 141 ? 61.661  40.883  -40.789 1.000 45.747  ? 4391 LEU B CD2   1 
ATOM   3426 N  N     . GLN B  2 142 ? 65.454  42.062  -43.811 1.000 45.706  ? 4392 GLN B N     1 
ATOM   3427 C  CA    . GLN B  2 142 ? 66.759  42.590  -44.287 1.000 47.662  ? 4392 GLN B CA    1 
ATOM   3428 C  C     . GLN B  2 142 ? 67.743  42.579  -43.115 1.000 50.237  ? 4392 GLN B C     1 
ATOM   3429 O  O     . GLN B  2 142 ? 67.315  42.565  -41.957 1.000 49.700  ? 4392 GLN B O     1 
ATOM   3430 C  CB    . GLN B  2 142 ? 66.662  44.039  -44.761 1.000 46.482  ? 4392 GLN B CB    1 
ATOM   3431 C  CG    . GLN B  2 142 ? 65.491  44.329  -45.688 1.000 45.754  ? 4392 GLN B CG    1 
ATOM   3432 C  CD    . GLN B  2 142 ? 65.688  45.644  -46.401 1.000 44.507  ? 4392 GLN B CD    1 
ATOM   3433 O  OE1   . GLN B  2 142 ? 66.797  46.180  -46.444 1.000 43.890  ? 4392 GLN B OE1   1 
ATOM   3434 N  NE2   . GLN B  2 142 ? 64.620  46.160  -46.988 1.000 41.441  ? 4392 GLN B NE2   1 
ATOM   3435 O  OXT   . GLN B  2 142 ? 68.960  42.615  -43.299 1.000 54.296  ? 4392 GLN B OXT   1 
ATOM   3436 N  N     . SER C  1 4   ? 78.605  -47.472 -20.937 1.000 73.902  ? 6799 SER C N     1 
ATOM   3437 C  CA    . SER C  1 4   ? 79.966  -46.980 -20.554 1.000 70.354  ? 6799 SER C CA    1 
ATOM   3438 C  C     . SER C  1 4   ? 80.093  -46.951 -19.025 1.000 69.298  ? 6799 SER C C     1 
ATOM   3439 O  O     . SER C  1 4   ? 79.151  -46.469 -18.360 1.000 65.351  ? 6799 SER C O     1 
ATOM   3440 C  CB    . SER C  1 4   ? 80.244  -45.619 -21.158 1.000 67.901  ? 6799 SER C CB    1 
ATOM   3441 O  OG    . SER C  1 4   ? 81.562  -45.182 -20.857 1.000 64.638  ? 6799 SER C OG    1 
ATOM   3442 N  N     . SER C  1 5   ? 81.206  -47.474 -18.499 1.000 67.647  ? 6800 SER C N     1 
ATOM   3443 C  CA    . SER C  1 5   ? 81.480  -47.498 -17.036 1.000 66.564  ? 6800 SER C CA    1 
ATOM   3444 C  C     . SER C  1 5   ? 81.707  -46.068 -16.517 1.000 61.088  ? 6800 SER C C     1 
ATOM   3445 O  O     . SER C  1 5   ? 81.391  -45.789 -15.338 1.000 62.901  ? 6800 SER C O     1 
ATOM   3446 C  CB    . SER C  1 5   ? 82.663  -48.382 -16.753 1.000 70.906  ? 6800 SER C CB    1 
ATOM   3447 O  OG    . SER C  1 5   ? 83.772  -48.001 -17.558 1.000 71.512  ? 6800 SER C OG    1 
ATOM   3448 N  N     . GLN C  1 6   ? 82.214  -45.193 -17.388 1.000 51.957  ? 6801 GLN C N     1 
ATOM   3449 C  CA    . GLN C  1 6   ? 82.496  -43.776 -17.044 1.000 47.800  ? 6801 GLN C CA    1 
ATOM   3450 C  C     . GLN C  1 6   ? 81.183  -42.988 -16.928 1.000 41.393  ? 6801 GLN C C     1 
ATOM   3451 O  O     . GLN C  1 6   ? 81.216  -41.889 -16.346 1.000 37.886  ? 6801 GLN C O     1 
ATOM   3452 C  CB    . GLN C  1 6   ? 83.385  -43.151 -18.124 1.000 49.011  ? 6801 GLN C CB    1 
ATOM   3453 C  CG    . GLN C  1 6   ? 84.786  -43.747 -18.195 1.000 53.094  ? 6801 GLN C CG    1 
ATOM   3454 C  CD    . GLN C  1 6   ? 85.568  -43.265 -19.394 1.000 55.080  ? 6801 GLN C CD    1 
ATOM   3455 O  OE1   . GLN C  1 6   ? 85.007  -42.831 -20.404 1.000 55.313  ? 6801 GLN C OE1   1 
ATOM   3456 N  NE2   . GLN C  1 6   ? 86.884  -43.370 -19.303 1.000 54.837  ? 6801 GLN C NE2   1 
ATOM   3457 N  N     . ALA C  1 7   ? 80.076  -43.548 -17.432 1.000 37.190  ? 6802 ALA C N     1 
ATOM   3458 C  CA    . ALA C  1 7   ? 78.765  -42.852 -17.467 1.000 37.012  ? 6802 ALA C CA    1 
ATOM   3459 C  C     . ALA C  1 7   ? 78.223  -42.560 -16.060 1.000 37.496  ? 6802 ALA C C     1 
ATOM   3460 O  O     . ALA C  1 7   ? 77.432  -41.613 -15.942 1.000 36.048  ? 6802 ALA C O     1 
ATOM   3461 C  CB    . ALA C  1 7   ? 77.775  -43.673 -18.257 1.000 37.342  ? 6802 ALA C CB    1 
ATOM   3462 N  N     . TRP C  1 8   ? 78.601  -43.359 -15.055 1.000 39.241  ? 6803 TRP C N     1 
ATOM   3463 C  CA    . TRP C  1 8   ? 78.095  -43.184 -13.665 1.000 42.588  ? 6803 TRP C CA    1 
ATOM   3464 C  C     . TRP C  1 8   ? 78.862  -42.045 -12.969 1.000 38.984  ? 6803 TRP C C     1 
ATOM   3465 O  O     . TRP C  1 8   ? 78.335  -41.497 -11.984 1.000 40.436  ? 6803 TRP C O     1 
ATOM   3466 C  CB    . TRP C  1 8   ? 78.217  -44.504 -12.882 1.000 47.734  ? 6803 TRP C CB    1 
ATOM   3467 C  CG    . TRP C  1 8   ? 78.153  -45.737 -13.736 1.000 54.116  ? 6803 TRP C CG    1 
ATOM   3468 C  CD1   . TRP C  1 8   ? 79.107  -46.710 -13.827 1.000 59.356  ? 6803 TRP C CD1   1 
ATOM   3469 C  CD2   . TRP C  1 8   ? 77.151  -46.077 -14.714 1.000 57.736  ? 6803 TRP C CD2   1 
ATOM   3470 N  NE1   . TRP C  1 8   ? 78.738  -47.661 -14.741 1.000 63.090  ? 6803 TRP C NE1   1 
ATOM   3471 C  CE2   . TRP C  1 8   ? 77.549  -47.292 -15.313 1.000 61.469  ? 6803 TRP C CE2   1 
ATOM   3472 C  CE3   . TRP C  1 8   ? 75.947  -45.491 -15.126 1.000 60.753  ? 6803 TRP C CE3   1 
ATOM   3473 C  CZ2   . TRP C  1 8   ? 76.778  -47.930 -16.287 1.000 63.804  ? 6803 TRP C CZ2   1 
ATOM   3474 C  CZ3   . TRP C  1 8   ? 75.189  -46.118 -16.093 1.000 60.425  ? 6803 TRP C CZ3   1 
ATOM   3475 C  CH2   . TRP C  1 8   ? 75.602  -47.320 -16.667 1.000 63.437  ? 6803 TRP C CH2   1 
ATOM   3476 N  N     . GLN C  1 9   ? 80.057  -41.713 -13.473 1.000 35.089  ? 6804 GLN C N     1 
ATOM   3477 C  CA    . GLN C  1 9   ? 80.947  -40.662 -12.907 1.000 33.413  ? 6804 GLN C CA    1 
ATOM   3478 C  C     . GLN C  1 9   ? 80.410  -39.270 -13.250 1.000 29.402  ? 6804 GLN C C     1 
ATOM   3479 O  O     . GLN C  1 9   ? 79.542  -39.129 -14.107 1.000 28.162  ? 6804 GLN C O     1 
ATOM   3480 C  CB    . GLN C  1 9   ? 82.351  -40.802 -13.505 1.000 34.084  ? 6804 GLN C CB    1 
ATOM   3481 C  CG    . GLN C  1 9   ? 82.962  -42.193 -13.383 1.000 37.335  ? 6804 GLN C CG    1 
ATOM   3482 C  CD    . GLN C  1 9   ? 84.304  -42.290 -14.076 1.000 40.210  ? 6804 GLN C CD    1 
ATOM   3483 O  OE1   . GLN C  1 9   ? 84.781  -41.350 -14.725 1.000 40.933  ? 6804 GLN C OE1   1 
ATOM   3484 N  NE2   . GLN C  1 9   ? 84.935  -43.444 -13.948 1.000 42.057  ? 6804 GLN C NE2   1 
ATOM   3485 N  N     . PRO C  1 10  ? 80.879  -38.195 -12.573 1.000 27.104  ? 6805 PRO C N     1 
ATOM   3486 C  CA    . PRO C  1 10  ? 80.455  -36.837 -12.915 1.000 25.686  ? 6805 PRO C CA    1 
ATOM   3487 C  C     . PRO C  1 10  ? 81.065  -36.422 -14.263 1.000 23.957  ? 6805 PRO C C     1 
ATOM   3488 O  O     . PRO C  1 10  ? 80.578  -35.510 -14.889 1.000 23.981  ? 6805 PRO C O     1 
ATOM   3489 C  CB    . PRO C  1 10  ? 80.987  -35.968 -11.762 1.000 25.706  ? 6805 PRO C CB    1 
ATOM   3490 C  CG    . PRO C  1 10  ? 82.128  -36.777 -11.168 1.000 27.201  ? 6805 PRO C CG    1 
ATOM   3491 C  CD    . PRO C  1 10  ? 81.757  -38.230 -11.391 1.000 28.171  ? 6805 PRO C CD    1 
ATOM   3492 N  N     . GLY C  1 11  ? 82.124  -37.119 -14.673 1.000 23.860  ? 6806 GLY C N     1 
ATOM   3493 C  CA    . GLY C  1 11  ? 82.801  -36.796 -15.936 1.000 23.287  ? 6806 GLY C CA    1 
ATOM   3494 C  C     . GLY C  1 11  ? 84.032  -37.649 -16.127 1.000 23.595  ? 6806 GLY C C     1 
ATOM   3495 O  O     . GLY C  1 11  ? 84.173  -38.654 -15.401 1.000 23.538  ? 6806 GLY C O     1 
ATOM   3496 N  N     . VAL C  1 12  ? 84.915  -37.225 -17.030 1.000 22.710  ? 6807 VAL C N     1 
ATOM   3497 C  CA    . VAL C  1 12  ? 86.120  -38.029 -17.355 1.000 23.372  ? 6807 VAL C CA    1 
ATOM   3498 C  C     . VAL C  1 12  ? 87.340  -37.120 -17.365 1.000 22.638  ? 6807 VAL C C     1 
ATOM   3499 O  O     . VAL C  1 12  ? 87.282  -36.047 -18.002 1.000 22.095  ? 6807 VAL C O     1 
ATOM   3500 C  CB    . VAL C  1 12  ? 85.950  -38.731 -18.715 1.000 24.585  ? 6807 VAL C CB    1 
ATOM   3501 C  CG1   . VAL C  1 12  ? 87.124  -39.648 -19.007 1.000 25.825  ? 6807 VAL C CG1   1 
ATOM   3502 C  CG2   . VAL C  1 12  ? 84.640  -39.501 -18.781 1.000 25.598  ? 6807 VAL C CG2   1 
ATOM   3503 N  N     . ALA C  1 13  ? 88.393  -37.560 -16.683 1.000 22.677  ? 6808 ALA C N     1 
ATOM   3504 C  CA    . ALA C  1 13  ? 89.671  -36.827 -16.626 1.000 22.799  ? 6808 ALA C CA    1 
ATOM   3505 C  C     . ALA C  1 13  ? 90.611  -37.401 -17.687 1.000 23.287  ? 6808 ALA C C     1 
ATOM   3506 O  O     . ALA C  1 13  ? 90.619  -38.628 -17.879 1.000 23.886  ? 6808 ALA C O     1 
ATOM   3507 C  CB    . ALA C  1 13  ? 90.268  -36.957 -15.248 1.000 24.589  ? 6808 ALA C CB    1 
ATOM   3508 N  N     . MET C  1 14  ? 91.380  -36.532 -18.329 1.000 23.250  ? 6809 MET C N     1 
ATOM   3509 C  CA    . MET C  1 14  ? 92.376  -36.927 -19.352 1.000 23.880  ? 6809 MET C CA    1 
ATOM   3510 C  C     . MET C  1 14  ? 93.378  -37.899 -18.724 1.000 24.853  ? 6809 MET C C     1 
ATOM   3511 O  O     . MET C  1 14  ? 94.037  -37.546 -17.751 1.000 24.299  ? 6809 MET C O     1 
ATOM   3512 C  CB    . MET C  1 14  ? 93.103  -35.675 -19.828 1.000 23.739  ? 6809 MET C CB    1 
ATOM   3513 C  CG    . MET C  1 14  ? 94.044  -35.898 -20.960 1.000 24.690  ? 6809 MET C CG    1 
ATOM   3514 S  SD    . MET C  1 14  ? 94.745  -34.320 -21.428 1.000 26.281  ? 6809 MET C SD    1 
ATOM   3515 C  CE    . MET C  1 14  ? 95.970  -34.865 -22.621 1.000 25.771  ? 6809 MET C CE    1 
ATOM   3516 N  N     . PRO C  1 15  ? 93.483  -39.160 -19.206 1.000 25.445  ? 6810 PRO C N     1 
ATOM   3517 C  CA    . PRO C  1 15  ? 94.438  -40.123 -18.645 1.000 27.531  ? 6810 PRO C CA    1 
ATOM   3518 C  C     . PRO C  1 15  ? 95.898  -39.653 -18.730 1.000 27.884  ? 6810 PRO C C     1 
ATOM   3519 O  O     . PRO C  1 15  ? 96.248  -38.973 -19.669 1.000 28.273  ? 6810 PRO C O     1 
ATOM   3520 C  CB    . PRO C  1 15  ? 94.218  -41.395 -19.480 1.000 28.155  ? 6810 PRO C CB    1 
ATOM   3521 C  CG    . PRO C  1 15  ? 92.797  -41.252 -19.991 1.000 27.189  ? 6810 PRO C CG    1 
ATOM   3522 C  CD    . PRO C  1 15  ? 92.620  -39.766 -20.228 1.000 25.689  ? 6810 PRO C CD    1 
ATOM   3523 N  N     . ASN C  1 16  ? 96.713  -40.050 -17.752 1.000 29.765  ? 6811 ASN C N     1 
ATOM   3524 C  CA    . ASN C  1 16  ? 98.143  -39.630 -17.684 1.000 30.361  ? 6811 ASN C CA    1 
ATOM   3525 C  C     . ASN C  1 16  ? 98.894  -39.958 -18.980 1.000 30.091  ? 6811 ASN C C     1 
ATOM   3526 O  O     . ASN C  1 16  ? 99.698  -39.116 -19.421 1.000 29.562  ? 6811 ASN C O     1 
ATOM   3527 C  CB    . ASN C  1 16  ? 98.849  -40.248 -16.474 1.000 32.118  ? 6811 ASN C CB    1 
ATOM   3528 C  CG    . ASN C  1 16  ? 98.408  -39.617 -15.170 1.000 32.536  ? 6811 ASN C CG    1 
ATOM   3529 O  OD1   . ASN C  1 16  ? 97.739  -38.586 -15.185 1.000 31.868  ? 6811 ASN C OD1   1 
ATOM   3530 N  ND2   . ASN C  1 16  ? 98.806  -40.198 -14.050 1.000 33.628  ? 6811 ASN C ND2   1 
ATOM   3531 N  N     . LEU C  1 17  ? 98.633  -41.115 -19.585 1.000 30.793  ? 6812 LEU C N     1 
ATOM   3532 C  CA    . LEU C  1 17  ? 99.409  -41.487 -20.801 1.000 31.022  ? 6812 LEU C CA    1 
ATOM   3533 C  C     . LEU C  1 17  ? 99.152  -40.473 -21.928 1.000 29.920  ? 6812 LEU C C     1 
ATOM   3534 O  O     . LEU C  1 17  ? 100.101 -40.182 -22.679 1.000 29.778  ? 6812 LEU C O     1 
ATOM   3535 C  CB    . LEU C  1 17  ? 99.035  -42.915 -21.200 1.000 32.207  ? 6812 LEU C CB    1 
ATOM   3536 C  CG    . LEU C  1 17  ? 99.779  -43.492 -22.402 1.000 33.215  ? 6812 LEU C CG    1 
ATOM   3537 C  CD1   . LEU C  1 17  ? 101.285 -43.325 -22.260 1.000 34.119  ? 6812 LEU C CD1   1 
ATOM   3538 C  CD2   . LEU C  1 17  ? 99.414  -44.959 -22.581 1.000 34.803  ? 6812 LEU C CD2   1 
ATOM   3539 N  N     . TYR C  1 18  ? 97.935  -39.920 -22.017 1.000 29.153  ? 6813 TYR C N     1 
ATOM   3540 C  CA    . TYR C  1 18  ? 97.634  -38.930 -23.087 1.000 28.495  ? 6813 TYR C CA    1 
ATOM   3541 C  C     . TYR C  1 18  ? 98.414  -37.635 -22.834 1.000 28.199  ? 6813 TYR C C     1 
ATOM   3542 O  O     . TYR C  1 18  ? 98.802  -36.968 -23.804 1.000 27.676  ? 6813 TYR C O     1 
ATOM   3543 C  CB    . TYR C  1 18  ? 96.130  -38.674 -23.201 1.000 28.213  ? 6813 TYR C CB    1 
ATOM   3544 C  CG    . TYR C  1 18  ? 95.379  -39.788 -23.884 1.000 29.217  ? 6813 TYR C CG    1 
ATOM   3545 C  CD1   . TYR C  1 18  ? 95.320  -39.850 -25.265 1.000 30.702  ? 6813 TYR C CD1   1 
ATOM   3546 C  CD2   . TYR C  1 18  ? 94.744  -40.784 -23.163 1.000 30.034  ? 6813 TYR C CD2   1 
ATOM   3547 C  CE1   . TYR C  1 18  ? 94.651  -40.873 -25.918 1.000 31.908  ? 6813 TYR C CE1   1 
ATOM   3548 C  CE2   . TYR C  1 18  ? 94.071  -41.815 -23.800 1.000 31.731  ? 6813 TYR C CE2   1 
ATOM   3549 C  CZ    . TYR C  1 18  ? 94.018  -41.855 -25.182 1.000 32.636  ? 6813 TYR C CZ    1 
ATOM   3550 O  OH    . TYR C  1 18  ? 93.363  -42.862 -25.833 1.000 34.834  ? 6813 TYR C OH    1 
ATOM   3551 N  N     . LYS C  1 19  ? 98.629  -37.289 -21.566 1.000 27.936  ? 6814 LYS C N     1 
ATOM   3552 C  CA    . LYS C  1 19  ? 99.396  -36.063 -21.226 1.000 28.884  ? 6814 LYS C CA    1 
ATOM   3553 C  C     . LYS C  1 19  ? 100.865 -36.195 -21.655 1.000 31.032  ? 6814 LYS C C     1 
ATOM   3554 O  O     . LYS C  1 19  ? 101.503 -35.161 -21.867 1.000 32.173  ? 6814 LYS C O     1 
ATOM   3555 C  CB    . LYS C  1 19  ? 99.360  -35.833 -19.715 1.000 29.128  ? 6814 LYS C CB    1 
ATOM   3556 C  CG    . LYS C  1 19  ? 97.972  -35.715 -19.104 1.000 28.921  ? 6814 LYS C CG    1 
ATOM   3557 C  CD    . LYS C  1 19  ? 98.021  -35.651 -17.597 1.000 30.125  ? 6814 LYS C CD    1 
ATOM   3558 C  CE    . LYS C  1 19  ? 96.660  -35.688 -16.943 1.000 30.065  ? 6814 LYS C CE    1 
ATOM   3559 N  NZ    . LYS C  1 19  ? 96.791  -35.820 -15.472 1.000 32.023  ? 6814 LYS C NZ    1 
ATOM   3560 N  N     . MET C  1 20  ? 101.365 -37.418 -21.839 1.000 32.941  ? 6815 MET C N     1 
ATOM   3561 C  CA    . MET C  1 20  ? 102.814 -37.623 -22.130 1.000 35.037  ? 6815 MET C CA    1 
ATOM   3562 C  C     . MET C  1 20  ? 103.094 -37.808 -23.625 1.000 34.114  ? 6815 MET C C     1 
ATOM   3563 O  O     . MET C  1 20  ? 104.247 -38.130 -23.978 1.000 34.783  ? 6815 MET C O     1 
ATOM   3564 C  CB    . MET C  1 20  ? 103.295 -38.841 -21.354 1.000 38.175  ? 6815 MET C CB    1 
ATOM   3565 C  CG    . MET C  1 20  ? 103.109 -38.656 -19.867 1.000 40.813  ? 6815 MET C CG    1 
ATOM   3566 S  SD    . MET C  1 20  ? 103.577 -40.119 -19.004 1.000 46.724  ? 6815 MET C SD    1 
ATOM   3567 C  CE    . MET C  1 20  ? 105.320 -40.173 -19.414 1.000 47.503  ? 6815 MET C CE    1 
ATOM   3568 N  N     . GLN C  1 21  ? 102.102 -37.541 -24.468 1.000 31.898  ? 6816 GLN C N     1 
ATOM   3569 C  CA    . GLN C  1 21  ? 102.265 -37.690 -25.933 1.000 32.049  ? 6816 GLN C CA    1 
ATOM   3570 C  C     . GLN C  1 21  ? 102.890 -36.416 -26.505 1.000 33.319  ? 6816 GLN C C     1 
ATOM   3571 O  O     . GLN C  1 21  ? 103.108 -35.458 -25.733 1.000 31.095  ? 6816 GLN C O     1 
ATOM   3572 C  CB    . GLN C  1 21  ? 100.905 -37.985 -26.566 1.000 30.239  ? 6816 GLN C CB    1 
ATOM   3573 C  CG    . GLN C  1 21  ? 100.281 -39.262 -26.037 1.000 29.524  ? 6816 GLN C CG    1 
ATOM   3574 C  CD    . GLN C  1 21  ? 101.255 -40.405 -26.177 1.000 30.864  ? 6816 GLN C CD    1 
ATOM   3575 O  OE1   . GLN C  1 21  ? 101.770 -40.669 -27.267 1.000 31.596  ? 6816 GLN C OE1   1 
ATOM   3576 N  NE2   . GLN C  1 21  ? 101.519 -41.085 -25.070 1.000 30.399  ? 6816 GLN C NE2   1 
ATOM   3577 N  N     . ARG C  1 22  ? 103.204 -36.431 -27.801 1.000 35.094  ? 6817 ARG C N     1 
ATOM   3578 C  CA    . ARG C  1 22  ? 103.746 -35.222 -28.472 1.000 38.371  ? 6817 ARG C CA    1 
ATOM   3579 C  C     . ARG C  1 22  ? 102.970 -35.063 -29.782 1.000 37.924  ? 6817 ARG C C     1 
ATOM   3580 O  O     . ARG C  1 22  ? 103.564 -35.180 -30.862 1.000 36.436  ? 6817 ARG C O     1 
ATOM   3581 C  CB    . ARG C  1 22  ? 105.257 -35.322 -28.683 1.000 43.521  ? 6817 ARG C CB    1 
ATOM   3582 C  CG    . ARG C  1 22  ? 105.896 -33.961 -28.894 1.000 48.661  ? 6817 ARG C CG    1 
ATOM   3583 C  CD    . ARG C  1 22  ? 107.398 -33.957 -29.099 1.000 55.364  ? 6817 ARG C CD    1 
ATOM   3584 N  NE    . ARG C  1 22  ? 107.903 -32.642 -28.718 1.000 61.292  ? 6817 ARG C NE    1 
ATOM   3585 C  CZ    . ARG C  1 22  ? 107.770 -31.524 -29.435 1.000 64.866  ? 6817 ARG C CZ    1 
ATOM   3586 N  NH1   . ARG C  1 22  ? 107.131 -31.534 -30.594 1.000 66.821  ? 6817 ARG C NH1   1 
ATOM   3587 N  NH2   . ARG C  1 22  ? 108.263 -30.388 -28.975 1.000 66.315  ? 6817 ARG C NH2   1 
ATOM   3588 N  N     . MET C  1 23  ? 101.670 -34.807 -29.665 1.000 36.840  ? 6818 MET C N     1 
ATOM   3589 C  CA    . MET C  1 23  ? 100.788 -34.726 -30.856 1.000 37.700  ? 6818 MET C CA    1 
ATOM   3590 C  C     . MET C  1 23  ? 100.852 -33.354 -31.529 1.000 37.761  ? 6818 MET C C     1 
ATOM   3591 O  O     . MET C  1 23  ? 101.242 -32.371 -30.874 1.000 37.191  ? 6818 MET C O     1 
ATOM   3592 C  CB    . MET C  1 23  ? 99.340  -35.001 -30.448 1.000 36.789  ? 6818 MET C CB    1 
ATOM   3593 C  CG    . MET C  1 23  ? 99.154  -36.350 -29.813 1.000 37.147  ? 6818 MET C CG    1 
ATOM   3594 S  SD    . MET C  1 23  ? 99.779  -37.643 -30.892 1.000 40.846  ? 6818 MET C SD    1 
ATOM   3595 C  CE    . MET C  1 23  ? 99.422  -39.114 -29.935 1.000 42.991  ? 6818 MET C CE    1 
ATOM   3596 N  N     . LEU C  1 24  ? 100.542 -33.336 -32.829 1.000 39.454  ? 6819 LEU C N     1 
ATOM   3597 C  CA    . LEU C  1 24  ? 100.415 -32.067 -33.584 1.000 40.335  ? 6819 LEU C CA    1 
ATOM   3598 C  C     . LEU C  1 24  ? 98.947  -31.659 -33.450 1.000 37.755  ? 6819 LEU C C     1 
ATOM   3599 O  O     . LEU C  1 24  ? 98.094  -32.561 -33.346 1.000 35.178  ? 6819 LEU C O     1 
ATOM   3600 C  CB    . LEU C  1 24  ? 100.822 -32.268 -35.047 1.000 43.767  ? 6819 LEU C CB    1 
ATOM   3601 C  CG    . LEU C  1 24  ? 102.268 -32.707 -35.268 1.000 47.135  ? 6819 LEU C CG    1 
ATOM   3602 C  CD1   . LEU C  1 24  ? 102.543 -32.946 -36.747 1.000 49.551  ? 6819 LEU C CD1   1 
ATOM   3603 C  CD2   . LEU C  1 24  ? 103.241 -31.684 -34.698 1.000 48.434  ? 6819 LEU C CD2   1 
ATOM   3604 N  N     . LEU C  1 25  ? 98.673  -30.360 -33.419 1.000 37.248  ? 6820 LEU C N     1 
ATOM   3605 C  CA    . LEU C  1 25  ? 97.283  -29.897 -33.234 1.000 36.853  ? 6820 LEU C CA    1 
ATOM   3606 C  C     . LEU C  1 25  ? 96.433  -30.262 -34.453 1.000 38.079  ? 6820 LEU C C     1 
ATOM   3607 O  O     . LEU C  1 25  ? 96.832  -29.924 -35.576 1.000 39.548  ? 6820 LEU C O     1 
ATOM   3608 C  CB    . LEU C  1 25  ? 97.289  -28.386 -33.012 1.000 38.206  ? 6820 LEU C CB    1 
ATOM   3609 C  CG    . LEU C  1 25  ? 95.915  -27.777 -32.767 1.000 37.939  ? 6820 LEU C CG    1 
ATOM   3610 C  CD1   . LEU C  1 25  ? 95.295  -28.367 -31.515 1.000 37.630  ? 6820 LEU C CD1   1 
ATOM   3611 C  CD2   . LEU C  1 25  ? 96.008  -26.266 -32.657 1.000 40.319  ? 6820 LEU C CD2   1 
ATOM   3612 N  N     . GLU C  1 26  ? 95.318  -30.951 -34.218 1.000 37.376  ? 6821 GLU C N     1 
ATOM   3613 C  CA    . GLU C  1 26  ? 94.364  -31.307 -35.296 1.000 38.575  ? 6821 GLU C CA    1 
ATOM   3614 C  C     . GLU C  1 26  ? 92.989  -30.728 -34.953 1.000 37.627  ? 6821 GLU C C     1 
ATOM   3615 O  O     . GLU C  1 26  ? 92.781  -30.283 -33.801 1.000 33.245  ? 6821 GLU C O     1 
ATOM   3616 C  CB    . GLU C  1 26  ? 94.271  -32.822 -35.474 1.000 41.048  ? 6821 GLU C CB    1 
ATOM   3617 C  CG    . GLU C  1 26  ? 95.575  -33.456 -35.932 1.000 44.958  ? 6821 GLU C CG    1 
ATOM   3618 C  CD    . GLU C  1 26  ? 96.105  -32.977 -37.278 1.000 49.639  ? 6821 GLU C CD    1 
ATOM   3619 O  OE1   . GLU C  1 26  ? 95.364  -32.268 -37.995 1.000 53.818  ? 6821 GLU C OE1   1 
ATOM   3620 O  OE2   . GLU C  1 26  ? 97.270  -33.304 -37.607 1.000 53.303  ? 6821 GLU C OE2   1 
ATOM   3621 N  N     . LYS C  1 27  ? 92.102  -30.716 -35.941 1.000 36.734  ? 6822 LYS C N     1 
ATOM   3622 C  CA    . LYS C  1 27  ? 90.718  -30.241 -35.740 1.000 37.291  ? 6822 LYS C CA    1 
ATOM   3623 C  C     . LYS C  1 27  ? 90.023  -31.171 -34.740 1.000 34.502  ? 6822 LYS C C     1 
ATOM   3624 O  O     . LYS C  1 27  ? 90.259  -32.392 -34.809 1.000 32.930  ? 6822 LYS C O     1 
ATOM   3625 C  CB    . LYS C  1 27  ? 90.006  -30.231 -37.098 1.000 40.895  ? 6822 LYS C CB    1 
ATOM   3626 C  CG    . LYS C  1 27  ? 88.502  -30.019 -37.059 1.000 43.615  ? 6822 LYS C CG    1 
ATOM   3627 C  CD    . LYS C  1 27  ? 87.877  -29.927 -38.447 1.000 47.538  ? 6822 LYS C CD    1 
ATOM   3628 C  CE    . LYS C  1 27  ? 86.365  -29.844 -38.412 1.000 50.611  ? 6822 LYS C CE    1 
ATOM   3629 N  NZ    . LYS C  1 27  ? 85.889  -28.697 -37.599 1.000 52.469  ? 6822 LYS C NZ    1 
ATOM   3630 N  N     . CYS C  1 28  ? 89.230  -30.613 -33.825 1.000 32.617  ? 6823 CYS C N     1 
ATOM   3631 C  CA    . CYS C  1 28  ? 88.466  -31.471 -32.885 1.000 32.876  ? 6823 CYS C CA    1 
ATOM   3632 C  C     . CYS C  1 28  ? 87.222  -31.974 -33.629 1.000 34.991  ? 6823 CYS C C     1 
ATOM   3633 O  O     . CYS C  1 28  ? 86.475  -31.134 -34.175 1.000 37.981  ? 6823 CYS C O     1 
ATOM   3634 C  CB    . CYS C  1 28  ? 88.078  -30.716 -31.620 1.000 32.292  ? 6823 CYS C CB    1 
ATOM   3635 S  SG    . CYS C  1 28  ? 87.417  -31.793 -30.324 1.000 32.897  ? 6823 CYS C SG    1 
ATOM   3636 N  N     . ASP C  1 29  ? 87.041  -33.290 -33.693 1.000 34.696  ? 6824 ASP C N     1 
ATOM   3637 C  CA    . ASP C  1 29  ? 85.899  -33.920 -34.409 1.000 36.664  ? 6824 ASP C CA    1 
ATOM   3638 C  C     . ASP C  1 29  ? 85.309  -34.962 -33.458 1.000 35.165  ? 6824 ASP C C     1 
ATOM   3639 O  O     . ASP C  1 29  ? 85.794  -36.111 -33.452 1.000 34.104  ? 6824 ASP C O     1 
ATOM   3640 C  CB    . ASP C  1 29  ? 86.362  -34.518 -35.741 1.000 40.325  ? 6824 ASP C CB    1 
ATOM   3641 C  CG    . ASP C  1 29  ? 85.263  -35.178 -36.557 1.000 44.054  ? 6824 ASP C CG    1 
ATOM   3642 O  OD1   . ASP C  1 29  ? 84.074  -34.957 -36.250 1.000 46.799  ? 6824 ASP C OD1   1 
ATOM   3643 O  OD2   . ASP C  1 29  ? 85.607  -35.920 -37.479 1.000 50.085  ? 6824 ASP C OD2   1 
ATOM   3644 N  N     . LEU C  1 30  ? 84.304  -34.561 -32.683 1.000 32.753  ? 6825 LEU C N     1 
ATOM   3645 C  CA    . LEU C  1 30  ? 83.726  -35.454 -31.647 1.000 32.241  ? 6825 LEU C CA    1 
ATOM   3646 C  C     . LEU C  1 30  ? 82.634  -36.339 -32.238 1.000 33.921  ? 6825 LEU C C     1 
ATOM   3647 O  O     . LEU C  1 30  ? 81.661  -35.804 -32.797 1.000 33.464  ? 6825 LEU C O     1 
ATOM   3648 C  CB    . LEU C  1 30  ? 83.184  -34.599 -30.498 1.000 30.897  ? 6825 LEU C CB    1 
ATOM   3649 C  CG    . LEU C  1 30  ? 84.234  -33.759 -29.782 1.000 30.242  ? 6825 LEU C CG    1 
ATOM   3650 C  CD1   . LEU C  1 30  ? 83.609  -32.916 -28.685 1.000 29.311  ? 6825 LEU C CD1   1 
ATOM   3651 C  CD2   . LEU C  1 30  ? 85.334  -34.642 -29.220 1.000 31.071  ? 6825 LEU C CD2   1 
ATOM   3652 N  N     . GLN C  1 31  ? 82.789  -37.648 -32.050 1.000 35.731  ? 6826 GLN C N     1 
ATOM   3653 C  CA    . GLN C  1 31  ? 81.791  -38.651 -32.490 1.000 39.315  ? 6826 GLN C CA    1 
ATOM   3654 C  C     . GLN C  1 31  ? 80.416  -38.317 -31.904 1.000 38.195  ? 6826 GLN C C     1 
ATOM   3655 O  O     . GLN C  1 31  ? 79.432  -38.432 -32.629 1.000 38.131  ? 6826 GLN C O     1 
ATOM   3656 C  CB    . GLN C  1 31  ? 82.216  -40.036 -31.996 1.000 42.725  ? 6826 GLN C CB    1 
ATOM   3657 C  CG    . GLN C  1 31  ? 81.132  -41.093 -32.143 1.000 46.665  ? 6826 GLN C CG    1 
ATOM   3658 C  CD    . GLN C  1 31  ? 81.538  -42.420 -31.552 1.000 49.437  ? 6826 GLN C CD    1 
ATOM   3659 O  OE1   . GLN C  1 31  ? 82.523  -43.033 -31.966 1.000 51.822  ? 6826 GLN C OE1   1 
ATOM   3660 N  NE2   . GLN C  1 31  ? 80.743  -42.894 -30.605 1.000 50.083  ? 6826 GLN C NE2   1 
ATOM   3661 N  N     . ASN C  1 32  ? 80.375  -37.890 -30.638 1.000 37.068  ? 6827 ASN C N     1 
ATOM   3662 C  CA    . ASN C  1 32  ? 79.090  -37.631 -29.928 1.000 38.298  ? 6827 ASN C CA    1 
ATOM   3663 C  C     . ASN C  1 32  ? 78.720  -36.144 -29.977 1.000 37.429  ? 6827 ASN C C     1 
ATOM   3664 O  O     . ASN C  1 32  ? 77.967  -35.717 -29.094 1.000 37.331  ? 6827 ASN C O     1 
ATOM   3665 C  CB    . ASN C  1 32  ? 79.171  -38.136 -28.481 1.000 37.754  ? 6827 ASN C CB    1 
ATOM   3666 C  CG    . ASN C  1 32  ? 79.433  -39.629 -28.401 1.000 38.583  ? 6827 ASN C CG    1 
ATOM   3667 O  OD1   . ASN C  1 32  ? 79.222  -40.355 -29.372 1.000 37.973  ? 6827 ASN C OD1   1 
ATOM   3668 N  ND2   . ASN C  1 32  ? 79.890  -40.099 -27.250 1.000 37.065  ? 6827 ASN C ND2   1 
ATOM   3669 N  N     . TYR C  1 33  ? 79.163  -35.420 -31.011 1.000 41.572  ? 6828 TYR C N     1 
ATOM   3670 C  CA    . TYR C  1 33  ? 78.905  -33.961 -31.146 1.000 45.802  ? 6828 TYR C CA    1 
ATOM   3671 C  C     . TYR C  1 33  ? 77.403  -33.639 -31.116 1.000 46.202  ? 6828 TYR C C     1 
ATOM   3672 O  O     . TYR C  1 33  ? 77.047  -32.561 -30.602 1.000 47.102  ? 6828 TYR C O     1 
ATOM   3673 C  CB    . TYR C  1 33  ? 79.548  -33.421 -32.427 1.000 50.634  ? 6828 TYR C CB    1 
ATOM   3674 C  CG    . TYR C  1 33  ? 79.275  -31.963 -32.696 1.000 57.762  ? 6828 TYR C CG    1 
ATOM   3675 C  CD1   . TYR C  1 33  ? 79.971  -30.968 -32.024 1.000 60.973  ? 6828 TYR C CD1   1 
ATOM   3676 C  CD2   . TYR C  1 33  ? 78.330  -31.573 -33.634 1.000 62.381  ? 6828 TYR C CD2   1 
ATOM   3677 C  CE1   . TYR C  1 33  ? 79.725  -29.625 -32.264 1.000 63.367  ? 6828 TYR C CE1   1 
ATOM   3678 C  CE2   . TYR C  1 33  ? 78.078  -30.234 -33.892 1.000 65.693  ? 6828 TYR C CE2   1 
ATOM   3679 C  CZ    . TYR C  1 33  ? 78.777  -29.257 -33.204 1.000 66.543  ? 6828 TYR C CZ    1 
ATOM   3680 O  OH    . TYR C  1 33  ? 78.534  -27.936 -33.453 1.000 71.370  ? 6828 TYR C OH    1 
ATOM   3681 N  N     . GLY C  1 34  ? 76.550  -34.532 -31.621 1.000 47.516  ? 6829 GLY C N     1 
ATOM   3682 C  CA    . GLY C  1 34  ? 75.098  -34.239 -31.658 1.000 49.970  ? 6829 GLY C CA    1 
ATOM   3683 C  C     . GLY C  1 34  ? 74.322  -34.778 -30.459 1.000 48.103  ? 6829 GLY C C     1 
ATOM   3684 O  O     . GLY C  1 34  ? 73.101  -34.529 -30.400 1.000 47.188  ? 6829 GLY C O     1 
ATOM   3685 N  N     . ASP C  1 35  ? 74.993  -35.439 -29.510 1.000 45.146  ? 6830 ASP C N     1 
ATOM   3686 C  CA    . ASP C  1 35  ? 74.284  -36.058 -28.356 1.000 43.300  ? 6830 ASP C CA    1 
ATOM   3687 C  C     . ASP C  1 35  ? 73.992  -35.038 -27.244 1.000 42.381  ? 6830 ASP C C     1 
ATOM   3688 O  O     . ASP C  1 35  ? 74.656  -33.974 -27.190 1.000 41.166  ? 6830 ASP C O     1 
ATOM   3689 C  CB    . ASP C  1 35  ? 75.090  -37.228 -27.785 1.000 43.512  ? 6830 ASP C CB    1 
ATOM   3690 C  CG    . ASP C  1 35  ? 75.222  -38.418 -28.722 1.000 44.807  ? 6830 ASP C CG    1 
ATOM   3691 O  OD1   . ASP C  1 35  ? 74.587  -38.395 -29.794 1.000 45.695  ? 6830 ASP C OD1   1 
ATOM   3692 O  OD2   . ASP C  1 35  ? 75.959  -39.357 -28.367 1.000 44.115  ? 6830 ASP C OD2   1 
ATOM   3693 N  N     A SER C  1 36  ? 73.021  -35.370 -26.384 0.700 41.734  ? 6831 SER C N     1 
ATOM   3694 N  N     B SER C  1 36  ? 73.022  -35.370 -26.383 0.300 41.275  ? 6831 SER C N     1 
ATOM   3695 C  CA    A SER C  1 36  ? 72.645  -34.518 -25.223 0.700 41.052  ? 6831 SER C CA    1 
ATOM   3696 C  CA    B SER C  1 36  ? 72.620  -34.515 -25.234 0.300 40.081  ? 6831 SER C CA    1 
ATOM   3697 C  C     A SER C  1 36  ? 72.328  -35.422 -24.030 0.700 39.973  ? 6831 SER C C     1 
ATOM   3698 C  C     B SER C  1 36  ? 72.291  -35.406 -24.031 0.300 39.466  ? 6831 SER C C     1 
ATOM   3699 O  O     A SER C  1 36  ? 71.818  -36.542 -24.245 0.700 39.973  ? 6831 SER C O     1 
ATOM   3700 O  O     B SER C  1 36  ? 71.733  -36.502 -24.242 0.300 39.963  ? 6831 SER C O     1 
ATOM   3701 C  CB    A SER C  1 36  ? 71.475  -33.627 -25.531 0.700 41.387  ? 6831 SER C CB    1 
ATOM   3702 C  CB    B SER C  1 36  ? 71.457  -33.625 -25.592 0.300 40.140  ? 6831 SER C CB    1 
ATOM   3703 O  OG    A SER C  1 36  ? 70.291  -34.395 -25.651 0.700 43.806  ? 6831 SER C OG    1 
ATOM   3704 O  OG    B SER C  1 36  ? 71.794  -32.755 -26.662 0.300 40.178  ? 6831 SER C OG    1 
ATOM   3705 N  N     . ALA C  1 37  ? 72.634  -34.949 -22.822 1.000 37.919  ? 6832 ALA C N     1 
ATOM   3706 C  CA    . ALA C  1 37  ? 72.357  -35.725 -21.594 1.000 37.582  ? 6832 ALA C CA    1 
ATOM   3707 C  C     . ALA C  1 37  ? 70.877  -35.565 -21.228 1.000 37.604  ? 6832 ALA C C     1 
ATOM   3708 O  O     . ALA C  1 37  ? 70.220  -34.659 -21.777 1.000 34.487  ? 6832 ALA C O     1 
ATOM   3709 C  CB    . ALA C  1 37  ? 73.251  -35.245 -20.476 1.000 35.918  ? 6832 ALA C CB    1 
ATOM   3710 N  N     . THR C  1 38  ? 70.383  -36.443 -20.352 1.000 38.417  ? 6833 THR C N     1 
ATOM   3711 C  CA    . THR C  1 38  ? 68.991  -36.356 -19.844 1.000 39.130  ? 6833 THR C CA    1 
ATOM   3712 C  C     . THR C  1 38  ? 69.025  -35.500 -18.573 1.000 36.159  ? 6833 THR C C     1 
ATOM   3713 O  O     . THR C  1 38  ? 69.204  -36.063 -17.480 1.000 36.452  ? 6833 THR C O     1 
ATOM   3714 C  CB    . THR C  1 38  ? 68.411  -37.760 -19.637 1.000 41.117  ? 6833 THR C CB    1 
ATOM   3715 O  OG1   . THR C  1 38  ? 68.481  -38.411 -20.904 1.000 41.418  ? 6833 THR C OG1   1 
ATOM   3716 C  CG2   . THR C  1 38  ? 66.985  -37.755 -19.130 1.000 43.418  ? 6833 THR C CG2   1 
ATOM   3717 N  N     . LEU C  1 39  ? 68.871  -34.183 -18.716 1.000 34.831  ? 6834 LEU C N     1 
ATOM   3718 C  CA    . LEU C  1 39  ? 68.932  -33.287 -17.528 1.000 33.117  ? 6834 LEU C CA    1 
ATOM   3719 C  C     . LEU C  1 39  ? 67.700  -33.478 -16.651 1.000 32.193  ? 6834 LEU C C     1 
ATOM   3720 O  O     . LEU C  1 39  ? 66.596  -33.640 -17.160 1.000 31.603  ? 6834 LEU C O     1 
ATOM   3721 C  CB    . LEU C  1 39  ? 69.010  -31.828 -17.981 1.000 33.774  ? 6834 LEU C CB    1 
ATOM   3722 C  CG    . LEU C  1 39  ? 70.290  -31.422 -18.700 1.000 34.664  ? 6834 LEU C CG    1 
ATOM   3723 C  CD1   . LEU C  1 39  ? 70.317  -29.923 -18.913 1.000 35.944  ? 6834 LEU C CD1   1 
ATOM   3724 C  CD2   . LEU C  1 39  ? 71.508  -31.859 -17.914 1.000 34.757  ? 6834 LEU C CD2   1 
ATOM   3725 N  N     . PRO C  1 40  ? 67.845  -33.460 -15.307 1.000 31.279  ? 6835 PRO C N     1 
ATOM   3726 C  CA    . PRO C  1 40  ? 66.684  -33.534 -14.424 1.000 31.233  ? 6835 PRO C CA    1 
ATOM   3727 C  C     . PRO C  1 40  ? 65.750  -32.373 -14.796 1.000 31.201  ? 6835 PRO C C     1 
ATOM   3728 O  O     . PRO C  1 40  ? 66.232  -31.306 -15.187 1.000 29.848  ? 6835 PRO C O     1 
ATOM   3729 C  CB    . PRO C  1 40  ? 67.278  -33.418 -13.019 1.000 30.810  ? 6835 PRO C CB    1 
ATOM   3730 C  CG    . PRO C  1 40  ? 68.700  -33.912 -13.193 1.000 30.820  ? 6835 PRO C CG    1 
ATOM   3731 C  CD    . PRO C  1 40  ? 69.112  -33.419 -14.563 1.000 30.358  ? 6835 PRO C CD    1 
ATOM   3732 N  N     . LYS C  1 41  ? 64.449  -32.611 -14.683 1.000 31.935  ? 6836 LYS C N     1 
ATOM   3733 C  CA    . LYS C  1 41  ? 63.410  -31.624 -15.062 1.000 33.655  ? 6836 LYS C CA    1 
ATOM   3734 C  C     . LYS C  1 41  ? 63.658  -30.250 -14.417 1.000 31.111  ? 6836 LYS C C     1 
ATOM   3735 O  O     . LYS C  1 41  ? 63.837  -30.188 -13.183 1.000 29.198  ? 6836 LYS C O     1 
ATOM   3736 C  CB    . LYS C  1 41  ? 62.051  -32.206 -14.668 1.000 37.878  ? 6836 LYS C CB    1 
ATOM   3737 C  CG    . LYS C  1 41  ? 60.852  -31.312 -14.907 1.000 41.914  ? 6836 LYS C CG    1 
ATOM   3738 C  CD    . LYS C  1 41  ? 59.553  -32.028 -14.602 1.000 47.274  ? 6836 LYS C CD    1 
ATOM   3739 C  CE    . LYS C  1 41  ? 58.341  -31.131 -14.729 1.000 50.983  ? 6836 LYS C CE    1 
ATOM   3740 N  NZ    . LYS C  1 41  ? 58.385  -30.029 -13.740 1.000 53.129  ? 6836 LYS C NZ    1 
ATOM   3741 N  N     . GLY C  1 42  ? 63.660  -29.196 -15.245 1.000 29.999  ? 6837 GLY C N     1 
ATOM   3742 C  CA    . GLY C  1 42  ? 63.809  -27.794 -14.803 1.000 29.354  ? 6837 GLY C CA    1 
ATOM   3743 C  C     . GLY C  1 42  ? 65.229  -27.408 -14.418 1.000 27.447  ? 6837 GLY C C     1 
ATOM   3744 O  O     . GLY C  1 42  ? 65.418  -26.263 -13.969 1.000 27.400  ? 6837 GLY C O     1 
ATOM   3745 N  N     . ILE C  1 43  ? 66.208  -28.293 -14.608 1.000 26.090  ? 6838 ILE C N     1 
ATOM   3746 C  CA    . ILE C  1 43  ? 67.607  -27.953 -14.214 1.000 24.974  ? 6838 ILE C CA    1 
ATOM   3747 C  C     . ILE C  1 43  ? 68.350  -27.373 -15.420 1.000 25.294  ? 6838 ILE C C     1 
ATOM   3748 O  O     . ILE C  1 43  ? 68.330  -28.003 -16.492 1.000 25.587  ? 6838 ILE C O     1 
ATOM   3749 C  CB    . ILE C  1 43  ? 68.335  -29.175 -13.620 1.000 24.247  ? 6838 ILE C CB    1 
ATOM   3750 C  CG1   . ILE C  1 43  ? 67.702  -29.623 -12.297 1.000 24.651  ? 6838 ILE C CG1   1 
ATOM   3751 C  CG2   . ILE C  1 43  ? 69.814  -28.893 -13.456 1.000 23.650  ? 6838 ILE C CG2   1 
ATOM   3752 C  CD1   . ILE C  1 43  ? 67.795  -28.612 -11.179 1.000 24.239  ? 6838 ILE C CD1   1 
ATOM   3753 N  N     . MET C  1 44  ? 68.998  -26.225 -15.217 1.000 25.173  ? 6839 MET C N     1 
ATOM   3754 C  CA    . MET C  1 44  ? 69.791  -25.550 -16.280 1.000 25.594  ? 6839 MET C CA    1 
ATOM   3755 C  C     . MET C  1 44  ? 71.065  -26.345 -16.572 1.000 24.516  ? 6839 MET C C     1 
ATOM   3756 O  O     . MET C  1 44  ? 71.665  -26.884 -15.617 1.000 22.734  ? 6839 MET C O     1 
ATOM   3757 C  CB    . MET C  1 44  ? 70.231  -24.155 -15.822 1.000 26.181  ? 6839 MET C CB    1 
ATOM   3758 C  CG    . MET C  1 44  ? 69.110  -23.173 -15.620 1.000 28.177  ? 6839 MET C CG    1 
ATOM   3759 S  SD    . MET C  1 44  ? 69.750  -21.636 -14.888 1.000 30.066  ? 6839 MET C SD    1 
ATOM   3760 C  CE    . MET C  1 44  ? 68.281  -20.611 -14.923 1.000 31.206  ? 6839 MET C CE    1 
ATOM   3761 N  N     . MET C  1 45  ? 71.499  -26.332 -17.831 1.000 24.158  ? 6840 MET C N     1 
ATOM   3762 C  CA    . MET C  1 45  ? 72.763  -26.989 -18.249 1.000 24.684  ? 6840 MET C CA    1 
ATOM   3763 C  C     . MET C  1 45  ? 73.924  -26.520 -17.362 1.000 23.250  ? 6840 MET C C     1 
ATOM   3764 O  O     . MET C  1 45  ? 74.713  -27.378 -16.961 1.000 22.560  ? 6840 MET C O     1 
ATOM   3765 C  CB    . MET C  1 45  ? 73.102  -26.647 -19.707 1.000 27.373  ? 6840 MET C CB    1 
ATOM   3766 C  CG    . MET C  1 45  ? 74.533  -27.012 -20.101 1.000 28.432  ? 6840 MET C CG    1 
ATOM   3767 S  SD    . MET C  1 45  ? 74.923  -28.782 -19.959 1.000 33.219  ? 6840 MET C SD    1 
ATOM   3768 C  CE    . MET C  1 45  ? 74.052  -29.425 -21.382 1.000 34.442  ? 6840 MET C CE    1 
ATOM   3769 N  N     . ASN C  1 46  ? 74.011  -25.223 -17.030 1.000 22.353  ? 6841 ASN C N     1 
ATOM   3770 C  CA    . ASN C  1 46  ? 75.197  -24.751 -16.259 1.000 22.558  ? 6841 ASN C CA    1 
ATOM   3771 C  C     . ASN C  1 46  ? 75.095  -25.179 -14.789 1.000 21.319  ? 6841 ASN C C     1 
ATOM   3772 O  O     . ASN C  1 46  ? 76.156  -25.312 -14.155 1.000 21.550  ? 6841 ASN C O     1 
ATOM   3773 C  CB    . ASN C  1 46  ? 75.487  -23.270 -16.513 1.000 24.171  ? 6841 ASN C CB    1 
ATOM   3774 C  CG    . ASN C  1 46  ? 76.075  -23.056 -17.898 1.000 27.037  ? 6841 ASN C CG    1 
ATOM   3775 O  OD1   . ASN C  1 46  ? 76.580  -23.995 -18.514 1.000 32.595  ? 6841 ASN C OD1   1 
ATOM   3776 N  ND2   . ASN C  1 46  ? 76.002  -21.845 -18.412 1.000 27.798  ? 6841 ASN C ND2   1 
ATOM   3777 N  N     . VAL C  1 47  ? 73.889  -25.381 -14.260 1.000 20.381  ? 6842 VAL C N     1 
ATOM   3778 C  CA    . VAL C  1 47  ? 73.787  -25.929 -12.876 1.000 20.035  ? 6842 VAL C CA    1 
ATOM   3779 C  C     . VAL C  1 47  ? 74.307  -27.373 -12.923 1.000 19.539  ? 6842 VAL C C     1 
ATOM   3780 O  O     . VAL C  1 47  ? 75.097  -27.753 -12.051 1.000 19.368  ? 6842 VAL C O     1 
ATOM   3781 C  CB    . VAL C  1 47  ? 72.355  -25.837 -12.324 1.000 20.534  ? 6842 VAL C CB    1 
ATOM   3782 C  CG1   . VAL C  1 47  ? 72.158  -26.714 -11.103 1.000 20.941  ? 6842 VAL C CG1   1 
ATOM   3783 C  CG2   . VAL C  1 47  ? 71.976  -24.396 -12.016 1.000 21.059  ? 6842 VAL C CG2   1 
ATOM   3784 N  N     . ALA C  1 48  ? 73.893  -28.138 -13.932 1.000 19.949  ? 6843 ALA C N     1 
ATOM   3785 C  CA    . ALA C  1 48  ? 74.349  -29.543 -14.082 1.000 20.238  ? 6843 ALA C CA    1 
ATOM   3786 C  C     . ALA C  1 48  ? 75.871  -29.593 -14.268 1.000 19.715  ? 6843 ALA C C     1 
ATOM   3787 O  O     . ALA C  1 48  ? 76.525  -30.450 -13.638 1.000 19.741  ? 6843 ALA C O     1 
ATOM   3788 C  CB    . ALA C  1 48  ? 73.633  -30.172 -15.256 1.000 20.877  ? 6843 ALA C CB    1 
ATOM   3789 N  N     . LYS C  1 49  ? 76.403  -28.703 -15.112 1.000 19.755  ? 6844 LYS C N     1 
ATOM   3790 C  CA    . LYS C  1 49  ? 77.850  -28.664 -15.446 1.000 19.920  ? 6844 LYS C CA    1 
ATOM   3791 C  C     . LYS C  1 49  ? 78.676  -28.339 -14.197 1.000 19.343  ? 6844 LYS C C     1 
ATOM   3792 O  O     . LYS C  1 49  ? 79.632  -29.082 -13.907 1.000 19.613  ? 6844 LYS C O     1 
ATOM   3793 C  CB    . LYS C  1 49  ? 78.093  -27.629 -16.548 1.000 20.311  ? 6844 LYS C CB    1 
ATOM   3794 C  CG    . LYS C  1 49  ? 79.534  -27.477 -16.994 1.000 21.009  ? 6844 LYS C CG    1 
ATOM   3795 C  CD    . LYS C  1 49  ? 79.750  -26.324 -17.948 1.000 22.005  ? 6844 LYS C CD    1 
ATOM   3796 C  CE    . LYS C  1 49  ? 78.935  -26.418 -19.219 1.000 22.914  ? 6844 LYS C CE    1 
ATOM   3797 N  NZ    . LYS C  1 49  ? 79.327  -25.352 -20.171 1.000 23.792  ? 6844 LYS C NZ    1 
ATOM   3798 N  N     . TYR C  1 50  ? 78.320  -27.275 -13.482 1.000 19.253  ? 6845 TYR C N     1 
ATOM   3799 C  CA    . TYR C  1 50  ? 79.090  -26.917 -12.262 1.000 19.016  ? 6845 TYR C CA    1 
ATOM   3800 C  C     . TYR C  1 50  ? 78.906  -27.989 -11.182 1.000 18.743  ? 6845 TYR C C     1 
ATOM   3801 O  O     . TYR C  1 50  ? 79.857  -28.230 -10.430 1.000 19.118  ? 6845 TYR C O     1 
ATOM   3802 C  CB    . TYR C  1 50  ? 78.683  -25.539 -11.748 1.000 19.430  ? 6845 TYR C CB    1 
ATOM   3803 C  CG    . TYR C  1 50  ? 79.355  -24.365 -12.410 1.000 19.584  ? 6845 TYR C CG    1 
ATOM   3804 C  CD1   . TYR C  1 50  ? 79.028  -23.964 -13.693 1.000 20.314  ? 6845 TYR C CD1   1 
ATOM   3805 C  CD2   . TYR C  1 50  ? 80.263  -23.593 -11.703 1.000 19.895  ? 6845 TYR C CD2   1 
ATOM   3806 C  CE1   . TYR C  1 50  ? 79.616  -22.847 -14.270 1.000 20.735  ? 6845 TYR C CE1   1 
ATOM   3807 C  CE2   . TYR C  1 50  ? 80.847  -22.465 -12.257 1.000 20.321  ? 6845 TYR C CE2   1 
ATOM   3808 C  CZ    . TYR C  1 50  ? 80.528  -22.093 -13.549 1.000 20.999  ? 6845 TYR C CZ    1 
ATOM   3809 O  OH    . TYR C  1 50  ? 81.084  -20.965 -14.093 1.000 21.666  ? 6845 TYR C OH    1 
ATOM   3810 N  N     . THR C  1 51  ? 77.727  -28.609 -11.101 1.000 19.001  ? 6846 THR C N     1 
ATOM   3811 C  CA    . THR C  1 51  ? 77.536  -29.675 -10.078 1.000 18.971  ? 6846 THR C CA    1 
ATOM   3812 C  C     . THR C  1 51  ? 78.533  -30.801 -10.377 1.000 19.354  ? 6846 THR C C     1 
ATOM   3813 O  O     . THR C  1 51  ? 79.254  -31.220 -9.453  1.000 19.094  ? 6846 THR C O     1 
ATOM   3814 C  CB    . THR C  1 51  ? 76.073  -30.134 -10.017 1.000 19.425  ? 6846 THR C CB    1 
ATOM   3815 O  OG1   . THR C  1 51  ? 75.282  -29.005 -9.649  1.000 19.300  ? 6846 THR C OG1   1 
ATOM   3816 C  CG2   . THR C  1 51  ? 75.830  -31.256 -9.031  1.000 20.067  ? 6846 THR C CG2   1 
ATOM   3817 N  N     . GLN C  1 52  ? 78.632  -31.218 -11.639 1.000 19.809  ? 6847 GLN C N     1 
ATOM   3818 C  CA    . GLN C  1 52  ? 79.588  -32.299 -11.992 1.000 20.057  ? 6847 GLN C CA    1 
ATOM   3819 C  C     . GLN C  1 52  ? 81.031  -31.853 -11.742 1.000 20.101  ? 6847 GLN C C     1 
ATOM   3820 O  O     . GLN C  1 52  ? 81.808  -32.686 -11.238 1.000 20.162  ? 6847 GLN C O     1 
ATOM   3821 C  CB    . GLN C  1 52  ? 79.343  -32.786 -13.416 1.000 20.142  ? 6847 GLN C CB    1 
ATOM   3822 C  CG    . GLN C  1 52  ? 78.104  -33.665 -13.487 1.000 20.387  ? 6847 GLN C CG    1 
ATOM   3823 C  CD    . GLN C  1 52  ? 77.871  -34.259 -14.849 1.000 20.694  ? 6847 GLN C CD    1 
ATOM   3824 O  OE1   . GLN C  1 52  ? 78.293  -33.720 -15.874 1.000 19.853  ? 6847 GLN C OE1   1 
ATOM   3825 N  NE2   . GLN C  1 52  ? 77.164  -35.377 -14.861 1.000 21.728  ? 6847 GLN C NE2   1 
ATOM   3826 N  N     . LEU C  1 53  ? 81.387  -30.612 -12.081 1.000 19.892  ? 6848 LEU C N     1 
ATOM   3827 C  CA    . LEU C  1 53  ? 82.768  -30.145 -11.799 1.000 19.882  ? 6848 LEU C CA    1 
ATOM   3828 C  C     . LEU C  1 53  ? 83.034  -30.262 -10.293 1.000 19.619  ? 6848 LEU C C     1 
ATOM   3829 O  O     . LEU C  1 53  ? 84.083  -30.805 -9.910  1.000 20.347  ? 6848 LEU C O     1 
ATOM   3830 C  CB    . LEU C  1 53  ? 82.917  -28.697 -12.276 1.000 20.044  ? 6848 LEU C CB    1 
ATOM   3831 C  CG    . LEU C  1 53  ? 84.230  -28.008 -11.910 1.000 20.776  ? 6848 LEU C CG    1 
ATOM   3832 C  CD1   . LEU C  1 53  ? 85.422  -28.744 -12.511 1.000 21.186  ? 6848 LEU C CD1   1 
ATOM   3833 C  CD2   . LEU C  1 53  ? 84.211  -26.552 -12.358 1.000 20.891  ? 6848 LEU C CD2   1 
ATOM   3834 N  N     . CYS C  1 54  ? 82.109  -29.772 -9.471  1.000 20.001  ? 6849 CYS C N     1 
ATOM   3835 C  CA    . CYS C  1 54  ? 82.292  -29.817 -7.997  1.000 20.395  ? 6849 CYS C CA    1 
ATOM   3836 C  C     . CYS C  1 54  ? 82.345  -31.270 -7.511  1.000 21.102  ? 6849 CYS C C     1 
ATOM   3837 O  O     . CYS C  1 54  ? 83.167  -31.562 -6.618  1.000 21.321  ? 6849 CYS C O     1 
ATOM   3838 C  CB    . CYS C  1 54  ? 81.208  -29.003 -7.300  1.000 20.470  ? 6849 CYS C CB    1 
ATOM   3839 S  SG    . CYS C  1 54  ? 81.352  -27.224 -7.616  1.000 21.236  ? 6849 CYS C SG    1 
ATOM   3840 N  N     . GLN C  1 55  ? 81.511  -32.150 -8.067  1.000 21.193  ? 6850 GLN C N     1 
ATOM   3841 C  CA    . GLN C  1 55  ? 81.543  -33.576 -7.658  1.000 21.829  ? 6850 GLN C CA    1 
ATOM   3842 C  C     . GLN C  1 55  ? 82.939  -34.135 -7.943  1.000 22.591  ? 6850 GLN C C     1 
ATOM   3843 O  O     . GLN C  1 55  ? 83.439  -34.922 -7.138  1.000 21.707  ? 6850 GLN C O     1 
ATOM   3844 C  CB    . GLN C  1 55  ? 80.471  -34.372 -8.400  1.000 22.176  ? 6850 GLN C CB    1 
ATOM   3845 C  CG    . GLN C  1 55  ? 79.061  -34.074 -7.918  1.000 22.246  ? 6850 GLN C CG    1 
ATOM   3846 C  CD    . GLN C  1 55  ? 78.018  -34.815 -8.718  1.000 23.514  ? 6850 GLN C CD    1 
ATOM   3847 O  OE1   . GLN C  1 55  ? 78.131  -34.967 -9.934  1.000 23.432  ? 6850 GLN C OE1   1 
ATOM   3848 N  NE2   . GLN C  1 55  ? 76.972  -35.259 -8.038  1.000 23.874  ? 6850 GLN C NE2   1 
ATOM   3849 N  N     . TYR C  1 56  ? 83.541  -33.729 -9.063  1.000 22.119  ? 6851 TYR C N     1 
ATOM   3850 C  CA    . TYR C  1 56  ? 84.899  -34.229 -9.385  1.000 22.285  ? 6851 TYR C CA    1 
ATOM   3851 C  C     . TYR C  1 56  ? 85.926  -33.580 -8.446  1.000 21.894  ? 6851 TYR C C     1 
ATOM   3852 O  O     . TYR C  1 56  ? 86.808  -34.301 -7.941  1.000 22.153  ? 6851 TYR C O     1 
ATOM   3853 C  CB    . TYR C  1 56  ? 85.236  -33.990 -10.855 1.000 22.372  ? 6851 TYR C CB    1 
ATOM   3854 C  CG    . TYR C  1 56  ? 86.619  -34.464 -11.197 1.000 22.848  ? 6851 TYR C CG    1 
ATOM   3855 C  CD1   . TYR C  1 56  ? 86.911  -35.820 -11.251 1.000 23.654  ? 6851 TYR C CD1   1 
ATOM   3856 C  CD2   . TYR C  1 56  ? 87.643  -33.562 -11.420 1.000 22.776  ? 6851 TYR C CD2   1 
ATOM   3857 C  CE1   . TYR C  1 56  ? 88.192  -36.266 -11.527 1.000 24.400  ? 6851 TYR C CE1   1 
ATOM   3858 C  CE2   . TYR C  1 56  ? 88.922  -33.995 -11.714 1.000 23.259  ? 6851 TYR C CE2   1 
ATOM   3859 C  CZ    . TYR C  1 56  ? 89.199  -35.345 -11.753 1.000 23.779  ? 6851 TYR C CZ    1 
ATOM   3860 O  OH    . TYR C  1 56  ? 90.469  -35.752 -12.023 1.000 25.453  ? 6851 TYR C OH    1 
ATOM   3861 N  N     . LEU C  1 57  ? 85.808  -32.274 -8.197  1.000 20.858  ? 6852 LEU C N     1 
ATOM   3862 C  CA    . LEU C  1 57  ? 86.765  -31.576 -7.289  1.000 20.827  ? 6852 LEU C CA    1 
ATOM   3863 C  C     . LEU C  1 57  ? 86.733  -32.218 -5.891  1.000 21.497  ? 6852 LEU C C     1 
ATOM   3864 O  O     . LEU C  1 57  ? 87.799  -32.231 -5.222  1.000 21.651  ? 6852 LEU C O     1 
ATOM   3865 C  CB    . LEU C  1 57  ? 86.448  -30.082 -7.253  1.000 20.707  ? 6852 LEU C CB    1 
ATOM   3866 C  CG    . LEU C  1 57  ? 86.690  -29.330 -8.568  1.000 20.792  ? 6852 LEU C CG    1 
ATOM   3867 C  CD1   . LEU C  1 57  ? 86.291  -27.870 -8.446  1.000 20.419  ? 6852 LEU C CD1   1 
ATOM   3868 C  CD2   . LEU C  1 57  ? 88.146  -29.439 -9.005  1.000 21.667  ? 6852 LEU C CD2   1 
ATOM   3869 N  N     . ASN C  1 58  ? 85.589  -32.775 -5.486  1.000 21.221  ? 6853 ASN C N     1 
ATOM   3870 C  CA    . ASN C  1 58  ? 85.487  -33.466 -4.174  1.000 22.845  ? 6853 ASN C CA    1 
ATOM   3871 C  C     . ASN C  1 58  ? 86.447  -34.662 -4.109  1.000 24.206  ? 6853 ASN C C     1 
ATOM   3872 O  O     . ASN C  1 58  ? 86.841  -35.019 -2.984  1.000 24.611  ? 6853 ASN C O     1 
ATOM   3873 C  CB    . ASN C  1 58  ? 84.077  -34.006 -3.896  1.000 23.263  ? 6853 ASN C CB    1 
ATOM   3874 C  CG    . ASN C  1 58  ? 83.094  -32.942 -3.464  1.000 23.004  ? 6853 ASN C CG    1 
ATOM   3875 O  OD1   . ASN C  1 58  ? 83.492  -31.877 -2.994  1.000 23.123  ? 6853 ASN C OD1   1 
ATOM   3876 N  ND2   . ASN C  1 58  ? 81.811  -33.244 -3.576  1.000 22.551  ? 6853 ASN C ND2   1 
ATOM   3877 N  N     . THR C  1 59  ? 86.787  -35.274 -5.250  1.000 23.722  ? 6854 THR C N     1 
ATOM   3878 C  CA    . THR C  1 59  ? 87.656  -36.480 -5.235  1.000 25.613  ? 6854 THR C CA    1 
ATOM   3879 C  C     . THR C  1 59  ? 89.147  -36.114 -5.184  1.000 26.331  ? 6854 THR C C     1 
ATOM   3880 O  O     . THR C  1 59  ? 89.960  -37.048 -5.055  1.000 27.102  ? 6854 THR C O     1 
ATOM   3881 C  CB    . THR C  1 59  ? 87.400  -37.354 -6.470  1.000 26.322  ? 6854 THR C CB    1 
ATOM   3882 O  OG1   . THR C  1 59  ? 87.936  -36.685 -7.613  1.000 24.525  ? 6854 THR C OG1   1 
ATOM   3883 C  CG2   . THR C  1 59  ? 85.931  -37.664 -6.668  1.000 26.658  ? 6854 THR C CG2   1 
ATOM   3884 N  N     . LEU C  1 60  ? 89.494  -34.828 -5.243  1.000 26.084  ? 6855 LEU C N     1 
ATOM   3885 C  CA    . LEU C  1 60  ? 90.928  -34.428 -5.281  1.000 27.598  ? 6855 LEU C CA    1 
ATOM   3886 C  C     . LEU C  1 60  ? 91.395  -34.015 -3.874  1.000 29.267  ? 6855 LEU C C     1 
ATOM   3887 O  O     . LEU C  1 60  ? 90.623  -34.198 -2.933  1.000 36.419  ? 6855 LEU C O     1 
ATOM   3888 C  CB    . LEU C  1 60  ? 91.082  -33.297 -6.300  1.000 26.680  ? 6855 LEU C CB    1 
ATOM   3889 C  CG    . LEU C  1 60  ? 90.574  -33.598 -7.713  1.000 26.859  ? 6855 LEU C CG    1 
ATOM   3890 C  CD1   . LEU C  1 60  ? 90.870  -32.435 -8.644  1.000 26.587  ? 6855 LEU C CD1   1 
ATOM   3891 C  CD2   . LEU C  1 60  ? 91.187  -34.874 -8.261  1.000 28.404  ? 6855 LEU C CD2   1 
ATOM   3892 N  N     . THR C  1 61  ? 92.609  -33.481 -3.739  1.000 28.081  ? 6856 THR C N     1 
ATOM   3893 C  CA    . THR C  1 61  ? 93.121  -33.071 -2.401  1.000 28.112  ? 6856 THR C CA    1 
ATOM   3894 C  C     . THR C  1 61  ? 93.071  -31.540 -2.270  1.000 26.333  ? 6856 THR C C     1 
ATOM   3895 O  O     . THR C  1 61  ? 94.124  -30.931 -2.032  1.000 25.814  ? 6856 THR C O     1 
ATOM   3896 C  CB    . THR C  1 61  ? 94.528  -33.636 -2.182  1.000 29.172  ? 6856 THR C CB    1 
ATOM   3897 O  OG1   . THR C  1 61  ? 95.332  -33.130 -3.242  1.000 28.615  ? 6856 THR C OG1   1 
ATOM   3898 C  CG2   . THR C  1 61  ? 94.566  -35.151 -2.169  1.000 30.646  ? 6856 THR C CG2   1 
ATOM   3899 N  N     . LEU C  1 62  ? 91.893  -30.943 -2.462  1.000 25.471  ? 6857 LEU C N     1 
ATOM   3900 C  CA    . LEU C  1 62  ? 91.755  -29.476 -2.298  1.000 25.276  ? 6857 LEU C CA    1 
ATOM   3901 C  C     . LEU C  1 62  ? 92.008  -29.073 -0.846  1.000 24.352  ? 6857 LEU C C     1 
ATOM   3902 O  O     . LEU C  1 62  ? 91.517  -29.770 0.057   1.000 23.195  ? 6857 LEU C O     1 
ATOM   3903 C  CB    . LEU C  1 62  ? 90.338  -29.008 -2.646  1.000 26.783  ? 6857 LEU C CB    1 
ATOM   3904 C  CG    . LEU C  1 62  ? 89.899  -29.118 -4.100  1.000 29.475  ? 6857 LEU C CG    1 
ATOM   3905 C  CD1   . LEU C  1 62  ? 88.662  -28.256 -4.332  1.000 29.901  ? 6857 LEU C CD1   1 
ATOM   3906 C  CD2   . LEU C  1 62  ? 91.006  -28.697 -5.033  1.000 30.266  ? 6857 LEU C CD2   1 
ATOM   3907 N  N     . ALA C  1 63  ? 92.736  -27.974 -0.657  1.000 23.527  ? 6858 ALA C N     1 
ATOM   3908 C  CA    . ALA C  1 63  ? 92.871  -27.365 0.682   1.000 24.020  ? 6858 ALA C CA    1 
ATOM   3909 C  C     . ALA C  1 63  ? 91.560  -26.617 0.935   1.000 23.660  ? 6858 ALA C C     1 
ATOM   3910 O  O     . ALA C  1 63  ? 91.088  -25.919 -0.006  1.000 23.439  ? 6858 ALA C O     1 
ATOM   3911 C  CB    . ALA C  1 63  ? 94.058  -26.444 0.727   1.000 24.660  ? 6858 ALA C CB    1 
ATOM   3912 N  N     . VAL C  1 64  ? 90.972  -26.798 2.120   1.000 23.130  ? 6859 VAL C N     1 
ATOM   3913 C  CA    . VAL C  1 64  ? 89.673  -26.153 2.457   1.000 23.007  ? 6859 VAL C CA    1 
ATOM   3914 C  C     . VAL C  1 64  ? 89.807  -25.500 3.831   1.000 22.932  ? 6859 VAL C C     1 
ATOM   3915 O  O     . VAL C  1 64  ? 89.391  -26.057 4.843   1.000 24.087  ? 6859 VAL C O     1 
ATOM   3916 C  CB    . VAL C  1 64  ? 88.522  -27.176 2.417   1.000 22.985  ? 6859 VAL C CB    1 
ATOM   3917 C  CG1   . VAL C  1 64  ? 87.170  -26.496 2.554   1.000 23.189  ? 6859 VAL C CG1   1 
ATOM   3918 C  CG2   . VAL C  1 64  ? 88.556  -28.018 1.146   1.000 23.041  ? 6859 VAL C CG2   1 
ATOM   3919 N  N     . PRO C  1 65  ? 90.443  -24.318 3.916   1.000 22.922  ? 6860 PRO C N     1 
ATOM   3920 C  CA    . PRO C  1 65  ? 90.588  -23.636 5.191   1.000 23.712  ? 6860 PRO C CA    1 
ATOM   3921 C  C     . PRO C  1 65  ? 89.307  -22.940 5.653   1.000 23.992  ? 6860 PRO C C     1 
ATOM   3922 O  O     . PRO C  1 65  ? 88.345  -22.849 4.903   1.000 23.440  ? 6860 PRO C O     1 
ATOM   3923 C  CB    . PRO C  1 65  ? 91.630  -22.550 4.892   1.000 23.901  ? 6860 PRO C CB    1 
ATOM   3924 C  CG    . PRO C  1 65  ? 91.429  -22.238 3.424   1.000 23.305  ? 6860 PRO C CG    1 
ATOM   3925 C  CD    . PRO C  1 65  ? 91.034  -23.561 2.798   1.000 22.575  ? 6860 PRO C CD    1 
ATOM   3926 N  N     . TYR C  1 66  ? 89.323  -22.516 6.909   1.000 25.029  ? 6861 TYR C N     1 
ATOM   3927 C  CA    . TYR C  1 66  ? 88.235  -21.659 7.415   1.000 25.297  ? 6861 TYR C CA    1 
ATOM   3928 C  C     . TYR C  1 66  ? 88.336  -20.334 6.656   1.000 25.578  ? 6861 TYR C C     1 
ATOM   3929 O  O     . TYR C  1 66  ? 89.469  -19.956 6.307   1.000 25.178  ? 6861 TYR C O     1 
ATOM   3930 C  CB    . TYR C  1 66  ? 88.415  -21.396 8.908   1.000 26.445  ? 6861 TYR C CB    1 
ATOM   3931 C  CG    . TYR C  1 66  ? 87.997  -22.514 9.820   1.000 26.820  ? 6861 TYR C CG    1 
ATOM   3932 C  CD1   . TYR C  1 66  ? 86.655  -22.792 10.004  1.000 27.888  ? 6861 TYR C CD1   1 
ATOM   3933 C  CD2   . TYR C  1 66  ? 88.918  -23.230 10.566  1.000 27.107  ? 6861 TYR C CD2   1 
ATOM   3934 C  CE1   . TYR C  1 66  ? 86.235  -23.781 10.879  1.000 28.612  ? 6861 TYR C CE1   1 
ATOM   3935 C  CE2   . TYR C  1 66  ? 88.515  -24.217 11.453  1.000 28.007  ? 6861 TYR C CE2   1 
ATOM   3936 C  CZ    . TYR C  1 66  ? 87.168  -24.502 11.601  1.000 28.479  ? 6861 TYR C CZ    1 
ATOM   3937 O  OH    . TYR C  1 66  ? 86.735  -25.459 12.475  1.000 29.317  ? 6861 TYR C OH    1 
ATOM   3938 N  N     . ASN C  1 67  ? 87.211  -19.682 6.366   1.000 26.974  ? 6862 ASN C N     1 
ATOM   3939 C  CA    . ASN C  1 67  ? 87.258  -18.358 5.690   1.000 28.243  ? 6862 ASN C CA    1 
ATOM   3940 C  C     . ASN C  1 67  ? 87.987  -18.522 4.347   1.000 26.355  ? 6862 ASN C C     1 
ATOM   3941 O  O     . ASN C  1 67  ? 88.782  -17.636 3.966   1.000 24.972  ? 6862 ASN C O     1 
ATOM   3942 C  CB    . ASN C  1 67  ? 87.941  -17.341 6.613   1.000 32.958  ? 6862 ASN C CB    1 
ATOM   3943 C  CG    . ASN C  1 67  ? 87.450  -15.917 6.452   1.000 38.802  ? 6862 ASN C CG    1 
ATOM   3944 O  OD1   . ASN C  1 67  ? 86.324  -15.686 6.011   1.000 44.745  ? 6862 ASN C OD1   1 
ATOM   3945 N  ND2   . ASN C  1 67  ? 88.249  -14.959 6.908   1.000 42.294  ? 6862 ASN C ND2   1 
ATOM   3946 N  N     . MET C  1 68  ? 87.731  -19.641 3.673   1.000 24.422  ? 6863 MET C N     1 
ATOM   3947 C  CA    . MET C  1 68  ? 88.346  -19.961 2.365   1.000 24.180  ? 6863 MET C CA    1 
ATOM   3948 C  C     . MET C  1 68  ? 88.019  -18.847 1.360   1.000 23.290  ? 6863 MET C C     1 
ATOM   3949 O  O     . MET C  1 68  ? 86.894  -18.317 1.396   1.000 22.999  ? 6863 MET C O     1 
ATOM   3950 C  CB    . MET C  1 68  ? 87.809  -21.303 1.875   1.000 24.780  ? 6863 MET C CB    1 
ATOM   3951 C  CG    . MET C  1 68  ? 88.387  -21.780 0.585   1.000 25.964  ? 6863 MET C CG    1 
ATOM   3952 S  SD    . MET C  1 68  ? 87.655  -23.398 0.237   1.000 27.388  ? 6863 MET C SD    1 
ATOM   3953 C  CE    . MET C  1 68  ? 88.461  -23.802 -1.305  1.000 27.692  ? 6863 MET C CE    1 
ATOM   3954 N  N     . ARG C  1 69  ? 88.986  -18.514 0.507   1.000 22.146  ? 6864 ARG C N     1 
ATOM   3955 C  CA    . ARG C  1 69  ? 88.849  -17.412 -0.475  1.000 22.390  ? 6864 ARG C CA    1 
ATOM   3956 C  C     . ARG C  1 69  ? 88.669  -17.997 -1.874  1.000 21.183  ? 6864 ARG C C     1 
ATOM   3957 O  O     . ARG C  1 69  ? 89.635  -18.576 -2.412  1.000 21.339  ? 6864 ARG C O     1 
ATOM   3958 C  CB    . ARG C  1 69  ? 90.080  -16.517 -0.370  1.000 23.390  ? 6864 ARG C CB    1 
ATOM   3959 C  CG    . ARG C  1 69  ? 90.267  -15.921 1.017   1.000 24.798  ? 6864 ARG C CG    1 
ATOM   3960 C  CD    . ARG C  1 69  ? 91.592  -15.219 1.065   1.000 25.985  ? 6864 ARG C CD    1 
ATOM   3961 N  NE    . ARG C  1 69  ? 91.811  -14.529 2.320   1.000 26.884  ? 6864 ARG C NE    1 
ATOM   3962 C  CZ    . ARG C  1 69  ? 92.859  -13.756 2.568   1.000 27.892  ? 6864 ARG C CZ    1 
ATOM   3963 N  NH1   . ARG C  1 69  ? 93.787  -13.581 1.643   1.000 27.495  ? 6864 ARG C NH1   1 
ATOM   3964 N  NH2   . ARG C  1 69  ? 92.966  -13.146 3.737   1.000 29.149  ? 6864 ARG C NH2   1 
ATOM   3965 N  N     . VAL C  1 70  ? 87.488  -17.788 -2.450  1.000 19.862  ? 6865 VAL C N     1 
ATOM   3966 C  CA    . VAL C  1 70  ? 87.175  -18.346 -3.788  1.000 19.670  ? 6865 VAL C CA    1 
ATOM   3967 C  C     . VAL C  1 70  ? 86.795  -17.209 -4.728  1.000 20.039  ? 6865 VAL C C     1 
ATOM   3968 O  O     . VAL C  1 70  ? 85.953  -16.366 -4.350  1.000 20.459  ? 6865 VAL C O     1 
ATOM   3969 C  CB    . VAL C  1 70  ? 86.055  -19.393 -3.715  1.000 19.427  ? 6865 VAL C CB    1 
ATOM   3970 C  CG1   . VAL C  1 70  ? 85.765  -19.975 -5.091  1.000 19.447  ? 6865 VAL C CG1   1 
ATOM   3971 C  CG2   . VAL C  1 70  ? 86.397  -20.487 -2.718  1.000 20.013  ? 6865 VAL C CG2   1 
ATOM   3972 N  N     . ILE C  1 71  ? 87.421  -17.193 -5.901  1.000 20.262  ? 6866 ILE C N     1 
ATOM   3973 C  CA    . ILE C  1 71  ? 87.074  -16.167 -6.918  1.000 20.420  ? 6866 ILE C CA    1 
ATOM   3974 C  C     . ILE C  1 71  ? 86.590  -16.903 -8.172  1.000 19.664  ? 6866 ILE C C     1 
ATOM   3975 O  O     . ILE C  1 71  ? 87.230  -17.920 -8.580  1.000 19.697  ? 6866 ILE C O     1 
ATOM   3976 C  CB    . ILE C  1 71  ? 88.229  -15.175 -7.147  1.000 21.264  ? 6866 ILE C CB    1 
ATOM   3977 C  CG1   . ILE C  1 71  ? 87.798  -14.037 -8.077  1.000 22.563  ? 6866 ILE C CG1   1 
ATOM   3978 C  CG2   . ILE C  1 71  ? 89.483  -15.876 -7.635  1.000 21.492  ? 6866 ILE C CG2   1 
ATOM   3979 C  CD1   . ILE C  1 71  ? 88.710  -12.819 -8.012  1.000 24.397  ? 6866 ILE C CD1   1 
ATOM   3980 N  N     . HIS C  1 72  ? 85.479  -16.413 -8.723  1.000 19.338  ? 6867 HIS C N     1 
ATOM   3981 C  CA    . HIS C  1 72  ? 84.786  -17.030 -9.879  1.000 19.126  ? 6867 HIS C CA    1 
ATOM   3982 C  C     . HIS C  1 72  ? 84.695  -16.037 -11.042 1.000 19.629  ? 6867 HIS C C     1 
ATOM   3983 O  O     . HIS C  1 72  ? 83.890  -15.089 -10.966 1.000 20.016  ? 6867 HIS C O     1 
ATOM   3984 C  CB    . HIS C  1 72  ? 83.431  -17.561 -9.404  1.000 19.233  ? 6867 HIS C CB    1 
ATOM   3985 C  CG    . HIS C  1 72  ? 82.630  -18.224 -10.468 1.000 18.714  ? 6867 HIS C CG    1 
ATOM   3986 N  ND1   . HIS C  1 72  ? 81.249  -18.192 -10.480 1.000 18.629  ? 6867 HIS C ND1   1 
ATOM   3987 C  CD2   . HIS C  1 72  ? 83.009  -18.874 -11.587 1.000 18.803  ? 6867 HIS C CD2   1 
ATOM   3988 C  CE1   . HIS C  1 72  ? 80.816  -18.842 -11.543 1.000 18.806  ? 6867 HIS C CE1   1 
ATOM   3989 N  NE2   . HIS C  1 72  ? 81.874  -19.271 -12.239 1.000 18.517  ? 6867 HIS C NE2   1 
ATOM   3990 N  N     . PHE C  1 73  ? 85.499  -16.279 -12.079 1.000 19.349  ? 6868 PHE C N     1 
ATOM   3991 C  CA    . PHE C  1 73  ? 85.536  -15.419 -13.284 1.000 20.174  ? 6868 PHE C CA    1 
ATOM   3992 C  C     . PHE C  1 73  ? 84.577  -15.987 -14.333 1.000 20.269  ? 6868 PHE C C     1 
ATOM   3993 O  O     . PHE C  1 73  ? 84.451  -17.230 -14.442 1.000 19.947  ? 6868 PHE C O     1 
ATOM   3994 C  CB    . PHE C  1 73  ? 86.960  -15.322 -13.827 1.000 20.891  ? 6868 PHE C CB    1 
ATOM   3995 C  CG    . PHE C  1 73  ? 87.932  -14.627 -12.912 1.000 21.691  ? 6868 PHE C CG    1 
ATOM   3996 C  CD1   . PHE C  1 73  ? 87.931  -13.244 -12.799 1.000 22.952  ? 6868 PHE C CD1   1 
ATOM   3997 C  CD2   . PHE C  1 73  ? 88.888  -15.349 -12.215 1.000 22.215  ? 6868 PHE C CD2   1 
ATOM   3998 C  CE1   . PHE C  1 73  ? 88.851  -12.600 -11.984 1.000 23.639  ? 6868 PHE C CE1   1 
ATOM   3999 C  CE2   . PHE C  1 73  ? 89.802  -14.700 -11.397 1.000 23.081  ? 6868 PHE C CE2   1 
ATOM   4000 C  CZ    . PHE C  1 73  ? 89.785  -13.332 -11.287 1.000 22.889  ? 6868 PHE C CZ    1 
ATOM   4001 N  N     . GLY C  1 74  ? 83.971  -15.100 -15.121 1.000 20.296  ? 6869 GLY C N     1 
ATOM   4002 C  CA    . GLY C  1 74  ? 83.005  -15.517 -16.153 1.000 21.054  ? 6869 GLY C CA    1 
ATOM   4003 C  C     . GLY C  1 74  ? 81.757  -16.115 -15.522 1.000 20.845  ? 6869 GLY C C     1 
ATOM   4004 O  O     . GLY C  1 74  ? 81.229  -17.097 -16.077 1.000 21.570  ? 6869 GLY C O     1 
ATOM   4005 N  N     . ALA C  1 75  ? 81.278  -15.496 -14.439 1.000 20.887  ? 6870 ALA C N     1 
ATOM   4006 C  CA    . ALA C  1 75  ? 80.119  -15.979 -13.651 1.000 21.254  ? 6870 ALA C CA    1 
ATOM   4007 C  C     . ALA C  1 75  ? 78.782  -15.489 -14.211 1.000 22.189  ? 6870 ALA C C     1 
ATOM   4008 O  O     . ALA C  1 75  ? 77.747  -15.997 -13.749 1.000 22.797  ? 6870 ALA C O     1 
ATOM   4009 C  CB    . ALA C  1 75  ? 80.278  -15.523 -12.222 1.000 21.406  ? 6870 ALA C CB    1 
ATOM   4010 N  N     . GLY C  1 76  ? 78.794  -14.535 -15.142 1.000 22.803  ? 6871 GLY C N     1 
ATOM   4011 C  CA    . GLY C  1 76  ? 77.535  -14.001 -15.683 1.000 24.907  ? 6871 GLY C CA    1 
ATOM   4012 C  C     . GLY C  1 76  ? 76.998  -14.852 -16.813 1.000 27.134  ? 6871 GLY C C     1 
ATOM   4013 O  O     . GLY C  1 76  ? 77.590  -15.903 -17.117 1.000 27.874  ? 6871 GLY C O     1 
ATOM   4014 N  N     . SER C  1 77  ? 75.899  -14.416 -17.414 1.000 30.206  ? 6872 SER C N     1 
ATOM   4015 C  CA    . SER C  1 77  ? 75.297  -15.173 -18.539 1.000 32.472  ? 6872 SER C CA    1 
ATOM   4016 C  C     . SER C  1 77  ? 74.277  -14.286 -19.237 1.000 33.549  ? 6872 SER C C     1 
ATOM   4017 O  O     . SER C  1 77  ? 73.882  -13.261 -18.646 1.000 32.191  ? 6872 SER C O     1 
ATOM   4018 C  CB    . SER C  1 77  ? 74.644  -16.438 -18.067 1.000 32.987  ? 6872 SER C CB    1 
ATOM   4019 O  OG    . SER C  1 77  ? 73.514  -16.151 -17.268 1.000 34.863  ? 6872 SER C OG    1 
ATOM   4020 N  N     A ASP C  1 78  ? 73.854  -14.696 -20.435 0.700 35.411  ? 6873 ASP C N     1 
ATOM   4021 N  N     B ASP C  1 78  ? 73.863  -14.681 -20.446 0.300 34.164  ? 6873 ASP C N     1 
ATOM   4022 C  CA    A ASP C  1 78  ? 72.851  -13.930 -21.220 0.700 38.484  ? 6873 ASP C CA    1 
ATOM   4023 C  CA    B ASP C  1 78  ? 72.845  -13.928 -21.227 0.300 35.960  ? 6873 ASP C CA    1 
ATOM   4024 C  C     A ASP C  1 78  ? 71.517  -13.936 -20.463 0.700 36.950  ? 6873 ASP C C     1 
ATOM   4025 C  C     B ASP C  1 78  ? 71.519  -13.924 -20.455 0.300 35.720  ? 6873 ASP C C     1 
ATOM   4026 O  O     A ASP C  1 78  ? 70.652  -13.132 -20.806 0.700 37.263  ? 6873 ASP C O     1 
ATOM   4027 O  O     B ASP C  1 78  ? 70.654  -13.101 -20.788 0.300 36.469  ? 6873 ASP C O     1 
ATOM   4028 C  CB    A ASP C  1 78  ? 72.728  -14.482 -22.644 0.700 42.122  ? 6873 ASP C CB    1 
ATOM   4029 C  CB    B ASP C  1 78  ? 72.663  -14.520 -22.628 0.300 37.199  ? 6873 ASP C CB    1 
ATOM   4030 C  CG    A ASP C  1 78  ? 72.381  -15.958 -22.724 0.700 43.995  ? 6873 ASP C CG    1 
ATOM   4031 C  CG    B ASP C  1 78  ? 73.844  -14.296 -23.558 0.300 37.919  ? 6873 ASP C CG    1 
ATOM   4032 O  OD1   A ASP C  1 78  ? 72.145  -16.568 -21.664 0.700 46.777  ? 6873 ASP C OD1   1 
ATOM   4033 O  OD1   B ASP C  1 78  ? 74.741  -13.510 -23.192 0.300 38.251  ? 6873 ASP C OD1   1 
ATOM   4034 O  OD2   A ASP C  1 78  ? 72.361  -16.488 -23.851 0.700 49.848  ? 6873 ASP C OD2   1 
ATOM   4035 O  OD2   B ASP C  1 78  ? 73.850  -14.903 -24.648 0.300 39.010  ? 6873 ASP C OD2   1 
ATOM   4036 N  N     . LYS C  1 79  ? 71.384  -14.800 -19.453 1.000 34.611  ? 6874 LYS C N     1 
ATOM   4037 C  CA    . LYS C  1 79  ? 70.139  -14.878 -18.640 1.000 34.584  ? 6874 LYS C CA    1 
ATOM   4038 C  C     . LYS C  1 79  ? 70.123  -13.753 -17.596 1.000 32.215  ? 6874 LYS C C     1 
ATOM   4039 O  O     . LYS C  1 79  ? 69.047  -13.479 -17.046 1.000 34.044  ? 6874 LYS C O     1 
ATOM   4040 C  CB    . LYS C  1 79  ? 70.054  -16.217 -17.901 1.000 36.140  ? 6874 LYS C CB    1 
ATOM   4041 C  CG    . LYS C  1 79  ? 70.062  -17.473 -18.762 1.000 38.111  ? 6874 LYS C CG    1 
ATOM   4042 C  CD    . LYS C  1 79  ? 70.157  -18.725 -17.922 1.000 39.106  ? 6874 LYS C CD    1 
ATOM   4043 C  CE    . LYS C  1 79  ? 70.272  -20.000 -18.727 1.000 41.663  ? 6874 LYS C CE    1 
ATOM   4044 N  NZ    . LYS C  1 79  ? 69.078  -20.235 -19.566 1.000 44.884  ? 6874 LYS C NZ    1 
ATOM   4045 N  N     . GLY C  1 80  ? 71.280  -13.158 -17.300 1.000 29.273  ? 6875 GLY C N     1 
ATOM   4046 C  CA    . GLY C  1 80  ? 71.354  -12.091 -16.280 1.000 28.966  ? 6875 GLY C CA    1 
ATOM   4047 C  C     . GLY C  1 80  ? 71.466  -12.650 -14.867 1.000 27.129  ? 6875 GLY C C     1 
ATOM   4048 O  O     . GLY C  1 80  ? 71.387  -11.849 -13.905 1.000 26.678  ? 6875 GLY C O     1 
ATOM   4049 N  N     . VAL C  1 81  ? 71.653  -13.970 -14.736 1.000 25.154  ? 6876 VAL C N     1 
ATOM   4050 C  CA    . VAL C  1 81  ? 71.802  -14.612 -13.399 1.000 24.547  ? 6876 VAL C CA    1 
ATOM   4051 C  C     . VAL C  1 81  ? 73.125  -15.395 -13.383 1.000 23.788  ? 6876 VAL C C     1 
ATOM   4052 O  O     . VAL C  1 81  ? 73.804  -15.450 -14.437 1.000 23.601  ? 6876 VAL C O     1 
ATOM   4053 C  CB    . VAL C  1 81  ? 70.578  -15.486 -13.055 1.000 24.698  ? 6876 VAL C CB    1 
ATOM   4054 C  CG1   . VAL C  1 81  ? 69.325  -14.646 -12.892 1.000 26.342  ? 6876 VAL C CG1   1 
ATOM   4055 C  CG2   . VAL C  1 81  ? 70.349  -16.581 -14.082 1.000 24.616  ? 6876 VAL C CG2   1 
ATOM   4056 N  N     . ALA C  1 82  ? 73.469  -15.998 -12.244 1.000 22.519  ? 6877 ALA C N     1 
ATOM   4057 C  CA    . ALA C  1 82  ? 74.760  -16.713 -12.118 1.000 21.153  ? 6877 ALA C CA    1 
ATOM   4058 C  C     . ALA C  1 82  ? 74.531  -18.141 -11.644 1.000 20.942  ? 6877 ALA C C     1 
ATOM   4059 O  O     . ALA C  1 82  ? 74.735  -18.437 -10.469 1.000 21.216  ? 6877 ALA C O     1 
ATOM   4060 C  CB    . ALA C  1 82  ? 75.650  -15.955 -11.166 1.000 20.788  ? 6877 ALA C CB    1 
ATOM   4061 N  N     . PRO C  1 83  ? 74.127  -19.069 -12.542 1.000 21.480  ? 6878 PRO C N     1 
ATOM   4062 C  CA    . PRO C  1 83  ? 73.887  -20.463 -12.160 1.000 21.776  ? 6878 PRO C CA    1 
ATOM   4063 C  C     . PRO C  1 83  ? 75.114  -21.100 -11.491 1.000 20.816  ? 6878 PRO C C     1 
ATOM   4064 O  O     . PRO C  1 83  ? 74.966  -21.666 -10.424 1.000 20.740  ? 6878 PRO C O     1 
ATOM   4065 C  CB    . PRO C  1 83  ? 73.543  -21.156 -13.487 1.000 22.123  ? 6878 PRO C CB    1 
ATOM   4066 C  CG    . PRO C  1 83  ? 73.038  -20.029 -14.371 1.000 23.051  ? 6878 PRO C CG    1 
ATOM   4067 C  CD    . PRO C  1 83  ? 73.861  -18.825 -13.966 1.000 22.164  ? 6878 PRO C CD    1 
ATOM   4068 N  N     . GLY C  1 84  ? 76.289  -20.964 -12.113 1.000 20.253  ? 6879 GLY C N     1 
ATOM   4069 C  CA    . GLY C  1 84  ? 77.534  -21.527 -11.557 1.000 19.873  ? 6879 GLY C CA    1 
ATOM   4070 C  C     . GLY C  1 84  ? 77.830  -20.991 -10.161 1.000 19.726  ? 6879 GLY C C     1 
ATOM   4071 O  O     . GLY C  1 84  ? 78.224  -21.792 -9.282  1.000 19.091  ? 6879 GLY C O     1 
ATOM   4072 N  N     . THR C  1 85  ? 77.698  -19.678 -9.958  1.000 19.703  ? 6880 THR C N     1 
ATOM   4073 C  CA    . THR C  1 85  ? 77.944  -19.113 -8.605  1.000 20.127  ? 6880 THR C CA    1 
ATOM   4074 C  C     . THR C  1 85  ? 76.988  -19.760 -7.598  1.000 20.139  ? 6880 THR C C     1 
ATOM   4075 O  O     . THR C  1 85  ? 77.430  -20.054 -6.474  1.000 19.379  ? 6880 THR C O     1 
ATOM   4076 C  CB    . THR C  1 85  ? 77.807  -17.588 -8.595  1.000 20.723  ? 6880 THR C CB    1 
ATOM   4077 O  OG1   . THR C  1 85  ? 78.865  -17.069 -9.394  1.000 20.936  ? 6880 THR C OG1   1 
ATOM   4078 C  CG2   . THR C  1 85  ? 77.884  -16.995 -7.206  1.000 21.808  ? 6880 THR C CG2   1 
ATOM   4079 N  N     . ALA C  1 86  ? 75.722  -19.958 -7.983  1.000 20.112  ? 6881 ALA C N     1 
ATOM   4080 C  CA    . ALA C  1 86  ? 74.745  -20.575 -7.060  1.000 20.105  ? 6881 ALA C CA    1 
ATOM   4081 C  C     . ALA C  1 86  ? 75.219  -21.988 -6.683  1.000 19.964  ? 6881 ALA C C     1 
ATOM   4082 O  O     . ALA C  1 86  ? 75.067  -22.373 -5.508  1.000 19.938  ? 6881 ALA C O     1 
ATOM   4083 C  CB    . ALA C  1 86  ? 73.378  -20.581 -7.691  1.000 20.808  ? 6881 ALA C CB    1 
ATOM   4084 N  N     . VAL C  1 87  ? 75.765  -22.732 -7.646  1.000 19.456  ? 6882 VAL C N     1 
ATOM   4085 C  CA    . VAL C  1 87  ? 76.281  -24.098 -7.348  1.000 19.456  ? 6882 VAL C CA    1 
ATOM   4086 C  C     . VAL C  1 87  ? 77.520  -23.986 -6.448  1.000 19.116  ? 6882 VAL C C     1 
ATOM   4087 O  O     . VAL C  1 87  ? 77.604  -24.750 -5.471  1.000 19.237  ? 6882 VAL C O     1 
ATOM   4088 C  CB    . VAL C  1 87  ? 76.590  -24.886 -8.631  1.000 19.108  ? 6882 VAL C CB    1 
ATOM   4089 C  CG1   . VAL C  1 87  ? 77.236  -26.228 -8.305  1.000 18.784  ? 6882 VAL C CG1   1 
ATOM   4090 C  CG2   . VAL C  1 87  ? 75.349  -25.080 -9.485  1.000 19.556  ? 6882 VAL C CG2   1 
ATOM   4091 N  N     . LEU C  1 88  ? 78.440  -23.069 -6.751  1.000 19.412  ? 6883 LEU C N     1 
ATOM   4092 C  CA    . LEU C  1 88  ? 79.667  -22.942 -5.914  1.000 19.707  ? 6883 LEU C CA    1 
ATOM   4093 C  C     . LEU C  1 88  ? 79.285  -22.602 -4.475  1.000 20.331  ? 6883 LEU C C     1 
ATOM   4094 O  O     . LEU C  1 88  ? 79.877  -23.165 -3.551  1.000 20.637  ? 6883 LEU C O     1 
ATOM   4095 C  CB    . LEU C  1 88  ? 80.594  -21.868 -6.492  1.000 19.846  ? 6883 LEU C CB    1 
ATOM   4096 C  CG    . LEU C  1 88  ? 81.269  -22.215 -7.810  1.000 19.941  ? 6883 LEU C CG    1 
ATOM   4097 C  CD1   . LEU C  1 88  ? 82.073  -21.029 -8.319  1.000 20.363  ? 6883 LEU C CD1   1 
ATOM   4098 C  CD2   . LEU C  1 88  ? 82.147  -23.453 -7.673  1.000 20.202  ? 6883 LEU C CD2   1 
ATOM   4099 N  N     A ARG C  1 89  ? 78.326  -21.694 -4.294  0.700 22.259  ? 6884 ARG C N     1 
ATOM   4100 N  N     B ARG C  1 89  ? 78.314  -21.698 -4.320  0.300 20.328  ? 6884 ARG C N     1 
ATOM   4101 C  CA    A ARG C  1 89  ? 77.909  -21.296 -2.926  0.700 23.455  ? 6884 ARG C CA    1 
ATOM   4102 C  CA    B ARG C  1 89  ? 77.795  -21.239 -3.004  0.300 20.494  ? 6884 ARG C CA    1 
ATOM   4103 C  C     A ARG C  1 89  ? 77.268  -22.495 -2.218  0.700 22.968  ? 6884 ARG C C     1 
ATOM   4104 C  C     B ARG C  1 89  ? 77.227  -22.442 -2.239  0.300 21.086  ? 6884 ARG C C     1 
ATOM   4105 O  O     A ARG C  1 89  ? 77.480  -22.637 -0.993  0.700 22.348  ? 6884 ARG C O     1 
ATOM   4106 O  O     B ARG C  1 89  ? 77.421  -22.514 -1.007  0.300 21.195  ? 6884 ARG C O     1 
ATOM   4107 C  CB    A ARG C  1 89  ? 77.019  -20.054 -2.992  0.700 26.453  ? 6884 ARG C CB    1 
ATOM   4108 C  CB    B ARG C  1 89  ? 76.727  -20.171 -3.259  0.300 20.605  ? 6884 ARG C CB    1 
ATOM   4109 C  CG    A ARG C  1 89  ? 76.356  -19.698 -1.671  0.700 30.311  ? 6884 ARG C CG    1 
ATOM   4110 C  CG    B ARG C  1 89  ? 76.149  -19.506 -2.017  0.300 21.101  ? 6884 ARG C CG    1 
ATOM   4111 C  CD    A ARG C  1 89  ? 76.306  -18.208 -1.445  0.700 33.835  ? 6884 ARG C CD    1 
ATOM   4112 C  CD    B ARG C  1 89  ? 77.193  -18.687 -1.300  0.300 20.926  ? 6884 ARG C CD    1 
ATOM   4113 N  NE    A ARG C  1 89  ? 77.677  -17.817 -1.176  0.700 39.218  ? 6884 ARG C NE    1 
ATOM   4114 N  NE    B ARG C  1 89  ? 76.642  -17.718 -0.356  0.300 21.425  ? 6884 ARG C NE    1 
ATOM   4115 C  CZ    A ARG C  1 89  ? 78.074  -16.638 -0.723  0.700 38.831  ? 6884 ARG C CZ    1 
ATOM   4116 C  CZ    B ARG C  1 89  ? 77.380  -16.800 0.253   0.300 21.579  ? 6884 ARG C CZ    1 
ATOM   4117 N  NH1   A ARG C  1 89  ? 77.202  -15.682 -0.443  0.700 41.807  ? 6884 ARG C NH1   1 
ATOM   4118 N  NH1   B ARG C  1 89  ? 76.833  -15.944 1.098   0.300 22.214  ? 6884 ARG C NH1   1 
ATOM   4119 N  NH2   A ARG C  1 89  ? 79.360  -16.443 -0.521  0.700 38.935  ? 6884 ARG C NH2   1 
ATOM   4120 N  NH2   B ARG C  1 89  ? 78.674  -16.738 -0.011  0.300 21.408  ? 6884 ARG C NH2   1 
ATOM   4121 N  N     . GLN C  1 90  ? 76.556  -23.345 -2.960  1.000 21.287  ? 6885 GLN C N     1 
ATOM   4122 C  CA    . GLN C  1 90  ? 75.940  -24.555 -2.360  1.000 20.972  ? 6885 GLN C CA    1 
ATOM   4123 C  C     . GLN C  1 90  ? 77.045  -25.530 -1.941  1.000 20.387  ? 6885 GLN C C     1 
ATOM   4124 O  O     . GLN C  1 90  ? 76.981  -26.088 -0.834  1.000 19.613  ? 6885 GLN C O     1 
ATOM   4125 C  CB    . GLN C  1 90  ? 75.027  -25.218 -3.391  1.000 20.970  ? 6885 GLN C CB    1 
ATOM   4126 C  CG    . GLN C  1 90  ? 74.522  -26.594 -2.994  1.000 21.411  ? 6885 GLN C CG    1 
ATOM   4127 C  CD    . GLN C  1 90  ? 73.757  -27.249 -4.117  1.000 21.465  ? 6885 GLN C CD    1 
ATOM   4128 O  OE1   . GLN C  1 90  ? 73.760  -26.772 -5.248  1.000 21.852  ? 6885 GLN C OE1   1 
ATOM   4129 N  NE2   . GLN C  1 90  ? 73.105  -28.359 -3.813  1.000 20.731  ? 6885 GLN C NE2   1 
ATOM   4130 N  N     . TRP C  1 91  ? 78.023  -25.710 -2.818  1.000 19.659  ? 6886 TRP C N     1 
ATOM   4131 C  CA    . TRP C  1 91  ? 79.131  -26.677 -2.633  1.000 20.041  ? 6886 TRP C CA    1 
ATOM   4132 C  C     . TRP C  1 91  ? 80.084  -26.268 -1.501  1.000 20.636  ? 6886 TRP C C     1 
ATOM   4133 O  O     . TRP C  1 91  ? 80.434  -27.133 -0.669  1.000 20.107  ? 6886 TRP C O     1 
ATOM   4134 C  CB    . TRP C  1 91  ? 79.868  -26.788 -3.962  1.000 19.614  ? 6886 TRP C CB    1 
ATOM   4135 C  CG    . TRP C  1 91  ? 81.059  -27.685 -3.954  1.000 19.336  ? 6886 TRP C CG    1 
ATOM   4136 C  CD1   . TRP C  1 91  ? 81.082  -29.021 -3.690  1.000 20.214  ? 6886 TRP C CD1   1 
ATOM   4137 C  CD2   . TRP C  1 91  ? 82.388  -27.325 -4.353  1.000 19.196  ? 6886 TRP C CD2   1 
ATOM   4138 N  NE1   . TRP C  1 91  ? 82.349  -29.507 -3.849  1.000 20.591  ? 6886 TRP C NE1   1 
ATOM   4139 C  CE2   . TRP C  1 91  ? 83.169  -28.495 -4.272  1.000 19.682  ? 6886 TRP C CE2   1 
ATOM   4140 C  CE3   . TRP C  1 91  ? 82.990  -26.130 -4.764  1.000 18.929  ? 6886 TRP C CE3   1 
ATOM   4141 C  CZ2   . TRP C  1 91  ? 84.529  -28.498 -4.568  1.000 19.756  ? 6886 TRP C CZ2   1 
ATOM   4142 C  CZ3   . TRP C  1 91  ? 84.335  -26.133 -5.060  1.000 19.565  ? 6886 TRP C CZ3   1 
ATOM   4143 C  CH2   . TRP C  1 91  ? 85.091  -27.303 -4.957  1.000 19.719  ? 6886 TRP C CH2   1 
ATOM   4144 N  N     . LEU C  1 92  ? 80.518  -25.012 -1.518  1.000 20.518  ? 6887 LEU C N     1 
ATOM   4145 C  CA    . LEU C  1 92  ? 81.519  -24.497 -0.552  1.000 21.100  ? 6887 LEU C CA    1 
ATOM   4146 C  C     . LEU C  1 92  ? 80.947  -24.416 0.857   1.000 22.107  ? 6887 LEU C C     1 
ATOM   4147 O  O     . LEU C  1 92  ? 79.754  -24.191 1.041   1.000 21.669  ? 6887 LEU C O     1 
ATOM   4148 C  CB    . LEU C  1 92  ? 81.953  -23.115 -1.024  1.000 20.969  ? 6887 LEU C CB    1 
ATOM   4149 C  CG    . LEU C  1 92  ? 82.714  -23.097 -2.345  1.000 20.297  ? 6887 LEU C CG    1 
ATOM   4150 C  CD1   . LEU C  1 92  ? 82.755  -21.692 -2.897  1.000 20.397  ? 6887 LEU C CD1   1 
ATOM   4151 C  CD2   . LEU C  1 92  ? 84.115  -23.676 -2.157  1.000 20.793  ? 6887 LEU C CD2   1 
ATOM   4152 N  N     . PRO C  1 93  ? 81.791  -24.618 1.892   1.000 22.803  ? 6888 PRO C N     1 
ATOM   4153 C  CA    . PRO C  1 93  ? 81.335  -24.496 3.268   1.000 24.609  ? 6888 PRO C CA    1 
ATOM   4154 C  C     . PRO C  1 93  ? 80.745  -23.106 3.531   1.000 25.404  ? 6888 PRO C C     1 
ATOM   4155 O  O     . PRO C  1 93  ? 81.200  -22.124 2.920   1.000 23.631  ? 6888 PRO C O     1 
ATOM   4156 C  CB    . PRO C  1 93  ? 82.617  -24.681 4.103   1.000 24.693  ? 6888 PRO C CB    1 
ATOM   4157 C  CG    . PRO C  1 93  ? 83.516  -25.510 3.211   1.000 23.950  ? 6888 PRO C CG    1 
ATOM   4158 C  CD    . PRO C  1 93  ? 83.196  -25.047 1.800   1.000 22.890  ? 6888 PRO C CD    1 
ATOM   4159 N  N     . THR C  1 94  ? 79.717  -23.067 4.374   1.000 26.592  ? 6889 THR C N     1 
ATOM   4160 C  CA    . THR C  1 94  ? 79.124  -21.780 4.792   1.000 29.972  ? 6889 THR C CA    1 
ATOM   4161 C  C     . THR C  1 94  ? 80.272  -21.020 5.459   1.000 30.636  ? 6889 THR C C     1 
ATOM   4162 O  O     . THR C  1 94  ? 81.020  -21.652 6.231   1.000 36.445  ? 6889 THR C O     1 
ATOM   4163 C  CB    . THR C  1 94  ? 77.922  -22.008 5.726   1.000 32.071  ? 6889 THR C CB    1 
ATOM   4164 O  OG1   . THR C  1 94  ? 76.967  -22.818 5.035   1.000 32.051  ? 6889 THR C OG1   1 
ATOM   4165 C  CG2   . THR C  1 94  ? 77.264  -20.719 6.172   1.000 33.980  ? 6889 THR C CG2   1 
ATOM   4166 N  N     . GLY C  1 95  ? 80.453  -19.752 5.138   1.000 31.299  ? 6890 GLY C N     1 
ATOM   4167 C  CA    . GLY C  1 95  ? 81.577  -19.023 5.760   1.000 31.721  ? 6890 GLY C CA    1 
ATOM   4168 C  C     . GLY C  1 95  ? 82.686  -18.816 4.745   1.000 28.784  ? 6890 GLY C C     1 
ATOM   4169 O  O     . GLY C  1 95  ? 83.604  -18.026 5.003   1.000 28.784  ? 6890 GLY C O     1 
ATOM   4170 N  N     . THR C  1 96  ? 82.615  -19.547 3.637   1.000 26.081  ? 6891 THR C N     1 
ATOM   4171 C  CA    . THR C  1 96  ? 83.614  -19.360 2.562   1.000 24.716  ? 6891 THR C CA    1 
ATOM   4172 C  C     . THR C  1 96  ? 83.354  -18.018 1.882   1.000 23.947  ? 6891 THR C C     1 
ATOM   4173 O  O     . THR C  1 96  ? 82.177  -17.711 1.614   1.000 23.257  ? 6891 THR C O     1 
ATOM   4174 C  CB    . THR C  1 96  ? 83.494  -20.456 1.496   1.000 23.377  ? 6891 THR C CB    1 
ATOM   4175 O  OG1   . THR C  1 96  ? 83.780  -21.706 2.113   1.000 22.722  ? 6891 THR C OG1   1 
ATOM   4176 C  CG2   . THR C  1 96  ? 84.429  -20.249 0.327   1.000 23.612  ? 6891 THR C CG2   1 
ATOM   4177 N  N     A LEU C  1 97  ? 84.409  -17.233 1.641   0.500 23.625  ? 6892 LEU C N     1 
ATOM   4178 N  N     B LEU C  1 97  ? 84.421  -17.257 1.634   0.500 23.851  ? 6892 LEU C N     1 
ATOM   4179 C  CA    A LEU C  1 97  ? 84.255  -15.941 0.918   0.500 23.770  ? 6892 LEU C CA    1 
ATOM   4180 C  CA    B LEU C  1 97  ? 84.310  -15.979 0.889   0.500 24.103  ? 6892 LEU C CA    1 
ATOM   4181 C  C     A LEU C  1 97  ? 84.203  -16.247 -0.584  0.500 22.636  ? 6892 LEU C C     1 
ATOM   4182 C  C     B LEU C  1 97  ? 84.187  -16.306 -0.601  0.500 22.797  ? 6892 LEU C C     1 
ATOM   4183 O  O     A LEU C  1 97  ? 85.164  -16.867 -1.098  0.500 22.302  ? 6892 LEU C O     1 
ATOM   4184 O  O     B LEU C  1 97  ? 85.082  -17.012 -1.126  0.500 22.229  ? 6892 LEU C O     1 
ATOM   4185 C  CB    A LEU C  1 97  ? 85.420  -15.006 1.263   0.500 24.764  ? 6892 LEU C CB    1 
ATOM   4186 C  CB    B LEU C  1 97  ? 85.558  -15.131 1.134   0.500 25.413  ? 6892 LEU C CB    1 
ATOM   4187 C  CG    A LEU C  1 97  ? 85.583  -14.686 2.748   0.500 25.922  ? 6892 LEU C CG    1 
ATOM   4188 C  CG    B LEU C  1 97  ? 85.706  -13.947 0.187   0.500 26.297  ? 6892 LEU C CG    1 
ATOM   4189 C  CD1   A LEU C  1 97  ? 86.809  -13.818 2.992   0.500 26.726  ? 6892 LEU C CD1   1 
ATOM   4190 C  CD1   B LEU C  1 97  ? 84.559  -12.966 0.370   0.500 27.395  ? 6892 LEU C CD1   1 
ATOM   4191 C  CD2   A LEU C  1 97  ? 84.335  -14.014 3.297   0.500 26.905  ? 6892 LEU C CD2   1 
ATOM   4192 C  CD2   B LEU C  1 97  ? 87.042  -13.260 0.385   0.500 27.363  ? 6892 LEU C CD2   1 
ATOM   4193 N  N     . LEU C  1 98  ? 83.110  -15.856 -1.246  1.000 22.094  ? 6893 LEU C N     1 
ATOM   4194 C  CA    . LEU C  1 98  ? 82.939  -16.115 -2.700  1.000 21.426  ? 6893 LEU C CA    1 
ATOM   4195 C  C     . LEU C  1 98  ? 82.755  -14.789 -3.437  1.000 21.196  ? 6893 LEU C C     1 
ATOM   4196 O  O     . LEU C  1 98  ? 81.812  -14.054 -3.127  1.000 21.597  ? 6893 LEU C O     1 
ATOM   4197 C  CB    . LEU C  1 98  ? 81.743  -17.045 -2.913  1.000 21.892  ? 6893 LEU C CB    1 
ATOM   4198 C  CG    . LEU C  1 98  ? 81.421  -17.394 -4.368  1.000 21.627  ? 6893 LEU C CG    1 
ATOM   4199 C  CD1   . LEU C  1 98  ? 82.610  -18.036 -5.074  1.000 21.365  ? 6893 LEU C CD1   1 
ATOM   4200 C  CD2   . LEU C  1 98  ? 80.208  -18.308 -4.428  1.000 22.426  ? 6893 LEU C CD2   1 
ATOM   4201 N  N     . VAL C  1 99  ? 83.695  -14.477 -4.318  1.000 21.313  ? 6894 VAL C N     1 
ATOM   4202 C  CA    . VAL C  1 99  ? 83.641  -13.252 -5.158  1.000 22.587  ? 6894 VAL C CA    1 
ATOM   4203 C  C     . VAL C  1 99  ? 83.475  -13.703 -6.604  1.000 22.266  ? 6894 VAL C C     1 
ATOM   4204 O  O     . VAL C  1 99  ? 84.161  -14.673 -6.989  1.000 21.775  ? 6894 VAL C O     1 
ATOM   4205 C  CB    . VAL C  1 99  ? 84.911  -12.407 -4.971  1.000 24.051  ? 6894 VAL C CB    1 
ATOM   4206 C  CG1   . VAL C  1 99  ? 85.015  -11.297 -6.000  1.000 25.717  ? 6894 VAL C CG1   1 
ATOM   4207 C  CG2   . VAL C  1 99  ? 84.975  -11.853 -3.555  1.000 24.639  ? 6894 VAL C CG2   1 
ATOM   4208 N  N     . ASP C  1 100 ? 82.577  -13.068 -7.357  1.000 22.380  ? 6895 ASP C N     1 
ATOM   4209 C  CA    . ASP C  1 100 ? 82.444  -13.473 -8.779  1.000 22.105  ? 6895 ASP C CA    1 
ATOM   4210 C  C     . ASP C  1 100 ? 82.585  -12.238 -9.671  1.000 22.965  ? 6895 ASP C C     1 
ATOM   4211 O  O     . ASP C  1 100 ? 82.564  -11.076 -9.156  1.000 22.461  ? 6895 ASP C O     1 
ATOM   4212 C  CB    . ASP C  1 100 ? 81.201  -14.323 -9.026  1.000 22.163  ? 6895 ASP C CB    1 
ATOM   4213 C  CG    . ASP C  1 100 ? 79.874  -13.629 -8.836  1.000 23.031  ? 6895 ASP C CG    1 
ATOM   4214 O  OD1   . ASP C  1 100 ? 79.871  -12.404 -8.562  1.000 23.171  ? 6895 ASP C OD1   1 
ATOM   4215 O  OD2   . ASP C  1 100 ? 78.846  -14.338 -8.966  1.000 23.449  ? 6895 ASP C OD2   1 
ATOM   4216 N  N     . SER C  1 101 ? 82.685  -12.483 -10.969 1.000 23.210  ? 6896 SER C N     1 
ATOM   4217 C  CA    . SER C  1 101 ? 82.985  -11.385 -11.909 1.000 24.774  ? 6896 SER C CA    1 
ATOM   4218 C  C     . SER C  1 101 ? 82.559  -11.750 -13.325 1.000 23.869  ? 6896 SER C C     1 
ATOM   4219 O  O     . SER C  1 101 ? 82.522  -12.956 -13.662 1.000 22.017  ? 6896 SER C O     1 
ATOM   4220 C  CB    . SER C  1 101 ? 84.474  -11.112 -11.857 1.000 27.344  ? 6896 SER C CB    1 
ATOM   4221 O  OG    . SER C  1 101 ? 84.835  -10.015 -12.675 1.000 32.487  ? 6896 SER C OG    1 
ATOM   4222 N  N     . ASP C  1 102 ? 82.282  -10.724 -14.118 1.000 24.168  ? 6897 ASP C N     1 
ATOM   4223 C  CA    . ASP C  1 102 ? 81.927  -10.927 -15.541 1.000 24.888  ? 6897 ASP C CA    1 
ATOM   4224 C  C     . ASP C  1 102 ? 82.020  -9.584  -16.257 1.000 26.802  ? 6897 ASP C C     1 
ATOM   4225 O  O     . ASP C  1 102 ? 81.975  -8.524  -15.583 1.000 25.438  ? 6897 ASP C O     1 
ATOM   4226 C  CB    . ASP C  1 102 ? 80.537  -11.537 -15.706 1.000 24.962  ? 6897 ASP C CB    1 
ATOM   4227 C  CG    . ASP C  1 102 ? 80.310  -12.117 -17.092 1.000 25.549  ? 6897 ASP C CG    1 
ATOM   4228 O  OD1   . ASP C  1 102 ? 80.094  -11.318 -18.045 1.000 26.405  ? 6897 ASP C OD1   1 
ATOM   4229 O  OD2   . ASP C  1 102 ? 80.446  -13.356 -17.228 1.000 24.195  ? 6897 ASP C OD2   1 
ATOM   4230 N  N     A LEU C  1 103 ? 82.172  -9.653  -17.575 0.700 27.486  ? 6898 LEU C N     1 
ATOM   4231 N  N     B LEU C  1 103 ? 82.196  -9.637  -17.584 0.300 27.209  ? 6898 LEU C N     1 
ATOM   4232 C  CA    A LEU C  1 103 ? 82.249  -8.472  -18.457 0.700 29.577  ? 6898 LEU C CA    1 
ATOM   4233 C  CA    B LEU C  1 103 ? 82.223  -8.427  -18.447 0.300 28.952  ? 6898 LEU C CA    1 
ATOM   4234 C  C     A LEU C  1 103 ? 80.908  -7.728  -18.398 0.700 30.670  ? 6898 LEU C C     1 
ATOM   4235 C  C     B LEU C  1 103 ? 80.888  -7.702  -18.324 0.300 30.111  ? 6898 LEU C C     1 
ATOM   4236 O  O     A LEU C  1 103 ? 80.931  -6.491  -18.375 0.700 30.366  ? 6898 LEU C O     1 
ATOM   4237 O  O     B LEU C  1 103 ? 80.890  -6.463  -18.223 0.300 30.515  ? 6898 LEU C O     1 
ATOM   4238 C  CB    A LEU C  1 103 ? 82.561  -8.992  -19.868 0.700 30.363  ? 6898 LEU C CB    1 
ATOM   4239 C  CB    B LEU C  1 103 ? 82.414  -8.834  -19.914 0.300 29.285  ? 6898 LEU C CB    1 
ATOM   4240 C  CG    A LEU C  1 103 ? 82.773  -7.951  -20.962 0.700 31.776  ? 6898 LEU C CG    1 
ATOM   4241 C  CG    B LEU C  1 103 ? 83.847  -8.975  -20.415 0.300 29.204  ? 6898 LEU C CG    1 
ATOM   4242 C  CD1   A LEU C  1 103 ? 83.955  -7.051  -20.644 0.700 32.316  ? 6898 LEU C CD1   1 
ATOM   4243 C  CD1   B LEU C  1 103 ? 83.872  -9.606  -21.800 0.300 29.382  ? 6898 LEU C CD1   1 
ATOM   4244 C  CD2   A LEU C  1 103 ? 82.976  -8.639  -22.306 0.700 32.075  ? 6898 LEU C CD2   1 
ATOM   4245 C  CD2   B LEU C  1 103 ? 84.540  -7.625  -20.436 0.300 30.264  ? 6898 LEU C CD2   1 
ATOM   4246 N  N     . ASN C  1 104 ? 79.800  -8.477  -18.301 1.000 30.075  ? 6899 ASN C N     1 
ATOM   4247 C  CA    . ASN C  1 104 ? 78.424  -7.916  -18.318 1.000 31.687  ? 6899 ASN C CA    1 
ATOM   4248 C  C     . ASN C  1 104 ? 77.748  -8.016  -16.950 1.000 31.010  ? 6899 ASN C C     1 
ATOM   4249 O  O     . ASN C  1 104 ? 77.996  -8.991  -16.231 1.000 28.782  ? 6899 ASN C O     1 
ATOM   4250 C  CB    . ASN C  1 104 ? 77.620  -8.641  -19.396 1.000 32.718  ? 6899 ASN C CB    1 
ATOM   4251 C  CG    . ASN C  1 104 ? 78.323  -8.572  -20.734 1.000 33.740  ? 6899 ASN C CG    1 
ATOM   4252 O  OD1   . ASN C  1 104 ? 78.704  -7.494  -21.171 1.000 34.921  ? 6899 ASN C OD1   1 
ATOM   4253 N  ND2   . ASN C  1 104 ? 78.527  -9.712  -21.373 1.000 33.628  ? 6899 ASN C ND2   1 
ATOM   4254 N  N     . ASP C  1 105 ? 76.879  -7.046  -16.648 1.000 32.206  ? 6900 ASP C N     1 
ATOM   4255 C  CA    . ASP C  1 105 ? 76.168  -7.013  -15.345 1.000 33.123  ? 6900 ASP C CA    1 
ATOM   4256 C  C     . ASP C  1 105 ? 75.288  -8.264  -15.219 1.000 30.872  ? 6900 ASP C C     1 
ATOM   4257 O  O     . ASP C  1 105 ? 74.829  -8.802  -16.255 1.000 29.702  ? 6900 ASP C O     1 
ATOM   4258 C  CB    . ASP C  1 105 ? 75.343  -5.733  -15.183 1.000 37.769  ? 6900 ASP C CB    1 
ATOM   4259 C  CG    . ASP C  1 105 ? 74.995  -5.414  -13.736 1.000 40.710  ? 6900 ASP C CG    1 
ATOM   4260 O  OD1   . ASP C  1 105 ? 75.450  -6.155  -12.834 1.000 41.764  ? 6900 ASP C OD1   1 
ATOM   4261 O  OD2   . ASP C  1 105 ? 74.296  -4.409  -13.516 1.000 50.454  ? 6900 ASP C OD2   1 
ATOM   4262 N  N     . PHE C  1 106 ? 75.098  -8.722  -13.987 1.000 28.639  ? 6901 PHE C N     1 
ATOM   4263 C  CA    . PHE C  1 106 ? 74.257  -9.910  -13.707 1.000 28.256  ? 6901 PHE C CA    1 
ATOM   4264 C  C     . PHE C  1 106 ? 73.911  -9.900  -12.219 1.000 28.261  ? 6901 PHE C C     1 
ATOM   4265 O  O     . PHE C  1 106 ? 74.540  -9.143  -11.470 1.000 28.864  ? 6901 PHE C O     1 
ATOM   4266 C  CB    . PHE C  1 106 ? 74.981  -11.201 -14.108 1.000 26.278  ? 6901 PHE C CB    1 
ATOM   4267 C  CG    . PHE C  1 106 ? 76.240  -11.489 -13.331 1.000 24.967  ? 6901 PHE C CG    1 
ATOM   4268 C  CD1   . PHE C  1 106 ? 77.422  -10.831 -13.625 1.000 24.779  ? 6901 PHE C CD1   1 
ATOM   4269 C  CD2   . PHE C  1 106 ? 76.251  -12.440 -12.322 1.000 24.462  ? 6901 PHE C CD2   1 
ATOM   4270 C  CE1   . PHE C  1 106 ? 78.580  -11.099 -12.912 1.000 24.626  ? 6901 PHE C CE1   1 
ATOM   4271 C  CE2   . PHE C  1 106 ? 77.417  -12.727 -11.630 1.000 23.954  ? 6901 PHE C CE2   1 
ATOM   4272 C  CZ    . PHE C  1 106 ? 78.579  -12.057 -11.924 1.000 24.189  ? 6901 PHE C CZ    1 
ATOM   4273 N  N     . VAL C  1 107 ? 72.934  -10.712 -11.837 1.000 28.411  ? 6902 VAL C N     1 
ATOM   4274 C  CA    . VAL C  1 107 ? 72.444  -10.856 -10.433 1.000 29.949  ? 6902 VAL C CA    1 
ATOM   4275 C  C     . VAL C  1 107 ? 73.157  -12.076 -9.846  1.000 27.132  ? 6902 VAL C C     1 
ATOM   4276 O  O     . VAL C  1 107 ? 73.076  -13.119 -10.484 1.000 24.984  ? 6902 VAL C O     1 
ATOM   4277 C  CB    . VAL C  1 107 ? 70.911  -11.020 -10.451 1.000 32.127  ? 6902 VAL C CB    1 
ATOM   4278 C  CG1   . VAL C  1 107 ? 70.347  -11.447 -9.112  1.000 33.886  ? 6902 VAL C CG1   1 
ATOM   4279 C  CG2   . VAL C  1 107 ? 70.239  -9.759  -10.958 1.000 35.358  ? 6902 VAL C CG2   1 
ATOM   4280 N  N     . SER C  1 108 ? 73.754  -11.954 -8.656  1.000 26.357  ? 6903 SER C N     1 
ATOM   4281 C  CA    . SER C  1 108 ? 74.586  -13.045 -8.090  1.000 25.922  ? 6903 SER C CA    1 
ATOM   4282 C  C     . SER C  1 108 ? 74.321  -13.315 -6.605  1.000 25.485  ? 6903 SER C C     1 
ATOM   4283 O  O     . SER C  1 108 ? 73.911  -12.395 -5.884  1.000 25.668  ? 6903 SER C O     1 
ATOM   4284 C  CB    . SER C  1 108 ? 76.039  -12.689 -8.275  1.000 26.439  ? 6903 SER C CB    1 
ATOM   4285 O  OG    . SER C  1 108 ? 76.882  -13.656 -7.686  1.000 25.239  ? 6903 SER C OG    1 
ATOM   4286 N  N     . ASP C  1 109 ? 74.661  -14.532 -6.179  1.000 24.010  ? 6904 ASP C N     1 
ATOM   4287 C  CA    . ASP C  1 109 ? 74.573  -14.974 -4.764  1.000 24.527  ? 6904 ASP C CA    1 
ATOM   4288 C  C     . ASP C  1 109 ? 75.957  -14.825 -4.120  1.000 24.326  ? 6904 ASP C C     1 
ATOM   4289 O  O     . ASP C  1 109 ? 76.094  -15.159 -2.934  1.000 24.449  ? 6904 ASP C O     1 
ATOM   4290 C  CB    . ASP C  1 109 ? 74.046  -16.406 -4.682  1.000 24.851  ? 6904 ASP C CB    1 
ATOM   4291 C  CG    . ASP C  1 109 ? 72.573  -16.514 -5.045  1.000 26.139  ? 6904 ASP C CG    1 
ATOM   4292 O  OD1   . ASP C  1 109 ? 71.754  -15.861 -4.355  1.000 25.645  ? 6904 ASP C OD1   1 
ATOM   4293 O  OD2   . ASP C  1 109 ? 72.263  -17.200 -6.053  1.000 27.264  ? 6904 ASP C OD2   1 
ATOM   4294 N  N     . ALA C  1 110 ? 76.947  -14.332 -4.872  1.000 23.186  ? 6905 ALA C N     1 
ATOM   4295 C  CA    . ALA C  1 110 ? 78.306  -14.173 -4.303  1.000 23.253  ? 6905 ALA C CA    1 
ATOM   4296 C  C     . ALA C  1 110 ? 78.312  -13.057 -3.249  1.000 23.577  ? 6905 ALA C C     1 
ATOM   4297 O  O     . ALA C  1 110 ? 77.406  -12.198 -3.266  1.000 23.390  ? 6905 ALA C O     1 
ATOM   4298 C  CB    . ALA C  1 110 ? 79.307  -13.887 -5.401  1.000 23.291  ? 6905 ALA C CB    1 
ATOM   4299 N  N     . ASP C  1 111 ? 79.299  -13.099 -2.356  1.000 23.782  ? 6906 ASP C N     1 
ATOM   4300 C  CA    . ASP C  1 111 ? 79.498  -12.069 -1.302  1.000 25.527  ? 6906 ASP C CA    1 
ATOM   4301 C  C     . ASP C  1 111 ? 79.771  -10.722 -1.978  1.000 26.237  ? 6906 ASP C C     1 
ATOM   4302 O  O     . ASP C  1 111 ? 79.303  -9.704  -1.465  1.000 26.677  ? 6906 ASP C O     1 
ATOM   4303 C  CB    . ASP C  1 111 ? 80.631  -12.494 -0.365  1.000 25.707  ? 6906 ASP C CB    1 
ATOM   4304 C  CG    . ASP C  1 111 ? 80.272  -13.746 0.416   1.000 26.225  ? 6906 ASP C CG    1 
ATOM   4305 O  OD1   . ASP C  1 111 ? 79.235  -13.724 1.082   1.000 28.863  ? 6906 ASP C OD1   1 
ATOM   4306 O  OD2   . ASP C  1 111 ? 80.955  -14.771 0.247   1.000 25.455  ? 6906 ASP C OD2   1 
ATOM   4307 N  N     . SER C  1 112 ? 80.483  -10.739 -3.105  1.000 25.390  ? 6907 SER C N     1 
ATOM   4308 C  CA    . SER C  1 112 ? 80.793  -9.508  -3.878  1.000 26.744  ? 6907 SER C CA    1 
ATOM   4309 C  C     . SER C  1 112 ? 80.863  -9.859  -5.359  1.000 25.287  ? 6907 SER C C     1 
ATOM   4310 O  O     . SER C  1 112 ? 81.320  -10.978 -5.685  1.000 23.322  ? 6907 SER C O     1 
ATOM   4311 C  CB    . SER C  1 112 ? 82.073  -8.851  -3.429  1.000 29.234  ? 6907 SER C CB    1 
ATOM   4312 O  OG    . SER C  1 112 ? 81.957  -8.356  -2.110  1.000 33.477  ? 6907 SER C OG    1 
ATOM   4313 N  N     . THR C  1 113 ? 80.408  -8.936  -6.201  1.000 25.678  ? 6908 THR C N     1 
ATOM   4314 C  CA    . THR C  1 113 ? 80.384  -9.125  -7.673  1.000 26.039  ? 6908 THR C CA    1 
ATOM   4315 C  C     . THR C  1 113 ? 81.082  -7.938  -8.338  1.000 27.468  ? 6908 THR C C     1 
ATOM   4316 O  O     . THR C  1 113 ? 80.720  -6.799  -7.997  1.000 27.256  ? 6908 THR C O     1 
ATOM   4317 C  CB    . THR C  1 113 ? 78.936  -9.283  -8.150  1.000 26.922  ? 6908 THR C CB    1 
ATOM   4318 O  OG1   . THR C  1 113 ? 78.420  -10.465 -7.537  1.000 26.165  ? 6908 THR C OG1   1 
ATOM   4319 C  CG2   . THR C  1 113 ? 78.808  -9.385  -9.653  1.000 27.700  ? 6908 THR C CG2   1 
ATOM   4320 N  N     . LEU C  1 114 ? 82.070  -8.204  -9.199  1.000 27.458  ? 6909 LEU C N     1 
ATOM   4321 C  CA    . LEU C  1 114 ? 82.789  -7.134  -9.947  1.000 29.352  ? 6909 LEU C CA    1 
ATOM   4322 C  C     . LEU C  1 114 ? 82.401  -7.217  -11.424 1.000 28.690  ? 6909 LEU C C     1 
ATOM   4323 O  O     . LEU C  1 114 ? 82.571  -8.298  -12.028 1.000 26.979  ? 6909 LEU C O     1 
ATOM   4324 C  CB    . LEU C  1 114 ? 84.300  -7.311  -9.792  1.000 31.761  ? 6909 LEU C CB    1 
ATOM   4325 C  CG    . LEU C  1 114 ? 84.841  -7.167  -8.373  1.000 35.022  ? 6909 LEU C CG    1 
ATOM   4326 C  CD1   . LEU C  1 114 ? 86.346  -7.356  -8.364  1.000 38.508  ? 6909 LEU C CD1   1 
ATOM   4327 C  CD2   . LEU C  1 114 ? 84.488  -5.814  -7.793  1.000 36.655  ? 6909 LEU C CD2   1 
ATOM   4328 N  N     . ILE C  1 115 ? 81.946  -6.103  -11.992 1.000 28.731  ? 6910 ILE C N     1 
ATOM   4329 C  CA    . ILE C  1 115 ? 81.533  -6.085  -13.421 1.000 28.836  ? 6910 ILE C CA    1 
ATOM   4330 C  C     . ILE C  1 115 ? 82.623  -5.387  -14.230 1.000 30.281  ? 6910 ILE C C     1 
ATOM   4331 O  O     . ILE C  1 115 ? 82.987  -4.245  -13.874 1.000 31.013  ? 6910 ILE C O     1 
ATOM   4332 C  CB    . ILE C  1 115 ? 80.168  -5.392  -13.598 1.000 30.439  ? 6910 ILE C CB    1 
ATOM   4333 C  CG1   . ILE C  1 115 ? 79.088  -6.030  -12.724 1.000 29.654  ? 6910 ILE C CG1   1 
ATOM   4334 C  CG2   . ILE C  1 115 ? 79.770  -5.350  -15.069 1.000 31.590  ? 6910 ILE C CG2   1 
ATOM   4335 C  CD1   . ILE C  1 115 ? 78.946  -7.521  -12.915 1.000 28.622  ? 6910 ILE C CD1   1 
ATOM   4336 N  N     . GLY C  1 116 ? 83.050  -6.021  -15.321 1.000 29.136  ? 6911 GLY C N     1 
ATOM   4337 C  CA    . GLY C  1 116 ? 84.070  -5.442  -16.212 1.000 30.141  ? 6911 GLY C CA    1 
ATOM   4338 C  C     . GLY C  1 116 ? 85.023  -6.504  -16.723 1.000 29.678  ? 6911 GLY C C     1 
ATOM   4339 O  O     . GLY C  1 116 ? 84.913  -7.675  -16.295 1.000 26.768  ? 6911 GLY C O     1 
ATOM   4340 N  N     . ASP C  1 117 ? 85.895  -6.110  -17.641 1.000 30.229  ? 6912 ASP C N     1 
ATOM   4341 C  CA    . ASP C  1 117 ? 86.927  -7.022  -18.185 1.000 30.766  ? 6912 ASP C CA    1 
ATOM   4342 C  C     . ASP C  1 117 ? 87.737  -7.550  -16.996 1.000 30.035  ? 6912 ASP C C     1 
ATOM   4343 O  O     . ASP C  1 117 ? 88.082  -6.738  -16.114 1.000 29.157  ? 6912 ASP C O     1 
ATOM   4344 C  CB    . ASP C  1 117 ? 87.761  -6.270  -19.220 1.000 33.267  ? 6912 ASP C CB    1 
ATOM   4345 C  CG    . ASP C  1 117 ? 88.757  -7.114  -19.988 1.000 34.658  ? 6912 ASP C CG    1 
ATOM   4346 O  OD1   . ASP C  1 117 ? 89.172  -8.164  -19.483 1.000 33.264  ? 6912 ASP C OD1   1 
ATOM   4347 O  OD2   . ASP C  1 117 ? 89.105  -6.700  -21.093 1.000 42.290  ? 6912 ASP C OD2   1 
ATOM   4348 N  N     . CYS C  1 118 ? 88.004  -8.858  -16.950 1.000 27.937  ? 6913 CYS C N     1 
ATOM   4349 C  CA    . CYS C  1 118 ? 88.787  -9.402  -15.810 1.000 28.564  ? 6913 CYS C CA    1 
ATOM   4350 C  C     . CYS C  1 118 ? 90.132  -8.668  -15.704 1.000 28.932  ? 6913 CYS C C     1 
ATOM   4351 O  O     . CYS C  1 118 ? 90.659  -8.576  -14.592 1.000 29.156  ? 6913 CYS C O     1 
ATOM   4352 C  CB    . CYS C  1 118 ? 89.000  -10.902 -15.951 1.000 29.040  ? 6913 CYS C CB    1 
ATOM   4353 S  SG    . CYS C  1 118 ? 89.921  -11.336 -17.446 1.000 29.320  ? 6913 CYS C SG    1 
ATOM   4354 N  N     . ALA C  1 119 ? 90.622  -8.101  -16.807 1.000 29.403  ? 6914 ALA C N     1 
ATOM   4355 C  CA    . ALA C  1 119 ? 91.924  -7.389  -16.804 1.000 30.901  ? 6914 ALA C CA    1 
ATOM   4356 C  C     . ALA C  1 119 ? 91.867  -6.140  -15.909 1.000 31.613  ? 6914 ALA C C     1 
ATOM   4357 O  O     . ALA C  1 119 ? 92.943  -5.620  -15.574 1.000 32.260  ? 6914 ALA C O     1 
ATOM   4358 C  CB    . ALA C  1 119 ? 92.312  -7.028  -18.214 1.000 32.266  ? 6914 ALA C CB    1 
ATOM   4359 N  N     . THR C  1 120 ? 90.663  -5.689  -15.539 1.000 30.928  ? 6915 THR C N     1 
ATOM   4360 C  CA    . THR C  1 120 ? 90.481  -4.481  -14.687 1.000 32.161  ? 6915 THR C CA    1 
ATOM   4361 C  C     . THR C  1 120 ? 90.352  -4.889  -13.212 1.000 32.036  ? 6915 THR C C     1 
ATOM   4362 O  O     . THR C  1 120 ? 90.255  -3.985  -12.357 1.000 33.377  ? 6915 THR C O     1 
ATOM   4363 C  CB    . THR C  1 120 ? 89.234  -3.692  -15.107 1.000 32.421  ? 6915 THR C CB    1 
ATOM   4364 O  OG1   . THR C  1 120 ? 88.084  -4.470  -14.774 1.000 31.185  ? 6915 THR C OG1   1 
ATOM   4365 C  CG2   . THR C  1 120 ? 89.222  -3.331  -16.577 1.000 33.911  ? 6915 THR C CG2   1 
ATOM   4366 N  N     . VAL C  1 121 ? 90.382  -6.192  -12.925 1.000 31.101  ? 6916 VAL C N     1 
ATOM   4367 C  CA    . VAL C  1 121 ? 90.199  -6.690  -11.528 1.000 31.290  ? 6916 VAL C CA    1 
ATOM   4368 C  C     . VAL C  1 121 ? 91.543  -6.682  -10.802 1.000 32.377  ? 6916 VAL C C     1 
ATOM   4369 O  O     . VAL C  1 121 ? 92.504  -7.297  -11.317 1.000 32.446  ? 6916 VAL C O     1 
ATOM   4370 C  CB    . VAL C  1 121 ? 89.542  -8.083  -11.513 1.000 30.658  ? 6916 VAL C CB    1 
ATOM   4371 C  CG1   . VAL C  1 121 ? 89.558  -8.711  -10.129 1.000 30.628  ? 6916 VAL C CG1   1 
ATOM   4372 C  CG2   . VAL C  1 121 ? 88.121  -8.026  -12.064 1.000 30.902  ? 6916 VAL C CG2   1 
ATOM   4373 N  N     . HIS C  1 122 ? 91.592  -5.980  -9.667  1.000 33.717  ? 6917 HIS C N     1 
ATOM   4374 C  CA    . HIS C  1 122 ? 92.795  -5.910  -8.798  1.000 36.424  ? 6917 HIS C CA    1 
ATOM   4375 C  C     . HIS C  1 122 ? 92.454  -6.467  -7.417  1.000 35.430  ? 6917 HIS C C     1 
ATOM   4376 O  O     . HIS C  1 122 ? 91.294  -6.303  -6.974  1.000 33.761  ? 6917 HIS C O     1 
ATOM   4377 C  CB    . HIS C  1 122 ? 93.308  -4.476  -8.621  1.000 43.462  ? 6917 HIS C CB    1 
ATOM   4378 C  CG    . HIS C  1 122 ? 93.757  -3.822  -9.878  1.000 50.197  ? 6917 HIS C CG    1 
ATOM   4379 N  ND1   . HIS C  1 122 ? 94.891  -4.230  -10.558 1.000 56.562  ? 6917 HIS C ND1   1 
ATOM   4380 C  CD2   . HIS C  1 122 ? 93.276  -2.751  -10.540 1.000 56.661  ? 6917 HIS C CD2   1 
ATOM   4381 C  CE1   . HIS C  1 122 ? 95.068  -3.456  -11.611 1.000 61.355  ? 6917 HIS C CE1   1 
ATOM   4382 N  NE2   . HIS C  1 122 ? 94.090  -2.537  -11.619 1.000 60.958  ? 6917 HIS C NE2   1 
ATOM   4383 N  N     . THR C  1 123 ? 93.436  -7.099  -6.780  1.000 33.206  ? 6918 THR C N     1 
ATOM   4384 C  CA    . THR C  1 123 ? 93.291  -7.624  -5.402  1.000 32.693  ? 6918 THR C CA    1 
ATOM   4385 C  C     . THR C  1 123 ? 94.661  -7.540  -4.737  1.000 32.909  ? 6918 THR C C     1 
ATOM   4386 O  O     . THR C  1 123 ? 95.662  -7.761  -5.431  1.000 33.785  ? 6918 THR C O     1 
ATOM   4387 C  CB    . THR C  1 123 ? 92.753  -9.061  -5.354  1.000 30.843  ? 6918 THR C CB    1 
ATOM   4388 O  OG1   . THR C  1 123 ? 92.660  -9.431  -3.976  1.000 30.714  ? 6918 THR C OG1   1 
ATOM   4389 C  CG2   . THR C  1 123 ? 93.637  -10.059 -6.067  1.000 30.234  ? 6918 THR C CG2   1 
ATOM   4390 N  N     . ALA C  1 124 ? 94.687  -7.164  -3.464  1.000 34.564  ? 6919 ALA C N     1 
ATOM   4391 C  CA    . ALA C  1 124 ? 95.945  -7.128  -2.691  1.000 35.554  ? 6919 ALA C CA    1 
ATOM   4392 C  C     . ALA C  1 124 ? 96.106  -8.470  -1.960  1.000 34.599  ? 6919 ALA C C     1 
ATOM   4393 O  O     . ALA C  1 124 ? 97.076  -8.613  -1.207  1.000 36.231  ? 6919 ALA C O     1 
ATOM   4394 C  CB    . ALA C  1 124 ? 95.895  -5.980  -1.714  1.000 37.950  ? 6919 ALA C CB    1 
ATOM   4395 N  N     . ASN C  1 125 ? 95.209  -9.432  -2.209  1.000 31.823  ? 6920 ASN C N     1 
ATOM   4396 C  CA    . ASN C  1 125 ? 95.263  -10.701 -1.434  1.000 31.288  ? 6920 ASN C CA    1 
ATOM   4397 C  C     . ASN C  1 125 ? 95.501  -11.920 -2.312  1.000 29.762  ? 6920 ASN C C     1 
ATOM   4398 O  O     . ASN C  1 125 ? 95.306  -11.828 -3.542  1.000 28.393  ? 6920 ASN C O     1 
ATOM   4399 C  CB    . ASN C  1 125 ? 93.957  -10.959 -0.692  1.000 30.996  ? 6920 ASN C CB    1 
ATOM   4400 C  CG    . ASN C  1 125 ? 93.491  -9.728  0.043   1.000 33.763  ? 6920 ASN C CG    1 
ATOM   4401 O  OD1   . ASN C  1 125 ? 92.891  -8.840  -0.561  1.000 35.006  ? 6920 ASN C OD1   1 
ATOM   4402 N  ND2   . ASN C  1 125 ? 93.747  -9.681  1.339   1.000 33.262  ? 6920 ASN C ND2   1 
ATOM   4403 N  N     . LYS C  1 126 ? 95.919  -13.010 -1.664  1.000 29.163  ? 6921 LYS C N     1 
ATOM   4404 C  CA    . LYS C  1 126 ? 96.080  -14.327 -2.329  1.000 28.844  ? 6921 LYS C CA    1 
ATOM   4405 C  C     . LYS C  1 126 ? 94.778  -15.106 -2.105  1.000 26.503  ? 6921 LYS C C     1 
ATOM   4406 O  O     . LYS C  1 126 ? 94.153  -14.937 -1.035  1.000 25.996  ? 6921 LYS C O     1 
ATOM   4407 C  CB    . LYS C  1 126 ? 97.346  -15.030 -1.834  1.000 31.463  ? 6921 LYS C CB    1 
ATOM   4408 C  CG    . LYS C  1 126 ? 98.635  -14.415 -2.373  1.000 34.315  ? 6921 LYS C CG    1 
ATOM   4409 C  CD    . LYS C  1 126 ? 99.889  -15.104 -1.915  1.000 37.814  ? 6921 LYS C CD    1 
ATOM   4410 C  CE    . LYS C  1 126 ? 101.159 -14.408 -2.363  1.000 38.774  ? 6921 LYS C CE    1 
ATOM   4411 N  NZ    . LYS C  1 126 ? 101.370 -14.515 -3.824  1.000 40.176  ? 6921 LYS C NZ    1 
ATOM   4412 N  N     . TRP C  1 127 ? 94.377  -15.898 -3.103  1.000 24.642  ? 6922 TRP C N     1 
ATOM   4413 C  CA    . TRP C  1 127 ? 93.112  -16.675 -3.082  1.000 23.153  ? 6922 TRP C CA    1 
ATOM   4414 C  C     . TRP C  1 127 ? 93.401  -18.179 -2.949  1.000 22.386  ? 6922 TRP C C     1 
ATOM   4415 O  O     . TRP C  1 127 ? 94.513  -18.614 -3.275  1.000 23.431  ? 6922 TRP C O     1 
ATOM   4416 C  CB    . TRP C  1 127 ? 92.296  -16.286 -4.324  1.000 22.819  ? 6922 TRP C CB    1 
ATOM   4417 C  CG    . TRP C  1 127 ? 91.912  -14.843 -4.250  1.000 23.364  ? 6922 TRP C CG    1 
ATOM   4418 C  CD1   . TRP C  1 127 ? 92.733  -13.765 -4.435  1.000 24.354  ? 6922 TRP C CD1   1 
ATOM   4419 C  CD2   . TRP C  1 127 ? 90.635  -14.311 -3.859  1.000 23.265  ? 6922 TRP C CD2   1 
ATOM   4420 N  NE1   . TRP C  1 127 ? 92.051  -12.603 -4.201  1.000 25.038  ? 6922 TRP C NE1   1 
ATOM   4421 C  CE2   . TRP C  1 127 ? 90.761  -12.906 -3.850  1.000 23.935  ? 6922 TRP C CE2   1 
ATOM   4422 C  CE3   . TRP C  1 127 ? 89.396  -14.878 -3.542  1.000 22.510  ? 6922 TRP C CE3   1 
ATOM   4423 C  CZ2   . TRP C  1 127 ? 89.699  -12.069 -3.525  1.000 24.509  ? 6922 TRP C CZ2   1 
ATOM   4424 C  CZ3   . TRP C  1 127 ? 88.349  -14.048 -3.217  1.000 23.352  ? 6922 TRP C CZ3   1 
ATOM   4425 C  CH2   . TRP C  1 127 ? 88.502  -12.663 -3.200  1.000 24.155  ? 6922 TRP C CH2   1 
ATOM   4426 N  N     . ASP C  1 128 ? 92.410  -18.946 -2.502  1.000 21.589  ? 6923 ASP C N     1 
ATOM   4427 C  CA    . ASP C  1 128 ? 92.577  -20.395 -2.213  1.000 21.435  ? 6923 ASP C CA    1 
ATOM   4428 C  C     . ASP C  1 128 ? 92.052  -21.245 -3.373  1.000 20.516  ? 6923 ASP C C     1 
ATOM   4429 O  O     . ASP C  1 128 ? 92.513  -22.397 -3.535  1.000 20.621  ? 6923 ASP C O     1 
ATOM   4430 C  CB    . ASP C  1 128 ? 91.869  -20.716 -0.899  1.000 21.469  ? 6923 ASP C CB    1 
ATOM   4431 C  CG    . ASP C  1 128 ? 92.404  -19.889 0.256   1.000 22.384  ? 6923 ASP C CG    1 
ATOM   4432 O  OD1   . ASP C  1 128 ? 93.630  -19.631 0.273   1.000 22.528  ? 6923 ASP C OD1   1 
ATOM   4433 O  OD2   . ASP C  1 128 ? 91.587  -19.474 1.107   1.000 22.463  ? 6923 ASP C OD2   1 
ATOM   4434 N  N     . LEU C  1 129 ? 91.128  -20.692 -4.149  1.000 19.737  ? 6924 LEU C N     1 
ATOM   4435 C  CA    . LEU C  1 129 ? 90.525  -21.444 -5.275  1.000 19.399  ? 6924 LEU C CA    1 
ATOM   4436 C  C     . LEU C  1 129 ? 90.085  -20.456 -6.352  1.000 19.433  ? 6924 LEU C C     1 
ATOM   4437 O  O     . LEU C  1 129 ? 89.425  -19.435 -6.008  1.000 18.700  ? 6924 LEU C O     1 
ATOM   4438 C  CB    . LEU C  1 129 ? 89.333  -22.248 -4.757  1.000 19.540  ? 6924 LEU C CB    1 
ATOM   4439 C  CG    . LEU C  1 129 ? 88.590  -23.081 -5.799  1.000 19.973  ? 6924 LEU C CG    1 
ATOM   4440 C  CD1   . LEU C  1 129 ? 89.482  -24.182 -6.359  1.000 20.713  ? 6924 LEU C CD1   1 
ATOM   4441 C  CD2   . LEU C  1 129 ? 87.326  -23.677 -5.199  1.000 20.127  ? 6924 LEU C CD2   1 
ATOM   4442 N  N     . ILE C  1 130 ? 90.497  -20.724 -7.587  1.000 19.780  ? 6925 ILE C N     1 
ATOM   4443 C  CA    . ILE C  1 130 ? 90.091  -19.884 -8.746  1.000 20.106  ? 6925 ILE C CA    1 
ATOM   4444 C  C     . ILE C  1 130 ? 89.257  -20.743 -9.685  1.000 19.935  ? 6925 ILE C C     1 
ATOM   4445 O  O     . ILE C  1 130 ? 89.747  -21.816 -10.101 1.000 19.745  ? 6925 ILE C O     1 
ATOM   4446 C  CB    . ILE C  1 130 ? 91.303  -19.314 -9.497  1.000 21.082  ? 6925 ILE C CB    1 
ATOM   4447 C  CG1   . ILE C  1 130 ? 92.233  -18.528 -8.574  1.000 22.479  ? 6925 ILE C CG1   1 
ATOM   4448 C  CG2   . ILE C  1 130 ? 90.831  -18.473 -10.682 1.000 21.774  ? 6925 ILE C CG2   1 
ATOM   4449 C  CD1   . ILE C  1 130 ? 93.588  -18.248 -9.193  1.000 24.057  ? 6925 ILE C CD1   1 
ATOM   4450 N  N     . ILE C  1 131 ? 88.039  -20.291 -9.971  1.000 19.809  ? 6926 ILE C N     1 
ATOM   4451 C  CA    . ILE C  1 131 ? 87.168  -20.965 -10.967 1.000 19.768  ? 6926 ILE C CA    1 
ATOM   4452 C  C     . ILE C  1 131 ? 86.965  -19.979 -12.116 1.000 20.246  ? 6926 ILE C C     1 
ATOM   4453 O  O     . ILE C  1 131 ? 86.658  -18.787 -11.833 1.000 21.220  ? 6926 ILE C O     1 
ATOM   4454 C  CB    . ILE C  1 131 ? 85.814  -21.395 -10.372 1.000 19.746  ? 6926 ILE C CB    1 
ATOM   4455 C  CG1   . ILE C  1 131 ? 85.963  -22.216 -9.088  1.000 19.892  ? 6926 ILE C CG1   1 
ATOM   4456 C  CG2   . ILE C  1 131 ? 85.000  -22.136 -11.424 1.000 20.132  ? 6926 ILE C CG2   1 
ATOM   4457 C  CD1   . ILE C  1 131 ? 86.694  -23.524 -9.273  1.000 20.383  ? 6926 ILE C CD1   1 
ATOM   4458 N  N     . SER C  1 132 ? 87.175  -20.434 -13.353 1.000 20.492  ? 6927 SER C N     1 
ATOM   4459 C  CA    . SER C  1 132 ? 86.904  -19.563 -14.522 1.000 20.105  ? 6927 SER C CA    1 
ATOM   4460 C  C     . SER C  1 132 ? 86.041  -20.291 -15.557 1.000 20.006  ? 6927 SER C C     1 
ATOM   4461 O  O     . SER C  1 132 ? 86.383  -21.432 -15.947 1.000 19.799  ? 6927 SER C O     1 
ATOM   4462 C  CB    . SER C  1 132 ? 88.168  -19.052 -15.169 1.000 20.875  ? 6927 SER C CB    1 
ATOM   4463 O  OG    . SER C  1 132 ? 87.855  -18.350 -16.375 1.000 21.142  ? 6927 SER C OG    1 
ATOM   4464 N  N     . ASP C  1 133 ? 84.971  -19.623 -15.989 1.000 20.361  ? 6928 ASP C N     1 
ATOM   4465 C  CA    . ASP C  1 133 ? 84.112  -20.113 -17.090 1.000 21.412  ? 6928 ASP C CA    1 
ATOM   4466 C  C     . ASP C  1 133 ? 84.155  -19.039 -18.180 1.000 21.332  ? 6928 ASP C C     1 
ATOM   4467 O  O     . ASP C  1 133 ? 83.264  -19.026 -19.036 1.000 22.391  ? 6928 ASP C O     1 
ATOM   4468 C  CB    . ASP C  1 133 ? 82.689  -20.419 -16.623 1.000 22.562  ? 6928 ASP C CB    1 
ATOM   4469 C  CG    . ASP C  1 133 ? 81.920  -21.281 -17.608 1.000 24.452  ? 6928 ASP C CG    1 
ATOM   4470 O  OD1   . ASP C  1 133 ? 82.571  -22.126 -18.273 1.000 24.869  ? 6928 ASP C OD1   1 
ATOM   4471 O  OD2   . ASP C  1 133 ? 80.681  -21.100 -17.713 1.000 26.851  ? 6928 ASP C OD2   1 
ATOM   4472 N  N     . MET C  1 134 ? 85.153  -18.148 -18.124 1.000 21.519  ? 6929 MET C N     1 
ATOM   4473 C  CA    . MET C  1 134 ? 85.264  -17.101 -19.166 1.000 22.469  ? 6929 MET C CA    1 
ATOM   4474 C  C     . MET C  1 134 ? 85.380  -17.753 -20.545 1.000 22.791  ? 6929 MET C C     1 
ATOM   4475 O  O     . MET C  1 134 ? 86.119  -18.746 -20.709 1.000 20.995  ? 6929 MET C O     1 
ATOM   4476 C  CB    . MET C  1 134 ? 86.433  -16.143 -18.921 1.000 22.803  ? 6929 MET C CB    1 
ATOM   4477 C  CG    . MET C  1 134 ? 86.151  -15.211 -17.755 1.000 22.890  ? 6929 MET C CG    1 
ATOM   4478 S  SD    . MET C  1 134 ? 87.399  -13.938 -17.505 1.000 23.678  ? 6929 MET C SD    1 
ATOM   4479 C  CE    . MET C  1 134 ? 88.804  -14.928 -16.998 1.000 22.668  ? 6929 MET C CE    1 
ATOM   4480 N  N     . TYR C  1 135 ? 84.659  -17.172 -21.496 1.000 24.449  ? 6930 TYR C N     1 
ATOM   4481 C  CA    . TYR C  1 135 ? 84.604  -17.695 -22.875 1.000 26.415  ? 6930 TYR C CA    1 
ATOM   4482 C  C     . TYR C  1 135 ? 84.031  -16.605 -23.781 1.000 28.793  ? 6930 TYR C C     1 
ATOM   4483 O  O     . TYR C  1 135 ? 83.103  -15.891 -23.372 1.000 26.914  ? 6930 TYR C O     1 
ATOM   4484 C  CB    . TYR C  1 135 ? 83.753  -18.966 -22.907 1.000 26.692  ? 6930 TYR C CB    1 
ATOM   4485 C  CG    . TYR C  1 135 ? 83.611  -19.602 -24.265 1.000 28.696  ? 6930 TYR C CG    1 
ATOM   4486 C  CD1   . TYR C  1 135 ? 84.659  -20.306 -24.832 1.000 29.123  ? 6930 TYR C CD1   1 
ATOM   4487 C  CD2   . TYR C  1 135 ? 82.417  -19.540 -24.966 1.000 31.948  ? 6930 TYR C CD2   1 
ATOM   4488 C  CE1   . TYR C  1 135 ? 84.544  -20.904 -26.076 1.000 30.664  ? 6930 TYR C CE1   1 
ATOM   4489 C  CE2   . TYR C  1 135 ? 82.286  -20.124 -26.219 1.000 34.225  ? 6930 TYR C CE2   1 
ATOM   4490 C  CZ    . TYR C  1 135 ? 83.352  -20.817 -26.771 1.000 33.383  ? 6930 TYR C CZ    1 
ATOM   4491 O  OH    . TYR C  1 135 ? 83.234  -21.408 -27.996 1.000 34.957  ? 6930 TYR C OH    1 
ATOM   4492 N  N     . ASP C  1 136 ? 84.602  -16.484 -24.970 1.000 32.242  ? 6931 ASP C N     1 
ATOM   4493 C  CA    . ASP C  1 136 ? 84.115  -15.500 -25.970 1.000 37.521  ? 6931 ASP C CA    1 
ATOM   4494 C  C     . ASP C  1 136 ? 83.750  -16.310 -27.211 1.000 39.790  ? 6931 ASP C C     1 
ATOM   4495 O  O     . ASP C  1 136 ? 84.634  -16.786 -27.910 1.000 41.211  ? 6931 ASP C O     1 
ATOM   4496 C  CB    . ASP C  1 136 ? 85.175  -14.424 -26.197 1.000 40.360  ? 6931 ASP C CB    1 
ATOM   4497 C  CG    . ASP C  1 136 ? 84.718  -13.281 -27.086 1.000 45.788  ? 6931 ASP C CG    1 
ATOM   4498 O  OD1   . ASP C  1 136 ? 83.553  -13.320 -27.558 1.000 45.764  ? 6931 ASP C OD1   1 
ATOM   4499 O  OD2   . ASP C  1 136 ? 85.529  -12.355 -27.285 1.000 47.470  ? 6931 ASP C OD2   1 
ATOM   4500 N  N     . PRO C  1 137 ? 82.449  -16.547 -27.488 1.000 54.538  ? 6932 PRO C N     1 
ATOM   4501 C  CA    . PRO C  1 137 ? 82.039  -17.342 -28.650 1.000 61.302  ? 6932 PRO C CA    1 
ATOM   4502 C  C     . PRO C  1 137 ? 82.728  -16.975 -29.979 1.000 64.932  ? 6932 PRO C C     1 
ATOM   4503 O  O     . PRO C  1 137 ? 83.064  -17.887 -30.714 1.000 69.949  ? 6932 PRO C O     1 
ATOM   4504 C  CB    . PRO C  1 137 ? 80.530  -17.064 -28.758 1.000 62.050  ? 6932 PRO C CB    1 
ATOM   4505 C  CG    . PRO C  1 137 ? 80.106  -16.727 -27.340 1.000 61.332  ? 6932 PRO C CG    1 
ATOM   4506 C  CD    . PRO C  1 137 ? 81.303  -16.034 -26.721 1.000 56.659  ? 6932 PRO C CD    1 
ATOM   4507 N  N     . LYS C  1 138 ? 82.942  -15.679 -30.249 1.000 68.418  ? 6933 LYS C N     1 
ATOM   4508 C  CA    . LYS C  1 138 ? 83.581  -15.253 -31.530 1.000 74.443  ? 6933 LYS C CA    1 
ATOM   4509 C  C     . LYS C  1 138 ? 85.026  -15.768 -31.589 1.000 74.476  ? 6933 LYS C C     1 
ATOM   4510 O  O     . LYS C  1 138 ? 85.623  -15.940 -30.506 1.000 76.815  ? 6933 LYS C O     1 
ATOM   4511 C  CB    . LYS C  1 138 ? 83.542  -13.729 -31.707 1.000 79.520  ? 6933 LYS C CB    1 
ATOM   4512 C  CG    . LYS C  1 138 ? 84.439  -12.920 -30.776 1.000 82.418  ? 6933 LYS C CG    1 
ATOM   4513 C  CD    . LYS C  1 138 ? 84.513  -11.439 -31.121 1.000 88.825  ? 6933 LYS C CD    1 
ATOM   4514 C  CE    . LYS C  1 138 ? 83.186  -10.715 -31.015 1.000 91.731  ? 6933 LYS C CE    1 
ATOM   4515 N  NZ    . LYS C  1 138 ? 82.650  -10.747 -29.633 1.000 91.307  ? 6933 LYS C NZ    1 
ATOM   4516 N  N     . LYS C  1 144 ? 89.810  -19.374 -38.385 1.000 56.002  ? 6939 LYS C N     1 
ATOM   4517 C  CA    . LYS C  1 144 ? 89.845  -20.835 -38.100 1.000 53.089  ? 6939 LYS C CA    1 
ATOM   4518 C  C     . LYS C  1 144 ? 91.244  -21.274 -37.644 1.000 48.622  ? 6939 LYS C C     1 
ATOM   4519 O  O     . LYS C  1 144 ? 91.333  -22.398 -37.109 1.000 50.108  ? 6939 LYS C O     1 
ATOM   4520 C  CB    . LYS C  1 144 ? 89.386  -21.661 -39.308 1.000 57.435  ? 6939 LYS C CB    1 
ATOM   4521 C  CG    . LYS C  1 144 ? 87.877  -21.795 -39.474 1.000 61.892  ? 6939 LYS C CG    1 
ATOM   4522 C  CD    . LYS C  1 144 ? 87.149  -20.499 -39.756 1.000 65.435  ? 6939 LYS C CD    1 
ATOM   4523 C  CE    . LYS C  1 144 ? 85.652  -20.696 -39.854 1.000 69.793  ? 6939 LYS C CE    1 
ATOM   4524 N  NZ    . LYS C  1 144 ? 84.943  -19.421 -40.113 1.000 73.912  ? 6939 LYS C NZ    1 
ATOM   4525 N  N     . GLU C  1 145 ? 92.291  -20.466 -37.870 1.000 40.183  ? 6940 GLU C N     1 
ATOM   4526 C  CA    . GLU C  1 145 ? 93.640  -20.875 -37.386 1.000 40.318  ? 6940 GLU C CA    1 
ATOM   4527 C  C     . GLU C  1 145 ? 93.545  -21.001 -35.860 1.000 37.455  ? 6940 GLU C C     1 
ATOM   4528 O  O     . GLU C  1 145 ? 93.001  -20.074 -35.231 1.000 37.313  ? 6940 GLU C O     1 
ATOM   4529 C  CB    . GLU C  1 145 ? 94.722  -19.894 -37.823 1.000 43.489  ? 6940 GLU C CB    1 
ATOM   4530 C  CG    . GLU C  1 145 ? 96.126  -20.338 -37.450 1.000 46.760  ? 6940 GLU C CG    1 
ATOM   4531 C  CD    . GLU C  1 145 ? 97.225  -19.578 -38.181 1.000 54.697  ? 6940 GLU C CD    1 
ATOM   4532 O  OE1   . GLU C  1 145 ? 96.939  -18.462 -38.677 1.000 59.414  ? 6940 GLU C OE1   1 
ATOM   4533 O  OE2   . GLU C  1 145 ? 98.348  -20.131 -38.319 1.000 56.991  ? 6940 GLU C OE2   1 
ATOM   4534 N  N     . ASN C  1 146 ? 94.054  -22.092 -35.290 1.000 33.710  ? 6941 ASN C N     1 
ATOM   4535 C  CA    . ASN C  1 146 ? 93.850  -22.311 -33.835 1.000 32.199  ? 6941 ASN C CA    1 
ATOM   4536 C  C     . ASN C  1 146 ? 95.148  -22.058 -33.065 1.000 32.195  ? 6941 ASN C C     1 
ATOM   4537 O  O     . ASN C  1 146 ? 95.793  -23.037 -32.661 1.000 32.334  ? 6941 ASN C O     1 
ATOM   4538 C  CB    . ASN C  1 146 ? 93.273  -23.704 -33.579 1.000 30.227  ? 6941 ASN C CB    1 
ATOM   4539 C  CG    . ASN C  1 146 ? 92.777  -23.861 -32.158 1.000 28.709  ? 6941 ASN C CG    1 
ATOM   4540 O  OD1   . ASN C  1 146 ? 92.731  -22.887 -31.415 1.000 27.571  ? 6941 ASN C OD1   1 
ATOM   4541 N  ND2   . ASN C  1 146 ? 92.388  -25.069 -31.787 1.000 27.012  ? 6941 ASN C ND2   1 
ATOM   4542 N  N     . ASP C  1 147 ? 95.472  -20.784 -32.841 1.000 33.306  ? 6942 ASP C N     1 
ATOM   4543 C  CA    . ASP C  1 147 ? 96.691  -20.388 -32.090 1.000 35.202  ? 6942 ASP C CA    1 
ATOM   4544 C  C     . ASP C  1 147 ? 96.320  -20.150 -30.622 1.000 31.618  ? 6942 ASP C C     1 
ATOM   4545 O  O     . ASP C  1 147 ? 95.117  -20.059 -30.313 1.000 30.285  ? 6942 ASP C O     1 
ATOM   4546 C  CB    . ASP C  1 147 ? 97.337  -19.128 -32.675 1.000 39.295  ? 6942 ASP C CB    1 
ATOM   4547 C  CG    . ASP C  1 147 ? 98.076  -19.346 -33.985 1.000 46.946  ? 6942 ASP C CG    1 
ATOM   4548 O  OD1   . ASP C  1 147 ? 98.584  -20.478 -34.202 1.000 51.692  ? 6942 ASP C OD1   1 
ATOM   4549 O  OD2   . ASP C  1 147 ? 98.142  -18.382 -34.785 1.000 52.817  ? 6942 ASP C OD2   1 
ATOM   4550 N  N     . SER C  1 148 ? 97.332  -20.094 -29.759 1.000 30.276  ? 6943 SER C N     1 
ATOM   4551 C  CA    . SER C  1 148 ? 97.139  -19.803 -28.319 1.000 29.216  ? 6943 SER C CA    1 
ATOM   4552 C  C     . SER C  1 148 ? 96.425  -18.451 -28.195 1.000 28.575  ? 6943 SER C C     1 
ATOM   4553 O  O     . SER C  1 148 ? 96.869  -17.517 -28.858 1.000 29.067  ? 6943 SER C O     1 
ATOM   4554 C  CB    . SER C  1 148 ? 98.465  -19.798 -27.616 1.000 29.685  ? 6943 SER C CB    1 
ATOM   4555 O  OG    . SER C  1 148 ? 98.295  -19.476 -26.251 1.000 28.618  ? 6943 SER C OG    1 
ATOM   4556 N  N     . LYS C  1 149 ? 95.375  -18.357 -27.376 1.000 27.661  ? 6944 LYS C N     1 
ATOM   4557 C  CA    . LYS C  1 149 ? 94.587  -17.100 -27.238 1.000 28.567  ? 6944 LYS C CA    1 
ATOM   4558 C  C     . LYS C  1 149 ? 95.194  -16.251 -26.110 1.000 30.690  ? 6944 LYS C C     1 
ATOM   4559 O  O     . LYS C  1 149 ? 95.488  -16.825 -25.039 1.000 29.162  ? 6944 LYS C O     1 
ATOM   4560 C  CB    . LYS C  1 149 ? 93.105  -17.432 -27.030 1.000 26.956  ? 6944 LYS C CB    1 
ATOM   4561 C  CG    . LYS C  1 149 ? 92.463  -18.273 -28.133 1.000 26.184  ? 6944 LYS C CG    1 
ATOM   4562 C  CD    . LYS C  1 149 ? 92.608  -17.683 -29.531 1.000 27.526  ? 6944 LYS C CD    1 
ATOM   4563 C  CE    . LYS C  1 149 ? 91.889  -18.467 -30.617 1.000 26.992  ? 6944 LYS C CE    1 
ATOM   4564 N  NZ    . LYS C  1 149 ? 92.416  -19.847 -30.752 1.000 26.643  ? 6944 LYS C NZ    1 
ATOM   4565 N  N     . GLU C  1 150 ? 95.333  -14.936 -26.333 1.000 33.599  ? 6945 GLU C N     1 
ATOM   4566 C  CA    . GLU C  1 150 ? 96.008  -14.035 -25.354 1.000 37.787  ? 6945 GLU C CA    1 
ATOM   4567 C  C     . GLU C  1 150 ? 95.110  -12.886 -24.886 1.000 38.543  ? 6945 GLU C C     1 
ATOM   4568 O  O     . GLU C  1 150 ? 95.617  -11.756 -24.784 1.000 45.823  ? 6945 GLU C O     1 
ATOM   4569 C  CB    . GLU C  1 150 ? 97.285  -13.454 -25.962 1.000 42.776  ? 6945 GLU C CB    1 
ATOM   4570 C  CG    . GLU C  1 150 ? 98.329  -14.509 -26.253 1.000 47.293  ? 6945 GLU C CG    1 
ATOM   4571 C  CD    . GLU C  1 150 ? 99.589  -13.978 -26.907 1.000 54.724  ? 6945 GLU C CD    1 
ATOM   4572 O  OE1   . GLU C  1 150 ? 99.700  -12.741 -27.056 1.000 61.910  ? 6945 GLU C OE1   1 
ATOM   4573 O  OE2   . GLU C  1 150 ? 100.450 -14.806 -27.280 1.000 60.562  ? 6945 GLU C OE2   1 
ATOM   4574 N  N     . GLY C  1 151 ? 93.844  -13.164 -24.597 1.000 36.150  ? 6946 GLY C N     1 
ATOM   4575 C  CA    . GLY C  1 151 ? 92.945  -12.145 -24.027 1.000 33.825  ? 6946 GLY C CA    1 
ATOM   4576 C  C     . GLY C  1 151 ? 92.848  -12.351 -22.521 1.000 31.293  ? 6946 GLY C C     1 
ATOM   4577 O  O     . GLY C  1 151 ? 93.856  -12.124 -21.823 1.000 31.924  ? 6946 GLY C O     1 
ATOM   4578 N  N     . PHE C  1 152 ? 91.718  -12.867 -22.043 1.000 27.840  ? 6947 PHE C N     1 
ATOM   4579 C  CA    . PHE C  1 152 ? 91.548  -13.082 -20.583 1.000 26.436  ? 6947 PHE C CA    1 
ATOM   4580 C  C     . PHE C  1 152 ? 92.524  -14.159 -20.088 1.000 25.316  ? 6947 PHE C C     1 
ATOM   4581 O  O     . PHE C  1 152 ? 92.836  -14.143 -18.894 1.000 25.384  ? 6947 PHE C O     1 
ATOM   4582 C  CB    . PHE C  1 152 ? 90.093  -13.413 -20.239 1.000 26.023  ? 6947 PHE C CB    1 
ATOM   4583 C  CG    . PHE C  1 152 ? 89.526  -14.631 -20.918 1.000 24.569  ? 6947 PHE C CG    1 
ATOM   4584 C  CD1   . PHE C  1 152 ? 89.873  -15.904 -20.495 1.000 24.595  ? 6947 PHE C CD1   1 
ATOM   4585 C  CD2   . PHE C  1 152 ? 88.622  -14.506 -21.960 1.000 25.808  ? 6947 PHE C CD2   1 
ATOM   4586 C  CE1   . PHE C  1 152 ? 89.354  -17.024 -21.123 1.000 23.556  ? 6947 PHE C CE1   1 
ATOM   4587 C  CE2   . PHE C  1 152 ? 88.088  -15.631 -22.576 1.000 25.120  ? 6947 PHE C CE2   1 
ATOM   4588 C  CZ    . PHE C  1 152 ? 88.461  -16.885 -22.157 1.000 24.128  ? 6947 PHE C CZ    1 
ATOM   4589 N  N     . PHE C  1 153 ? 93.042  -15.025 -20.970 1.000 24.545  ? 6948 PHE C N     1 
ATOM   4590 C  CA    . PHE C  1 153 ? 93.990  -16.069 -20.488 1.000 25.322  ? 6948 PHE C CA    1 
ATOM   4591 C  C     . PHE C  1 153 ? 95.289  -15.441 -19.959 1.000 26.385  ? 6948 PHE C C     1 
ATOM   4592 O  O     . PHE C  1 153 ? 95.883  -16.007 -19.017 1.000 26.363  ? 6948 PHE C O     1 
ATOM   4593 C  CB    . PHE C  1 153 ? 94.269  -17.132 -21.553 1.000 25.624  ? 6948 PHE C CB    1 
ATOM   4594 C  CG    . PHE C  1 153 ? 93.146  -18.116 -21.753 1.000 24.688  ? 6948 PHE C CG    1 
ATOM   4595 C  CD1   . PHE C  1 153 ? 92.793  -18.991 -20.739 1.000 24.168  ? 6948 PHE C CD1   1 
ATOM   4596 C  CD2   . PHE C  1 153 ? 92.487  -18.217 -22.969 1.000 25.453  ? 6948 PHE C CD2   1 
ATOM   4597 C  CE1   . PHE C  1 153 ? 91.774  -19.915 -20.921 1.000 24.056  ? 6948 PHE C CE1   1 
ATOM   4598 C  CE2   . PHE C  1 153 ? 91.469  -19.140 -23.148 1.000 24.515  ? 6948 PHE C CE2   1 
ATOM   4599 C  CZ    . PHE C  1 153 ? 91.120  -19.993 -22.128 1.000 23.841  ? 6948 PHE C CZ    1 
ATOM   4600 N  N     A THR C  1 154 ? 95.743  -14.329 -20.547 0.700 27.761  ? 6949 THR C N     1 
ATOM   4601 N  N     B THR C  1 154 ? 95.718  -14.324 -20.554 0.300 27.331  ? 6949 THR C N     1 
ATOM   4602 C  CA    A THR C  1 154 ? 96.988  -13.695 -20.034 0.700 29.018  ? 6949 THR C CA    1 
ATOM   4603 C  CA    B THR C  1 154 ? 96.947  -13.624 -20.098 0.300 28.261  ? 6949 THR C CA    1 
ATOM   4604 C  C     A THR C  1 154 ? 96.714  -13.201 -18.609 0.700 28.379  ? 6949 THR C C     1 
ATOM   4605 C  C     B THR C  1 154 ? 96.722  -13.162 -18.652 0.300 28.075  ? 6949 THR C C     1 
ATOM   4606 O  O     A THR C  1 154 ? 97.604  -13.348 -17.754 0.700 28.009  ? 6949 THR C O     1 
ATOM   4607 O  O     B THR C  1 154 ? 97.655  -13.284 -17.836 0.300 28.137  ? 6949 THR C O     1 
ATOM   4608 C  CB    A THR C  1 154 ? 97.494  -12.584 -20.961 0.700 30.876  ? 6949 THR C CB    1 
ATOM   4609 C  CB    B THR C  1 154 ? 97.291  -12.465 -21.040 0.300 29.449  ? 6949 THR C CB    1 
ATOM   4610 O  OG1   A THR C  1 154 ? 96.594  -11.479 -20.887 0.700 32.309  ? 6949 THR C OG1   1 
ATOM   4611 O  OG1   B THR C  1 154 ? 97.280  -12.971 -22.376 0.300 29.739  ? 6949 THR C OG1   1 
ATOM   4612 C  CG2   A THR C  1 154 ? 97.635  -13.051 -22.394 0.700 31.701  ? 6949 THR C CG2   1 
ATOM   4613 C  CG2   B THR C  1 154 ? 98.626  -11.826 -20.729 0.300 30.425  ? 6949 THR C CG2   1 
ATOM   4614 N  N     . TYR C  1 155 ? 95.515  -12.662 -18.367 1.000 27.865  ? 6950 TYR C N     1 
ATOM   4615 C  CA    . TYR C  1 155 ? 95.141  -12.190 -17.012 1.000 27.762  ? 6950 TYR C CA    1 
ATOM   4616 C  C     . TYR C  1 155 ? 95.124  -13.382 -16.042 1.000 26.300  ? 6950 TYR C C     1 
ATOM   4617 O  O     . TYR C  1 155 ? 95.695  -13.281 -14.951 1.000 25.966  ? 6950 TYR C O     1 
ATOM   4618 C  CB    . TYR C  1 155 ? 93.785  -11.480 -17.016 1.000 28.108  ? 6950 TYR C CB    1 
ATOM   4619 C  CG    . TYR C  1 155 ? 93.361  -11.040 -15.642 1.000 28.290  ? 6950 TYR C CG    1 
ATOM   4620 C  CD1   . TYR C  1 155 ? 93.863  -9.878  -15.080 1.000 30.042  ? 6950 TYR C CD1   1 
ATOM   4621 C  CD2   . TYR C  1 155 ? 92.523  -11.828 -14.867 1.000 28.509  ? 6950 TYR C CD2   1 
ATOM   4622 C  CE1   . TYR C  1 155 ? 93.512  -9.491  -13.796 1.000 30.190  ? 6950 TYR C CE1   1 
ATOM   4623 C  CE2   . TYR C  1 155 ? 92.160  -11.453 -13.585 1.000 28.202  ? 6950 TYR C CE2   1 
ATOM   4624 C  CZ    . TYR C  1 155 ? 92.656  -10.281 -13.048 1.000 29.106  ? 6950 TYR C CZ    1 
ATOM   4625 O  OH    . TYR C  1 155 ? 92.303  -9.904  -11.783 1.000 30.674  ? 6950 TYR C OH    1 
ATOM   4626 N  N     A ILE C  1 156 ? 94.480  -14.485 -16.434 0.700 25.867  ? 6951 ILE C N     1 
ATOM   4627 N  N     B ILE C  1 156 ? 94.483  -14.483 -16.453 0.300 25.411  ? 6951 ILE C N     1 
ATOM   4628 C  CA    A ILE C  1 156 ? 94.407  -15.688 -15.548 0.700 25.148  ? 6951 ILE C CA    1 
ATOM   4629 C  CA    B ILE C  1 156 ? 94.397  -15.721 -15.620 0.300 24.474  ? 6951 ILE C CA    1 
ATOM   4630 C  C     A ILE C  1 156 ? 95.826  -16.184 -15.227 0.700 25.100  ? 6951 ILE C C     1 
ATOM   4631 C  C     B ILE C  1 156 ? 95.809  -16.186 -15.243 0.300 24.822  ? 6951 ILE C C     1 
ATOM   4632 O  O     A ILE C  1 156 ? 96.076  -16.505 -14.047 0.700 24.093  ? 6951 ILE C O     1 
ATOM   4633 O  O     B ILE C  1 156 ? 96.030  -16.484 -14.052 0.300 24.295  ? 6951 ILE C O     1 
ATOM   4634 C  CB    A ILE C  1 156 ? 93.521  -16.784 -16.173 0.700 25.084  ? 6951 ILE C CB    1 
ATOM   4635 C  CB    B ILE C  1 156 ? 93.625  -16.832 -16.359 0.300 23.806  ? 6951 ILE C CB    1 
ATOM   4636 C  CG1   A ILE C  1 156 ? 92.041  -16.386 -16.179 0.700 25.315  ? 6951 ILE C CG1   1 
ATOM   4637 C  CG1   B ILE C  1 156 ? 92.143  -16.489 -16.533 0.300 23.406  ? 6951 ILE C CG1   1 
ATOM   4638 C  CG2   A ILE C  1 156 ? 93.725  -18.110 -15.463 0.700 24.980  ? 6951 ILE C CG2   1 
ATOM   4639 C  CG2   B ILE C  1 156 ? 93.800  -18.164 -15.651 0.300 23.404  ? 6951 ILE C CG2   1 
ATOM   4640 C  CD1   A ILE C  1 156 ? 91.421  -16.261 -14.796 0.700 25.690  ? 6951 ILE C CD1   1 
ATOM   4641 C  CD1   B ILE C  1 156 ? 91.353  -17.560 -17.251 0.300 22.783  ? 6951 ILE C CD1   1 
ATOM   4642 N  N     . CYS C  1 157 ? 96.721  -16.248 -16.220 1.000 25.486  ? 6952 CYS C N     1 
ATOM   4643 C  CA    . CYS C  1 157 ? 98.112  -16.715 -15.955 1.000 26.303  ? 6952 CYS C CA    1 
ATOM   4644 C  C     . CYS C  1 157 ? 98.777  -15.802 -14.914 1.000 26.814  ? 6952 CYS C C     1 
ATOM   4645 O  O     . CYS C  1 157 ? 99.404  -16.330 -13.969 1.000 26.049  ? 6952 CYS C O     1 
ATOM   4646 C  CB    . CYS C  1 157 ? 98.936  -16.789 -17.235 1.000 27.908  ? 6952 CYS C CB    1 
ATOM   4647 S  SG    . CYS C  1 157 ? 98.372  -18.089 -18.365 1.000 28.803  ? 6952 CYS C SG    1 
ATOM   4648 N  N     . GLY C  1 158 ? 98.632  -14.483 -15.075 1.000 27.388  ? 6953 GLY C N     1 
ATOM   4649 C  CA    . GLY C  1 158 ? 99.221  -13.540 -14.104 1.000 28.162  ? 6953 GLY C CA    1 
ATOM   4650 C  C     . GLY C  1 158 ? 98.582  -13.704 -12.734 1.000 27.232  ? 6953 GLY C C     1 
ATOM   4651 O  O     . GLY C  1 158 ? 99.319  -13.672 -11.729 1.000 27.872  ? 6953 GLY C O     1 
ATOM   4652 N  N     . PHE C  1 159 ? 97.264  -13.910 -12.694 1.000 26.270  ? 6954 PHE C N     1 
ATOM   4653 C  CA    . PHE C  1 159 ? 96.529  -14.061 -11.409 1.000 26.051  ? 6954 PHE C CA    1 
ATOM   4654 C  C     . PHE C  1 159 ? 97.015  -15.326 -10.677 1.000 25.137  ? 6954 PHE C C     1 
ATOM   4655 O  O     . PHE C  1 159 ? 97.222  -15.284 -9.451  1.000 24.946  ? 6954 PHE C O     1 
ATOM   4656 C  CB    . PHE C  1 159 ? 95.022  -14.064 -11.667 1.000 25.642  ? 6954 PHE C CB    1 
ATOM   4657 C  CG    . PHE C  1 159 ? 94.186  -13.792 -10.444 1.000 26.161  ? 6954 PHE C CG    1 
ATOM   4658 C  CD1   . PHE C  1 159 ? 93.879  -14.805 -9.551  1.000 25.810  ? 6954 PHE C CD1   1 
ATOM   4659 C  CD2   . PHE C  1 159 ? 93.705  -12.520 -10.187 1.000 26.532  ? 6954 PHE C CD2   1 
ATOM   4660 C  CE1   . PHE C  1 159 ? 93.118  -14.547 -8.420  1.000 25.349  ? 6954 PHE C CE1   1 
ATOM   4661 C  CE2   . PHE C  1 159 ? 92.930  -12.267 -9.065  1.000 26.879  ? 6954 PHE C CE2   1 
ATOM   4662 C  CZ    . PHE C  1 159 ? 92.631  -13.284 -8.188  1.000 25.703  ? 6954 PHE C CZ    1 
ATOM   4663 N  N     . ILE C  1 160 ? 97.199  -16.422 -11.408 1.000 25.466  ? 6955 ILE C N     1 
ATOM   4664 C  CA    . ILE C  1 160 ? 97.723  -17.687 -10.810 1.000 26.092  ? 6955 ILE C CA    1 
ATOM   4665 C  C     . ILE C  1 160 ? 99.137  -17.455 -10.261 1.000 27.366  ? 6955 ILE C C     1 
ATOM   4666 O  O     . ILE C  1 160 ? 99.406  -17.884 -9.120  1.000 28.002  ? 6955 ILE C O     1 
ATOM   4667 C  CB    . ILE C  1 160 ? 97.698  -18.820 -11.852 1.000 26.489  ? 6955 ILE C CB    1 
ATOM   4668 C  CG1   . ILE C  1 160 ? 96.262  -19.249 -12.169 1.000 25.770  ? 6955 ILE C CG1   1 
ATOM   4669 C  CG2   . ILE C  1 160 ? 98.549  -19.992 -11.391 1.000 27.391  ? 6955 ILE C CG2   1 
ATOM   4670 C  CD1   . ILE C  1 160 ? 96.142  -20.205 -13.340 1.000 25.601  ? 6955 ILE C CD1   1 
ATOM   4671 N  N     . GLN C  1 161 ? 99.995  -16.764 -11.015 1.000 27.823  ? 6956 GLN C N     1 
ATOM   4672 C  CA    . GLN C  1 161 ? 101.406 -16.566 -10.581 1.000 30.812  ? 6956 GLN C CA    1 
ATOM   4673 C  C     . GLN C  1 161 ? 101.547 -15.531 -9.456  1.000 31.009  ? 6956 GLN C C     1 
ATOM   4674 O  O     . GLN C  1 161 ? 102.582 -15.580 -8.775  1.000 31.358  ? 6956 GLN C O     1 
ATOM   4675 C  CB    . GLN C  1 161 ? 102.260 -16.154 -11.780 1.000 33.219  ? 6956 GLN C CB    1 
ATOM   4676 C  CG    . GLN C  1 161 ? 102.474 -17.291 -12.765 1.000 35.216  ? 6956 GLN C CG    1 
ATOM   4677 C  CD    . GLN C  1 161 ? 103.267 -16.855 -13.970 1.000 38.720  ? 6956 GLN C CD    1 
ATOM   4678 O  OE1   . GLN C  1 161 ? 102.771 -16.158 -14.852 1.000 42.963  ? 6956 GLN C OE1   1 
ATOM   4679 N  NE2   . GLN C  1 161 ? 104.500 -17.320 -14.040 1.000 41.599  ? 6956 GLN C NE2   1 
ATOM   4680 N  N     . GLN C  1 162 ? 100.548 -14.678 -9.213  1.000 31.119  ? 6957 GLN C N     1 
ATOM   4681 C  CA    . GLN C  1 162 ? 100.749 -13.609 -8.193  1.000 32.622  ? 6957 GLN C CA    1 
ATOM   4682 C  C     . GLN C  1 162 ? 99.689  -13.623 -7.087  1.000 29.926  ? 6957 GLN C C     1 
ATOM   4683 O  O     . GLN C  1 162 ? 100.034 -13.188 -5.951  1.000 28.425  ? 6957 GLN C O     1 
ATOM   4684 C  CB    . GLN C  1 162 ? 100.683 -12.245 -8.884  1.000 37.202  ? 6957 GLN C CB    1 
ATOM   4685 C  CG    . GLN C  1 162 ? 101.666 -12.103 -10.038 1.000 42.864  ? 6957 GLN C CG    1 
ATOM   4686 C  CD    . GLN C  1 162 ? 101.369 -10.911 -10.916 1.000 49.576  ? 6957 GLN C CD    1 
ATOM   4687 O  OE1   . GLN C  1 162 ? 100.913 -9.864  -10.451 1.000 58.142  ? 6957 GLN C OE1   1 
ATOM   4688 N  NE2   . GLN C  1 162 ? 101.634 -11.063 -12.208 1.000 52.106  ? 6957 GLN C NE2   1 
ATOM   4689 N  N     . LYS C  1 163 ? 98.487  -14.138 -7.371  1.000 27.025  ? 6958 LYS C N     1 
ATOM   4690 C  CA    . LYS C  1 163 ? 97.364  -14.009 -6.403  1.000 26.904  ? 6958 LYS C CA    1 
ATOM   4691 C  C     . LYS C  1 163 ? 96.803  -15.366 -5.959  1.000 26.001  ? 6958 LYS C C     1 
ATOM   4692 O  O     . LYS C  1 163 ? 95.699  -15.375 -5.375  1.000 27.237  ? 6958 LYS C O     1 
ATOM   4693 C  CB    . LYS C  1 163 ? 96.261  -13.161 -7.044  1.000 27.433  ? 6958 LYS C CB    1 
ATOM   4694 C  CG    . LYS C  1 163 ? 96.715  -11.812 -7.591  1.000 29.452  ? 6958 LYS C CG    1 
ATOM   4695 C  CD    . LYS C  1 163 ? 97.356  -10.904 -6.557  1.000 31.301  ? 6958 LYS C CD    1 
ATOM   4696 C  CE    . LYS C  1 163 ? 97.787  -9.578  -7.147  1.000 34.284  ? 6958 LYS C CE    1 
ATOM   4697 N  NZ    . LYS C  1 163 ? 98.332  -8.677  -6.112  1.000 36.140  ? 6958 LYS C NZ    1 
ATOM   4698 N  N     . LEU C  1 164 ? 97.516  -16.461 -6.219  1.000 25.509  ? 6959 LEU C N     1 
ATOM   4699 C  CA    . LEU C  1 164 ? 97.042  -17.794 -5.765  1.000 24.368  ? 6959 LEU C CA    1 
ATOM   4700 C  C     . LEU C  1 164 ? 97.924  -18.248 -4.600  1.000 24.449  ? 6959 LEU C C     1 
ATOM   4701 O  O     . LEU C  1 164 ? 99.167  -18.222 -4.741  1.000 25.213  ? 6959 LEU C O     1 
ATOM   4702 C  CB    . LEU C  1 164 ? 97.101  -18.783 -6.929  1.000 24.412  ? 6959 LEU C CB    1 
ATOM   4703 C  CG    . LEU C  1 164 ? 96.610  -20.196 -6.623  1.000 23.904  ? 6959 LEU C CG    1 
ATOM   4704 C  CD1   . LEU C  1 164 ? 95.140  -20.201 -6.223  1.000 22.802  ? 6959 LEU C CD1   1 
ATOM   4705 C  CD2   . LEU C  1 164 ? 96.836  -21.100 -7.823  1.000 23.765  ? 6959 LEU C CD2   1 
ATOM   4706 N  N     . ALA C  1 165 ? 97.304  -18.597 -3.477  1.000 23.392  ? 6960 ALA C N     1 
ATOM   4707 C  CA    . ALA C  1 165 ? 98.065  -19.074 -2.305  1.000 23.973  ? 6960 ALA C CA    1 
ATOM   4708 C  C     . ALA C  1 165 ? 98.749  -20.397 -2.639  1.000 23.772  ? 6960 ALA C C     1 
ATOM   4709 O  O     . ALA C  1 165 ? 98.195  -21.156 -3.454  1.000 22.129  ? 6960 ALA C O     1 
ATOM   4710 C  CB    . ALA C  1 165 ? 97.124  -19.259 -1.138  1.000 24.268  ? 6960 ALA C CB    1 
ATOM   4711 N  N     . LEU C  1 166 ? 99.918  -20.657 -2.044  1.000 25.360  ? 6961 LEU C N     1 
ATOM   4712 C  CA    . LEU C  1 166 ? 100.539 -21.993 -2.232  1.000 25.723  ? 6961 LEU C CA    1 
ATOM   4713 C  C     . LEU C  1 166 ? 99.566  -22.997 -1.612  1.000 24.830  ? 6961 LEU C C     1 
ATOM   4714 O  O     . LEU C  1 166 ? 98.999  -22.673 -0.553  1.000 23.441  ? 6961 LEU C O     1 
ATOM   4715 C  CB    . LEU C  1 166 ? 101.913 -22.036 -1.563  1.000 28.452  ? 6961 LEU C CB    1 
ATOM   4716 C  CG    . LEU C  1 166 ? 102.935 -21.059 -2.140  1.000 29.895  ? 6961 LEU C CG    1 
ATOM   4717 C  CD1   . LEU C  1 166 ? 104.213 -21.056 -1.320  1.000 32.281  ? 6961 LEU C CD1   1 
ATOM   4718 C  CD2   . LEU C  1 166 ? 103.224 -21.399 -3.585  1.000 30.119  ? 6961 LEU C CD2   1 
ATOM   4719 N  N     . GLY C  1 167 ? 99.332  -24.128 -2.283  1.000 24.476  ? 6962 GLY C N     1 
ATOM   4720 C  CA    . GLY C  1 167 ? 98.350  -25.127 -1.822  1.000 23.589  ? 6962 GLY C CA    1 
ATOM   4721 C  C     . GLY C  1 167 ? 96.986  -24.897 -2.461  1.000 22.864  ? 6962 GLY C C     1 
ATOM   4722 O  O     . GLY C  1 167 ? 96.136  -25.815 -2.408  1.000 23.092  ? 6962 GLY C O     1 
ATOM   4723 N  N     . GLY C  1 168 ? 96.782  -23.718 -3.058  1.000 22.055  ? 6963 GLY C N     1 
ATOM   4724 C  CA    . GLY C  1 168 ? 95.505  -23.384 -3.711  1.000 21.228  ? 6963 GLY C CA    1 
ATOM   4725 C  C     . GLY C  1 168 ? 95.299  -24.175 -4.995  1.000 20.966  ? 6963 GLY C C     1 
ATOM   4726 O  O     . GLY C  1 168 ? 96.265  -24.786 -5.493  1.000 21.193  ? 6963 GLY C O     1 
ATOM   4727 N  N     . SER C  1 169 ? 94.078  -24.159 -5.519  1.000 20.187  ? 6964 SER C N     1 
ATOM   4728 C  CA    . SER C  1 169 ? 93.745  -24.924 -6.747  1.000 20.344  ? 6964 SER C CA    1 
ATOM   4729 C  C     . SER C  1 169 ? 92.981  -24.045 -7.738  1.000 19.967  ? 6964 SER C C     1 
ATOM   4730 O  O     . SER C  1 169 ? 92.507  -22.966 -7.348  1.000 19.086  ? 6964 SER C O     1 
ATOM   4731 C  CB    . SER C  1 169 ? 92.979  -26.176 -6.404  1.000 20.451  ? 6964 SER C CB    1 
ATOM   4732 O  OG    . SER C  1 169 ? 93.794  -27.075 -5.661  1.000 20.573  ? 6964 SER C OG    1 
ATOM   4733 N  N     . VAL C  1 170 ? 92.918  -24.495 -8.993  1.000 20.050  ? 6965 VAL C N     1 
ATOM   4734 C  CA    . VAL C  1 170 ? 92.197  -23.755 -10.060 1.000 19.517  ? 6965 VAL C CA    1 
ATOM   4735 C  C     . VAL C  1 170 ? 91.419  -24.749 -10.934 1.000 19.253  ? 6965 VAL C C     1 
ATOM   4736 O  O     . VAL C  1 170 ? 91.821  -25.944 -11.035 1.000 18.849  ? 6965 VAL C O     1 
ATOM   4737 C  CB    . VAL C  1 170 ? 93.170  -22.933 -10.933 1.000 19.619  ? 6965 VAL C CB    1 
ATOM   4738 C  CG1   . VAL C  1 170 ? 94.112  -22.071 -10.104 1.000 20.362  ? 6965 VAL C CG1   1 
ATOM   4739 C  CG2   . VAL C  1 170 ? 93.974  -23.818 -11.868 1.000 20.526  ? 6965 VAL C CG2   1 
ATOM   4740 N  N     . ALA C  1 171 ? 90.335  -24.261 -11.522 1.000 18.901  ? 6966 ALA C N     1 
ATOM   4741 C  CA    . ALA C  1 171 ? 89.551  -24.997 -12.542 1.000 18.603  ? 6966 ALA C CA    1 
ATOM   4742 C  C     . ALA C  1 171 ? 89.221  -23.942 -13.599 1.000 19.027  ? 6966 ALA C C     1 
ATOM   4743 O  O     . ALA C  1 171 ? 88.426  -23.024 -13.297 1.000 19.149  ? 6966 ALA C O     1 
ATOM   4744 C  CB    . ALA C  1 171 ? 88.335  -25.662 -11.952 1.000 18.424  ? 6966 ALA C CB    1 
ATOM   4745 N  N     . ILE C  1 172 ? 89.911  -24.003 -14.740 1.000 19.169  ? 6967 ILE C N     1 
ATOM   4746 C  CA    . ILE C  1 172 ? 89.781  -22.982 -15.813 1.000 19.713  ? 6967 ILE C CA    1 
ATOM   4747 C  C     . ILE C  1 172 ? 89.149  -23.610 -17.056 1.000 19.539  ? 6967 ILE C C     1 
ATOM   4748 O  O     . ILE C  1 172 ? 89.745  -24.554 -17.627 1.000 19.311  ? 6967 ILE C O     1 
ATOM   4749 C  CB    . ILE C  1 172 ? 91.160  -22.382 -16.132 1.000 20.381  ? 6967 ILE C CB    1 
ATOM   4750 C  CG1   . ILE C  1 172 ? 91.890  -21.918 -14.866 1.000 21.186  ? 6967 ILE C CG1   1 
ATOM   4751 C  CG2   . ILE C  1 172 ? 91.033  -21.276 -17.171 1.000 21.090  ? 6967 ILE C CG2   1 
ATOM   4752 C  CD1   . ILE C  1 172 ? 91.152  -20.871 -14.045 1.000 20.643  ? 6967 ILE C CD1   1 
ATOM   4753 N  N     . LYS C  1 173 ? 88.027  -23.052 -17.496 1.000 19.377  ? 6968 LYS C N     1 
ATOM   4754 C  CA    . LYS C  1 173 ? 87.347  -23.620 -18.681 1.000 20.738  ? 6968 LYS C CA    1 
ATOM   4755 C  C     . LYS C  1 173 ? 88.132  -23.311 -19.962 1.000 20.868  ? 6968 LYS C C     1 
ATOM   4756 O  O     . LYS C  1 173 ? 88.568  -22.148 -20.160 1.000 20.509  ? 6968 LYS C O     1 
ATOM   4757 C  CB    . LYS C  1 173 ? 85.903  -23.124 -18.769 1.000 21.963  ? 6968 LYS C CB    1 
ATOM   4758 C  CG    . LYS C  1 173 ? 85.045  -23.895 -19.765 1.000 23.486  ? 6968 LYS C CG    1 
ATOM   4759 C  CD    . LYS C  1 173 ? 84.984  -23.310 -21.137 1.000 25.576  ? 6968 LYS C CD    1 
ATOM   4760 C  CE    . LYS C  1 173 ? 83.935  -22.235 -21.250 1.000 26.026  ? 6968 LYS C CE    1 
ATOM   4761 N  NZ    . LYS C  1 173 ? 82.582  -22.760 -20.931 1.000 26.430  ? 6968 LYS C NZ    1 
ATOM   4762 N  N     . ILE C  1 174 ? 88.305  -24.347 -20.784 1.000 20.456  ? 6969 ILE C N     1 
ATOM   4763 C  CA    . ILE C  1 174 ? 88.945  -24.228 -22.122 1.000 21.687  ? 6969 ILE C CA    1 
ATOM   4764 C  C     . ILE C  1 174 ? 88.050  -24.961 -23.129 1.000 21.465  ? 6969 ILE C C     1 
ATOM   4765 O  O     . ILE C  1 174 ? 87.140  -25.702 -22.706 1.000 21.004  ? 6969 ILE C O     1 
ATOM   4766 C  CB    . ILE C  1 174 ? 90.375  -24.804 -22.164 1.000 22.230  ? 6969 ILE C CB    1 
ATOM   4767 C  CG1   . ILE C  1 174 ? 90.380  -26.310 -21.902 1.000 23.085  ? 6969 ILE C CG1   1 
ATOM   4768 C  CG2   . ILE C  1 174 ? 91.302  -24.051 -21.224 1.000 22.547  ? 6969 ILE C CG2   1 
ATOM   4769 C  CD1   . ILE C  1 174 ? 91.680  -26.996 -22.257 1.000 25.208  ? 6969 ILE C CD1   1 
ATOM   4770 N  N     . THR C  1 175 ? 88.311  -24.741 -24.412 1.000 21.306  ? 6970 THR C N     1 
ATOM   4771 C  CA    . THR C  1 175 ? 87.607  -25.455 -25.504 1.000 21.509  ? 6970 THR C CA    1 
ATOM   4772 C  C     . THR C  1 175 ? 88.653  -25.728 -26.581 1.000 21.642  ? 6970 THR C C     1 
ATOM   4773 O  O     . THR C  1 175 ? 89.834  -25.410 -26.357 1.000 22.015  ? 6970 THR C O     1 
ATOM   4774 C  CB    . THR C  1 175 ? 86.430  -24.664 -26.092 1.000 21.803  ? 6970 THR C CB    1 
ATOM   4775 O  OG1   . THR C  1 175 ? 86.949  -23.495 -26.726 1.000 22.358  ? 6970 THR C OG1   1 
ATOM   4776 C  CG2   . THR C  1 175 ? 85.389  -24.281 -25.067 1.000 21.964  ? 6970 THR C CG2   1 
ATOM   4777 N  N     . GLU C  1 176 ? 88.233  -26.286 -27.704 1.000 22.727  ? 6971 GLU C N     1 
ATOM   4778 C  CA    . GLU C  1 176 ? 89.183  -26.505 -28.820 1.000 22.840  ? 6971 GLU C CA    1 
ATOM   4779 C  C     . GLU C  1 176 ? 89.867  -25.181 -29.184 1.000 22.765  ? 6971 GLU C C     1 
ATOM   4780 O  O     . GLU C  1 176 ? 91.099  -25.176 -29.314 1.000 22.459  ? 6971 GLU C O     1 
ATOM   4781 C  CB    . GLU C  1 176 ? 88.445  -27.022 -30.054 1.000 23.710  ? 6971 GLU C CB    1 
ATOM   4782 C  CG    . GLU C  1 176 ? 89.331  -27.096 -31.280 1.000 24.820  ? 6971 GLU C CG    1 
ATOM   4783 C  CD    . GLU C  1 176 ? 88.633  -27.528 -32.559 1.000 26.190  ? 6971 GLU C CD    1 
ATOM   4784 O  OE1   . GLU C  1 176 ? 87.387  -27.581 -32.570 1.000 27.105  ? 6971 GLU C OE1   1 
ATOM   4785 O  OE2   . GLU C  1 176 ? 89.344  -27.832 -33.531 1.000 26.751  ? 6971 GLU C OE2   1 
ATOM   4786 N  N     . HIS C  1 177 ? 89.081  -24.107 -29.312 1.000 23.059  ? 6972 HIS C N     1 
ATOM   4787 C  CA    . HIS C  1 177 ? 89.584  -22.785 -29.773 1.000 24.369  ? 6972 HIS C CA    1 
ATOM   4788 C  C     . HIS C  1 177 ? 89.879  -21.825 -28.621 1.000 24.193  ? 6972 HIS C C     1 
ATOM   4789 O  O     . HIS C  1 177 ? 90.685  -20.902 -28.845 1.000 25.044  ? 6972 HIS C O     1 
ATOM   4790 C  CB    . HIS C  1 177 ? 88.600  -22.173 -30.775 1.000 25.517  ? 6972 HIS C CB    1 
ATOM   4791 C  CG    . HIS C  1 177 ? 88.607  -22.904 -32.073 1.000 27.074  ? 6972 HIS C CG    1 
ATOM   4792 N  ND1   . HIS C  1 177 ? 89.521  -22.612 -33.066 1.000 27.977  ? 6972 HIS C ND1   1 
ATOM   4793 C  CD2   . HIS C  1 177 ? 87.868  -23.944 -32.518 1.000 27.255  ? 6972 HIS C CD2   1 
ATOM   4794 C  CE1   . HIS C  1 177 ? 89.318  -23.422 -34.092 1.000 29.260  ? 6972 HIS C CE1   1 
ATOM   4795 N  NE2   . HIS C  1 177 ? 88.317  -24.255 -33.776 1.000 28.301  ? 6972 HIS C NE2   1 
ATOM   4796 N  N     . SER C  1 178 ? 89.264  -22.028 -27.454 1.000 23.231  ? 6973 SER C N     1 
ATOM   4797 C  CA    . SER C  1 178 ? 89.499  -21.117 -26.303 1.000 22.557  ? 6973 SER C CA    1 
ATOM   4798 C  C     . SER C  1 178 ? 90.523  -21.769 -25.369 1.000 22.308  ? 6973 SER C C     1 
ATOM   4799 O  O     . SER C  1 178 ? 90.118  -22.529 -24.485 1.000 21.751  ? 6973 SER C O     1 
ATOM   4800 C  CB    . SER C  1 178 ? 88.219  -20.783 -25.593 1.000 21.965  ? 6973 SER C CB    1 
ATOM   4801 O  OG    . SER C  1 178 ? 88.445  -19.792 -24.603 1.000 22.036  ? 6973 SER C OG    1 
ATOM   4802 N  N     . TRP C  1 179 ? 91.805  -21.485 -25.594 1.000 23.165  ? 6974 TRP C N     1 
ATOM   4803 C  CA    . TRP C  1 179 ? 92.899  -22.079 -24.786 1.000 23.260  ? 6974 TRP C CA    1 
ATOM   4804 C  C     . TRP C  1 179 ? 94.128  -21.172 -24.844 1.000 23.873  ? 6974 TRP C C     1 
ATOM   4805 O  O     . TRP C  1 179 ? 94.187  -20.291 -25.738 1.000 24.433  ? 6974 TRP C O     1 
ATOM   4806 C  CB    . TRP C  1 179 ? 93.247  -23.480 -25.307 1.000 23.810  ? 6974 TRP C CB    1 
ATOM   4807 C  CG    . TRP C  1 179 ? 93.870  -23.437 -26.665 1.000 24.724  ? 6974 TRP C CG    1 
ATOM   4808 C  CD1   . TRP C  1 179 ? 93.222  -23.268 -27.853 1.000 25.430  ? 6974 TRP C CD1   1 
ATOM   4809 C  CD2   . TRP C  1 179 ? 95.270  -23.535 -26.984 1.000 25.600  ? 6974 TRP C CD2   1 
ATOM   4810 N  NE1   . TRP C  1 179 ? 94.119  -23.251 -28.882 1.000 26.342  ? 6974 TRP C NE1   1 
ATOM   4811 C  CE2   . TRP C  1 179 ? 95.381  -23.412 -28.386 1.000 26.544  ? 6974 TRP C CE2   1 
ATOM   4812 C  CE3   . TRP C  1 179 ? 96.437  -23.701 -26.231 1.000 26.090  ? 6974 TRP C CE3   1 
ATOM   4813 C  CZ2   . TRP C  1 179 ? 96.603  -23.469 -29.048 1.000 27.443  ? 6974 TRP C CZ2   1 
ATOM   4814 C  CZ3   . TRP C  1 179 ? 97.647  -23.765 -26.887 1.000 27.231  ? 6974 TRP C CZ3   1 
ATOM   4815 C  CH2   . TRP C  1 179 ? 97.728  -23.638 -28.275 1.000 27.915  ? 6974 TRP C CH2   1 
ATOM   4816 N  N     . ASN C  1 180 ? 95.108  -21.467 -23.995 1.000 23.354  ? 6975 ASN C N     1 
ATOM   4817 C  CA    . ASN C  1 180 ? 96.349  -20.658 -23.909 1.000 24.772  ? 6975 ASN C CA    1 
ATOM   4818 C  C     . ASN C  1 180 ? 97.511  -21.592 -23.546 1.000 24.923  ? 6975 ASN C C     1 
ATOM   4819 O  O     . ASN C  1 180 ? 97.362  -22.397 -22.604 1.000 24.406  ? 6975 ASN C O     1 
ATOM   4820 C  CB    . ASN C  1 180 ? 96.150  -19.483 -22.951 1.000 24.629  ? 6975 ASN C CB    1 
ATOM   4821 C  CG    . ASN C  1 180 ? 97.438  -18.753 -22.643 1.000 26.140  ? 6975 ASN C CG    1 
ATOM   4822 O  OD1   . ASN C  1 180 ? 98.238  -19.229 -21.840 1.000 25.730  ? 6975 ASN C OD1   1 
ATOM   4823 N  ND2   . ASN C  1 180 ? 97.621  -17.579 -23.235 1.000 26.383  ? 6975 ASN C ND2   1 
ATOM   4824 N  N     . ALA C  1 181 ? 98.629  -21.467 -24.261 1.000 26.023  ? 6976 ALA C N     1 
ATOM   4825 C  CA    . ALA C  1 181 ? 99.799  -22.353 -24.040 1.000 26.772  ? 6976 ALA C CA    1 
ATOM   4826 C  C     . ALA C  1 181 ? 100.431 -22.090 -22.664 1.000 27.271  ? 6976 ALA C C     1 
ATOM   4827 O  O     . ALA C  1 181 ? 100.883 -23.060 -22.022 1.000 27.107  ? 6976 ALA C O     1 
ATOM   4828 C  CB    . ALA C  1 181 ? 100.802 -22.152 -25.148 1.000 28.123  ? 6976 ALA C CB    1 
ATOM   4829 N  N     . ASP C  1 182 ? 100.458 -20.829 -22.231 1.000 27.603  ? 6977 ASP C N     1 
ATOM   4830 C  CA    . ASP C  1 182 ? 101.062 -20.475 -20.919 1.000 28.963  ? 6977 ASP C CA    1 
ATOM   4831 C  C     . ASP C  1 182 ? 100.232 -21.090 -19.787 1.000 27.284  ? 6977 ASP C C     1 
ATOM   4832 O  O     . ASP C  1 182 ? 100.832 -21.492 -18.770 1.000 27.084  ? 6977 ASP C O     1 
ATOM   4833 C  CB    . ASP C  1 182 ? 101.219 -18.962 -20.781 1.000 31.131  ? 6977 ASP C CB    1 
ATOM   4834 C  CG    . ASP C  1 182 ? 102.395 -18.427 -21.576 1.000 36.803  ? 6977 ASP C CG    1 
ATOM   4835 O  OD1   . ASP C  1 182 ? 103.455 -19.097 -21.569 1.000 40.073  ? 6977 ASP C OD1   1 
ATOM   4836 O  OD2   . ASP C  1 182 ? 102.233 -17.375 -22.226 1.000 40.199  ? 6977 ASP C OD2   1 
ATOM   4837 N  N     . LEU C  1 183 ? 98.912  -21.154 -19.951 1.000 25.254  ? 6978 LEU C N     1 
ATOM   4838 C  CA    . LEU C  1 183 ? 98.064  -21.771 -18.898 1.000 24.700  ? 6978 LEU C CA    1 
ATOM   4839 C  C     . LEU C  1 183 ? 98.436  -23.252 -18.763 1.000 24.322  ? 6978 LEU C C     1 
ATOM   4840 O  O     . LEU C  1 183 ? 98.601  -23.716 -17.629 1.000 25.180  ? 6978 LEU C O     1 
ATOM   4841 C  CB    . LEU C  1 183 ? 96.587  -21.583 -19.243 1.000 24.103  ? 6978 LEU C CB    1 
ATOM   4842 C  CG    . LEU C  1 183 ? 95.607  -22.177 -18.231 1.000 24.678  ? 6978 LEU C CG    1 
ATOM   4843 C  CD1   . LEU C  1 183 ? 95.829  -21.593 -16.846 1.000 25.636  ? 6978 LEU C CD1   1 
ATOM   4844 C  CD2   . LEU C  1 183 ? 94.174  -21.949 -18.678 1.000 24.734  ? 6978 LEU C CD2   1 
ATOM   4845 N  N     . TYR C  1 184 ? 98.533  -23.981 -19.873 1.000 24.782  ? 6979 TYR C N     1 
ATOM   4846 C  CA    . TYR C  1 184 ? 98.956  -25.401 -19.770 1.000 24.506  ? 6979 TYR C CA    1 
ATOM   4847 C  C     . TYR C  1 184 ? 100.330 -25.498 -19.091 1.000 25.265  ? 6979 TYR C C     1 
ATOM   4848 O  O     . TYR C  1 184 ? 100.515 -26.379 -18.228 1.000 25.436  ? 6979 TYR C O     1 
ATOM   4849 C  CB    . TYR C  1 184 ? 98.994  -26.049 -21.149 1.000 24.948  ? 6979 TYR C CB    1 
ATOM   4850 C  CG    . TYR C  1 184 ? 97.686  -26.559 -21.688 1.000 23.784  ? 6979 TYR C CG    1 
ATOM   4851 C  CD1   . TYR C  1 184 ? 97.179  -27.767 -21.247 1.000 24.128  ? 6979 TYR C CD1   1 
ATOM   4852 C  CD2   . TYR C  1 184 ? 97.036  -25.927 -22.738 1.000 24.120  ? 6979 TYR C CD2   1 
ATOM   4853 C  CE1   . TYR C  1 184 ? 96.033  -28.316 -21.795 1.000 24.068  ? 6979 TYR C CE1   1 
ATOM   4854 C  CE2   . TYR C  1 184 ? 95.877  -26.454 -23.287 1.000 23.598  ? 6979 TYR C CE2   1 
ATOM   4855 C  CZ    . TYR C  1 184 ? 95.384  -27.662 -22.824 1.000 23.527  ? 6979 TYR C CZ    1 
ATOM   4856 O  OH    . TYR C  1 184 ? 94.259  -28.223 -23.355 1.000 24.496  ? 6979 TYR C OH    1 
ATOM   4857 N  N     . LYS C  1 185 ? 101.269 -24.628 -19.470 1.000 26.518  ? 6980 LYS C N     1 
ATOM   4858 C  CA    . LYS C  1 185 ? 102.618 -24.627 -18.841 1.000 28.771  ? 6980 LYS C CA    1 
ATOM   4859 C  C     . LYS C  1 185 ? 102.476 -24.448 -17.320 1.000 28.430  ? 6980 LYS C C     1 
ATOM   4860 O  O     . LYS C  1 185 ? 103.202 -25.143 -16.573 1.000 26.929  ? 6980 LYS C O     1 
ATOM   4861 C  CB    . LYS C  1 185 ? 103.479 -23.517 -19.454 1.000 31.992  ? 6980 LYS C CB    1 
ATOM   4862 C  CG    . LYS C  1 185 ? 104.883 -23.379 -18.876 1.000 36.347  ? 6980 LYS C CG    1 
ATOM   4863 C  CD    . LYS C  1 185 ? 105.741 -22.323 -19.561 1.000 39.878  ? 6980 LYS C CD    1 
ATOM   4864 C  CE    . LYS C  1 185 ? 106.031 -22.622 -21.019 1.000 43.970  ? 6980 LYS C CE    1 
ATOM   4865 N  NZ    . LYS C  1 185 ? 106.800 -23.881 -21.206 1.000 46.494  ? 6980 LYS C NZ    1 
ATOM   4866 N  N     . LEU C  1 186 ? 101.553 -23.577 -16.885 1.000 27.196  ? 6981 LEU C N     1 
ATOM   4867 C  CA    . LEU C  1 186 ? 101.345 -23.298 -15.433 1.000 27.799  ? 6981 LEU C CA    1 
ATOM   4868 C  C     . LEU C  1 186 ? 100.738 -24.520 -14.733 1.000 26.645  ? 6981 LEU C C     1 
ATOM   4869 O  O     . LEU C  1 186 ? 100.890 -24.612 -13.506 1.000 27.185  ? 6981 LEU C O     1 
ATOM   4870 C  CB    . LEU C  1 186 ? 100.460 -22.061 -15.250 1.000 28.410  ? 6981 LEU C CB    1 
ATOM   4871 C  CG    . LEU C  1 186 ? 101.131 -20.718 -15.526 1.000 30.759  ? 6981 LEU C CG    1 
ATOM   4872 C  CD1   . LEU C  1 186 ? 100.139 -19.578 -15.325 1.000 30.681  ? 6981 LEU C CD1   1 
ATOM   4873 C  CD2   . LEU C  1 186 ? 102.350 -20.522 -14.630 1.000 32.485  ? 6981 LEU C CD2   1 
ATOM   4874 N  N     . MET C  1 187 ? 100.078 -25.417 -15.472 1.000 26.027  ? 6982 MET C N     1 
ATOM   4875 C  CA    . MET C  1 187 ? 99.549  -26.651 -14.830 1.000 25.942  ? 6982 MET C CA    1 
ATOM   4876 C  C     . MET C  1 187 ? 100.726 -27.424 -14.211 1.000 26.341  ? 6982 MET C C     1 
ATOM   4877 O  O     . MET C  1 187 ? 100.500 -28.153 -13.222 1.000 26.069  ? 6982 MET C O     1 
ATOM   4878 C  CB    . MET C  1 187 ? 98.820  -27.561 -15.823 1.000 26.417  ? 6982 MET C CB    1 
ATOM   4879 C  CG    . MET C  1 187 ? 97.480  -27.039 -16.319 1.000 26.508  ? 6982 MET C CG    1 
ATOM   4880 S  SD    . MET C  1 187 ? 96.278  -26.737 -14.992 1.000 27.747  ? 6982 MET C SD    1 
ATOM   4881 C  CE    . MET C  1 187 ? 96.424  -24.966 -14.802 1.000 27.112  ? 6982 MET C CE    1 
ATOM   4882 N  N     . GLY C  1 188 ? 101.933 -27.245 -14.761 1.000 25.989  ? 6983 GLY C N     1 
ATOM   4883 C  CA    . GLY C  1 188 ? 103.144 -27.913 -14.247 1.000 27.383  ? 6983 GLY C CA    1 
ATOM   4884 C  C     . GLY C  1 188 ? 103.643 -27.293 -12.947 1.000 27.718  ? 6983 GLY C C     1 
ATOM   4885 O  O     . GLY C  1 188 ? 104.629 -27.822 -12.382 1.000 28.960  ? 6983 GLY C O     1 
ATOM   4886 N  N     . HIS C  1 189 ? 103.006 -26.204 -12.498 1.000 26.722  ? 6984 HIS C N     1 
ATOM   4887 C  CA    . HIS C  1 189 ? 103.377 -25.498 -11.239 1.000 27.303  ? 6984 HIS C CA    1 
ATOM   4888 C  C     . HIS C  1 189 ? 102.494 -26.007 -10.097 1.000 26.249  ? 6984 HIS C C     1 
ATOM   4889 O  O     . HIS C  1 189 ? 102.558 -25.429 -9.001  1.000 26.852  ? 6984 HIS C O     1 
ATOM   4890 C  CB    . HIS C  1 189 ? 103.250 -23.980 -11.412 1.000 27.564  ? 6984 HIS C CB    1 
ATOM   4891 C  CG    . HIS C  1 189 ? 104.237 -23.374 -12.351 1.000 29.173  ? 6984 HIS C CG    1 
ATOM   4892 N  ND1   . HIS C  1 189 ? 104.938 -22.230 -12.036 1.000 30.319  ? 6984 HIS C ND1   1 
ATOM   4893 C  CD2   . HIS C  1 189 ? 104.685 -23.771 -13.563 1.000 30.350  ? 6984 HIS C CD2   1 
ATOM   4894 C  CE1   . HIS C  1 189 ? 105.733 -21.914 -13.041 1.000 31.576  ? 6984 HIS C CE1   1 
ATOM   4895 N  NE2   . HIS C  1 189 ? 105.609 -22.852 -13.982 1.000 30.782  ? 6984 HIS C NE2   1 
ATOM   4896 N  N     . PHE C  1 190 ? 101.697 -27.041 -10.368 1.000 24.820  ? 6985 PHE C N     1 
ATOM   4897 C  CA    . PHE C  1 190 ? 100.812 -27.666 -9.356  1.000 24.374  ? 6985 PHE C CA    1 
ATOM   4898 C  C     . PHE C  1 190 ? 101.311 -29.082 -9.042  1.000 25.486  ? 6985 PHE C C     1 
ATOM   4899 O  O     . PHE C  1 190 ? 102.071 -29.655 -9.855  1.000 25.108  ? 6985 PHE C O     1 
ATOM   4900 C  CB    . PHE C  1 190 ? 99.366  -27.684 -9.852  1.000 23.304  ? 6985 PHE C CB    1 
ATOM   4901 C  CG    . PHE C  1 190 ? 98.734  -26.323 -9.988  1.000 22.290  ? 6985 PHE C CG    1 
ATOM   4902 C  CD1   . PHE C  1 190 ? 98.992  -25.531 -11.092 1.000 22.235  ? 6985 PHE C CD1   1 
ATOM   4903 C  CD2   . PHE C  1 190 ? 97.864  -25.845 -9.019  1.000 21.522  ? 6985 PHE C CD2   1 
ATOM   4904 C  CE1   . PHE C  1 190 ? 98.402  -24.282 -11.224 1.000 21.939  ? 6985 PHE C CE1   1 
ATOM   4905 C  CE2   . PHE C  1 190 ? 97.271  -24.600 -9.155  1.000 21.591  ? 6985 PHE C CE2   1 
ATOM   4906 C  CZ    . PHE C  1 190 ? 97.541  -23.820 -10.257 1.000 21.516  ? 6985 PHE C CZ    1 
ATOM   4907 N  N     . ALA C  1 191 ? 100.922 -29.611 -7.877  1.000 25.385  ? 6986 ALA C N     1 
ATOM   4908 C  CA    . ALA C  1 191 ? 101.320 -30.985 -7.482  1.000 26.990  ? 6986 ALA C CA    1 
ATOM   4909 C  C     . ALA C  1 191 ? 100.705 -31.988 -8.468  1.000 27.300  ? 6986 ALA C C     1 
ATOM   4910 O  O     . ALA C  1 191 ? 101.315 -33.040 -8.707  1.000 27.683  ? 6986 ALA C O     1 
ATOM   4911 C  CB    . ALA C  1 191 ? 100.881 -31.265 -6.067  1.000 27.506  ? 6986 ALA C CB    1 
ATOM   4912 N  N     . TRP C  1 192 ? 99.543  -31.650 -9.030  1.000 26.373  ? 6987 TRP C N     1 
ATOM   4913 C  CA    . TRP C  1 192 ? 98.854  -32.545 -9.994  1.000 26.490  ? 6987 TRP C CA    1 
ATOM   4914 C  C     . TRP C  1 192 ? 97.926  -31.707 -10.867 1.000 24.594  ? 6987 TRP C C     1 
ATOM   4915 O  O     . TRP C  1 192 ? 97.507  -30.617 -10.412 1.000 23.883  ? 6987 TRP C O     1 
ATOM   4916 C  CB    . TRP C  1 192 ? 98.087  -33.642 -9.243  1.000 28.264  ? 6987 TRP C CB    1 
ATOM   4917 C  CG    . TRP C  1 192 ? 97.482  -34.695 -10.119 1.000 29.586  ? 6987 TRP C CG    1 
ATOM   4918 C  CD1   . TRP C  1 192 ? 98.104  -35.804 -10.615 1.000 32.549  ? 6987 TRP C CD1   1 
ATOM   4919 C  CD2   . TRP C  1 192 ? 96.116  -34.774 -10.562 1.000 29.794  ? 6987 TRP C CD2   1 
ATOM   4920 N  NE1   . TRP C  1 192 ? 97.232  -36.548 -11.361 1.000 32.246  ? 6987 TRP C NE1   1 
ATOM   4921 C  CE2   . TRP C  1 192 ? 96.003  -35.949 -11.336 1.000 31.514  ? 6987 TRP C CE2   1 
ATOM   4922 C  CE3   . TRP C  1 192 ? 94.990  -33.962 -10.400 1.000 30.047  ? 6987 TRP C CE3   1 
ATOM   4923 C  CZ2   . TRP C  1 192 ? 94.809  -36.324 -11.946 1.000 31.434  ? 6987 TRP C CZ2   1 
ATOM   4924 C  CZ3   . TRP C  1 192 ? 93.805  -34.340 -10.995 1.000 29.549  ? 6987 TRP C CZ3   1 
ATOM   4925 C  CH2   . TRP C  1 192 ? 93.718  -35.513 -11.741 1.000 30.243  ? 6987 TRP C CH2   1 
ATOM   4926 N  N     . TRP C  1 193 ? 97.617  -32.190 -12.069 1.000 23.599  ? 6988 TRP C N     1 
ATOM   4927 C  CA    . TRP C  1 193 ? 96.705  -31.420 -12.949 1.000 22.727  ? 6988 TRP C CA    1 
ATOM   4928 C  C     . TRP C  1 193 ? 95.984  -32.380 -13.893 1.000 22.477  ? 6988 TRP C C     1 
ATOM   4929 O  O     . TRP C  1 193 ? 96.466  -33.507 -14.087 1.000 22.358  ? 6988 TRP C O     1 
ATOM   4930 C  CB    . TRP C  1 193 ? 97.482  -30.368 -13.753 1.000 22.909  ? 6988 TRP C CB    1 
ATOM   4931 C  CG    . TRP C  1 193 ? 98.206  -30.964 -14.922 1.000 23.503  ? 6988 TRP C CG    1 
ATOM   4932 C  CD1   . TRP C  1 193 ? 99.426  -31.574 -14.913 1.000 24.562  ? 6988 TRP C CD1   1 
ATOM   4933 C  CD2   . TRP C  1 193 ? 97.708  -31.080 -16.267 1.000 22.888  ? 6988 TRP C CD2   1 
ATOM   4934 N  NE1   . TRP C  1 193 ? 99.735  -32.036 -16.167 1.000 24.885  ? 6988 TRP C NE1   1 
ATOM   4935 C  CE2   . TRP C  1 193 ? 98.701  -31.745 -17.019 1.000 24.279  ? 6988 TRP C CE2   1 
ATOM   4936 C  CE3   . TRP C  1 193 ? 96.541  -30.664 -16.917 1.000 22.748  ? 6988 TRP C CE3   1 
ATOM   4937 C  CZ2   . TRP C  1 193 ? 98.548  -32.017 -18.379 1.000 24.487  ? 6988 TRP C CZ2   1 
ATOM   4938 C  CZ3   . TRP C  1 193 ? 96.392  -30.934 -18.262 1.000 23.229  ? 6988 TRP C CZ3   1 
ATOM   4939 C  CH2   . TRP C  1 193 ? 97.380  -31.607 -18.978 1.000 23.666  ? 6988 TRP C CH2   1 
ATOM   4940 N  N     . THR C  1 194 ? 94.862  -31.933 -14.451 1.000 22.323  ? 6989 THR C N     1 
ATOM   4941 C  CA    . THR C  1 194 ? 94.187  -32.739 -15.494 1.000 22.340  ? 6989 THR C CA    1 
ATOM   4942 C  C     . THR C  1 194 ? 93.279  -31.831 -16.315 1.000 22.262  ? 6989 THR C C     1 
ATOM   4943 O  O     . THR C  1 194 ? 93.177  -30.625 -15.987 1.000 21.807  ? 6989 THR C O     1 
ATOM   4944 C  CB    . THR C  1 194 ? 93.356  -33.888 -14.906 1.000 22.791  ? 6989 THR C CB    1 
ATOM   4945 O  OG1   . THR C  1 194 ? 93.016  -34.774 -15.975 1.000 23.677  ? 6989 THR C OG1   1 
ATOM   4946 C  CG2   . THR C  1 194 ? 92.099  -33.418 -14.205 1.000 22.283  ? 6989 THR C CG2   1 
ATOM   4947 N  N     . ALA C  1 195 ? 92.741  -32.393 -17.396 1.000 22.280  ? 6990 ALA C N     1 
ATOM   4948 C  CA    . ALA C  1 195 ? 91.691  -31.761 -18.218 1.000 22.071  ? 6990 ALA C CA    1 
ATOM   4949 C  C     . ALA C  1 195 ? 90.440  -32.595 -17.929 1.000 21.773  ? 6990 ALA C C     1 
ATOM   4950 O  O     . ALA C  1 195 ? 90.473  -33.825 -18.218 1.000 21.548  ? 6990 ALA C O     1 
ATOM   4951 C  CB    . ALA C  1 195 ? 92.060  -31.760 -19.678 1.000 22.680  ? 6990 ALA C CB    1 
ATOM   4952 N  N     . PHE C  1 196 ? 89.428  -31.979 -17.317 1.000 20.860  ? 6991 PHE C N     1 
ATOM   4953 C  CA    . PHE C  1 196 ? 88.204  -32.712 -16.908 1.000 20.906  ? 6991 PHE C CA    1 
ATOM   4954 C  C     . PHE C  1 196 ? 87.029  -32.317 -17.792 1.000 20.426  ? 6991 PHE C C     1 
ATOM   4955 O  O     . PHE C  1 196 ? 86.739  -31.119 -17.945 1.000 19.794  ? 6991 PHE C O     1 
ATOM   4956 C  CB    . PHE C  1 196 ? 87.877  -32.450 -15.437 1.000 21.019  ? 6991 PHE C CB    1 
ATOM   4957 C  CG    . PHE C  1 196 ? 86.581  -33.065 -14.976 1.000 21.194  ? 6991 PHE C CG    1 
ATOM   4958 C  CD1   . PHE C  1 196 ? 86.506  -34.416 -14.687 1.000 22.098  ? 6991 PHE C CD1   1 
ATOM   4959 C  CD2   . PHE C  1 196 ? 85.445  -32.286 -14.809 1.000 21.288  ? 6991 PHE C CD2   1 
ATOM   4960 C  CE1   . PHE C  1 196 ? 85.318  -34.985 -14.257 1.000 22.518  ? 6991 PHE C CE1   1 
ATOM   4961 C  CE2   . PHE C  1 196 ? 84.257  -32.858 -14.381 1.000 21.829  ? 6991 PHE C CE2   1 
ATOM   4962 C  CZ    . PHE C  1 196 ? 84.197  -34.203 -14.102 1.000 22.068  ? 6991 PHE C CZ    1 
ATOM   4963 N  N     . VAL C  1 197 ? 86.375  -33.336 -18.343 1.000 21.097  ? 6992 VAL C N     1 
ATOM   4964 C  CA    . VAL C  1 197 ? 85.184  -33.165 -19.220 1.000 20.887  ? 6992 VAL C CA    1 
ATOM   4965 C  C     . VAL C  1 197 ? 83.941  -33.582 -18.426 1.000 20.446  ? 6992 VAL C C     1 
ATOM   4966 O  O     . VAL C  1 197 ? 83.883  -34.747 -18.005 1.000 20.787  ? 6992 VAL C O     1 
ATOM   4967 C  CB    . VAL C  1 197 ? 85.336  -34.011 -20.500 1.000 21.621  ? 6992 VAL C CB    1 
ATOM   4968 C  CG1   . VAL C  1 197 ? 84.076  -33.988 -21.351 1.000 22.420  ? 6992 VAL C CG1   1 
ATOM   4969 C  CG2   . VAL C  1 197 ? 86.545  -33.581 -21.320 1.000 21.648  ? 6992 VAL C CG2   1 
ATOM   4970 N  N     . THR C  1 198 ? 82.983  -32.673 -18.246 1.000 20.143  ? 6993 THR C N     1 
ATOM   4971 C  CA    . THR C  1 198 ? 81.728  -33.041 -17.543 1.000 20.833  ? 6993 THR C CA    1 
ATOM   4972 C  C     . THR C  1 198 ? 80.949  -34.029 -18.416 1.000 21.648  ? 6993 THR C C     1 
ATOM   4973 O  O     . THR C  1 198 ? 80.939  -33.873 -19.657 1.000 22.280  ? 6993 THR C O     1 
ATOM   4974 C  CB    . THR C  1 198 ? 80.872  -31.813 -17.211 1.000 21.070  ? 6993 THR C CB    1 
ATOM   4975 O  OG1   . THR C  1 198 ? 80.391  -31.228 -18.425 1.000 20.882  ? 6993 THR C OG1   1 
ATOM   4976 C  CG2   . THR C  1 198 ? 81.635  -30.794 -16.392 1.000 20.141  ? 6993 THR C CG2   1 
ATOM   4977 N  N     . ASN C  1 199 ? 80.318  -35.014 -17.796 1.000 22.059  ? 6994 ASN C N     1 
ATOM   4978 C  CA    . ASN C  1 199 ? 79.529  -35.981 -18.596 1.000 22.780  ? 6994 ASN C CA    1 
ATOM   4979 C  C     . ASN C  1 199 ? 78.309  -35.300 -19.231 1.000 22.635  ? 6994 ASN C C     1 
ATOM   4980 O  O     . ASN C  1 199 ? 77.892  -35.745 -20.312 1.000 22.965  ? 6994 ASN C O     1 
ATOM   4981 C  CB    . ASN C  1 199 ? 79.121  -37.203 -17.773 1.000 23.612  ? 6994 ASN C CB    1 
ATOM   4982 C  CG    . ASN C  1 199 ? 80.144  -38.317 -17.837 1.000 24.429  ? 6994 ASN C CG    1 
ATOM   4983 O  OD1   . ASN C  1 199 ? 80.933  -38.383 -18.782 1.000 24.068  ? 6994 ASN C OD1   1 
ATOM   4984 N  ND2   . ASN C  1 199 ? 80.106  -39.222 -16.872 1.000 24.503  ? 6994 ASN C ND2   1 
ATOM   4985 N  N     A VAL C  1 200 ? 77.771  -34.230 -18.630 0.600 21.910  ? 6995 VAL C N     1 
ATOM   4986 N  N     B VAL C  1 200 ? 77.820  -34.224 -18.611 0.400 22.095  ? 6995 VAL C N     1 
ATOM   4987 C  CA    A VAL C  1 200 ? 76.544  -33.616 -19.233 0.600 22.426  ? 6995 VAL C CA    1 
ATOM   4988 C  CA    B VAL C  1 200 ? 76.584  -33.552 -19.104 0.400 22.545  ? 6995 VAL C CA    1 
ATOM   4989 C  C     A VAL C  1 200 ? 76.910  -32.825 -20.490 0.600 22.650  ? 6995 VAL C C     1 
ATOM   4990 C  C     B VAL C  1 200 ? 76.888  -32.714 -20.355 0.400 22.698  ? 6995 VAL C C     1 
ATOM   4991 O  O     A VAL C  1 200 ? 76.031  -32.673 -21.344 0.600 23.633  ? 6995 VAL C O     1 
ATOM   4992 O  O     B VAL C  1 200 ? 75.926  -32.390 -21.065 0.400 23.283  ? 6995 VAL C O     1 
ATOM   4993 C  CB    A VAL C  1 200 ? 75.754  -32.726 -18.253 0.600 22.073  ? 6995 VAL C CB    1 
ATOM   4994 C  CB    B VAL C  1 200 ? 75.953  -32.699 -17.988 0.400 22.233  ? 6995 VAL C CB    1 
ATOM   4995 C  CG1   A VAL C  1 200 ? 75.108  -33.541 -17.152 0.600 22.482  ? 6995 VAL C CG1   1 
ATOM   4996 C  CG1   B VAL C  1 200 ? 76.727  -31.411 -17.753 0.400 21.470  ? 6995 VAL C CG1   1 
ATOM   4997 C  CG2   A VAL C  1 200 ? 76.590  -31.586 -17.685 0.600 21.310  ? 6995 VAL C CG2   1 
ATOM   4998 C  CG2   B VAL C  1 200 ? 74.500  -32.391 -18.281 0.400 22.855  ? 6995 VAL C CG2   1 
ATOM   4999 N  N     . ASN C  1 201 ? 78.156  -32.363 -20.606 1.000 22.541  ? 6996 ASN C N     1 
ATOM   5000 C  CA    . ASN C  1 201 ? 78.525  -31.542 -21.791 1.000 23.190  ? 6996 ASN C CA    1 
ATOM   5001 C  C     . ASN C  1 201 ? 79.624  -32.221 -22.619 1.000 23.857  ? 6996 ASN C C     1 
ATOM   5002 O  O     . ASN C  1 201 ? 80.331  -31.508 -23.357 1.000 23.910  ? 6996 ASN C O     1 
ATOM   5003 C  CB    . ASN C  1 201 ? 78.954  -30.144 -21.347 1.000 22.507  ? 6996 ASN C CB    1 
ATOM   5004 C  CG    . ASN C  1 201 ? 78.834  -29.138 -22.466 1.000 23.827  ? 6996 ASN C CG    1 
ATOM   5005 O  OD1   . ASN C  1 201 ? 77.977  -29.290 -23.337 1.000 23.944  ? 6996 ASN C OD1   1 
ATOM   5006 N  ND2   . ASN C  1 201 ? 79.669  -28.110 -22.438 1.000 23.456  ? 6996 ASN C ND2   1 
ATOM   5007 N  N     . ALA C  1 202 ? 79.702  -33.551 -22.571 1.000 24.870  ? 6997 ALA C N     1 
ATOM   5008 C  CA    . ALA C  1 202 ? 80.766  -34.310 -23.274 1.000 25.306  ? 6997 ALA C CA    1 
ATOM   5009 C  C     . ALA C  1 202 ? 80.642  -34.210 -24.805 1.000 25.487  ? 6997 ALA C C     1 
ATOM   5010 O  O     . ALA C  1 202 ? 81.566  -34.690 -25.490 1.000 24.166  ? 6997 ALA C O     1 
ATOM   5011 C  CB    . ALA C  1 202 ? 80.745  -35.743 -22.808 1.000 26.916  ? 6997 ALA C CB    1 
ATOM   5012 N  N     . SER C  1 203 ? 79.550  -33.632 -25.320 1.000 25.936  ? 6998 SER C N     1 
ATOM   5013 C  CA    . SER C  1 203 ? 79.374  -33.435 -26.785 1.000 27.508  ? 6998 SER C CA    1 
ATOM   5014 C  C     . SER C  1 203 ? 80.170  -32.202 -27.232 1.000 26.715  ? 6998 SER C C     1 
ATOM   5015 O  O     . SER C  1 203 ? 80.258  -31.958 -28.453 1.000 27.218  ? 6998 SER C O     1 
ATOM   5016 C  CB    . SER C  1 203 ? 77.917  -33.281 -27.132 1.000 29.854  ? 6998 SER C CB    1 
ATOM   5017 O  OG    . SER C  1 203 ? 77.342  -32.212 -26.388 1.000 30.718  ? 6998 SER C OG    1 
ATOM   5018 N  N     . SER C  1 204 ? 80.705  -31.451 -26.266 1.000 24.760  ? 6999 SER C N     1 
ATOM   5019 C  CA    . SER C  1 204 ? 81.499  -30.224 -26.523 1.000 23.943  ? 6999 SER C CA    1 
ATOM   5020 C  C     . SER C  1 204 ? 83.001  -30.486 -26.324 1.000 23.483  ? 6999 SER C C     1 
ATOM   5021 O  O     . SER C  1 204 ? 83.357  -31.357 -25.495 1.000 22.074  ? 6999 SER C O     1 
ATOM   5022 C  CB    . SER C  1 204 ? 81.045  -29.106 -25.610 1.000 23.590  ? 6999 SER C CB    1 
ATOM   5023 O  OG    . SER C  1 204 ? 81.904  -27.980 -25.741 1.000 24.422  ? 6999 SER C OG    1 
ATOM   5024 N  N     . SER C  1 205 ? 83.842  -29.697 -27.001 1.000 22.858  ? 7000 SER C N     1 
ATOM   5025 C  CA    . SER C  1 205 ? 85.319  -29.788 -26.842 1.000 23.014  ? 7000 SER C CA    1 
ATOM   5026 C  C     . SER C  1 205 ? 85.710  -29.136 -25.509 1.000 22.461  ? 7000 SER C C     1 
ATOM   5027 O  O     . SER C  1 205 ? 86.910  -29.091 -25.181 1.000 22.450  ? 7000 SER C O     1 
ATOM   5028 C  CB    . SER C  1 205 ? 86.030  -29.133 -27.997 1.000 23.705  ? 7000 SER C CB    1 
ATOM   5029 O  OG    . SER C  1 205 ? 85.745  -27.747 -28.036 1.000 22.967  ? 7000 SER C OG    1 
ATOM   5030 N  N     . GLU C  1 206 ? 84.715  -28.626 -24.786 1.000 22.432  ? 7001 GLU C N     1 
ATOM   5031 C  CA    . GLU C  1 206 ? 84.940  -27.972 -23.474 1.000 22.283  ? 7001 GLU C CA    1 
ATOM   5032 C  C     . GLU C  1 206 ? 85.598  -28.938 -22.479 1.000 21.622  ? 7001 GLU C C     1 
ATOM   5033 O  O     . GLU C  1 206 ? 85.297  -30.142 -22.511 1.000 21.268  ? 7001 GLU C O     1 
ATOM   5034 C  CB    . GLU C  1 206 ? 83.607  -27.504 -22.887 1.000 22.620  ? 7001 GLU C CB    1 
ATOM   5035 C  CG    . GLU C  1 206 ? 83.678  -27.096 -21.422 1.000 22.738  ? 7001 GLU C CG    1 
ATOM   5036 C  CD    . GLU C  1 206 ? 82.322  -26.732 -20.850 1.000 23.609  ? 7001 GLU C CD    1 
ATOM   5037 O  OE1   . GLU C  1 206 ? 81.893  -25.577 -21.040 1.000 23.685  ? 7001 GLU C OE1   1 
ATOM   5038 O  OE2   . GLU C  1 206 ? 81.639  -27.651 -20.332 1.000 24.485  ? 7001 GLU C OE2   1 
ATOM   5039 N  N     . ALA C  1 207 ? 86.482  -28.391 -21.650 1.000 20.983  ? 7002 ALA C N     1 
ATOM   5040 C  CA    . ALA C  1 207 ? 87.069  -29.120 -20.504 1.000 20.452  ? 7002 ALA C CA    1 
ATOM   5041 C  C     . ALA C  1 207 ? 87.474  -28.084 -19.456 1.000 20.175  ? 7002 ALA C C     1 
ATOM   5042 O  O     . ALA C  1 207 ? 87.564  -26.867 -19.785 1.000 19.685  ? 7002 ALA C O     1 
ATOM   5043 C  CB    . ALA C  1 207 ? 88.245  -29.969 -20.905 1.000 21.157  ? 7002 ALA C CB    1 
ATOM   5044 N  N     . PHE C  1 208 ? 87.618  -28.539 -18.224 1.000 19.855  ? 7003 PHE C N     1 
ATOM   5045 C  CA    . PHE C  1 208 ? 88.155  -27.663 -17.165 1.000 20.324  ? 7003 PHE C CA    1 
ATOM   5046 C  C     . PHE C  1 208 ? 89.597  -28.075 -16.898 1.000 20.093  ? 7003 PHE C C     1 
ATOM   5047 O  O     . PHE C  1 208 ? 89.807  -29.262 -16.571 1.000 20.793  ? 7003 PHE C O     1 
ATOM   5048 C  CB    . PHE C  1 208 ? 87.293  -27.743 -15.907 1.000 20.118  ? 7003 PHE C CB    1 
ATOM   5049 C  CG    . PHE C  1 208 ? 85.966  -27.066 -16.081 1.000 20.611  ? 7003 PHE C CG    1 
ATOM   5050 C  CD1   . PHE C  1 208 ? 85.828  -25.714 -15.815 1.000 21.573  ? 7003 PHE C CD1   1 
ATOM   5051 C  CD2   . PHE C  1 208 ? 84.875  -27.766 -16.563 1.000 22.036  ? 7003 PHE C CD2   1 
ATOM   5052 C  CE1   . PHE C  1 208 ? 84.608  -25.087 -15.996 1.000 22.590  ? 7003 PHE C CE1   1 
ATOM   5053 C  CE2   . PHE C  1 208 ? 83.659  -27.129 -16.754 1.000 22.918  ? 7003 PHE C CE2   1 
ATOM   5054 C  CZ    . PHE C  1 208 ? 83.529  -25.796 -16.466 1.000 22.455  ? 7003 PHE C CZ    1 
ATOM   5055 N  N     . LEU C  1 209 ? 90.543  -27.157 -17.121 1.000 20.180  ? 7004 LEU C N     1 
ATOM   5056 C  CA    . LEU C  1 209 ? 91.956  -27.434 -16.774 1.000 21.584  ? 7004 LEU C CA    1 
ATOM   5057 C  C     . LEU C  1 209 ? 92.047  -27.257 -15.267 1.000 21.550  ? 7004 LEU C C     1 
ATOM   5058 O  O     . LEU C  1 209 ? 91.822  -26.111 -14.783 1.000 20.713  ? 7004 LEU C O     1 
ATOM   5059 C  CB    . LEU C  1 209 ? 92.921  -26.485 -17.481 1.000 23.310  ? 7004 LEU C CB    1 
ATOM   5060 C  CG    . LEU C  1 209 ? 93.105  -26.694 -18.972 1.000 25.499  ? 7004 LEU C CG    1 
ATOM   5061 C  CD1   . LEU C  1 209 ? 94.242  -25.810 -19.480 1.000 25.736  ? 7004 LEU C CD1   1 
ATOM   5062 C  CD2   . LEU C  1 209 ? 93.387  -28.158 -19.289 1.000 27.219  ? 7004 LEU C CD2   1 
ATOM   5063 N  N     . ILE C  1 210 ? 92.322  -28.351 -14.570 1.000 21.207  ? 7005 ILE C N     1 
ATOM   5064 C  CA    . ILE C  1 210 ? 92.349  -28.333 -13.083 1.000 20.866  ? 7005 ILE C CA    1 
ATOM   5065 C  C     . ILE C  1 210 ? 93.788  -28.462 -12.598 1.000 21.511  ? 7005 ILE C C     1 
ATOM   5066 O  O     . ILE C  1 210 ? 94.452  -29.434 -12.973 1.000 21.953  ? 7005 ILE C O     1 
ATOM   5067 C  CB    . ILE C  1 210 ? 91.440  -29.446 -12.523 1.000 20.919  ? 7005 ILE C CB    1 
ATOM   5068 C  CG1   . ILE C  1 210 ? 89.987  -29.224 -12.953 1.000 20.397  ? 7005 ILE C CG1   1 
ATOM   5069 C  CG2   . ILE C  1 210 ? 91.572  -29.549 -11.003 1.000 21.493  ? 7005 ILE C CG2   1 
ATOM   5070 C  CD1   . ILE C  1 210 ? 89.077  -30.388 -12.650 1.000 21.185  ? 7005 ILE C CD1   1 
ATOM   5071 N  N     . GLY C  1 211 ? 94.233  -27.460 -11.843 1.000 21.961  ? 7006 GLY C N     1 
ATOM   5072 C  CA    . GLY C  1 211 ? 95.547  -27.434 -11.178 1.000 22.948  ? 7006 GLY C CA    1 
ATOM   5073 C  C     . GLY C  1 211 ? 95.295  -27.674 -9.703  1.000 23.557  ? 7006 GLY C C     1 
ATOM   5074 O  O     . GLY C  1 211 ? 94.540  -26.869 -9.094  1.000 21.520  ? 7006 GLY C O     1 
ATOM   5075 N  N     . CYS C  1 212 ? 95.837  -28.765 -9.160  1.000 24.962  ? 7007 CYS C N     1 
ATOM   5076 C  CA    . CYS C  1 212 ? 95.543  -29.116 -7.750  1.000 25.987  ? 7007 CYS C CA    1 
ATOM   5077 C  C     . CYS C  1 212 ? 96.795  -28.931 -6.883  1.000 25.852  ? 7007 CYS C C     1 
ATOM   5078 O  O     . CYS C  1 212 ? 97.803  -29.635 -7.124  1.000 26.183  ? 7007 CYS C O     1 
ATOM   5079 C  CB    . CYS C  1 212 ? 95.016  -30.544 -7.666  1.000 29.044  ? 7007 CYS C CB    1 
ATOM   5080 S  SG    . CYS C  1 212 ? 94.342  -30.959 -6.039  1.000 34.895  ? 7007 CYS C SG    1 
ATOM   5081 N  N     . ASN C  1 213 ? 96.717  -27.979 -5.950  1.000 24.733  ? 7008 ASN C N     1 
ATOM   5082 C  CA    . ASN C  1 213 ? 97.774  -27.653 -4.952  1.000 24.696  ? 7008 ASN C CA    1 
ATOM   5083 C  C     . ASN C  1 213 ? 98.941  -26.936 -5.639  1.000 24.280  ? 7008 ASN C C     1 
ATOM   5084 O  O     . ASN C  1 213 ? 99.909  -27.599 -6.042  1.000 24.828  ? 7008 ASN C O     1 
ATOM   5085 C  CB    . ASN C  1 213 ? 98.195  -28.905 -4.187  1.000 25.310  ? 7008 ASN C CB    1 
ATOM   5086 C  CG    . ASN C  1 213 ? 97.018  -29.624 -3.558  1.000 26.132  ? 7008 ASN C CG    1 
ATOM   5087 O  OD1   . ASN C  1 213 ? 96.878  -30.830 -3.738  1.000 26.945  ? 7008 ASN C OD1   1 
ATOM   5088 N  ND2   . ASN C  1 213 ? 96.143  -28.897 -2.865  1.000 24.254  ? 7008 ASN C ND2   1 
ATOM   5089 N  N     . TYR C  1 214 ? 98.871  -25.608 -5.666  1.000 24.497  ? 7009 TYR C N     1 
ATOM   5090 C  CA    . TYR C  1 214 ? 99.881  -24.737 -6.322  1.000 25.175  ? 7009 TYR C CA    1 
ATOM   5091 C  C     . TYR C  1 214 ? 101.198 -24.757 -5.534  1.000 26.638  ? 7009 TYR C C     1 
ATOM   5092 O  O     . TYR C  1 214 ? 101.171 -24.572 -4.293  1.000 26.871  ? 7009 TYR C O     1 
ATOM   5093 C  CB    . TYR C  1 214 ? 99.278  -23.341 -6.467  1.000 24.832  ? 7009 TYR C CB    1 
ATOM   5094 C  CG    . TYR C  1 214 ? 100.193 -22.304 -7.050  1.000 25.608  ? 7009 TYR C CG    1 
ATOM   5095 C  CD1   . TYR C  1 214 ? 100.650 -22.411 -8.352  1.000 26.417  ? 7009 TYR C CD1   1 
ATOM   5096 C  CD2   . TYR C  1 214 ? 100.536 -21.178 -6.326  1.000 26.617  ? 7009 TYR C CD2   1 
ATOM   5097 C  CE1   . TYR C  1 214 ? 101.459 -21.438 -8.911  1.000 27.683  ? 7009 TYR C CE1   1 
ATOM   5098 C  CE2   . TYR C  1 214 ? 101.355 -20.201 -6.867  1.000 27.613  ? 7009 TYR C CE2   1 
ATOM   5099 C  CZ    . TYR C  1 214 ? 101.811 -20.329 -8.164  1.000 28.159  ? 7009 TYR C CZ    1 
ATOM   5100 O  OH    . TYR C  1 214 ? 102.624 -19.373 -8.691  1.000 29.583  ? 7009 TYR C OH    1 
ATOM   5101 N  N     . LEU C  1 215 ? 102.318 -24.920 -6.249  1.000 27.353  ? 7010 LEU C N     1 
ATOM   5102 C  CA    . LEU C  1 215 ? 103.662 -25.025 -5.616  1.000 29.463  ? 7010 LEU C CA    1 
ATOM   5103 C  C     . LEU C  1 215 ? 104.482 -23.748 -5.841  1.000 30.618  ? 7010 LEU C C     1 
ATOM   5104 O  O     . LEU C  1 215 ? 105.551 -23.651 -5.244  1.000 31.319  ? 7010 LEU C O     1 
ATOM   5105 C  CB    . LEU C  1 215 ? 104.375 -26.262 -6.172  1.000 30.490  ? 7010 LEU C CB    1 
ATOM   5106 C  CG    . LEU C  1 215 ? 103.644 -27.587 -5.948  1.000 30.840  ? 7010 LEU C CG    1 
ATOM   5107 C  CD1   . LEU C  1 215 ? 104.434 -28.747 -6.529  1.000 31.789  ? 7010 LEU C CD1   1 
ATOM   5108 C  CD2   . LEU C  1 215 ? 103.372 -27.822 -4.465  1.000 31.279  ? 7010 LEU C CD2   1 
ATOM   5109 N  N     . GLY C  1 216 ? 104.005 -22.816 -6.673  1.000 31.967  ? 7011 GLY C N     1 
ATOM   5110 C  CA    . GLY C  1 216 ? 104.711 -21.532 -6.879  1.000 33.314  ? 7011 GLY C CA    1 
ATOM   5111 C  C     . GLY C  1 216 ? 105.948 -21.646 -7.756  1.000 35.637  ? 7011 GLY C C     1 
ATOM   5112 O  O     . GLY C  1 216 ? 106.661 -20.636 -7.890  1.000 36.667  ? 7011 GLY C O     1 
ATOM   5113 N  N     . LYS C  1 217 ? 106.196 -22.822 -8.329  1.000 36.834  ? 7012 LYS C N     1 
ATOM   5114 C  CA    . LYS C  1 217 ? 107.378 -23.032 -9.205  1.000 40.053  ? 7012 LYS C CA    1 
ATOM   5115 C  C     . LYS C  1 217 ? 107.099 -24.254 -10.070 1.000 39.424  ? 7012 LYS C C     1 
ATOM   5116 O  O     . LYS C  1 217 ? 106.267 -25.086 -9.709  1.000 36.114  ? 7012 LYS C O     1 
ATOM   5117 C  CB    . LYS C  1 217 ? 108.648 -23.222 -8.369  1.000 43.492  ? 7012 LYS C CB    1 
ATOM   5118 C  CG    . LYS C  1 217 ? 108.699 -24.503 -7.549  1.000 45.877  ? 7012 LYS C CG    1 
ATOM   5119 C  CD    . LYS C  1 217 ? 109.966 -24.637 -6.738  1.000 50.065  ? 7012 LYS C CD    1 
ATOM   5120 C  CE    . LYS C  1 217 ? 110.090 -25.979 -6.051  1.000 52.130  ? 7012 LYS C CE    1 
ATOM   5121 N  NZ    . LYS C  1 217 ? 111.361 -26.083 -5.294  1.000 53.958  ? 7012 LYS C NZ    1 
ATOM   5122 N  N     . PRO C  1 218 ? 107.782 -24.411 -11.226 1.000 40.487  ? 7013 PRO C N     1 
ATOM   5123 C  CA    . PRO C  1 218 ? 107.521 -25.550 -12.091 1.000 41.166  ? 7013 PRO C CA    1 
ATOM   5124 C  C     . PRO C  1 218 ? 108.017 -26.892 -11.540 1.000 43.324  ? 7013 PRO C C     1 
ATOM   5125 O  O     . PRO C  1 218 ? 109.204 -27.063 -11.342 1.000 47.723  ? 7013 PRO C O     1 
ATOM   5126 C  CB    . PRO C  1 218 ? 108.254 -25.213 -13.403 1.000 42.135  ? 7013 PRO C CB    1 
ATOM   5127 C  CG    . PRO C  1 218 ? 109.317 -24.203 -13.010 1.000 42.830  ? 7013 PRO C CG    1 
ATOM   5128 C  CD    . PRO C  1 218 ? 108.785 -23.491 -11.782 1.000 41.815  ? 7013 PRO C CD    1 
ATOM   5129 N  N     A ARG C  1 219 ? 107.072 -27.798 -11.276 0.500 41.524  ? 7014 ARG C N     1 
ATOM   5130 N  N     B ARG C  1 219 ? 107.070 -27.789 -11.256 0.500 42.641  ? 7014 ARG C N     1 
ATOM   5131 C  CA    A ARG C  1 219 ? 107.377 -29.177 -10.818 0.500 41.680  ? 7014 ARG C CA    1 
ATOM   5132 C  CA    B ARG C  1 219 ? 107.367 -29.177 -10.821 0.500 43.476  ? 7014 ARG C CA    1 
ATOM   5133 C  C     A ARG C  1 219 ? 107.769 -29.986 -12.059 0.500 42.223  ? 7014 ARG C C     1 
ATOM   5134 C  C     B ARG C  1 219 ? 107.780 -29.971 -12.063 0.500 43.273  ? 7014 ARG C C     1 
ATOM   5135 O  O     A ARG C  1 219 ? 108.653 -30.859 -11.956 0.500 43.086  ? 7014 ARG C O     1 
ATOM   5136 O  O     B ARG C  1 219 ? 108.690 -30.818 -11.964 0.500 44.087  ? 7014 ARG C O     1 
ATOM   5137 C  CB    A ARG C  1 219 ? 106.161 -29.773 -10.106 0.500 41.173  ? 7014 ARG C CB    1 
ATOM   5138 C  CB    B ARG C  1 219 ? 106.135 -29.797 -10.159 0.500 44.513  ? 7014 ARG C CB    1 
ATOM   5139 C  CG    A ARG C  1 219 ? 106.311 -31.240 -9.736  0.500 42.133  ? 7014 ARG C CG    1 
ATOM   5140 C  CG    B ARG C  1 219 ? 106.042 -31.304 -10.340 0.500 46.680  ? 7014 ARG C CG    1 
ATOM   5141 C  CD    A ARG C  1 219 ? 105.011 -31.820 -9.218  0.500 40.677  ? 7014 ARG C CD    1 
ATOM   5142 C  CD    B ARG C  1 219 ? 104.729 -31.856 -9.829  0.500 46.611  ? 7014 ARG C CD    1 
ATOM   5143 N  NE    A ARG C  1 219 ? 103.908 -31.570 -10.135 0.500 39.112  ? 7014 ARG C NE    1 
ATOM   5144 N  NE    B ARG C  1 219 ? 104.428 -33.127 -10.465 0.500 48.552  ? 7014 ARG C NE    1 
ATOM   5145 C  CZ    A ARG C  1 219 ? 103.671 -32.262 -11.243 0.500 40.170  ? 7014 ARG C CZ    1 
ATOM   5146 C  CZ    B ARG C  1 219 ? 103.713 -33.245 -11.580 0.500 49.854  ? 7014 ARG C CZ    1 
ATOM   5147 N  NH1   A ARG C  1 219 ? 104.484 -33.244 -11.597 0.500 42.001  ? 7014 ARG C NH1   1 
ATOM   5148 N  NH1   B ARG C  1 219 ? 103.224 -32.167 -12.168 0.500 49.247  ? 7014 ARG C NH1   1 
ATOM   5149 N  NH2   A ARG C  1 219 ? 102.635 -31.954 -12.006 0.500 39.403  ? 7014 ARG C NH2   1 
ATOM   5150 N  NH2   B ARG C  1 219 ? 103.483 -34.435 -12.102 0.500 51.423  ? 7014 ARG C NH2   1 
ATOM   5151 N  N     . GLU C  1 220 ? 107.117 -29.686 -13.188 1.000 41.052  ? 7015 GLU C N     1 
ATOM   5152 C  CA    . GLU C  1 220 ? 107.412 -30.333 -14.491 1.000 41.653  ? 7015 GLU C CA    1 
ATOM   5153 C  C     . GLU C  1 220 ? 107.307 -29.247 -15.568 1.000 39.867  ? 7015 GLU C C     1 
ATOM   5154 O  O     . GLU C  1 220 ? 106.522 -28.281 -15.385 1.000 36.999  ? 7015 GLU C O     1 
ATOM   5155 C  CB    . GLU C  1 220 ? 106.478 -31.514 -14.784 1.000 43.332  ? 7015 GLU C CB    1 
ATOM   5156 C  CG    . GLU C  1 220 ? 105.001 -31.158 -14.852 1.000 44.375  ? 7015 GLU C CG    1 
ATOM   5157 C  CD    . GLU C  1 220 ? 104.098 -32.245 -15.427 1.000 46.677  ? 7015 GLU C CD    1 
ATOM   5158 O  OE1   . GLU C  1 220 ? 102.968 -32.408 -14.919 1.000 47.322  ? 7015 GLU C OE1   1 
ATOM   5159 O  OE2   . GLU C  1 220 ? 104.502 -32.891 -16.420 1.000 51.232  ? 7015 GLU C OE2   1 
ATOM   5160 N  N     A GLN C  1 221 ? 108.103 -29.383 -16.633 0.500 39.832  ? 7016 GLN C N     1 
ATOM   5161 N  N     B GLN C  1 221 ? 108.098 -29.381 -16.636 0.500 39.211  ? 7016 GLN C N     1 
ATOM   5162 C  CA    A GLN C  1 221 ? 108.064 -28.412 -17.755 0.500 39.691  ? 7016 GLN C CA    1 
ATOM   5163 C  CA    B GLN C  1 221 ? 108.083 -28.397 -17.750 0.500 38.740  ? 7016 GLN C CA    1 
ATOM   5164 C  C     A GLN C  1 221 ? 107.021 -28.907 -18.758 0.500 37.453  ? 7016 GLN C C     1 
ATOM   5165 C  C     B GLN C  1 221 ? 107.053 -28.881 -18.779 0.500 36.998  ? 7016 GLN C C     1 
ATOM   5166 O  O     A GLN C  1 221 ? 107.121 -30.067 -19.192 0.500 38.059  ? 7016 GLN C O     1 
ATOM   5167 O  O     B GLN C  1 221 ? 107.208 -30.010 -19.276 0.500 37.784  ? 7016 GLN C O     1 
ATOM   5168 C  CB    A GLN C  1 221 ? 109.442 -28.254 -18.405 0.500 42.330  ? 7016 GLN C CB    1 
ATOM   5169 C  CB    B GLN C  1 221 ? 109.485 -28.262 -18.356 0.500 40.551  ? 7016 GLN C CB    1 
ATOM   5170 C  CG    A GLN C  1 221 ? 109.456 -27.234 -19.537 0.500 43.572  ? 7016 GLN C CG    1 
ATOM   5171 C  CG    B GLN C  1 221 ? 110.599 -28.086 -17.325 0.500 41.821  ? 7016 GLN C CG    1 
ATOM   5172 C  CD    A GLN C  1 221 ? 110.834 -26.995 -20.105 0.500 46.581  ? 7016 GLN C CD    1 
ATOM   5173 C  CD    B GLN C  1 221 ? 110.485 -26.847 -16.466 0.500 41.855  ? 7016 GLN C CD    1 
ATOM   5174 O  OE1   A GLN C  1 221 ? 111.837 -27.477 -19.583 0.500 49.314  ? 7016 GLN C OE1   1 
ATOM   5175 O  OE1   B GLN C  1 221 ? 109.841 -25.863 -16.826 0.500 41.734  ? 7016 GLN C OE1   1 
ATOM   5176 N  NE2   A GLN C  1 221 ? 110.893 -26.228 -21.182 0.500 46.705  ? 7016 GLN C NE2   1 
ATOM   5177 N  NE2   B GLN C  1 221 ? 111.146 -26.873 -15.320 0.500 42.320  ? 7016 GLN C NE2   1 
ATOM   5178 N  N     . ILE C  1 222 ? 106.029 -28.073 -19.063 1.000 35.314  ? 7017 ILE C N     1 
ATOM   5179 C  CA    . ILE C  1 222 ? 104.972 -28.466 -20.038 1.000 33.171  ? 7017 ILE C CA    1 
ATOM   5180 C  C     . ILE C  1 222 ? 104.971 -27.486 -21.212 1.000 32.747  ? 7017 ILE C C     1 
ATOM   5181 O  O     . ILE C  1 222 ? 104.943 -26.262 -20.965 1.000 31.941  ? 7017 ILE C O     1 
ATOM   5182 C  CB    . ILE C  1 222 ? 103.582 -28.523 -19.374 1.000 31.479  ? 7017 ILE C CB    1 
ATOM   5183 C  CG1   . ILE C  1 222 ? 103.473 -29.683 -18.379 1.000 31.072  ? 7017 ILE C CG1   1 
ATOM   5184 C  CG2   . ILE C  1 222 ? 102.487 -28.582 -20.438 1.000 30.448  ? 7017 ILE C CG2   1 
ATOM   5185 C  CD1   . ILE C  1 222 ? 102.186 -29.684 -17.578 1.000 30.138  ? 7017 ILE C CD1   1 
ATOM   5186 N  N     . ASP C  1 223 ? 105.025 -28.034 -22.426 1.000 32.514  ? 7018 ASP C N     1 
ATOM   5187 C  CA    . ASP C  1 223 ? 104.876 -27.253 -23.680 1.000 32.317  ? 7018 ASP C CA    1 
ATOM   5188 C  C     . ASP C  1 223 ? 103.366 -27.186 -23.896 1.000 30.324  ? 7018 ASP C C     1 
ATOM   5189 O  O     . ASP C  1 223 ? 102.760 -28.231 -24.186 1.000 28.994  ? 7018 ASP C O     1 
ATOM   5190 C  CB    . ASP C  1 223 ? 105.649 -27.913 -24.826 1.000 34.887  ? 7018 ASP C CB    1 
ATOM   5191 C  CG    . ASP C  1 223 ? 105.503 -27.221 -26.171 1.000 35.709  ? 7018 ASP C CG    1 
ATOM   5192 O  OD1   . ASP C  1 223 ? 104.429 -26.641 -26.437 1.000 35.360  ? 7018 ASP C OD1   1 
ATOM   5193 O  OD2   . ASP C  1 223 ? 106.472 -27.248 -26.928 1.000 39.666  ? 7018 ASP C OD2   1 
ATOM   5194 N  N     A GLY C  1 224 ? 102.775 -26.004 -23.704 0.500 29.568  ? 7019 GLY C N     1 
ATOM   5195 N  N     B GLY C  1 224 ? 102.799 -25.981 -23.768 0.500 30.156  ? 7019 GLY C N     1 
ATOM   5196 C  CA    A GLY C  1 224 ? 101.314 -25.825 -23.824 0.500 28.444  ? 7019 GLY C CA    1 
ATOM   5197 C  CA    B GLY C  1 224 ? 101.348 -25.737 -23.892 0.500 29.381  ? 7019 GLY C CA    1 
ATOM   5198 C  C     A GLY C  1 224 ? 100.792 -26.040 -25.232 0.500 28.371  ? 7019 GLY C C     1 
ATOM   5199 C  C     B GLY C  1 224 ? 100.774 -26.097 -25.250 0.500 29.579  ? 7019 GLY C C     1 
ATOM   5200 O  O     A GLY C  1 224 ? 99.613  -26.431 -25.366 0.500 27.124  ? 7019 GLY C O     1 
ATOM   5201 O  O     B GLY C  1 224 ? 99.683  -26.700 -25.276 0.500 28.546  ? 7019 GLY C O     1 
ATOM   5202 N  N     A TYR C  1 225 ? 101.615 -25.767 -26.249 0.500 29.277  ? 7020 TYR C N     1 
ATOM   5203 N  N     B TYR C  1 225 ? 101.430 -25.692 -26.343 0.500 30.722  ? 7020 TYR C N     1 
ATOM   5204 C  CA    A TYR C  1 225 ? 101.166 -25.965 -27.651 0.500 29.903  ? 7020 TYR C CA    1 
ATOM   5205 C  CA    B TYR C  1 225 ? 100.898 -26.050 -27.685 0.500 31.434  ? 7020 TYR C CA    1 
ATOM   5206 C  C     A TYR C  1 225 ? 101.013 -27.472 -27.901 0.500 29.590  ? 7020 TYR C C     1 
ATOM   5207 C  C     B TYR C  1 225 ? 100.757 -27.577 -27.771 0.500 30.524  ? 7020 TYR C C     1 
ATOM   5208 O  O     A TYR C  1 225 ? 100.080 -27.906 -28.648 0.500 28.907  ? 7020 TYR C O     1 
ATOM   5209 O  O     B TYR C  1 225 ? 99.642  -28.091 -28.135 0.500 29.426  ? 7020 TYR C O     1 
ATOM   5210 C  CB    A TYR C  1 225 ? 102.155 -25.309 -28.620 0.500 31.655  ? 7020 TYR C CB    1 
ATOM   5211 C  CB    B TYR C  1 225 ? 101.787 -25.489 -28.800 0.500 34.011  ? 7020 TYR C CB    1 
ATOM   5212 C  CG    A TYR C  1 225 ? 102.413 -23.848 -28.343 0.500 32.475  ? 7020 TYR C CG    1 
ATOM   5213 C  CG    B TYR C  1 225 ? 101.538 -24.039 -29.133 0.500 35.574  ? 7020 TYR C CG    1 
ATOM   5214 C  CD1   A TYR C  1 225 ? 101.621 -22.859 -28.906 0.500 32.985  ? 7020 TYR C CD1   1 
ATOM   5215 C  CD1   B TYR C  1 225 ? 102.179 -23.015 -28.453 0.500 36.868  ? 7020 TYR C CD1   1 
ATOM   5216 C  CD2   A TYR C  1 225 ? 103.446 -23.454 -27.510 0.500 33.444  ? 7020 TYR C CD2   1 
ATOM   5217 C  CD2   B TYR C  1 225 ? 100.656 -23.690 -30.142 0.500 36.382  ? 7020 TYR C CD2   1 
ATOM   5218 C  CE1   A TYR C  1 225 ? 101.851 -21.515 -28.650 0.500 33.749  ? 7020 TYR C CE1   1 
ATOM   5219 C  CE1   B TYR C  1 225 ? 101.944 -21.684 -28.763 0.500 38.255  ? 7020 TYR C CE1   1 
ATOM   5220 C  CE2   A TYR C  1 225 ? 103.690 -22.117 -27.244 0.500 34.254  ? 7020 TYR C CE2   1 
ATOM   5221 C  CE2   B TYR C  1 225 ? 100.407 -22.366 -30.461 0.500 37.759  ? 7020 TYR C CE2   1 
ATOM   5222 C  CZ    A TYR C  1 225 ? 102.891 -21.144 -27.816 0.500 34.476  ? 7020 TYR C CZ    1 
ATOM   5223 C  CZ    B TYR C  1 225 ? 101.054 -21.358 -29.771 0.500 38.611  ? 7020 TYR C CZ    1 
ATOM   5224 O  OH    A TYR C  1 225 ? 103.128 -19.826 -27.550 0.500 35.849  ? 7020 TYR C OH    1 
ATOM   5225 O  OH    B TYR C  1 225 ? 100.815 -20.051 -30.092 0.500 42.072  ? 7020 TYR C OH    1 
ATOM   5226 N  N     A VAL C  1 226 ? 101.906 -28.253 -27.273 0.500 29.623  ? 7021 VAL C N     1 
ATOM   5227 N  N     B VAL C  1 226 ? 101.845 -28.280 -27.409 0.500 30.501  ? 7021 VAL C N     1 
ATOM   5228 C  CA    A VAL C  1 226 ? 101.863 -29.736 -27.423 0.500 29.730  ? 7021 VAL C CA    1 
ATOM   5229 C  CA    B VAL C  1 226 ? 101.843 -29.771 -27.452 0.500 30.340  ? 7021 VAL C CA    1 
ATOM   5230 C  C     A VAL C  1 226 ? 100.737 -30.295 -26.549 0.500 28.378  ? 7021 VAL C C     1 
ATOM   5231 C  C     B VAL C  1 226 ? 100.728 -30.309 -26.547 0.500 28.716  ? 7021 VAL C C     1 
ATOM   5232 O  O     A VAL C  1 226 ? 99.981  -31.151 -27.036 0.500 27.543  ? 7021 VAL C O     1 
ATOM   5233 O  O     B VAL C  1 226 ? 99.963  -31.170 -27.013 0.500 27.826  ? 7021 VAL C O     1 
ATOM   5234 C  CB    A VAL C  1 226 ? 103.214 -30.373 -27.050 0.500 30.805  ? 7021 VAL C CB    1 
ATOM   5235 C  CB    B VAL C  1 226 ? 103.211 -30.345 -27.041 0.500 31.416  ? 7021 VAL C CB    1 
ATOM   5236 C  CG1   A VAL C  1 226 ? 103.083 -31.868 -26.829 0.500 31.343  ? 7021 VAL C CG1   1 
ATOM   5237 C  CG1   B VAL C  1 226 ? 103.149 -31.848 -26.847 0.500 32.049  ? 7021 VAL C CG1   1 
ATOM   5238 C  CG2   A VAL C  1 226 ? 104.291 -30.063 -28.080 0.500 32.007  ? 7021 VAL C CG2   1 
ATOM   5239 C  CG2   B VAL C  1 226 ? 104.303 -29.972 -28.035 0.500 32.604  ? 7021 VAL C CG2   1 
ATOM   5240 N  N     . MET C  1 227 ? 100.607 -29.791 -25.321 1.000 27.434  ? 7022 MET C N     1 
ATOM   5241 C  CA    . MET C  1 227 ? 99.584  -30.341 -24.392 1.000 26.306  ? 7022 MET C CA    1 
ATOM   5242 C  C     . MET C  1 227 ? 98.163  -30.107 -24.931 1.000 25.447  ? 7022 MET C C     1 
ATOM   5243 O  O     . MET C  1 227 ? 97.327  -31.020 -24.759 1.000 24.971  ? 7022 MET C O     1 
ATOM   5244 C  CB    . MET C  1 227 ? 99.737  -29.794 -22.972 1.000 25.095  ? 7022 MET C CB    1 
ATOM   5245 C  CG    . MET C  1 227 ? 98.992  -30.636 -21.952 1.000 24.681  ? 7022 MET C CG    1 
ATOM   5246 S  SD    . MET C  1 227 ? 99.581  -32.354 -21.881 1.000 25.274  ? 7022 MET C SD    1 
ATOM   5247 C  CE    . MET C  1 227 ? 101.212 -32.119 -21.173 1.000 26.640  ? 7022 MET C CE    1 
ATOM   5248 N  N     . HIS C  1 228 ? 97.884  -28.966 -25.571 1.000 25.361  ? 7023 HIS C N     1 
ATOM   5249 C  CA    . HIS C  1 228 ? 96.517  -28.771 -26.134 1.000 24.813  ? 7023 HIS C CA    1 
ATOM   5250 C  C     . HIS C  1 228 ? 96.300  -29.771 -27.280 1.000 25.108  ? 7023 HIS C C     1 
ATOM   5251 O  O     . HIS C  1 228 ? 95.179  -30.313 -27.393 1.000 25.101  ? 7023 HIS C O     1 
ATOM   5252 C  CB    . HIS C  1 228 ? 96.281  -27.320 -26.565 1.000 24.909  ? 7023 HIS C CB    1 
ATOM   5253 C  CG    . HIS C  1 228 ? 94.848  -27.051 -26.876 1.000 24.671  ? 7023 HIS C CG    1 
ATOM   5254 N  ND1   . HIS C  1 228 ? 93.868  -27.165 -25.916 1.000 24.099  ? 7023 HIS C ND1   1 
ATOM   5255 C  CD2   . HIS C  1 228 ? 94.229  -26.649 -28.010 1.000 25.367  ? 7023 HIS C CD2   1 
ATOM   5256 C  CE1   . HIS C  1 228 ? 92.699  -26.864 -26.449 1.000 24.554  ? 7023 HIS C CE1   1 
ATOM   5257 N  NE2   . HIS C  1 228 ? 92.893  -26.528 -27.729 1.000 24.247  ? 7023 HIS C NE2   1 
ATOM   5258 N  N     . ALA C  1 229 ? 97.331  -30.011 -28.096 1.000 25.632  ? 7024 ALA C N     1 
ATOM   5259 C  CA    . ALA C  1 229 ? 97.225  -31.011 -29.181 1.000 26.213  ? 7024 ALA C CA    1 
ATOM   5260 C  C     . ALA C  1 229 ? 96.964  -32.390 -28.556 1.000 25.856  ? 7024 ALA C C     1 
ATOM   5261 O  O     . ALA C  1 229 ? 96.135  -33.150 -29.108 1.000 25.007  ? 7024 ALA C O     1 
ATOM   5262 C  CB    . ALA C  1 229 ? 98.479  -31.000 -30.027 1.000 27.748  ? 7024 ALA C CB    1 
ATOM   5263 N  N     . ASN C  1 230 ? 97.614  -32.674 -27.419 1.000 25.332  ? 7025 ASN C N     1 
ATOM   5264 C  CA    . ASN C  1 230 ? 97.436  -33.973 -26.711 1.000 25.108  ? 7025 ASN C CA    1 
ATOM   5265 C  C     . ASN C  1 230 ? 95.991  -34.056 -26.210 1.000 24.263  ? 7025 ASN C C     1 
ATOM   5266 O  O     . ASN C  1 230 ? 95.389  -35.145 -26.285 1.000 24.377  ? 7025 ASN C O     1 
ATOM   5267 C  CB    . ASN C  1 230 ? 98.405  -34.137 -25.535 1.000 25.447  ? 7025 ASN C CB    1 
ATOM   5268 C  CG    . ASN C  1 230 ? 99.866  -34.277 -25.914 1.000 26.671  ? 7025 ASN C CG    1 
ATOM   5269 O  OD1   . ASN C  1 230 ? 100.202 -34.583 -27.058 1.000 27.904  ? 7025 ASN C OD1   1 
ATOM   5270 N  ND2   . ASN C  1 230 ? 100.744 -34.123 -24.934 1.000 26.390  ? 7025 ASN C ND2   1 
ATOM   5271 N  N     . TYR C  1 231 ? 95.472  -32.939 -25.697 1.000 23.496  ? 7026 TYR C N     1 
ATOM   5272 C  CA    . TYR C  1 231 ? 94.072  -32.895 -25.202 1.000 23.305  ? 7026 TYR C CA    1 
ATOM   5273 C  C     . TYR C  1 231 ? 93.099  -33.201 -26.356 1.000 23.525  ? 7026 TYR C C     1 
ATOM   5274 O  O     . TYR C  1 231 ? 92.217  -34.076 -26.205 1.000 23.507  ? 7026 TYR C O     1 
ATOM   5275 C  CB    . TYR C  1 231 ? 93.763  -31.548 -24.539 1.000 22.546  ? 7026 TYR C CB    1 
ATOM   5276 C  CG    . TYR C  1 231 ? 92.286  -31.346 -24.339 1.000 21.990  ? 7026 TYR C CG    1 
ATOM   5277 C  CD1   . TYR C  1 231 ? 91.596  -32.070 -23.383 1.000 21.625  ? 7026 TYR C CD1   1 
ATOM   5278 C  CD2   . TYR C  1 231 ? 91.569  -30.478 -25.147 1.000 22.300  ? 7026 TYR C CD2   1 
ATOM   5279 C  CE1   . TYR C  1 231 ? 90.227  -31.937 -23.231 1.000 21.512  ? 7026 TYR C CE1   1 
ATOM   5280 C  CE2   . TYR C  1 231 ? 90.199  -30.332 -25.006 1.000 21.761  ? 7026 TYR C CE2   1 
ATOM   5281 C  CZ    . TYR C  1 231 ? 89.525  -31.072 -24.051 1.000 21.476  ? 7026 TYR C CZ    1 
ATOM   5282 O  OH    . TYR C  1 231 ? 88.179  -30.948 -23.912 1.000 21.296  ? 7026 TYR C OH    1 
ATOM   5283 N  N     A ILE C  1 232 ? 93.269  -32.508 -27.484 0.700 23.957  ? 7027 ILE C N     1 
ATOM   5284 N  N     B ILE C  1 232 ? 93.258  -32.508 -27.487 0.300 24.033  ? 7027 ILE C N     1 
ATOM   5285 C  CA    A ILE C  1 232 ? 92.379  -32.720 -28.665 0.700 24.420  ? 7027 ILE C CA    1 
ATOM   5286 C  CA    B ILE C  1 232 ? 92.348  -32.733 -28.652 0.300 24.472  ? 7027 ILE C CA    1 
ATOM   5287 C  C     A ILE C  1 232 ? 92.504  -34.165 -29.155 0.700 25.176  ? 7027 ILE C C     1 
ATOM   5288 C  C     B ILE C  1 232 ? 92.498  -34.171 -29.160 0.300 25.300  ? 7027 ILE C C     1 
ATOM   5289 O  O     A ILE C  1 232 ? 91.466  -34.756 -29.509 0.700 25.238  ? 7027 ILE C O     1 
ATOM   5290 O  O     B ILE C  1 232 ? 91.469  -34.763 -29.542 0.300 25.386  ? 7027 ILE C O     1 
ATOM   5291 C  CB    A ILE C  1 232 ? 92.691  -31.697 -29.773 0.700 24.900  ? 7027 ILE C CB    1 
ATOM   5292 C  CB    B ILE C  1 232 ? 92.593  -31.702 -29.768 0.300 24.868  ? 7027 ILE C CB    1 
ATOM   5293 C  CG1   A ILE C  1 232 ? 92.411  -30.272 -29.288 0.700 24.467  ? 7027 ILE C CG1   1 
ATOM   5294 C  CG1   B ILE C  1 232 ? 92.223  -30.291 -29.308 0.300 24.340  ? 7027 ILE C CG1   1 
ATOM   5295 C  CG2   A ILE C  1 232 ? 91.919  -32.021 -31.042 0.700 25.240  ? 7027 ILE C CG2   1 
ATOM   5296 C  CG2   B ILE C  1 232 ? 91.838  -32.094 -31.028 0.300 25.270  ? 7027 ILE C CG2   1 
ATOM   5297 C  CD1   A ILE C  1 232 ? 90.991  -30.056 -28.819 0.700 23.966  ? 7027 ILE C CD1   1 
ATOM   5298 C  CD1   B ILE C  1 232 ? 92.288  -29.263 -30.406 0.300 24.834  ? 7027 ILE C CD1   1 
ATOM   5299 N  N     . PHE C  1 233 ? 93.726  -34.703 -29.176 1.000 26.310  ? 7028 PHE C N     1 
ATOM   5300 C  CA    . PHE C  1 233 ? 93.944  -36.099 -29.627 1.000 27.084  ? 7028 PHE C CA    1 
ATOM   5301 C  C     . PHE C  1 233 ? 93.140  -37.038 -28.719 1.000 25.858  ? 7028 PHE C C     1 
ATOM   5302 O  O     . PHE C  1 233 ? 92.458  -37.939 -29.241 1.000 25.770  ? 7028 PHE C O     1 
ATOM   5303 C  CB    . PHE C  1 233 ? 95.429  -36.466 -29.642 1.000 29.004  ? 7028 PHE C CB    1 
ATOM   5304 C  CG    . PHE C  1 233 ? 95.672  -37.911 -29.988 1.000 31.321  ? 7028 PHE C CG    1 
ATOM   5305 C  CD1   . PHE C  1 233 ? 95.532  -38.353 -31.293 1.000 32.744  ? 7028 PHE C CD1   1 
ATOM   5306 C  CD2   . PHE C  1 233 ? 96.013  -38.834 -29.011 1.000 32.798  ? 7028 PHE C CD2   1 
ATOM   5307 C  CE1   . PHE C  1 233 ? 95.736  -39.685 -31.616 1.000 34.805  ? 7028 PHE C CE1   1 
ATOM   5308 C  CE2   . PHE C  1 233 ? 96.226  -40.165 -29.340 1.000 34.338  ? 7028 PHE C CE2   1 
ATOM   5309 C  CZ    . PHE C  1 233 ? 96.087  -40.586 -30.639 1.000 35.140  ? 7028 PHE C CZ    1 
ATOM   5310 N  N     . TRP C  1 234 ? 93.228  -36.828 -27.402 1.000 25.017  ? 7029 TRP C N     1 
ATOM   5311 C  CA    . TRP C  1 234 ? 92.446  -37.639 -26.432 1.000 24.502  ? 7029 TRP C CA    1 
ATOM   5312 C  C     . TRP C  1 234 ? 90.946  -37.520 -26.742 1.000 24.077  ? 7029 TRP C C     1 
ATOM   5313 O  O     . TRP C  1 234 ? 90.278  -38.570 -26.864 1.000 24.884  ? 7029 TRP C O     1 
ATOM   5314 C  CB    . TRP C  1 234 ? 92.764  -37.232 -24.989 1.000 24.141  ? 7029 TRP C CB    1 
ATOM   5315 C  CG    . TRP C  1 234 ? 91.805  -37.815 -24.000 1.000 23.944  ? 7029 TRP C CG    1 
ATOM   5316 C  CD1   . TRP C  1 234 ? 91.548  -39.138 -23.800 1.000 24.648  ? 7029 TRP C CD1   1 
ATOM   5317 C  CD2   . TRP C  1 234 ? 90.997  -37.102 -23.050 1.000 23.211  ? 7029 TRP C CD2   1 
ATOM   5318 N  NE1   . TRP C  1 234 ? 90.602  -39.295 -22.827 1.000 24.158  ? 7029 TRP C NE1   1 
ATOM   5319 C  CE2   . TRP C  1 234 ? 90.259  -38.068 -22.333 1.000 23.667  ? 7029 TRP C CE2   1 
ATOM   5320 C  CE3   . TRP C  1 234 ? 90.821  -35.750 -22.732 1.000 23.008  ? 7029 TRP C CE3   1 
ATOM   5321 C  CZ2   . TRP C  1 234 ? 89.354  -37.722 -21.331 1.000 23.255  ? 7029 TRP C CZ2   1 
ATOM   5322 C  CZ3   . TRP C  1 234 ? 89.943  -35.409 -21.730 1.000 22.794  ? 7029 TRP C CZ3   1 
ATOM   5323 C  CH2   . TRP C  1 234 ? 89.209  -36.382 -21.047 1.000 22.803  ? 7029 TRP C CH2   1 
ATOM   5324 N  N     . ARG C  1 235 ? 90.437  -36.294 -26.880 1.000 23.614  ? 7030 ARG C N     1 
ATOM   5325 C  CA    . ARG C  1 235 ? 88.985  -36.096 -27.157 1.000 23.489  ? 7030 ARG C CA    1 
ATOM   5326 C  C     . ARG C  1 235 ? 88.583  -36.740 -28.491 1.000 24.627  ? 7030 ARG C C     1 
ATOM   5327 O  O     . ARG C  1 235 ? 87.486  -37.331 -28.545 1.000 24.750  ? 7030 ARG C O     1 
ATOM   5328 C  CB    . ARG C  1 235 ? 88.626  -34.609 -27.201 1.000 22.697  ? 7030 ARG C CB    1 
ATOM   5329 C  CG    . ARG C  1 235 ? 88.800  -33.862 -25.889 1.000 21.853  ? 7030 ARG C CG    1 
ATOM   5330 C  CD    . ARG C  1 235 ? 88.075  -34.472 -24.705 1.000 21.848  ? 7030 ARG C CD    1 
ATOM   5331 N  NE    . ARG C  1 235 ? 86.698  -34.816 -25.004 1.000 22.506  ? 7030 ARG C NE    1 
ATOM   5332 C  CZ    . ARG C  1 235 ? 85.673  -33.971 -24.990 1.000 22.669  ? 7030 ARG C CZ    1 
ATOM   5333 N  NH1   . ARG C  1 235 ? 85.840  -32.690 -24.691 1.000 21.867  ? 7030 ARG C NH1   1 
ATOM   5334 N  NH2   . ARG C  1 235 ? 84.471  -34.421 -25.289 1.000 23.283  ? 7030 ARG C NH2   1 
ATOM   5335 N  N     . ASN C  1 236 ? 89.429  -36.616 -29.519 1.000 25.470  ? 7031 ASN C N     1 
ATOM   5336 C  CA    . ASN C  1 236 ? 89.123  -37.161 -30.866 1.000 26.905  ? 7031 ASN C CA    1 
ATOM   5337 C  C     . ASN C  1 236 ? 89.100  -38.690 -30.875 1.000 28.263  ? 7031 ASN C C     1 
ATOM   5338 O  O     . ASN C  1 236 ? 88.386  -39.246 -31.731 1.000 28.002  ? 7031 ASN C O     1 
ATOM   5339 C  CB    . ASN C  1 236 ? 90.140  -36.710 -31.922 1.000 28.128  ? 7031 ASN C CB    1 
ATOM   5340 C  CG    . ASN C  1 236 ? 89.914  -35.297 -32.408 1.000 28.627  ? 7031 ASN C CG    1 
ATOM   5341 O  OD1   . ASN C  1 236 ? 88.882  -34.703 -32.114 1.000 30.435  ? 7031 ASN C OD1   1 
ATOM   5342 N  ND2   . ASN C  1 236 ? 90.851  -34.764 -33.174 1.000 29.158  ? 7031 ASN C ND2   1 
ATOM   5343 N  N     . THR C  1 237 ? 89.816  -39.339 -29.952 1.000 27.788  ? 7032 THR C N     1 
ATOM   5344 C  CA    . THR C  1 237 ? 89.940  -40.819 -30.018 1.000 28.742  ? 7032 THR C CA    1 
ATOM   5345 C  C     . THR C  1 237 ? 89.212  -41.499 -28.861 1.000 28.750  ? 7032 THR C C     1 
ATOM   5346 O  O     . THR C  1 237 ? 89.204  -42.735 -28.850 1.000 28.943  ? 7032 THR C O     1 
ATOM   5347 C  CB    . THR C  1 237 ? 91.421  -41.214 -30.100 1.000 29.458  ? 7032 THR C CB    1 
ATOM   5348 O  OG1   . THR C  1 237 ? 92.118  -40.733 -28.950 1.000 28.022  ? 7032 THR C OG1   1 
ATOM   5349 C  CG2   . THR C  1 237 ? 92.081  -40.666 -31.346 1.000 30.490  ? 7032 THR C CG2   1 
ATOM   5350 N  N     . ASN C  1 238 ? 88.615  -40.730 -27.947 1.000 28.448  ? 7033 ASN C N     1 
ATOM   5351 C  CA    . ASN C  1 238 ? 87.893  -41.332 -26.797 1.000 29.372  ? 7033 ASN C CA    1 
ATOM   5352 C  C     . ASN C  1 238 ? 86.505  -40.724 -26.666 1.000 29.522  ? 7033 ASN C C     1 
ATOM   5353 O  O     . ASN C  1 238 ? 86.307  -39.772 -25.910 1.000 28.899  ? 7033 ASN C O     1 
ATOM   5354 C  CB    . ASN C  1 238 ? 88.652  -41.157 -25.483 1.000 30.397  ? 7033 ASN C CB    1 
ATOM   5355 C  CG    . ASN C  1 238 ? 89.936  -41.945 -25.469 1.000 31.874  ? 7033 ASN C CG    1 
ATOM   5356 O  OD1   . ASN C  1 238 ? 89.980  -43.017 -24.876 1.000 35.533  ? 7033 ASN C OD1   1 
ATOM   5357 N  ND2   . ASN C  1 238 ? 90.936  -41.486 -26.207 1.000 32.178  ? 7033 ASN C ND2   1 
ATOM   5358 N  N     . PRO C  1 239 ? 85.494  -41.279 -27.362 1.000 31.226  ? 7034 PRO C N     1 
ATOM   5359 C  CA    . PRO C  1 239 ? 84.135  -40.756 -27.265 1.000 30.811  ? 7034 PRO C CA    1 
ATOM   5360 C  C     . PRO C  1 239 ? 83.660  -40.873 -25.815 1.000 30.170  ? 7034 PRO C C     1 
ATOM   5361 O  O     . PRO C  1 239 ? 83.907  -41.890 -25.195 1.000 29.678  ? 7034 PRO C O     1 
ATOM   5362 C  CB    . PRO C  1 239 ? 83.299  -41.645 -28.198 1.000 32.264  ? 7034 PRO C CB    1 
ATOM   5363 C  CG    . PRO C  1 239 ? 84.320  -42.337 -29.085 1.000 33.281  ? 7034 PRO C CG    1 
ATOM   5364 C  CD    . PRO C  1 239 ? 85.587  -42.435 -28.265 1.000 32.272  ? 7034 PRO C CD    1 
ATOM   5365 N  N     . ILE C  1 240 ? 83.080  -39.797 -25.294 1.000 29.013  ? 7035 ILE C N     1 
ATOM   5366 C  CA    . ILE C  1 240 ? 82.541  -39.807 -23.907 1.000 28.862  ? 7035 ILE C CA    1 
ATOM   5367 C  C     . ILE C  1 240 ? 81.016  -39.810 -24.018 1.000 29.666  ? 7035 ILE C C     1 
ATOM   5368 O  O     . ILE C  1 240 ? 80.465  -38.929 -24.709 1.000 29.780  ? 7035 ILE C O     1 
ATOM   5369 C  CB    . ILE C  1 240 ? 83.089  -38.621 -23.094 1.000 28.078  ? 7035 ILE C CB    1 
ATOM   5370 C  CG1   . ILE C  1 240 ? 84.615  -38.685 -22.980 1.000 27.425  ? 7035 ILE C CG1   1 
ATOM   5371 C  CG2   . ILE C  1 240 ? 82.419  -38.552 -21.726 1.000 28.144  ? 7035 ILE C CG2   1 
ATOM   5372 C  CD1   . ILE C  1 240 ? 85.244  -37.446 -22.382 1.000 27.377  ? 7035 ILE C CD1   1 
ATOM   5373 N  N     . GLN C  1 241 ? 80.384  -40.817 -23.420 1.000 30.502  ? 7036 GLN C N     1 
ATOM   5374 C  CA    . GLN C  1 241 ? 78.908  -40.956 -23.446 1.000 32.230  ? 7036 GLN C CA    1 
ATOM   5375 C  C     . GLN C  1 241 ? 78.277  -39.806 -22.656 1.000 29.962  ? 7036 GLN C C     1 
ATOM   5376 O  O     . GLN C  1 241 ? 78.701  -39.592 -21.504 1.000 28.727  ? 7036 GLN C O     1 
ATOM   5377 C  CB    . GLN C  1 241 ? 78.520  -42.303 -22.833 1.000 35.696  ? 7036 GLN C CB    1 
ATOM   5378 C  CG    . GLN C  1 241 ? 77.022  -42.551 -22.757 1.000 39.064  ? 7036 GLN C CG    1 
ATOM   5379 C  CD    . GLN C  1 241 ? 76.705  -43.893 -22.139 1.000 42.682  ? 7036 GLN C CD    1 
ATOM   5380 O  OE1   . GLN C  1 241 ? 77.517  -44.816 -22.148 1.000 45.303  ? 7036 GLN C OE1   1 
ATOM   5381 N  NE2   . GLN C  1 241 ? 75.500  -44.017 -21.609 1.000 45.471  ? 7036 GLN C NE2   1 
ATOM   5382 N  N     . LEU C  1 242 ? 77.355  -39.071 -23.279 1.000 29.112  ? 7037 LEU C N     1 
ATOM   5383 C  CA    . LEU C  1 242 ? 76.636  -37.988 -22.560 1.000 29.842  ? 7037 LEU C CA    1 
ATOM   5384 C  C     . LEU C  1 242 ? 75.917  -38.621 -21.370 1.000 30.225  ? 7037 LEU C C     1 
ATOM   5385 O  O     . LEU C  1 242 ? 75.291  -39.684 -21.564 1.000 29.668  ? 7037 LEU C O     1 
ATOM   5386 C  CB    . LEU C  1 242 ? 75.660  -37.297 -23.514 1.000 31.114  ? 7037 LEU C CB    1 
ATOM   5387 C  CG    . LEU C  1 242 ? 76.262  -36.207 -24.401 1.000 30.903  ? 7037 LEU C CG    1 
ATOM   5388 C  CD1   . LEU C  1 242 ? 76.519  -34.953 -23.590 1.000 30.402  ? 7037 LEU C CD1   1 
ATOM   5389 C  CD2   . LEU C  1 242 ? 77.535  -36.687 -25.090 1.000 31.369  ? 7037 LEU C CD2   1 
ATOM   5390 N  N     . SER C  1 243 ? 76.027  -38.008 -20.187 1.000 29.271  ? 7038 SER C N     1 
ATOM   5391 C  CA    . SER C  1 243 ? 75.401  -38.590 -18.973 1.000 29.869  ? 7038 SER C CA    1 
ATOM   5392 C  C     . SER C  1 243 ? 75.112  -37.521 -17.906 1.000 28.240  ? 7038 SER C C     1 
ATOM   5393 O  O     . SER C  1 243 ? 75.957  -36.638 -17.698 1.000 27.134  ? 7038 SER C O     1 
ATOM   5394 C  CB    . SER C  1 243 ? 76.298  -39.671 -18.432 1.000 30.603  ? 7038 SER C CB    1 
ATOM   5395 O  OG    . SER C  1 243 ? 75.897  -40.069 -17.137 1.000 32.099  ? 7038 SER C OG    1 
ATOM   5396 N  N     . SER C  1 244 ? 73.934  -37.618 -17.285 1.000 29.014  ? 7039 SER C N     1 
ATOM   5397 C  CA    . SER C  1 244 ? 73.483  -36.753 -16.162 1.000 29.224  ? 7039 SER C CA    1 
ATOM   5398 C  C     . SER C  1 244 ? 73.348  -37.620 -14.902 1.000 29.272  ? 7039 SER C C     1 
ATOM   5399 O  O     . SER C  1 244 ? 72.965  -37.088 -13.847 1.000 28.383  ? 7039 SER C O     1 
ATOM   5400 C  CB    . SER C  1 244 ? 72.152  -36.144 -16.484 1.000 30.176  ? 7039 SER C CB    1 
ATOM   5401 O  OG    . SER C  1 244 ? 71.196  -37.180 -16.703 1.000 31.330  ? 7039 SER C OG    1 
ATOM   5402 N  N     . TYR C  1 245 ? 73.708  -38.899 -15.019 1.000 29.909  ? 7040 TYR C N     1 
ATOM   5403 C  CA    . TYR C  1 245 ? 73.464  -39.903 -13.947 1.000 29.918  ? 7040 TYR C CA    1 
ATOM   5404 C  C     . TYR C  1 245 ? 74.031  -39.477 -12.584 1.000 28.760  ? 7040 TYR C C     1 
ATOM   5405 O  O     . TYR C  1 245 ? 73.346  -39.742 -11.583 1.000 29.177  ? 7040 TYR C O     1 
ATOM   5406 C  CB    . TYR C  1 245 ? 73.950  -41.279 -14.407 1.000 31.375  ? 7040 TYR C CB    1 
ATOM   5407 C  CG    . TYR C  1 245 ? 73.488  -41.679 -15.792 1.000 32.381  ? 7040 TYR C CG    1 
ATOM   5408 C  CD1   . TYR C  1 245 ? 72.290  -41.216 -16.319 1.000 32.785  ? 7040 TYR C CD1   1 
ATOM   5409 C  CD2   . TYR C  1 245 ? 74.175  -42.637 -16.518 1.000 33.610  ? 7040 TYR C CD2   1 
ATOM   5410 C  CE1   . TYR C  1 245 ? 71.860  -41.590 -17.582 1.000 33.979  ? 7040 TYR C CE1   1 
ATOM   5411 C  CE2   . TYR C  1 245 ? 73.739  -43.059 -17.764 1.000 35.067  ? 7040 TYR C CE2   1 
ATOM   5412 C  CZ    . TYR C  1 245 ? 72.583  -42.524 -18.305 1.000 35.555  ? 7040 TYR C CZ    1 
ATOM   5413 O  OH    . TYR C  1 245 ? 72.147  -42.934 -19.530 1.000 37.618  ? 7040 TYR C OH    1 
ATOM   5414 N  N     . SER C  1 246 ? 75.193  -38.820 -12.531 1.000 26.484  ? 7041 SER C N     1 
ATOM   5415 C  CA    . SER C  1 246 ? 75.787  -38.419 -11.227 1.000 26.179  ? 7041 SER C CA    1 
ATOM   5416 C  C     . SER C  1 246 ? 74.959  -37.320 -10.543 1.000 26.058  ? 7041 SER C C     1 
ATOM   5417 O  O     . SER C  1 246 ? 75.183  -37.095 -9.347  1.000 26.125  ? 7041 SER C O     1 
ATOM   5418 C  CB    . SER C  1 246 ? 77.202  -37.935 -11.408 1.000 25.703  ? 7041 SER C CB    1 
ATOM   5419 O  OG    . SER C  1 246 ? 77.212  -36.623 -11.966 1.000 23.905  ? 7041 SER C OG    1 
ATOM   5420 N  N     . LEU C  1 247 ? 74.025  -36.683 -11.256 1.000 25.744  ? 7042 LEU C N     1 
ATOM   5421 C  CA    . LEU C  1 247 ? 73.255  -35.539 -10.684 1.000 25.629  ? 7042 LEU C CA    1 
ATOM   5422 C  C     . LEU C  1 247 ? 72.092  -35.996 -9.797  1.000 25.874  ? 7042 LEU C C     1 
ATOM   5423 O  O     . LEU C  1 247 ? 71.593  -35.147 -9.034  1.000 25.692  ? 7042 LEU C O     1 
ATOM   5424 C  CB    . LEU C  1 247 ? 72.679  -34.697 -11.824 1.000 26.110  ? 7042 LEU C CB    1 
ATOM   5425 C  CG    . LEU C  1 247 ? 73.675  -34.113 -12.821 1.000 26.968  ? 7042 LEU C CG    1 
ATOM   5426 C  CD1   . LEU C  1 247 ? 72.937  -33.297 -13.867 1.000 28.503  ? 7042 LEU C CD1   1 
ATOM   5427 C  CD2   . LEU C  1 247 ? 74.722  -33.269 -12.121 1.000 26.519  ? 7042 LEU C CD2   1 
ATOM   5428 N  N     . PHE C  1 248 ? 71.661  -37.255 -9.909  1.000 26.175  ? 7043 PHE C N     1 
ATOM   5429 C  CA    . PHE C  1 248 ? 70.465  -37.730 -9.170  1.000 28.018  ? 7043 PHE C CA    1 
ATOM   5430 C  C     . PHE C  1 248 ? 70.783  -38.066 -7.714  1.000 28.943  ? 7043 PHE C C     1 
ATOM   5431 O  O     . PHE C  1 248 ? 69.827  -38.106 -6.919  1.000 31.395  ? 7043 PHE C O     1 
ATOM   5432 C  CB    . PHE C  1 248 ? 69.813  -38.884 -9.932  1.000 28.861  ? 7043 PHE C CB    1 
ATOM   5433 C  CG    . PHE C  1 248 ? 69.221  -38.444 -11.244 1.000 28.979  ? 7043 PHE C CG    1 
ATOM   5434 C  CD1   . PHE C  1 248 ? 69.998  -38.383 -12.390 1.000 28.281  ? 7043 PHE C CD1   1 
ATOM   5435 C  CD2   . PHE C  1 248 ? 67.898  -38.039 -11.320 1.000 29.819  ? 7043 PHE C CD2   1 
ATOM   5436 C  CE1   . PHE C  1 248 ? 69.457  -37.948 -13.590 1.000 28.469  ? 7043 PHE C CE1   1 
ATOM   5437 C  CE2   . PHE C  1 248 ? 67.358  -37.611 -12.523 1.000 29.896  ? 7043 PHE C CE2   1 
ATOM   5438 C  CZ    . PHE C  1 248 ? 68.138  -37.563 -13.653 1.000 29.447  ? 7043 PHE C CZ    1 
ATOM   5439 N  N     . ASP C  1 249 ? 72.054  -38.275 -7.374  1.000 28.830  ? 7044 ASP C N     1 
ATOM   5440 C  CA    . ASP C  1 249 ? 72.400  -38.562 -5.955  1.000 29.597  ? 7044 ASP C CA    1 
ATOM   5441 C  C     . ASP C  1 249 ? 73.270  -37.412 -5.447  1.000 27.761  ? 7044 ASP C C     1 
ATOM   5442 O  O     . ASP C  1 249 ? 74.475  -37.377 -5.773  1.000 27.361  ? 7044 ASP C O     1 
ATOM   5443 C  CB    . ASP C  1 249 ? 73.068  -39.930 -5.801  1.000 31.012  ? 7044 ASP C CB    1 
ATOM   5444 C  CG    . ASP C  1 249 ? 73.336  -40.303 -4.354  1.000 31.841  ? 7044 ASP C CG    1 
ATOM   5445 O  OD1   . ASP C  1 249 ? 73.170  -39.427 -3.475  1.000 30.319  ? 7044 ASP C OD1   1 
ATOM   5446 O  OD2   . ASP C  1 249 ? 73.693  -41.470 -4.116  1.000 33.894  ? 7044 ASP C OD2   1 
ATOM   5447 N  N     . MET C  1 250 ? 72.670  -36.512 -4.675  1.000 27.303  ? 7045 MET C N     1 
ATOM   5448 C  CA    . MET C  1 250 ? 73.394  -35.321 -4.165  1.000 26.228  ? 7045 MET C CA    1 
ATOM   5449 C  C     . MET C  1 250 ? 73.765  -35.501 -2.683  1.000 26.820  ? 7045 MET C C     1 
ATOM   5450 O  O     . MET C  1 250 ? 74.214  -34.500 -2.066  1.000 25.400  ? 7045 MET C O     1 
ATOM   5451 C  CB    . MET C  1 250 ? 72.515  -34.084 -4.346  1.000 26.163  ? 7045 MET C CB    1 
ATOM   5452 C  CG    . MET C  1 250 ? 72.315  -33.710 -5.806  1.000 26.118  ? 7045 MET C CG    1 
ATOM   5453 S  SD    . MET C  1 250 ? 73.853  -33.147 -6.589  1.000 25.356  ? 7045 MET C SD    1 
ATOM   5454 C  CE    . MET C  1 250 ? 74.098  -31.586 -5.748  1.000 25.430  ? 7045 MET C CE    1 
ATOM   5455 N  N     . SER C  1 251 ? 73.675  -36.731 -2.161  1.000 27.656  ? 7046 SER C N     1 
ATOM   5456 C  CA    . SER C  1 251 ? 73.937  -36.983 -0.716  1.000 29.614  ? 7046 SER C CA    1 
ATOM   5457 C  C     . SER C  1 251 ? 75.371  -36.615 -0.300  1.000 29.979  ? 7046 SER C C     1 
ATOM   5458 O  O     . SER C  1 251 ? 75.530  -36.179 0.861   1.000 33.323  ? 7046 SER C O     1 
ATOM   5459 C  CB    . SER C  1 251 ? 73.589  -38.405 -0.312  1.000 30.959  ? 7046 SER C CB    1 
ATOM   5460 O  OG    . SER C  1 251 ? 74.325  -39.357 -1.061  1.000 31.710  ? 7046 SER C OG    1 
ATOM   5461 N  N     . LYS C  1 252 ? 76.383  -36.768 -1.154  1.000 37.780  ? 7047 LYS C N     1 
ATOM   5462 C  CA    . LYS C  1 252 ? 77.752  -36.419 -0.666  1.000 37.346  ? 7047 LYS C CA    1 
ATOM   5463 C  C     . LYS C  1 252 ? 78.288  -35.185 -1.403  1.000 32.432  ? 7047 LYS C C     1 
ATOM   5464 O  O     . LYS C  1 252 ? 79.512  -35.021 -1.459  1.000 31.212  ? 7047 LYS C O     1 
ATOM   5465 C  CB    . LYS C  1 252 ? 78.675  -37.632 -0.834  1.000 40.592  ? 7047 LYS C CB    1 
ATOM   5466 C  CG    . LYS C  1 252 ? 78.208  -38.878 -0.090  1.000 46.466  ? 7047 LYS C CG    1 
ATOM   5467 C  CD    . LYS C  1 252 ? 79.170  -40.039 -0.160  1.000 50.744  ? 7047 LYS C CD    1 
ATOM   5468 C  CE    . LYS C  1 252 ? 78.638  -41.274 0.532   1.000 56.797  ? 7047 LYS C CE    1 
ATOM   5469 N  NZ    . LYS C  1 252 ? 79.636  -42.370 0.533   1.000 61.290  ? 7047 LYS C NZ    1 
ATOM   5470 N  N     . PHE C  1 253 ? 77.403  -34.274 -1.804  1.000 29.733  ? 7048 PHE C N     1 
ATOM   5471 C  CA    . PHE C  1 253 ? 77.845  -33.146 -2.658  1.000 26.400  ? 7048 PHE C CA    1 
ATOM   5472 C  C     . PHE C  1 253 ? 78.687  -32.102 -1.927  1.000 24.798  ? 7048 PHE C C     1 
ATOM   5473 O  O     . PHE C  1 253 ? 79.726  -31.697 -2.442  1.000 22.486  ? 7048 PHE C O     1 
ATOM   5474 C  CB    . PHE C  1 253 ? 76.636  -32.475 -3.311  1.000 26.183  ? 7048 PHE C CB    1 
ATOM   5475 C  CG    . PHE C  1 253 ? 77.035  -31.332 -4.205  1.000 24.076  ? 7048 PHE C CG    1 
ATOM   5476 C  CD1   . PHE C  1 253 ? 77.734  -31.577 -5.376  1.000 23.448  ? 7048 PHE C CD1   1 
ATOM   5477 C  CD2   . PHE C  1 253 ? 76.740  -30.021 -3.868  1.000 23.372  ? 7048 PHE C CD2   1 
ATOM   5478 C  CE1   . PHE C  1 253 ? 78.133  -30.532 -6.196  1.000 21.724  ? 7048 PHE C CE1   1 
ATOM   5479 C  CE2   . PHE C  1 253 ? 77.124  -28.979 -4.698  1.000 21.825  ? 7048 PHE C CE2   1 
ATOM   5480 C  CZ    . PHE C  1 253 ? 77.825  -29.239 -5.855  1.000 21.272  ? 7048 PHE C CZ    1 
ATOM   5481 N  N     . PRO C  1 254 ? 78.278  -31.612 -0.736  1.000 25.444  ? 7049 PRO C N     1 
ATOM   5482 C  CA    . PRO C  1 254 ? 78.990  -30.511 -0.085  1.000 24.606  ? 7049 PRO C CA    1 
ATOM   5483 C  C     . PRO C  1 254 ? 80.486  -30.768 0.148   1.000 23.720  ? 7049 PRO C C     1 
ATOM   5484 O  O     . PRO C  1 254 ? 80.847  -31.850 0.579   1.000 23.926  ? 7049 PRO C O     1 
ATOM   5485 C  CB    . PRO C  1 254 ? 78.277  -30.331 1.270   1.000 26.599  ? 7049 PRO C CB    1 
ATOM   5486 C  CG    . PRO C  1 254 ? 76.944  -31.053 1.117   1.000 28.317  ? 7049 PRO C CG    1 
ATOM   5487 C  CD    . PRO C  1 254 ? 77.177  -32.139 0.086   1.000 28.136  ? 7049 PRO C CD    1 
ATOM   5488 N  N     . LEU C  1 255 ? 81.309  -29.788 -0.207  1.000 22.364  ? 7050 LEU C N     1 
ATOM   5489 C  CA    . LEU C  1 255 ? 82.773  -29.864 0.030   1.000 22.762  ? 7050 LEU C CA    1 
ATOM   5490 C  C     . LEU C  1 255 ? 82.986  -29.907 1.547   1.000 24.409  ? 7050 LEU C C     1 
ATOM   5491 O  O     . LEU C  1 255 ? 82.453  -29.021 2.248   1.000 24.763  ? 7050 LEU C O     1 
ATOM   5492 C  CB    . LEU C  1 255 ? 83.452  -28.646 -0.598  1.000 21.276  ? 7050 LEU C CB    1 
ATOM   5493 C  CG    . LEU C  1 255 ? 84.966  -28.540 -0.407  1.000 21.089  ? 7050 LEU C CG    1 
ATOM   5494 C  CD1   . LEU C  1 255 ? 85.688  -29.721 -1.041  1.000 21.532  ? 7050 LEU C CD1   1 
ATOM   5495 C  CD2   . LEU C  1 255 ? 85.484  -27.235 -0.984  1.000 20.317  ? 7050 LEU C CD2   1 
ATOM   5496 N  N     . LYS C  1 256 ? 83.693  -30.916 2.037   1.000 25.606  ? 7051 LYS C N     1 
ATOM   5497 C  CA    . LYS C  1 256 ? 83.923  -31.034 3.503   1.000 28.379  ? 7051 LYS C CA    1 
ATOM   5498 C  C     . LYS C  1 256 ? 84.899  -29.947 3.979   1.000 26.237  ? 7051 LYS C C     1 
ATOM   5499 O  O     . LYS C  1 256 ? 85.982  -29.834 3.413   1.000 23.934  ? 7051 LYS C O     1 
ATOM   5500 C  CB    . LYS C  1 256 ? 84.450  -32.431 3.838   1.000 31.937  ? 7051 LYS C CB    1 
ATOM   5501 C  CG    . LYS C  1 256 ? 84.798  -32.654 5.305   1.000 37.175  ? 7051 LYS C CG    1 
ATOM   5502 C  CD    . LYS C  1 256 ? 85.205  -34.084 5.617   1.000 42.459  ? 7051 LYS C CD    1 
ATOM   5503 C  CE    . LYS C  1 256 ? 85.667  -34.275 7.049   1.000 45.837  ? 7051 LYS C CE    1 
ATOM   5504 N  NZ    . LYS C  1 256 ? 84.634  -33.848 8.024   1.000 49.345  ? 7051 LYS C NZ    1 
ATOM   5505 N  N     . LEU C  1 257 ? 84.498  -29.163 4.982   1.000 27.423  ? 7052 LEU C N     1 
ATOM   5506 C  CA    . LEU C  1 257 ? 85.390  -28.127 5.567   1.000 27.036  ? 7052 LEU C CA    1 
ATOM   5507 C  C     . LEU C  1 257 ? 86.510  -28.856 6.319   1.000 27.843  ? 7052 LEU C C     1 
ATOM   5508 O  O     . LEU C  1 257 ? 86.197  -29.696 7.163   1.000 29.087  ? 7052 LEU C O     1 
ATOM   5509 C  CB    . LEU C  1 257 ? 84.567  -27.235 6.502   1.000 28.528  ? 7052 LEU C CB    1 
ATOM   5510 C  CG    . LEU C  1 257 ? 85.352  -26.182 7.289   1.000 29.109  ? 7052 LEU C CG    1 
ATOM   5511 C  CD1   . LEU C  1 257 ? 86.173  -25.298 6.369   1.000 27.982  ? 7052 LEU C CD1   1 
ATOM   5512 C  CD2   . LEU C  1 257 ? 84.407  -25.341 8.141   1.000 30.842  ? 7052 LEU C CD2   1 
ATOM   5513 N  N     . ARG C  1 258 ? 87.768  -28.580 5.990   1.000 27.349  ? 7053 ARG C N     1 
ATOM   5514 C  CA    . ARG C  1 258 ? 88.895  -29.285 6.655   1.000 28.536  ? 7053 ARG C CA    1 
ATOM   5515 C  C     . ARG C  1 258 ? 89.594  -28.388 7.682   1.000 26.620  ? 7053 ARG C C     1 
ATOM   5516 O  O     . ARG C  1 258 ? 90.349  -28.934 8.502   1.000 26.275  ? 7053 ARG C O     1 
ATOM   5517 C  CB    . ARG C  1 258 ? 89.912  -29.734 5.604   1.000 31.083  ? 7053 ARG C CB    1 
ATOM   5518 C  CG    . ARG C  1 258 ? 89.319  -30.612 4.510   1.000 35.414  ? 7053 ARG C CG    1 
ATOM   5519 C  CD    . ARG C  1 258 ? 90.377  -31.463 3.833   1.000 40.851  ? 7053 ARG C CD    1 
ATOM   5520 N  NE    . ARG C  1 258 ? 90.928  -32.420 4.790   1.000 47.416  ? 7053 ARG C NE    1 
ATOM   5521 C  CZ    . ARG C  1 258 ? 91.898  -33.290 4.524   1.000 51.770  ? 7053 ARG C CZ    1 
ATOM   5522 N  NH1   . ARG C  1 258 ? 92.325  -34.114 5.469   1.000 53.596  ? 7053 ARG C NH1   1 
ATOM   5523 N  NH2   . ARG C  1 258 ? 92.439  -33.332 3.319   1.000 52.308  ? 7053 ARG C NH2   1 
ATOM   5524 N  N     . GLY C  1 259 ? 89.354  -27.074 7.639   1.000 24.715  ? 7054 GLY C N     1 
ATOM   5525 C  CA    . GLY C  1 259 ? 90.068  -26.158 8.547   1.000 25.086  ? 7054 GLY C CA    1 
ATOM   5526 C  C     . GLY C  1 259 ? 91.554  -26.248 8.262   1.000 24.335  ? 7054 GLY C C     1 
ATOM   5527 O  O     . GLY C  1 259 ? 92.350  -26.226 9.206   1.000 24.524  ? 7054 GLY C O     1 
ATOM   5528 N  N     . THR C  1 260 ? 91.888  -26.448 6.985   1.000 23.895  ? 7055 THR C N     1 
ATOM   5529 C  CA    . THR C  1 260 ? 93.289  -26.575 6.522   1.000 23.807  ? 7055 THR C CA    1 
ATOM   5530 C  C     . THR C  1 260 ? 94.131  -25.445 7.105   1.000 24.286  ? 7055 THR C C     1 
ATOM   5531 O  O     . THR C  1 260 ? 93.730  -24.269 6.961   1.000 24.057  ? 7055 THR C O     1 
ATOM   5532 C  CB    . THR C  1 260 ? 93.378  -26.542 4.996   1.000 23.350  ? 7055 THR C CB    1 
ATOM   5533 O  OG1   . THR C  1 260 ? 92.500  -27.537 4.467   1.000 23.006  ? 7055 THR C OG1   1 
ATOM   5534 C  CG2   . THR C  1 260 ? 94.796  -26.755 4.512   1.000 23.713  ? 7055 THR C CG2   1 
ATOM   5535 N  N     . ALA C  1 261 ? 95.284  -25.802 7.668   1.000 24.726  ? 7056 ALA C N     1 
ATOM   5536 C  CA    . ALA C  1 261 ? 96.206  -24.822 8.273   1.000 25.856  ? 7056 ALA C CA    1 
ATOM   5537 C  C     . ALA C  1 261 ? 96.605  -23.759 7.245   1.000 25.656  ? 7056 ALA C C     1 
ATOM   5538 O  O     . ALA C  1 261 ? 96.880  -24.108 6.089   1.000 24.072  ? 7056 ALA C O     1 
ATOM   5539 C  CB    . ALA C  1 261 ? 97.429  -25.527 8.806   1.000 27.206  ? 7056 ALA C CB    1 
ATOM   5540 N  N     . VAL C  1 262 ? 96.581  -22.500 7.667   1.000 26.857  ? 7057 VAL C N     1 
ATOM   5541 C  CA    . VAL C  1 262 ? 97.030  -21.366 6.815   1.000 28.306  ? 7057 VAL C CA    1 
ATOM   5542 C  C     . VAL C  1 262 ? 98.262  -20.779 7.502   1.000 30.670  ? 7057 VAL C C     1 
ATOM   5543 O  O     . VAL C  1 262 ? 98.135  -20.402 8.679   1.000 30.762  ? 7057 VAL C O     1 
ATOM   5544 C  CB    . VAL C  1 262 ? 95.921  -20.315 6.632   1.000 28.344  ? 7057 VAL C CB    1 
ATOM   5545 C  CG1   . VAL C  1 262 ? 96.425  -19.097 5.881   1.000 29.515  ? 7057 VAL C CG1   1 
ATOM   5546 C  CG2   . VAL C  1 262 ? 94.700  -20.899 5.946   1.000 26.752  ? 7057 VAL C CG2   1 
ATOM   5547 N  N     . MET C  1 263 ? 99.411  -20.785 6.827   1.000 32.379  ? 7058 MET C N     1 
ATOM   5548 C  CA    . MET C  1 263 ? 100.658 -20.236 7.423   1.000 36.766  ? 7058 MET C CA    1 
ATOM   5549 C  C     . MET C  1 263 ? 101.225 -19.132 6.529   1.000 37.166  ? 7058 MET C C     1 
ATOM   5550 O  O     . MET C  1 263 ? 101.126 -19.257 5.297   1.000 33.994  ? 7058 MET C O     1 
ATOM   5551 C  CB    . MET C  1 263 ? 101.706 -21.336 7.589   1.000 39.534  ? 7058 MET C CB    1 
ATOM   5552 C  CG    . MET C  1 263 ? 101.272 -22.401 8.557   1.000 42.306  ? 7058 MET C CG    1 
ATOM   5553 S  SD    . MET C  1 263 ? 102.526 -23.676 8.762   1.000 48.409  ? 7058 MET C SD    1 
ATOM   5554 C  CE    . MET C  1 263 ? 101.722 -24.672 10.015  1.000 49.338  ? 7058 MET C CE    1 
ATOM   5555 N  N     . SER C  1 264 ? 101.810 -18.103 7.146   1.000 39.219  ? 7059 SER C N     1 
ATOM   5556 C  CA    . SER C  1 264 ? 102.397 -16.972 6.383   1.000 42.603  ? 7059 SER C CA    1 
ATOM   5557 C  C     . SER C  1 264 ? 103.910 -17.167 6.249   1.000 46.178  ? 7059 SER C C     1 
ATOM   5558 O  O     . SER C  1 264 ? 104.656 -16.375 6.828   1.000 51.278  ? 7059 SER C O     1 
ATOM   5559 C  CB    . SER C  1 264 ? 102.050 -15.652 7.021   1.000 43.867  ? 7059 SER C CB    1 
ATOM   5560 O  OG    . SER C  1 264 ? 102.419 -15.642 8.395   1.000 45.805  ? 7059 SER C OG    1 
ATOM   5561 N  N     . LEU C  1 265 ? 104.329 -18.203 5.522   1.000 48.213  ? 7060 LEU C N     1 
ATOM   5562 C  CA    . LEU C  1 265 ? 105.771 -18.470 5.275   1.000 52.206  ? 7060 LEU C CA    1 
ATOM   5563 C  C     . LEU C  1 265 ? 106.205 -17.648 4.056   1.000 56.765  ? 7060 LEU C C     1 
ATOM   5564 O  O     . LEU C  1 265 ? 105.334 -17.346 3.211   1.000 55.097  ? 7060 LEU C O     1 
ATOM   5565 C  CB    . LEU C  1 265 ? 105.988 -19.969 5.034   1.000 51.216  ? 7060 LEU C CB    1 
ATOM   5566 C  CG    . LEU C  1 265 ? 105.603 -20.899 6.185   1.000 50.597  ? 7060 LEU C CG    1 
ATOM   5567 C  CD1   . LEU C  1 265 ? 105.754 -22.354 5.775   1.000 50.060  ? 7060 LEU C CD1   1 
ATOM   5568 C  CD2   . LEU C  1 265 ? 106.433 -20.613 7.428   1.000 52.682  ? 7060 LEU C CD2   1 
ATOM   5569 N  N     . LYS C  1 266 ? 107.488 -17.277 3.991   1.000 65.109  ? 7061 LYS C N     1 
ATOM   5570 C  CA    . LYS C  1 266 ? 108.033 -16.486 2.850   1.000 71.867  ? 7061 LYS C CA    1 
ATOM   5571 C  C     . LYS C  1 266 ? 108.940 -17.390 2.005   1.000 75.571  ? 7061 LYS C C     1 
ATOM   5572 O  O     . LYS C  1 266 ? 109.369 -18.444 2.524   1.000 74.057  ? 7061 LYS C O     1 
ATOM   5573 C  CB    . LYS C  1 266 ? 108.736 -15.226 3.368   1.000 76.671  ? 7061 LYS C CB    1 
ATOM   5574 C  CG    . LYS C  1 266 ? 107.801 -14.183 3.972   1.000 77.652  ? 7061 LYS C CG    1 
ATOM   5575 C  CD    . LYS C  1 266 ? 106.837 -13.578 2.957   1.000 78.691  ? 7061 LYS C CD    1 
ATOM   5576 C  CE    . LYS C  1 266 ? 105.784 -12.672 3.565   1.000 78.721  ? 7061 LYS C CE    1 
ATOM   5577 N  NZ    . LYS C  1 266 ? 104.817 -13.425 4.402   1.000 75.878  ? 7061 LYS C NZ    1 
ATOM   5578 N  N     . GLU C  1 267 ? 109.209 -16.978 0.757   1.000 80.686  ? 7062 GLU C N     1 
ATOM   5579 C  CA    . GLU C  1 267 ? 110.017 -17.747 -0.238  1.000 84.952  ? 7062 GLU C CA    1 
ATOM   5580 C  C     . GLU C  1 267 ? 111.211 -18.457 0.416   1.000 83.584  ? 7062 GLU C C     1 
ATOM   5581 O  O     . GLU C  1 267 ? 111.476 -19.617 0.040   1.000 85.148  ? 7062 GLU C O     1 
ATOM   5582 C  CB    . GLU C  1 267 ? 110.519 -16.837 -1.364  1.000 91.198  ? 7062 GLU C CB    1 
ATOM   5583 C  CG    . GLU C  1 267 ? 109.413 -16.285 -2.252  1.000 93.126  ? 7062 GLU C CG    1 
ATOM   5584 C  CD    . GLU C  1 267 ? 109.891 -15.493 -3.460  1.000 97.304  ? 7062 GLU C CD    1 
ATOM   5585 O  OE1   . GLU C  1 267 ? 109.033 -15.010 -4.224  1.000 99.965  ? 7062 GLU C OE1   1 
ATOM   5586 O  OE2   . GLU C  1 267 ? 111.120 -15.365 -3.642  1.000 101.762 ? 7062 GLU C OE2   1 
ATOM   5587 N  N     . GLY C  1 268 ? 111.901 -17.797 1.348   1.000 81.548  ? 7063 GLY C N     1 
ATOM   5588 C  CA    . GLY C  1 268 ? 113.085 -18.401 1.991   1.000 82.360  ? 7063 GLY C CA    1 
ATOM   5589 C  C     . GLY C  1 268 ? 112.738 -19.520 2.960   1.000 79.157  ? 7063 GLY C C     1 
ATOM   5590 O  O     . GLY C  1 268 ? 113.678 -20.066 3.566   1.000 82.498  ? 7063 GLY C O     1 
ATOM   5591 N  N     . GLN C  1 269 ? 111.454 -19.883 3.080   1.000 74.975  ? 7064 GLN C N     1 
ATOM   5592 C  CA    . GLN C  1 269 ? 111.034 -20.940 4.043   1.000 71.302  ? 7064 GLN C CA    1 
ATOM   5593 C  C     . GLN C  1 269 ? 110.290 -22.072 3.321   1.000 66.282  ? 7064 GLN C C     1 
ATOM   5594 O  O     . GLN C  1 269 ? 109.897 -23.030 4.007   1.000 64.808  ? 7064 GLN C O     1 
ATOM   5595 C  CB    . GLN C  1 269 ? 110.110 -20.353 5.112   1.000 71.804  ? 7064 GLN C CB    1 
ATOM   5596 C  CG    . GLN C  1 269 ? 110.629 -19.076 5.760   1.000 74.783  ? 7064 GLN C CG    1 
ATOM   5597 C  CD    . GLN C  1 269 ? 109.647 -18.533 6.769   1.000 74.221  ? 7064 GLN C CD    1 
ATOM   5598 O  OE1   . GLN C  1 269 ? 109.218 -19.231 7.684   1.000 73.488  ? 7064 GLN C OE1   1 
ATOM   5599 N  NE2   . GLN C  1 269 ? 109.302 -17.264 6.623   1.000 74.653  ? 7064 GLN C NE2   1 
ATOM   5600 N  N     . ILE C  1 270 ? 110.095 -21.970 2.001   1.000 63.867  ? 7065 ILE C N     1 
ATOM   5601 C  CA    . ILE C  1 270 ? 109.349 -23.035 1.262   1.000 60.570  ? 7065 ILE C CA    1 
ATOM   5602 C  C     . ILE C  1 270 ? 110.327 -24.163 0.912   1.000 61.315  ? 7065 ILE C C     1 
ATOM   5603 O  O     . ILE C  1 270 ? 110.773 -24.220 -0.256  1.000 64.023  ? 7065 ILE C O     1 
ATOM   5604 C  CB    . ILE C  1 270 ? 108.646 -22.466 0.012   1.000 60.063  ? 7065 ILE C CB    1 
ATOM   5605 C  CG1   . ILE C  1 270 ? 107.903 -21.160 0.312   1.000 59.359  ? 7065 ILE C CG1   1 
ATOM   5606 C  CG2   . ILE C  1 270 ? 107.729 -23.509 -0.609  1.000 58.267  ? 7065 ILE C CG2   1 
ATOM   5607 C  CD1   . ILE C  1 270 ? 106.889 -21.266 1.427   1.000 57.482  ? 7065 ILE C CD1   1 
ATOM   5608 N  N     . ASN C  1 271 ? 110.621 -25.028 1.889   1.000 57.821  ? 7066 ASN C N     1 
ATOM   5609 C  CA    . ASN C  1 271 ? 111.559 -26.172 1.713   1.000 57.956  ? 7066 ASN C CA    1 
ATOM   5610 C  C     . ASN C  1 271 ? 110.801 -27.382 1.147   1.000 55.476  ? 7066 ASN C C     1 
ATOM   5611 O  O     . ASN C  1 271 ? 109.574 -27.285 0.963   1.000 51.502  ? 7066 ASN C O     1 
ATOM   5612 C  CB    . ASN C  1 271 ? 112.281 -26.502 3.024   1.000 59.548  ? 7066 ASN C CB    1 
ATOM   5613 C  CG    . ASN C  1 271 ? 111.341 -26.850 4.160   1.000 58.126  ? 7066 ASN C CG    1 
ATOM   5614 O  OD1   . ASN C  1 271 ? 110.341 -27.532 3.965   1.000 55.953  ? 7066 ASN C OD1   1 
ATOM   5615 N  ND2   . ASN C  1 271 ? 111.677 -26.415 5.363   1.000 60.664  ? 7066 ASN C ND2   1 
ATOM   5616 N  N     . ASP C  1 272 ? 111.516 -28.485 0.901   1.000 56.457  ? 7067 ASP C N     1 
ATOM   5617 C  CA    . ASP C  1 272 ? 110.927 -29.723 0.315   1.000 55.861  ? 7067 ASP C CA    1 
ATOM   5618 C  C     . ASP C  1 272 ? 109.859 -30.311 1.247   1.000 51.889  ? 7067 ASP C C     1 
ATOM   5619 O  O     . ASP C  1 272 ? 108.892 -30.907 0.733   1.000 49.371  ? 7067 ASP C O     1 
ATOM   5620 C  CB    . ASP C  1 272 ? 112.023 -30.737 -0.021  1.000 60.467  ? 7067 ASP C CB    1 
ATOM   5621 C  CG    . ASP C  1 272 ? 112.925 -30.292 -1.161  1.000 64.168  ? 7067 ASP C CG    1 
ATOM   5622 O  OD1   . ASP C  1 272 ? 112.512 -29.380 -1.915  1.000 65.002  ? 7067 ASP C OD1   1 
ATOM   5623 O  OD2   . ASP C  1 272 ? 114.031 -30.857 -1.289  1.000 69.466  ? 7067 ASP C OD2   1 
ATOM   5624 N  N     . MET C  1 273 ? 110.018 -30.145 2.559   1.000 50.543  ? 7068 MET C N     1 
ATOM   5625 C  CA    . MET C  1 273 ? 109.028 -30.682 3.529   1.000 48.404  ? 7068 MET C CA    1 
ATOM   5626 C  C     . MET C  1 273 ? 107.710 -29.900 3.395   1.000 44.696  ? 7068 MET C C     1 
ATOM   5627 O  O     . MET C  1 273 ? 106.623 -30.521 3.444   1.000 41.275  ? 7068 MET C O     1 
ATOM   5628 C  CB    . MET C  1 273 ? 109.586 -30.581 4.951   1.000 51.086  ? 7068 MET C CB    1 
ATOM   5629 C  CG    . MET C  1 273 ? 108.630 -31.055 6.007   1.000 50.970  ? 7068 MET C CG    1 
ATOM   5630 S  SD    . MET C  1 273 ? 107.342 -29.837 6.371   1.000 51.146  ? 7068 MET C SD    1 
ATOM   5631 C  CE    . MET C  1 273 ? 108.300 -28.632 7.289   1.000 52.232  ? 7068 MET C CE    1 
ATOM   5632 N  N     . ILE C  1 274 ? 107.807 -28.580 3.240   1.000 43.574  ? 7069 ILE C N     1 
ATOM   5633 C  CA    . ILE C  1 274 ? 106.607 -27.717 3.040   1.000 40.822  ? 7069 ILE C CA    1 
ATOM   5634 C  C     . ILE C  1 274 ? 105.921 -28.110 1.721   1.000 38.915  ? 7069 ILE C C     1 
ATOM   5635 O  O     . ILE C  1 274 ? 104.677 -28.222 1.715   1.000 36.012  ? 7069 ILE C O     1 
ATOM   5636 C  CB    . ILE C  1 274 ? 107.020 -26.233 3.065   1.000 41.764  ? 7069 ILE C CB    1 
ATOM   5637 C  CG1   . ILE C  1 274 ? 107.531 -25.819 4.449   1.000 43.010  ? 7069 ILE C CG1   1 
ATOM   5638 C  CG2   . ILE C  1 274 ? 105.881 -25.342 2.591   1.000 40.527  ? 7069 ILE C CG2   1 
ATOM   5639 C  CD1   . ILE C  1 274 ? 106.527 -26.003 5.564   1.000 41.943  ? 7069 ILE C CD1   1 
ATOM   5640 N  N     . LEU C  1 275 ? 106.699 -28.328 0.655   1.000 39.062  ? 7070 LEU C N     1 
ATOM   5641 C  CA    . LEU C  1 275 ? 106.122 -28.707 -0.665  1.000 38.795  ? 7070 LEU C CA    1 
ATOM   5642 C  C     . LEU C  1 275 ? 105.336 -30.017 -0.534  1.000 37.710  ? 7070 LEU C C     1 
ATOM   5643 O  O     . LEU C  1 275 ? 104.284 -30.143 -1.200  1.000 35.691  ? 7070 LEU C O     1 
ATOM   5644 C  CB    . LEU C  1 275 ? 107.243 -28.821 -1.702  1.000 41.258  ? 7070 LEU C CB    1 
ATOM   5645 C  CG    . LEU C  1 275 ? 107.954 -27.511 -2.042  1.000 42.679  ? 7070 LEU C CG    1 
ATOM   5646 C  CD1   . LEU C  1 275 ? 109.185 -27.766 -2.901  1.000 45.512  ? 7070 LEU C CD1   1 
ATOM   5647 C  CD2   . LEU C  1 275 ? 107.013 -26.537 -2.734  1.000 41.340  ? 7070 LEU C CD2   1 
ATOM   5648 N  N     . SER C  1 276 ? 105.803 -30.936 0.317   1.000 38.670  ? 7071 SER C N     1 
ATOM   5649 C  CA    . SER C  1 276 ? 105.088 -32.222 0.529   1.000 38.119  ? 7071 SER C CA    1 
ATOM   5650 C  C     . SER C  1 276 ? 103.724 -31.947 1.178   1.000 35.865  ? 7071 SER C C     1 
ATOM   5651 O  O     . SER C  1 276 ? 102.718 -32.532 0.729   1.000 34.384  ? 7071 SER C O     1 
ATOM   5652 C  CB    . SER C  1 276 ? 105.916 -33.175 1.353   1.000 41.224  ? 7071 SER C CB    1 
ATOM   5653 O  OG    . SER C  1 276 ? 105.249 -34.421 1.483   1.000 42.856  ? 7071 SER C OG    1 
ATOM   5654 N  N     . LEU C  1 277 ? 103.678 -31.067 2.184   1.000 34.966  ? 7072 LEU C N     1 
ATOM   5655 C  CA    . LEU C  1 277 ? 102.376 -30.747 2.835   1.000 33.214  ? 7072 LEU C CA    1 
ATOM   5656 C  C     . LEU C  1 277 ? 101.452 -30.081 1.812   1.000 30.614  ? 7072 LEU C C     1 
ATOM   5657 O  O     . LEU C  1 277 ? 100.265 -30.435 1.763   1.000 29.660  ? 7072 LEU C O     1 
ATOM   5658 C  CB    . LEU C  1 277 ? 102.600 -29.821 4.034   1.000 33.754  ? 7072 LEU C CB    1 
ATOM   5659 C  CG    . LEU C  1 277 ? 103.302 -30.437 5.238   1.000 35.411  ? 7072 LEU C CG    1 
ATOM   5660 C  CD1   . LEU C  1 277 ? 103.461 -29.402 6.336   1.000 35.771  ? 7072 LEU C CD1   1 
ATOM   5661 C  CD2   . LEU C  1 277 ? 102.535 -31.641 5.749   1.000 35.795  ? 7072 LEU C CD2   1 
ATOM   5662 N  N     . LEU C  1 278 ? 101.980 -29.119 1.055   1.000 30.529  ? 7073 LEU C N     1 
ATOM   5663 C  CA    . LEU C  1 278 ? 101.167 -28.423 0.023   1.000 29.347  ? 7073 LEU C CA    1 
ATOM   5664 C  C     . LEU C  1 278 ? 100.606 -29.456 -0.963  1.000 29.263  ? 7073 LEU C C     1 
ATOM   5665 O  O     . LEU C  1 278 ? 99.403  -29.388 -1.268  1.000 27.383  ? 7073 LEU C O     1 
ATOM   5666 C  CB    . LEU C  1 278 ? 102.048 -27.407 -0.710  1.000 29.891  ? 7073 LEU C CB    1 
ATOM   5667 C  CG    . LEU C  1 278 ? 102.566 -26.238 0.125   1.000 30.153  ? 7073 LEU C CG    1 
ATOM   5668 C  CD1   . LEU C  1 278 ? 103.576 -25.428 -0.673  1.000 31.667  ? 7073 LEU C CD1   1 
ATOM   5669 C  CD2   . LEU C  1 278 ? 101.426 -25.352 0.590   1.000 28.762  ? 7073 LEU C CD2   1 
ATOM   5670 N  N     . SER C  1 279 ? 101.455 -30.392 -1.400  1.000 31.548  ? 7074 SER C N     1 
ATOM   5671 C  CA    . SER C  1 279 ? 101.099 -31.423 -2.413  1.000 32.776  ? 7074 SER C CA    1 
ATOM   5672 C  C     . SER C  1 279 ? 100.014 -32.382 -1.913  1.000 33.095  ? 7074 SER C C     1 
ATOM   5673 O  O     . SER C  1 279 ? 99.393  -33.027 -2.758  1.000 32.423  ? 7074 SER C O     1 
ATOM   5674 C  CB    . SER C  1 279 ? 102.325 -32.193 -2.831  1.000 34.897  ? 7074 SER C CB    1 
ATOM   5675 O  OG    . SER C  1 279 ? 103.294 -31.327 -3.401  1.000 35.786  ? 7074 SER C OG    1 
ATOM   5676 N  N     . LYS C  1 280 ? 99.816  -32.488 -0.595  1.000 34.682  ? 7075 LYS C N     1 
ATOM   5677 C  CA    . LYS C  1 280 ? 98.805  -33.423 -0.024  1.000 35.207  ? 7075 LYS C CA    1 
ATOM   5678 C  C     . LYS C  1 280 ? 97.512  -32.672 0.309   1.000 32.589  ? 7075 LYS C C     1 
ATOM   5679 O  O     . LYS C  1 280 ? 96.576  -33.319 0.818   1.000 33.150  ? 7075 LYS C O     1 
ATOM   5680 C  CB    . LYS C  1 280 ? 99.354  -34.090 1.244   1.000 38.752  ? 7075 LYS C CB    1 
ATOM   5681 C  CG    . LYS C  1 280 ? 100.560 -34.997 1.045   1.000 43.244  ? 7075 LYS C CG    1 
ATOM   5682 C  CD    . LYS C  1 280 ? 101.188 -35.442 2.356   1.000 46.081  ? 7075 LYS C CD    1 
ATOM   5683 C  CE    . LYS C  1 280 ? 102.424 -36.289 2.168   1.000 50.125  ? 7075 LYS C CE    1 
ATOM   5684 N  NZ    . LYS C  1 280 ? 103.115 -36.514 3.460   1.000 53.866  ? 7075 LYS C NZ    1 
ATOM   5685 N  N     . GLY C  1 281 ? 97.453  -31.368 0.025   1.000 29.670  ? 7076 GLY C N     1 
ATOM   5686 C  CA    . GLY C  1 281 ? 96.251  -30.572 0.345   1.000 28.221  ? 7076 GLY C CA    1 
ATOM   5687 C  C     . GLY C  1 281 ? 96.096  -30.343 1.845   1.000 27.909  ? 7076 GLY C C     1 
ATOM   5688 O  O     . GLY C  1 281 ? 94.955  -30.140 2.296   1.000 28.548  ? 7076 GLY C O     1 
ATOM   5689 N  N     . ARG C  1 282 ? 97.203  -30.333 2.592   1.000 28.151  ? 7077 ARG C N     1 
ATOM   5690 C  CA    . ARG C  1 282 ? 97.144  -30.172 4.075   1.000 28.321  ? 7077 ARG C CA    1 
ATOM   5691 C  C     . ARG C  1 282 ? 97.639  -28.792 4.515   1.000 27.052  ? 7077 ARG C C     1 
ATOM   5692 O  O     . ARG C  1 282 ? 97.658  -28.553 5.731   1.000 27.998  ? 7077 ARG C O     1 
ATOM   5693 C  CB    . ARG C  1 282 ? 97.998  -31.254 4.741   1.000 30.133  ? 7077 ARG C CB    1 
ATOM   5694 C  CG    . ARG C  1 282 ? 97.651  -32.669 4.305   1.000 32.114  ? 7077 ARG C CG    1 
ATOM   5695 C  CD    . ARG C  1 282 ? 96.206  -33.016 4.593   1.000 32.980  ? 7077 ARG C CD    1 
ATOM   5696 N  NE    . ARG C  1 282 ? 95.975  -33.114 6.023   1.000 35.219  ? 7077 ARG C NE    1 
ATOM   5697 C  CZ    . ARG C  1 282 ? 96.118  -34.224 6.732   1.000 38.420  ? 7077 ARG C CZ    1 
ATOM   5698 N  NH1   . ARG C  1 282 ? 96.491  -35.350 6.144   1.000 40.132  ? 7077 ARG C NH1   1 
ATOM   5699 N  NH2   . ARG C  1 282 ? 95.894  -34.207 8.033   1.000 40.165  ? 7077 ARG C NH2   1 
ATOM   5700 N  N     . LEU C  1 283 ? 97.978  -27.911 3.575   1.000 26.468  ? 7078 LEU C N     1 
ATOM   5701 C  CA    . LEU C  1 283 ? 98.527  -26.589 3.964   1.000 26.929  ? 7078 LEU C CA    1 
ATOM   5702 C  C     . LEU C  1 283 ? 98.220  -25.538 2.902   1.000 26.280  ? 7078 LEU C C     1 
ATOM   5703 O  O     . LEU C  1 283 ? 98.237  -25.857 1.694   1.000 25.930  ? 7078 LEU C O     1 
ATOM   5704 C  CB    . LEU C  1 283 ? 100.044 -26.731 4.133   1.000 28.212  ? 7078 LEU C CB    1 
ATOM   5705 C  CG    . LEU C  1 283 ? 100.808 -25.464 4.519   1.000 29.050  ? 7078 LEU C CG    1 
ATOM   5706 C  CD1   . LEU C  1 283 ? 100.389 -24.967 5.897   1.000 29.132  ? 7078 LEU C CD1   1 
ATOM   5707 C  CD2   . LEU C  1 283 ? 102.311 -25.715 4.499   1.000 30.569  ? 7078 LEU C CD2   1 
ATOM   5708 N  N     . ILE C  1 284 ? 97.953  -24.328 3.373   1.000 23.052  ? 7079 ILE C N     1 
ATOM   5709 C  CA    . ILE C  1 284 ? 97.766  -23.123 2.523   1.000 23.681  ? 7079 ILE C CA    1 
ATOM   5710 C  C     . ILE C  1 284 ? 98.824  -22.128 3.002   1.000 24.599  ? 7079 ILE C C     1 
ATOM   5711 O  O     . ILE C  1 284 ? 98.955  -21.958 4.238   1.000 24.397  ? 7079 ILE C O     1 
ATOM   5712 C  CB    . ILE C  1 284 ? 96.334  -22.554 2.638   1.000 23.940  ? 7079 ILE C CB    1 
ATOM   5713 C  CG1   . ILE C  1 284 ? 95.308  -23.377 1.856   1.000 24.966  ? 7079 ILE C CG1   1 
ATOM   5714 C  CG2   . ILE C  1 284 ? 96.307  -21.103 2.186   1.000 24.463  ? 7079 ILE C CG2   1 
ATOM   5715 C  CD1   . ILE C  1 284 ? 95.346  -23.146 0.359   1.000 26.442  ? 7079 ILE C CD1   1 
ATOM   5716 N  N     . ILE C  1 285 ? 99.572  -21.530 2.079   1.000 25.191  ? 7080 ILE C N     1 
ATOM   5717 C  CA    . ILE C  1 285 ? 100.576 -20.511 2.488   1.000 26.868  ? 7080 ILE C CA    1 
ATOM   5718 C  C     . ILE C  1 285 ? 100.151 -19.164 1.906   1.000 27.563  ? 7080 ILE C C     1 
ATOM   5719 O  O     . ILE C  1 285 ? 100.080 -19.022 0.663   1.000 25.975  ? 7080 ILE C O     1 
ATOM   5720 C  CB    . ILE C  1 285 ? 102.007 -20.911 2.090   1.000 29.024  ? 7080 ILE C CB    1 
ATOM   5721 C  CG1   . ILE C  1 285 ? 102.425 -22.196 2.809   1.000 30.401  ? 7080 ILE C CG1   1 
ATOM   5722 C  CG2   . ILE C  1 285 ? 102.978 -19.769 2.359   1.000 31.004  ? 7080 ILE C CG2   1 
ATOM   5723 C  CD1   . ILE C  1 285 ? 103.741 -22.757 2.354   1.000 33.697  ? 7080 ILE C CD1   1 
ATOM   5724 N  N     . ARG C  1 286 ? 99.831  -18.241 2.809   1.000 27.684  ? 7081 ARG C N     1 
ATOM   5725 C  CA    . ARG C  1 286 ? 99.454  -16.849 2.471   1.000 28.819  ? 7081 ARG C CA    1 
ATOM   5726 C  C     . ARG C  1 286 ? 99.209  -16.104 3.780   1.000 30.680  ? 7081 ARG C C     1 
ATOM   5727 O  O     . ARG C  1 286 ? 99.094  -16.775 4.830   1.000 29.266  ? 7081 ARG C O     1 
ATOM   5728 C  CB    . ARG C  1 286 ? 98.179  -16.761 1.625   1.000 27.636  ? 7081 ARG C CB    1 
ATOM   5729 C  CG    . ARG C  1 286 ? 96.955  -17.405 2.263   1.000 26.581  ? 7081 ARG C CG    1 
ATOM   5730 C  CD    . ARG C  1 286 ? 95.676  -16.890 1.629   1.000 25.480  ? 7081 ARG C CD    1 
ATOM   5731 N  NE    . ARG C  1 286 ? 94.474  -17.616 2.012   1.000 24.817  ? 7081 ARG C NE    1 
ATOM   5732 C  CZ    . ARG C  1 286 ? 93.775  -17.425 3.125   1.000 25.049  ? 7081 ARG C CZ    1 
ATOM   5733 N  NH1   . ARG C  1 286 ? 92.682  -18.135 3.338   1.000 25.002  ? 7081 ARG C NH1   1 
ATOM   5734 N  NH2   . ARG C  1 286 ? 94.164  -16.536 4.021   1.000 25.961  ? 7081 ARG C NH2   1 
ATOM   5735 N  N     . GLU C  1 287 ? 99.183  -14.775 3.709   1.000 33.008  ? 7082 GLU C N     1 
ATOM   5736 C  CA    . GLU C  1 287 ? 98.839  -13.962 4.894   1.000 36.628  ? 7082 GLU C CA    1 
ATOM   5737 C  C     . GLU C  1 287 ? 97.317  -14.026 5.030   1.000 35.436  ? 7082 GLU C C     1 
ATOM   5738 O  O     . GLU C  1 287 ? 96.660  -14.629 4.150   1.000 33.281  ? 7082 GLU C O     1 
ATOM   5739 C  CB    . GLU C  1 287 ? 99.389  -12.545 4.738   1.000 40.411  ? 7082 GLU C CB    1 
ATOM   5740 C  CG    . GLU C  1 287 ? 100.905 -12.501 4.769   1.000 45.426  ? 7082 GLU C CG    1 
ATOM   5741 C  CD    . GLU C  1 287 ? 101.514 -11.112 4.706   1.000 51.273  ? 7082 GLU C CD    1 
ATOM   5742 O  OE1   . GLU C  1 287 ? 100.768 -10.142 4.441   1.000 52.523  ? 7082 GLU C OE1   1 
ATOM   5743 O  OE2   . GLU C  1 287 ? 102.734 -11.002 4.941   1.000 58.699  ? 7082 GLU C OE2   1 
ATOM   5744 N  N     A ASN C  1 288 ? 96.781  -13.457 6.110   0.600 37.316  ? 7083 ASN C N     1 
ATOM   5745 N  N     B ASN C  1 288 ? 96.788  -13.454 6.116   0.400 36.979  ? 7083 ASN C N     1 
ATOM   5746 C  CA    A ASN C  1 288 ? 95.315  -13.442 6.349   0.600 38.895  ? 7083 ASN C CA    1 
ATOM   5747 C  CA    B ASN C  1 288 ? 95.327  -13.437 6.395   0.400 37.887  ? 7083 ASN C CA    1 
ATOM   5748 C  C     A ASN C  1 288 ? 94.876  -11.994 6.603   0.600 39.446  ? 7083 ASN C C     1 
ATOM   5749 C  C     B ASN C  1 288 ? 94.880  -11.987 6.611   0.400 38.940  ? 7083 ASN C C     1 
ATOM   5750 O  O     A ASN C  1 288 ? 94.238  -11.735 7.632   0.600 40.412  ? 7083 ASN C O     1 
ATOM   5751 O  O     B ASN C  1 288 ? 94.233  -11.719 7.635   0.400 40.112  ? 7083 ASN C O     1 
ATOM   5752 C  CB    A ASN C  1 288 ? 94.932  -14.427 7.456   0.600 42.571  ? 7083 ASN C CB    1 
ATOM   5753 C  CB    B ASN C  1 288 ? 94.979  -14.302 7.609   0.400 40.352  ? 7083 ASN C CB    1 
ATOM   5754 C  CG    A ASN C  1 288 ? 95.735  -14.256 8.728   0.600 46.151  ? 7083 ASN C CG    1 
ATOM   5755 C  CG    B ASN C  1 288 ? 93.492  -14.358 7.884   0.400 41.259  ? 7083 ASN C CG    1 
ATOM   5756 O  OD1   A ASN C  1 288 ? 96.404  -13.243 8.922   0.600 50.376  ? 7083 ASN C OD1   1 
ATOM   5757 O  OD1   B ASN C  1 288 ? 92.690  -13.899 7.073   0.400 41.800  ? 7083 ASN C OD1   1 
ATOM   5758 N  ND2   A ASN C  1 288 ? 95.680  -15.253 9.594   0.600 48.137  ? 7083 ASN C ND2   1 
ATOM   5759 N  ND2   B ASN C  1 288 ? 93.114  -14.937 9.012   0.400 42.238  ? 7083 ASN C ND2   1 
ATOM   5760 N  N     . ASN C  1 289 ? 95.228  -11.099 5.675   1.000 38.453  ? 7084 ASN C N     1 
ATOM   5761 C  CA    . ASN C  1 289 ? 94.876  -9.655  5.751   1.000 40.957  ? 7084 ASN C CA    1 
ATOM   5762 C  C     . ASN C  1 289 ? 93.440  -9.434  5.260   1.000 40.917  ? 7084 ASN C C     1 
ATOM   5763 O  O     . ASN C  1 289 ? 92.880  -10.354 4.645   1.000 38.749  ? 7084 ASN C O     1 
ATOM   5764 C  CB    . ASN C  1 289 ? 95.811  -8.824  4.869   1.000 40.859  ? 7084 ASN C CB    1 
ATOM   5765 C  CG    . ASN C  1 289 ? 97.273  -9.048  5.186   1.000 41.783  ? 7084 ASN C CG    1 
ATOM   5766 O  OD1   . ASN C  1 289 ? 97.638  -9.199  6.346   1.000 42.410  ? 7084 ASN C OD1   1 
ATOM   5767 N  ND2   . ASN C  1 289 ? 98.112  -9.067  4.164   1.000 39.503  ? 7084 ASN C ND2   1 
ATOM   5768 N  N     . ARG C  1 290 ? 92.892  -8.241  5.510   1.000 44.285  ? 7085 ARG C N     1 
ATOM   5769 C  CA    . ARG C  1 290 ? 91.539  -7.864  5.020   1.000 46.849  ? 7085 ARG C CA    1 
ATOM   5770 C  C     . ARG C  1 290 ? 91.472  -8.195  3.525   1.000 42.132  ? 7085 ARG C C     1 
ATOM   5771 O  O     . ARG C  1 290 ? 92.405  -7.804  2.794   1.000 39.014  ? 7085 ARG C O     1 
ATOM   5772 C  CB    . ARG C  1 290 ? 91.289  -6.366  5.231   1.000 51.590  ? 7085 ARG C CB    1 
ATOM   5773 C  CG    . ARG C  1 290 ? 91.379  -5.909  6.679   1.000 62.045  ? 7085 ARG C CG    1 
ATOM   5774 C  CD    . ARG C  1 290 ? 91.337  -4.397  6.838   1.000 68.685  ? 7085 ARG C CD    1 
ATOM   5775 N  NE    . ARG C  1 290 ? 90.098  -3.800  6.347   1.000 72.988  ? 7085 ARG C NE    1 
ATOM   5776 C  CZ    . ARG C  1 290 ? 89.911  -3.277  5.134   1.000 71.582  ? 7085 ARG C CZ    1 
ATOM   5777 N  NH1   . ARG C  1 290 ? 88.731  -2.767  4.819   1.000 73.387  ? 7085 ARG C NH1   1 
ATOM   5778 N  NH2   . ARG C  1 290 ? 90.891  -3.254  4.245   1.000 70.211  ? 7085 ARG C NH2   1 
ATOM   5779 N  N     . VAL C  1 291 ? 90.442  -8.924  3.095   1.000 40.223  ? 7086 VAL C N     1 
ATOM   5780 C  CA    . VAL C  1 291 ? 90.343  -9.271  1.649   1.000 39.228  ? 7086 VAL C CA    1 
ATOM   5781 C  C     . VAL C  1 291 ? 89.798  -8.048  0.919   1.000 38.983  ? 7086 VAL C C     1 
ATOM   5782 O  O     . VAL C  1 291 ? 88.658  -7.650  1.222   1.000 37.701  ? 7086 VAL C O     1 
ATOM   5783 C  CB    . VAL C  1 291 ? 89.473  -10.513 1.396   1.000 40.651  ? 7086 VAL C CB    1 
ATOM   5784 C  CG1   . VAL C  1 291 ? 89.399  -10.832 -0.091  1.000 40.045  ? 7086 VAL C CG1   1 
ATOM   5785 C  CG2   . VAL C  1 291 ? 89.977  -11.718 2.174   1.000 42.749  ? 7086 VAL C CG2   1 
ATOM   5786 N  N     . VAL C  1 292 ? 90.606  -7.473  0.021   1.000 36.928  ? 7087 VAL C N     1 
ATOM   5787 C  CA    . VAL C  1 292 ? 90.179  -6.269  -0.744  1.000 38.478  ? 7087 VAL C CA    1 
ATOM   5788 C  C     . VAL C  1 292 ? 90.294  -6.568  -2.241  1.000 34.676  ? 7087 VAL C C     1 
ATOM   5789 O  O     . VAL C  1 292 ? 91.329  -7.121  -2.686  1.000 33.349  ? 7087 VAL C O     1 
ATOM   5790 C  CB    . VAL C  1 292 ? 90.982  -5.013  -0.359  1.000 42.435  ? 7087 VAL C CB    1 
ATOM   5791 C  CG1   . VAL C  1 292 ? 90.951  -4.789  1.146   1.000 47.489  ? 7087 VAL C CG1   1 
ATOM   5792 C  CG2   . VAL C  1 292 ? 92.415  -5.061  -0.864  1.000 44.017  ? 7087 VAL C CG2   1 
ATOM   5793 N  N     A ILE C  1 293 ? 89.267  -6.186  -2.997  0.500 33.104  ? 7088 ILE C N     1 
ATOM   5794 N  N     B ILE C  1 293 ? 89.236  -6.215  -2.977  0.500 33.224  ? 7088 ILE C N     1 
ATOM   5795 C  CA    A ILE C  1 293 ? 89.269  -6.404  -4.470  0.500 31.814  ? 7088 ILE C CA    1 
ATOM   5796 C  CA    B ILE C  1 293 ? 89.128  -6.425  -4.449  0.500 32.049  ? 7088 ILE C CA    1 
ATOM   5797 C  C     A ILE C  1 293 ? 88.513  -5.233  -5.103  0.500 31.256  ? 7088 ILE C C     1 
ATOM   5798 C  C     B ILE C  1 293 ? 88.560  -5.148  -5.064  0.500 31.221  ? 7088 ILE C C     1 
ATOM   5799 O  O     A ILE C  1 293 ? 87.589  -4.698  -4.451  0.500 31.038  ? 7088 ILE C O     1 
ATOM   5800 O  O     B ILE C  1 293 ? 87.829  -4.431  -4.347  0.500 30.569  ? 7088 ILE C O     1 
ATOM   5801 C  CB    A ILE C  1 293 ? 88.677  -7.786  -4.815  0.500 32.248  ? 7088 ILE C CB    1 
ATOM   5802 C  CB    B ILE C  1 293 ? 88.186  -7.605  -4.760  0.500 32.768  ? 7088 ILE C CB    1 
ATOM   5803 C  CG1   A ILE C  1 293 ? 89.006  -8.212  -6.248  0.500 32.751  ? 7088 ILE C CG1   1 
ATOM   5804 C  CG1   B ILE C  1 293 ? 86.726  -7.212  -4.520  0.500 34.847  ? 7088 ILE C CG1   1 
ATOM   5805 C  CG2   A ILE C  1 293 ? 87.187  -7.824  -4.522  0.500 33.613  ? 7088 ILE C CG2   1 
ATOM   5806 C  CG2   B ILE C  1 293 ? 88.575  -8.846  -3.979  0.500 32.671  ? 7088 ILE C CG2   1 
ATOM   5807 C  CD1   A ILE C  1 293 ? 88.574  -9.622  -6.586  0.500 33.062  ? 7088 ILE C CD1   1 
ATOM   5808 C  CD1   B ILE C  1 293 ? 85.726  -8.296  -4.841  0.500 36.000  ? 7088 ILE C CD1   1 
ATOM   5809 N  N     . SER C  1 294 ? 88.908  -4.858  -6.318  1.000 29.079  ? 7089 SER C N     1 
ATOM   5810 C  CA    . SER C  1 294 ? 88.308  -3.704  -7.022  1.000 31.175  ? 7089 SER C CA    1 
ATOM   5811 C  C     . SER C  1 294 ? 88.353  -3.952  -8.524  1.000 31.219  ? 7089 SER C C     1 
ATOM   5812 O  O     . SER C  1 294 ? 89.122  -4.835  -8.971  1.000 28.491  ? 7089 SER C O     1 
ATOM   5813 C  CB    . SER C  1 294 ? 89.019  -2.422  -6.668  1.000 31.026  ? 7089 SER C CB    1 
ATOM   5814 O  OG    . SER C  1 294 ? 90.379  -2.497  -7.060  1.000 31.902  ? 7089 SER C OG    1 
ATOM   5815 N  N     . SER C  1 295 ? 87.551  -3.178  -9.247  1.000 32.888  ? 7090 SER C N     1 
ATOM   5816 C  CA    . SER C  1 295 ? 87.478  -3.214  -10.723 1.000 34.937  ? 7090 SER C CA    1 
ATOM   5817 C  C     . SER C  1 295 ? 87.802  -1.809  -11.231 1.000 34.799  ? 7090 SER C C     1 
ATOM   5818 O  O     . SER C  1 295 ? 87.067  -0.885  -10.868 1.000 32.932  ? 7090 SER C O     1 
ATOM   5819 C  CB    . SER C  1 295 ? 86.133  -3.681  -11.190 1.000 36.619  ? 7090 SER C CB    1 
ATOM   5820 O  OG    . SER C  1 295 ? 86.022  -3.538  -12.592 1.000 41.500  ? 7090 SER C OG    1 
ATOM   5821 N  N     . ASP C  1 296 ? 88.917  -1.671  -11.953 1.000 36.839  ? 7091 ASP C N     1 
ATOM   5822 C  CA    . ASP C  1 296 ? 89.356  -0.379  -12.536 1.000 39.616  ? 7091 ASP C CA    1 
ATOM   5823 C  C     . ASP C  1 296 ? 88.280  0.199   -13.445 1.000 42.520  ? 7091 ASP C C     1 
ATOM   5824 O  O     . ASP C  1 296 ? 87.627  -0.565  -14.177 1.000 44.296  ? 7091 ASP C O     1 
ATOM   5825 C  CB    . ASP C  1 296 ? 90.578  -0.530  -13.447 1.000 42.683  ? 7091 ASP C CB    1 
ATOM   5826 C  CG    . ASP C  1 296 ? 91.891  -0.743  -12.726 1.000 44.603  ? 7091 ASP C CG    1 
ATOM   5827 O  OD1   . ASP C  1 296 ? 91.958  -0.418  -11.535 1.000 47.090  ? 7091 ASP C OD1   1 
ATOM   5828 O  OD2   . ASP C  1 296 ? 92.839  -1.220  -13.377 1.000 53.074  ? 7091 ASP C OD2   1 
ATOM   5829 N  N     A VAL C  1 297 ? 88.074  1.511   -13.371 0.600 43.297  ? 7092 VAL C N     1 
ATOM   5830 N  N     B VAL C  1 297 ? 88.117  1.519   -13.389 0.400 43.245  ? 7092 VAL C N     1 
ATOM   5831 C  CA    A VAL C  1 297 ? 87.120  2.163   -14.313 0.600 45.724  ? 7092 VAL C CA    1 
ATOM   5832 C  CA    B VAL C  1 297 ? 87.148  2.227   -14.269 0.400 45.355  ? 7092 VAL C CA    1 
ATOM   5833 C  C     A VAL C  1 297 ? 87.946  3.119   -15.181 0.600 46.246  ? 7092 VAL C C     1 
ATOM   5834 C  C     B VAL C  1 297 ? 87.962  3.144   -15.184 0.400 46.333  ? 7092 VAL C C     1 
ATOM   5835 O  O     A VAL C  1 297 ? 88.808  3.839   -14.617 0.600 43.384  ? 7092 VAL C O     1 
ATOM   5836 O  O     B VAL C  1 297 ? 88.795  3.911   -14.649 0.400 44.510  ? 7092 VAL C O     1 
ATOM   5837 C  CB    A VAL C  1 297 ? 85.944  2.860   -13.596 0.600 46.580  ? 7092 VAL C CB    1 
ATOM   5838 C  CB    B VAL C  1 297 ? 86.112  3.024   -13.455 0.400 45.619  ? 7092 VAL C CB    1 
ATOM   5839 C  CG1   A VAL C  1 297 ? 85.121  1.873   -12.786 0.600 47.975  ? 7092 VAL C CG1   1 
ATOM   5840 C  CG1   B VAL C  1 297 ? 85.117  3.732   -14.362 0.400 47.322  ? 7092 VAL C CG1   1 
ATOM   5841 C  CG2   A VAL C  1 297 ? 86.387  4.012   -12.715 0.600 46.249  ? 7092 VAL C CG2   1 
ATOM   5842 C  CG2   B VAL C  1 297 ? 85.387  2.146   -12.446 0.400 45.892  ? 7092 VAL C CG2   1 
ATOM   5843 N  N     . LEU C  1 298 ? 87.795  3.006   -16.502 1.000 48.697  ? 7093 LEU C N     1 
ATOM   5844 C  CA    . LEU C  1 298 ? 88.496  3.898   -17.460 1.000 51.911  ? 7093 LEU C CA    1 
ATOM   5845 C  C     . LEU C  1 298 ? 87.673  5.184   -17.492 1.000 51.000  ? 7093 LEU C C     1 
ATOM   5846 O  O     . LEU C  1 298 ? 86.459  5.089   -17.755 1.000 51.211  ? 7093 LEU C O     1 
ATOM   5847 C  CB    . LEU C  1 298 ? 88.582  3.253   -18.847 1.000 56.032  ? 7093 LEU C CB    1 
ATOM   5848 C  CG    . LEU C  1 298 ? 89.159  4.147   -19.950 1.000 60.059  ? 7093 LEU C CG    1 
ATOM   5849 C  CD1   . LEU C  1 298 ? 90.583  4.576   -19.622 1.000 60.637  ? 7093 LEU C CD1   1 
ATOM   5850 C  CD2   . LEU C  1 298 ? 89.113  3.449   -21.302 1.000 62.593  ? 7093 LEU C CD2   1 
ATOM   5851 N  N     . VAL C  1 299 ? 88.290  6.316   -17.166 1.000 49.331  ? 7094 VAL C N     1 
ATOM   5852 C  CA    . VAL C  1 299 ? 87.531  7.598   -17.132 1.000 51.536  ? 7094 VAL C CA    1 
ATOM   5853 C  C     . VAL C  1 299 ? 87.765  8.332   -18.456 1.000 55.023  ? 7094 VAL C C     1 
ATOM   5854 O  O     . VAL C  1 299 ? 88.939  8.430   -18.868 1.000 52.456  ? 7094 VAL C O     1 
ATOM   5855 C  CB    . VAL C  1 299 ? 87.950  8.451   -15.919 1.000 50.071  ? 7094 VAL C CB    1 
ATOM   5856 C  CG1   . VAL C  1 299 ? 87.018  9.640   -15.720 1.000 51.612  ? 7094 VAL C CG1   1 
ATOM   5857 C  CG2   . VAL C  1 299 ? 88.014  7.619   -14.645 1.000 48.754  ? 7094 VAL C CG2   1 
ATOM   5858 N  N     . ASN C  1 300 ? 86.687  8.822   -19.082 1.000 60.995  ? 7095 ASN C N     1 
ATOM   5859 C  CA    . ASN C  1 300 ? 86.774  9.564   -20.372 1.000 66.549  ? 7095 ASN C CA    1 
ATOM   5860 C  C     . ASN C  1 300 ? 85.441  10.276  -20.647 1.000 66.512  ? 7095 ASN C C     1 
ATOM   5861 O  O     . ASN C  1 300 ? 84.595  10.425  -19.761 1.000 61.253  ? 7095 ASN C O     1 
ATOM   5862 C  CB    . ASN C  1 300 ? 87.191  8.642   -21.524 1.000 71.170  ? 7095 ASN C CB    1 
ATOM   5863 C  CG    . ASN C  1 300 ? 86.356  7.381   -21.628 1.000 75.966  ? 7095 ASN C CG    1 
ATOM   5864 O  OD1   . ASN C  1 300 ? 85.333  7.242   -20.958 1.000 79.644  ? 7095 ASN C OD1   1 
ATOM   5865 N  ND2   . ASN C  1 300 ? 86.789  6.448   -22.463 1.000 80.155  ? 7095 ASN C ND2   1 
ATOM   5866 N  N     . ALA D  2 21  ? 59.535  11.037  -0.584  1.000 80.114  ? 4271 ALA D N     1 
ATOM   5867 C  CA    . ALA D  2 21  ? 58.073  10.718  -0.564  1.000 80.106  ? 4271 ALA D CA    1 
ATOM   5868 C  C     . ALA D  2 21  ? 57.725  9.755   -1.708  1.000 78.727  ? 4271 ALA D C     1 
ATOM   5869 O  O     . ALA D  2 21  ? 56.831  8.906   -1.507  1.000 80.301  ? 4271 ALA D O     1 
ATOM   5870 C  CB    . ALA D  2 21  ? 57.268  11.992  -0.647  1.000 79.940  ? 4271 ALA D CB    1 
ATOM   5871 N  N     . PHE D  2 22  ? 58.404  9.882   -2.858  1.000 75.829  ? 4272 PHE D N     1 
ATOM   5872 C  CA    . PHE D  2 22  ? 58.138  8.999   -4.028  1.000 71.030  ? 4272 PHE D CA    1 
ATOM   5873 C  C     . PHE D  2 22  ? 59.019  7.746   -3.977  1.000 71.412  ? 4272 PHE D C     1 
ATOM   5874 O  O     . PHE D  2 22  ? 60.178  7.821   -3.527  1.000 74.411  ? 4272 PHE D O     1 
ATOM   5875 C  CB    . PHE D  2 22  ? 58.371  9.723   -5.359  1.000 64.652  ? 4272 PHE D CB    1 
ATOM   5876 C  CG    . PHE D  2 22  ? 58.302  8.824   -6.572  1.000 58.876  ? 4272 PHE D CG    1 
ATOM   5877 C  CD1   . PHE D  2 22  ? 57.081  8.388   -7.068  1.000 57.601  ? 4272 PHE D CD1   1 
ATOM   5878 C  CD2   . PHE D  2 22  ? 59.458  8.412   -7.221  1.000 55.217  ? 4272 PHE D CD2   1 
ATOM   5879 C  CE1   . PHE D  2 22  ? 57.020  7.556   -8.177  1.000 56.068  ? 4272 PHE D CE1   1 
ATOM   5880 C  CE2   . PHE D  2 22  ? 59.394  7.587   -8.335  1.000 54.585  ? 4272 PHE D CE2   1 
ATOM   5881 C  CZ    . PHE D  2 22  ? 58.175  7.160   -8.811  1.000 54.816  ? 4272 PHE D CZ    1 
ATOM   5882 N  N     . ALA D  2 23  ? 58.463  6.633   -4.462  1.000 70.979  ? 4273 ALA D N     1 
ATOM   5883 C  CA    . ALA D  2 23  ? 59.158  5.327   -4.536  1.000 70.033  ? 4273 ALA D CA    1 
ATOM   5884 C  C     . ALA D  2 23  ? 58.364  4.416   -5.477  1.000 67.508  ? 4273 ALA D C     1 
ATOM   5885 O  O     . ALA D  2 23  ? 57.151  4.246   -5.238  1.000 68.982  ? 4273 ALA D O     1 
ATOM   5886 C  CB    . ALA D  2 23  ? 59.290  4.725   -3.159  1.000 71.746  ? 4273 ALA D CB    1 
ATOM   5887 N  N     . VAL D  2 24  ? 59.010  3.893   -6.523  1.000 67.385  ? 4274 VAL D N     1 
ATOM   5888 C  CA    . VAL D  2 24  ? 58.317  2.990   -7.491  1.000 67.825  ? 4274 VAL D CA    1 
ATOM   5889 C  C     . VAL D  2 24  ? 57.845  1.750   -6.726  1.000 65.537  ? 4274 VAL D C     1 
ATOM   5890 O  O     . VAL D  2 24  ? 58.664  1.173   -5.987  1.000 68.504  ? 4274 VAL D O     1 
ATOM   5891 C  CB    . VAL D  2 24  ? 59.232  2.608   -8.671  1.000 69.735  ? 4274 VAL D CB    1 
ATOM   5892 C  CG1   . VAL D  2 24  ? 58.554  1.625   -9.611  1.000 71.250  ? 4274 VAL D CG1   1 
ATOM   5893 C  CG2   . VAL D  2 24  ? 59.706  3.833   -9.438  1.000 71.531  ? 4274 VAL D CG2   1 
ATOM   5894 N  N     . ASP D  2 25  ? 56.572  1.376   -6.885  1.000 61.964  ? 4275 ASP D N     1 
ATOM   5895 C  CA    . ASP D  2 25  ? 56.020  0.184   -6.185  1.000 61.710  ? 4275 ASP D CA    1 
ATOM   5896 C  C     . ASP D  2 25  ? 56.132  -1.019  -7.131  1.000 58.605  ? 4275 ASP D C     1 
ATOM   5897 O  O     . ASP D  2 25  ? 55.108  -1.404  -7.740  1.000 55.170  ? 4275 ASP D O     1 
ATOM   5898 C  CB    . ASP D  2 25  ? 54.591  0.442   -5.699  1.000 63.243  ? 4275 ASP D CB    1 
ATOM   5899 C  CG    . ASP D  2 25  ? 54.010  -0.675  -4.847  1.000 66.573  ? 4275 ASP D CG    1 
ATOM   5900 O  OD1   . ASP D  2 25  ? 54.717  -1.686  -4.626  1.000 64.408  ? 4275 ASP D OD1   1 
ATOM   5901 O  OD2   . ASP D  2 25  ? 52.850  -0.527  -4.408  1.000 70.857  ? 4275 ASP D OD2   1 
ATOM   5902 N  N     . ALA D  2 26  ? 57.340  -1.585  -7.238  1.000 55.949  ? 4276 ALA D N     1 
ATOM   5903 C  CA    . ALA D  2 26  ? 57.605  -2.737  -8.135  1.000 52.164  ? 4276 ALA D CA    1 
ATOM   5904 C  C     . ALA D  2 26  ? 56.761  -3.951  -7.720  1.000 48.596  ? 4276 ALA D C     1 
ATOM   5905 O  O     . ALA D  2 26  ? 56.244  -4.637  -8.625  1.000 47.264  ? 4276 ALA D O     1 
ATOM   5906 C  CB    . ALA D  2 26  ? 59.078  -3.056  -8.128  1.000 52.261  ? 4276 ALA D CB    1 
ATOM   5907 N  N     . ALA D  2 27  ? 56.628  -4.200  -6.410  1.000 47.592  ? 4277 ALA D N     1 
ATOM   5908 C  CA    . ALA D  2 27  ? 55.841  -5.352  -5.903  1.000 47.810  ? 4277 ALA D CA    1 
ATOM   5909 C  C     . ALA D  2 27  ? 54.435  -5.329  -6.514  1.000 50.107  ? 4277 ALA D C     1 
ATOM   5910 O  O     . ALA D  2 27  ? 54.072  -6.297  -7.214  1.000 47.733  ? 4277 ALA D O     1 
ATOM   5911 C  CB    . ALA D  2 27  ? 55.786  -5.316  -4.397  1.000 50.280  ? 4277 ALA D CB    1 
ATOM   5912 N  N     . LYS D  2 28  ? 53.686  -4.248  -6.266  1.000 52.551  ? 4278 LYS D N     1 
ATOM   5913 C  CA    . LYS D  2 28  ? 52.310  -4.075  -6.806  1.000 54.259  ? 4278 LYS D CA    1 
ATOM   5914 C  C     . LYS D  2 28  ? 52.326  -4.208  -8.335  1.000 50.803  ? 4278 LYS D C     1 
ATOM   5915 O  O     . LYS D  2 28  ? 51.454  -4.925  -8.874  1.000 50.392  ? 4278 LYS D O     1 
ATOM   5916 C  CB    . LYS D  2 28  ? 51.752  -2.709  -6.384  1.000 60.003  ? 4278 LYS D CB    1 
ATOM   5917 C  CG    . LYS D  2 28  ? 50.448  -2.299  -7.056  1.000 65.151  ? 4278 LYS D CG    1 
ATOM   5918 C  CD    . LYS D  2 28  ? 49.921  -0.954  -6.592  1.000 70.367  ? 4278 LYS D CD    1 
ATOM   5919 C  CE    . LYS D  2 28  ? 48.800  -0.431  -7.466  1.000 74.741  ? 4278 LYS D CE    1 
ATOM   5920 N  NZ    . LYS D  2 28  ? 47.706  -1.421  -7.613  1.000 77.882  ? 4278 LYS D NZ    1 
ATOM   5921 N  N     . ALA D  2 29  ? 53.272  -3.535  -9.000  1.000 47.254  ? 4279 ALA D N     1 
ATOM   5922 C  CA    . ALA D  2 29  ? 53.378  -3.566  -10.479 1.000 47.602  ? 4279 ALA D CA    1 
ATOM   5923 C  C     . ALA D  2 29  ? 53.515  -5.011  -10.979 1.000 47.122  ? 4279 ALA D C     1 
ATOM   5924 O  O     . ALA D  2 29  ? 52.850  -5.357  -11.977 1.000 48.760  ? 4279 ALA D O     1 
ATOM   5925 C  CB    . ALA D  2 29  ? 54.547  -2.720  -10.927 1.000 48.247  ? 4279 ALA D CB    1 
ATOM   5926 N  N     . TYR D  2 30  ? 54.343  -5.825  -10.318 1.000 48.587  ? 4280 TYR D N     1 
ATOM   5927 C  CA    . TYR D  2 30  ? 54.529  -7.226  -10.783 1.000 45.313  ? 4280 TYR D CA    1 
ATOM   5928 C  C     . TYR D  2 30  ? 53.231  -8.014  -10.554 1.000 44.250  ? 4280 TYR D C     1 
ATOM   5929 O  O     . TYR D  2 30  ? 52.820  -8.750  -11.468 1.000 42.986  ? 4280 TYR D O     1 
ATOM   5930 C  CB    . TYR D  2 30  ? 55.744  -7.876  -10.112 1.000 44.977  ? 4280 TYR D CB    1 
ATOM   5931 C  CG    . TYR D  2 30  ? 56.031  -9.278  -10.590 1.000 41.945  ? 4280 TYR D CG    1 
ATOM   5932 C  CD1   . TYR D  2 30  ? 56.466  -9.513  -11.884 1.000 41.274  ? 4280 TYR D CD1   1 
ATOM   5933 C  CD2   . TYR D  2 30  ? 55.907  -10.368 -9.743  1.000 42.498  ? 4280 TYR D CD2   1 
ATOM   5934 C  CE1   . TYR D  2 30  ? 56.733  -10.797 -12.335 1.000 40.028  ? 4280 TYR D CE1   1 
ATOM   5935 C  CE2   . TYR D  2 30  ? 56.179  -11.657 -10.176 1.000 40.108  ? 4280 TYR D CE2   1 
ATOM   5936 C  CZ    . TYR D  2 30  ? 56.594  -11.873 -11.477 1.000 38.887  ? 4280 TYR D CZ    1 
ATOM   5937 O  OH    . TYR D  2 30  ? 56.854  -13.140 -11.912 1.000 37.692  ? 4280 TYR D OH    1 
ATOM   5938 N  N     . LYS D  2 31  ? 52.601  -7.846  -9.387  1.000 47.640  ? 4281 LYS D N     1 
ATOM   5939 C  CA    . LYS D  2 31  ? 51.332  -8.561  -9.067  1.000 50.468  ? 4281 LYS D CA    1 
ATOM   5940 C  C     . LYS D  2 31  ? 50.254  -8.181  -10.093 1.000 51.566  ? 4281 LYS D C     1 
ATOM   5941 O  O     . LYS D  2 31  ? 49.506  -9.082  -10.518 1.000 50.732  ? 4281 LYS D O     1 
ATOM   5942 C  CB    . LYS D  2 31  ? 50.900  -8.241  -7.633  1.000 54.545  ? 4281 LYS D CB    1 
ATOM   5943 C  CG    . LYS D  2 31  ? 51.903  -8.663  -6.568  1.000 56.525  ? 4281 LYS D CG    1 
ATOM   5944 C  CD    . LYS D  2 31  ? 51.549  -8.212  -5.169  1.000 61.105  ? 4281 LYS D CD    1 
ATOM   5945 C  CE    . LYS D  2 31  ? 52.646  -8.525  -4.173  1.000 63.289  ? 4281 LYS D CE    1 
ATOM   5946 N  NZ    . LYS D  2 31  ? 52.309  -8.059  -2.808  1.000 69.163  ? 4281 LYS D NZ    1 
ATOM   5947 N  N     . ASP D  2 32  ? 50.193  -6.900  -10.482 1.000 54.033  ? 4282 ASP D N     1 
ATOM   5948 C  CA    . ASP D  2 32  ? 49.205  -6.426  -11.494 1.000 56.530  ? 4282 ASP D CA    1 
ATOM   5949 C  C     . ASP D  2 32  ? 49.513  -7.089  -12.842 1.000 54.315  ? 4282 ASP D C     1 
ATOM   5950 O  O     . ASP D  2 32  ? 48.567  -7.562  -13.501 1.000 53.540  ? 4282 ASP D O     1 
ATOM   5951 C  CB    . ASP D  2 32  ? 49.214  -4.898  -11.625 1.000 60.824  ? 4282 ASP D CB    1 
ATOM   5952 C  CG    . ASP D  2 32  ? 48.693  -4.161  -10.401 1.000 64.390  ? 4282 ASP D CG    1 
ATOM   5953 O  OD1   . ASP D  2 32  ? 48.029  -4.807  -9.566  1.000 65.144  ? 4282 ASP D OD1   1 
ATOM   5954 O  OD2   . ASP D  2 32  ? 48.969  -2.947  -10.286 1.000 66.762  ? 4282 ASP D OD2   1 
ATOM   5955 N  N     . TYR D  2 33  ? 50.793  -7.107  -13.225 1.000 53.417  ? 4283 TYR D N     1 
ATOM   5956 C  CA    . TYR D  2 33  ? 51.258  -7.733  -14.493 1.000 51.743  ? 4283 TYR D CA    1 
ATOM   5957 C  C     . TYR D  2 33  ? 50.810  -9.203  -14.532 1.000 50.375  ? 4283 TYR D C     1 
ATOM   5958 O  O     . TYR D  2 33  ? 50.267  -9.636  -15.567 1.000 51.296  ? 4283 TYR D O     1 
ATOM   5959 C  CB    . TYR D  2 33  ? 52.773  -7.544  -14.615 1.000 50.953  ? 4283 TYR D CB    1 
ATOM   5960 C  CG    . TYR D  2 33  ? 53.470  -8.420  -15.625 1.000 51.936  ? 4283 TYR D CG    1 
ATOM   5961 C  CD1   . TYR D  2 33  ? 53.605  -8.037  -16.952 1.000 53.112  ? 4283 TYR D CD1   1 
ATOM   5962 C  CD2   . TYR D  2 33  ? 54.046  -9.618  -15.233 1.000 48.986  ? 4283 TYR D CD2   1 
ATOM   5963 C  CE1   . TYR D  2 33  ? 54.265  -8.841  -17.869 1.000 53.626  ? 4283 TYR D CE1   1 
ATOM   5964 C  CE2   . TYR D  2 33  ? 54.707  -10.432 -16.136 1.000 48.687  ? 4283 TYR D CE2   1 
ATOM   5965 C  CZ    . TYR D  2 33  ? 54.822  -10.042 -17.459 1.000 52.551  ? 4283 TYR D CZ    1 
ATOM   5966 O  OH    . TYR D  2 33  ? 55.478  -10.850 -18.344 1.000 54.156  ? 4283 TYR D OH    1 
ATOM   5967 N  N     . LEU D  2 34  ? 51.019  -9.938  -13.433 1.000 50.384  ? 4284 LEU D N     1 
ATOM   5968 C  CA    . LEU D  2 34  ? 50.616  -11.371 -13.359 1.000 50.358  ? 4284 LEU D CA    1 
ATOM   5969 C  C     . LEU D  2 34  ? 49.097  -11.490 -13.517 1.000 53.197  ? 4284 LEU D C     1 
ATOM   5970 O  O     . LEU D  2 34  ? 48.656  -12.326 -14.337 1.000 53.940  ? 4284 LEU D O     1 
ATOM   5971 C  CB    . LEU D  2 34  ? 51.063  -11.966 -12.020 1.000 49.168  ? 4284 LEU D CB    1 
ATOM   5972 C  CG    . LEU D  2 34  ? 52.570  -12.132 -11.833 1.000 47.929  ? 4284 LEU D CG    1 
ATOM   5973 C  CD1   . LEU D  2 34  ? 52.889  -12.581 -10.415 1.000 48.165  ? 4284 LEU D CD1   1 
ATOM   5974 C  CD2   . LEU D  2 34  ? 53.139  -13.111 -12.849 1.000 47.276  ? 4284 LEU D CD2   1 
ATOM   5975 N  N     . ALA D  2 35  ? 48.344  -10.680 -12.761 1.000 54.414  ? 4285 ALA D N     1 
ATOM   5976 C  CA    . ALA D  2 35  ? 46.859  -10.704 -12.788 1.000 60.057  ? 4285 ALA D CA    1 
ATOM   5977 C  C     . ALA D  2 35  ? 46.338  -10.488 -14.216 1.000 61.472  ? 4285 ALA D C     1 
ATOM   5978 O  O     . ALA D  2 35  ? 45.267  -11.036 -14.529 1.000 65.865  ? 4285 ALA D O     1 
ATOM   5979 C  CB    . ALA D  2 35  ? 46.310  -9.663  -11.841 1.000 60.862  ? 4285 ALA D CB    1 
ATOM   5980 N  N     . SER D  2 36  ? 47.076  -9.732  -15.040 1.000 61.499  ? 4286 SER D N     1 
ATOM   5981 C  CA    . SER D  2 36  ? 46.673  -9.443  -16.445 1.000 65.248  ? 4286 SER D CA    1 
ATOM   5982 C  C     . SER D  2 36  ? 47.151  -10.552 -17.397 1.000 65.680  ? 4286 SER D C     1 
ATOM   5983 O  O     . SER D  2 36  ? 47.033  -10.360 -18.626 1.000 68.062  ? 4286 SER D O     1 
ATOM   5984 C  CB    . SER D  2 36  ? 47.184  -8.094  -16.878 1.000 67.697  ? 4286 SER D CB    1 
ATOM   5985 O  OG    . SER D  2 36  ? 46.658  -7.068  -16.049 1.000 70.318  ? 4286 SER D OG    1 
ATOM   5986 N  N     . GLY D  2 37  ? 47.683  -11.656 -16.854 1.000 62.730  ? 4287 GLY D N     1 
ATOM   5987 C  CA    . GLY D  2 37  ? 48.135  -12.805 -17.666 1.000 62.392  ? 4287 GLY D CA    1 
ATOM   5988 C  C     . GLY D  2 37  ? 49.571  -12.672 -18.153 1.000 59.325  ? 4287 GLY D C     1 
ATOM   5989 O  O     . GLY D  2 37  ? 49.909  -13.337 -19.155 1.000 57.902  ? 4287 GLY D O     1 
ATOM   5990 N  N     . GLY D  2 38  ? 50.390  -11.858 -17.478 1.000 56.131  ? 4288 GLY D N     1 
ATOM   5991 C  CA    . GLY D  2 38  ? 51.800  -11.683 -17.878 1.000 53.905  ? 4288 GLY D CA    1 
ATOM   5992 C  C     . GLY D  2 38  ? 52.631  -12.907 -17.518 1.000 51.963  ? 4288 GLY D C     1 
ATOM   5993 O  O     . GLY D  2 38  ? 52.370  -13.495 -16.451 1.000 49.819  ? 4288 GLY D O     1 
ATOM   5994 N  N     . GLN D  2 39  ? 53.571  -13.292 -18.391 1.000 52.103  ? 4289 GLN D N     1 
ATOM   5995 C  CA    . GLN D  2 39  ? 54.449  -14.469 -18.147 1.000 51.807  ? 4289 GLN D CA    1 
ATOM   5996 C  C     . GLN D  2 39  ? 55.364  -14.185 -16.959 1.000 44.639  ? 4289 GLN D C     1 
ATOM   5997 O  O     . GLN D  2 39  ? 56.072  -13.182 -16.946 1.000 44.406  ? 4289 GLN D O     1 
ATOM   5998 C  CB    . GLN D  2 39  ? 55.292  -14.802 -19.382 1.000 59.024  ? 4289 GLN D CB    1 
ATOM   5999 C  CG    . GLN D  2 39  ? 54.507  -15.432 -20.527 1.000 68.899  ? 4289 GLN D CG    1 
ATOM   6000 C  CD    . GLN D  2 39  ? 54.074  -16.853 -20.248 1.000 74.312  ? 4289 GLN D CD    1 
ATOM   6001 O  OE1   . GLN D  2 39  ? 54.494  -17.478 -19.274 1.000 77.597  ? 4289 GLN D OE1   1 
ATOM   6002 N  NE2   . GLN D  2 39  ? 53.245  -17.389 -21.130 1.000 79.311  ? 4289 GLN D NE2   1 
ATOM   6003 N  N     . PRO D  2 40  ? 55.374  -15.055 -15.924 1.000 50.662  ? 4290 PRO D N     1 
ATOM   6004 C  CA    . PRO D  2 40  ? 56.252  -14.866 -14.769 1.000 47.006  ? 4290 PRO D CA    1 
ATOM   6005 C  C     . PRO D  2 40  ? 57.741  -14.724 -15.120 1.000 43.226  ? 4290 PRO D C     1 
ATOM   6006 O  O     . PRO D  2 40  ? 58.161  -15.252 -16.134 1.000 41.142  ? 4290 PRO D O     1 
ATOM   6007 C  CB    . PRO D  2 40  ? 56.063  -16.167 -13.974 1.000 46.761  ? 4290 PRO D CB    1 
ATOM   6008 C  CG    . PRO D  2 40  ? 54.662  -16.623 -14.334 1.000 48.590  ? 4290 PRO D CG    1 
ATOM   6009 C  CD    . PRO D  2 40  ? 54.501  -16.232 -15.786 1.000 50.317  ? 4290 PRO D CD    1 
ATOM   6010 N  N     . ILE D  2 41  ? 58.489  -13.995 -14.288 1.000 40.892  ? 4291 ILE D N     1 
ATOM   6011 C  CA    . ILE D  2 41  ? 59.963  -13.851 -14.483 1.000 38.338  ? 4291 ILE D CA    1 
ATOM   6012 C  C     . ILE D  2 41  ? 60.555  -15.257 -14.588 1.000 35.617  ? 4291 ILE D C     1 
ATOM   6013 O  O     . ILE D  2 41  ? 60.235  -16.105 -13.737 1.000 34.131  ? 4291 ILE D O     1 
ATOM   6014 C  CB    . ILE D  2 41  ? 60.591  -13.038 -13.339 1.000 37.938  ? 4291 ILE D CB    1 
ATOM   6015 C  CG1   . ILE D  2 41  ? 60.145  -11.576 -13.418 1.000 39.733  ? 4291 ILE D CG1   1 
ATOM   6016 C  CG2   . ILE D  2 41  ? 62.108  -13.179 -13.356 1.000 35.821  ? 4291 ILE D CG2   1 
ATOM   6017 C  CD1   . ILE D  2 41  ? 60.469  -10.758 -12.191 1.000 40.576  ? 4291 ILE D CD1   1 
ATOM   6018 N  N     A THR D  2 42  ? 61.421  -15.460 -15.583 0.700 35.316  ? 4292 THR D N     1 
ATOM   6019 N  N     B THR D  2 42  ? 61.403  -15.492 -15.593 0.300 34.974  ? 4292 THR D N     1 
ATOM   6020 C  CA    A THR D  2 42  ? 62.039  -16.785 -15.857 0.700 34.527  ? 4292 THR D CA    1 
ATOM   6021 C  CA    B THR D  2 42  ? 61.999  -16.842 -15.789 0.300 33.686  ? 4292 THR D CA    1 
ATOM   6022 C  C     A THR D  2 42  ? 63.503  -16.815 -15.406 0.700 32.284  ? 4292 THR D C     1 
ATOM   6023 C  C     B THR D  2 42  ? 63.486  -16.822 -15.417 0.300 31.879  ? 4292 THR D C     1 
ATOM   6024 O  O     A THR D  2 42  ? 63.986  -15.802 -14.842 0.700 30.793  ? 4292 THR D O     1 
ATOM   6025 O  O     B THR D  2 42  ? 63.968  -15.779 -14.923 0.300 31.253  ? 4292 THR D O     1 
ATOM   6026 C  CB    A THR D  2 42  ? 61.969  -17.094 -17.358 0.700 36.154  ? 4292 THR D CB    1 
ATOM   6027 C  CB    B THR D  2 42  ? 61.790  -17.330 -17.229 0.300 34.750  ? 4292 THR D CB    1 
ATOM   6028 O  OG1   A THR D  2 42  ? 62.722  -16.087 -18.035 0.700 36.724  ? 4292 THR D OG1   1 
ATOM   6029 O  OG1   B THR D  2 42  ? 62.193  -18.698 -17.296 0.300 33.808  ? 4292 THR D OG1   1 
ATOM   6030 C  CG2   A THR D  2 42  ? 60.555  -17.118 -17.897 0.700 38.485  ? 4292 THR D CG2   1 
ATOM   6031 C  CG2   B THR D  2 42  ? 62.550  -16.510 -18.248 0.300 35.433  ? 4292 THR D CG2   1 
ATOM   6032 N  N     . ASN D  2 43  ? 64.161  -17.955 -15.636 1.000 30.302  ? 4293 ASN D N     1 
ATOM   6033 C  CA    . ASN D  2 43  ? 65.607  -18.142 -15.350 1.000 29.491  ? 4293 ASN D CA    1 
ATOM   6034 C  C     . ASN D  2 43  ? 65.907  -18.096 -13.847 1.000 27.545  ? 4293 ASN D C     1 
ATOM   6035 O  O     . ASN D  2 43  ? 67.067  -17.802 -13.501 1.000 27.015  ? 4293 ASN D O     1 
ATOM   6036 C  CB    . ASN D  2 43  ? 66.453  -17.207 -16.219 1.000 31.094  ? 4293 ASN D CB    1 
ATOM   6037 C  CG    . ASN D  2 43  ? 66.360  -17.592 -17.681 1.000 33.812  ? 4293 ASN D CG    1 
ATOM   6038 O  OD1   . ASN D  2 43  ? 66.319  -18.776 -18.006 1.000 35.446  ? 4293 ASN D OD1   1 
ATOM   6039 N  ND2   . ASN D  2 43  ? 66.335  -16.613 -18.568 1.000 35.389  ? 4293 ASN D ND2   1 
ATOM   6040 N  N     . CYS D  2 44  ? 64.911  -18.340 -12.990 1.000 26.490  ? 4294 CYS D N     1 
ATOM   6041 C  CA    . CYS D  2 44  ? 65.243  -18.511 -11.552 1.000 26.820  ? 4294 CYS D CA    1 
ATOM   6042 C  C     . CYS D  2 44  ? 66.144  -19.755 -11.496 1.000 25.309  ? 4294 CYS D C     1 
ATOM   6043 O  O     . CYS D  2 44  ? 65.862  -20.711 -12.234 1.000 25.573  ? 4294 CYS D O     1 
ATOM   6044 C  CB    . CYS D  2 44  ? 63.993  -18.640 -10.695 1.000 28.006  ? 4294 CYS D CB    1 
ATOM   6045 S  SG    . CYS D  2 44  ? 62.939  -17.167 -10.795 1.000 31.200  ? 4294 CYS D SG    1 
ATOM   6046 N  N     . VAL D  2 45  ? 67.194  -19.739 -10.680 1.000 23.835  ? 4295 VAL D N     1 
ATOM   6047 C  CA    . VAL D  2 45  ? 68.189  -20.852 -10.717 1.000 22.705  ? 4295 VAL D CA    1 
ATOM   6048 C  C     . VAL D  2 45  ? 67.773  -21.981 -9.772  1.000 22.152  ? 4295 VAL D C     1 
ATOM   6049 O  O     . VAL D  2 45  ? 67.976  -21.842 -8.547  1.000 22.333  ? 4295 VAL D O     1 
ATOM   6050 C  CB    . VAL D  2 45  ? 69.598  -20.324 -10.401 1.000 22.312  ? 4295 VAL D CB    1 
ATOM   6051 C  CG1   . VAL D  2 45  ? 70.641  -21.430 -10.449 1.000 21.616  ? 4295 VAL D CG1   1 
ATOM   6052 C  CG2   . VAL D  2 45  ? 69.981  -19.194 -11.343 1.000 22.691  ? 4295 VAL D CG2   1 
ATOM   6053 N  N     . LYS D  2 46  ? 67.289  -23.084 -10.344 1.000 21.607  ? 4296 LYS D N     1 
ATOM   6054 C  CA    . LYS D  2 46  ? 66.873  -24.242 -9.517  1.000 22.929  ? 4296 LYS D CA    1 
ATOM   6055 C  C     . LYS D  2 46  ? 68.113  -25.093 -9.216  1.000 22.169  ? 4296 LYS D C     1 
ATOM   6056 O  O     . LYS D  2 46  ? 68.919  -25.355 -10.142 1.000 21.519  ? 4296 LYS D O     1 
ATOM   6057 C  CB    . LYS D  2 46  ? 65.765  -25.053 -10.190 1.000 24.725  ? 4296 LYS D CB    1 
ATOM   6058 C  CG    . LYS D  2 46  ? 65.160  -26.108 -9.272  1.000 26.469  ? 4296 LYS D CG    1 
ATOM   6059 C  CD    . LYS D  2 46  ? 63.903  -26.766 -9.788  1.000 28.783  ? 4296 LYS D CD    1 
ATOM   6060 C  CE    . LYS D  2 46  ? 64.125  -27.711 -10.942 1.000 29.407  ? 4296 LYS D CE    1 
ATOM   6061 N  NZ    . LYS D  2 46  ? 62.867  -28.417 -11.293 1.000 30.973  ? 4296 LYS D NZ    1 
ATOM   6062 N  N     . MET D  2 47  ? 68.271  -25.475 -7.950  1.000 21.576  ? 4297 MET D N     1 
ATOM   6063 C  CA    . MET D  2 47  ? 69.456  -26.261 -7.542  1.000 20.891  ? 4297 MET D CA    1 
ATOM   6064 C  C     . MET D  2 47  ? 69.124  -27.750 -7.518  1.000 21.622  ? 4297 MET D C     1 
ATOM   6065 O  O     . MET D  2 47  ? 67.938  -28.116 -7.319  1.000 22.658  ? 4297 MET D O     1 
ATOM   6066 C  CB    . MET D  2 47  ? 69.910  -25.873 -6.131  1.000 21.179  ? 4297 MET D CB    1 
ATOM   6067 C  CG    . MET D  2 47  ? 69.965  -24.382 -5.874  1.000 21.084  ? 4297 MET D CG    1 
ATOM   6068 S  SD    . MET D  2 47  ? 70.914  -23.474 -7.120  1.000 21.950  ? 4297 MET D SD    1 
ATOM   6069 C  CE    . MET D  2 47  ? 72.508  -24.287 -7.026  1.000 21.726  ? 4297 MET D CE    1 
ATOM   6070 N  N     . LEU D  2 48  ? 70.153  -28.562 -7.722  1.000 21.212  ? 4298 LEU D N     1 
ATOM   6071 C  CA    . LEU D  2 48  ? 70.051  -30.023 -7.527  1.000 22.249  ? 4298 LEU D CA    1 
ATOM   6072 C  C     . LEU D  2 48  ? 70.204  -30.274 -6.021  1.000 22.832  ? 4298 LEU D C     1 
ATOM   6073 O  O     . LEU D  2 48  ? 71.102  -29.663 -5.422  1.000 22.671  ? 4298 LEU D O     1 
ATOM   6074 C  CB    . LEU D  2 48  ? 71.172  -30.701 -8.312  1.000 21.838  ? 4298 LEU D CB    1 
ATOM   6075 C  CG    . LEU D  2 48  ? 70.987  -30.708 -9.823  1.000 22.255  ? 4298 LEU D CG    1 
ATOM   6076 C  CD1   . LEU D  2 48  ? 72.302  -30.993 -10.526 1.000 22.721  ? 4298 LEU D CD1   1 
ATOM   6077 C  CD2   . LEU D  2 48  ? 69.917  -31.718 -10.219 1.000 23.240  ? 4298 LEU D CD2   1 
ATOM   6078 N  N     . CYS D  2 49  ? 69.334  -31.085 -5.419  1.000 24.655  ? 4299 CYS D N     1 
ATOM   6079 C  CA    . CYS D  2 49  ? 69.501  -31.377 -3.972  1.000 25.597  ? 4299 CYS D CA    1 
ATOM   6080 C  C     . CYS D  2 49  ? 68.844  -32.722 -3.651  1.000 25.931  ? 4299 CYS D C     1 
ATOM   6081 O  O     . CYS D  2 49  ? 68.265  -33.344 -4.565  1.000 25.360  ? 4299 CYS D O     1 
ATOM   6082 C  CB    . CYS D  2 49  ? 68.980  -30.238 -3.103  1.000 27.967  ? 4299 CYS D CB    1 
ATOM   6083 S  SG    . CYS D  2 49  ? 67.214  -29.913 -3.320  1.000 30.882  ? 4299 CYS D SG    1 
ATOM   6084 N  N     . THR D  2 50  ? 68.981  -33.171 -2.405  1.000 25.740  ? 4300 THR D N     1 
ATOM   6085 C  CA    . THR D  2 50  ? 68.452  -34.488 -1.968  1.000 26.070  ? 4300 THR D CA    1 
ATOM   6086 C  C     . THR D  2 50  ? 66.950  -34.432 -1.686  1.000 26.283  ? 4300 THR D C     1 
ATOM   6087 O  O     . THR D  2 50  ? 66.348  -35.502 -1.650  1.000 27.061  ? 4300 THR D O     1 
ATOM   6088 C  CB    . THR D  2 50  ? 69.186  -34.946 -0.704  1.000 27.469  ? 4300 THR D CB    1 
ATOM   6089 O  OG1   . THR D  2 50  ? 68.871  -33.994 0.311   1.000 26.204  ? 4300 THR D OG1   1 
ATOM   6090 C  CG2   . THR D  2 50  ? 70.684  -35.056 -0.897  1.000 27.683  ? 4300 THR D CG2   1 
ATOM   6091 N  N     . HIS D  2 51  ? 66.381  -33.238 -1.481  1.000 25.626  ? 4301 HIS D N     1 
ATOM   6092 C  CA    . HIS D  2 51  ? 64.947  -33.095 -1.095  1.000 27.164  ? 4301 HIS D CA    1 
ATOM   6093 C  C     . HIS D  2 51  ? 64.708  -33.781 0.262   1.000 28.240  ? 4301 HIS D C     1 
ATOM   6094 O  O     . HIS D  2 51  ? 63.607  -34.317 0.481   1.000 28.105  ? 4301 HIS D O     1 
ATOM   6095 C  CB    . HIS D  2 51  ? 64.009  -33.569 -2.215  1.000 28.659  ? 4301 HIS D CB    1 
ATOM   6096 C  CG    . HIS D  2 51  ? 64.068  -32.676 -3.403  1.000 27.730  ? 4301 HIS D CG    1 
ATOM   6097 N  ND1   . HIS D  2 51  ? 63.206  -31.608 -3.564  1.000 28.457  ? 4301 HIS D ND1   1 
ATOM   6098 C  CD2   . HIS D  2 51  ? 64.932  -32.636 -4.440  1.000 28.158  ? 4301 HIS D CD2   1 
ATOM   6099 C  CE1   . HIS D  2 51  ? 63.525  -30.958 -4.671  1.000 29.275  ? 4301 HIS D CE1   1 
ATOM   6100 N  NE2   . HIS D  2 51  ? 64.590  -31.565 -5.223  1.000 28.716  ? 4301 HIS D NE2   1 
ATOM   6101 N  N     . THR D  2 52  ? 65.708  -33.728 1.149   1.000 29.215  ? 4302 THR D N     1 
ATOM   6102 C  CA    . THR D  2 52  ? 65.614  -34.303 2.519   1.000 30.903  ? 4302 THR D CA    1 
ATOM   6103 C  C     . THR D  2 52  ? 65.837  -33.178 3.533   1.000 31.247  ? 4302 THR D C     1 
ATOM   6104 O  O     . THR D  2 52  ? 66.155  -33.482 4.692   1.000 32.897  ? 4302 THR D O     1 
ATOM   6105 C  CB    . THR D  2 52  ? 66.657  -35.403 2.748   1.000 32.044  ? 4302 THR D CB    1 
ATOM   6106 O  OG1   . THR D  2 52  ? 67.940  -34.791 2.646   1.000 30.891  ? 4302 THR D OG1   1 
ATOM   6107 C  CG2   . THR D  2 52  ? 66.543  -36.558 1.778   1.000 32.746  ? 4302 THR D CG2   1 
ATOM   6108 N  N     . GLY D  2 53  ? 65.632  -31.930 3.106   1.000 30.499  ? 4303 GLY D N     1 
ATOM   6109 C  CA    . GLY D  2 53  ? 65.911  -30.758 3.959   1.000 30.783  ? 4303 GLY D CA    1 
ATOM   6110 C  C     . GLY D  2 53  ? 64.829  -30.455 4.978   1.000 32.147  ? 4303 GLY D C     1 
ATOM   6111 O  O     . GLY D  2 53  ? 63.809  -31.165 5.024   1.000 33.088  ? 4303 GLY D O     1 
ATOM   6112 N  N     . THR D  2 54  ? 65.051  -29.382 5.741   1.000 32.323  ? 4304 THR D N     1 
ATOM   6113 C  CA    . THR D  2 54  ? 64.151  -28.941 6.835   1.000 33.555  ? 4304 THR D CA    1 
ATOM   6114 C  C     . THR D  2 54  ? 62.871  -28.312 6.285   1.000 33.398  ? 4304 THR D C     1 
ATOM   6115 O  O     . THR D  2 54  ? 61.905  -28.240 7.041   1.000 33.627  ? 4304 THR D O     1 
ATOM   6116 C  CB    . THR D  2 54  ? 64.866  -27.911 7.713   1.000 34.573  ? 4304 THR D CB    1 
ATOM   6117 O  OG1   . THR D  2 54  ? 65.125  -26.776 6.886   1.000 32.208  ? 4304 THR D OG1   1 
ATOM   6118 C  CG2   . THR D  2 54  ? 66.153  -28.438 8.307   1.000 35.479  ? 4304 THR D CG2   1 
ATOM   6119 N  N     . GLY D  2 55  ? 62.882  -27.839 5.035   1.000 31.541  ? 4305 GLY D N     1 
ATOM   6120 C  CA    . GLY D  2 55  ? 61.682  -27.190 4.475   1.000 32.688  ? 4305 GLY D CA    1 
ATOM   6121 C  C     . GLY D  2 55  ? 61.568  -25.726 4.890   1.000 33.222  ? 4305 GLY D C     1 
ATOM   6122 O  O     . GLY D  2 55  ? 60.554  -25.099 4.535   1.000 33.577  ? 4305 GLY D O     1 
ATOM   6123 N  N     . GLN D  2 56  ? 62.554  -25.196 5.627   1.000 33.694  ? 4306 GLN D N     1 
ATOM   6124 C  CA    . GLN D  2 56  ? 62.526  -23.756 6.004   1.000 34.956  ? 4306 GLN D CA    1 
ATOM   6125 C  C     . GLN D  2 56  ? 62.552  -22.914 4.719   1.000 32.284  ? 4306 GLN D C     1 
ATOM   6126 O  O     . GLN D  2 56  ? 63.118  -23.377 3.714   1.000 30.869  ? 4306 GLN D O     1 
ATOM   6127 C  CB    . GLN D  2 56  ? 63.661  -23.409 6.968   1.000 36.859  ? 4306 GLN D CB    1 
ATOM   6128 C  CG    . GLN D  2 56  ? 63.453  -23.975 8.368   1.000 40.979  ? 4306 GLN D CG    1 
ATOM   6129 C  CD    . GLN D  2 56  ? 64.431  -23.396 9.362   1.000 44.172  ? 4306 GLN D CD    1 
ATOM   6130 O  OE1   . GLN D  2 56  ? 65.639  -23.371 9.141   1.000 48.158  ? 4306 GLN D OE1   1 
ATOM   6131 N  NE2   . GLN D  2 56  ? 63.910  -22.934 10.482  1.000 48.805  ? 4306 GLN D NE2   1 
ATOM   6132 N  N     . ALA D  2 57  ? 61.989  -21.704 4.785   1.000 33.042  ? 4307 ALA D N     1 
ATOM   6133 C  CA    . ALA D  2 57  ? 61.815  -20.799 3.625   1.000 31.949  ? 4307 ALA D CA    1 
ATOM   6134 C  C     . ALA D  2 57  ? 63.140  -20.334 3.009   1.000 30.380  ? 4307 ALA D C     1 
ATOM   6135 O  O     . ALA D  2 57  ? 63.295  -20.514 1.789   1.000 29.538  ? 4307 ALA D O     1 
ATOM   6136 C  CB    . ALA D  2 57  ? 60.990  -19.612 4.042   1.000 34.136  ? 4307 ALA D CB    1 
ATOM   6137 N  N     . ILE D  2 58  ? 64.031  -19.732 3.807   1.000 30.350  ? 4308 ILE D N     1 
ATOM   6138 C  CA    . ILE D  2 58  ? 65.298  -19.138 3.280   1.000 29.437  ? 4308 ILE D CA    1 
ATOM   6139 C  C     . ILE D  2 58  ? 66.462  -19.669 4.116   1.000 29.317  ? 4308 ILE D C     1 
ATOM   6140 O  O     . ILE D  2 58  ? 66.514  -19.349 5.318   1.000 29.908  ? 4308 ILE D O     1 
ATOM   6141 C  CB    . ILE D  2 58  ? 65.201  -17.602 3.285   1.000 30.480  ? 4308 ILE D CB    1 
ATOM   6142 C  CG1   . ILE D  2 58  ? 63.947  -17.128 2.544   1.000 30.774  ? 4308 ILE D CG1   1 
ATOM   6143 C  CG2   . ILE D  2 58  ? 66.467  -16.986 2.716   1.000 29.903  ? 4308 ILE D CG2   1 
ATOM   6144 C  CD1   . ILE D  2 58  ? 63.697  -15.643 2.632   1.000 32.398  ? 4308 ILE D CD1   1 
ATOM   6145 N  N     . THR D  2 59  ? 67.384  -20.390 3.469   1.000 27.012  ? 4309 THR D N     1 
ATOM   6146 C  CA    . THR D  2 59  ? 68.446  -21.126 4.200   1.000 27.564  ? 4309 THR D CA    1 
ATOM   6147 C  C     . THR D  2 59  ? 69.830  -20.891 3.586   1.000 26.474  ? 4309 THR D C     1 
ATOM   6148 O  O     . THR D  2 59  ? 69.905  -20.435 2.428   1.000 25.820  ? 4309 THR D O     1 
ATOM   6149 C  CB    . THR D  2 59  ? 68.036  -22.602 4.243   1.000 27.804  ? 4309 THR D CB    1 
ATOM   6150 O  OG1   . THR D  2 59  ? 67.824  -23.023 2.898   1.000 26.638  ? 4309 THR D OG1   1 
ATOM   6151 C  CG2   . THR D  2 59  ? 66.765  -22.826 5.032   1.000 29.467  ? 4309 THR D CG2   1 
ATOM   6152 N  N     . VAL D  2 60  ? 70.883  -21.223 4.341   1.000 26.633  ? 4310 VAL D N     1 
ATOM   6153 C  CA    . VAL D  2 60  ? 72.286  -20.956 3.898   1.000 27.765  ? 4310 VAL D CA    1 
ATOM   6154 C  C     . VAL D  2 60  ? 72.680  -21.966 2.812   1.000 26.461  ? 4310 VAL D C     1 
ATOM   6155 O  O     . VAL D  2 60  ? 73.645  -21.692 2.075   1.000 25.768  ? 4310 VAL D O     1 
ATOM   6156 C  CB    . VAL D  2 60  ? 73.274  -20.983 5.079   1.000 29.493  ? 4310 VAL D CB    1 
ATOM   6157 C  CG1   . VAL D  2 60  ? 72.938  -19.926 6.126   1.000 31.939  ? 4310 VAL D CG1   1 
ATOM   6158 C  CG2   . VAL D  2 60  ? 73.365  -22.357 5.719   1.000 31.194  ? 4310 VAL D CG2   1 
ATOM   6159 N  N     . THR D  2 61  ? 71.963  -23.087 2.754   1.000 26.447  ? 4311 THR D N     1 
ATOM   6160 C  CA    . THR D  2 61  ? 72.201  -24.171 1.770   1.000 27.143  ? 4311 THR D CA    1 
ATOM   6161 C  C     . THR D  2 61  ? 70.830  -24.733 1.395   1.000 26.471  ? 4311 THR D C     1 
ATOM   6162 O  O     . THR D  2 61  ? 69.858  -24.525 2.121   1.000 27.918  ? 4311 THR D O     1 
ATOM   6163 C  CB    . THR D  2 61  ? 73.182  -25.199 2.352   1.000 29.721  ? 4311 THR D CB    1 
ATOM   6164 O  OG1   . THR D  2 61  ? 73.670  -26.024 1.296   1.000 33.959  ? 4311 THR D OG1   1 
ATOM   6165 C  CG2   . THR D  2 61  ? 72.561  -26.056 3.431   1.000 31.145  ? 4311 THR D CG2   1 
ATOM   6166 N  N     . PRO D  2 62  ? 70.662  -25.379 0.222   1.000 25.623  ? 4312 PRO D N     1 
ATOM   6167 C  CA    . PRO D  2 62  ? 69.358  -25.922 -0.163  1.000 25.510  ? 4312 PRO D CA    1 
ATOM   6168 C  C     . PRO D  2 62  ? 68.761  -26.824 0.927   1.000 26.411  ? 4312 PRO D C     1 
ATOM   6169 O  O     . PRO D  2 62  ? 69.453  -27.718 1.396   1.000 26.342  ? 4312 PRO D O     1 
ATOM   6170 C  CB    . PRO D  2 62  ? 69.688  -26.700 -1.448  1.000 24.911  ? 4312 PRO D CB    1 
ATOM   6171 C  CG    . PRO D  2 62  ? 70.825  -25.912 -2.042  1.000 24.152  ? 4312 PRO D CG    1 
ATOM   6172 C  CD    . PRO D  2 62  ? 71.669  -25.539 -0.841  1.000 24.969  ? 4312 PRO D CD    1 
ATOM   6173 N  N     . GLU D  2 63  ? 67.510  -26.545 1.308   1.000 26.675  ? 4313 GLU D N     1 
ATOM   6174 C  CA    . GLU D  2 63  ? 66.799  -27.303 2.374   1.000 27.769  ? 4313 GLU D CA    1 
ATOM   6175 C  C     . GLU D  2 63  ? 65.428  -27.771 1.870   1.000 27.509  ? 4313 GLU D C     1 
ATOM   6176 O  O     . GLU D  2 63  ? 64.533  -28.017 2.714   1.000 27.914  ? 4313 GLU D O     1 
ATOM   6177 C  CB    . GLU D  2 63  ? 66.672  -26.442 3.632   1.000 29.018  ? 4313 GLU D CB    1 
ATOM   6178 C  CG    . GLU D  2 63  ? 67.976  -26.265 4.389   1.000 29.871  ? 4313 GLU D CG    1 
ATOM   6179 C  CD    . GLU D  2 63  ? 68.524  -27.524 5.045   1.000 31.303  ? 4313 GLU D CD    1 
ATOM   6180 O  OE1   . GLU D  2 63  ? 67.802  -28.547 5.071   1.000 31.242  ? 4313 GLU D OE1   1 
ATOM   6181 O  OE2   . GLU D  2 63  ? 69.675  -27.478 5.535   1.000 32.163  ? 4313 GLU D OE2   1 
ATOM   6182 N  N     . ALA D  2 64  ? 65.276  -27.923 0.553   1.000 25.424  ? 4314 ALA D N     1 
ATOM   6183 C  CA    . ALA D  2 64  ? 63.990  -28.407 -0.004  1.000 26.159  ? 4314 ALA D CA    1 
ATOM   6184 C  C     . ALA D  2 64  ? 63.613  -29.768 0.594   1.000 27.010  ? 4314 ALA D C     1 
ATOM   6185 O  O     . ALA D  2 64  ? 64.507  -30.617 0.796   1.000 26.473  ? 4314 ALA D O     1 
ATOM   6186 C  CB    . ALA D  2 64  ? 64.064  -28.528 -1.513  1.000 25.052  ? 4314 ALA D CB    1 
ATOM   6187 N  N     . ASN D  2 65  ? 62.329  -29.933 0.896   1.000 28.071  ? 4315 ASN D N     1 
ATOM   6188 C  CA    . ASN D  2 65  ? 61.781  -31.251 1.311   1.000 30.775  ? 4315 ASN D CA    1 
ATOM   6189 C  C     . ASN D  2 65  ? 61.176  -31.837 0.027   1.000 31.661  ? 4315 ASN D C     1 
ATOM   6190 O  O     . ASN D  2 65  ? 61.459  -31.269 -1.053  1.000 29.466  ? 4315 ASN D O     1 
ATOM   6191 C  CB    . ASN D  2 65  ? 60.827  -31.135 2.503   1.000 32.271  ? 4315 ASN D CB    1 
ATOM   6192 C  CG    . ASN D  2 65  ? 59.617  -30.266 2.234   1.000 33.176  ? 4315 ASN D CG    1 
ATOM   6193 O  OD1   . ASN D  2 65  ? 59.216  -30.078 1.087   1.000 31.993  ? 4315 ASN D OD1   1 
ATOM   6194 N  ND2   . ASN D  2 65  ? 59.002  -29.771 3.296   1.000 34.404  ? 4315 ASN D ND2   1 
ATOM   6195 N  N     . MET D  2 66  ? 60.373  -32.896 0.118   1.000 33.806  ? 4316 MET D N     1 
ATOM   6196 C  CA    . MET D  2 66  ? 59.801  -33.517 -1.111  1.000 34.932  ? 4316 MET D CA    1 
ATOM   6197 C  C     . MET D  2 66  ? 58.626  -32.706 -1.673  1.000 35.848  ? 4316 MET D C     1 
ATOM   6198 O  O     . MET D  2 66  ? 58.144  -33.071 -2.752  1.000 35.478  ? 4316 MET D O     1 
ATOM   6199 C  CB    . MET D  2 66  ? 59.359  -34.960 -0.849  1.000 37.400  ? 4316 MET D CB    1 
ATOM   6200 C  CG    . MET D  2 66  ? 60.476  -35.953 -1.071  1.000 37.912  ? 4316 MET D CG    1 
ATOM   6201 S  SD    . MET D  2 66  ? 61.109  -35.806 -2.766  1.000 40.598  ? 4316 MET D SD    1 
ATOM   6202 C  CE    . MET D  2 66  ? 59.634  -36.182 -3.714  1.000 41.373  ? 4316 MET D CE    1 
ATOM   6203 N  N     . ASP D  2 67  ? 58.220  -31.629 -1.004  1.000 35.862  ? 4317 ASP D N     1 
ATOM   6204 C  CA    . ASP D  2 67  ? 57.086  -30.800 -1.491  1.000 37.267  ? 4317 ASP D CA    1 
ATOM   6205 C  C     . ASP D  2 67  ? 57.634  -29.461 -2.000  1.000 34.996  ? 4317 ASP D C     1 
ATOM   6206 O  O     . ASP D  2 67  ? 56.821  -28.556 -2.284  1.000 35.315  ? 4317 ASP D O     1 
ATOM   6207 C  CB    . ASP D  2 67  ? 56.065  -30.583 -0.371  1.000 40.664  ? 4317 ASP D CB    1 
ATOM   6208 C  CG    . ASP D  2 67  ? 55.521  -31.873 0.226   1.000 44.446  ? 4317 ASP D CG    1 
ATOM   6209 O  OD1   . ASP D  2 67  ? 55.342  -32.853 -0.531  1.000 45.081  ? 4317 ASP D OD1   1 
ATOM   6210 O  OD2   . ASP D  2 67  ? 55.323  -31.902 1.454   1.000 48.930  ? 4317 ASP D OD2   1 
ATOM   6211 N  N     . GLN D  2 68  ? 58.959  -29.352 -2.138  1.000 32.028  ? 4318 GLN D N     1 
ATOM   6212 C  CA    . GLN D  2 68  ? 59.567  -28.060 -2.542  1.000 30.065  ? 4318 GLN D CA    1 
ATOM   6213 C  C     . GLN D  2 68  ? 60.714  -28.239 -3.544  1.000 28.788  ? 4318 GLN D C     1 
ATOM   6214 O  O     . GLN D  2 68  ? 61.207  -29.371 -3.724  1.000 26.993  ? 4318 GLN D O     1 
ATOM   6215 C  CB    . GLN D  2 68  ? 60.202  -27.384 -1.324  1.000 29.709  ? 4318 GLN D CB    1 
ATOM   6216 C  CG    . GLN D  2 68  ? 59.249  -27.096 -0.172  1.000 31.025  ? 4318 GLN D CG    1 
ATOM   6217 C  CD    . GLN D  2 68  ? 60.000  -26.759 1.094   1.000 30.827  ? 4318 GLN D CD    1 
ATOM   6218 O  OE1   . GLN D  2 68  ? 61.101  -27.254 1.330   1.000 29.715  ? 4318 GLN D OE1   1 
ATOM   6219 N  NE2   . GLN D  2 68  ? 59.396  -25.936 1.938   1.000 30.975  ? 4318 GLN D NE2   1 
ATOM   6220 N  N     . GLU D  2 69  ? 61.108  -27.115 -4.144  1.000 27.165  ? 4319 GLU D N     1 
ATOM   6221 C  CA    . GLU D  2 69  ? 62.298  -26.982 -5.013  1.000 27.204  ? 4319 GLU D CA    1 
ATOM   6222 C  C     . GLU D  2 69  ? 63.165  -25.906 -4.350  1.000 26.267  ? 4319 GLU D C     1 
ATOM   6223 O  O     . GLU D  2 69  ? 62.574  -25.001 -3.723  1.000 26.965  ? 4319 GLU D O     1 
ATOM   6224 C  CB    . GLU D  2 69  ? 61.929  -26.552 -6.436  1.000 28.463  ? 4319 GLU D CB    1 
ATOM   6225 C  CG    . GLU D  2 69  ? 61.137  -27.580 -7.227  1.000 30.996  ? 4319 GLU D CG    1 
ATOM   6226 C  CD    . GLU D  2 69  ? 61.946  -28.734 -7.798  1.000 33.698  ? 4319 GLU D CD    1 
ATOM   6227 O  OE1   . GLU D  2 69  ? 61.530  -29.274 -8.859  1.000 37.363  ? 4319 GLU D OE1   1 
ATOM   6228 O  OE2   . GLU D  2 69  ? 62.999  -29.082 -7.212  1.000 34.602  ? 4319 GLU D OE2   1 
ATOM   6229 N  N     . SER D  2 70  ? 64.490  -26.057 -4.403  1.000 24.776  ? 4320 SER D N     1 
ATOM   6230 C  CA    . SER D  2 70  ? 65.419  -25.039 -3.855  1.000 24.315  ? 4320 SER D CA    1 
ATOM   6231 C  C     . SER D  2 70  ? 65.965  -24.206 -5.016  1.000 23.269  ? 4320 SER D C     1 
ATOM   6232 O  O     . SER D  2 70  ? 66.350  -24.797 -6.042  1.000 23.403  ? 4320 SER D O     1 
ATOM   6233 C  CB    . SER D  2 70  ? 66.546  -25.645 -3.068  1.000 24.237  ? 4320 SER D CB    1 
ATOM   6234 O  OG    . SER D  2 70  ? 66.092  -26.171 -1.831  1.000 26.453  ? 4320 SER D OG    1 
ATOM   6235 N  N     . PHE D  2 71  ? 65.988  -22.890 -4.841  1.000 23.169  ? 4321 PHE D N     1 
ATOM   6236 C  CA    . PHE D  2 71  ? 66.520  -21.973 -5.872  1.000 22.797  ? 4321 PHE D CA    1 
ATOM   6237 C  C     . PHE D  2 71  ? 67.553  -21.023 -5.276  1.000 23.054  ? 4321 PHE D C     1 
ATOM   6238 O  O     . PHE D  2 71  ? 67.432  -20.660 -4.078  1.000 22.827  ? 4321 PHE D O     1 
ATOM   6239 C  CB    . PHE D  2 71  ? 65.408  -21.092 -6.444  1.000 23.455  ? 4321 PHE D CB    1 
ATOM   6240 C  CG    . PHE D  2 71  ? 64.371  -21.802 -7.270  1.000 24.144  ? 4321 PHE D CG    1 
ATOM   6241 C  CD1   . PHE D  2 71  ? 63.304  -22.449 -6.669  1.000 25.127  ? 4321 PHE D CD1   1 
ATOM   6242 C  CD2   . PHE D  2 71  ? 64.421  -21.756 -8.655  1.000 24.769  ? 4321 PHE D CD2   1 
ATOM   6243 C  CE1   . PHE D  2 71  ? 62.338  -23.079 -7.438  1.000 25.980  ? 4321 PHE D CE1   1 
ATOM   6244 C  CE2   . PHE D  2 71  ? 63.448  -22.378 -9.422  1.000 24.874  ? 4321 PHE D CE2   1 
ATOM   6245 C  CZ    . PHE D  2 71  ? 62.412  -23.040 -8.810  1.000 26.248  ? 4321 PHE D CZ    1 
ATOM   6246 N  N     . GLY D  2 72  ? 68.529  -20.628 -6.096  1.000 22.606  ? 4322 GLY D N     1 
ATOM   6247 C  CA    . GLY D  2 72  ? 69.464  -19.568 -5.679  1.000 23.292  ? 4322 GLY D CA    1 
ATOM   6248 C  C     . GLY D  2 72  ? 68.632  -18.338 -5.363  1.000 23.809  ? 4322 GLY D C     1 
ATOM   6249 O  O     . GLY D  2 72  ? 67.789  -17.958 -6.211  1.000 24.627  ? 4322 GLY D O     1 
ATOM   6250 N  N     . GLY D  2 73  ? 68.844  -17.745 -4.191  1.000 24.736  ? 4323 GLY D N     1 
ATOM   6251 C  CA    . GLY D  2 73  ? 68.008  -16.629 -3.707  1.000 25.769  ? 4323 GLY D CA    1 
ATOM   6252 C  C     . GLY D  2 73  ? 68.002  -15.397 -4.595  1.000 26.296  ? 4323 GLY D C     1 
ATOM   6253 O  O     . GLY D  2 73  ? 66.894  -14.877 -4.878  1.000 26.811  ? 4323 GLY D O     1 
ATOM   6254 N  N     . ALA D  2 74  ? 69.179  -14.911 -4.994  1.000 26.194  ? 4324 ALA D N     1 
ATOM   6255 C  CA    . ALA D  2 74  ? 69.235  -13.664 -5.793  1.000 27.384  ? 4324 ALA D CA    1 
ATOM   6256 C  C     . ALA D  2 74  ? 68.323  -13.761 -7.024  1.000 27.477  ? 4324 ALA D C     1 
ATOM   6257 O  O     . ALA D  2 74  ? 67.613  -12.770 -7.306  1.000 27.121  ? 4324 ALA D O     1 
ATOM   6258 C  CB    . ALA D  2 74  ? 70.660  -13.371 -6.187  1.000 27.699  ? 4324 ALA D CB    1 
ATOM   6259 N  N     . SER D  2 75  ? 68.326  -14.912 -7.705  1.000 25.468  ? 4325 SER D N     1 
ATOM   6260 C  CA    . SER D  2 75  ? 67.554  -15.112 -8.959  1.000 25.984  ? 4325 SER D CA    1 
ATOM   6261 C  C     . SER D  2 75  ? 66.038  -15.093 -8.718  1.000 27.304  ? 4325 SER D C     1 
ATOM   6262 O  O     . SER D  2 75  ? 65.301  -14.935 -9.707  1.000 27.602  ? 4325 SER D O     1 
ATOM   6263 C  CB    . SER D  2 75  ? 67.975  -16.380 -9.652  1.000 25.647  ? 4325 SER D CB    1 
ATOM   6264 O  OG    . SER D  2 75  ? 67.550  -17.530 -8.936  1.000 24.208  ? 4325 SER D OG    1 
ATOM   6265 N  N     . CYS D  2 76  ? 65.589  -15.215 -7.463  1.000 27.604  ? 4326 CYS D N     1 
ATOM   6266 C  CA    . CYS D  2 76  ? 64.133  -15.227 -7.150  1.000 28.957  ? 4326 CYS D CA    1 
ATOM   6267 C  C     . CYS D  2 76  ? 63.693  -13.922 -6.489  1.000 29.809  ? 4326 CYS D C     1 
ATOM   6268 O  O     . CYS D  2 76  ? 62.550  -13.878 -5.995  1.000 30.144  ? 4326 CYS D O     1 
ATOM   6269 C  CB    . CYS D  2 76  ? 63.790  -16.359 -6.192  1.000 29.434  ? 4326 CYS D CB    1 
ATOM   6270 S  SG    . CYS D  2 76  ? 64.226  -17.979 -6.851  1.000 28.324  ? 4326 CYS D SG    1 
ATOM   6271 N  N     . CYS D  2 77  ? 64.566  -12.912 -6.476  1.000 29.322  ? 4327 CYS D N     1 
ATOM   6272 C  CA    . CYS D  2 77  ? 64.246  -11.620 -5.817  1.000 31.114  ? 4327 CYS D CA    1 
ATOM   6273 C  C     . CYS D  2 77  ? 63.831  -10.589 -6.873  1.000 32.124  ? 4327 CYS D C     1 
ATOM   6274 O  O     . CYS D  2 77  ? 64.640  -10.306 -7.774  1.000 31.296  ? 4327 CYS D O     1 
ATOM   6275 C  CB    . CYS D  2 77  ? 65.448  -11.144 -5.014  1.000 31.860  ? 4327 CYS D CB    1 
ATOM   6276 S  SG    . CYS D  2 77  ? 65.225  -9.512  -4.257  1.000 33.338  ? 4327 CYS D SG    1 
ATOM   6277 N  N     . LEU D  2 78  ? 62.612  -10.053 -6.762  1.000 34.331  ? 4328 LEU D N     1 
ATOM   6278 C  CA    . LEU D  2 78  ? 62.124  -9.038  -7.733  1.000 35.510  ? 4328 LEU D CA    1 
ATOM   6279 C  C     . LEU D  2 78  ? 63.112  -7.870  -7.818  1.000 36.864  ? 4328 LEU D C     1 
ATOM   6280 O  O     . LEU D  2 78  ? 63.422  -7.435  -8.947  1.000 36.013  ? 4328 LEU D O     1 
ATOM   6281 C  CB    . LEU D  2 78  ? 60.760  -8.507  -7.284  1.000 37.599  ? 4328 LEU D CB    1 
ATOM   6282 C  CG    . LEU D  2 78  ? 60.136  -7.473  -8.223  1.000 39.335  ? 4328 LEU D CG    1 
ATOM   6283 C  CD1   . LEU D  2 78  ? 59.719  -8.124  -9.533  1.000 39.139  ? 4328 LEU D CD1   1 
ATOM   6284 C  CD2   . LEU D  2 78  ? 58.943  -6.782  -7.581  1.000 42.373  ? 4328 LEU D CD2   1 
ATOM   6285 N  N     . TYR D  2 79  ? 63.567  -7.383  -6.660  1.000 32.288  ? 4329 TYR D N     1 
ATOM   6286 C  CA    . TYR D  2 79  ? 64.453  -6.189  -6.588  1.000 34.452  ? 4329 TYR D CA    1 
ATOM   6287 C  C     . TYR D  2 79  ? 65.803  -6.503  -7.233  1.000 33.080  ? 4329 TYR D C     1 
ATOM   6288 O  O     . TYR D  2 79  ? 66.269  -5.678  -8.050  1.000 33.797  ? 4329 TYR D O     1 
ATOM   6289 C  CB    . TYR D  2 79  ? 64.505  -5.698  -5.140  1.000 36.202  ? 4329 TYR D CB    1 
ATOM   6290 C  CG    . TYR D  2 79  ? 63.120  -5.553  -4.569  1.000 38.777  ? 4329 TYR D CG    1 
ATOM   6291 C  CD1   . TYR D  2 79  ? 62.322  -4.471  -4.905  1.000 40.976  ? 4329 TYR D CD1   1 
ATOM   6292 C  CD2   . TYR D  2 79  ? 62.564  -6.551  -3.786  1.000 38.671  ? 4329 TYR D CD2   1 
ATOM   6293 C  CE1   . TYR D  2 79  ? 61.027  -4.356  -4.429  1.000 44.038  ? 4329 TYR D CE1   1 
ATOM   6294 C  CE2   . TYR D  2 79  ? 61.269  -6.454  -3.305  1.000 41.651  ? 4329 TYR D CE2   1 
ATOM   6295 C  CZ    . TYR D  2 79  ? 60.497  -5.354  -3.630  1.000 43.848  ? 4329 TYR D CZ    1 
ATOM   6296 O  OH    . TYR D  2 79  ? 59.221  -5.252  -3.160  1.000 47.622  ? 4329 TYR D OH    1 
ATOM   6297 N  N     . CYS D  2 80  ? 66.394  -7.654  -6.903  1.000 32.151  ? 4330 CYS D N     1 
ATOM   6298 C  CA    . CYS D  2 80  ? 67.678  -8.045  -7.541  1.000 30.849  ? 4330 CYS D CA    1 
ATOM   6299 C  C     . CYS D  2 80  ? 67.485  -8.179  -9.058  1.000 30.113  ? 4330 CYS D C     1 
ATOM   6300 O  O     . CYS D  2 80  ? 68.296  -7.607  -9.805  1.000 31.809  ? 4330 CYS D O     1 
ATOM   6301 C  CB    . CYS D  2 80  ? 68.207  -9.374  -7.008  1.000 31.205  ? 4330 CYS D CB    1 
ATOM   6302 S  SG    . CYS D  2 80  ? 68.936  -9.315  -5.348  1.000 32.967  ? 4330 CYS D SG    1 
ATOM   6303 N  N     . ARG D  2 81  ? 66.424  -8.871  -9.485  1.000 29.447  ? 4331 ARG D N     1 
ATOM   6304 C  CA    . ARG D  2 81  ? 66.204  -9.178  -10.930 1.000 30.124  ? 4331 ARG D CA    1 
ATOM   6305 C  C     . ARG D  2 81  ? 65.847  -7.918  -11.730 1.000 32.773  ? 4331 ARG D C     1 
ATOM   6306 O  O     . ARG D  2 81  ? 66.217  -7.868  -12.913 1.000 33.323  ? 4331 ARG D O     1 
ATOM   6307 C  CB    . ARG D  2 81  ? 65.122  -10.250 -11.100 1.000 29.582  ? 4331 ARG D CB    1 
ATOM   6308 C  CG    . ARG D  2 81  ? 65.503  -11.634 -10.588 1.000 28.234  ? 4331 ARG D CG    1 
ATOM   6309 C  CD    . ARG D  2 81  ? 66.676  -12.257 -11.326 1.000 26.840  ? 4331 ARG D CD    1 
ATOM   6310 N  NE    . ARG D  2 81  ? 66.413  -12.378 -12.754 1.000 28.021  ? 4331 ARG D NE    1 
ATOM   6311 C  CZ    . ARG D  2 81  ? 65.792  -13.403 -13.334 1.000 27.638  ? 4331 ARG D CZ    1 
ATOM   6312 N  NH1   . ARG D  2 81  ? 65.349  -14.417 -12.609 1.000 26.613  ? 4331 ARG D NH1   1 
ATOM   6313 N  NH2   . ARG D  2 81  ? 65.595  -13.396 -14.640 1.000 28.790  ? 4331 ARG D NH2   1 
ATOM   6314 N  N     . CYS D  2 82  ? 65.154  -6.957  -11.119 1.000 34.568  ? 4332 CYS D N     1 
ATOM   6315 C  CA    . CYS D  2 82  ? 64.762  -5.709  -11.832 1.000 37.649  ? 4332 CYS D CA    1 
ATOM   6316 C  C     . CYS D  2 82  ? 65.846  -4.634  -11.676 1.000 38.632  ? 4332 CYS D C     1 
ATOM   6317 O  O     . CYS D  2 82  ? 65.705  -3.563  -12.299 1.000 39.214  ? 4332 CYS D O     1 
ATOM   6318 C  CB    . CYS D  2 82  ? 63.415  -5.202  -11.329 1.000 39.010  ? 4332 CYS D CB    1 
ATOM   6319 S  SG    . CYS D  2 82  ? 62.048  -6.328  -11.714 1.000 42.154  ? 4332 CYS D SG    1 
ATOM   6320 N  N     . HIS D  2 83  ? 66.893  -4.915  -10.893 1.000 38.544  ? 4333 HIS D N     1 
ATOM   6321 C  CA    . HIS D  2 83  ? 67.992  -3.935  -10.673 1.000 42.025  ? 4333 HIS D CA    1 
ATOM   6322 C  C     . HIS D  2 83  ? 67.417  -2.662  -10.038 1.000 43.016  ? 4333 HIS D C     1 
ATOM   6323 O  O     . HIS D  2 83  ? 67.736  -1.554  -10.504 1.000 45.424  ? 4333 HIS D O     1 
ATOM   6324 C  CB    . HIS D  2 83  ? 68.772  -3.703  -11.978 1.000 46.515  ? 4333 HIS D CB    1 
ATOM   6325 C  CG    . HIS D  2 83  ? 69.473  -4.931  -12.454 1.000 49.370  ? 4333 HIS D CG    1 
ATOM   6326 N  ND1   . HIS D  2 83  ? 70.792  -5.201  -12.130 1.000 52.578  ? 4333 HIS D ND1   1 
ATOM   6327 C  CD2   . HIS D  2 83  ? 69.037  -5.988  -13.175 1.000 52.417  ? 4333 HIS D CD2   1 
ATOM   6328 C  CE1   . HIS D  2 83  ? 71.146  -6.358  -12.658 1.000 52.919  ? 4333 HIS D CE1   1 
ATOM   6329 N  NE2   . HIS D  2 83  ? 70.084  -6.864  -13.302 1.000 50.682  ? 4333 HIS D NE2   1 
ATOM   6330 N  N     A ILE D  2 84  ? 66.580  -2.834  -9.012  0.700 41.840  ? 4334 ILE D N     1 
ATOM   6331 N  N     B ILE D  2 84  ? 66.590  -2.850  -9.003  0.300 42.353  ? 4334 ILE D N     1 
ATOM   6332 C  CA    A ILE D  2 84  ? 65.977  -1.692  -8.261  0.700 43.737  ? 4334 ILE D CA    1 
ATOM   6333 C  CA    B ILE D  2 84  ? 65.917  -1.754  -8.241  0.300 44.052  ? 4334 ILE D CA    1 
ATOM   6334 C  C     A ILE D  2 84  ? 66.331  -1.853  -6.779  0.700 44.196  ? 4334 ILE D C     1 
ATOM   6335 C  C     B ILE D  2 84  ? 66.329  -1.865  -6.769  0.300 43.878  ? 4334 ILE D C     1 
ATOM   6336 O  O     A ILE D  2 84  ? 66.675  -2.982  -6.365  0.700 41.617  ? 4334 ILE D O     1 
ATOM   6337 O  O     B ILE D  2 84  ? 66.731  -2.972  -6.355  0.300 41.752  ? 4334 ILE D O     1 
ATOM   6338 C  CB    A ILE D  2 84  ? 64.456  -1.598  -8.497  0.700 44.120  ? 4334 ILE D CB    1 
ATOM   6339 C  CB    B ILE D  2 84  ? 64.387  -1.847  -8.417  0.300 44.663  ? 4334 ILE D CB    1 
ATOM   6340 C  CG1   A ILE D  2 84  ? 63.739  -2.889  -8.100  0.700 42.617  ? 4334 ILE D CG1   1 
ATOM   6341 C  CG1   B ILE D  2 84  ? 63.987  -1.737  -9.890  0.300 45.741  ? 4334 ILE D CG1   1 
ATOM   6342 C  CG2   A ILE D  2 84  ? 64.163  -1.210  -9.941  0.700 45.553  ? 4334 ILE D CG2   1 
ATOM   6343 C  CG2   B ILE D  2 84  ? 63.660  -0.817  -7.566  0.300 46.901  ? 4334 ILE D CG2   1 
ATOM   6344 C  CD1   A ILE D  2 84  ? 62.247  -2.852  -8.304  0.700 43.994  ? 4334 ILE D CD1   1 
ATOM   6345 C  CD1   B ILE D  2 84  ? 62.499  -1.739  -10.121 0.300 47.019  ? 4334 ILE D CD1   1 
ATOM   6346 N  N     . ASP D  2 85  ? 66.239  -0.762  -6.016  1.000 44.654  ? 4335 ASP D N     1 
ATOM   6347 C  CA    . ASP D  2 85  ? 66.594  -0.783  -4.572  1.000 45.989  ? 4335 ASP D CA    1 
ATOM   6348 C  C     . ASP D  2 85  ? 65.633  -1.701  -3.810  1.000 44.888  ? 4335 ASP D C     1 
ATOM   6349 O  O     . ASP D  2 85  ? 64.478  -1.860  -4.250  1.000 44.289  ? 4335 ASP D O     1 
ATOM   6350 C  CB    . ASP D  2 85  ? 66.555  0.620   -3.960  1.000 49.676  ? 4335 ASP D CB    1 
ATOM   6351 C  CG    . ASP D  2 85  ? 67.575  1.586   -4.545  1.000 51.885  ? 4335 ASP D CG    1 
ATOM   6352 O  OD1   . ASP D  2 85  ? 68.513  1.117   -5.231  1.000 51.295  ? 4335 ASP D OD1   1 
ATOM   6353 O  OD2   . ASP D  2 85  ? 67.409  2.802   -4.330  1.000 56.265  ? 4335 ASP D OD2   1 
ATOM   6354 N  N     . HIS D  2 86  ? 66.112  -2.284  -2.712  1.000 44.237  ? 4336 HIS D N     1 
ATOM   6355 C  CA    . HIS D  2 86  ? 65.270  -3.140  -1.833  1.000 45.619  ? 4336 HIS D CA    1 
ATOM   6356 C  C     . HIS D  2 86  ? 64.447  -2.219  -0.936  1.000 50.108  ? 4336 HIS D C     1 
ATOM   6357 O  O     . HIS D  2 86  ? 64.976  -1.243  -0.415  1.000 51.562  ? 4336 HIS D O     1 
ATOM   6358 C  CB    . HIS D  2 86  ? 66.156  -4.133  -1.080  1.000 44.190  ? 4336 HIS D CB    1 
ATOM   6359 C  CG    . HIS D  2 86  ? 66.752  -5.146  -1.993  1.000 41.989  ? 4336 HIS D CG    1 
ATOM   6360 N  ND1   . HIS D  2 86  ? 67.830  -4.863  -2.817  1.000 40.452  ? 4336 HIS D ND1   1 
ATOM   6361 C  CD2   . HIS D  2 86  ? 66.395  -6.421  -2.256  1.000 39.041  ? 4336 HIS D CD2   1 
ATOM   6362 C  CE1   . HIS D  2 86  ? 68.120  -5.938  -3.524  1.000 39.132  ? 4336 HIS D CE1   1 
ATOM   6363 N  NE2   . HIS D  2 86  ? 67.248  -6.892  -3.198  1.000 37.190  ? 4336 HIS D NE2   1 
ATOM   6364 N  N     . PRO D  2 87  ? 63.147  -2.510  -0.706  1.000 53.575  ? 4337 PRO D N     1 
ATOM   6365 C  CA    . PRO D  2 87  ? 62.279  -1.621  0.071   1.000 58.216  ? 4337 PRO D CA    1 
ATOM   6366 C  C     . PRO D  2 87  ? 62.503  -1.620  1.593   1.000 62.094  ? 4337 PRO D C     1 
ATOM   6367 O  O     . PRO D  2 87  ? 61.595  -1.978  2.322   1.000 64.499  ? 4337 PRO D O     1 
ATOM   6368 C  CB    . PRO D  2 87  ? 60.879  -2.150  -0.284  1.000 58.581  ? 4337 PRO D CB    1 
ATOM   6369 C  CG    . PRO D  2 87  ? 61.097  -3.633  -0.488  1.000 55.455  ? 4337 PRO D CG    1 
ATOM   6370 C  CD    . PRO D  2 87  ? 62.451  -3.725  -1.159  1.000 52.647  ? 4337 PRO D CD    1 
ATOM   6371 N  N     . ASN D  2 88  ? 63.692  -1.194  2.028   1.000 64.236  ? 4338 ASN D N     1 
ATOM   6372 C  CA    . ASN D  2 88  ? 64.023  -1.075  3.476   1.000 67.487  ? 4338 ASN D CA    1 
ATOM   6373 C  C     . ASN D  2 88  ? 65.170  -0.071  3.606   1.000 70.418  ? 4338 ASN D C     1 
ATOM   6374 O  O     . ASN D  2 88  ? 65.963  0.079   2.678   1.000 68.961  ? 4338 ASN D O     1 
ATOM   6375 C  CB    . ASN D  2 88  ? 64.281  -2.443  4.118   1.000 65.976  ? 4338 ASN D CB    1 
ATOM   6376 C  CG    . ASN D  2 88  ? 65.464  -3.182  3.531   1.000 63.493  ? 4338 ASN D CG    1 
ATOM   6377 O  OD1   . ASN D  2 88  ? 66.572  -2.656  3.488   1.000 65.178  ? 4338 ASN D OD1   1 
ATOM   6378 N  ND2   . ASN D  2 88  ? 65.254  -4.428  3.138   1.000 59.001  ? 4338 ASN D ND2   1 
ATOM   6379 N  N     . PRO D  2 89  ? 65.272  0.676   4.732   1.000 75.280  ? 4339 PRO D N     1 
ATOM   6380 C  CA    . PRO D  2 89  ? 66.323  1.683   4.903   1.000 77.699  ? 4339 PRO D CA    1 
ATOM   6381 C  C     . PRO D  2 89  ? 67.740  1.220   4.519   1.000 75.575  ? 4339 PRO D C     1 
ATOM   6382 O  O     . PRO D  2 89  ? 68.379  1.913   3.745   1.000 75.207  ? 4339 PRO D O     1 
ATOM   6383 C  CB    . PRO D  2 89  ? 66.244  2.016   6.403   1.000 82.676  ? 4339 PRO D CB    1 
ATOM   6384 C  CG    . PRO D  2 89  ? 64.787  1.781   6.753   1.000 82.976  ? 4339 PRO D CG    1 
ATOM   6385 C  CD    . PRO D  2 89  ? 64.367  0.606   5.892   1.000 78.529  ? 4339 PRO D CD    1 
ATOM   6386 N  N     . LYS D  2 90  ? 68.189  0.077   5.052   1.000 74.053  ? 4340 LYS D N     1 
ATOM   6387 C  CA    . LYS D  2 90  ? 69.552  -0.452  4.755   1.000 72.437  ? 4340 LYS D CA    1 
ATOM   6388 C  C     . LYS D  2 90  ? 69.637  -0.996  3.322   1.000 66.497  ? 4340 LYS D C     1 
ATOM   6389 O  O     . LYS D  2 90  ? 70.769  -1.237  2.864   1.000 65.493  ? 4340 LYS D O     1 
ATOM   6390 C  CB    . LYS D  2 90  ? 69.936  -1.565  5.736   1.000 74.068  ? 4340 LYS D CB    1 
ATOM   6391 C  CG    . LYS D  2 90  ? 70.228  -1.115  7.161   1.000 78.898  ? 4340 LYS D CG    1 
ATOM   6392 C  CD    . LYS D  2 90  ? 70.704  -2.250  8.048   1.000 80.677  ? 4340 LYS D CD    1 
ATOM   6393 C  CE    . LYS D  2 90  ? 71.178  -1.794  9.413   1.000 85.755  ? 4340 LYS D CE    1 
ATOM   6394 N  NZ    . LYS D  2 90  ? 70.100  -1.121  10.176  1.000 89.594  ? 4340 LYS D NZ    1 
ATOM   6395 N  N     . GLY D  2 91  ? 68.500  -1.179  2.641   1.000 63.538  ? 4341 GLY D N     1 
ATOM   6396 C  CA    . GLY D  2 91  ? 68.511  -1.736  1.272   1.000 60.205  ? 4341 GLY D CA    1 
ATOM   6397 C  C     . GLY D  2 91  ? 69.060  -3.157  1.267   1.000 56.768  ? 4341 GLY D C     1 
ATOM   6398 O  O     . GLY D  2 91  ? 69.673  -3.553  0.261   1.000 55.526  ? 4341 GLY D O     1 
ATOM   6399 N  N     . PHE D  2 92  ? 68.842  -3.889  2.364   1.000 55.984  ? 4342 PHE D N     1 
ATOM   6400 C  CA    . PHE D  2 92  ? 69.331  -5.283  2.544   1.000 53.593  ? 4342 PHE D CA    1 
ATOM   6401 C  C     . PHE D  2 92  ? 68.414  -6.275  1.813   1.000 47.509  ? 4342 PHE D C     1 
ATOM   6402 O  O     . PHE D  2 92  ? 67.191  -6.047  1.723   1.000 48.076  ? 4342 PHE D O     1 
ATOM   6403 C  CB    . PHE D  2 92  ? 69.423  -5.597  4.041   1.000 58.453  ? 4342 PHE D CB    1 
ATOM   6404 C  CG    . PHE D  2 92  ? 69.713  -7.037  4.385   1.000 60.314  ? 4342 PHE D CG    1 
ATOM   6405 C  CD1   . PHE D  2 92  ? 71.015  -7.515  4.411   1.000 61.469  ? 4342 PHE D CD1   1 
ATOM   6406 C  CD2   . PHE D  2 92  ? 68.682  -7.910  4.704   1.000 61.347  ? 4342 PHE D CD2   1 
ATOM   6407 C  CE1   . PHE D  2 92  ? 71.278  -8.839  4.731   1.000 61.151  ? 4342 PHE D CE1   1 
ATOM   6408 C  CE2   . PHE D  2 92  ? 68.947  -9.233  5.029   1.000 61.090  ? 4342 PHE D CE2   1 
ATOM   6409 C  CZ    . PHE D  2 92  ? 70.244  -9.694  5.043   1.000 60.933  ? 4342 PHE D CZ    1 
ATOM   6410 N  N     . CYS D  2 93  ? 69.000  -7.359  1.306   1.000 43.391  ? 4343 CYS D N     1 
ATOM   6411 C  CA    . CYS D  2 93  ? 68.211  -8.404  0.600   1.000 39.874  ? 4343 CYS D CA    1 
ATOM   6412 C  C     . CYS D  2 93  ? 68.177  -9.670  1.462   1.000 39.685  ? 4343 CYS D C     1 
ATOM   6413 O  O     . CYS D  2 93  ? 69.255  -10.127 1.871   1.000 39.306  ? 4343 CYS D O     1 
ATOM   6414 C  CB    . CYS D  2 93  ? 68.800  -8.719  -0.766  1.000 38.207  ? 4343 CYS D CB    1 
ATOM   6415 S  SG    . CYS D  2 93  ? 67.796  -9.904  -1.700  1.000 34.158  ? 4343 CYS D SG    1 
ATOM   6416 N  N     . ASP D  2 94  ? 66.980  -10.198 1.726   1.000 39.827  ? 4344 ASP D N     1 
ATOM   6417 C  CA    . ASP D  2 94  ? 66.824  -11.426 2.551   1.000 41.612  ? 4344 ASP D CA    1 
ATOM   6418 C  C     . ASP D  2 94  ? 67.068  -12.690 1.707   1.000 36.848  ? 4344 ASP D C     1 
ATOM   6419 O  O     . ASP D  2 94  ? 67.210  -13.755 2.309   1.000 35.295  ? 4344 ASP D O     1 
ATOM   6420 C  CB    . ASP D  2 94  ? 65.432  -11.484 3.188   1.000 48.451  ? 4344 ASP D CB    1 
ATOM   6421 C  CG    . ASP D  2 94  ? 64.279  -11.384 2.196   1.000 53.129  ? 4344 ASP D CG    1 
ATOM   6422 O  OD1   . ASP D  2 94  ? 64.539  -11.043 1.022   1.000 57.065  ? 4344 ASP D OD1   1 
ATOM   6423 O  OD2   . ASP D  2 94  ? 63.123  -11.642 2.605   1.000 62.756  ? 4344 ASP D OD2   1 
ATOM   6424 N  N     . LEU D  2 95  ? 67.174  -12.573 0.381   1.000 33.612  ? 4345 LEU D N     1 
ATOM   6425 C  CA    . LEU D  2 95  ? 67.308  -13.787 -0.480  1.000 32.155  ? 4345 LEU D CA    1 
ATOM   6426 C  C     . LEU D  2 95  ? 68.732  -13.973 -1.019  1.000 30.682  ? 4345 LEU D C     1 
ATOM   6427 O  O     . LEU D  2 95  ? 69.203  -15.123 -1.071  1.000 29.705  ? 4345 LEU D O     1 
ATOM   6428 C  CB    . LEU D  2 95  ? 66.318  -13.655 -1.640  1.000 31.936  ? 4345 LEU D CB    1 
ATOM   6429 C  CG    . LEU D  2 95  ? 64.841  -13.745 -1.264  1.000 34.937  ? 4345 LEU D CG    1 
ATOM   6430 C  CD1   . LEU D  2 95  ? 63.959  -13.263 -2.406  1.000 35.705  ? 4345 LEU D CD1   1 
ATOM   6431 C  CD2   . LEU D  2 95  ? 64.469  -15.162 -0.864  1.000 35.835  ? 4345 LEU D CD2   1 
ATOM   6432 N  N     . LYS D  2 96  ? 69.363  -12.880 -1.437  1.000 30.540  ? 4346 LYS D N     1 
ATOM   6433 C  CA    . LYS D  2 96  ? 70.708  -12.885 -2.068  1.000 30.250  ? 4346 LYS D CA    1 
ATOM   6434 C  C     . LYS D  2 96  ? 71.722  -13.649 -1.208  1.000 27.966  ? 4346 LYS D C     1 
ATOM   6435 O  O     . LYS D  2 96  ? 71.865  -13.315 -0.023  1.000 28.101  ? 4346 LYS D O     1 
ATOM   6436 C  CB    . LYS D  2 96  ? 71.136  -11.429 -2.259  1.000 34.769  ? 4346 LYS D CB    1 
ATOM   6437 C  CG    . LYS D  2 96  ? 72.380  -11.202 -3.088  1.000 38.277  ? 4346 LYS D CG    1 
ATOM   6438 C  CD    . LYS D  2 96  ? 72.647  -9.728  -3.311  1.000 42.065  ? 4346 LYS D CD    1 
ATOM   6439 C  CE    . LYS D  2 96  ? 73.600  -9.481  -4.457  1.000 43.845  ? 4346 LYS D CE    1 
ATOM   6440 N  NZ    . LYS D  2 96  ? 74.891  -10.167 -4.243  1.000 47.605  ? 4346 LYS D NZ    1 
ATOM   6441 N  N     . GLY D  2 97  ? 72.409  -14.630 -1.798  1.000 25.311  ? 4347 GLY D N     1 
ATOM   6442 C  CA    . GLY D  2 97  ? 73.445  -15.398 -1.080  1.000 25.615  ? 4347 GLY D CA    1 
ATOM   6443 C  C     . GLY D  2 97  ? 72.858  -16.543 -0.282  1.000 24.795  ? 4347 GLY D C     1 
ATOM   6444 O  O     . GLY D  2 97  ? 73.628  -17.245 0.401   1.000 25.688  ? 4347 GLY D O     1 
ATOM   6445 N  N     . LYS D  2 98  ? 71.545  -16.725 -0.373  1.000 24.520  ? 4348 LYS D N     1 
ATOM   6446 C  CA    . LYS D  2 98  ? 70.850  -17.812 0.356   1.000 26.643  ? 4348 LYS D CA    1 
ATOM   6447 C  C     . LYS D  2 98  ? 70.107  -18.670 -0.659  1.000 23.948  ? 4348 LYS D C     1 
ATOM   6448 O  O     . LYS D  2 98  ? 70.206  -18.384 -1.865  1.000 24.381  ? 4348 LYS D O     1 
ATOM   6449 C  CB    . LYS D  2 98  ? 69.817  -17.255 1.340   1.000 29.636  ? 4348 LYS D CB    1 
ATOM   6450 C  CG    . LYS D  2 98  ? 70.317  -16.212 2.324   1.000 35.383  ? 4348 LYS D CG    1 
ATOM   6451 C  CD    . LYS D  2 98  ? 71.167  -16.756 3.433   1.000 39.734  ? 4348 LYS D CD    1 
ATOM   6452 C  CE    . LYS D  2 98  ? 71.378  -15.726 4.527   1.000 45.032  ? 4348 LYS D CE    1 
ATOM   6453 N  NZ    . LYS D  2 98  ? 72.218  -16.262 5.624   1.000 49.304  ? 4348 LYS D NZ    1 
ATOM   6454 N  N     . TYR D  2 99  ? 69.366  -19.650 -0.161  1.000 23.732  ? 4349 TYR D N     1 
ATOM   6455 C  CA    . TYR D  2 99  ? 68.550  -20.551 -1.005  1.000 23.990  ? 4349 TYR D CA    1 
ATOM   6456 C  C     . TYR D  2 99  ? 67.107  -20.413 -0.535  1.000 26.092  ? 4349 TYR D C     1 
ATOM   6457 O  O     . TYR D  2 99  ? 66.868  -20.395 0.696   1.000 27.954  ? 4349 TYR D O     1 
ATOM   6458 C  CB    . TYR D  2 99  ? 69.110  -21.977 -0.958  1.000 22.924  ? 4349 TYR D CB    1 
ATOM   6459 C  CG    . TYR D  2 99  ? 70.490  -21.997 -1.537  1.000 22.690  ? 4349 TYR D CG    1 
ATOM   6460 C  CD1   . TYR D  2 99  ? 71.593  -21.737 -0.744  1.000 22.885  ? 4349 TYR D CD1   1 
ATOM   6461 C  CD2   . TYR D  2 99  ? 70.675  -22.106 -2.907  1.000 21.857  ? 4349 TYR D CD2   1 
ATOM   6462 C  CE1   . TYR D  2 99  ? 72.860  -21.642 -1.292  1.000 23.239  ? 4349 TYR D CE1   1 
ATOM   6463 C  CE2   . TYR D  2 99  ? 71.932  -22.012 -3.468  1.000 21.592  ? 4349 TYR D CE2   1 
ATOM   6464 C  CZ    . TYR D  2 99  ? 73.023  -21.767 -2.660  1.000 22.095  ? 4349 TYR D CZ    1 
ATOM   6465 O  OH    . TYR D  2 99  ? 74.253  -21.645 -3.212  1.000 21.895  ? 4349 TYR D OH    1 
ATOM   6466 N  N     . VAL D  2 100 ? 66.194  -20.237 -1.489  1.000 25.850  ? 4350 VAL D N     1 
ATOM   6467 C  CA    . VAL D  2 100 ? 64.760  -20.131 -1.128  1.000 26.736  ? 4350 VAL D CA    1 
ATOM   6468 C  C     . VAL D  2 100 ? 64.061  -21.430 -1.536  1.000 26.240  ? 4350 VAL D C     1 
ATOM   6469 O  O     . VAL D  2 100 ? 64.310  -21.926 -2.664  1.000 26.313  ? 4350 VAL D O     1 
ATOM   6470 C  CB    . VAL D  2 100 ? 64.089  -18.889 -1.744  1.000 27.820  ? 4350 VAL D CB    1 
ATOM   6471 C  CG1   . VAL D  2 100 ? 64.082  -18.919 -3.259  1.000 28.902  ? 4350 VAL D CG1   1 
ATOM   6472 C  CG2   . VAL D  2 100 ? 62.682  -18.720 -1.208  1.000 29.406  ? 4350 VAL D CG2   1 
ATOM   6473 N  N     . GLN D  2 101 ? 63.287  -21.985 -0.601  1.000 25.973  ? 4351 GLN D N     1 
ATOM   6474 C  CA    . GLN D  2 101 ? 62.475  -23.202 -0.826  1.000 26.690  ? 4351 GLN D CA    1 
ATOM   6475 C  C     . GLN D  2 101 ? 61.096  -22.738 -1.306  1.000 28.584  ? 4351 GLN D C     1 
ATOM   6476 O  O     . GLN D  2 101 ? 60.453  -21.933 -0.601  1.000 30.734  ? 4351 GLN D O     1 
ATOM   6477 C  CB    . GLN D  2 101 ? 62.443  -24.063 0.436   1.000 27.085  ? 4351 GLN D CB    1 
ATOM   6478 C  CG    . GLN D  2 101 ? 63.700  -24.908 0.632   1.000 26.786  ? 4351 GLN D CG    1 
ATOM   6479 C  CD    . GLN D  2 101 ? 64.985  -24.126 0.769   1.000 26.945  ? 4351 GLN D CD    1 
ATOM   6480 O  OE1   . GLN D  2 101 ? 65.955  -24.380 0.055   1.000 26.405  ? 4351 GLN D OE1   1 
ATOM   6481 N  NE2   . GLN D  2 101 ? 65.003  -23.158 1.675   1.000 25.635  ? 4351 GLN D NE2   1 
ATOM   6482 N  N     . ILE D  2 102 ? 60.691  -23.204 -2.485  1.000 29.873  ? 4352 ILE D N     1 
ATOM   6483 C  CA    . ILE D  2 102 ? 59.405  -22.814 -3.128  1.000 30.873  ? 4352 ILE D CA    1 
ATOM   6484 C  C     . ILE D  2 102 ? 58.539  -24.061 -3.269  1.000 31.804  ? 4352 ILE D C     1 
ATOM   6485 O  O     . ILE D  2 102 ? 59.017  -25.082 -3.757  1.000 31.049  ? 4352 ILE D O     1 
ATOM   6486 C  CB    . ILE D  2 102 ? 59.681  -22.177 -4.506  1.000 31.107  ? 4352 ILE D CB    1 
ATOM   6487 C  CG1   . ILE D  2 102 ? 60.641  -20.986 -4.422  1.000 30.737  ? 4352 ILE D CG1   1 
ATOM   6488 C  CG2   . ILE D  2 102 ? 58.378  -21.803 -5.198  1.000 33.113  ? 4352 ILE D CG2   1 
ATOM   6489 C  CD1   . ILE D  2 102 ? 60.065  -19.768 -3.736  1.000 32.842  ? 4352 ILE D CD1   1 
ATOM   6490 N  N     . PRO D  2 103 ? 57.262  -24.049 -2.815  1.000 34.301  ? 4353 PRO D N     1 
ATOM   6491 C  CA    . PRO D  2 103 ? 56.380  -25.200 -3.010  1.000 36.121  ? 4353 PRO D CA    1 
ATOM   6492 C  C     . PRO D  2 103 ? 56.409  -25.583 -4.500  1.000 37.785  ? 4353 PRO D C     1 
ATOM   6493 O  O     . PRO D  2 103 ? 56.352  -24.695 -5.341  1.000 36.944  ? 4353 PRO D O     1 
ATOM   6494 C  CB    . PRO D  2 103 ? 55.009  -24.692 -2.539  1.000 38.306  ? 4353 PRO D CB    1 
ATOM   6495 C  CG    . PRO D  2 103 ? 55.346  -23.603 -1.533  1.000 37.736  ? 4353 PRO D CG    1 
ATOM   6496 C  CD    . PRO D  2 103 ? 56.623  -22.970 -2.050  1.000 36.000  ? 4353 PRO D CD    1 
ATOM   6497 N  N     A THR D  2 104 ? 56.486  -26.885 -4.788  0.600 38.268  ? 4354 THR D N     1 
ATOM   6498 N  N     B THR D  2 104 ? 56.502  -26.885 -4.796  0.400 37.963  ? 4354 THR D N     1 
ATOM   6499 C  CA    A THR D  2 104 ? 56.573  -27.385 -6.188  0.600 40.931  ? 4354 THR D CA    1 
ATOM   6500 C  CA    B THR D  2 104 ? 56.577  -27.376 -6.201  0.400 39.798  ? 4354 THR D CA    1 
ATOM   6501 C  C     A THR D  2 104 ? 55.437  -26.800 -7.041  0.600 42.878  ? 4354 THR D C     1 
ATOM   6502 C  C     B THR D  2 104 ? 55.435  -26.793 -7.046  0.400 42.224  ? 4354 THR D C     1 
ATOM   6503 O  O     A THR D  2 104 ? 55.706  -26.455 -8.207  0.600 42.226  ? 4354 THR D O     1 
ATOM   6504 O  O     B THR D  2 104 ? 55.697  -26.448 -8.215  0.400 41.866  ? 4354 THR D O     1 
ATOM   6505 C  CB    A THR D  2 104 ? 56.591  -28.918 -6.215  0.600 42.785  ? 4354 THR D CB    1 
ATOM   6506 C  CB    B THR D  2 104 ? 56.586  -28.909 -6.255  0.400 40.773  ? 4354 THR D CB    1 
ATOM   6507 O  OG1   A THR D  2 104 ? 57.686  -29.346 -5.403  0.600 43.136  ? 4354 THR D OG1   1 
ATOM   6508 O  OG1   B THR D  2 104 ? 55.475  -29.382 -5.493  0.400 41.212  ? 4354 THR D OG1   1 
ATOM   6509 C  CG2   A THR D  2 104 ? 56.737  -29.485 -7.609  0.600 43.391  ? 4354 THR D CG2   1 
ATOM   6510 C  CG2   B THR D  2 104 ? 57.864  -29.510 -5.713  0.400 39.721  ? 4354 THR D CG2   1 
ATOM   6511 N  N     . THR D  2 105 ? 54.229  -26.681 -6.481  1.000 44.759  ? 4355 THR D N     1 
ATOM   6512 C  CA    . THR D  2 105 ? 53.060  -26.136 -7.232  1.000 47.649  ? 4355 THR D CA    1 
ATOM   6513 C  C     . THR D  2 105 ? 53.279  -24.663 -7.614  1.000 46.595  ? 4355 THR D C     1 
ATOM   6514 O  O     . THR D  2 105 ? 52.607  -24.212 -8.552  1.000 49.937  ? 4355 THR D O     1 
ATOM   6515 C  CB    . THR D  2 105 ? 51.766  -26.300 -6.426  1.000 50.401  ? 4355 THR D CB    1 
ATOM   6516 O  OG1   . THR D  2 105 ? 51.940  -25.631 -5.176  1.000 50.296  ? 4355 THR D OG1   1 
ATOM   6517 C  CG2   . THR D  2 105 ? 51.407  -27.749 -6.181  1.000 52.680  ? 4355 THR D CG2   1 
ATOM   6518 N  N     . CYS D  2 106 ? 54.193  -23.957 -6.938  1.000 43.863  ? 4356 CYS D N     1 
ATOM   6519 C  CA    . CYS D  2 106 ? 54.445  -22.514 -7.221  1.000 43.719  ? 4356 CYS D CA    1 
ATOM   6520 C  C     . CYS D  2 106 ? 55.828  -22.299 -7.852  1.000 41.368  ? 4356 CYS D C     1 
ATOM   6521 O  O     . CYS D  2 106 ? 56.169  -21.125 -8.122  1.000 41.776  ? 4356 CYS D O     1 
ATOM   6522 C  CB    . CYS D  2 106 ? 54.352  -21.698 -5.937  1.000 43.950  ? 4356 CYS D CB    1 
ATOM   6523 S  SG    . CYS D  2 106 ? 52.745  -21.837 -5.110  1.000 47.706  ? 4356 CYS D SG    1 
ATOM   6524 N  N     . ALA D  2 107 ? 56.561  -23.386 -8.124  1.000 39.742  ? 4357 ALA D N     1 
ATOM   6525 C  CA    . ALA D  2 107 ? 57.938  -23.322 -8.673  1.000 38.493  ? 4357 ALA D CA    1 
ATOM   6526 C  C     . ALA D  2 107 ? 57.963  -22.673 -10.062 1.000 38.683  ? 4357 ALA D C     1 
ATOM   6527 O  O     . ALA D  2 107 ? 59.071  -22.352 -10.524 1.000 38.382  ? 4357 ALA D O     1 
ATOM   6528 C  CB    . ALA D  2 107 ? 58.546  -24.704 -8.705  1.000 39.059  ? 4357 ALA D CB    1 
ATOM   6529 N  N     . ASN D  2 108 ? 56.803  -22.492 -10.701 1.000 39.280  ? 4358 ASN D N     1 
ATOM   6530 C  CA    . ASN D  2 108 ? 56.765  -21.836 -12.037 1.000 40.179  ? 4358 ASN D CA    1 
ATOM   6531 C  C     . ASN D  2 108 ? 56.955  -20.319 -11.881 1.000 38.924  ? 4358 ASN D C     1 
ATOM   6532 O  O     . ASN D  2 108 ? 57.259  -19.666 -12.893 1.000 39.066  ? 4358 ASN D O     1 
ATOM   6533 C  CB    . ASN D  2 108 ? 55.460  -22.103 -12.791 1.000 43.335  ? 4358 ASN D CB    1 
ATOM   6534 C  CG    . ASN D  2 108 ? 54.240  -21.605 -12.044 1.000 46.903  ? 4358 ASN D CG    1 
ATOM   6535 O  OD1   . ASN D  2 108 ? 54.036  -21.943 -10.877 1.000 45.974  ? 4358 ASN D OD1   1 
ATOM   6536 N  ND2   . ASN D  2 108 ? 53.406  -20.827 -12.718 1.000 48.752  ? 4358 ASN D ND2   1 
ATOM   6537 N  N     . ASP D  2 109 ? 56.761  -19.778 -10.671 1.000 37.903  ? 4359 ASP D N     1 
ATOM   6538 C  CA    . ASP D  2 109 ? 56.906  -18.312 -10.452 1.000 37.364  ? 4359 ASP D CA    1 
ATOM   6539 C  C     . ASP D  2 109 ? 57.491  -18.065 -9.064  1.000 35.515  ? 4359 ASP D C     1 
ATOM   6540 O  O     . ASP D  2 109 ? 56.784  -17.622 -8.163  1.000 36.322  ? 4359 ASP D O     1 
ATOM   6541 C  CB    . ASP D  2 109 ? 55.556  -17.605 -10.633 1.000 39.864  ? 4359 ASP D CB    1 
ATOM   6542 C  CG    . ASP D  2 109 ? 55.608  -16.087 -10.529 1.000 41.053  ? 4359 ASP D CG    1 
ATOM   6543 O  OD1   . ASP D  2 109 ? 56.728  -15.527 -10.553 1.000 38.722  ? 4359 ASP D OD1   1 
ATOM   6544 O  OD2   . ASP D  2 109 ? 54.523  -15.473 -10.439 1.000 42.843  ? 4359 ASP D OD2   1 
ATOM   6545 N  N     . PRO D  2 110 ? 58.791  -18.362 -8.837  1.000 32.700  ? 4360 PRO D N     1 
ATOM   6546 C  CA    . PRO D  2 110 ? 59.413  -18.127 -7.536  1.000 31.053  ? 4360 PRO D CA    1 
ATOM   6547 C  C     . PRO D  2 110 ? 59.421  -16.648 -7.128  1.000 31.785  ? 4360 PRO D C     1 
ATOM   6548 O  O     . PRO D  2 110 ? 59.285  -16.377 -5.947  1.000 32.024  ? 4360 PRO D O     1 
ATOM   6549 C  CB    . PRO D  2 110 ? 60.857  -18.620 -7.730  1.000 30.049  ? 4360 PRO D CB    1 
ATOM   6550 C  CG    . PRO D  2 110 ? 60.761  -19.596 -8.876  1.000 30.411  ? 4360 PRO D CG    1 
ATOM   6551 C  CD    . PRO D  2 110 ? 59.712  -19.000 -9.791  1.000 31.873  ? 4360 PRO D CD    1 
ATOM   6552 N  N     . VAL D  2 111 ? 59.639  -15.741 -8.087  1.000 31.345  ? 4361 VAL D N     1 
ATOM   6553 C  CA    . VAL D  2 111 ? 59.650  -14.286 -7.753  1.000 33.005  ? 4361 VAL D CA    1 
ATOM   6554 C  C     . VAL D  2 111 ? 58.272  -13.918 -7.195  1.000 34.071  ? 4361 VAL D C     1 
ATOM   6555 O  O     . VAL D  2 111 ? 58.209  -13.274 -6.129  1.000 34.566  ? 4361 VAL D O     1 
ATOM   6556 C  CB    . VAL D  2 111 ? 60.028  -13.416 -8.966  1.000 34.386  ? 4361 VAL D CB    1 
ATOM   6557 C  CG1   . VAL D  2 111 ? 59.942  -11.929 -8.637  1.000 35.907  ? 4361 VAL D CG1   1 
ATOM   6558 C  CG2   . VAL D  2 111 ? 61.412  -13.763 -9.493  1.000 33.021  ? 4361 VAL D CG2   1 
ATOM   6559 N  N     . GLY D  2 112 ? 57.207  -14.338 -7.875  1.000 35.364  ? 4362 GLY D N     1 
ATOM   6560 C  CA    . GLY D  2 112 ? 55.849  -14.034 -7.387  1.000 37.811  ? 4362 GLY D CA    1 
ATOM   6561 C  C     . GLY D  2 112 ? 55.589  -14.676 -6.033  1.000 38.232  ? 4362 GLY D C     1 
ATOM   6562 O  O     . GLY D  2 112 ? 54.965  -14.025 -5.179  1.000 37.663  ? 4362 GLY D O     1 
ATOM   6563 N  N     . PHE D  2 113 ? 56.091  -15.895 -5.825  1.000 37.326  ? 4363 PHE D N     1 
ATOM   6564 C  CA    . PHE D  2 113 ? 55.846  -16.600 -4.540  1.000 38.136  ? 4363 PHE D CA    1 
ATOM   6565 C  C     . PHE D  2 113 ? 56.500  -15.846 -3.374  1.000 38.099  ? 4363 PHE D C     1 
ATOM   6566 O  O     . PHE D  2 113 ? 55.818  -15.628 -2.356  1.000 41.217  ? 4363 PHE D O     1 
ATOM   6567 C  CB    . PHE D  2 113 ? 56.354  -18.042 -4.575  1.000 37.063  ? 4363 PHE D CB    1 
ATOM   6568 C  CG    . PHE D  2 113 ? 56.033  -18.790 -3.306  1.000 38.279  ? 4363 PHE D CG    1 
ATOM   6569 C  CD1   . PHE D  2 113 ? 56.896  -18.751 -2.222  1.000 36.962  ? 4363 PHE D CD1   1 
ATOM   6570 C  CD2   . PHE D  2 113 ? 54.822  -19.451 -3.162  1.000 40.090  ? 4363 PHE D CD2   1 
ATOM   6571 C  CE1   . PHE D  2 113 ? 56.578  -19.403 -1.040  1.000 37.780  ? 4363 PHE D CE1   1 
ATOM   6572 C  CE2   . PHE D  2 113 ? 54.509  -20.106 -1.982  1.000 40.523  ? 4363 PHE D CE2   1 
ATOM   6573 C  CZ    . PHE D  2 113 ? 55.386  -20.076 -0.922  1.000 38.790  ? 4363 PHE D CZ    1 
ATOM   6574 N  N     . THR D  2 114 ? 57.773  -15.469 -3.514  1.000 36.904  ? 4364 THR D N     1 
ATOM   6575 C  CA    . THR D  2 114 ? 58.486  -14.755 -2.420  1.000 38.617  ? 4364 THR D CA    1 
ATOM   6576 C  C     . THR D  2 114 ? 57.825  -13.397 -2.156  1.000 41.196  ? 4364 THR D C     1 
ATOM   6577 O  O     . THR D  2 114 ? 57.739  -13.001 -0.991  1.000 44.681  ? 4364 THR D O     1 
ATOM   6578 C  CB    . THR D  2 114 ? 59.981  -14.595 -2.723  1.000 36.972  ? 4364 THR D CB    1 
ATOM   6579 O  OG1   . THR D  2 114 ? 60.148  -13.806 -3.904  1.000 38.076  ? 4364 THR D OG1   1 
ATOM   6580 C  CG2   . THR D  2 114 ? 60.683  -15.926 -2.892  1.000 35.772  ? 4364 THR D CG2   1 
ATOM   6581 N  N     A LEU D  2 115 ? 57.387  -12.700 -3.210  0.600 43.275  ? 4365 LEU D N     1 
ATOM   6582 N  N     B LEU D  2 115 ? 57.367  -12.736 -3.221  0.400 43.170  ? 4365 LEU D N     1 
ATOM   6583 C  CA    A LEU D  2 115 ? 56.720  -11.377 -3.045  0.600 46.032  ? 4365 LEU D CA    1 
ATOM   6584 C  CA    B LEU D  2 115 ? 56.731  -11.396 -3.144  0.400 45.831  ? 4365 LEU D CA    1 
ATOM   6585 C  C     A LEU D  2 115 ? 55.393  -11.533 -2.299  0.600 48.221  ? 4365 LEU D C     1 
ATOM   6586 C  C     B LEU D  2 115 ? 55.376  -11.474 -2.425  0.400 48.131  ? 4365 LEU D C     1 
ATOM   6587 O  O     A LEU D  2 115 ? 55.140  -10.734 -1.377  0.600 51.661  ? 4365 LEU D O     1 
ATOM   6588 O  O     B LEU D  2 115 ? 55.084  -10.556 -1.634  0.400 50.679  ? 4365 LEU D O     1 
ATOM   6589 C  CB    A LEU D  2 115 ? 56.451  -10.756 -4.419  0.600 46.365  ? 4365 LEU D CB    1 
ATOM   6590 C  CB    B LEU D  2 115 ? 56.564  -10.882 -4.577  0.400 46.083  ? 4365 LEU D CB    1 
ATOM   6591 C  CG    A LEU D  2 115 ? 57.661  -10.204 -5.163  0.600 45.308  ? 4365 LEU D CG    1 
ATOM   6592 C  CG    B LEU D  2 115 ? 56.152  -9.420  -4.710  0.400 48.416  ? 4365 LEU D CG    1 
ATOM   6593 C  CD1   A LEU D  2 115 ? 57.284  -9.855  -6.594  0.600 46.180  ? 4365 LEU D CD1   1 
ATOM   6594 C  CD1   B LEU D  2 115 ? 57.211  -8.512  -4.105  0.400 48.115  ? 4365 LEU D CD1   1 
ATOM   6595 C  CD2   A LEU D  2 115 ? 58.237  -8.992  -4.443  0.600 45.941  ? 4365 LEU D CD2   1 
ATOM   6596 C  CD2   B LEU D  2 115 ? 55.910  -9.066  -6.168  0.400 49.100  ? 4365 LEU D CD2   1 
ATOM   6597 N  N     . LYS D  2 116 ? 54.584  -12.518 -2.699  1.000 48.745  ? 4366 LYS D N     1 
ATOM   6598 C  CA    . LYS D  2 116 ? 53.224  -12.701 -2.114  1.000 51.349  ? 4366 LYS D CA    1 
ATOM   6599 C  C     . LYS D  2 116 ? 53.233  -13.434 -0.770  1.000 50.970  ? 4366 LYS D C     1 
ATOM   6600 O  O     . LYS D  2 116 ? 52.144  -13.514 -0.171  1.000 53.448  ? 4366 LYS D O     1 
ATOM   6601 C  CB    . LYS D  2 116 ? 52.350  -13.491 -3.092  1.000 53.294  ? 4366 LYS D CB    1 
ATOM   6602 C  CG    . LYS D  2 116 ? 52.107  -12.809 -4.432  1.000 55.485  ? 4366 LYS D CG    1 
ATOM   6603 C  CD    . LYS D  2 116 ? 51.396  -13.688 -5.433  1.000 56.956  ? 4366 LYS D CD    1 
ATOM   6604 C  CE    . LYS D  2 116 ? 51.130  -12.979 -6.743  1.000 58.779  ? 4366 LYS D CE    1 
ATOM   6605 N  NZ    . LYS D  2 116 ? 50.484  -13.880 -7.724  1.000 60.317  ? 4366 LYS D NZ    1 
ATOM   6606 N  N     . ASN D  2 117 ? 54.380  -13.929 -0.294  1.000 47.338  ? 4367 ASN D N     1 
ATOM   6607 C  CA    . ASN D  2 117 ? 54.345  -14.692 0.985   1.000 46.429  ? 4367 ASN D CA    1 
ATOM   6608 C  C     . ASN D  2 117 ? 55.296  -14.097 2.024   1.000 45.291  ? 4367 ASN D C     1 
ATOM   6609 O  O     . ASN D  2 117 ? 56.146  -13.256 1.665   1.000 45.350  ? 4367 ASN D O     1 
ATOM   6610 C  CB    . ASN D  2 117 ? 54.580  -16.185 0.759   1.000 45.053  ? 4367 ASN D CB    1 
ATOM   6611 C  CG    . ASN D  2 117 ? 53.448  -16.806 -0.031  1.000 47.201  ? 4367 ASN D CG    1 
ATOM   6612 O  OD1   . ASN D  2 117 ? 52.508  -17.343 0.553   1.000 48.601  ? 4367 ASN D OD1   1 
ATOM   6613 N  ND2   . ASN D  2 117 ? 53.468  -16.629 -1.342  1.000 45.758  ? 4367 ASN D ND2   1 
ATOM   6614 N  N     . THR D  2 118 ? 55.150  -14.564 3.267   1.000 45.640  ? 4368 THR D N     1 
ATOM   6615 C  CA    . THR D  2 118 ? 55.922  -14.051 4.426   1.000 45.337  ? 4368 THR D CA    1 
ATOM   6616 C  C     . THR D  2 118 ? 56.534  -15.213 5.209   1.000 43.386  ? 4368 THR D C     1 
ATOM   6617 O  O     . THR D  2 118 ? 55.830  -16.218 5.433   1.000 42.403  ? 4368 THR D O     1 
ATOM   6618 C  CB    . THR D  2 118 ? 55.009  -13.223 5.340   1.000 48.544  ? 4368 THR D CB    1 
ATOM   6619 O  OG1   . THR D  2 118 ? 54.420  -12.201 4.534   1.000 49.138  ? 4368 THR D OG1   1 
ATOM   6620 C  CG2   . THR D  2 118 ? 55.737  -12.615 6.519   1.000 49.782  ? 4368 THR D CG2   1 
ATOM   6621 N  N     . VAL D  2 119 ? 57.795  -15.058 5.613   1.000 42.007  ? 4369 VAL D N     1 
ATOM   6622 C  CA    . VAL D  2 119 ? 58.493  -16.100 6.416   1.000 41.785  ? 4369 VAL D CA    1 
ATOM   6623 C  C     . VAL D  2 119 ? 58.128  -15.894 7.884   1.000 44.722  ? 4369 VAL D C     1 
ATOM   6624 O  O     . VAL D  2 119 ? 58.116  -14.732 8.340   1.000 46.041  ? 4369 VAL D O     1 
ATOM   6625 C  CB    . VAL D  2 119 ? 60.017  -16.035 6.223   1.000 40.399  ? 4369 VAL D CB    1 
ATOM   6626 C  CG1   . VAL D  2 119 ? 60.736  -17.014 7.140   1.000 40.309  ? 4369 VAL D CG1   1 
ATOM   6627 C  CG2   . VAL D  2 119 ? 60.406  -16.258 4.771   1.000 38.527  ? 4369 VAL D CG2   1 
ATOM   6628 N  N     . CYS D  2 120 ? 57.824  -16.983 8.583   1.000 45.582  ? 4370 CYS D N     1 
ATOM   6629 C  CA    . CYS D  2 120 ? 57.508  -16.897 10.028  1.000 49.174  ? 4370 CYS D CA    1 
ATOM   6630 C  C     . CYS D  2 120 ? 58.794  -16.575 10.795  1.000 49.693  ? 4370 CYS D C     1 
ATOM   6631 O  O     . CYS D  2 120 ? 59.777  -17.322 10.637  1.000 47.813  ? 4370 CYS D O     1 
ATOM   6632 C  CB    . CYS D  2 120 ? 56.912  -18.203 10.526  1.000 50.552  ? 4370 CYS D CB    1 
ATOM   6633 S  SG    . CYS D  2 120 ? 56.573  -18.201 12.303  1.000 52.503  ? 4370 CYS D SG    1 
ATOM   6634 N  N     . THR D  2 121 ? 58.781  -15.503 11.591  1.000 52.736  ? 4371 THR D N     1 
ATOM   6635 C  CA    . THR D  2 121 ? 59.987  -15.081 12.353  1.000 55.368  ? 4371 THR D CA    1 
ATOM   6636 C  C     . THR D  2 121 ? 60.294  -16.063 13.494  1.000 56.734  ? 4371 THR D C     1 
ATOM   6637 O  O     . THR D  2 121 ? 61.406  -15.968 14.046  1.000 59.473  ? 4371 THR D O     1 
ATOM   6638 C  CB    . THR D  2 121 ? 59.806  -13.661 12.901  1.000 58.790  ? 4371 THR D CB    1 
ATOM   6639 O  OG1   . THR D  2 121 ? 58.638  -13.668 13.721  1.000 60.833  ? 4371 THR D OG1   1 
ATOM   6640 C  CG2   . THR D  2 121 ? 59.659  -12.621 11.812  1.000 59.333  ? 4371 THR D CG2   1 
ATOM   6641 N  N     . VAL D  2 122 ? 59.381  -16.996 13.793  1.000 56.648  ? 4372 VAL D N     1 
ATOM   6642 C  CA    . VAL D  2 122 ? 59.575  -17.948 14.932  1.000 56.862  ? 4372 VAL D CA    1 
ATOM   6643 C  C     . VAL D  2 122 ? 60.155  -19.280 14.434  1.000 54.239  ? 4372 VAL D C     1 
ATOM   6644 O  O     . VAL D  2 122 ? 61.237  -19.653 14.926  1.000 55.793  ? 4372 VAL D O     1 
ATOM   6645 C  CB    . VAL D  2 122 ? 58.260  -18.165 15.712  1.000 58.981  ? 4372 VAL D CB    1 
ATOM   6646 C  CG1   . VAL D  2 122 ? 58.422  -19.186 16.833  1.000 59.621  ? 4372 VAL D CG1   1 
ATOM   6647 C  CG2   . VAL D  2 122 ? 57.709  -16.861 16.267  1.000 61.541  ? 4372 VAL D CG2   1 
ATOM   6648 N  N     . CYS D  2 123 ? 59.474  -19.967 13.507  1.000 51.750  ? 4373 CYS D N     1 
ATOM   6649 C  CA    . CYS D  2 123 ? 59.936  -21.305 13.032  1.000 49.218  ? 4373 CYS D CA    1 
ATOM   6650 C  C     . CYS D  2 123 ? 60.714  -21.221 11.708  1.000 45.049  ? 4373 CYS D C     1 
ATOM   6651 O  O     . CYS D  2 123 ? 61.324  -22.241 11.338  1.000 43.216  ? 4373 CYS D O     1 
ATOM   6652 C  CB    . CYS D  2 123 ? 58.760  -22.257 12.846  1.000 50.406  ? 4373 CYS D CB    1 
ATOM   6653 S  SG    . CYS D  2 123 ? 57.636  -21.746 11.522  1.000 49.306  ? 4373 CYS D SG    1 
ATOM   6654 N  N     . GLY D  2 124 ? 60.651  -20.089 10.998  1.000 43.708  ? 4374 GLY D N     1 
ATOM   6655 C  CA    . GLY D  2 124 ? 61.401  -19.933 9.732   1.000 42.082  ? 4374 GLY D CA    1 
ATOM   6656 C  C     . GLY D  2 124 ? 60.728  -20.620 8.549   1.000 40.347  ? 4374 GLY D C     1 
ATOM   6657 O  O     . GLY D  2 124 ? 61.370  -20.716 7.484   1.000 38.163  ? 4374 GLY D O     1 
ATOM   6658 N  N     . MET D  2 125 ? 59.489  -21.088 8.727   1.000 40.362  ? 4375 MET D N     1 
ATOM   6659 C  CA    . MET D  2 125 ? 58.726  -21.738 7.629   1.000 41.166  ? 4375 MET D CA    1 
ATOM   6660 C  C     . MET D  2 125 ? 57.834  -20.680 6.970   1.000 41.484  ? 4375 MET D C     1 
ATOM   6661 O  O     . MET D  2 125 ? 57.531  -19.668 7.643   1.000 40.981  ? 4375 MET D O     1 
ATOM   6662 C  CB    . MET D  2 125 ? 57.838  -22.861 8.175   1.000 44.118  ? 4375 MET D CB    1 
ATOM   6663 C  CG    . MET D  2 125 ? 58.588  -23.891 9.002   1.000 45.984  ? 4375 MET D CG    1 
ATOM   6664 S  SD    . MET D  2 125 ? 59.681  -24.941 8.023   1.000 46.253  ? 4375 MET D SD    1 
ATOM   6665 C  CE    . MET D  2 125 ? 58.486  -25.961 7.162   1.000 50.801  ? 4375 MET D CE    1 
ATOM   6666 N  N     . TRP D  2 126 ? 57.445  -20.887 5.708   1.000 38.774  ? 4376 TRP D N     1 
ATOM   6667 C  CA    . TRP D  2 126 ? 56.515  -19.935 5.044   1.000 39.762  ? 4376 TRP D CA    1 
ATOM   6668 C  C     . TRP D  2 126 ? 55.158  -19.971 5.759   1.000 42.642  ? 4376 TRP D C     1 
ATOM   6669 O  O     . TRP D  2 126 ? 54.675  -21.080 6.037   1.000 41.696  ? 4376 TRP D O     1 
ATOM   6670 C  CB    . TRP D  2 126 ? 56.316  -20.270 3.562   1.000 39.281  ? 4376 TRP D CB    1 
ATOM   6671 C  CG    . TRP D  2 126 ? 57.479  -19.983 2.666   1.000 36.624  ? 4376 TRP D CG    1 
ATOM   6672 C  CD1   . TRP D  2 126 ? 58.293  -20.889 2.054   1.000 34.934  ? 4376 TRP D CD1   1 
ATOM   6673 C  CD2   . TRP D  2 126 ? 57.942  -18.684 2.256   1.000 36.698  ? 4376 TRP D CD2   1 
ATOM   6674 N  NE1   . TRP D  2 126 ? 59.224  -20.244 1.285   1.000 33.339  ? 4376 TRP D NE1   1 
ATOM   6675 C  CE2   . TRP D  2 126 ? 59.039  -18.892 1.393   1.000 34.864  ? 4376 TRP D CE2   1 
ATOM   6676 C  CE3   . TRP D  2 126 ? 57.543  -17.373 2.536   1.000 38.085  ? 4376 TRP D CE3   1 
ATOM   6677 C  CZ2   . TRP D  2 126 ? 59.739  -17.835 0.814   1.000 35.246  ? 4376 TRP D CZ2   1 
ATOM   6678 C  CZ3   . TRP D  2 126 ? 58.235  -16.330 1.963   1.000 37.944  ? 4376 TRP D CZ3   1 
ATOM   6679 C  CH2   . TRP D  2 126 ? 59.318  -16.560 1.113   1.000 35.638  ? 4376 TRP D CH2   1 
ATOM   6680 N  N     . LYS D  2 127 ? 54.573  -18.809 6.049   1.000 45.694  ? 4377 LYS D N     1 
ATOM   6681 C  CA    . LYS D  2 127 ? 53.223  -18.802 6.674   1.000 50.981  ? 4377 LYS D CA    1 
ATOM   6682 C  C     . LYS D  2 127 ? 52.246  -19.332 5.616   1.000 50.880  ? 4377 LYS D C     1 
ATOM   6683 O  O     . LYS D  2 127 ? 52.281  -18.826 4.471   1.000 49.751  ? 4377 LYS D O     1 
ATOM   6684 C  CB    . LYS D  2 127 ? 52.869  -17.406 7.196   1.000 55.405  ? 4377 LYS D CB    1 
ATOM   6685 C  CG    . LYS D  2 127 ? 53.860  -16.848 8.211   1.000 59.107  ? 4377 LYS D CG    1 
ATOM   6686 C  CD    . LYS D  2 127 ? 53.478  -15.505 8.810   1.000 65.047  ? 4377 LYS D CD    1 
ATOM   6687 C  CE    . LYS D  2 127 ? 52.255  -15.568 9.700   1.000 71.542  ? 4377 LYS D CE    1 
ATOM   6688 N  NZ    . LYS D  2 127 ? 52.448  -16.514 10.826  1.000 74.426  ? 4377 LYS D NZ    1 
ATOM   6689 N  N     . GLY D  2 128 ? 51.488  -20.376 5.960   1.000 53.100  ? 4378 GLY D N     1 
ATOM   6690 C  CA    . GLY D  2 128 ? 50.531  -21.000 5.026   1.000 54.787  ? 4378 GLY D CA    1 
ATOM   6691 C  C     . GLY D  2 128 ? 51.159  -22.138 4.234   1.000 53.486  ? 4378 GLY D C     1 
ATOM   6692 O  O     . GLY D  2 128 ? 50.413  -22.826 3.518   1.000 57.991  ? 4378 GLY D O     1 
ATOM   6693 N  N     . TYR D  2 129 ? 52.478  -22.336 4.353   1.000 52.178  ? 4379 TYR D N     1 
ATOM   6694 C  CA    . TYR D  2 129 ? 53.170  -23.426 3.614   1.000 51.274  ? 4379 TYR D CA    1 
ATOM   6695 C  C     . TYR D  2 129 ? 54.264  -24.057 4.484   1.000 50.153  ? 4379 TYR D C     1 
ATOM   6696 O  O     . TYR D  2 129 ? 55.425  -24.162 4.002   1.000 50.079  ? 4379 TYR D O     1 
ATOM   6697 C  CB    . TYR D  2 129 ? 53.779  -22.897 2.313   1.000 50.441  ? 4379 TYR D CB    1 
ATOM   6698 C  CG    . TYR D  2 129 ? 52.785  -22.379 1.308   1.000 51.993  ? 4379 TYR D CG    1 
ATOM   6699 C  CD1   . TYR D  2 129 ? 52.188  -23.234 0.397   1.000 52.706  ? 4379 TYR D CD1   1 
ATOM   6700 C  CD2   . TYR D  2 129 ? 52.463  -21.034 1.246   1.000 53.142  ? 4379 TYR D CD2   1 
ATOM   6701 C  CE1   . TYR D  2 129 ? 51.288  -22.769 -0.546  1.000 55.427  ? 4379 TYR D CE1   1 
ATOM   6702 C  CE2   . TYR D  2 129 ? 51.562  -20.553 0.311   1.000 56.485  ? 4379 TYR D CE2   1 
ATOM   6703 C  CZ    . TYR D  2 129 ? 50.974  -21.424 -0.588  1.000 57.746  ? 4379 TYR D CZ    1 
ATOM   6704 O  OH    . TYR D  2 129 ? 50.079  -20.962 -1.507  1.000 63.897  ? 4379 TYR D OH    1 
ATOM   6705 N  N     . GLY D  2 130 ? 53.914  -24.458 5.712   1.000 48.650  ? 4380 GLY D N     1 
ATOM   6706 C  CA    . GLY D  2 130 ? 54.878  -25.111 6.619   1.000 48.217  ? 4380 GLY D CA    1 
ATOM   6707 C  C     . GLY D  2 130 ? 54.787  -24.620 8.056   1.000 48.785  ? 4380 GLY D C     1 
ATOM   6708 O  O     . GLY D  2 130 ? 54.997  -25.450 8.957   1.000 49.254  ? 4380 GLY D O     1 
ATOM   6709 N  N     . CYS D  2 131 ? 54.532  -23.319 8.266   1.000 49.245  ? 4381 CYS D N     1 
ATOM   6710 C  CA    . CYS D  2 131 ? 54.450  -22.745 9.640   1.000 50.089  ? 4381 CYS D CA    1 
ATOM   6711 C  C     . CYS D  2 131 ? 53.273  -23.371 10.391  1.000 53.278  ? 4381 CYS D C     1 
ATOM   6712 O  O     . CYS D  2 131 ? 52.127  -23.217 9.928   1.000 52.919  ? 4381 CYS D O     1 
ATOM   6713 C  CB    . CYS D  2 131 ? 54.303  -21.227 9.628   1.000 51.378  ? 4381 CYS D CB    1 
ATOM   6714 S  SG    . CYS D  2 131 ? 54.059  -20.500 11.276  1.000 48.503  ? 4381 CYS D SG    1 
ATOM   6715 N  N     . SER D  2 132 ? 53.572  -24.060 11.494  1.000 57.104  ? 4382 SER D N     1 
ATOM   6716 C  CA    . SER D  2 132 ? 52.544  -24.723 12.340  1.000 63.022  ? 4382 SER D CA    1 
ATOM   6717 C  C     . SER D  2 132 ? 52.535  -24.082 13.732  1.000 67.242  ? 4382 SER D C     1 
ATOM   6718 O  O     . SER D  2 132 ? 52.299  -24.806 14.723  1.000 71.003  ? 4382 SER D O     1 
ATOM   6719 C  CB    . SER D  2 132 ? 52.791  -26.207 12.407  1.000 63.691  ? 4382 SER D CB    1 
ATOM   6720 O  OG    . SER D  2 132 ? 54.121  -26.479 12.822  1.000 65.430  ? 4382 SER D OG    1 
ATOM   6721 N  N     . CYS D  2 133 ? 52.770  -22.767 13.791  1.000 67.823  ? 4383 CYS D N     1 
ATOM   6722 C  CA    . CYS D  2 133 ? 52.788  -22.014 15.076  1.000 70.994  ? 4383 CYS D CA    1 
ATOM   6723 C  C     . CYS D  2 133 ? 51.366  -21.758 15.602  1.000 75.536  ? 4383 CYS D C     1 
ATOM   6724 O  O     . CYS D  2 133 ? 51.262  -21.267 16.741  1.000 77.972  ? 4383 CYS D O     1 
ATOM   6725 C  CB    . CYS D  2 133 ? 53.514  -20.680 14.917  1.000 68.322  ? 4383 CYS D CB    1 
ATOM   6726 S  SG    . CYS D  2 133 ? 55.313  -20.834 14.769  1.000 60.395  ? 4383 CYS D SG    1 
ATOM   6727 N  N     . ASP D  2 134 ? 50.321  -22.099 14.835  1.000 80.958  ? 4384 ASP D N     1 
ATOM   6728 C  CA    . ASP D  2 134 ? 48.922  -21.820 15.275  1.000 88.215  ? 4384 ASP D CA    1 
ATOM   6729 C  C     . ASP D  2 134 ? 48.103  -23.113 15.418  1.000 90.232  ? 4384 ASP D C     1 
ATOM   6730 O  O     . ASP D  2 134 ? 46.861  -23.006 15.464  1.000 94.243  ? 4384 ASP D O     1 
ATOM   6731 C  CB    . ASP D  2 134 ? 48.227  -20.861 14.301  1.000 91.025  ? 4384 ASP D CB    1 
ATOM   6732 C  CG    . ASP D  2 134 ? 48.881  -19.493 14.199  1.000 91.908  ? 4384 ASP D CG    1 
ATOM   6733 O  OD1   . ASP D  2 134 ? 49.613  -19.118 15.137  1.000 92.757  ? 4384 ASP D OD1   1 
ATOM   6734 O  OD2   . ASP D  2 134 ? 48.662  -18.816 13.174  1.000 92.783  ? 4384 ASP D OD2   1 
ATOM   6735 N  N     . GLN D  2 135 ? 48.752  -24.278 15.508  1.000 90.358  ? 4385 GLN D N     1 
ATOM   6736 C  CA    . GLN D  2 135 ? 47.997  -25.555 15.657  1.000 93.127  ? 4385 GLN D CA    1 
ATOM   6737 C  C     . GLN D  2 135 ? 47.369  -25.616 17.056  1.000 96.022  ? 4385 GLN D C     1 
ATOM   6738 O  O     . GLN D  2 135 ? 48.048  -25.802 18.065  1.000 96.295  ? 4385 GLN D O     1 
ATOM   6739 C  CB    . GLN D  2 135 ? 48.902  -26.761 15.403  1.000 92.316  ? 4385 GLN D CB    1 
ATOM   6740 C  CG    . GLN D  2 135 ? 49.371  -26.879 13.960  1.000 91.157  ? 4385 GLN D CG    1 
ATOM   6741 C  CD    . GLN D  2 135 ? 50.205  -28.116 13.726  1.000 92.064  ? 4385 GLN D CD    1 
ATOM   6742 O  OE1   . GLN D  2 135 ? 50.619  -28.799 14.661  1.000 94.754  ? 4385 GLN D OE1   1 
ATOM   6743 N  NE2   . GLN D  2 135 ? 50.473  -28.408 12.463  1.000 89.886  ? 4385 GLN D NE2   1 
HETATM 6744 NA NA    . NA  E  3 .   ? 82.356  23.983  -17.754 1.000 45.296  ? 7101 NA  A NA    1 
HETATM 6745 N  N     . SAM F  4 .   ? 80.765  18.666  -0.958  1.000 26.715  ? 7102 SAM A N     1 
HETATM 6746 C  CA    . SAM F  4 .   ? 79.381  18.217  -0.653  1.000 26.063  ? 7102 SAM A CA    1 
HETATM 6747 C  C     . SAM F  4 .   ? 78.382  19.137  -1.376  1.000 28.200  ? 7102 SAM A C     1 
HETATM 6748 O  O     . SAM F  4 .   ? 78.728  19.568  -2.502  1.000 26.885  ? 7102 SAM A O     1 
HETATM 6749 O  OXT   . SAM F  4 .   ? 77.286  19.359  -0.823  1.000 30.732  ? 7102 SAM A OXT   1 
HETATM 6750 C  CB    . SAM F  4 .   ? 79.148  18.200  0.864   1.000 29.140  ? 7102 SAM A CB    1 
HETATM 6751 C  CG    . SAM F  4 .   ? 80.147  17.288  1.591   1.000 31.199  ? 7102 SAM A CG    1 
HETATM 6752 S  SD    . SAM F  4 .   ? 79.788  17.039  3.346   1.000 35.189  ? 7102 SAM A SD    1 
HETATM 6753 C  CE    . SAM F  4 .   ? 80.182  18.646  4.019   1.000 36.520  ? 7102 SAM A CE    1 
HETATM 6754 C  "C5'" . SAM F  4 .   ? 81.261  16.068  3.810   1.000 32.789  ? 7102 SAM A "C5'" 1 
HETATM 6755 C  "C4'" . SAM F  4 .   ? 81.340  14.695  3.164   1.000 31.762  ? 7102 SAM A "C4'" 1 
HETATM 6756 O  "O4'" . SAM F  4 .   ? 82.585  14.048  3.519   1.000 33.313  ? 7102 SAM A "O4'" 1 
HETATM 6757 C  "C3'" . SAM F  4 .   ? 80.236  13.714  3.577   1.000 31.413  ? 7102 SAM A "C3'" 1 
HETATM 6758 O  "O3'" . SAM F  4 .   ? 79.429  13.402  2.449   1.000 31.396  ? 7102 SAM A "O3'" 1 
HETATM 6759 C  "C2'" . SAM F  4 .   ? 80.995  12.489  4.113   1.000 31.971  ? 7102 SAM A "C2'" 1 
HETATM 6760 O  "O2'" . SAM F  4 .   ? 80.398  11.263  3.747   1.000 31.121  ? 7102 SAM A "O2'" 1 
HETATM 6761 C  "C1'" . SAM F  4 .   ? 82.362  12.660  3.461   1.000 32.307  ? 7102 SAM A "C1'" 1 
HETATM 6762 N  N9    . SAM F  4 .   ? 83.442  11.933  4.130   1.000 31.615  ? 7102 SAM A N9    1 
HETATM 6763 C  C8    . SAM F  4 .   ? 83.785  11.997  5.457   1.000 31.284  ? 7102 SAM A C8    1 
HETATM 6764 N  N7    . SAM F  4 .   ? 84.779  11.207  5.780   1.000 30.466  ? 7102 SAM A N7    1 
HETATM 6765 C  C5    . SAM F  4 .   ? 85.109  10.564  4.597   1.000 31.347  ? 7102 SAM A C5    1 
HETATM 6766 C  C6    . SAM F  4 .   ? 86.083  9.592   4.283   1.000 32.425  ? 7102 SAM A C6    1 
HETATM 6767 N  N6    . SAM F  4 .   ? 86.928  9.069   5.170   1.000 31.922  ? 7102 SAM A N6    1 
HETATM 6768 N  N1    . SAM F  4 .   ? 86.140  9.156   3.003   1.000 31.143  ? 7102 SAM A N1    1 
HETATM 6769 C  C2    . SAM F  4 .   ? 85.285  9.677   2.114   1.000 32.452  ? 7102 SAM A C2    1 
HETATM 6770 N  N3    . SAM F  4 .   ? 84.330  10.586  2.294   1.000 31.657  ? 7102 SAM A N3    1 
HETATM 6771 C  C4    . SAM F  4 .   ? 84.291  11.001  3.572   1.000 30.761  ? 7102 SAM A C4    1 
HETATM 6772 C  C     . FMT G  5 .   ? 84.376  22.404  13.529  1.000 28.376  ? 7103 FMT A C     1 
HETATM 6773 O  O1    . FMT G  5 .   ? 84.535  21.447  12.799  1.000 28.341  ? 7103 FMT A O1    1 
HETATM 6774 O  O2    . FMT G  5 .   ? 85.325  23.201  13.915  1.000 25.910  ? 7103 FMT A O2    1 
HETATM 6775 C  C     . FMT H  5 .   ? 81.380  24.205  7.919   1.000 53.587  ? 7104 FMT A C     1 
HETATM 6776 O  O1    . FMT H  5 .   ? 81.199  23.076  7.511   1.000 59.649  ? 7104 FMT A O1    1 
HETATM 6777 O  O2    . FMT H  5 .   ? 80.549  25.191  7.773   1.000 44.900  ? 7104 FMT A O2    1 
HETATM 6778 C  C     . FMT I  5 .   ? 81.979  25.721  12.417  1.000 50.620  ? 7105 FMT A C     1 
HETATM 6779 O  O1    . FMT I  5 .   ? 82.982  26.381  12.599  1.000 42.476  ? 7105 FMT A O1    1 
HETATM 6780 O  O2    . FMT I  5 .   ? 81.918  24.640  11.698  1.000 53.574  ? 7105 FMT A O2    1 
HETATM 6781 C  C     . FMT J  5 .   ? 99.563  9.227   -15.827 1.000 50.751  ? 7106 FMT A C     1 
HETATM 6782 O  O1    . FMT J  5 .   ? 98.722  9.285   -16.702 1.000 47.540  ? 7106 FMT A O1    1 
HETATM 6783 O  O2    . FMT J  5 .   ? 99.622  10.025  -14.800 1.000 50.650  ? 7106 FMT A O2    1 
HETATM 6784 C  C     . FMT K  5 .   ? 70.726  24.372  1.498   1.000 57.042  ? 7107 FMT A C     1 
HETATM 6785 O  O1    . FMT K  5 .   ? 71.083  25.529  1.584   1.000 47.607  ? 7107 FMT A O1    1 
HETATM 6786 O  O2    . FMT K  5 .   ? 71.518  23.364  1.286   1.000 61.078  ? 7107 FMT A O2    1 
HETATM 6787 C  C     . FMT L  5 .   ? 91.621  11.527  14.788  1.000 59.901  ? 7108 FMT A C     1 
HETATM 6788 O  O1    . FMT L  5 .   ? 90.801  11.540  13.893  1.000 62.275  ? 7108 FMT A O1    1 
HETATM 6789 O  O2    . FMT L  5 .   ? 92.896  11.729  14.633  1.000 54.421  ? 7108 FMT A O2    1 
HETATM 6790 C  C     . FMT M  5 .   ? 96.614  5.589   -4.470  1.000 49.827  ? 7109 FMT A C     1 
HETATM 6791 O  O1    . FMT M  5 .   ? 95.951  5.707   -5.479  1.000 49.649  ? 7109 FMT A O1    1 
HETATM 6792 O  O2    . FMT M  5 .   ? 96.474  6.311   -3.401  1.000 50.222  ? 7109 FMT A O2    1 
HETATM 6793 C  C     . FMT N  5 .   ? 101.385 7.484   -10.074 1.000 55.510  ? 7110 FMT A C     1 
HETATM 6794 O  O1    . FMT N  5 .   ? 101.616 6.924   -9.022  1.000 54.640  ? 7110 FMT A O1    1 
HETATM 6795 O  O2    . FMT N  5 .   ? 102.284 8.013   -10.845 1.000 57.655  ? 7110 FMT A O2    1 
HETATM 6796 C  C     . FMT O  5 .   ? 104.564 30.127  3.670   1.000 46.276  ? 7111 FMT A C     1 
HETATM 6797 O  O1    . FMT O  5 .   ? 104.542 29.712  4.809   1.000 46.842  ? 7111 FMT A O1    1 
HETATM 6798 O  O2    . FMT O  5 .   ? 105.315 29.659  2.720   1.000 51.517  ? 7111 FMT A O2    1 
HETATM 6799 ZN ZN    . ZN  P  6 .   ? 70.039  9.631   -15.601 1.000 34.146  ? 4401 ZN  B ZN    1 
HETATM 6800 ZN ZN    . ZN  Q  6 .   ? 62.986  23.046  -33.113 1.000 44.264  ? 4402 ZN  B ZN    1 
HETATM 6801 NA NA    . NA  R  3 .   ? 55.743  26.461  -10.287 0.750 66.128  ? 4403 NA  B NA    1 
HETATM 6802 NA NA    . NA  S  3 .   ? 77.525  -24.446 0.946   1.000 38.399  ? 7101 NA  C NA    1 
HETATM 6803 NA NA    . NA  T  3 .   ? 88.761  -34.361 -1.252  1.000 59.909  ? 7102 NA  C NA    1 
HETATM 6804 NA NA    . NA  U  3 .   ? 103.968 -17.468 -7.599  1.000 50.458  ? 7103 NA  C NA    1 
HETATM 6805 NA NA    . NA  V  3 .   ? 84.200  -2.155  -13.658 1.000 53.389  ? 7104 NA  C NA    1 
HETATM 6806 N  N     . SAM W  4 .   ? 79.498  -19.368 -15.837 1.000 25.886  ? 7105 SAM C N     1 
HETATM 6807 C  CA    . SAM W  4 .   ? 78.233  -18.814 -16.386 1.000 26.105  ? 7105 SAM C CA    1 
HETATM 6808 C  C     . SAM W  4 .   ? 77.057  -19.635 -15.836 1.000 27.180  ? 7105 SAM C C     1 
HETATM 6809 O  O     . SAM W  4 .   ? 77.187  -20.088 -14.674 1.000 25.846  ? 7105 SAM C O     1 
HETATM 6810 O  OXT   . SAM W  4 .   ? 76.045  -19.757 -16.550 1.000 26.528  ? 7105 SAM C OXT   1 
HETATM 6811 C  CB    . SAM W  4 .   ? 78.272  -18.819 -17.921 1.000 28.104  ? 7105 SAM C CB    1 
HETATM 6812 C  CG    . SAM W  4 .   ? 79.487  -18.057 -18.466 1.000 29.021  ? 7105 SAM C CG    1 
HETATM 6813 S  SD    . SAM W  4 .   ? 79.464  -17.794 -20.258 1.000 33.011  ? 7105 SAM C SD    1 
HETATM 6814 C  CE    . SAM W  4 .   ? 79.773  -19.437 -20.884 1.000 33.851  ? 7105 SAM C CE    1 
HETATM 6815 C  "C5'" . SAM W  4 .   ? 81.087  -16.995 -20.450 1.000 28.426  ? 7105 SAM C "C5'" 1 
HETATM 6816 C  "C4'" . SAM W  4 .   ? 81.202  -15.619 -19.809 1.000 28.014  ? 7105 SAM C "C4'" 1 
HETATM 6817 O  "O4'" . SAM W  4 .   ? 82.558  -15.129 -19.943 1.000 30.785  ? 7105 SAM C "O4'" 1 
HETATM 6818 C  "C3'" . SAM W  4 .   ? 80.312  -14.528 -20.420 1.000 29.252  ? 7105 SAM C "C3'" 1 
HETATM 6819 O  "O3'" . SAM W  4 .   ? 79.348  -14.093 -19.469 1.000 28.630  ? 7105 SAM C "O3'" 1 
HETATM 6820 C  "C2'" . SAM W  4 .   ? 81.290  -13.404 -20.801 1.000 30.398  ? 7105 SAM C "C2'" 1 
HETATM 6821 O  "O2'" . SAM W  4 .   ? 80.783  -12.115 -20.531 1.000 29.586  ? 7105 SAM C "O2'" 1 
HETATM 6822 C  "C1'" . SAM W  4 .   ? 82.492  -13.723 -19.920 1.000 29.903  ? 7105 SAM C "C1'" 1 
HETATM 6823 N  N9    . SAM W  4 .   ? 83.749  -13.136 -20.386 1.000 29.175  ? 7105 SAM C N9    1 
HETATM 6824 C  C8    . SAM W  4 .   ? 84.313  -13.262 -21.631 1.000 28.381  ? 7105 SAM C C8    1 
HETATM 6825 N  N7    . SAM W  4 .   ? 85.428  -12.585 -21.772 1.000 28.581  ? 7105 SAM C N7    1 
HETATM 6826 C  C5    . SAM W  4 .   ? 85.607  -11.953 -20.550 1.000 28.316  ? 7105 SAM C C5    1 
HETATM 6827 C  C6    . SAM W  4 .   ? 86.605  -11.080 -20.066 1.000 28.263  ? 7105 SAM C C6    1 
HETATM 6828 N  N6    . SAM W  4 .   ? 87.642  -10.658 -20.784 1.000 27.044  ? 7105 SAM C N6    1 
HETATM 6829 N  N1    . SAM W  4 .   ? 86.477  -10.629 -18.795 1.000 27.174  ? 7105 SAM C N1    1 
HETATM 6830 C  C2    . SAM W  4 .   ? 85.427  -11.043 -18.074 1.000 27.284  ? 7105 SAM C C2    1 
HETATM 6831 N  N3    . SAM W  4 .   ? 84.428  -11.848 -18.424 1.000 28.216  ? 7105 SAM C N3    1 
HETATM 6832 C  C4    . SAM W  4 .   ? 84.576  -12.284 -19.687 1.000 28.310  ? 7105 SAM C C4    1 
HETATM 6833 C  C     . FMT X  5 .   ? 96.534  -11.703 2.189   1.000 34.065  ? 7106 FMT C C     1 
HETATM 6834 O  O1    . FMT X  5 .   ? 95.521  -11.730 2.858   1.000 35.194  ? 7106 FMT C O1    1 
HETATM 6835 O  O2    . FMT X  5 .   ? 96.706  -12.358 1.080   1.000 34.462  ? 7106 FMT C O2    1 
HETATM 6836 C  C     . FMT Y  5 .   ? 85.117  -23.700 -29.416 1.000 30.966  ? 7107 FMT C C     1 
HETATM 6837 O  O1    . FMT Y  5 .   ? 85.204  -22.796 -28.609 1.000 29.751  ? 7107 FMT C O1    1 
HETATM 6838 O  O2    . FMT Y  5 .   ? 86.076  -24.524 -29.699 1.000 28.585  ? 7107 FMT C O2    1 
HETATM 6839 C  C     . FMT Z  5 .   ? 80.405  -24.924 -24.019 1.000 50.518  ? 7108 FMT C C     1 
HETATM 6840 O  O1    . FMT Z  5 .   ? 81.179  -24.048 -24.347 1.000 55.676  ? 7108 FMT C O1    1 
HETATM 6841 O  O2    . FMT Z  5 .   ? 80.359  -26.114 -24.542 1.000 39.601  ? 7108 FMT C O2    1 
HETATM 6842 C  C     . FMT AA 5 .   ? 95.043  -42.277 -15.413 1.000 45.323  ? 7109 FMT C C     1 
HETATM 6843 O  O1    . FMT AA 5 .   ? 95.022  -43.111 -16.295 1.000 52.173  ? 7109 FMT C O1    1 
HETATM 6844 O  O2    . FMT AA 5 .   ? 95.746  -41.186 -15.444 1.000 42.053  ? 7109 FMT C O2    1 
HETATM 6845 C  C     . FMT BA 5 .   ? 82.464  -26.578 -28.740 1.000 57.486  ? 7110 FMT C C     1 
HETATM 6846 O  O1    . FMT BA 5 .   ? 82.481  -25.898 -27.734 1.000 62.931  ? 7110 FMT C O1    1 
HETATM 6847 O  O2    . FMT BA 5 .   ? 82.996  -27.762 -28.855 1.000 47.225  ? 7110 FMT C O2    1 
HETATM 6848 C  C     . FMT CA 5 .   ? 71.873  -39.403 -20.315 1.000 49.052  ? 7111 FMT C C     1 
HETATM 6849 O  O1    . FMT CA 5 .   ? 71.942  -38.476 -19.534 1.000 43.253  ? 7111 FMT C O1    1 
HETATM 6850 O  O2    . FMT CA 5 .   ? 70.774  -39.843 -20.854 1.000 49.126  ? 7111 FMT C O2    1 
HETATM 6851 C  C     . FMT DA 5 .   ? 69.589  -24.513 -20.153 1.000 56.642  ? 7112 FMT C C     1 
HETATM 6852 O  O1    . FMT DA 5 .   ? 69.664  -25.694 -19.886 1.000 49.612  ? 7112 FMT C O1    1 
HETATM 6853 O  O2    . FMT DA 5 .   ? 70.243  -23.566 -19.547 1.000 58.657  ? 7112 FMT C O2    1 
HETATM 6854 C  C     . FMT EA 5 .   ? 95.250  -8.577  -9.636  1.000 46.311  ? 7113 FMT C C     1 
HETATM 6855 O  O1    . FMT EA 5 .   ? 95.502  -7.757  -8.777  1.000 44.477  ? 7113 FMT C O1    1 
HETATM 6856 O  O2    . FMT EA 5 .   ? 96.051  -8.907  -10.602 1.000 48.070  ? 7113 FMT C O2    1 
HETATM 6857 C  C     . FMT FA 5 .   ? 99.253  -10.436 -3.203  1.000 46.026  ? 7114 FMT C C     1 
HETATM 6858 O  O1    . FMT FA 5 .   ? 99.700  -9.836  -4.159  1.000 47.652  ? 7114 FMT C O1    1 
HETATM 6859 O  O2    . FMT FA 5 .   ? 99.973  -11.049 -2.316  1.000 48.332  ? 7114 FMT C O2    1 
HETATM 6860 C  C     . FMT GA 5 .   ? 91.239  -15.373 -24.279 1.000 41.708  ? 7115 FMT C C     1 
HETATM 6861 O  O1    . FMT GA 5 .   ? 90.734  -15.147 -25.360 1.000 38.435  ? 7115 FMT C O1    1 
HETATM 6862 O  O2    . FMT GA 5 .   ? 92.494  -15.183 -23.981 1.000 38.963  ? 7115 FMT C O2    1 
HETATM 6863 ZN ZN    . ZN  HA 6 .   ? 67.351  -8.932  -3.723  1.000 31.119  ? 4401 ZN  D ZN    1 
HETATM 6864 ZN ZN    . ZN  IA 6 .   ? 55.990  -20.437 12.552  1.000 46.797  ? 4402 ZN  D ZN    1 
HETATM 6865 NA NA    . NA  JA 3 .   ? 58.388  -12.005 1.361   1.000 64.454  ? 4403 NA  D NA    1 
HETATM 6866 C  C     . FMT KA 5 .   ? 60.496  -25.615 -12.103 1.000 61.890  ? 4404 FMT D C     1 
HETATM 6867 O  O1    . FMT KA 5 .   ? 61.587  -26.132 -12.235 1.000 53.673  ? 4404 FMT D O1    1 
HETATM 6868 O  O2    . FMT KA 5 .   ? 59.409  -26.250 -11.780 1.000 64.064  ? 4404 FMT D O2    1 
HETATM 6869 O  O     . HOH LA 7 .   ? 84.410  43.874  -1.831  1.000 39.074  ? 7201 HOH A O     1 
HETATM 6870 O  O     . HOH LA 7 .   ? 91.650  13.022  9.218   1.000 41.303  ? 7202 HOH A O     1 
HETATM 6871 O  O     . HOH LA 7 .   ? 86.074  8.636   -0.986  0.500 21.803  ? 7203 HOH A O     1 
HETATM 6872 O  O     . HOH LA 7 .   ? 84.038  -16.352 6.680   1.000 45.737  ? 7204 HOH A O     1 
HETATM 6873 O  O     A HOH LA 7 .   ? 94.122  32.984  -12.943 0.500 28.510  ? 7205 HOH A O     1 
HETATM 6874 O  O     B HOH LA 7 .   ? 93.898  35.019  -13.078 0.500 32.090  ? 7205 HOH A O     1 
HETATM 6875 O  O     . HOH LA 7 .   ? 85.184  0.952   -0.634  1.000 50.262  ? 7206 HOH A O     1 
HETATM 6876 O  O     A HOH LA 7 .   ? 83.809  0.989   -2.853  0.600 33.993  ? 7207 HOH A O     1 
HETATM 6877 O  O     B HOH LA 7 .   ? 83.674  0.474   -4.651  0.400 29.077  ? 7207 HOH A O     1 
HETATM 6878 O  O     . HOH LA 7 .   ? 105.453 30.093  7.000   0.500 30.642  ? 7208 HOH A O     1 
HETATM 6879 O  O     . HOH LA 7 .   ? 91.619  -0.891  1.278   0.500 37.307  ? 7209 HOH A O     1 
HETATM 6880 O  O     A HOH LA 7 .   ? 97.209  26.630  -26.601 0.600 41.457  ? 7210 HOH A O     1 
HETATM 6881 O  O     B HOH LA 7 .   ? 98.820  25.122  -27.138 0.400 34.836  ? 7210 HOH A O     1 
HETATM 6882 O  O     . HOH LA 7 .   ? 94.153  40.905  8.583   0.500 28.843  ? 7211 HOH A O     1 
HETATM 6883 O  O     . HOH LA 7 .   ? 106.086 16.569  -1.641  1.000 37.144  ? 7212 HOH A O     1 
HETATM 6884 O  O     A HOH LA 7 .   ? 87.008  33.350  -15.997 0.500 38.836  ? 7213 HOH A O     1 
HETATM 6885 O  O     B HOH LA 7 .   ? 86.184  33.353  -17.761 0.500 40.442  ? 7213 HOH A O     1 
HETATM 6886 O  O     . HOH LA 7 .   ? 97.874  7.986   -2.235  1.000 40.404  ? 7214 HOH A O     1 
HETATM 6887 O  O     A HOH LA 7 .   ? 91.075  42.046  -0.822  0.700 40.034  ? 7215 HOH A O     1 
HETATM 6888 O  O     B HOH LA 7 .   ? 91.699  40.838  -2.053  0.300 20.900  ? 7215 HOH A O     1 
HETATM 6889 O  O     . HOH LA 7 .   ? 73.015  17.126  -10.754 1.000 25.785  ? 7216 HOH A O     1 
HETATM 6890 O  O     A HOH LA 7 .   ? 93.979  7.734   8.513   0.500 29.949  ? 7217 HOH A O     1 
HETATM 6891 O  O     B HOH LA 7 .   ? 95.503  7.316   9.689   0.500 40.487  ? 7217 HOH A O     1 
HETATM 6892 O  O     . HOH LA 7 .   ? 82.411  27.024  14.997  1.000 52.436  ? 7218 HOH A O     1 
HETATM 6893 O  O     . HOH LA 7 .   ? 109.551 28.107  8.896   1.000 71.176  ? 7219 HOH A O     1 
HETATM 6894 O  O     A HOH LA 7 .   ? 78.339  25.344  9.063   0.650 40.700  ? 7220 HOH A O     1 
HETATM 6895 O  O     B HOH LA 7 .   ? 76.211  25.158  9.057   0.350 32.045  ? 7220 HOH A O     1 
HETATM 6896 O  O     . HOH LA 7 .   ? 99.420  27.851  -18.405 1.000 45.577  ? 7221 HOH A O     1 
HETATM 6897 O  O     . HOH LA 7 .   ? 93.174  30.509  -12.181 1.000 41.132  ? 7222 HOH A O     1 
HETATM 6898 O  O     . HOH LA 7 .   ? 94.904  36.053  -2.593  1.000 36.630  ? 7223 HOH A O     1 
HETATM 6899 O  O     . HOH LA 7 .   ? 107.165 30.508  -4.619  1.000 36.330  ? 7224 HOH A O     1 
HETATM 6900 O  O     . HOH LA 7 .   ? 105.310 31.082  11.074  1.000 51.144  ? 7225 HOH A O     1 
HETATM 6901 O  O     . HOH LA 7 .   ? 104.858 14.373  -11.773 1.000 39.486  ? 7226 HOH A O     1 
HETATM 6902 O  O     . HOH LA 7 .   ? 112.572 29.031  0.043   0.500 39.162  ? 7227 HOH A O     1 
HETATM 6903 O  O     . HOH LA 7 .   ? 104.197 27.351  -0.252  1.000 36.244  ? 7228 HOH A O     1 
HETATM 6904 O  O     . HOH LA 7 .   ? 78.809  32.145  -16.382 1.000 33.210  ? 7229 HOH A O     1 
HETATM 6905 O  O     . HOH LA 7 .   ? 95.053  40.131  13.641  0.500 23.790  ? 7230 HOH A O     1 
HETATM 6906 O  O     . HOH LA 7 .   ? 105.934 14.121  -4.490  1.000 42.842  ? 7231 HOH A O     1 
HETATM 6907 O  O     . HOH LA 7 .   ? 84.369  15.832  -19.302 1.000 57.337  ? 7232 HOH A O     1 
HETATM 6908 O  O     A HOH LA 7 .   ? 91.781  34.580  -14.315 0.500 34.844  ? 7233 HOH A O     1 
HETATM 6909 O  O     B HOH LA 7 .   ? 89.880  34.351  -14.945 0.500 37.884  ? 7233 HOH A O     1 
HETATM 6910 O  O     . HOH LA 7 .   ? 75.307  32.144  5.209   1.000 39.264  ? 7234 HOH A O     1 
HETATM 6911 O  O     . HOH LA 7 .   ? 101.567 15.890  13.251  0.500 42.086  ? 7235 HOH A O     1 
HETATM 6912 O  O     . HOH LA 7 .   ? 80.498  7.040   -15.641 1.000 56.678  ? 7236 HOH A O     1 
HETATM 6913 O  O     . HOH LA 7 .   ? 81.821  36.904  -13.025 0.500 38.146  ? 7237 HOH A O     1 
HETATM 6914 O  O     . HOH LA 7 .   ? 99.050  14.817  12.198  1.000 43.622  ? 7238 HOH A O     1 
HETATM 6915 O  O     . HOH LA 7 .   ? 111.287 11.764  -19.594 0.500 42.240  ? 7239 HOH A O     1 
HETATM 6916 O  O     . HOH LA 7 .   ? 92.225  34.793  24.443  0.500 35.073  ? 7240 HOH A O     1 
HETATM 6917 O  O     . HOH LA 7 .   ? 100.048 10.079  4.737   1.000 48.257  ? 7241 HOH A O     1 
HETATM 6918 O  O     . HOH LA 7 .   ? 102.496 25.262  -13.309 1.000 35.578  ? 7242 HOH A O     1 
HETATM 6919 O  O     . HOH LA 7 .   ? 79.487  17.759  -4.533  1.000 23.905  ? 7243 HOH A O     1 
HETATM 6920 O  O     . HOH LA 7 .   ? 74.881  19.656  0.210   1.000 52.183  ? 7244 HOH A O     1 
HETATM 6921 O  O     A HOH LA 7 .   ? 97.264  17.991  -22.190 0.650 32.468  ? 7245 HOH A O     1 
HETATM 6922 O  O     B HOH LA 7 .   ? 98.385  16.427  -22.027 0.350 29.623  ? 7245 HOH A O     1 
HETATM 6923 O  O     . HOH LA 7 .   ? 77.907  40.639  -7.878  1.000 44.826  ? 7246 HOH A O     1 
HETATM 6924 O  O     . HOH LA 7 .   ? 83.540  20.697  -17.223 1.000 28.892  ? 7247 HOH A O     1 
HETATM 6925 O  O     . HOH LA 7 .   ? 68.469  29.328  -1.064  1.000 43.154  ? 7248 HOH A O     1 
HETATM 6926 O  O     A HOH LA 7 .   ? 99.880  23.633  -24.918 0.500 37.741  ? 7249 HOH A O     1 
HETATM 6927 O  O     B HOH LA 7 .   ? 101.477 22.743  -24.960 0.500 39.981  ? 7249 HOH A O     1 
HETATM 6928 O  O     . HOH LA 7 .   ? 97.091  32.656  21.096  1.000 35.375  ? 7250 HOH A O     1 
HETATM 6929 O  O     . HOH LA 7 .   ? 81.166  20.718  6.285   1.000 47.401  ? 7251 HOH A O     1 
HETATM 6930 O  O     . HOH LA 7 .   ? 80.281  21.877  2.541   1.000 29.457  ? 7252 HOH A O     1 
HETATM 6931 O  O     . HOH LA 7 .   ? 108.529 14.763  -5.087  0.500 49.781  ? 7253 HOH A O     1 
HETATM 6932 O  O     . HOH LA 7 .   ? 94.448  3.701   -1.680  1.000 55.449  ? 7254 HOH A O     1 
HETATM 6933 O  O     . HOH LA 7 .   ? 84.510  27.016  18.517  1.000 33.373  ? 7255 HOH A O     1 
HETATM 6934 O  O     . HOH LA 7 .   ? 93.104  39.167  2.643   1.000 35.015  ? 7256 HOH A O     1 
HETATM 6935 O  O     . HOH LA 7 .   ? 106.865 22.388  5.082   1.000 28.609  ? 7257 HOH A O     1 
HETATM 6936 O  O     . HOH LA 7 .   ? 83.963  29.635  6.287   1.000 21.951  ? 7258 HOH A O     1 
HETATM 6937 O  O     . HOH LA 7 .   ? 110.292 18.089  -7.198  1.000 45.175  ? 7259 HOH A O     1 
HETATM 6938 O  O     . HOH LA 7 .   ? 75.722  46.503  0.921   1.000 56.222  ? 7260 HOH A O     1 
HETATM 6939 O  O     A HOH LA 7 .   ? 98.214  34.219  1.849   0.500 25.603  ? 7261 HOH A O     1 
HETATM 6940 O  O     B HOH LA 7 .   ? 97.221  34.904  1.201   0.500 27.222  ? 7261 HOH A O     1 
HETATM 6941 O  O     . HOH LA 7 .   ? 81.013  40.892  -17.614 0.500 39.432  ? 7262 HOH A O     1 
HETATM 6942 O  O     . HOH LA 7 .   ? 94.894  24.487  -29.037 1.000 37.924  ? 7263 HOH A O     1 
HETATM 6943 O  O     . HOH LA 7 .   ? 74.164  15.607  -8.438  1.000 27.625  ? 7264 HOH A O     1 
HETATM 6944 O  O     . HOH LA 7 .   ? 87.477  36.214  18.806  1.000 37.765  ? 7265 HOH A O     1 
HETATM 6945 O  O     . HOH LA 7 .   ? 94.557  29.622  -14.263 1.000 30.453  ? 7266 HOH A O     1 
HETATM 6946 O  O     . HOH LA 7 .   ? 84.026  28.987  3.714   1.000 23.201  ? 7267 HOH A O     1 
HETATM 6947 O  O     . HOH LA 7 .   ? 87.471  19.031  6.842   1.000 20.999  ? 7268 HOH A O     1 
HETATM 6948 O  O     . HOH LA 7 .   ? 93.733  36.652  -5.678  1.000 46.390  ? 7269 HOH A O     1 
HETATM 6949 O  O     . HOH LA 7 .   ? 78.078  29.038  9.418   1.000 55.098  ? 7270 HOH A O     1 
HETATM 6950 O  O     . HOH LA 7 .   ? 96.909  28.660  -24.919 1.000 55.962  ? 7271 HOH A O     1 
HETATM 6951 O  O     . HOH LA 7 .   ? 93.722  13.317  16.661  1.000 46.434  ? 7272 HOH A O     1 
HETATM 6952 O  O     . HOH LA 7 .   ? 83.172  39.813  3.484   1.000 29.978  ? 7273 HOH A O     1 
HETATM 6953 O  O     . HOH LA 7 .   ? 87.499  35.172  -14.392 1.000 44.370  ? 7274 HOH A O     1 
HETATM 6954 O  O     . HOH LA 7 .   ? 66.876  35.160  -1.336  0.500 30.942  ? 7275 HOH A O     1 
HETATM 6955 O  O     . HOH LA 7 .   ? 90.996  25.554  18.713  1.000 22.985  ? 7276 HOH A O     1 
HETATM 6956 O  O     . HOH LA 7 .   ? 85.589  10.385  8.233   1.000 55.361  ? 7277 HOH A O     1 
HETATM 6957 O  O     . HOH LA 7 .   ? 76.479  16.712  -9.680  1.000 24.732  ? 7278 HOH A O     1 
HETATM 6958 O  O     . HOH LA 7 .   ? 97.208  8.336   0.299   1.000 36.019  ? 7279 HOH A O     1 
HETATM 6959 O  O     . HOH LA 7 .   ? 97.764  20.666  -22.247 1.000 38.284  ? 7280 HOH A O     1 
HETATM 6960 O  O     . HOH LA 7 .   ? 97.708  24.258  -10.850 1.000 25.639  ? 7281 HOH A O     1 
HETATM 6961 O  O     . HOH LA 7 .   ? 77.202  11.837  2.481   1.000 36.348  ? 7282 HOH A O     1 
HETATM 6962 O  O     . HOH LA 7 .   ? 89.824  32.488  21.695  1.000 38.219  ? 7283 HOH A O     1 
HETATM 6963 O  O     . HOH LA 7 .   ? 103.612 17.661  11.138  1.000 51.212  ? 7284 HOH A O     1 
HETATM 6964 O  O     . HOH LA 7 .   ? 90.182  7.547   5.739   1.000 38.746  ? 7285 HOH A O     1 
HETATM 6965 O  O     . HOH LA 7 .   ? 99.012  13.075  9.801   1.000 50.019  ? 7286 HOH A O     1 
HETATM 6966 O  O     . HOH LA 7 .   ? 89.086  18.735  18.319  1.000 30.126  ? 7287 HOH A O     1 
HETATM 6967 O  O     . HOH LA 7 .   ? 86.357  16.003  10.025  1.000 26.148  ? 7288 HOH A O     1 
HETATM 6968 O  O     . HOH LA 7 .   ? 92.760  30.054  -16.335 1.000 35.043  ? 7289 HOH A O     1 
HETATM 6969 O  O     . HOH LA 7 .   ? 70.741  9.757   -4.457  1.000 40.373  ? 7290 HOH A O     1 
HETATM 6970 O  O     . HOH LA 7 .   ? 77.196  26.599  6.967   1.000 57.992  ? 7291 HOH A O     1 
HETATM 6971 O  O     . HOH LA 7 .   ? 83.428  36.065  10.220  1.000 34.309  ? 7292 HOH A O     1 
HETATM 6972 O  O     . HOH LA 7 .   ? 101.884 29.797  -7.330  1.000 42.483  ? 7293 HOH A O     1 
HETATM 6973 O  O     . HOH LA 7 .   ? 80.309  38.090  -2.014  1.000 23.278  ? 7294 HOH A O     1 
HETATM 6974 O  O     . HOH LA 7 .   ? 76.377  40.462  6.489   1.000 44.590  ? 7295 HOH A O     1 
HETATM 6975 O  O     . HOH LA 7 .   ? 105.100 31.470  -1.464  1.000 35.284  ? 7296 HOH A O     1 
HETATM 6976 O  O     . HOH LA 7 .   ? 102.644 13.907  -6.177  1.000 32.391  ? 7297 HOH A O     1 
HETATM 6977 O  O     . HOH LA 7 .   ? 95.278  21.124  7.908   1.000 27.850  ? 7298 HOH A O     1 
HETATM 6978 O  O     A HOH LA 7 .   ? 84.208  18.340  -15.808 0.500 25.492  ? 7299 HOH A O     1 
HETATM 6979 O  O     . HOH LA 7 .   ? 102.360 26.100  -20.836 1.000 40.587  ? 7300 HOH A O     1 
HETATM 6980 O  O     A HOH LA 7 .   ? 81.966  41.938  9.979   0.600 32.500  ? 7301 HOH A O     1 
HETATM 6981 O  O     B HOH LA 7 .   ? 82.994  43.218  9.158   0.400 34.534  ? 7301 HOH A O     1 
HETATM 6982 O  O     . HOH LA 7 .   ? 73.836  10.315  0.442   0.500 35.909  ? 7302 HOH A O     1 
HETATM 6983 O  O     . HOH LA 7 .   ? 103.273 10.671  -14.184 1.000 44.860  ? 7303 HOH A O     1 
HETATM 6984 O  O     . HOH LA 7 .   ? 95.611  22.834  -11.648 1.000 27.358  ? 7304 HOH A O     1 
HETATM 6985 O  O     . HOH LA 7 .   ? 77.110  41.652  2.724   1.000 48.654  ? 7305 HOH A O     1 
HETATM 6986 O  O     . HOH LA 7 .   ? 84.818  2.057   2.296   1.000 38.171  ? 7306 HOH A O     1 
HETATM 6987 O  O     . HOH LA 7 .   ? 74.919  36.937  -13.177 1.000 53.315  ? 7307 HOH A O     1 
HETATM 6988 O  O     . HOH LA 7 .   ? 88.643  29.226  -22.047 0.500 34.544  ? 7308 HOH A O     1 
HETATM 6989 O  O     . HOH LA 7 .   ? 99.471  25.837  20.415  1.000 47.304  ? 7309 HOH A O     1 
HETATM 6990 O  O     . HOH LA 7 .   ? 104.308 14.581  -9.083  1.000 36.688  ? 7310 HOH A O     1 
HETATM 6991 O  O     . HOH LA 7 .   ? 94.811  4.091   1.985   1.000 44.797  ? 7311 HOH A O     1 
HETATM 6992 O  O     . HOH LA 7 .   ? 85.943  37.066  14.109  1.000 29.363  ? 7312 HOH A O     1 
HETATM 6993 O  O     . HOH LA 7 .   ? 81.036  38.073  -9.134  1.000 38.940  ? 7313 HOH A O     1 
HETATM 6994 O  O     . HOH LA 7 .   ? 84.250  25.323  15.347  1.000 37.752  ? 7314 HOH A O     1 
HETATM 6995 O  O     . HOH LA 7 .   ? 86.866  35.702  10.759  1.000 25.170  ? 7315 HOH A O     1 
HETATM 6996 O  O     . HOH LA 7 .   ? 90.745  20.537  -19.818 1.000 45.188  ? 7316 HOH A O     1 
HETATM 6997 O  O     B HOH LA 7 .   ? 97.046  21.043  18.649  0.500 32.590  ? 7317 HOH A O     1 
HETATM 6998 O  O     . HOH LA 7 .   ? 90.251  4.216   6.800   1.000 51.910  ? 7318 HOH A O     1 
HETATM 6999 O  O     . HOH LA 7 .   ? 112.765 24.199  3.222   0.500 45.460  ? 7319 HOH A O     1 
HETATM 7000 O  O     . HOH LA 7 .   ? 91.393  37.956  0.026   1.000 33.763  ? 7320 HOH A O     1 
HETATM 7001 O  O     . HOH LA 7 .   ? 76.728  27.698  -9.815  1.000 22.494  ? 7321 HOH A O     1 
HETATM 7002 O  O     . HOH LA 7 .   ? 74.058  22.706  0.324   1.000 29.426  ? 7322 HOH A O     1 
HETATM 7003 O  O     . HOH LA 7 .   ? 106.964 12.638  -15.328 0.500 34.434  ? 7323 HOH A O     1 
HETATM 7004 O  O     . HOH LA 7 .   ? 78.177  24.624  5.100   1.000 31.845  ? 7324 HOH A O     1 
HETATM 7005 O  O     . HOH LA 7 .   ? 88.470  18.160  3.492   1.000 20.628  ? 7325 HOH A O     1 
HETATM 7006 O  O     . HOH LA 7 .   ? 102.836 10.309  -21.406 1.000 57.554  ? 7326 HOH A O     1 
HETATM 7007 O  O     . HOH LA 7 .   ? 74.832  42.937  3.781   0.500 44.290  ? 7327 HOH A O     1 
HETATM 7008 O  O     . HOH LA 7 .   ? 85.634  26.592  -18.278 1.000 37.084  ? 7328 HOH A O     1 
HETATM 7009 O  O     . HOH LA 7 .   ? 92.845  22.194  22.169  1.000 28.166  ? 7329 HOH A O     1 
HETATM 7010 O  O     . HOH LA 7 .   ? 78.302  39.413  8.841   1.000 50.053  ? 7330 HOH A O     1 
HETATM 7011 O  O     . HOH LA 7 .   ? 81.560  11.065  -19.051 1.000 46.037  ? 7331 HOH A O     1 
HETATM 7012 O  O     . HOH LA 7 .   ? 83.912  39.708  -7.112  0.500 32.529  ? 7332 HOH A O     1 
HETATM 7013 O  O     . HOH LA 7 .   ? 93.697  13.116  -18.991 1.000 47.768  ? 7333 HOH A O     1 
HETATM 7014 O  O     . HOH LA 7 .   ? 68.059  32.530  -7.845  1.000 33.417  ? 7334 HOH A O     1 
HETATM 7015 O  O     A HOH LA 7 .   ? 87.620  22.040  -23.012 0.500 33.338  ? 7335 HOH A O     1 
HETATM 7016 O  O     . HOH LA 7 .   ? 82.527  5.608   -14.895 1.000 51.136  ? 7336 HOH A O     1 
HETATM 7017 O  O     . HOH LA 7 .   ? 103.232 31.137  0.866   1.000 41.309  ? 7337 HOH A O     1 
HETATM 7018 O  O     . HOH LA 7 .   ? 91.078  -0.204  -17.414 0.500 38.442  ? 7338 HOH A O     1 
HETATM 7019 O  O     . HOH LA 7 .   ? 100.770 26.830  18.605  1.000 50.953  ? 7339 HOH A O     1 
HETATM 7020 O  O     . HOH LA 7 .   ? 103.926 20.052  11.462  1.000 40.150  ? 7340 HOH A O     1 
HETATM 7021 O  O     . HOH LA 7 .   ? 103.616 16.647  5.623   1.000 48.632  ? 7341 HOH A O     1 
HETATM 7022 O  O     . HOH LA 7 .   ? 85.691  11.281  -0.606  1.000 27.850  ? 7342 HOH A O     1 
HETATM 7023 O  O     . HOH LA 7 .   ? 79.042  12.841  -16.450 0.500 31.238  ? 7343 HOH A O     1 
HETATM 7024 O  O     . HOH LA 7 .   ? 82.433  2.815   -6.224  1.000 35.691  ? 7344 HOH A O     1 
HETATM 7025 O  O     . HOH LA 7 .   ? 92.265  32.357  -14.592 0.500 30.448  ? 7345 HOH A O     1 
HETATM 7026 O  O     . HOH LA 7 .   ? 85.871  34.809  -11.262 1.000 43.089  ? 7346 HOH A O     1 
HETATM 7027 O  O     . HOH LA 7 .   ? 84.550  24.968  -21.768 1.000 36.022  ? 7347 HOH A O     1 
HETATM 7028 O  O     . HOH LA 7 .   ? 73.016  37.825  8.967   0.500 37.543  ? 7348 HOH A O     1 
HETATM 7029 O  O     . HOH LA 7 .   ? 76.375  9.186   -10.054 1.000 52.020  ? 7349 HOH A O     1 
HETATM 7030 O  O     . HOH LA 7 .   ? 86.894  36.527  -8.392  1.000 49.662  ? 7350 HOH A O     1 
HETATM 7031 O  O     . HOH LA 7 .   ? 65.170  30.057  -1.550  1.000 52.911  ? 7351 HOH A O     1 
HETATM 7032 O  O     . HOH LA 7 .   ? 75.305  16.411  4.024   1.000 50.550  ? 7352 HOH A O     1 
HETATM 7033 O  O     . HOH LA 7 .   ? 81.009  6.050   -12.104 1.000 47.656  ? 7353 HOH A O     1 
HETATM 7034 O  O     . HOH LA 7 .   ? 103.192 30.155  -20.976 0.500 52.407  ? 7354 HOH A O     1 
HETATM 7035 O  O     . HOH LA 7 .   ? 68.879  23.853  -5.689  1.000 31.013  ? 7355 HOH A O     1 
HETATM 7036 O  O     . HOH LA 7 .   ? 69.282  32.661  2.513   0.500 39.119  ? 7356 HOH A O     1 
HETATM 7037 O  O     . HOH LA 7 .   ? 102.804 35.782  -1.774  1.000 47.465  ? 7357 HOH A O     1 
HETATM 7038 O  O     . HOH LA 7 .   ? 82.137  19.025  -19.134 1.000 36.682  ? 7358 HOH A O     1 
HETATM 7039 O  O     . HOH LA 7 .   ? 82.726  30.681  16.596  1.000 35.791  ? 7359 HOH A O     1 
HETATM 7040 O  O     . HOH LA 7 .   ? 78.599  14.912  -19.955 1.000 60.494  ? 7360 HOH A O     1 
HETATM 7041 O  O     . HOH LA 7 .   ? 86.019  0.662   -8.460  1.000 41.607  ? 7361 HOH A O     1 
HETATM 7042 O  O     . HOH LA 7 .   ? 99.705  5.796   -15.285 0.500 35.298  ? 7362 HOH A O     1 
HETATM 7043 O  O     . HOH LA 7 .   ? 91.938  39.882  6.981   1.000 33.524  ? 7363 HOH A O     1 
HETATM 7044 O  O     . HOH LA 7 .   ? 99.359  39.092  1.927   1.000 34.551  ? 7364 HOH A O     1 
HETATM 7045 O  O     . HOH LA 7 .   ? 105.625 27.373  10.723  1.000 42.678  ? 7365 HOH A O     1 
HETATM 7046 O  O     . HOH LA 7 .   ? 78.616  29.467  -16.160 1.000 32.043  ? 7366 HOH A O     1 
HETATM 7047 O  O     . HOH LA 7 .   ? 102.896 13.588  -20.685 0.500 30.821  ? 7367 HOH A O     1 
HETATM 7048 O  O     . HOH LA 7 .   ? 76.094  4.258   0.789   1.000 51.510  ? 7368 HOH A O     1 
HETATM 7049 O  O     . HOH LA 7 .   ? 65.792  25.197  -6.376  1.000 51.141  ? 7369 HOH A O     1 
HETATM 7050 O  O     . HOH LA 7 .   ? 78.259  45.782  2.463   1.000 66.510  ? 7370 HOH A O     1 
HETATM 7051 O  O     . HOH LA 7 .   ? 81.168  -8.670  1.016   1.000 48.871  ? 7371 HOH A O     1 
HETATM 7052 O  O     . HOH LA 7 .   ? 77.937  29.625  12.545  1.000 54.308  ? 7372 HOH A O     1 
HETATM 7053 O  O     . HOH LA 7 .   ? 83.552  36.903  12.634  1.000 39.540  ? 7373 HOH A O     1 
HETATM 7054 O  O     . HOH LA 7 .   ? 79.116  5.243   -8.634  1.000 53.199  ? 7374 HOH A O     1 
HETATM 7055 O  O     . HOH LA 7 .   ? 83.999  24.259  19.216  1.000 41.192  ? 7375 HOH A O     1 
HETATM 7056 O  O     A HOH LA 7 .   ? 101.144 19.645  -23.652 0.600 35.349  ? 7376 HOH A O     1 
HETATM 7057 O  O     B HOH LA 7 .   ? 99.632  21.325  -24.573 0.400 31.084  ? 7376 HOH A O     1 
HETATM 7058 O  O     . HOH LA 7 .   ? 93.165  7.204   5.977   1.000 46.779  ? 7377 HOH A O     1 
HETATM 7059 O  O     . HOH LA 7 .   ? 82.069  34.899  -11.487 1.000 47.945  ? 7378 HOH A O     1 
HETATM 7060 O  O     A HOH LA 7 .   ? 84.438  41.343  5.268   0.600 24.724  ? 7379 HOH A O     1 
HETATM 7061 O  O     B HOH LA 7 .   ? 84.047  8.064   -17.483 0.500 30.973  ? 7380 HOH A O     1 
HETATM 7062 O  O     . HOH LA 7 .   ? 81.689  25.164  -23.316 1.000 57.589  ? 7381 HOH A O     1 
HETATM 7063 O  O     . HOH LA 7 .   ? 76.602  10.911  -0.205  1.000 30.554  ? 7382 HOH A O     1 
HETATM 7064 O  O     B HOH LA 7 .   ? 95.584  32.122  -14.366 0.500 35.705  ? 7383 HOH A O     1 
HETATM 7065 O  O     . HOH LA 7 .   ? 62.746  28.500  -4.160  0.500 41.256  ? 7384 HOH A O     1 
HETATM 7066 O  O     . HOH LA 7 .   ? 77.578  20.763  3.971   1.000 55.508  ? 7385 HOH A O     1 
HETATM 7067 O  O     . HOH LA 7 .   ? 108.258 19.851  4.867   1.000 51.796  ? 7386 HOH A O     1 
HETATM 7068 O  O     . HOH LA 7 .   ? 76.498  23.214  3.854   1.000 48.768  ? 7387 HOH A O     1 
HETATM 7069 O  O     . HOH LA 7 .   ? 89.883  31.936  -15.062 1.000 39.312  ? 7388 HOH A O     1 
HETATM 7070 O  O     . HOH LA 7 .   ? 95.410  37.881  1.426   1.000 51.629  ? 7389 HOH A O     1 
HETATM 7071 O  O     . HOH LA 7 .   ? 89.610  39.276  7.653   1.000 53.297  ? 7390 HOH A O     1 
HETATM 7072 O  O     . HOH LA 7 .   ? 98.710  32.038  -7.501  1.000 46.865  ? 7391 HOH A O     1 
HETATM 7073 O  O     . HOH LA 7 .   ? 83.047  25.648  -19.138 1.000 52.103  ? 7392 HOH A O     1 
HETATM 7074 O  O     . HOH LA 7 .   ? 85.825  -1.521  1.875   1.000 65.843  ? 7393 HOH A O     1 
HETATM 7075 O  O     . HOH LA 7 .   ? 83.805  44.193  4.896   1.000 52.588  ? 7394 HOH A O     1 
HETATM 7076 O  O     . HOH LA 7 .   ? 74.520  38.812  1.742   1.000 37.958  ? 7395 HOH A O     1 
HETATM 7077 O  O     . HOH LA 7 .   ? 91.044  36.431  -12.659 1.000 70.334  ? 7396 HOH A O     1 
HETATM 7078 O  O     A HOH LA 7 .   ? 88.000  9.719   8.180   0.500 32.044  ? 7397 HOH A O     1 
HETATM 7079 O  O     B HOH LA 7 .   ? 88.399  10.834  9.187   0.500 34.714  ? 7397 HOH A O     1 
HETATM 7080 O  O     . HOH LA 7 .   ? 91.890  1.175   3.010   1.000 61.672  ? 7398 HOH A O     1 
HETATM 7081 O  O     A HOH LA 7 .   ? 91.364  40.177  0.789   0.600 32.130  ? 7399 HOH A O     1 
HETATM 7082 O  O     B HOH LA 7 .   ? 90.087  41.047  1.475   0.400 25.355  ? 7399 HOH A O     1 
HETATM 7083 O  O     . HOH LA 7 .   ? 106.760 28.575  8.716   1.000 47.473  ? 7400 HOH A O     1 
HETATM 7084 O  O     . HOH LA 7 .   ? 84.252  28.570  15.424  1.000 42.854  ? 7401 HOH A O     1 
HETATM 7085 O  O     . HOH LA 7 .   ? 79.500  42.046  9.717   0.500 33.640  ? 7402 HOH A O     1 
HETATM 7086 O  O     . HOH LA 7 .   ? 113.744 25.892  -0.155  0.500 46.882  ? 7403 HOH A O     1 
HETATM 7087 O  O     . HOH LA 7 .   ? 101.873 14.887  -22.335 0.500 46.355  ? 7404 HOH A O     1 
HETATM 7088 O  O     . HOH LA 7 .   ? 98.046  35.389  -9.580  1.000 52.846  ? 7405 HOH A O     1 
HETATM 7089 O  O     . HOH LA 7 .   ? 90.375  37.866  -2.130  1.000 48.541  ? 7406 HOH A O     1 
HETATM 7090 O  O     B HOH LA 7 .   ? 108.648 26.773  11.141  0.500 46.705  ? 7407 HOH A O     1 
HETATM 7091 O  O     . HOH LA 7 .   ? 103.805 31.667  -7.014  1.000 49.439  ? 7408 HOH A O     1 
HETATM 7092 O  O     . HOH LA 7 .   ? 81.034  40.580  -7.729  1.000 51.092  ? 7409 HOH A O     1 
HETATM 7093 O  O     . HOH LA 7 .   ? 98.715  4.045   -21.118 0.500 45.995  ? 7410 HOH A O     1 
HETATM 7094 O  O     A HOH LA 7 .   ? 109.390 24.924  11.115  0.500 39.571  ? 7411 HOH A O     1 
HETATM 7095 O  O     B HOH LA 7 .   ? 108.944 23.232  11.281  0.500 40.607  ? 7411 HOH A O     1 
HETATM 7096 O  O     . HOH LA 7 .   ? 88.891  1.803   4.684   1.000 64.592  ? 7412 HOH A O     1 
HETATM 7097 O  O     . HOH LA 7 .   ? 89.690  20.597  -22.311 1.000 53.388  ? 7413 HOH A O     1 
HETATM 7098 O  O     . HOH LA 7 .   ? 87.095  16.999  17.660  1.000 49.068  ? 7414 HOH A O     1 
HETATM 7099 O  O     . HOH LA 7 .   ? 85.873  13.848  -22.437 0.500 47.342  ? 7415 HOH A O     1 
HETATM 7100 O  O     . HOH LA 7 .   ? 67.782  25.161  -1.818  1.000 61.278  ? 7416 HOH A O     1 
HETATM 7101 O  O     . HOH LA 7 .   ? 98.546  37.189  -0.626  0.500 40.721  ? 7417 HOH A O     1 
HETATM 7102 O  O     . HOH LA 7 .   ? 89.048  35.125  20.876  1.000 49.447  ? 7418 HOH A O     1 
HETATM 7103 O  O     . HOH LA 7 .   ? 109.158 12.236  -4.468  0.500 50.699  ? 7419 HOH A O     1 
HETATM 7104 O  O     . HOH LA 7 .   ? 73.024  30.962  4.348   1.000 50.562  ? 7420 HOH A O     1 
HETATM 7105 O  O     . HOH LA 7 .   ? 108.769 30.261  10.023  1.000 69.830  ? 7421 HOH A O     1 
HETATM 7106 O  O     . HOH LA 7 .   ? 79.639  32.726  -18.993 1.000 52.589  ? 7422 HOH A O     1 
HETATM 7107 O  O     . HOH LA 7 .   ? 79.820  -17.898 8.540   1.000 58.947  ? 7423 HOH A O     1 
HETATM 7108 O  O     . HOH LA 7 .   ? 89.581  13.439  10.182  1.000 39.769  ? 7424 HOH A O     1 
HETATM 7109 O  O     . HOH LA 7 .   ? 95.102  6.216   4.411   1.000 52.654  ? 7425 HOH A O     1 
HETATM 7110 O  O     . HOH LA 7 .   ? 101.731 36.389  -3.857  1.000 57.301  ? 7426 HOH A O     1 
HETATM 7111 O  O     . HOH LA 7 .   ? 79.090  27.198  11.639  1.000 61.724  ? 7427 HOH A O     1 
HETATM 7112 O  O     . HOH LA 7 .   ? 96.686  5.197   0.266   1.000 51.082  ? 7428 HOH A O     1 
HETATM 7113 O  O     . HOH LA 7 .   ? 80.965  29.559  18.339  0.500 52.741  ? 7429 HOH A O     1 
HETATM 7114 O  O     . HOH LA 7 .   ? 84.075  37.272  -8.257  1.000 46.243  ? 7430 HOH A O     1 
HETATM 7115 O  O     . HOH LA 7 .   ? 76.831  18.384  3.574   0.500 38.959  ? 7431 HOH A O     1 
HETATM 7116 O  O     . HOH LA 7 .   ? 104.990 33.575  -2.858  1.000 49.583  ? 7432 HOH A O     1 
HETATM 7117 O  O     . HOH LA 7 .   ? 79.315  16.701  6.445   0.500 30.693  ? 7433 HOH A O     1 
HETATM 7118 O  O     . HOH LA 7 .   ? 75.860  41.822  -13.977 0.500 36.882  ? 7434 HOH A O     1 
HETATM 7119 O  O     . HOH LA 7 .   ? 102.155 18.531  18.842  1.000 57.702  ? 7435 HOH A O     1 
HETATM 7120 O  O     . HOH LA 7 .   ? 94.208  32.409  -17.458 1.000 52.294  ? 7436 HOH A O     1 
HETATM 7121 O  O     . HOH LA 7 .   ? 93.064  26.616  -29.699 1.000 41.425  ? 7437 HOH A O     1 
HETATM 7122 O  O     . HOH LA 7 .   ? 101.025 28.294  -20.434 0.500 35.023  ? 7438 HOH A O     1 
HETATM 7123 O  O     . HOH LA 7 .   ? 92.631  37.997  -11.331 1.000 58.233  ? 7439 HOH A O     1 
HETATM 7124 O  O     . HOH LA 7 .   ? 109.237 15.219  -7.825  1.000 58.085  ? 7440 HOH A O     1 
HETATM 7125 O  O     . HOH LA 7 .   ? 81.989  27.277  17.444  1.000 48.543  ? 7441 HOH A O     1 
HETATM 7126 O  O     . HOH LA 7 .   ? 89.103  37.949  -4.297  1.000 55.614  ? 7442 HOH A O     1 
HETATM 7127 O  O     . HOH LA 7 .   ? 106.244 14.531  -7.174  1.000 56.459  ? 7443 HOH A O     1 
HETATM 7128 O  O     . HOH LA 7 .   ? 105.521 11.811  -13.198 0.500 39.381  ? 7444 HOH A O     1 
HETATM 7129 O  O     . HOH LA 7 .   ? 103.206 26.282  -23.396 0.500 36.561  ? 7445 HOH A O     1 
HETATM 7130 O  O     . HOH LA 7 .   ? 82.588  24.277  17.115  0.500 31.236  ? 7446 HOH A O     1 
HETATM 7131 O  O     A HOH LA 7 .   ? 82.568  23.854  21.782  0.500 37.236  ? 7447 HOH A O     1 
HETATM 7132 O  O     B HOH LA 7 .   ? 82.549  25.359  21.337  0.500 41.126  ? 7447 HOH A O     1 
HETATM 7133 O  O     . HOH LA 7 .   ? 64.247  25.122  -3.773  1.000 52.088  ? 7448 HOH A O     1 
HETATM 7134 O  O     . HOH LA 7 .   ? 102.998 24.821  18.853  0.500 36.162  ? 7449 HOH A O     1 
HETATM 7135 O  O     . HOH LA 7 .   ? 96.740  35.967  -4.835  1.000 47.096  ? 7450 HOH A O     1 
HETATM 7136 O  O     . HOH LA 7 .   ? 103.791 33.592  -5.205  1.000 46.333  ? 7451 HOH A O     1 
HETATM 7137 O  O     . HOH LA 7 .   ? 89.557  36.145  23.822  1.000 67.017  ? 7452 HOH A O     1 
HETATM 7138 O  O     . HOH LA 7 .   ? 86.381  1.051   4.157   1.000 47.037  ? 7453 HOH A O     1 
HETATM 7139 O  O     . HOH LA 7 .   ? 88.410  36.405  -12.238 1.000 55.937  ? 7454 HOH A O     1 
HETATM 7140 O  O     . HOH LA 7 .   ? 80.547  25.117  18.764  0.500 45.956  ? 7455 HOH A O     1 
HETATM 7141 O  O     . HOH LA 7 .   ? 99.125  4.466   1.050   0.500 42.245  ? 7456 HOH A O     1 
HETATM 7142 O  O     . HOH LA 7 .   ? 88.242  38.239  -6.664  0.500 34.630  ? 7457 HOH A O     1 
HETATM 7143 O  O     . HOH LA 7 .   ? 103.379 20.918  18.644  0.500 39.985  ? 7458 HOH A O     1 
HETATM 7144 O  O     . HOH MA 7 .   ? 65.151  4.222   -5.342  0.500 38.841  ? 4501 HOH B O     1 
HETATM 7145 O  O     . HOH MA 7 .   ? 62.797  14.342  -22.176 1.000 46.430  ? 4502 HOH B O     1 
HETATM 7146 O  O     . HOH MA 7 .   ? 58.611  28.646  -39.854 1.000 61.001  ? 4503 HOH B O     1 
HETATM 7147 O  O     . HOH MA 7 .   ? 80.830  22.750  -18.886 1.000 41.318  ? 4504 HOH B O     1 
HETATM 7148 O  O     . HOH MA 7 .   ? 71.728  6.544   -10.059 1.000 43.911  ? 4505 HOH B O     1 
HETATM 7149 O  O     . HOH MA 7 .   ? 61.707  8.441   -19.827 0.500 36.489  ? 4506 HOH B O     1 
HETATM 7150 O  O     . HOH MA 7 .   ? 73.369  26.311  -26.304 1.000 43.522  ? 4507 HOH B O     1 
HETATM 7151 O  O     . HOH MA 7 .   ? 51.592  3.752   -12.229 0.500 39.446  ? 4508 HOH B O     1 
HETATM 7152 O  O     . HOH MA 7 .   ? 74.433  13.020  -20.558 0.500 34.914  ? 4509 HOH B O     1 
HETATM 7153 O  O     . HOH MA 7 .   ? 75.337  34.887  -22.390 0.500 44.873  ? 4510 HOH B O     1 
HETATM 7154 O  O     . HOH MA 7 .   ? 72.102  15.129  -23.835 1.000 47.257  ? 4511 HOH B O     1 
HETATM 7155 O  O     . HOH MA 7 .   ? 65.591  32.344  -9.115  1.000 42.505  ? 4512 HOH B O     1 
HETATM 7156 O  O     . HOH MA 7 .   ? 76.728  25.826  -23.934 0.500 38.349  ? 4513 HOH B O     1 
HETATM 7157 O  O     . HOH MA 7 .   ? 61.348  2.300   -16.021 0.500 37.335  ? 4514 HOH B O     1 
HETATM 7158 O  O     . HOH MA 7 .   ? 54.372  19.471  -22.288 0.500 43.571  ? 4515 HOH B O     1 
HETATM 7159 O  O     . HOH MA 7 .   ? 70.088  45.000  -43.044 0.500 42.547  ? 4516 HOH B O     1 
HETATM 7160 O  O     . HOH MA 7 .   ? 79.438  9.816   -12.089 1.000 31.521  ? 4517 HOH B O     1 
HETATM 7161 O  O     . HOH MA 7 .   ? 62.019  46.186  -47.582 1.000 23.772  ? 4518 HOH B O     1 
HETATM 7162 O  O     . HOH MA 7 .   ? 75.399  31.525  -24.009 1.000 48.911  ? 4519 HOH B O     1 
HETATM 7163 O  O     . HOH MA 7 .   ? 69.312  46.220  -45.517 1.000 40.229  ? 4520 HOH B O     1 
HETATM 7164 O  O     . HOH MA 7 .   ? 63.337  22.754  -7.746  1.000 46.739  ? 4521 HOH B O     1 
HETATM 7165 O  O     . HOH MA 7 .   ? 61.554  17.259  -9.564  1.000 33.625  ? 4522 HOH B O     1 
HETATM 7166 O  O     . HOH MA 7 .   ? 55.732  17.722  -13.580 1.000 49.344  ? 4523 HOH B O     1 
HETATM 7167 O  O     . HOH MA 7 .   ? 52.659  5.893   -8.622  0.500 40.558  ? 4524 HOH B O     1 
HETATM 7168 O  O     . HOH MA 7 .   ? 58.005  19.070  -24.828 1.000 46.165  ? 4525 HOH B O     1 
HETATM 7169 O  O     . HOH MA 7 .   ? 65.414  1.776   -7.170  1.000 48.912  ? 4526 HOH B O     1 
HETATM 7170 O  O     . HOH MA 7 .   ? 69.179  34.879  -23.295 1.000 40.645  ? 4527 HOH B O     1 
HETATM 7171 O  O     . HOH MA 7 .   ? 71.337  25.000  -5.700  1.000 25.378  ? 4528 HOH B O     1 
HETATM 7172 O  O     . HOH MA 7 .   ? 58.095  26.898  -10.507 0.750 45.963  ? 4529 HOH B O     1 
HETATM 7173 O  O     . HOH MA 7 .   ? 69.314  20.857  -26.071 1.000 35.241  ? 4530 HOH B O     1 
HETATM 7174 O  O     . HOH MA 7 .   ? 59.528  12.896  -23.685 1.000 63.789  ? 4531 HOH B O     1 
HETATM 7175 O  O     . HOH MA 7 .   ? 79.329  19.234  -19.409 1.000 32.481  ? 4532 HOH B O     1 
HETATM 7176 O  O     . HOH MA 7 .   ? 64.061  14.785  -25.620 1.000 45.701  ? 4533 HOH B O     1 
HETATM 7177 O  O     . HOH MA 7 .   ? 70.456  4.659   -12.201 0.500 39.536  ? 4534 HOH B O     1 
HETATM 7178 O  O     . HOH MA 7 .   ? 69.502  28.835  -12.751 1.000 28.340  ? 4535 HOH B O     1 
HETATM 7179 O  O     . HOH MA 7 .   ? 66.634  31.660  -25.523 1.000 48.351  ? 4536 HOH B O     1 
HETATM 7180 O  O     . HOH MA 7 .   ? 54.665  18.539  -10.491 1.000 47.324  ? 4537 HOH B O     1 
HETATM 7181 O  O     . HOH MA 7 .   ? 62.139  36.216  -40.730 0.500 34.112  ? 4538 HOH B O     1 
HETATM 7182 O  O     . HOH MA 7 .   ? 63.415  26.993  -32.438 1.000 44.959  ? 4539 HOH B O     1 
HETATM 7183 O  O     . HOH MA 7 .   ? 68.399  10.440  -5.406  1.000 40.940  ? 4540 HOH B O     1 
HETATM 7184 O  O     . HOH MA 7 .   ? 72.475  31.507  -18.082 1.000 35.314  ? 4541 HOH B O     1 
HETATM 7185 O  O     . HOH MA 7 .   ? 77.438  28.743  -18.566 1.000 37.950  ? 4542 HOH B O     1 
HETATM 7186 O  O     A HOH MA 7 .   ? 63.018  35.769  -22.414 0.500 38.117  ? 4543 HOH B O     1 
HETATM 7187 O  O     . HOH MA 7 .   ? 54.145  25.086  -11.374 0.500 42.653  ? 4544 HOH B O     1 
HETATM 7188 O  O     . HOH MA 7 .   ? 75.923  32.025  -16.954 1.000 35.883  ? 4545 HOH B O     1 
HETATM 7189 O  O     . HOH MA 7 .   ? 63.788  12.529  -15.707 1.000 40.649  ? 4546 HOH B O     1 
HETATM 7190 O  O     . HOH MA 7 .   ? 64.178  25.195  -24.704 1.000 39.157  ? 4547 HOH B O     1 
HETATM 7191 O  O     . HOH MA 7 .   ? 67.653  11.997  -3.149  1.000 45.990  ? 4548 HOH B O     1 
HETATM 7192 O  O     . HOH MA 7 .   ? 68.771  18.899  -30.787 0.500 42.712  ? 4549 HOH B O     1 
HETATM 7193 O  O     . HOH MA 7 .   ? 58.857  30.228  -17.338 1.000 50.677  ? 4550 HOH B O     1 
HETATM 7194 O  O     . HOH MA 7 .   ? 70.859  31.256  -11.220 1.000 30.868  ? 4551 HOH B O     1 
HETATM 7195 O  O     . HOH MA 7 .   ? 61.860  27.129  -21.821 1.000 45.146  ? 4552 HOH B O     1 
HETATM 7196 O  O     . HOH MA 7 .   ? 66.350  -0.807  -13.051 0.500 30.710  ? 4553 HOH B O     1 
HETATM 7197 O  O     . HOH MA 7 .   ? 71.115  2.721   -16.647 1.000 57.927  ? 4554 HOH B O     1 
HETATM 7198 O  O     . HOH MA 7 .   ? 60.241  4.540   -16.979 1.000 52.214  ? 4555 HOH B O     1 
HETATM 7199 O  O     . HOH MA 7 .   ? 62.589  16.285  -32.459 1.000 58.205  ? 4556 HOH B O     1 
HETATM 7200 O  O     . HOH MA 7 .   ? 56.762  15.155  -24.715 0.500 46.553  ? 4557 HOH B O     1 
HETATM 7201 O  O     . HOH MA 7 .   ? 74.672  31.130  -19.483 1.000 39.878  ? 4558 HOH B O     1 
HETATM 7202 O  O     . HOH MA 7 .   ? 55.471  20.244  -18.631 1.000 50.831  ? 4559 HOH B O     1 
HETATM 7203 O  O     . HOH MA 7 .   ? 64.213  20.208  -6.673  1.000 39.921  ? 4560 HOH B O     1 
HETATM 7204 O  O     . HOH MA 7 .   ? 60.564  27.922  -49.285 0.500 43.001  ? 4561 HOH B O     1 
HETATM 7205 O  O     . HOH MA 7 .   ? 62.900  13.914  -3.197  1.000 48.304  ? 4562 HOH B O     1 
HETATM 7206 O  O     . HOH MA 7 .   ? 68.774  30.988  -9.897  1.000 44.977  ? 4563 HOH B O     1 
HETATM 7207 O  O     . HOH MA 7 .   ? 57.396  20.485  -13.918 1.000 45.850  ? 4564 HOH B O     1 
HETATM 7208 O  O     A HOH MA 7 .   ? 76.737  18.569  -15.118 0.500 22.418  ? 4565 HOH B O     1 
HETATM 7209 O  O     . HOH MA 7 .   ? 71.631  21.458  -27.025 1.000 51.750  ? 4566 HOH B O     1 
HETATM 7210 O  O     . HOH MA 7 .   ? 67.261  35.987  -21.882 1.000 52.983  ? 4567 HOH B O     1 
HETATM 7211 O  O     A HOH MA 7 .   ? 65.365  36.940  -42.616 0.500 32.445  ? 4568 HOH B O     1 
HETATM 7212 O  O     B HOH MA 7 .   ? 67.276  37.802  -42.526 0.500 27.436  ? 4568 HOH B O     1 
HETATM 7213 O  O     . HOH MA 7 .   ? 58.821  -11.505 -17.260 1.000 50.620  ? 4569 HOH B O     1 
HETATM 7214 O  O     . HOH MA 7 .   ? 64.023  26.995  -7.683  1.000 49.691  ? 4570 HOH B O     1 
HETATM 7215 O  O     . HOH MA 7 .   ? 75.720  22.774  -25.170 1.000 41.744  ? 4571 HOH B O     1 
HETATM 7216 O  O     . HOH MA 7 .   ? 62.005  30.709  -22.955 0.500 35.721  ? 4572 HOH B O     1 
HETATM 7217 O  O     . HOH MA 7 .   ? 59.483  12.788  -3.751  0.500 37.797  ? 4573 HOH B O     1 
HETATM 7218 O  O     . HOH MA 7 .   ? 73.504  33.386  -25.496 0.500 35.228  ? 4574 HOH B O     1 
HETATM 7219 O  O     . HOH MA 7 .   ? 56.339  21.651  -5.892  0.500 39.311  ? 4575 HOH B O     1 
HETATM 7220 O  O     . HOH MA 7 .   ? 67.180  10.755  -18.609 1.000 57.525  ? 4576 HOH B O     1 
HETATM 7221 O  O     . HOH MA 7 .   ? 55.206  -4.720  -17.424 1.000 61.975  ? 4577 HOH B O     1 
HETATM 7222 O  O     . HOH MA 7 .   ? 54.572  12.697  -21.420 1.000 61.632  ? 4578 HOH B O     1 
HETATM 7223 O  O     . HOH MA 7 .   ? 60.718  29.144  -20.719 1.000 56.402  ? 4579 HOH B O     1 
HETATM 7224 O  O     . HOH MA 7 .   ? 70.823  36.946  -24.323 1.000 54.679  ? 4580 HOH B O     1 
HETATM 7225 O  O     . HOH MA 7 .   ? 64.450  11.555  -22.146 0.500 36.223  ? 4581 HOH B O     1 
HETATM 7226 O  O     . HOH MA 7 .   ? 52.022  30.469  -35.941 1.000 61.099  ? 4582 HOH B O     1 
HETATM 7227 O  O     . HOH MA 7 .   ? 62.312  12.577  -23.921 1.000 61.540  ? 4583 HOH B O     1 
HETATM 7228 O  O     . HOH MA 7 .   ? 55.540  26.002  -8.067  0.500 44.332  ? 4584 HOH B O     1 
HETATM 7229 O  O     . HOH MA 7 .   ? 59.639  26.939  -8.010  0.500 37.704  ? 4585 HOH B O     1 
HETATM 7230 O  O     . HOH MA 7 .   ? 81.444  28.050  -19.952 1.000 49.947  ? 4586 HOH B O     1 
HETATM 7231 O  O     . HOH MA 7 .   ? 62.207  32.359  -46.707 1.000 59.164  ? 4587 HOH B O     1 
HETATM 7232 O  O     . HOH MA 7 .   ? 64.333  11.986  -18.174 1.000 48.142  ? 4588 HOH B O     1 
HETATM 7233 O  O     A HOH MA 7 .   ? 54.989  28.656  -10.432 0.500 43.915  ? 4589 HOH B O     1 
HETATM 7234 O  O     B HOH MA 7 .   ? 53.816  28.047  -8.919  0.500 43.357  ? 4589 HOH B O     1 
HETATM 7235 O  O     . HOH MA 7 .   ? 75.733  32.660  -21.542 0.500 38.162  ? 4590 HOH B O     1 
HETATM 7236 O  O     . HOH MA 7 .   ? 71.569  33.673  -27.127 0.500 43.022  ? 4591 HOH B O     1 
HETATM 7237 O  O     . HOH MA 7 .   ? 79.739  17.471  -21.447 1.000 48.693  ? 4592 HOH B O     1 
HETATM 7238 O  O     A HOH MA 7 .   ? 77.581  37.012  -19.650 0.600 43.416  ? 4593 HOH B O     1 
HETATM 7239 O  O     B HOH MA 7 .   ? 75.891  37.924  -19.408 0.400 28.945  ? 4593 HOH B O     1 
HETATM 7240 O  O     . HOH MA 7 .   ? 79.371  29.626  -20.286 0.500 38.860  ? 4594 HOH B O     1 
HETATM 7241 O  O     . HOH MA 7 .   ? 69.686  18.273  -26.680 1.000 47.867  ? 4595 HOH B O     1 
HETATM 7242 O  O     . HOH MA 7 .   ? 56.159  17.503  -25.784 0.500 39.459  ? 4596 HOH B O     1 
HETATM 7243 O  O     . HOH MA 7 .   ? 73.139  7.514   -13.012 0.500 36.896  ? 4597 HOH B O     1 
HETATM 7244 O  O     . HOH MA 7 .   ? 69.372  37.420  -26.497 0.500 40.971  ? 4598 HOH B O     1 
HETATM 7245 O  O     . HOH NA 7 .   ? 88.599  -15.514 -26.286 1.000 52.723  ? 7201 HOH C O     1 
HETATM 7246 O  O     . HOH NA 7 .   ? 69.953  -42.238 -20.095 0.500 32.062  ? 7202 HOH C O     1 
HETATM 7247 O  O     . HOH NA 7 .   ? 98.505  -12.586 8.006   1.000 51.225  ? 7203 HOH C O     1 
HETATM 7248 O  O     . HOH NA 7 .   ? 85.746  -9.934  -14.917 1.000 37.984  ? 7204 HOH C O     1 
HETATM 7249 O  O     . HOH NA 7 .   ? 73.977  -42.139 -21.217 0.500 35.827  ? 7205 HOH C O     1 
HETATM 7250 O  O     . HOH NA 7 .   ? 97.606  -10.682 -11.285 1.000 45.280  ? 7206 HOH C O     1 
HETATM 7251 O  O     . HOH NA 7 .   ? 92.708  -31.732 1.423   1.000 45.203  ? 7207 HOH C O     1 
HETATM 7252 O  O     . HOH NA 7 .   ? 103.339 -19.096 -25.172 1.000 52.899  ? 7208 HOH C O     1 
HETATM 7253 O  O     . HOH NA 7 .   ? 106.036 -32.632 -18.379 0.500 35.795  ? 7209 HOH C O     1 
HETATM 7254 O  O     A HOH NA 7 .   ? 98.494  -26.633 -30.122 0.500 29.301  ? 7210 HOH C O     1 
HETATM 7255 O  O     . HOH NA 7 .   ? 89.277  -42.604 -19.424 0.500 30.700  ? 7211 HOH C O     1 
HETATM 7256 O  O     . HOH NA 7 .   ? 73.950  -32.486 -22.750 1.000 32.507  ? 7212 HOH C O     1 
HETATM 7257 O  O     . HOH NA 7 .   ? 93.329  -29.915 4.599   1.000 29.431  ? 7213 HOH C O     1 
HETATM 7258 O  O     . HOH NA 7 .   ? 74.803  -14.994 2.279   1.000 54.349  ? 7214 HOH C O     1 
HETATM 7259 O  O     . HOH NA 7 .   ? 98.149  -23.718 -33.308 1.000 50.142  ? 7215 HOH C O     1 
HETATM 7260 O  O     A HOH NA 7 .   ? 95.467  -10.050 -22.656 0.600 35.195  ? 7216 HOH C O     1 
HETATM 7261 O  O     B HOH NA 7 .   ? 97.174  -9.204  -22.954 0.400 37.397  ? 7216 HOH C O     1 
HETATM 7262 O  O     . HOH NA 7 .   ? 91.975  -44.493 -24.280 1.000 45.095  ? 7217 HOH C O     1 
HETATM 7263 O  O     . HOH NA 7 .   ? 70.330  -16.928 -7.707  1.000 25.486  ? 7218 HOH C O     1 
HETATM 7264 O  O     . HOH NA 7 .   ? 77.853  -11.727 1.888   1.000 41.392  ? 7219 HOH C O     1 
HETATM 7265 O  O     . HOH NA 7 .   ? 97.641  -27.936 0.316   1.000 28.178  ? 7220 HOH C O     1 
HETATM 7266 O  O     . HOH NA 7 .   ? 104.323 -20.060 -10.494 1.000 37.026  ? 7221 HOH C O     1 
HETATM 7267 O  O     . HOH NA 7 .   ? 103.157 -12.796 -13.343 0.500 40.518  ? 7222 HOH C O     1 
HETATM 7268 O  O     . HOH NA 7 .   ? 107.696 -24.491 -17.185 1.000 44.874  ? 7223 HOH C O     1 
HETATM 7269 O  O     . HOH NA 7 .   ? 104.131 -16.891 -23.896 0.500 42.727  ? 7224 HOH C O     1 
HETATM 7270 O  O     . HOH NA 7 .   ? 83.030  -27.800 -31.435 1.000 53.106  ? 7225 HOH C O     1 
HETATM 7271 O  O     . HOH NA 7 .   ? 106.040 -18.242 -7.151  0.500 41.958  ? 7226 HOH C O     1 
HETATM 7272 O  O     . HOH NA 7 .   ? 79.378  -22.687 -19.280 1.000 27.733  ? 7227 HOH C O     1 
HETATM 7273 O  O     . HOH NA 7 .   ? 81.011  -23.827 7.628   0.500 32.571  ? 7228 HOH C O     1 
HETATM 7274 O  O     . HOH NA 7 .   ? 74.914  -31.765 -28.510 0.500 37.609  ? 7229 HOH C O     1 
HETATM 7275 O  O     . HOH NA 7 .   ? 80.395  -27.457 2.106   1.000 25.655  ? 7230 HOH C O     1 
HETATM 7276 O  O     A HOH NA 7 .   ? 82.908  8.519   -19.275 0.500 42.809  ? 7231 HOH C O     1 
HETATM 7277 O  O     B HOH NA 7 .   ? 81.518  8.741   -17.994 0.500 41.250  ? 7231 HOH C O     1 
HETATM 7278 O  O     . HOH NA 7 .   ? 77.788  -18.337 -12.626 1.000 21.256  ? 7232 HOH C O     1 
HETATM 7279 O  O     . HOH NA 7 .   ? 99.735  -17.330 -25.981 1.000 49.852  ? 7233 HOH C O     1 
HETATM 7280 O  O     . HOH NA 7 .   ? 82.147  -33.960 -0.206  1.000 48.235  ? 7234 HOH C O     1 
HETATM 7281 O  O     . HOH NA 7 .   ? 95.350  -40.341 -13.015 0.500 27.493  ? 7235 HOH C O     1 
HETATM 7282 O  O     . HOH NA 7 .   ? 94.698  -17.286 -39.293 1.000 49.539  ? 7236 HOH C O     1 
HETATM 7283 O  O     . HOH NA 7 .   ? 76.097  -38.725 -7.532  1.000 39.943  ? 7237 HOH C O     1 
HETATM 7284 O  O     . HOH NA 7 .   ? 78.214  -9.277  0.863   1.000 50.370  ? 7238 HOH C O     1 
HETATM 7285 O  O     . HOH NA 7 .   ? 86.003  -28.575 -34.543 1.000 38.718  ? 7239 HOH C O     1 
HETATM 7286 O  O     . HOH NA 7 .   ? 80.297  -6.348  -1.941  1.000 47.408  ? 7240 HOH C O     1 
HETATM 7287 O  O     . HOH NA 7 .   ? 85.887  -2.249  -15.160 1.000 47.506  ? 7241 HOH C O     1 
HETATM 7288 O  O     . HOH NA 7 .   ? 94.200  -37.109 -15.178 1.000 34.315  ? 7242 HOH C O     1 
HETATM 7289 O  O     . HOH NA 7 .   ? 82.784  -30.862 -22.377 1.000 23.468  ? 7243 HOH C O     1 
HETATM 7290 O  O     . HOH NA 7 .   ? 90.002  -41.136 -17.443 1.000 50.245  ? 7244 HOH C O     1 
HETATM 7291 O  O     . HOH NA 7 .   ? 78.976  -18.124 3.710   0.500 38.721  ? 7245 HOH C O     1 
HETATM 7292 O  O     . HOH NA 7 .   ? 111.185 -30.662 -11.158 0.500 41.744  ? 7246 HOH C O     1 
HETATM 7293 O  O     . HOH NA 7 .   ? 86.872  -11.943 -23.871 1.000 47.264  ? 7247 HOH C O     1 
HETATM 7294 O  O     A HOH NA 7 .   ? 85.960  -36.252 -0.836  0.600 35.283  ? 7248 HOH C O     1 
HETATM 7295 O  O     B HOH NA 7 .   ? 85.648  -37.373 0.942   0.400 33.021  ? 7248 HOH C O     1 
HETATM 7296 O  O     . HOH NA 7 .   ? 91.118  -38.286 -11.762 1.000 34.115  ? 7249 HOH C O     1 
HETATM 7297 O  O     . HOH NA 7 .   ? 99.108  -16.669 -29.944 1.000 49.164  ? 7250 HOH C O     1 
HETATM 7298 O  O     A HOH NA 7 .   ? 82.409  -37.060 -6.002  0.500 27.818  ? 7251 HOH C O     1 
HETATM 7299 O  O     B HOH NA 7 .   ? 82.115  -38.100 -7.690  0.500 34.735  ? 7251 HOH C O     1 
HETATM 7300 O  O     . HOH NA 7 .   ? 93.684  -26.581 -2.996  1.000 21.130  ? 7252 HOH C O     1 
HETATM 7301 O  O     . HOH NA 7 .   ? 97.768  -34.979 -3.470  0.500 40.107  ? 7253 HOH C O     1 
HETATM 7302 O  O     . HOH NA 7 .   ? 102.487 -10.293 -2.043  0.500 37.028  ? 7254 HOH C O     1 
HETATM 7303 O  O     . HOH NA 7 .   ? 105.605 -26.192 -16.877 1.000 26.878  ? 7255 HOH C O     1 
HETATM 7304 O  O     . HOH NA 7 .   ? 90.049  -15.346 4.314   1.000 35.035  ? 7256 HOH C O     1 
HETATM 7305 O  O     . HOH NA 7 .   ? 103.219 -33.983 -7.139  1.000 38.028  ? 7257 HOH C O     1 
HETATM 7306 O  O     . HOH NA 7 .   ? 97.440  -8.282  1.393   1.000 52.686  ? 7258 HOH C O     1 
HETATM 7307 O  O     . HOH NA 7 .   ? 85.243  -26.470 -31.287 1.000 41.886  ? 7259 HOH C O     1 
HETATM 7308 O  O     . HOH NA 7 .   ? 72.307  -43.675 -4.587  1.000 36.771  ? 7260 HOH C O     1 
HETATM 7309 O  O     . HOH NA 7 .   ? 98.866  -22.629 -37.606 1.000 61.143  ? 7261 HOH C O     1 
HETATM 7310 O  O     . HOH NA 7 .   ? 94.545  -6.272  2.488   1.000 52.871  ? 7262 HOH C O     1 
HETATM 7311 O  O     . HOH NA 7 .   ? 105.639 -26.773 -29.400 1.000 48.842  ? 7263 HOH C O     1 
HETATM 7312 O  O     . HOH NA 7 .   ? 76.444  -40.014 -25.844 1.000 34.636  ? 7264 HOH C O     1 
HETATM 7313 O  O     A HOH NA 7 .   ? 78.109  -30.381 -29.523 0.500 40.080  ? 7265 HOH C O     1 
HETATM 7314 O  O     B HOH NA 7 .   ? 78.569  -29.104 -28.460 0.500 35.718  ? 7265 HOH C O     1 
HETATM 7315 O  O     . HOH NA 7 .   ? 82.395  -30.195 -19.829 1.000 20.863  ? 7266 HOH C O     1 
HETATM 7316 O  O     . HOH NA 7 .   ? 95.235  -11.221 10.188  0.500 39.915  ? 7267 HOH C O     1 
HETATM 7317 O  O     . HOH NA 7 .   ? 79.097  -21.297 0.657   1.000 24.714  ? 7268 HOH C O     1 
HETATM 7318 O  O     . HOH NA 7 .   ? 73.483  -40.301 -8.986  0.500 22.677  ? 7269 HOH C O     1 
HETATM 7319 O  O     . HOH NA 7 .   ? 88.438  -26.476 -35.633 1.000 36.402  ? 7270 HOH C O     1 
HETATM 7320 O  O     A HOH NA 7 .   ? 109.055 -31.818 -1.762  0.500 27.093  ? 7271 HOH C O     1 
HETATM 7321 O  O     B HOH NA 7 .   ? 108.255 -32.796 -1.085  0.500 32.919  ? 7271 HOH C O     1 
HETATM 7322 O  O     . HOH NA 7 .   ? 80.517  -40.831 -19.750 1.000 30.014  ? 7272 HOH C O     1 
HETATM 7323 O  O     . HOH NA 7 .   ? 102.006 -33.890 -16.918 1.000 47.114  ? 7273 HOH C O     1 
HETATM 7324 O  O     . HOH NA 7 .   ? 89.444  -31.446 -0.044  1.000 32.159  ? 7274 HOH C O     1 
HETATM 7325 O  O     A HOH NA 7 .   ? 86.717  -18.342 -28.521 0.500 35.490  ? 7275 HOH C O     1 
HETATM 7326 O  O     B HOH NA 7 .   ? 88.347  -17.884 -28.641 0.500 40.243  ? 7275 HOH C O     1 
HETATM 7327 O  O     . HOH NA 7 .   ? 87.269  -17.602 -25.581 1.000 26.905  ? 7276 HOH C O     1 
HETATM 7328 O  O     . HOH NA 7 .   ? 76.041  -13.303 -0.817  0.500 30.591  ? 7277 HOH C O     1 
HETATM 7329 O  O     . HOH NA 7 .   ? 91.794  -22.940 8.242   1.000 25.142  ? 7278 HOH C O     1 
HETATM 7330 O  O     . HOH NA 7 .   ? 107.177 -22.474 -16.116 1.000 43.572  ? 7279 HOH C O     1 
HETATM 7331 O  O     . HOH NA 7 .   ? 80.183  -34.262 1.527   1.000 52.199  ? 7280 HOH C O     1 
HETATM 7332 O  O     . HOH NA 7 .   ? 83.679  -46.693 -20.225 0.500 50.066  ? 7281 HOH C O     1 
HETATM 7333 O  O     . HOH NA 7 .   ? 104.534 -32.150 -5.626  1.000 41.299  ? 7282 HOH C O     1 
HETATM 7334 O  O     . HOH NA 7 .   ? 91.617  -6.080  -21.791 0.500 39.339  ? 7283 HOH C O     1 
HETATM 7335 O  O     . HOH NA 7 .   ? 68.556  -35.687 -23.613 1.000 49.277  ? 7284 HOH C O     1 
HETATM 7336 O  O     . HOH NA 7 .   ? 100.335 -13.155 -17.853 1.000 49.429  ? 7285 HOH C O     1 
HETATM 7337 O  O     . HOH NA 7 .   ? 73.467  -32.242 -0.823  1.000 32.388  ? 7286 HOH C O     1 
HETATM 7338 O  O     . HOH NA 7 .   ? 87.283  -31.527 1.781   1.000 26.872  ? 7287 HOH C O     1 
HETATM 7339 O  O     . HOH NA 7 .   ? 94.596  -9.751  -26.255 0.500 43.549  ? 7288 HOH C O     1 
HETATM 7340 O  O     . HOH NA 7 .   ? 81.929  -36.201 -1.498  1.000 42.605  ? 7289 HOH C O     1 
HETATM 7341 O  O     . HOH NA 7 .   ? 93.014  -31.127 -38.637 1.000 40.856  ? 7290 HOH C O     1 
HETATM 7342 O  O     . HOH NA 7 .   ? 87.669  -44.067 -23.982 0.500 43.921  ? 7291 HOH C O     1 
HETATM 7343 O  O     . HOH NA 7 .   ? 100.518 -35.487 -34.447 0.500 42.036  ? 7292 HOH C O     1 
HETATM 7344 O  O     . HOH NA 7 .   ? 80.493  -22.026 -22.706 1.000 44.632  ? 7293 HOH C O     1 
HETATM 7345 O  O     . HOH NA 7 .   ? 88.824  -32.206 -2.663  1.000 42.359  ? 7294 HOH C O     1 
HETATM 7346 O  O     . HOH NA 7 .   ? 101.870 -17.560 -0.730  1.000 32.994  ? 7295 HOH C O     1 
HETATM 7347 O  O     . HOH NA 7 .   ? 90.904  -31.559 8.213   1.000 44.401  ? 7296 HOH C O     1 
HETATM 7348 O  O     . HOH NA 7 .   ? 91.075  -25.084 -37.043 0.500 35.694  ? 7297 HOH C O     1 
HETATM 7349 O  O     . HOH NA 7 .   ? 90.395  -34.330 -36.683 1.000 39.987  ? 7298 HOH C O     1 
HETATM 7350 O  O     . HOH NA 7 .   ? 100.041 -15.969 -22.945 1.000 52.147  ? 7299 HOH C O     1 
HETATM 7351 O  O     . HOH NA 7 .   ? 105.583 -34.861 -24.821 1.000 55.165  ? 7300 HOH C O     1 
HETATM 7352 O  O     . HOH NA 7 .   ? 87.371  -20.663 -22.278 1.000 20.424  ? 7301 HOH C O     1 
HETATM 7353 O  O     . HOH NA 7 .   ? 78.075  -26.181 -25.992 1.000 51.680  ? 7302 HOH C O     1 
HETATM 7354 O  O     . HOH NA 7 .   ? 97.401  -37.349 -26.088 1.000 37.848  ? 7303 HOH C O     1 
HETATM 7355 O  O     . HOH NA 7 .   ? 87.710  -37.898 -34.148 1.000 36.963  ? 7304 HOH C O     1 
HETATM 7356 O  O     . HOH NA 7 .   ? 88.485  -1.690  2.343   1.000 61.279  ? 7305 HOH C O     1 
HETATM 7357 O  O     . HOH NA 7 .   ? 73.984  -16.792 -8.109  1.000 21.035  ? 7306 HOH C O     1 
HETATM 7358 O  O     . HOH NA 7 .   ? 72.647  -23.140 -18.356 1.000 27.798  ? 7307 HOH C O     1 
HETATM 7359 O  O     . HOH NA 7 .   ? 76.371  -37.384 -3.823  1.000 35.728  ? 7308 HOH C O     1 
HETATM 7360 O  O     . HOH NA 7 .   ? 82.268  -1.990  -12.534 1.000 65.733  ? 7309 HOH C O     1 
HETATM 7361 O  O     . HOH NA 7 .   ? 70.138  -9.499  -14.476 1.000 36.711  ? 7310 HOH C O     1 
HETATM 7362 O  O     . HOH NA 7 .   ? 107.509 -22.112 -4.145  1.000 46.764  ? 7311 HOH C O     1 
HETATM 7363 O  O     . HOH NA 7 .   ? 100.493 -16.903 -6.719  1.000 25.681  ? 7312 HOH C O     1 
HETATM 7364 O  O     . HOH NA 7 .   ? 99.184  -11.520 0.249   1.000 48.542  ? 7313 HOH C O     1 
HETATM 7365 O  O     . HOH NA 7 .   ? 106.408 -34.823 -16.664 0.500 40.946  ? 7314 HOH C O     1 
HETATM 7366 O  O     . HOH NA 7 .   ? 74.442  -40.550 -24.007 1.000 52.214  ? 7315 HOH C O     1 
HETATM 7367 O  O     A HOH NA 7 .   ? 91.194  -37.464 -2.657  0.600 39.663  ? 7316 HOH C O     1 
HETATM 7368 O  O     B HOH NA 7 .   ? 91.963  -37.346 -0.707  0.400 37.784  ? 7316 HOH C O     1 
HETATM 7369 O  O     A HOH NA 7 .   ? 99.724  -20.316 -31.059 0.500 26.065  ? 7317 HOH C O     1 
HETATM 7370 O  O     . HOH NA 7 .   ? 95.398  -6.654  -16.187 1.000 47.483  ? 7318 HOH C O     1 
HETATM 7371 O  O     . HOH NA 7 .   ? 66.371  -29.460 -17.722 1.000 47.709  ? 7319 HOH C O     1 
HETATM 7372 O  O     . HOH NA 7 .   ? 92.065  -27.521 -33.451 1.000 27.815  ? 7320 HOH C O     1 
HETATM 7373 O  O     . HOH NA 7 .   ? 91.109  -9.554  -20.834 1.000 37.683  ? 7321 HOH C O     1 
HETATM 7374 O  O     A HOH NA 7 .   ? 106.525 -36.830 -23.181 0.500 40.082  ? 7322 HOH C O     1 
HETATM 7375 O  O     B HOH NA 7 .   ? 106.113 -35.826 -20.996 0.500 34.814  ? 7322 HOH C O     1 
HETATM 7376 O  O     . HOH NA 7 .   ? 94.098  -5.746  -12.927 1.000 52.810  ? 7323 HOH C O     1 
HETATM 7377 O  O     . HOH NA 7 .   ? 82.075  -37.231 -26.406 1.000 30.092  ? 7324 HOH C O     1 
HETATM 7378 O  O     . HOH NA 7 .   ? 80.398  -18.978 -0.276  1.000 42.485  ? 7325 HOH C O     1 
HETATM 7379 O  O     . HOH NA 7 .   ? 95.844  -28.761 7.790   1.000 26.199  ? 7326 HOH C O     1 
HETATM 7380 O  O     . HOH NA 7 .   ? 91.514  8.268   -19.829 1.000 48.925  ? 7327 HOH C O     1 
HETATM 7381 O  O     . HOH NA 7 .   ? 77.314  -12.285 -19.907 1.000 33.467  ? 7328 HOH C O     1 
HETATM 7382 O  O     . HOH NA 7 .   ? 103.110 -15.720 3.366   1.000 43.353  ? 7329 HOH C O     1 
HETATM 7383 O  O     . HOH NA 7 .   ? 88.200  -39.896 -15.220 1.000 32.967  ? 7330 HOH C O     1 
HETATM 7384 O  O     . HOH NA 7 .   ? 91.630  -24.864 -2.502  1.000 25.868  ? 7331 HOH C O     1 
HETATM 7385 O  O     . HOH NA 7 .   ? 107.293 -31.683 -26.199 0.500 50.036  ? 7332 HOH C O     1 
HETATM 7386 O  O     . HOH NA 7 .   ? 102.153 -11.491 -5.427  1.000 54.767  ? 7333 HOH C O     1 
HETATM 7387 O  O     . HOH NA 7 .   ? 85.679  -37.103 -26.462 1.000 23.812  ? 7334 HOH C O     1 
HETATM 7388 O  O     A HOH NA 7 .   ? 78.413  -5.428  -8.689  0.500 34.686  ? 7335 HOH C O     1 
HETATM 7389 O  O     B HOH NA 7 .   ? 76.962  -5.821  -9.668  0.500 33.120  ? 7335 HOH C O     1 
HETATM 7390 O  O     . HOH NA 7 .   ? 93.969  -9.727  -20.434 1.000 48.103  ? 7336 HOH C O     1 
HETATM 7391 O  O     . HOH NA 7 .   ? 90.964  -20.244 -33.150 1.000 27.549  ? 7337 HOH C O     1 
HETATM 7392 O  O     . HOH NA 7 .   ? 103.019 -38.644 -29.465 1.000 37.881  ? 7338 HOH C O     1 
HETATM 7393 O  O     . HOH NA 7 .   ? 72.158  -15.633 -9.748  1.000 24.580  ? 7339 HOH C O     1 
HETATM 7394 O  O     . HOH NA 7 .   ? 101.576 -17.646 -3.488  1.000 34.276  ? 7340 HOH C O     1 
HETATM 7395 O  O     . HOH NA 7 .   ? 93.842  -42.893 -28.675 1.000 39.170  ? 7341 HOH C O     1 
HETATM 7396 O  O     . HOH NA 7 .   ? 94.367  -13.828 -28.690 1.000 40.084  ? 7342 HOH C O     1 
HETATM 7397 O  O     . HOH NA 7 .   ? 109.705 -31.650 -16.782 1.000 44.496  ? 7343 HOH C O     1 
HETATM 7398 O  O     . HOH NA 7 .   ? 85.346  -38.526 -29.858 1.000 24.107  ? 7344 HOH C O     1 
HETATM 7399 O  O     . HOH NA 7 .   ? 63.861  -32.200 -11.262 1.000 29.580  ? 7345 HOH C O     1 
HETATM 7400 O  O     . HOH NA 7 .   ? 92.150  -24.664 11.499  1.000 28.166  ? 7346 HOH C O     1 
HETATM 7401 O  O     . HOH NA 7 .   ? 76.951  -38.410 -14.831 1.000 23.095  ? 7347 HOH C O     1 
HETATM 7402 O  O     . HOH NA 7 .   ? 63.465  -29.352 -18.019 1.000 49.976  ? 7348 HOH C O     1 
HETATM 7403 O  O     . HOH NA 7 .   ? 85.226  -12.616 -15.280 1.000 24.531  ? 7349 HOH C O     1 
HETATM 7404 O  O     A HOH NA 7 .   ? 99.965  -13.530 1.340   0.600 27.510  ? 7350 HOH C O     1 
HETATM 7405 O  O     B HOH NA 7 .   ? 101.591 -13.910 1.075   0.400 29.617  ? 7350 HOH C O     1 
HETATM 7406 O  O     . HOH NA 7 .   ? 97.016  -43.241 -18.241 1.000 34.565  ? 7351 HOH C O     1 
HETATM 7407 O  O     . HOH NA 7 .   ? 70.069  -37.073 -3.822  1.000 35.123  ? 7352 HOH C O     1 
HETATM 7408 O  O     . HOH NA 7 .   ? 87.991  -19.795 -18.766 1.000 19.904  ? 7353 HOH C O     1 
HETATM 7409 O  O     . HOH NA 7 .   ? 94.058  -18.389 -33.128 1.000 47.063  ? 7354 HOH C O     1 
HETATM 7410 O  O     . HOH NA 7 .   ? 81.909  -29.399 6.014   1.000 38.534  ? 7355 HOH C O     1 
HETATM 7411 O  O     . HOH NA 7 .   ? 94.907  -23.532 -21.888 1.000 30.595  ? 7356 HOH C O     1 
HETATM 7412 O  O     A HOH NA 7 .   ? 78.863  -25.499 5.465   0.600 19.870  ? 7357 HOH C O     1 
HETATM 7413 O  O     B HOH NA 7 .   ? 80.140  -26.041 6.269   0.400 31.708  ? 7357 HOH C O     1 
HETATM 7414 O  O     . HOH NA 7 .   ? 92.263  -42.979 -16.780 1.000 48.965  ? 7358 HOH C O     1 
HETATM 7415 O  O     . HOH NA 7 .   ? 98.358  -16.508 7.526   1.000 38.615  ? 7359 HOH C O     1 
HETATM 7416 O  O     . HOH NA 7 .   ? 95.586  -32.883 -31.849 1.000 27.449  ? 7360 HOH C O     1 
HETATM 7417 O  O     A HOH NA 7 .   ? 101.741 -35.300 -10.321 0.500 27.832  ? 7361 HOH C O     1 
HETATM 7418 O  O     . HOH NA 7 .   ? 73.039  -27.805 -7.777  1.000 20.971  ? 7362 HOH C O     1 
HETATM 7419 O  O     . HOH NA 7 .   ? 77.332  -25.251 -22.174 1.000 31.602  ? 7363 HOH C O     1 
HETATM 7420 O  O     A HOH NA 7 .   ? 87.884  -39.032 -9.194  0.500 30.650  ? 7364 HOH C O     1 
HETATM 7421 O  O     B HOH NA 7 .   ? 89.426  -38.371 -8.819  0.500 31.315  ? 7364 HOH C O     1 
HETATM 7422 O  O     . HOH NA 7 .   ? 83.265  -31.931 -32.873 1.000 33.980  ? 7365 HOH C O     1 
HETATM 7423 O  O     . HOH NA 7 .   ? 78.078  -7.157  -1.168  1.000 55.994  ? 7366 HOH C O     1 
HETATM 7424 O  O     . HOH NA 7 .   ? 97.597  -32.704 -5.755  1.000 40.728  ? 7367 HOH C O     1 
HETATM 7425 O  O     . HOH NA 7 .   ? 85.866  -3.341  -18.323 1.000 41.004  ? 7368 HOH C O     1 
HETATM 7426 O  O     A HOH NA 7 .   ? 73.143  -41.725 0.005   0.700 53.273  ? 7369 HOH C O     1 
HETATM 7427 O  O     B HOH NA 7 .   ? 71.498  -41.407 0.328   0.300 32.048  ? 7369 HOH C O     1 
HETATM 7428 O  O     . HOH NA 7 .   ? 103.343 -20.202 -18.350 1.000 46.188  ? 7370 HOH C O     1 
HETATM 7429 O  O     . HOH NA 7 .   ? 100.450 -9.465  1.686   1.000 53.534  ? 7371 HOH C O     1 
HETATM 7430 O  O     . HOH NA 7 .   ? 100.781 -28.428 -33.292 1.000 51.383  ? 7372 HOH C O     1 
HETATM 7431 O  O     . HOH NA 7 .   ? 97.078  -10.941 -14.054 1.000 34.822  ? 7373 HOH C O     1 
HETATM 7432 O  O     . HOH NA 7 .   ? 75.979  -24.762 6.890   0.500 32.717  ? 7374 HOH C O     1 
HETATM 7433 O  O     . HOH NA 7 .   ? 70.651  -34.044 -28.950 0.500 41.762  ? 7375 HOH C O     1 
HETATM 7434 O  O     . HOH NA 7 .   ? 81.918  -42.408 -21.496 1.000 31.820  ? 7376 HOH C O     1 
HETATM 7435 O  O     . HOH NA 7 .   ? 82.636  -38.022 -28.873 1.000 30.275  ? 7377 HOH C O     1 
HETATM 7436 O  O     . HOH NA 7 .   ? 67.729  -32.824 -20.974 1.000 52.530  ? 7378 HOH C O     1 
HETATM 7437 O  O     . HOH NA 7 .   ? 73.613  -10.411 -18.386 0.500 39.859  ? 7379 HOH C O     1 
HETATM 7438 O  O     . HOH NA 7 .   ? 92.120  -18.047 -39.495 0.500 45.486  ? 7380 HOH C O     1 
HETATM 7439 O  O     . HOH NA 7 .   ? 76.454  -22.684 2.188   1.000 39.785  ? 7381 HOH C O     1 
HETATM 7440 O  O     . HOH NA 7 .   ? 74.641  -9.333  -7.789  1.000 48.571  ? 7382 HOH C O     1 
HETATM 7441 O  O     . HOH NA 7 .   ? 75.505  -16.819 -21.524 1.000 47.493  ? 7383 HOH C O     1 
HETATM 7442 O  O     . HOH NA 7 .   ? 95.527  -21.805 10.281  1.000 31.819  ? 7384 HOH C O     1 
HETATM 7443 O  O     . HOH NA 7 .   ? 73.581  -29.537 -1.201  1.000 28.218  ? 7385 HOH C O     1 
HETATM 7444 O  O     . HOH NA 7 .   ? 88.110  -9.492  4.732   1.000 49.646  ? 7386 HOH C O     1 
HETATM 7445 O  O     . HOH NA 7 .   ? 85.619  -21.844 4.366   1.000 24.943  ? 7387 HOH C O     1 
HETATM 7446 O  O     . HOH NA 7 .   ? 104.357 -23.520 -23.792 1.000 34.218  ? 7388 HOH C O     1 
HETATM 7447 O  O     . HOH NA 7 .   ? 85.670  -1.781  -7.506  1.000 38.576  ? 7389 HOH C O     1 
HETATM 7448 O  O     . HOH NA 7 .   ? 75.626  -23.662 -21.254 0.500 28.814  ? 7390 HOH C O     1 
HETATM 7449 O  O     . HOH NA 7 .   ? 97.480  -36.290 3.561   1.000 50.782  ? 7391 HOH C O     1 
HETATM 7450 O  O     . HOH NA 7 .   ? 98.069  -39.622 -11.282 1.000 46.903  ? 7392 HOH C O     1 
HETATM 7451 O  O     . HOH NA 7 .   ? 89.549  -41.747 -21.634 1.000 34.287  ? 7393 HOH C O     1 
HETATM 7452 O  O     . HOH NA 7 .   ? 104.199 -14.029 -3.258  0.500 41.786  ? 7394 HOH C O     1 
HETATM 7453 O  O     A HOH NA 7 .   ? 80.158  -42.922 -26.509 0.650 30.814  ? 7395 HOH C O     1 
HETATM 7454 O  O     B HOH NA 7 .   ? 81.292  -44.033 -25.484 0.350 30.664  ? 7395 HOH C O     1 
HETATM 7455 O  O     . HOH NA 7 .   ? 78.935  -40.438 -9.310  1.000 46.381  ? 7396 HOH C O     1 
HETATM 7456 O  O     . HOH NA 7 .   ? 94.389  -30.815 6.945   1.000 38.880  ? 7397 HOH C O     1 
HETATM 7457 O  O     . HOH NA 7 .   ? 82.035  -3.661  -10.343 1.000 35.601  ? 7398 HOH C O     1 
HETATM 7458 O  O     . HOH NA 7 .   ? 94.547  -6.514  7.237   1.000 47.673  ? 7399 HOH C O     1 
HETATM 7459 O  O     . HOH NA 7 .   ? 67.967  -36.972 -4.927  1.000 33.059  ? 7400 HOH C O     1 
HETATM 7460 O  O     . HOH NA 7 .   ? 87.031  -42.331 -22.495 0.500 42.290  ? 7401 HOH C O     1 
HETATM 7461 O  O     . HOH NA 7 .   ? 109.927 -23.624 -3.035  0.500 38.485  ? 7402 HOH C O     1 
HETATM 7462 O  O     A HOH NA 7 .   ? 77.240  -21.467 -21.083 0.600 40.491  ? 7403 HOH C O     1 
HETATM 7463 O  O     B HOH NA 7 .   ? 76.158  -21.487 -22.446 0.400 37.360  ? 7403 HOH C O     1 
HETATM 7464 O  O     . HOH NA 7 .   ? 94.935  -28.263 -37.158 0.500 30.960  ? 7404 HOH C O     1 
HETATM 7465 O  O     . HOH NA 7 .   ? 76.467  -11.253 -17.426 1.000 31.872  ? 7405 HOH C O     1 
HETATM 7466 O  O     . HOH NA 7 .   ? 104.213 -21.171 -23.586 1.000 52.699  ? 7406 HOH C O     1 
HETATM 7467 O  O     A HOH NA 7 .   ? 71.678  -37.883 -27.293 0.500 31.471  ? 7407 HOH C O     1 
HETATM 7468 O  O     B HOH NA 7 .   ? 72.158  -38.798 -26.284 0.500 43.246  ? 7407 HOH C O     1 
HETATM 7469 O  O     A HOH NA 7 .   ? 95.547  -16.069 -31.123 0.500 39.439  ? 7408 HOH C O     1 
HETATM 7470 O  O     B HOH NA 7 .   ? 93.783  -15.629 -32.267 0.500 35.394  ? 7408 HOH C O     1 
HETATM 7471 O  O     . HOH NA 7 .   ? 102.032 -18.669 10.081  1.000 44.517  ? 7409 HOH C O     1 
HETATM 7472 O  O     . HOH NA 7 .   ? 79.416  -6.500  -4.763  1.000 40.594  ? 7410 HOH C O     1 
HETATM 7473 O  O     A HOH NA 7 .   ? 77.100  -4.481  -18.191 0.650 34.380  ? 7411 HOH C O     1 
HETATM 7474 O  O     B HOH NA 7 .   ? 75.981  -5.162  -19.102 0.350 28.638  ? 7411 HOH C O     1 
HETATM 7475 O  O     . HOH NA 7 .   ? 101.924 -29.452 -31.070 1.000 47.846  ? 7412 HOH C O     1 
HETATM 7476 O  O     . HOH NA 7 .   ? 80.604  -35.760 -4.689  1.000 35.356  ? 7413 HOH C O     1 
HETATM 7477 O  O     . HOH NA 7 .   ? 104.557 -30.975 -22.900 1.000 45.050  ? 7414 HOH C O     1 
HETATM 7478 O  O     . HOH NA 7 .   ? 84.436  -33.191 0.201   1.000 32.313  ? 7415 HOH C O     1 
HETATM 7479 O  O     . HOH NA 7 .   ? 108.718 -33.736 -12.875 1.000 52.993  ? 7416 HOH C O     1 
HETATM 7480 O  O     . HOH NA 7 .   ? 114.509 -27.917 0.931   0.500 42.911  ? 7417 HOH C O     1 
HETATM 7481 O  O     . HOH NA 7 .   ? 86.735  -33.712 -0.216  1.000 35.815  ? 7418 HOH C O     1 
HETATM 7482 O  O     . HOH NA 7 .   ? 76.262  -26.804 -23.868 0.500 36.819  ? 7419 HOH C O     1 
HETATM 7483 O  O     . HOH NA 7 .   ? 89.491  -12.014 -23.976 1.000 53.371  ? 7420 HOH C O     1 
HETATM 7484 O  O     . HOH NA 7 .   ? 92.187  -35.210 0.899   0.500 33.153  ? 7421 HOH C O     1 
HETATM 7485 O  O     . HOH NA 7 .   ? 108.953 -28.177 -22.557 0.500 39.574  ? 7422 HOH C O     1 
HETATM 7486 O  O     A HOH NA 7 .   ? 92.875  -36.898 -34.101 0.500 35.440  ? 7423 HOH C O     1 
HETATM 7487 O  O     B HOH NA 7 .   ? 92.115  -38.539 -34.588 0.500 33.460  ? 7423 HOH C O     1 
HETATM 7488 O  O     . HOH NA 7 .   ? 94.235  -35.117 -5.810  1.000 48.585  ? 7424 HOH C O     1 
HETATM 7489 O  O     A HOH NA 7 .   ? 90.813  -14.340 8.612   0.600 45.277  ? 7425 HOH C O     1 
HETATM 7490 O  O     B HOH NA 7 .   ? 90.896  -16.127 7.773   0.400 30.161  ? 7425 HOH C O     1 
HETATM 7491 O  O     . HOH NA 7 .   ? 84.556  -21.317 6.762   1.000 38.323  ? 7426 HOH C O     1 
HETATM 7492 O  O     . HOH NA 7 .   ? 92.062  -40.458 -15.763 0.500 31.748  ? 7427 HOH C O     1 
HETATM 7493 O  O     . HOH NA 7 .   ? 107.223 -24.120 -24.320 1.000 55.950  ? 7428 HOH C O     1 
HETATM 7494 O  O     . HOH NA 7 .   ? 89.083  -36.606 -1.434  1.000 59.690  ? 7429 HOH C O     1 
HETATM 7495 O  O     . HOH NA 7 .   ? 88.543  0.120   -17.541 1.000 59.052  ? 7430 HOH C O     1 
HETATM 7496 O  O     . HOH NA 7 .   ? 89.789  -39.583 -3.164  0.500 40.993  ? 7431 HOH C O     1 
HETATM 7497 O  O     . HOH NA 7 .   ? 91.046  -44.860 -27.230 0.750 54.606  ? 7432 HOH C O     1 
HETATM 7498 O  O     . HOH NA 7 .   ? 102.748 -16.816 -17.974 1.000 61.103  ? 7433 HOH C O     1 
HETATM 7499 O  O     . HOH NA 7 .   ? 105.684 -15.367 -8.030  1.000 64.981  ? 7434 HOH C O     1 
HETATM 7500 O  O     . HOH NA 7 .   ? 77.399  -19.473 2.262   1.000 37.231  ? 7435 HOH C O     1 
HETATM 7501 O  O     . HOH NA 7 .   ? 77.421  -26.046 2.408   1.000 42.403  ? 7436 HOH C O     1 
HETATM 7502 O  O     . HOH NA 7 .   ? 78.101  -35.758 -4.986  1.000 42.485  ? 7437 HOH C O     1 
HETATM 7503 O  O     A HOH NA 7 .   ? 99.651  -34.699 -5.591  0.700 37.677  ? 7438 HOH C O     1 
HETATM 7504 O  O     B HOH NA 7 .   ? 101.631 -35.219 -5.385  0.300 29.400  ? 7438 HOH C O     1 
HETATM 7505 O  O     A HOH NA 7 .   ? 104.156 -14.690 -5.997  0.650 44.263  ? 7439 HOH C O     1 
HETATM 7506 O  O     B HOH NA 7 .   ? 102.949 -16.367 -5.888  0.350 29.423  ? 7439 HOH C O     1 
HETATM 7507 O  O     . HOH NA 7 .   ? 93.134  -37.718 -4.204  1.000 59.830  ? 7440 HOH C O     1 
HETATM 7508 O  O     . HOH NA 7 .   ? 68.231  -31.808 -25.055 0.500 39.721  ? 7441 HOH C O     1 
HETATM 7509 O  O     . HOH NA 7 .   ? 90.196  -34.019 0.401   1.000 43.400  ? 7442 HOH C O     1 
HETATM 7510 O  O     . HOH NA 7 .   ? 73.946  -19.132 -20.396 0.500 31.517  ? 7443 HOH C O     1 
HETATM 7511 O  O     . HOH NA 7 .   ? 85.345  -39.099 -12.256 1.000 56.001  ? 7444 HOH C O     1 
HETATM 7512 O  O     . HOH NA 7 .   ? 85.654  -38.180 -2.683  1.000 62.310  ? 7445 HOH C O     1 
HETATM 7513 O  O     A HOH NA 7 .   ? 110.706 -28.120 -14.226 0.500 41.541  ? 7446 HOH C O     1 
HETATM 7514 O  O     . HOH NA 7 .   ? 94.228  -35.126 -32.762 1.000 49.398  ? 7447 HOH C O     1 
HETATM 7515 O  O     A HOH NA 7 .   ? 79.564  -27.595 -28.755 0.500 36.320  ? 7448 HOH C O     1 
HETATM 7516 O  O     . HOH NA 7 .   ? 84.125  12.584  -22.423 0.500 40.029  ? 7449 HOH C O     1 
HETATM 7517 O  O     . HOH NA 7 .   ? 65.721  -24.505 -16.949 1.000 56.415  ? 7450 HOH C O     1 
HETATM 7518 O  O     . HOH NA 7 .   ? 100.864 -15.306 -19.762 1.000 56.350  ? 7451 HOH C O     1 
HETATM 7519 O  O     . HOH NA 7 .   ? 84.405  -29.967 -31.267 1.000 49.788  ? 7452 HOH C O     1 
HETATM 7520 O  O     . HOH NA 7 .   ? 76.103  -19.190 -20.799 0.500 34.991  ? 7453 HOH C O     1 
HETATM 7521 O  O     . HOH NA 7 .   ? 71.528  -31.365 -22.226 0.500 34.981  ? 7454 HOH C O     1 
HETATM 7522 O  O     . HOH NA 7 .   ? 93.897  -8.659  -24.236 0.500 39.350  ? 7455 HOH C O     1 
HETATM 7523 O  O     . HOH NA 7 .   ? 77.556  -42.736 -26.434 1.000 46.965  ? 7456 HOH C O     1 
HETATM 7524 O  O     A HOH NA 7 .   ? 93.915  -3.934  -4.896  0.600 40.382  ? 7457 HOH C O     1 
HETATM 7525 O  O     B HOH NA 7 .   ? 91.784  -3.583  -4.763  0.400 28.825  ? 7457 HOH C O     1 
HETATM 7526 O  O     . HOH NA 7 .   ? 68.059  -15.421 -21.864 0.500 47.089  ? 7458 HOH C O     1 
HETATM 7527 O  O     A HOH NA 7 .   ? 105.320 -34.279 -2.796  0.650 47.424  ? 7459 HOH C O     1 
HETATM 7528 O  O     B HOH NA 7 .   ? 104.554 -35.303 -0.981  0.350 37.411  ? 7459 HOH C O     1 
HETATM 7529 O  O     . HOH NA 7 .   ? 88.140  -33.933 2.947   1.000 46.260  ? 7460 HOH C O     1 
HETATM 7530 O  O     . HOH NA 7 .   ? 69.876  -38.884 -1.944  1.000 53.495  ? 7461 HOH C O     1 
HETATM 7531 O  O     . HOH NA 7 .   ? 91.493  -44.129 -21.713 1.000 63.659  ? 7462 HOH C O     1 
HETATM 7532 O  O     . HOH NA 7 .   ? 89.783  -36.882 -35.987 0.500 39.135  ? 7463 HOH C O     1 
HETATM 7533 O  O     A HOH NA 7 .   ? 87.667  -39.897 -12.884 0.500 33.284  ? 7464 HOH C O     1 
HETATM 7534 O  O     B HOH NA 7 .   ? 89.291  -39.928 -11.623 0.500 33.204  ? 7464 HOH C O     1 
HETATM 7535 O  O     . HOH NA 7 .   ? 70.511  -41.258 -1.591  0.500 30.439  ? 7465 HOH C O     1 
HETATM 7536 O  O     A HOH NA 7 .   ? 79.971  -30.625 4.588   0.650 44.843  ? 7466 HOH C O     1 
HETATM 7537 O  O     B HOH NA 7 .   ? 78.277  -29.479 4.799   0.350 25.854  ? 7466 HOH C O     1 
HETATM 7538 O  O     . HOH NA 7 .   ? 79.566  -17.221 -23.399 1.000 48.163  ? 7467 HOH C O     1 
HETATM 7539 O  O     . HOH NA 7 .   ? 90.392  -9.519  -23.373 0.500 36.575  ? 7468 HOH C O     1 
HETATM 7540 O  O     . HOH NA 7 .   ? 95.799  -8.680  -18.360 1.000 47.245  ? 7469 HOH C O     1 
HETATM 7541 O  O     . HOH NA 7 .   ? 93.012  -39.049 -13.710 1.000 36.309  ? 7470 HOH C O     1 
HETATM 7542 O  O     . HOH NA 7 .   ? 77.713  -17.014 5.583   0.500 34.043  ? 7471 HOH C O     1 
HETATM 7543 O  O     . HOH NA 7 .   ? 99.844  -6.888  1.426   0.500 40.343  ? 7472 HOH C O     1 
HETATM 7544 O  O     A HOH NA 7 .   ? 79.720  -38.105 -8.193  0.500 28.480  ? 7473 HOH C O     1 
HETATM 7545 O  O     B HOH NA 7 .   ? 79.174  -37.458 -6.724  0.500 38.653  ? 7473 HOH C O     1 
HETATM 7546 O  O     . HOH NA 7 .   ? 103.725 -12.065 -7.406  0.500 38.988  ? 7474 HOH C O     1 
HETATM 7547 O  O     . HOH NA 7 .   ? 100.314 -36.796 -7.610  0.500 37.585  ? 7475 HOH C O     1 
HETATM 7548 O  O     . HOH NA 7 .   ? 73.604  -32.776 1.878   1.000 49.047  ? 7476 HOH C O     1 
HETATM 7549 O  O     A HOH NA 7 .   ? 103.780 -17.986 -4.989  0.500 33.706  ? 7477 HOH C O     1 
HETATM 7550 O  O     A HOH NA 7 .   ? 92.429  -38.300 -9.407  0.600 37.555  ? 7478 HOH C O     1 
HETATM 7551 O  O     B HOH NA 7 .   ? 93.857  -37.422 -8.294  0.400 29.229  ? 7478 HOH C O     1 
HETATM 7552 O  O     . HOH NA 7 .   ? 65.669  -34.563 -21.331 0.500 42.014  ? 7479 HOH C O     1 
HETATM 7553 O  O     A HOH NA 7 .   ? 102.613 -15.395 0.675   0.600 35.881  ? 7480 HOH C O     1 
HETATM 7554 O  O     B HOH NA 7 .   ? 103.981 -16.611 0.459   0.400 32.094  ? 7480 HOH C O     1 
HETATM 7555 O  O     B HOH NA 7 .   ? 92.135  10.941  -19.951 0.500 46.330  ? 7481 HOH C O     1 
HETATM 7556 O  O     . HOH NA 7 .   ? 90.832  -11.266 -27.077 1.000 57.345  ? 7482 HOH C O     1 
HETATM 7557 O  O     A HOH NA 7 .   ? 88.109  -2.689  -19.984 0.600 36.571  ? 7483 HOH C O     1 
HETATM 7558 O  O     B HOH NA 7 .   ? 90.031  -3.546  -20.037 0.400 34.567  ? 7483 HOH C O     1 
HETATM 7559 O  O     . HOH NA 7 .   ? 76.652  -41.140 -8.065  1.000 46.889  ? 7484 HOH C O     1 
HETATM 7560 O  O     . HOH NA 7 .   ? 103.967 -27.876 -31.156 0.500 34.652  ? 7485 HOH C O     1 
HETATM 7561 O  O     . HOH NA 7 .   ? 80.536  10.654  -21.343 0.500 41.834  ? 7486 HOH C O     1 
HETATM 7562 O  O     . HOH NA 7 .   ? 105.856 -38.957 -30.956 1.000 60.621  ? 7487 HOH C O     1 
HETATM 7563 O  O     . HOH NA 7 .   ? 83.235  -37.734 -3.200  0.500 37.383  ? 7488 HOH C O     1 
HETATM 7564 O  O     . HOH NA 7 .   ? 102.471 -38.787 -33.403 0.500 35.153  ? 7489 HOH C O     1 
HETATM 7565 O  O     A HOH NA 7 .   ? 106.941 -19.601 -3.445  0.700 45.830  ? 7490 HOH C O     1 
HETATM 7566 O  O     B HOH NA 7 .   ? 105.903 -18.618 -4.226  0.300 33.970  ? 7490 HOH C O     1 
HETATM 7567 O  O     . HOH NA 7 .   ? 97.599  -37.229 -1.457  0.500 38.584  ? 7491 HOH C O     1 
HETATM 7568 O  O     . HOH NA 7 .   ? 107.061 -31.453 -6.173  1.000 57.683  ? 7492 HOH C O     1 
HETATM 7569 O  O     A HOH NA 7 .   ? 83.128  -39.699 -8.499  0.500 33.897  ? 7493 HOH C O     1 
HETATM 7570 O  O     . HOH NA 7 .   ? 79.463  -39.865 -3.978  0.500 44.729  ? 7494 HOH C O     1 
HETATM 7571 O  O     . HOH NA 7 .   ? 95.642  -38.480 -2.324  0.500 42.348  ? 7495 HOH C O     1 
HETATM 7572 O  O     A HOH OA 7 .   ? 53.152  -24.235 -10.895 0.600 33.759  ? 4501 HOH D O     1 
HETATM 7573 O  O     B HOH OA 7 .   ? 54.798  -25.300 -10.585 0.400 27.032  ? 4501 HOH D O     1 
HETATM 7574 O  O     A HOH OA 7 .   ? 69.343  -0.017  -9.529  0.500 35.975  ? 4502 HOH D O     1 
HETATM 7575 O  O     B HOH OA 7 .   ? 69.298  -0.059  -7.590  0.500 31.492  ? 4502 HOH D O     1 
HETATM 7576 O  O     A HOH OA 7 .   ? 66.622  -14.211 -17.870 0.500 31.921  ? 4503 HOH D O     1 
HETATM 7577 O  O     B HOH OA 7 .   ? 64.883  -13.740 -17.800 0.500 44.547  ? 4503 HOH D O     1 
HETATM 7578 O  O     . HOH OA 7 .   ? 77.247  -10.212 -5.146  1.000 29.541  ? 4504 HOH D O     1 
HETATM 7579 O  O     . HOH OA 7 .   ? 58.359  -6.686  -1.267  0.500 38.834  ? 4505 HOH D O     1 
HETATM 7580 O  O     . HOH OA 7 .   ? 60.823  -21.807 -12.283 1.000 44.303  ? 4506 HOH D O     1 
HETATM 7581 O  O     . HOH OA 7 .   ? 70.350  -6.311  -8.971  0.500 24.928  ? 4507 HOH D O     1 
HETATM 7582 O  O     . HOH OA 7 .   ? 68.628  -30.625 6.350   1.000 44.043  ? 4508 HOH D O     1 
HETATM 7583 O  O     . HOH OA 7 .   ? 63.247  -24.382 -13.195 1.000 40.455  ? 4509 HOH D O     1 
HETATM 7584 O  O     . HOH OA 7 .   ? 59.781  -0.804  -4.715  0.500 38.640  ? 4510 HOH D O     1 
HETATM 7585 O  O     . HOH OA 7 .   ? 57.042  -10.469 0.385   1.000 73.210  ? 4511 HOH D O     1 
HETATM 7586 O  O     . HOH OA 7 .   ? 67.093  -25.180 7.951   1.000 41.580  ? 4512 HOH D O     1 
HETATM 7587 O  O     . HOH OA 7 .   ? 63.313  -20.802 -16.221 1.000 60.579  ? 4513 HOH D O     1 
HETATM 7588 O  O     . HOH OA 7 .   ? 61.525  -24.681 12.291  0.500 34.131  ? 4514 HOH D O     1 
HETATM 7589 O  O     . HOH OA 7 .   ? 71.443  -29.402 5.206   1.000 48.622  ? 4515 HOH D O     1 
HETATM 7590 O  O     . HOH OA 7 .   ? 50.168  -14.503 -15.370 0.500 36.561  ? 4516 HOH D O     1 
HETATM 7591 O  O     . HOH OA 7 .   ? 61.802  -29.195 9.517   1.000 52.123  ? 4517 HOH D O     1 
HETATM 7592 O  O     . HOH OA 7 .   ? 60.708  8.675   -0.958  0.500 47.973  ? 4518 HOH D O     1 
HETATM 7593 O  O     . HOH OA 7 .   ? 74.653  -19.224 2.017   1.000 28.908  ? 4519 HOH D O     1 
HETATM 7594 O  O     . HOH OA 7 .   ? 68.719  -24.928 -12.772 1.000 25.044  ? 4520 HOH D O     1 
HETATM 7595 O  O     . HOH OA 7 .   ? 53.098  -16.477 3.491   1.000 49.124  ? 4521 HOH D O     1 
HETATM 7596 O  O     . HOH OA 7 .   ? 53.487  -32.325 -2.399  1.000 50.946  ? 4522 HOH D O     1 
HETATM 7597 O  O     . HOH OA 7 .   ? 68.935  -4.363  -7.001  0.500 33.745  ? 4523 HOH D O     1 
HETATM 7598 O  O     . HOH OA 7 .   ? 52.285  -12.780 2.999   0.500 42.931  ? 4524 HOH D O     1 
HETATM 7599 O  O     . HOH OA 7 .   ? 67.408  -14.278 4.943   1.000 46.540  ? 4525 HOH D O     1 
HETATM 7600 O  O     . HOH OA 7 .   ? 70.742  -12.341 2.249   1.000 47.344  ? 4526 HOH D O     1 
HETATM 7601 O  O     . HOH OA 7 .   ? 61.831  -13.037 4.521   1.000 55.195  ? 4527 HOH D O     1 
HETATM 7602 O  O     . HOH OA 7 .   ? 63.633  -19.441 6.725   1.000 34.264  ? 4528 HOH D O     1 
HETATM 7603 O  O     . HOH OA 7 .   ? 67.483  -10.009 -14.015 1.000 35.534  ? 4529 HOH D O     1 
HETATM 7604 O  O     . HOH OA 7 .   ? 62.685  -33.605 4.564   1.000 41.077  ? 4530 HOH D O     1 
HETATM 7605 O  O     . HOH OA 7 .   ? 52.255  -16.526 -11.529 0.500 33.856  ? 4531 HOH D O     1 
HETATM 7606 O  O     . HOH OA 7 .   ? 70.735  -24.980 5.824   1.000 39.900  ? 4532 HOH D O     1 
HETATM 7607 O  O     . HOH OA 7 .   ? 59.367  -15.990 -11.117 1.000 33.721  ? 4533 HOH D O     1 
HETATM 7608 O  O     . HOH OA 7 .   ? 72.051  -28.566 1.023   1.000 41.588  ? 4534 HOH D O     1 
HETATM 7609 O  O     . HOH OA 7 .   ? 65.362  -28.077 -6.091  1.000 30.575  ? 4535 HOH D O     1 
HETATM 7610 O  O     . HOH OA 7 .   ? 58.386  -23.279 4.628   1.000 37.894  ? 4536 HOH D O     1 
HETATM 7611 O  O     . HOH OA 7 .   ? 59.159  -12.703 4.959   1.000 41.422  ? 4537 HOH D O     1 
HETATM 7612 O  O     . HOH OA 7 .   ? 67.067  -11.611 -16.217 1.000 47.841  ? 4538 HOH D O     1 
HETATM 7613 O  O     . HOH OA 7 .   ? 52.824  -15.392 -8.022  0.500 41.828  ? 4539 HOH D O     1 
HETATM 7614 O  O     A HOH OA 7 .   ? 56.571  -25.128 1.630   0.500 29.437  ? 4540 HOH D O     1 
HETATM 7615 O  O     B HOH OA 7 .   ? 55.590  -26.824 0.564   0.500 37.255  ? 4540 HOH D O     1 
HETATM 7616 O  O     . HOH OA 7 .   ? 61.662  -34.620 2.481   1.000 49.904  ? 4541 HOH D O     1 
HETATM 7617 O  O     . HOH OA 7 .   ? 60.879  -11.123 -4.825  1.000 44.062  ? 4542 HOH D O     1 
HETATM 7618 O  O     A HOH OA 7 .   ? 56.276  -24.538 12.133  0.500 38.895  ? 4543 HOH D O     1 
HETATM 7619 O  O     B HOH OA 7 .   ? 56.794  -26.603 11.213  0.500 45.479  ? 4543 HOH D O     1 
HETATM 7620 O  O     . HOH OA 7 .   ? 69.104  -30.515 1.748   1.000 42.329  ? 4544 HOH D O     1 
HETATM 7621 O  O     . HOH OA 7 .   ? 67.105  -16.729 6.253   0.500 40.717  ? 4545 HOH D O     1 
HETATM 7622 O  O     . HOH OA 7 .   ? 50.263  -8.613  -18.221 0.500 44.308  ? 4546 HOH D O     1 
HETATM 7623 O  O     . HOH OA 7 .   ? 67.219  -30.776 -0.075  1.000 29.103  ? 4547 HOH D O     1 
HETATM 7624 O  O     . HOH OA 7 .   ? 71.838  -7.590  1.000   1.000 50.796  ? 4548 HOH D O     1 
HETATM 7625 O  O     . HOH OA 7 .   ? 63.786  -9.724  -1.428  1.000 45.691  ? 4549 HOH D O     1 
HETATM 7626 O  O     . HOH OA 7 .   ? 58.068  -2.762  -4.045  1.000 53.096  ? 4550 HOH D O     1 
HETATM 7627 O  O     . HOH OA 7 .   ? 66.657  -30.701 -7.235  1.000 28.576  ? 4551 HOH D O     1 
HETATM 7628 O  O     . HOH OA 7 .   ? 64.612  -30.628 -9.042  1.000 38.912  ? 4552 HOH D O     1 
HETATM 7629 O  O     . HOH OA 7 .   ? 61.310  -31.512 -10.674 1.000 51.671  ? 4553 HOH D O     1 
HETATM 7630 O  O     . HOH OA 7 .   ? 44.262  -13.451 -13.300 0.500 43.333  ? 4554 HOH D O     1 
HETATM 7631 O  O     . HOH OA 7 .   ? 72.999  -18.528 -2.664  0.500 25.282  ? 4555 HOH D O     1 
HETATM 7632 O  O     . HOH OA 7 .   ? 69.000  -1.976  -2.437  1.000 56.355  ? 4556 HOH D O     1 
HETATM 7633 O  O     . HOH OA 7 .   ? 54.090  -18.630 -7.595  0.500 32.818  ? 4557 HOH D O     1 
HETATM 7634 O  O     . HOH OA 7 .   ? 67.681  -22.360 10.999  0.500 34.985  ? 4558 HOH D O     1 
HETATM 7635 O  O     . HOH OA 7 .   ? 66.413  -23.441 -13.205 1.000 28.485  ? 4559 HOH D O     1 
HETATM 7636 O  O     . HOH OA 7 .   ? 62.475  -13.164 -17.107 1.000 53.233  ? 4560 HOH D O     1 
HETATM 7637 O  O     A HOH OA 7 .   ? 54.199  -20.140 -15.476 0.600 42.052  ? 4561 HOH D O     1 
HETATM 7638 O  O     B HOH OA 7 .   ? 56.292  -19.715 -15.690 0.400 37.261  ? 4561 HOH D O     1 
HETATM 7639 O  O     . HOH OA 7 .   ? 55.526  6.738   -4.163  1.000 59.013  ? 4562 HOH D O     1 
HETATM 7640 O  O     . HOH OA 7 .   ? 70.794  -31.745 -0.552  1.000 38.232  ? 4563 HOH D O     1 
HETATM 7641 O  O     . HOH OA 7 .   ? 70.199  -28.471 8.332   0.500 38.651  ? 4564 HOH D O     1 
HETATM 7642 O  O     . HOH OA 7 .   ? 60.309  -30.612 6.077   1.000 48.056  ? 4565 HOH D O     1 
HETATM 7643 O  O     . HOH OA 7 .   ? 66.364  -32.200 7.453   1.000 50.685  ? 4566 HOH D O     1 
HETATM 7644 O  O     . HOH OA 7 .   ? 62.075  -19.405 -13.371 1.000 41.173  ? 4567 HOH D O     1 
HETATM 7645 O  O     . HOH OA 7 .   ? 69.991  -22.056 7.160   1.000 38.211  ? 4568 HOH D O     1 
HETATM 7646 O  O     . HOH OA 7 .   ? 65.707  -20.446 8.140   1.000 45.885  ? 4569 HOH D O     1 
HETATM 7647 O  O     . HOH OA 7 .   ? 74.800  -17.323 4.168   1.000 44.357  ? 4570 HOH D O     1 
HETATM 7648 O  O     . HOH OA 7 .   ? 56.248  -13.635 11.175  1.000 63.382  ? 4571 HOH D O     1 
HETATM 7649 O  O     . HOH OA 7 .   ? 69.122  -18.431 7.021   0.500 45.413  ? 4572 HOH D O     1 
HETATM 7650 O  O     A HOH OA 7 .   ? 63.861  -35.516 5.793   0.500 36.994  ? 4573 HOH D O     1 
HETATM 7651 O  O     B HOH OA 7 .   ? 65.447  -35.903 6.202   0.500 34.309  ? 4573 HOH D O     1 
HETATM 7652 O  O     . HOH OA 7 .   ? 58.394  -33.695 2.662   1.000 61.999  ? 4574 HOH D O     1 
HETATM 7653 O  O     . HOH OA 7 .   ? 60.431  -9.732  1.942   0.500 45.150  ? 4575 HOH D O     1 
HETATM 7654 O  O     A HOH OA 7 .   ? 60.159  -13.224 1.368   0.500 40.665  ? 4576 HOH D O     1 
HETATM 7655 O  O     B HOH OA 7 .   ? 61.433  -12.621 0.308   0.500 40.951  ? 4576 HOH D O     1 
HETATM 7656 O  O     . HOH OA 7 .   ? 69.395  -32.082 4.070   1.000 55.817  ? 4577 HOH D O     1 
HETATM 7657 O  O     . HOH OA 7 .   ? 77.335  -7.828  -3.938  1.000 51.511  ? 4578 HOH D O     1 
HETATM 7658 O  O     A HOH OA 7 .   ? 66.969  -6.073  -15.756 0.600 52.449  ? 4579 HOH D O     1 
HETATM 7659 O  O     B HOH OA 7 .   ? 67.580  -7.147  -17.309 0.400 40.017  ? 4579 HOH D O     1 
HETATM 7660 O  O     . HOH OA 7 .   ? 75.794  -28.254 3.050   1.000 47.448  ? 4580 HOH D O     1 
HETATM 7661 O  O     . HOH OA 7 .   ? 66.942  -17.634 -21.909 0.500 38.906  ? 4581 HOH D O     1 
HETATM 7662 O  O     . HOH OA 7 .   ? 54.184  4.242   -7.600  0.500 41.072  ? 4582 HOH D O     1 
HETATM 7663 O  O     . HOH OA 7 .   ? 51.389  -14.444 3.842   0.500 40.588  ? 4583 HOH D O     1 
HETATM 7664 O  O     . HOH OA 7 .   ? 61.121  -10.467 -2.287  1.000 50.497  ? 4584 HOH D O     1 
HETATM 7665 O  O     A HOH OA 7 .   ? 63.517  -26.705 11.065  0.500 38.196  ? 4585 HOH D O     1 
HETATM 7666 O  O     B HOH OA 7 .   ? 65.369  -26.986 11.702  0.500 43.827  ? 4585 HOH D O     1 
HETATM 7667 O  O     . HOH OA 7 .   ? 61.992  -24.367 -15.735 0.500 36.134  ? 4586 HOH D O     1 
HETATM 7668 O  O     . HOH OA 7 .   ? 64.112  -16.709 7.230   1.000 46.758  ? 4587 HOH D O     1 
HETATM 7669 O  O     . HOH OA 7 .   ? 73.125  -25.578 6.971   0.500 39.971  ? 4588 HOH D O     1 
HETATM 7670 O  O     . HOH OA 7 .   ? 73.153  -29.854 3.122   1.000 49.930  ? 4589 HOH D O     1 
HETATM 7671 O  O     A HOH OA 7 .   ? 59.798  -20.172 -16.437 0.600 39.855  ? 4590 HOH D O     1 
HETATM 7672 O  O     B HOH OA 7 .   ? 59.427  -21.062 -18.147 0.400 47.907  ? 4590 HOH D O     1 
HETATM 7673 O  O     . HOH OA 7 .   ? 59.674  -33.526 5.546   0.500 35.306  ? 4591 HOH D O     1 
HETATM 7674 O  O     . HOH OA 7 .   ? 63.529  -14.409 6.137   1.000 54.388  ? 4592 HOH D O     1 
HETATM 7675 O  O     . HOH OA 7 .   ? 70.129  -38.404 0.956   1.000 45.908  ? 4593 HOH D O     1 
HETATM 7676 O  O     . HOH OA 7 .   ? 72.031  -22.151 9.227   0.500 39.831  ? 4594 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 5   ? 0.875 0.480 0.748 0.045  -0.102 0.037  6800 SER A N   
2    C CA  . SER A 5   ? 0.793 0.446 0.683 0.059  -0.088 0.025  6800 SER A CA  
3    C C   . SER A 5   ? 0.736 0.434 0.642 0.043  -0.075 0.034  6800 SER A C   
4    O O   . SER A 5   ? 0.772 0.471 0.676 0.033  -0.076 0.048  6800 SER A O   
5    C CB  . SER A 5   ? 0.813 0.470 0.702 0.088  -0.092 0.019  6800 SER A CB  
6    O OG  . SER A 5   ? 0.742 0.451 0.648 0.097  -0.078 0.010  6800 SER A OG  
7    N N   A GLN A 6   ? 0.672 0.404 0.590 0.043  -0.062 0.025  6801 GLN A N   
8    N N   B GLN A 6   ? 0.675 0.406 0.593 0.043  -0.062 0.025  6801 GLN A N   
9    C CA  A GLN A 6   ? 0.615 0.384 0.545 0.030  -0.051 0.030  6801 GLN A CA  
10   C CA  B GLN A 6   ? 0.617 0.386 0.547 0.030  -0.050 0.030  6801 GLN A CA  
11   C C   A GLN A 6   ? 0.570 0.370 0.508 0.042  -0.046 0.028  6801 GLN A C   
12   C C   B GLN A 6   ? 0.574 0.375 0.512 0.042  -0.045 0.028  6801 GLN A C   
13   O O   A GLN A 6   ? 0.517 0.344 0.462 0.033  -0.038 0.032  6801 GLN A O   
14   O O   B GLN A 6   ? 0.534 0.361 0.479 0.033  -0.037 0.030  6801 GLN A O   
15   C CB  A GLN A 6   ? 0.599 0.380 0.534 0.020  -0.043 0.024  6801 GLN A CB  
16   C CB  B GLN A 6   ? 0.602 0.382 0.537 0.022  -0.043 0.022  6801 GLN A CB  
17   C CG  A GLN A 6   ? 0.633 0.390 0.561 0.005  -0.048 0.028  6801 GLN A CG  
18   C CG  B GLN A 6   ? 0.614 0.398 0.549 0.037  -0.041 0.008  6801 GLN A CG  
19   C CD  A GLN A 6   ? 0.617 0.382 0.549 0.000  -0.043 0.019  6801 GLN A CD  
20   C CD  B GLN A 6   ? 0.612 0.400 0.549 0.028  -0.037 0.002  6801 GLN A CD  
21   O OE1 A GLN A 6   ? 0.673 0.442 0.605 0.013  -0.041 0.008  6801 GLN A OE1 
22   O OE1 B GLN A 6   ? 0.664 0.449 0.601 0.012  -0.036 0.008  6801 GLN A OE1 
23   N NE2 A GLN A 6   ? 0.596 0.364 0.528 -0.017 -0.042 0.025  6801 GLN A NE2 
24   N NE2 B GLN A 6   ? 0.604 0.402 0.542 0.040  -0.034 -0.009 6801 GLN A NE2 
25   N N   . ALA A 7   ? 0.565 0.361 0.501 0.063  -0.051 0.023  6802 ALA A N   
26   C CA  . ALA A 7   ? 0.543 0.376 0.488 0.075  -0.047 0.021  6802 ALA A CA  
27   C C   . ALA A 7   ? 0.508 0.353 0.454 0.068  -0.048 0.033  6802 ALA A C   
28   O O   . ALA A 7   ? 0.493 0.374 0.448 0.070  -0.043 0.033  6802 ALA A O   
29   C CB  . ALA A 7   ? 0.584 0.413 0.525 0.101  -0.054 0.013  6802 ALA A CB  
30   N N   . TRP A 8   ? 0.498 0.318 0.436 0.059  -0.055 0.044  6803 TRP A N   
31   C CA  . TRP A 8   ? 0.489 0.323 0.426 0.053  -0.055 0.056  6803 TRP A CA  
32   C C   . TRP A 8   ? 0.454 0.301 0.393 0.032  -0.047 0.060  6803 TRP A C   
33   O O   . TRP A 8   ? 0.446 0.309 0.385 0.026  -0.047 0.068  6803 TRP A O   
34   C CB  . TRP A 8   ? 0.535 0.339 0.460 0.058  -0.068 0.067  6803 TRP A CB  
35   C CG  . TRP A 8   ? 0.549 0.348 0.473 0.084  -0.076 0.063  6803 TRP A CG  
36   C CD1 . TRP A 8   ? 0.549 0.377 0.478 0.096  -0.078 0.066  6803 TRP A CD1 
37   C CD2 . TRP A 8   ? 0.569 0.337 0.485 0.102  -0.084 0.055  6803 TRP A CD2 
38   N NE1 . TRP A 8   ? 0.569 0.388 0.496 0.123  -0.086 0.059  6803 TRP A NE1 
39   C CE2 . TRP A 8   ? 0.582 0.362 0.499 0.128  -0.090 0.052  6803 TRP A CE2 
40   C CE3 . TRP A 8   ? 0.594 0.325 0.501 0.100  -0.088 0.048  6803 TRP A CE3 
41   C CZ2 . TRP A 8   ? 0.611 0.367 0.520 0.155  -0.099 0.042  6803 TRP A CZ2 
42   C CZ3 . TRP A 8   ? 0.623 0.327 0.521 0.123  -0.098 0.038  6803 TRP A CZ3 
43   C CH2 . TRP A 8   ? 0.637 0.353 0.535 0.152  -0.103 0.034  6803 TRP A CH2 
44   N N   . GLN A 9   ? 0.428 0.273 0.370 0.023  -0.041 0.054  6804 GLN A N   
45   C CA  . GLN A 9   ? 0.413 0.272 0.356 0.008  -0.033 0.055  6804 GLN A CA  
46   C C   . GLN A 9   ? 0.370 0.256 0.319 0.009  -0.026 0.047  6804 GLN A C   
47   O O   . GLN A 9   ? 0.360 0.255 0.314 0.019  -0.027 0.041  6804 GLN A O   
48   C CB  . GLN A 9   ? 0.431 0.279 0.373 -0.001 -0.031 0.052  6804 GLN A CB  
49   C CG  . GLN A 9   ? 0.478 0.297 0.412 -0.007 -0.039 0.060  6804 GLN A CG  
50   C CD  . GLN A 9   ? 0.508 0.318 0.443 -0.015 -0.038 0.055  6804 GLN A CD  
51   O OE1 . GLN A 9   ? 0.525 0.351 0.466 -0.015 -0.030 0.047  6804 GLN A OE1 
52   N NE2 . GLN A 9   ? 0.532 0.316 0.459 -0.023 -0.046 0.062  6804 GLN A NE2 
53   N N   . PRO A 10  ? 0.350 0.250 0.297 -0.001 -0.021 0.047  6805 PRO A N   
54   C CA  . PRO A 10  ? 0.333 0.250 0.283 -0.002 -0.017 0.041  6805 PRO A CA  
55   C C   . PRO A 10  ? 0.319 0.233 0.273 -0.002 -0.013 0.032  6805 PRO A C   
56   O O   . PRO A 10  ? 0.318 0.244 0.273 -0.003 -0.011 0.028  6805 PRO A O   
57   C CB  . PRO A 10  ? 0.330 0.254 0.273 -0.011 -0.014 0.042  6805 PRO A CB  
58   C CG  . PRO A 10  ? 0.343 0.257 0.282 -0.015 -0.014 0.048  6805 PRO A CG  
59   C CD  . PRO A 10  ? 0.359 0.259 0.300 -0.011 -0.020 0.055  6805 PRO A CD  
60   N N   . GLY A 11  ? 0.321 0.219 0.274 -0.002 -0.013 0.032  6806 GLY A N   
61   C CA  . GLY A 11  ? 0.319 0.215 0.274 -0.002 -0.009 0.025  6806 GLY A CA  
62   C C   . GLY A 11  ? 0.323 0.203 0.277 -0.005 -0.010 0.025  6806 GLY A C   
63   O O   . GLY A 11  ? 0.337 0.207 0.289 -0.007 -0.015 0.032  6806 GLY A O   
64   N N   . VAL A 12  ? 0.319 0.199 0.274 -0.006 -0.007 0.020  6807 VAL A N   
65   C CA  . VAL A 12  ? 0.333 0.202 0.287 -0.011 -0.009 0.020  6807 VAL A CA  
66   C C   . VAL A 12  ? 0.322 0.202 0.277 -0.015 -0.004 0.018  6807 VAL A C   
67   O O   . VAL A 12  ? 0.306 0.191 0.261 -0.012 -0.001 0.013  6807 VAL A O   
68   C CB  . VAL A 12  ? 0.350 0.207 0.305 -0.005 -0.012 0.014  6807 VAL A CB  
69   C CG1 . VAL A 12  ? 0.373 0.216 0.326 -0.012 -0.016 0.015  6807 VAL A CG1 
70   C CG2 . VAL A 12  ? 0.383 0.231 0.337 0.005  -0.017 0.014  6807 VAL A CG2 
71   N N   . ALA A 13  ? 0.317 0.201 0.271 -0.023 -0.004 0.024  6808 ALA A N   
72   C CA  . ALA A 13  ? 0.318 0.217 0.273 -0.024 0.000  0.022  6808 ALA A CA  
73   C C   . ALA A 13  ? 0.327 0.222 0.285 -0.027 -0.002 0.019  6808 ALA A C   
74   O O   . ALA A 13  ? 0.336 0.218 0.294 -0.033 -0.008 0.022  6808 ALA A O   
75   C CB  . ALA A 13  ? 0.326 0.240 0.279 -0.030 0.001  0.028  6808 ALA A CB  
76   N N   . MET A 14  ? 0.330 0.233 0.288 -0.024 0.001  0.014  6809 MET A N   
77   C CA  . MET A 14  ? 0.335 0.239 0.296 -0.027 -0.002 0.012  6809 MET A CA  
78   C C   . MET A 14  ? 0.338 0.252 0.302 -0.038 -0.004 0.019  6809 MET A C   
79   O O   . MET A 14  ? 0.339 0.275 0.304 -0.040 -0.001 0.023  6809 MET A O   
80   C CB  . MET A 14  ? 0.338 0.252 0.298 -0.020 0.002  0.007  6809 MET A CB  
81   C CG  . MET A 14  ? 0.344 0.261 0.306 -0.022 -0.001 0.004  6809 MET A CG  
82   S SD  . MET A 14  ? 0.380 0.306 0.338 -0.012 0.001  0.000  6809 MET A SD  
83   C CE  . MET A 14  ? 0.403 0.354 0.363 -0.008 0.004  0.003  6809 MET A CE  
84   N N   . PRO A 15  ? 0.342 0.241 0.305 -0.047 -0.011 0.020  6810 PRO A N   
85   C CA  . PRO A 15  ? 0.354 0.263 0.319 -0.063 -0.015 0.029  6810 PRO A CA  
86   C C   . PRO A 15  ? 0.345 0.288 0.316 -0.064 -0.012 0.029  6810 PRO A C   
87   O O   . PRO A 15  ? 0.336 0.282 0.308 -0.055 -0.010 0.021  6810 PRO A O   
88   C CB  . PRO A 15  ? 0.382 0.261 0.341 -0.069 -0.024 0.026  6810 PRO A CB  
89   C CG  . PRO A 15  ? 0.380 0.234 0.335 -0.056 -0.025 0.020  6810 PRO A CG  
90   C CD  . PRO A 15  ? 0.355 0.226 0.313 -0.043 -0.016 0.014  6810 PRO A CD  
91   N N   . ASN A 16  ? 0.338 0.309 0.313 -0.075 -0.011 0.038  6811 ASN A N   
92   C CA  . ASN A 16  ? 0.336 0.348 0.318 -0.074 -0.008 0.039  6811 ASN A CA  
93   C C   . ASN A 16  ? 0.343 0.357 0.328 -0.079 -0.012 0.035  6811 ASN A C   
94   O O   . ASN A 16  ? 0.335 0.373 0.323 -0.068 -0.009 0.030  6811 ASN A O   
95   C CB  . ASN A 16  ? 0.340 0.387 0.326 -0.088 -0.007 0.051  6811 ASN A CB  
96   C CG  . ASN A 16  ? 0.358 0.422 0.342 -0.079 0.000  0.053  6811 ASN A CG  
97   O OD1 . ASN A 16  ? 0.349 0.403 0.329 -0.060 0.005  0.044  6811 ASN A OD1 
98   N ND2 . ASN A 16  ? 0.352 0.440 0.337 -0.094 0.000  0.065  6811 ASN A ND2 
99   N N   A LEU A 17  ? 0.363 0.349 0.343 -0.093 -0.021 0.036  6812 LEU A N   
100  N N   B LEU A 17  ? 0.359 0.345 0.339 -0.092 -0.021 0.036  6812 LEU A N   
101  C CA  A LEU A 17  ? 0.376 0.363 0.356 -0.099 -0.027 0.032  6812 LEU A CA  
102  C CA  B LEU A 17  ? 0.368 0.356 0.349 -0.099 -0.027 0.032  6812 LEU A CA  
103  C C   A LEU A 17  ? 0.367 0.351 0.347 -0.080 -0.023 0.020  6812 LEU A C   
104  C C   B LEU A 17  ? 0.362 0.347 0.343 -0.080 -0.023 0.020  6812 LEU A C   
105  O O   A LEU A 17  ? 0.355 0.361 0.339 -0.080 -0.024 0.018  6812 LEU A O   
106  O O   B LEU A 17  ? 0.356 0.360 0.339 -0.081 -0.025 0.018  6812 LEU A O   
107  C CB  A LEU A 17  ? 0.406 0.354 0.377 -0.114 -0.038 0.032  6812 LEU A CB  
108  C CB  B LEU A 17  ? 0.392 0.341 0.363 -0.115 -0.038 0.032  6812 LEU A CB  
109  C CG  A LEU A 17  ? 0.433 0.386 0.403 -0.141 -0.047 0.045  6812 LEU A CG  
110  C CG  B LEU A 17  ? 0.403 0.353 0.373 -0.126 -0.047 0.029  6812 LEU A CG  
111  C CD1 A LEU A 17  ? 0.469 0.369 0.425 -0.152 -0.059 0.045  6812 LEU A CD1 
112  C CD1 B LEU A 17  ? 0.394 0.395 0.375 -0.140 -0.046 0.037  6812 LEU A CD1 
113  C CD2 A LEU A 17  ? 0.441 0.434 0.419 -0.155 -0.049 0.048  6812 LEU A CD2 
114  C CD2 B LEU A 17  ? 0.440 0.345 0.396 -0.142 -0.060 0.028  6812 LEU A CD2 
115  N N   . TYR A 18  ? 0.364 0.327 0.340 -0.065 -0.018 0.014  6813 TYR A N   
116  C CA  . TYR A 18  ? 0.360 0.320 0.333 -0.050 -0.015 0.006  6813 TYR A CA  
117  C C   . TYR A 18  ? 0.365 0.355 0.342 -0.040 -0.011 0.007  6813 TYR A C   
118  O O   . TYR A 18  ? 0.376 0.371 0.352 -0.033 -0.011 0.002  6813 TYR A O   
119  C CB  . TYR A 18  ? 0.358 0.293 0.325 -0.039 -0.012 0.002  6813 TYR A CB  
120  C CG  . TYR A 18  ? 0.374 0.281 0.336 -0.042 -0.016 -0.002 6813 TYR A CG  
121  C CD1 . TYR A 18  ? 0.381 0.278 0.338 -0.039 -0.019 -0.010 6813 TYR A CD1 
122  C CD2 . TYR A 18  ? 0.387 0.276 0.347 -0.047 -0.019 0.002  6813 TYR A CD2 
123  C CE1 . TYR A 18  ? 0.394 0.265 0.343 -0.039 -0.024 -0.016 6813 TYR A CE1 
124  C CE2 . TYR A 18  ? 0.401 0.262 0.354 -0.046 -0.025 -0.003 6813 TYR A CE2 
125  C CZ  . TYR A 18  ? 0.403 0.256 0.351 -0.041 -0.027 -0.013 6813 TYR A CZ  
126  O OH  . TYR A 18  ? 0.429 0.254 0.368 -0.036 -0.033 -0.020 6813 TYR A OH  
127  N N   . LYS A 19  ? 0.371 0.383 0.353 -0.038 -0.007 0.012  6814 LYS A N   
128  C CA  . LYS A 19  ? 0.365 0.405 0.348 -0.024 -0.003 0.011  6814 LYS A CA  
129  C C   . LYS A 19  ? 0.371 0.446 0.362 -0.027 -0.006 0.012  6814 LYS A C   
130  O O   . LYS A 19  ? 0.368 0.461 0.359 -0.011 -0.005 0.009  6814 LYS A O   
131  C CB  . LYS A 19  ? 0.373 0.435 0.359 -0.022 0.002  0.015  6814 LYS A CB  
132  C CG  . LYS A 19  ? 0.377 0.413 0.356 -0.019 0.004  0.014  6814 LYS A CG  
133  C CD  . LYS A 19  ? 0.387 0.450 0.367 -0.018 0.008  0.019  6814 LYS A CD  
134  C CE  . LYS A 19  ? 0.397 0.438 0.370 -0.017 0.010  0.019  6814 LYS A CE  
135  N NZ  . LYS A 19  ? 0.391 0.463 0.365 -0.018 0.014  0.024  6814 LYS A NZ  
136  N N   . MET A 20  ? 0.364 0.444 0.359 -0.047 -0.011 0.017  6815 MET A N   
137  C CA  . MET A 20  ? 0.379 0.496 0.382 -0.055 -0.015 0.020  6815 MET A CA  
138  C C   . MET A 20  ? 0.361 0.461 0.361 -0.057 -0.021 0.014  6815 MET A C   
139  O O   . MET A 20  ? 0.341 0.470 0.346 -0.065 -0.026 0.016  6815 MET A O   
140  C CB  . MET A 20  ? 0.424 0.561 0.433 -0.080 -0.019 0.030  6815 MET A CB  
141  C CG  . MET A 20  ? 0.458 0.620 0.471 -0.079 -0.013 0.037  6815 MET A CG  
142  S SD  . MET A 20  ? 0.585 0.771 0.603 -0.112 -0.018 0.052  6815 MET A SD  
143  C CE  . MET A 20  ? 0.596 0.711 0.601 -0.125 -0.026 0.052  6815 MET A CE  
144  N N   . GLN A 21  ? 0.351 0.410 0.340 -0.050 -0.021 0.007  6816 GLN A N   
145  C CA  . GLN A 21  ? 0.356 0.402 0.340 -0.051 -0.026 0.001  6816 GLN A CA  
146  C C   . GLN A 21  ? 0.346 0.403 0.328 -0.032 -0.024 -0.002 6816 GLN A C   
147  O O   . GLN A 21  ? 0.319 0.388 0.302 -0.018 -0.019 0.000  6816 GLN A O   
148  C CB  . GLN A 21  ? 0.367 0.370 0.342 -0.053 -0.027 -0.005 6816 GLN A CB  
149  C CG  . GLN A 21  ? 0.379 0.364 0.352 -0.069 -0.031 -0.001 6816 GLN A CG  
150  C CD  . GLN A 21  ? 0.399 0.402 0.377 -0.089 -0.039 0.004  6816 GLN A CD  
151  O OE1 . GLN A 21  ? 0.412 0.421 0.388 -0.095 -0.045 0.000  6816 GLN A OE1 
152  N NE2 . GLN A 21  ? 0.376 0.389 0.358 -0.103 -0.040 0.013  6816 GLN A NE2 
153  N N   A ARG A 22  ? 0.353 0.406 0.330 -0.032 -0.028 -0.006 6817 ARG A N   
154  N N   B ARG A 22  ? 0.356 0.409 0.333 -0.033 -0.028 -0.006 6817 ARG A N   
155  C CA  A ARG A 22  ? 0.363 0.422 0.335 -0.016 -0.027 -0.007 6817 ARG A CA  
156  C CA  B ARG A 22  ? 0.367 0.428 0.339 -0.017 -0.028 -0.007 6817 ARG A CA  
157  C C   A ARG A 22  ? 0.362 0.393 0.322 -0.016 -0.029 -0.012 6817 ARG A C   
158  C C   B ARG A 22  ? 0.364 0.395 0.324 -0.016 -0.029 -0.012 6817 ARG A C   
159  O O   A ARG A 22  ? 0.359 0.398 0.316 -0.018 -0.034 -0.014 6817 ARG A O   
160  O O   B ARG A 22  ? 0.358 0.396 0.315 -0.019 -0.034 -0.015 6817 ARG A O   
161  C CB  A ARG A 22  ? 0.378 0.478 0.357 -0.014 -0.032 -0.004 6817 ARG A CB  
162  C CB  B ARG A 22  ? 0.391 0.488 0.369 -0.021 -0.034 -0.005 6817 ARG A CB  
163  C CG  A ARG A 22  ? 0.400 0.509 0.375 0.007  -0.031 -0.003 6817 ARG A CG  
164  C CG  B ARG A 22  ? 0.409 0.547 0.401 -0.025 -0.033 0.001  6817 ARG A CG  
165  C CD  A ARG A 22  ? 0.414 0.570 0.399 0.014  -0.035 0.000  6817 ARG A CD  
166  C CD  B ARG A 22  ? 0.436 0.615 0.436 -0.035 -0.040 0.003  6817 ARG A CD  
167  N NE  A ARG A 22  ? 0.430 0.589 0.409 0.040  -0.034 0.001  6817 ARG A NE  
168  N NE  B ARG A 22  ? 0.453 0.642 0.449 -0.020 -0.043 0.001  6817 ARG A NE  
169  C CZ  A ARG A 22  ? 0.437 0.602 0.417 0.053  -0.030 0.001  6817 ARG A CZ  
170  C CZ  B ARG A 22  ? 0.473 0.648 0.460 -0.026 -0.049 -0.003 6817 ARG A CZ  
171  N NH1 A ARG A 22  ? 0.453 0.613 0.424 0.078  -0.031 0.000  6817 ARG A NH1 
172  N NH1 B ARG A 22  ? 0.481 0.631 0.463 -0.044 -0.052 -0.007 6817 ARG A NH1 
173  N NH2 A ARG A 22  ? 0.430 0.603 0.418 0.041  -0.025 0.002  6817 ARG A NH2 
174  N NH2 B ARG A 22  ? 0.490 0.678 0.473 -0.012 -0.052 -0.003 6817 ARG A NH2 
175  N N   . MET A 23  ? 0.360 0.363 0.315 -0.013 -0.024 -0.014 6818 MET A N   
176  C CA  . MET A 23  ? 0.380 0.363 0.324 -0.012 -0.024 -0.018 6818 MET A CA  
177  C C   . MET A 23  ? 0.387 0.370 0.323 -0.001 -0.023 -0.015 6818 MET A C   
178  O O   . MET A 23  ? 0.378 0.364 0.314 0.008  -0.023 -0.010 6818 MET A O   
179  C CB  . MET A 23  ? 0.394 0.355 0.337 -0.013 -0.020 -0.020 6818 MET A CB  
180  C CG  . MET A 23  ? 0.413 0.367 0.362 -0.023 -0.021 -0.021 6818 MET A CG  
181  S SD  . MET A 23  ? 0.485 0.437 0.430 -0.035 -0.030 -0.028 6818 MET A SD  
182  C CE  . MET A 23  ? 0.483 0.419 0.415 -0.027 -0.030 -0.037 6818 MET A CE  
183  N N   . LEU A 24  ? 0.405 0.385 0.332 -0.002 -0.025 -0.019 6819 LEU A N   
184  C CA  . LEU A 24  ? 0.394 0.372 0.310 0.004  -0.025 -0.014 6819 LEU A CA  
185  C C   . LEU A 24  ? 0.379 0.338 0.290 0.004  -0.020 -0.012 6819 LEU A C   
186  O O   . LEU A 24  ? 0.356 0.310 0.270 0.000  -0.017 -0.018 6819 LEU A O   
187  C CB  . LEU A 24  ? 0.412 0.400 0.321 0.001  -0.029 -0.018 6819 LEU A CB  
188  C CG  . LEU A 24  ? 0.433 0.422 0.329 0.007  -0.031 -0.011 6819 LEU A CG  
189  C CD1 . LEU A 24  ? 0.460 0.455 0.356 0.016  -0.035 -0.003 6819 LEU A CD1 
190  C CD2 . LEU A 24  ? 0.457 0.459 0.344 0.003  -0.033 -0.016 6819 LEU A CD2 
191  N N   . LEU A 25  ? 0.383 0.333 0.286 0.009  -0.020 -0.005 6820 LEU A N   
192  C CA  . LEU A 25  ? 0.398 0.333 0.296 0.005  -0.016 -0.002 6820 LEU A CA  
193  C C   . LEU A 25  ? 0.403 0.346 0.294 0.000  -0.014 -0.003 6820 LEU A C   
194  O O   . LEU A 25  ? 0.423 0.378 0.308 0.000  -0.017 -0.003 6820 LEU A O   
195  C CB  . LEU A 25  ? 0.436 0.355 0.324 0.009  -0.020 0.007  6820 LEU A CB  
196  C CG  . LEU A 25  ? 0.460 0.364 0.341 0.003  -0.018 0.012  6820 LEU A CG  
197  C CD1 . LEU A 25  ? 0.456 0.355 0.347 0.002  -0.014 0.008  6820 LEU A CD1 
198  C CD2 . LEU A 25  ? 0.524 0.404 0.388 0.005  -0.024 0.022  6820 LEU A CD2 
199  N N   . GLU A 26  ? 0.391 0.333 0.284 -0.003 -0.010 -0.005 6821 GLU A N   
200  C CA  . GLU A 26  ? 0.409 0.365 0.296 -0.007 -0.007 -0.006 6821 GLU A CA  
201  C C   . GLU A 26  ? 0.381 0.337 0.271 -0.010 -0.003 -0.004 6821 GLU A C   
202  O O   . GLU A 26  ? 0.369 0.310 0.265 -0.010 -0.003 -0.002 6821 GLU A O   
203  C CB  . GLU A 26  ? 0.446 0.416 0.334 -0.003 -0.007 -0.018 6821 GLU A CB  
204  C CG  . GLU A 26  ? 0.485 0.447 0.382 0.000  -0.006 -0.028 6821 GLU A CG  
205  C CD  . GLU A 26  ? 0.556 0.523 0.449 0.003  -0.009 -0.041 6821 GLU A CD  
206  O OE1 . GLU A 26  ? 0.579 0.550 0.468 0.001  -0.013 -0.042 6821 GLU A OE1 
207  O OE2 . GLU A 26  ? 0.596 0.564 0.488 0.008  -0.007 -0.050 6821 GLU A OE2 
208  N N   . LYS A 27  ? 0.375 0.350 0.260 -0.013 0.001  -0.004 6822 LYS A N   
209  C CA  . LYS A 27  ? 0.375 0.358 0.264 -0.017 0.005  0.000  6822 LYS A CA  
210  C C   . LYS A 27  ? 0.359 0.335 0.260 -0.010 0.007  -0.009 6822 LYS A C   
211  O O   . LYS A 27  ? 0.335 0.308 0.240 -0.002 0.006  -0.020 6822 LYS A O   
212  C CB  . LYS A 27  ? 0.403 0.419 0.287 -0.018 0.009  -0.001 6822 LYS A CB  
213  C CG  . LYS A 27  ? 0.429 0.463 0.318 -0.023 0.013  0.004  6822 LYS A CG  
214  C CD  . LYS A 27  ? 0.455 0.530 0.339 -0.025 0.017  0.004  6822 LYS A CD  
215  C CE  . LYS A 27  ? 0.481 0.581 0.371 -0.033 0.021  0.012  6822 LYS A CE  
216  N NZ  . LYS A 27  ? 0.510 0.603 0.412 -0.023 0.022  0.003  6822 LYS A NZ  
217  N N   . CYS A 28  ? 0.352 0.322 0.256 -0.015 0.008  -0.003 6823 CYS A N   
218  C CA  . CYS A 28  ? 0.357 0.325 0.272 -0.009 0.009  -0.010 6823 CYS A CA  
219  C C   . CYS A 28  ? 0.377 0.373 0.294 -0.005 0.013  -0.013 6823 CYS A C   
220  O O   . CYS A 28  ? 0.391 0.406 0.305 -0.014 0.015  -0.005 6823 CYS A O   
221  C CB  . CYS A 28  ? 0.361 0.313 0.279 -0.015 0.008  -0.003 6823 CYS A CB  
222  S SG  . CYS A 28  ? 0.361 0.309 0.290 -0.009 0.009  -0.009 6823 CYS A SG  
223  N N   . ASP A 29  ? 0.386 0.385 0.306 0.007  0.013  -0.025 6824 ASP A N   
224  C CA  . ASP A 29  ? 0.408 0.437 0.329 0.017  0.017  -0.032 6824 ASP A CA  
225  C C   . ASP A 29  ? 0.399 0.416 0.327 0.028  0.015  -0.039 6824 ASP A C   
226  O O   . ASP A 29  ? 0.399 0.395 0.325 0.038  0.011  -0.049 6824 ASP A O   
227  C CB  . ASP A 29  ? 0.469 0.508 0.380 0.025  0.017  -0.042 6824 ASP A CB  
228  C CG  . ASP A 29  ? 0.540 0.618 0.449 0.037  0.021  -0.050 6824 ASP A CG  
229  O OD1 . ASP A 29  ? 0.576 0.681 0.491 0.036  0.025  -0.044 6824 ASP A OD1 
230  O OD2 . ASP A 29  ? 0.656 0.738 0.556 0.048  0.020  -0.062 6824 ASP A OD2 
231  N N   . LEU A 30  ? 0.381 0.409 0.315 0.026  0.017  -0.033 6825 LEU A N   
232  C CA  . LEU A 30  ? 0.398 0.414 0.339 0.036  0.015  -0.037 6825 LEU A CA  
233  C C   . LEU A 30  ? 0.420 0.459 0.360 0.055  0.015  -0.048 6825 LEU A C   
234  O O   . LEU A 30  ? 0.396 0.476 0.338 0.056  0.020  -0.046 6825 LEU A O   
235  C CB  . LEU A 30  ? 0.377 0.396 0.324 0.025  0.015  -0.026 6825 LEU A CB  
236  C CG  . LEU A 30  ? 0.363 0.357 0.309 0.010  0.014  -0.018 6825 LEU A CG  
237  C CD1 . LEU A 30  ? 0.360 0.355 0.309 0.001  0.013  -0.009 6825 LEU A CD1 
238  C CD2 . LEU A 30  ? 0.368 0.329 0.313 0.014  0.010  -0.023 6825 LEU A CD2 
239  N N   . GLN A 31  ? 0.491 0.503 0.428 0.070  0.010  -0.058 6826 GLN A N   
240  C CA  . GLN A 31  ? 0.578 0.604 0.512 0.093  0.008  -0.071 6826 GLN A CA  
241  C C   . GLN A 31  ? 0.587 0.643 0.531 0.099  0.011  -0.066 6826 GLN A C   
242  O O   . GLN A 31  ? 0.602 0.699 0.547 0.113  0.014  -0.071 6826 GLN A O   
243  C CB  . GLN A 31  ? 0.668 0.647 0.593 0.105  -0.001 -0.082 6826 GLN A CB  
244  C CG  . GLN A 31  ? 0.772 0.757 0.689 0.134  -0.005 -0.097 6826 GLN A CG  
245  C CD  . GLN A 31  ? 0.861 0.791 0.765 0.144  -0.017 -0.107 6826 GLN A CD  
246  O OE1 . GLN A 31  ? 0.940 0.832 0.844 0.128  -0.022 -0.100 6826 GLN A OE1 
247  N NE2 . GLN A 31  ? 0.961 0.886 0.853 0.171  -0.022 -0.123 6826 GLN A NE2 
248  N N   . ASN A 32  ? 0.595 0.635 0.546 0.087  0.009  -0.055 6827 ASN A N   
249  C CA  . ASN A 32  ? 0.627 0.693 0.588 0.091  0.010  -0.049 6827 ASN A CA  
250  C C   . ASN A 32  ? 0.646 0.749 0.613 0.071  0.016  -0.037 6827 ASN A C   
251  O O   . ASN A 32  ? 0.633 0.749 0.608 0.065  0.016  -0.029 6827 ASN A O   
252  C CB  . ASN A 32  ? 0.603 0.631 0.566 0.089  0.004  -0.044 6827 ASN A CB  
253  C CG  . ASN A 32  ? 0.626 0.614 0.579 0.105  -0.004 -0.054 6827 ASN A CG  
254  O OD1 . ASN A 32  ? 0.591 0.578 0.536 0.121  -0.005 -0.067 6827 ASN A OD1 
255  N ND2 . ASN A 32  ? 0.633 0.588 0.586 0.102  -0.009 -0.049 6827 ASN A ND2 
256  N N   . TYR A 33  ? 0.637 0.696 0.672 0.069  -0.001 -0.092 6828 TYR A N   
257  C CA  . TYR A 33  ? 0.692 0.760 0.718 0.064  0.005  -0.083 6828 TYR A CA  
258  C C   . TYR A 33  ? 0.711 0.792 0.750 0.065  0.006  -0.085 6828 TYR A C   
259  O O   . TYR A 33  ? 0.707 0.799 0.759 0.072  0.005  -0.097 6828 TYR A O   
260  C CB  . TYR A 33  ? 0.774 0.856 0.787 0.064  0.011  -0.083 6828 TYR A CB  
261  C CG  . TYR A 33  ? 0.869 0.961 0.873 0.059  0.018  -0.074 6828 TYR A CG  
262  C CD1 . TYR A 33  ? 0.924 1.004 0.915 0.053  0.018  -0.062 6828 TYR A CD1 
263  C CD2 . TYR A 33  ? 0.921 1.035 0.929 0.060  0.024  -0.079 6828 TYR A CD2 
264  C CE1 . TYR A 33  ? 0.962 1.048 0.944 0.048  0.024  -0.053 6828 TYR A CE1 
265  C CE2 . TYR A 33  ? 0.969 1.092 0.968 0.054  0.030  -0.070 6828 TYR A CE2 
266  C CZ  . TYR A 33  ? 1.000 1.108 0.986 0.047  0.030  -0.057 6828 TYR A CZ  
267  O OH  . TYR A 33  ? 1.089 1.203 1.066 0.041  0.037  -0.047 6828 TYR A OH  
268  N N   . GLY A 34  ? 0.750 0.832 0.787 0.059  0.009  -0.075 6829 GLY A N   
269  C CA  . GLY A 34  ? 0.827 0.924 0.878 0.059  0.010  -0.078 6829 GLY A CA  
270  C C   . GLY A 34  ? 0.849 0.936 0.914 0.063  0.002  -0.080 6829 GLY A C   
271  O O   . GLY A 34  ? 0.972 1.066 1.047 0.060  0.002  -0.078 6829 GLY A O   
272  N N   . ASP A 35  ? 0.815 0.888 0.884 0.067  -0.005 -0.085 6830 ASP A N   
273  C CA  . ASP A 35  ? 0.768 0.827 0.848 0.071  -0.014 -0.086 6830 ASP A CA  
274  C C   . ASP A 35  ? 0.770 0.818 0.846 0.063  -0.016 -0.073 6830 ASP A C   
275  O O   . ASP A 35  ? 0.724 0.770 0.786 0.056  -0.011 -0.065 6830 ASP A O   
276  C CB  . ASP A 35  ? 0.760 0.798 0.840 0.074  -0.021 -0.089 6830 ASP A CB  
277  C CG  . ASP A 35  ? 0.759 0.804 0.850 0.083  -0.023 -0.103 6830 ASP A CG  
278  O OD1 . ASP A 35  ? 0.748 0.816 0.845 0.087  -0.018 -0.112 6830 ASP A OD1 
279  O OD2 . ASP A 35  ? 0.680 0.708 0.773 0.085  -0.029 -0.106 6830 ASP A OD2 
280  N N   . SER A 36  ? 0.759 0.798 0.844 0.066  -0.024 -0.073 6831 SER A N   
281  C CA  . SER A 36  ? 0.731 0.759 0.812 0.059  -0.028 -0.062 6831 SER A CA  
282  C C   . SER A 36  ? 0.692 0.701 0.777 0.063  -0.039 -0.061 6831 SER A C   
283  O O   . SER A 36  ? 0.699 0.711 0.799 0.071  -0.044 -0.069 6831 SER A O   
284  C CB  . SER A 36  ? 0.731 0.778 0.820 0.057  -0.025 -0.061 6831 SER A CB  
285  O OG  . SER A 36  ? 0.769 0.829 0.849 0.051  -0.015 -0.059 6831 SER A OG  
286  N N   . ALA A 37  ? 0.614 0.605 0.687 0.057  -0.042 -0.051 6832 ALA A N   
287  C CA  . ALA A 37  ? 0.592 0.564 0.666 0.059  -0.052 -0.047 6832 ALA A CA  
288  C C   . ALA A 37  ? 0.558 0.537 0.643 0.060  -0.058 -0.047 6832 ALA A C   
289  O O   . ALA A 37  ? 0.516 0.514 0.605 0.058  -0.053 -0.047 6832 ALA A O   
290  C CB  . ALA A 37  ? 0.583 0.535 0.639 0.051  -0.052 -0.038 6832 ALA A CB  
291  N N   . THR A 38  ? 0.565 0.532 0.655 0.065  -0.068 -0.046 6833 THR A N   
292  C CA  . THR A 38  ? 0.553 0.527 0.654 0.067  -0.075 -0.045 6833 THR A CA  
293  C C   . THR A 38  ? 0.485 0.447 0.570 0.058  -0.077 -0.034 6833 THR A C   
294  O O   . THR A 38  ? 0.520 0.461 0.595 0.058  -0.084 -0.028 6833 THR A O   
295  C CB  . THR A 38  ? 0.600 0.566 0.713 0.077  -0.087 -0.049 6833 THR A CB  
296  O OG1 . THR A 38  ? 0.645 0.620 0.770 0.084  -0.085 -0.060 6833 THR A OG1 
297  C CG2 . THR A 38  ? 0.607 0.585 0.734 0.080  -0.095 -0.050 6833 THR A CG2 
298  N N   . LEU A 39  ? 0.437 0.412 0.520 0.052  -0.072 -0.032 6834 LEU A N   
299  C CA  . LEU A 39  ? 0.433 0.396 0.502 0.044  -0.074 -0.023 6834 LEU A CA  
300  C C   . LEU A 39  ? 0.406 0.366 0.480 0.047  -0.086 -0.021 6834 LEU A C   
301  O O   . LEU A 39  ? 0.401 0.378 0.494 0.052  -0.090 -0.027 6834 LEU A O   
302  C CB  . LEU A 39  ? 0.437 0.413 0.502 0.036  -0.065 -0.022 6834 LEU A CB  
303  C CG  . LEU A 39  ? 0.444 0.419 0.499 0.033  -0.054 -0.021 6834 LEU A CG  
304  C CD1 . LEU A 39  ? 0.439 0.425 0.492 0.025  -0.047 -0.019 6834 LEU A CD1 
305  C CD2 . LEU A 39  ? 0.466 0.419 0.503 0.030  -0.055 -0.015 6834 LEU A CD2 
306  N N   . PRO A 40  ? 0.388 0.328 0.447 0.044  -0.092 -0.014 6835 PRO A N   
307  C CA  . PRO A 40  ? 0.391 0.329 0.454 0.046  -0.105 -0.011 6835 PRO A CA  
308  C C   . PRO A 40  ? 0.379 0.338 0.453 0.043  -0.104 -0.014 6835 PRO A C   
309  O O   . PRO A 40  ? 0.371 0.337 0.440 0.036  -0.094 -0.014 6835 PRO A O   
310  C CB  . PRO A 40  ? 0.400 0.315 0.440 0.041  -0.108 -0.002 6835 PRO A CB  
311  C CG  . PRO A 40  ? 0.397 0.300 0.426 0.039  -0.100 0.000  6835 PRO A CG  
312  C CD  . PRO A 40  ? 0.388 0.309 0.426 0.038  -0.089 -0.007 6835 PRO A CD  
313  N N   . LYS A 41  ? 0.380 0.347 0.467 0.048  -0.114 -0.017 6836 LYS A N   
314  C CA  . LYS A 41  ? 0.391 0.381 0.493 0.044  -0.114 -0.021 6836 LYS A CA  
315  C C   . LYS A 41  ? 0.375 0.361 0.462 0.033  -0.110 -0.015 6836 LYS A C   
316  O O   . LYS A 41  ? 0.372 0.338 0.440 0.030  -0.115 -0.009 6836 LYS A O   
317  C CB  . LYS A 41  ? 0.421 0.416 0.535 0.051  -0.129 -0.022 6836 LYS A CB  
318  C CG  . LYS A 41  ? 0.441 0.461 0.574 0.048  -0.131 -0.028 6836 LYS A CG  
319  C CD  . LYS A 41  ? 0.481 0.505 0.625 0.055  -0.147 -0.029 6836 LYS A CD  
320  C CE  . LYS A 41  ? 0.503 0.556 0.670 0.053  -0.149 -0.036 6836 LYS A CE  
321  N NZ  . LYS A 41  ? 0.531 0.585 0.687 0.039  -0.143 -0.033 6836 LYS A NZ  
322  N N   . GLY A 42  ? 0.362 0.365 0.457 0.026  -0.101 -0.018 6837 GLY A N   
323  C CA  . GLY A 42  ? 0.357 0.357 0.441 0.015  -0.097 -0.015 6837 GLY A CA  
324  C C   . GLY A 42  ? 0.346 0.325 0.406 0.011  -0.090 -0.009 6837 GLY A C   
325  O O   . GLY A 42  ? 0.343 0.316 0.392 0.003  -0.088 -0.006 6837 GLY A O   
326  N N   . ILE A 43  ? 0.337 0.305 0.389 0.016  -0.087 -0.008 6838 ILE A N   
327  C CA  . ILE A 43  ? 0.338 0.288 0.369 0.012  -0.080 -0.003 6838 ILE A CA  
328  C C   . ILE A 43  ? 0.333 0.292 0.366 0.009  -0.068 -0.004 6838 ILE A C   
329  O O   . ILE A 43  ? 0.331 0.301 0.374 0.014  -0.064 -0.008 6838 ILE A O   
330  C CB  . ILE A 43  ? 0.336 0.270 0.357 0.017  -0.084 0.000  6838 ILE A CB  
331  C CG1 . ILE A 43  ? 0.350 0.273 0.366 0.019  -0.096 0.004  6838 ILE A CG1 
332  C CG2 . ILE A 43  ? 0.337 0.257 0.341 0.013  -0.076 0.004  6838 ILE A CG2 
333  C CD1 . ILE A 43  ? 0.357 0.271 0.357 0.011  -0.098 0.008  6838 ILE A CD1 
334  N N   . MET A 44  ? 0.330 0.282 0.350 0.002  -0.063 -0.001 6839 MET A N   
335  C CA  . MET A 44  ? 0.335 0.292 0.353 -0.002 -0.052 -0.001 6839 MET A CA  
336  C C   . MET A 44  ? 0.336 0.284 0.346 0.003  -0.048 -0.001 6839 MET A C   
337  O O   . MET A 44  ? 0.317 0.250 0.315 0.005  -0.052 0.002  6839 MET A O   
338  C CB  . MET A 44  ? 0.350 0.297 0.355 -0.009 -0.050 0.003  6839 MET A CB  
339  C CG  . MET A 44  ? 0.375 0.329 0.388 -0.016 -0.054 0.002  6839 MET A CG  
340  S SD  . MET A 44  ? 0.411 0.348 0.408 -0.024 -0.052 0.006  6839 MET A SD  
341  C CE  . MET A 44  ? 0.408 0.357 0.419 -0.032 -0.057 0.004  6839 MET A CE  
342  N N   . MET A 45  ? 0.328 0.286 0.341 0.004  -0.040 -0.002 6840 MET A N   
343  C CA  . MET A 45  ? 0.331 0.283 0.337 0.008  -0.036 -0.003 6840 MET A CA  
344  C C   . MET A 45  ? 0.328 0.263 0.317 0.005  -0.035 0.001  6840 MET A C   
345  O O   . MET A 45  ? 0.310 0.235 0.292 0.008  -0.036 0.001  6840 MET A O   
346  C CB  . MET A 45  ? 0.356 0.321 0.365 0.008  -0.027 -0.005 6840 MET A CB  
347  C CG  . MET A 45  ? 0.386 0.345 0.385 0.011  -0.023 -0.005 6840 MET A CG  
348  S SD  . MET A 45  ? 0.438 0.394 0.443 0.019  -0.027 -0.010 6840 MET A SD  
349  C CE  . MET A 45  ? 0.468 0.446 0.491 0.024  -0.025 -0.018 6840 MET A CE  
350  N N   . ASN A 46  ? 0.328 0.258 0.308 0.000  -0.033 0.004  6841 ASN A N   
351  C CA  . ASN A 46  ? 0.346 0.260 0.310 -0.002 -0.032 0.007  6841 ASN A CA  
352  C C   . ASN A 46  ? 0.333 0.236 0.291 -0.002 -0.038 0.008  6841 ASN A C   
353  O O   . ASN A 46  ? 0.338 0.231 0.284 -0.002 -0.037 0.009  6841 ASN A O   
354  C CB  . ASN A 46  ? 0.380 0.290 0.338 -0.007 -0.028 0.009  6841 ASN A CB  
355  C CG  . ASN A 46  ? 0.409 0.328 0.368 -0.006 -0.021 0.010  6841 ASN A CG  
356  O OD1 . ASN A 46  ? 0.469 0.392 0.430 -0.001 -0.018 0.007  6841 ASN A OD1 
357  N ND2 . ASN A 46  ? 0.431 0.350 0.389 -0.010 -0.018 0.012  6841 ASN A ND2 
358  N N   . VAL A 47  ? 0.323 0.228 0.287 -0.003 -0.045 0.008  6842 VAL A N   
359  C CA  . VAL A 47  ? 0.322 0.215 0.276 -0.003 -0.052 0.010  6842 VAL A CA  
360  C C   . VAL A 47  ? 0.319 0.209 0.274 0.002  -0.052 0.010  6842 VAL A C   
361  O O   . VAL A 47  ? 0.324 0.203 0.268 0.001  -0.052 0.013  6842 VAL A O   
362  C CB  . VAL A 47  ? 0.324 0.221 0.285 -0.004 -0.061 0.010  6842 VAL A CB  
363  C CG1 . VAL A 47  ? 0.333 0.219 0.286 -0.002 -0.069 0.013  6842 VAL A CG1 
364  C CG2 . VAL A 47  ? 0.335 0.231 0.292 -0.010 -0.061 0.010  6842 VAL A CG2 
365  N N   . ALA A 48  ? 0.309 0.210 0.279 0.006  -0.052 0.007  6843 ALA A N   
366  C CA  . ALA A 48  ? 0.310 0.206 0.282 0.011  -0.053 0.006  6843 ALA A CA  
367  C C   . ALA A 48  ? 0.314 0.206 0.278 0.010  -0.046 0.006  6843 ALA A C   
368  O O   . ALA A 48  ? 0.321 0.202 0.278 0.010  -0.047 0.008  6843 ALA A O   
369  C CB  . ALA A 48  ? 0.305 0.215 0.295 0.016  -0.054 0.001  6843 ALA A CB  
370  N N   . LYS A 49  ? 0.314 0.213 0.278 0.009  -0.039 0.004  6844 LYS A N   
371  C CA  . LYS A 49  ? 0.318 0.215 0.275 0.009  -0.032 0.004  6844 LYS A CA  
372  C C   . LYS A 49  ? 0.317 0.202 0.259 0.006  -0.032 0.007  6844 LYS A C   
373  O O   . LYS A 49  ? 0.316 0.196 0.254 0.006  -0.030 0.007  6844 LYS A O   
374  C CB  . LYS A 49  ? 0.324 0.230 0.282 0.009  -0.026 0.002  6844 LYS A CB  
375  C CG  . LYS A 49  ? 0.346 0.252 0.298 0.010  -0.021 0.001  6844 LYS A CG  
376  C CD  . LYS A 49  ? 0.339 0.252 0.289 0.010  -0.016 0.002  6844 LYS A CD  
377  C CE  . LYS A 49  ? 0.343 0.269 0.303 0.011  -0.015 0.000  6844 LYS A CE  
378  N NZ  . LYS A 49  ? 0.343 0.274 0.299 0.010  -0.010 0.002  6844 LYS A NZ  
379  N N   . TYR A 50  ? 0.317 0.198 0.252 0.002  -0.033 0.009  6845 TYR A N   
380  C CA  . TYR A 50  ? 0.330 0.200 0.250 -0.001 -0.032 0.011  6845 TYR A CA  
381  C C   . TYR A 50  ? 0.334 0.196 0.250 -0.002 -0.037 0.014  6845 TYR A C   
382  O O   . TYR A 50  ? 0.347 0.203 0.253 -0.004 -0.034 0.015  6845 TYR A O   
383  C CB  . TYR A 50  ? 0.340 0.207 0.254 -0.004 -0.033 0.012  6845 TYR A CB  
384  C CG  . TYR A 50  ? 0.339 0.208 0.251 -0.004 -0.028 0.010  6845 TYR A CG  
385  C CD1 . TYR A 50  ? 0.341 0.218 0.262 -0.003 -0.026 0.010  6845 TYR A CD1 
386  C CD2 . TYR A 50  ? 0.358 0.219 0.259 -0.005 -0.025 0.009  6845 TYR A CD2 
387  C CE1 . TYR A 50  ? 0.354 0.230 0.272 -0.003 -0.022 0.010  6845 TYR A CE1 
388  C CE2 . TYR A 50  ? 0.361 0.221 0.260 -0.004 -0.022 0.008  6845 TYR A CE2 
389  C CZ  . TYR A 50  ? 0.362 0.229 0.269 -0.003 -0.020 0.009  6845 TYR A CZ  
390  O OH  . TYR A 50  ? 0.373 0.237 0.277 -0.003 -0.017 0.009  6845 TYR A OH  
391  N N   . THR A 51  ? 0.334 0.196 0.256 -0.001 -0.044 0.015  6846 THR A N   
392  C CA  . THR A 51  ? 0.339 0.191 0.255 -0.002 -0.049 0.019  6846 THR A CA  
393  C C   . THR A 51  ? 0.339 0.188 0.257 -0.001 -0.046 0.019  6846 THR A C   
394  O O   . THR A 51  ? 0.340 0.180 0.246 -0.005 -0.045 0.022  6846 THR A O   
395  C CB  . THR A 51  ? 0.340 0.192 0.264 0.001  -0.058 0.020  6846 THR A CB  
396  O OG1 . THR A 51  ? 0.343 0.198 0.264 -0.001 -0.061 0.020  6846 THR A OG1 
397  C CG2 . THR A 51  ? 0.358 0.198 0.276 0.001  -0.065 0.025  6846 THR A CG2 
398  N N   . GLN A 52  ? 0.334 0.191 0.264 0.003  -0.043 0.014  6847 GLN A N   
399  C CA  . GLN A 52  ? 0.330 0.186 0.264 0.003  -0.041 0.013  6847 GLN A CA  
400  C C   . GLN A 52  ? 0.332 0.188 0.257 0.000  -0.033 0.012  6847 GLN A C   
401  O O   . GLN A 52  ? 0.333 0.183 0.255 -0.003 -0.032 0.013  6847 GLN A O   
402  C CB  . GLN A 52  ? 0.321 0.186 0.271 0.009  -0.041 0.007  6847 GLN A CB  
403  C CG  . GLN A 52  ? 0.328 0.190 0.287 0.013  -0.049 0.007  6847 GLN A CG  
404  C CD  . GLN A 52  ? 0.322 0.194 0.297 0.019  -0.049 0.000  6847 GLN A CD  
405  O OE1 . GLN A 52  ? 0.313 0.197 0.291 0.020  -0.043 -0.004 6847 GLN A OE1 
406  N NE2 . GLN A 52  ? 0.332 0.198 0.315 0.023  -0.055 -0.001 6847 GLN A NE2 
407  N N   . LEU A 53  ? 0.330 0.193 0.253 0.000  -0.029 0.010  6848 LEU A N   
408  C CA  . LEU A 53  ? 0.336 0.200 0.252 -0.001 -0.022 0.008  6848 LEU A CA  
409  C C   . LEU A 53  ? 0.350 0.205 0.253 -0.007 -0.022 0.012  6848 LEU A C   
410  O O   . LEU A 53  ? 0.360 0.214 0.260 -0.009 -0.018 0.012  6848 LEU A O   
411  C CB  . LEU A 53  ? 0.333 0.203 0.247 0.000  -0.019 0.007  6848 LEU A CB  
412  C CG  . LEU A 53  ? 0.344 0.215 0.251 0.000  -0.014 0.005  6848 LEU A CG  
413  C CD1 . LEU A 53  ? 0.342 0.219 0.255 0.001  -0.010 0.001  6848 LEU A CD1 
414  C CD2 . LEU A 53  ? 0.343 0.215 0.248 0.002  -0.012 0.004  6848 LEU A CD2 
415  N N   . CYS A 54  ? 0.351 0.201 0.246 -0.008 -0.026 0.015  6849 CYS A N   
416  C CA  . CYS A 54  ? 0.364 0.206 0.244 -0.013 -0.027 0.019  6849 CYS A CA  
417  C C   . CYS A 54  ? 0.372 0.206 0.251 -0.017 -0.029 0.024  6849 CYS A C   
418  O O   . CYS A 54  ? 0.380 0.211 0.249 -0.022 -0.025 0.026  6849 CYS A O   
419  C CB  . CYS A 54  ? 0.381 0.219 0.254 -0.014 -0.032 0.021  6849 CYS A CB  
420  S SG  . CYS A 54  ? 0.386 0.229 0.257 -0.013 -0.029 0.016  6849 CYS A SG  
421  N N   . GLN A 55  ? 0.371 0.203 0.260 -0.014 -0.035 0.025  6850 GLN A N   
422  C CA  . GLN A 55  ? 0.387 0.208 0.275 -0.016 -0.038 0.029  6850 GLN A CA  
423  C C   . GLN A 55  ? 0.384 0.208 0.275 -0.019 -0.031 0.027  6850 GLN A C   
424  O O   . GLN A 55  ? 0.391 0.207 0.275 -0.025 -0.029 0.031  6850 GLN A O   
425  C CB  . GLN A 55  ? 0.388 0.206 0.289 -0.011 -0.046 0.029  6850 GLN A CB  
426  C CG  . GLN A 55  ? 0.392 0.206 0.290 -0.009 -0.054 0.033  6850 GLN A CG  
427  C CD  . GLN A 55  ? 0.395 0.208 0.308 -0.003 -0.062 0.031  6850 GLN A CD  
428  O OE1 . GLN A 55  ? 0.385 0.207 0.312 0.002  -0.059 0.025  6850 GLN A OE1 
429  N NE2 . GLN A 55  ? 0.404 0.208 0.314 -0.001 -0.071 0.036  6850 GLN A NE2 
430  N N   . TYR A 56  ? 0.358 0.193 0.259 -0.016 -0.026 0.020  6851 TYR A N   
431  C CA  . TYR A 56  ? 0.357 0.198 0.263 -0.018 -0.020 0.016  6851 TYR A CA  
432  C C   . TYR A 56  ? 0.361 0.206 0.256 -0.023 -0.013 0.016  6851 TYR A C   
433  O O   . TYR A 56  ? 0.362 0.206 0.255 -0.029 -0.009 0.017  6851 TYR A O   
434  C CB  . TYR A 56  ? 0.349 0.201 0.268 -0.012 -0.018 0.009  6851 TYR A CB  
435  C CG  . TYR A 56  ? 0.349 0.208 0.273 -0.014 -0.012 0.004  6851 TYR A CG  
436  C CD1 . TYR A 56  ? 0.359 0.213 0.289 -0.018 -0.013 0.004  6851 TYR A CD1 
437  C CD2 . TYR A 56  ? 0.347 0.217 0.270 -0.012 -0.007 0.000  6851 TYR A CD2 
438  C CE1 . TYR A 56  ? 0.363 0.225 0.299 -0.020 -0.008 -0.001 6851 TYR A CE1 
439  C CE2 . TYR A 56  ? 0.344 0.223 0.273 -0.014 -0.002 -0.005 6851 TYR A CE2 
440  C CZ  . TYR A 56  ? 0.352 0.228 0.288 -0.018 -0.003 -0.006 6851 TYR A CZ  
441  O OH  . TYR A 56  ? 0.351 0.237 0.294 -0.020 0.001  -0.011 6851 TYR A OH  
442  N N   . LEU A 57  ? 0.359 0.208 0.247 -0.021 -0.011 0.015  6852 LEU A N   
443  C CA  . LEU A 57  ? 0.376 0.229 0.254 -0.024 -0.005 0.013  6852 LEU A CA  
444  C C   . LEU A 57  ? 0.391 0.237 0.257 -0.032 -0.004 0.019  6852 LEU A C   
445  O O   . LEU A 57  ? 0.393 0.244 0.253 -0.036 0.003  0.018  6852 LEU A O   
446  C CB  . LEU A 57  ? 0.367 0.223 0.241 -0.020 -0.005 0.011  6852 LEU A CB  
447  C CG  . LEU A 57  ? 0.361 0.224 0.244 -0.013 -0.004 0.006  6852 LEU A CG  
448  C CD1 . LEU A 57  ? 0.362 0.224 0.240 -0.011 -0.005 0.005  6852 LEU A CD1 
449  C CD2 . LEU A 57  ? 0.364 0.237 0.253 -0.012 0.002  0.001  6852 LEU A CD2 
450  N N   . ASN A 58  ? 0.405 0.238 0.265 -0.033 -0.011 0.026  6853 ASN A N   
451  C CA  . ASN A 58  ? 0.433 0.257 0.279 -0.041 -0.012 0.034  6853 ASN A CA  
452  C C   . ASN A 58  ? 0.446 0.269 0.294 -0.047 -0.007 0.035  6853 ASN A C   
453  O O   . ASN A 58  ? 0.474 0.294 0.310 -0.055 -0.003 0.040  6853 ASN A O   
454  C CB  . ASN A 58  ? 0.450 0.260 0.291 -0.040 -0.022 0.041  6853 ASN A CB  
455  C CG  . ASN A 58  ? 0.455 0.264 0.287 -0.037 -0.027 0.042  6853 ASN A CG  
456  O OD1 . ASN A 58  ? 0.457 0.271 0.279 -0.038 -0.022 0.038  6853 ASN A OD1 
457  N ND2 . ASN A 58  ? 0.461 0.262 0.295 -0.034 -0.036 0.045  6853 ASN A ND2 
458  N N   . THR A 59  ? 0.439 0.266 0.305 -0.045 -0.007 0.031  6854 THR A N   
459  C CA  . THR A 59  ? 0.453 0.278 0.323 -0.052 -0.003 0.032  6854 THR A CA  
460  C C   . THR A 59  ? 0.441 0.283 0.316 -0.055 0.007  0.025  6854 THR A C   
461  O O   . THR A 59  ? 0.439 0.282 0.318 -0.062 0.011  0.025  6854 THR A O   
462  C CB  . THR A 59  ? 0.447 0.269 0.334 -0.048 -0.008 0.029  6854 THR A CB  
463  O OG1 . THR A 59  ? 0.430 0.267 0.329 -0.041 -0.005 0.020  6854 THR A OG1 
464  C CG2 . THR A 59  ? 0.465 0.274 0.352 -0.043 -0.018 0.033  6854 THR A CG2 
465  N N   . LEU A 60  ? 0.430 0.283 0.302 -0.049 0.010  0.020  6855 LEU A N   
466  C CA  . LEU A 60  ? 0.438 0.309 0.316 -0.050 0.019  0.012  6855 LEU A CA  
467  C C   . LEU A 60  ? 0.479 0.354 0.342 -0.055 0.025  0.013  6855 LEU A C   
468  O O   . LEU A 60  ? 0.564 0.429 0.412 -0.058 0.023  0.019  6855 LEU A O   
469  C CB  . LEU A 60  ? 0.419 0.298 0.304 -0.039 0.018  0.004  6855 LEU A CB  
470  C CG  . LEU A 60  ? 0.407 0.284 0.305 -0.033 0.012  0.003  6855 LEU A CG  
471  C CD1 . LEU A 60  ? 0.394 0.281 0.297 -0.024 0.012  -0.004 6855 LEU A CD1 
472  C CD2 . LEU A 60  ? 0.408 0.288 0.319 -0.037 0.013  0.001  6855 LEU A CD2 
473  N N   . THR A 61  ? 0.455 0.346 0.323 -0.056 0.033  0.006  6856 THR A N   
474  C CA  . THR A 61  ? 0.471 0.369 0.326 -0.061 0.041  0.005  6856 THR A CA  
475  C C   . THR A 61  ? 0.448 0.352 0.298 -0.052 0.041  -0.001 6856 THR A C   
476  O O   . THR A 61  ? 0.438 0.357 0.291 -0.050 0.048  -0.009 6856 THR A O   
477  C CB  . THR A 61  ? 0.482 0.397 0.347 -0.067 0.050  0.000  6856 THR A CB  
478  O OG1 . THR A 61  ? 0.478 0.407 0.360 -0.059 0.050  -0.010 6856 THR A OG1 
479  C CG2 . THR A 61  ? 0.501 0.410 0.371 -0.078 0.050  0.006  6856 THR A CG2 
480  N N   . LEU A 62  ? 0.447 0.339 0.291 -0.047 0.034  0.002  6857 LEU A N   
481  C CA  . LEU A 62  ? 0.449 0.342 0.287 -0.040 0.033  -0.003 6857 LEU A CA  
482  C C   . LEU A 62  ? 0.456 0.353 0.278 -0.045 0.038  -0.004 6857 LEU A C   
483  O O   . LEU A 62  ? 0.467 0.356 0.276 -0.053 0.038  0.003  6857 LEU A O   
484  C CB  . LEU A 62  ? 0.472 0.351 0.306 -0.036 0.024  0.001  6857 LEU A CB  
485  C CG  . LEU A 62  ? 0.508 0.385 0.357 -0.030 0.018  0.001  6857 LEU A CG  
486  C CD1 . LEU A 62  ? 0.531 0.398 0.375 -0.026 0.011  0.003  6857 LEU A CD1 
487  C CD2 . LEU A 62  ? 0.506 0.394 0.367 -0.024 0.022  -0.007 6857 LEU A CD2 
488  N N   . ALA A 63  ? 0.448 0.355 0.270 -0.039 0.043  -0.014 6858 ALA A N   
489  C CA  . ALA A 63  ? 0.464 0.375 0.270 -0.041 0.048  -0.017 6858 ALA A CA  
490  C C   . ALA A 63  ? 0.467 0.363 0.261 -0.039 0.040  -0.014 6858 ALA A C   
491  O O   . ALA A 63  ? 0.446 0.336 0.248 -0.032 0.034  -0.015 6858 ALA A O   
492  C CB  . ALA A 63  ? 0.459 0.385 0.273 -0.035 0.054  -0.029 6858 ALA A CB  
493  N N   . VAL A 64  ? 0.485 0.376 0.260 -0.046 0.040  -0.009 6859 VAL A N   
494  C CA  . VAL A 64  ? 0.490 0.368 0.252 -0.044 0.032  -0.007 6859 VAL A CA  
495  C C   . VAL A 64  ? 0.516 0.398 0.259 -0.046 0.036  -0.012 6859 VAL A C   
496  O O   . VAL A 64  ? 0.522 0.401 0.248 -0.054 0.037  -0.005 6859 VAL A O   
497  C CB  . VAL A 64  ? 0.502 0.367 0.259 -0.049 0.024  0.005  6859 VAL A CB  
498  C CG1 . VAL A 64  ? 0.510 0.363 0.257 -0.047 0.015  0.007  6859 VAL A CG1 
499  C CG2 . VAL A 64  ? 0.485 0.346 0.260 -0.048 0.021  0.009  6859 VAL A CG2 
500  N N   . PRO A 65  ? 0.518 0.408 0.263 -0.040 0.040  -0.024 6860 PRO A N   
501  C CA  . PRO A 65  ? 0.549 0.444 0.277 -0.041 0.044  -0.030 6860 PRO A CA  
502  C C   . PRO A 65  ? 0.566 0.447 0.278 -0.040 0.035  -0.029 6860 PRO A C   
503  O O   . PRO A 65  ? 0.551 0.420 0.269 -0.038 0.026  -0.024 6860 PRO A O   
504  C CB  . PRO A 65  ? 0.548 0.453 0.287 -0.032 0.048  -0.044 6860 PRO A CB  
505  C CG  . PRO A 65  ? 0.521 0.419 0.279 -0.024 0.042  -0.043 6860 PRO A CG  
506  C CD  . PRO A 65  ? 0.511 0.403 0.274 -0.030 0.039  -0.031 6860 PRO A CD  
507  N N   . TYR A 66  ? 0.600 0.485 0.292 -0.043 0.038  -0.033 6861 TYR A N   
508  C CA  . TYR A 66  ? 0.627 0.501 0.305 -0.042 0.030  -0.035 6861 TYR A CA  
509  C C   . TYR A 66  ? 0.624 0.496 0.315 -0.032 0.027  -0.047 6861 TYR A C   
510  O O   . TYR A 66  ? 0.657 0.539 0.359 -0.027 0.034  -0.055 6861 TYR A O   
511  C CB  . TYR A 66  ? 0.648 0.529 0.301 -0.047 0.034  -0.038 6861 TYR A CB  
512  C CG  . TYR A 66  ? 0.659 0.543 0.298 -0.058 0.039  -0.027 6861 TYR A CG  
513  C CD1 . TYR A 66  ? 0.677 0.547 0.306 -0.063 0.030  -0.014 6861 TYR A CD1 
514  C CD2 . TYR A 66  ? 0.666 0.565 0.301 -0.062 0.051  -0.029 6861 TYR A CD2 
515  C CE1 . TYR A 66  ? 0.692 0.562 0.306 -0.072 0.033  -0.002 6861 TYR A CE1 
516  C CE2 . TYR A 66  ? 0.690 0.591 0.311 -0.073 0.056  -0.017 6861 TYR A CE2 
517  C CZ  . TYR A 66  ? 0.701 0.586 0.311 -0.078 0.046  -0.003 6861 TYR A CZ  
518  O OH  . TYR A 66  ? 0.719 0.602 0.313 -0.089 0.049  0.010  6861 TYR A OH  
519  N N   . ASN A 67  ? 0.651 0.509 0.341 -0.030 0.017  -0.047 6862 ASN A N   
520  C CA  . ASN A 67  ? 0.664 0.518 0.366 -0.021 0.014  -0.057 6862 ASN A CA  
521  C C   . ASN A 67  ? 0.618 0.474 0.343 -0.017 0.016  -0.054 6862 ASN A C   
522  O O   . ASN A 67  ? 0.596 0.455 0.331 -0.010 0.019  -0.063 6862 ASN A O   
523  C CB  . ASN A 67  ? 0.716 0.577 0.410 -0.017 0.020  -0.071 6862 ASN A CB  
524  C CG  . ASN A 67  ? 0.792 0.653 0.462 -0.022 0.019  -0.074 6862 ASN A CG  
525  O OD1 . ASN A 67  ? 0.851 0.701 0.513 -0.025 0.010  -0.070 6862 ASN A OD1 
526  N ND2 . ASN A 67  ? 0.826 0.700 0.485 -0.022 0.028  -0.082 6862 ASN A ND2 
527  N N   . MET A 68  ? 0.580 0.434 0.312 -0.021 0.014  -0.043 6863 MET A N   
528  C CA  . MET A 68  ? 0.552 0.409 0.304 -0.017 0.015  -0.041 6863 MET A CA  
529  C C   . MET A 68  ? 0.530 0.376 0.292 -0.011 0.009  -0.044 6863 MET A C   
530  O O   . MET A 68  ? 0.545 0.381 0.301 -0.012 0.002  -0.044 6863 MET A O   
531  C CB  . MET A 68  ? 0.547 0.402 0.304 -0.022 0.012  -0.028 6863 MET A CB  
532  C CG  . MET A 68  ? 0.539 0.397 0.315 -0.019 0.014  -0.026 6863 MET A CG  
533  S SD  . MET A 68  ? 0.553 0.408 0.332 -0.025 0.010  -0.013 6863 MET A SD  
534  C CE  . MET A 68  ? 0.538 0.399 0.339 -0.021 0.012  -0.013 6863 MET A CE  
535  N N   . ARG A 69  ? 0.496 0.346 0.273 -0.004 0.012  -0.047 6864 ARG A N   
536  C CA  . ARG A 69  ? 0.490 0.330 0.276 0.002  0.006  -0.049 6864 ARG A CA  
537  C C   . ARG A 69  ? 0.465 0.306 0.266 0.002  0.005  -0.041 6864 ARG A C   
538  O O   . ARG A 69  ? 0.470 0.320 0.278 0.005  0.010  -0.041 6864 ARG A O   
539  C CB  . ARG A 69  ? 0.502 0.344 0.290 0.010  0.010  -0.060 6864 ARG A CB  
540  C CG  . ARG A 69  ? 0.529 0.373 0.304 0.010  0.012  -0.070 6864 ARG A CG  
541  C CD  . ARG A 69  ? 0.542 0.391 0.323 0.019  0.017  -0.081 6864 ARG A CD  
542  N NE  . ARG A 69  ? 0.572 0.422 0.341 0.021  0.019  -0.092 6864 ARG A NE  
543  C CZ  . ARG A 69  ? 0.580 0.435 0.353 0.030  0.022  -0.104 6864 ARG A CZ  
544  N NH1 . ARG A 69  ? 0.567 0.426 0.354 0.038  0.023  -0.105 6864 ARG A NH1 
545  N NH2 . ARG A 69  ? 0.597 0.454 0.358 0.032  0.024  -0.116 6864 ARG A NH2 
546  N N   . VAL A 70  ? 0.446 0.277 0.249 0.000  -0.002 -0.036 6865 VAL A N   
547  C CA  . VAL A 70  ? 0.420 0.252 0.237 0.001  -0.003 -0.029 6865 VAL A CA  
548  C C   . VAL A 70  ? 0.417 0.240 0.240 0.004  -0.008 -0.029 6865 VAL A C   
549  O O   . VAL A 70  ? 0.418 0.231 0.236 0.001  -0.013 -0.030 6865 VAL A O   
550  C CB  . VAL A 70  ? 0.420 0.252 0.236 -0.005 -0.007 -0.021 6865 VAL A CB  
551  C CG1 . VAL A 70  ? 0.412 0.247 0.242 -0.004 -0.008 -0.015 6865 VAL A CG1 
552  C CG2 . VAL A 70  ? 0.429 0.268 0.237 -0.009 -0.003 -0.019 6865 VAL A CG2 
553  N N   . ILE A 71  ? 0.401 0.227 0.234 0.008  -0.006 -0.027 6866 ILE A N   
554  C CA  . ILE A 71  ? 0.407 0.222 0.244 0.010  -0.010 -0.025 6866 ILE A CA  
555  C C   . ILE A 71  ? 0.386 0.207 0.233 0.009  -0.010 -0.017 6866 ILE A C   
556  O O   . ILE A 71  ? 0.375 0.206 0.227 0.010  -0.007 -0.016 6866 ILE A O   
557  C CB  . ILE A 71  ? 0.423 0.234 0.260 0.018  -0.009 -0.031 6866 ILE A CB  
558  C CG1 . ILE A 71  ? 0.434 0.232 0.274 0.019  -0.013 -0.027 6866 ILE A CG1 
559  C CG2 . ILE A 71  ? 0.416 0.239 0.260 0.023  -0.004 -0.032 6866 ILE A CG2 
560  C CD1 . ILE A 71  ? 0.454 0.241 0.292 0.026  -0.014 -0.033 6866 ILE A CD1 
561  N N   . HIS A 72  ? 0.386 0.201 0.236 0.005  -0.014 -0.013 6867 HIS A N   
562  C CA  . HIS A 72  ? 0.375 0.195 0.234 0.003  -0.015 -0.007 6867 HIS A CA  
563  C C   . HIS A 72  ? 0.375 0.190 0.238 0.004  -0.016 -0.004 6867 HIS A C   
564  O O   . HIS A 72  ? 0.390 0.196 0.252 0.000  -0.019 -0.003 6867 HIS A O   
565  C CB  . HIS A 72  ? 0.373 0.195 0.233 -0.003 -0.019 -0.004 6867 HIS A CB  
566  C CG  . HIS A 72  ? 0.366 0.196 0.236 -0.005 -0.020 0.001  6867 HIS A CG  
567  N ND1 . HIS A 72  ? 0.367 0.198 0.241 -0.010 -0.024 0.003  6867 HIS A ND1 
568  C CD2 . HIS A 72  ? 0.362 0.200 0.240 -0.002 -0.017 0.003  6867 HIS A CD2 
569  C CE1 . HIS A 72  ? 0.372 0.211 0.256 -0.009 -0.023 0.006  6867 HIS A CE1 
570  N NE2 . HIS A 72  ? 0.354 0.198 0.240 -0.005 -0.019 0.006  6867 HIS A NE2 
571  N N   . PHE A 73  ? 0.371 0.191 0.238 0.009  -0.013 -0.002 6868 PHE A N   
572  C CA  . PHE A 73  ? 0.377 0.192 0.246 0.010  -0.013 0.003  6868 PHE A CA  
573  C C   . PHE A 73  ? 0.365 0.190 0.242 0.006  -0.013 0.008  6868 PHE A C   
574  O O   . PHE A 73  ? 0.356 0.193 0.238 0.006  -0.012 0.008  6868 PHE A O   
575  C CB  . PHE A 73  ? 0.384 0.200 0.252 0.018  -0.011 0.001  6868 PHE A CB  
576  C CG  . PHE A 73  ? 0.406 0.215 0.268 0.023  -0.012 -0.005 6868 PHE A CG  
577  C CD1 . PHE A 73  ? 0.426 0.218 0.284 0.024  -0.015 -0.005 6868 PHE A CD1 
578  C CD2 . PHE A 73  ? 0.412 0.229 0.274 0.027  -0.009 -0.011 6868 PHE A CD2 
579  C CE1 . PHE A 73  ? 0.444 0.229 0.297 0.030  -0.016 -0.012 6868 PHE A CE1 
580  C CE2 . PHE A 73  ? 0.423 0.236 0.281 0.032  -0.009 -0.018 6868 PHE A CE2 
581  C CZ  . PHE A 73  ? 0.439 0.235 0.292 0.035  -0.013 -0.019 6868 PHE A CZ  
582  N N   . GLY A 74  ? 0.366 0.186 0.244 0.002  -0.014 0.013  6869 GLY A N   
583  C CA  . GLY A 74  ? 0.371 0.201 0.257 -0.002 -0.013 0.017  6869 GLY A CA  
584  C C   . GLY A 74  ? 0.375 0.210 0.266 -0.007 -0.015 0.016  6869 GLY A C   
585  O O   . GLY A 74  ? 0.374 0.222 0.272 -0.008 -0.014 0.017  6869 GLY A O   
586  N N   . ALA A 75  ? 0.380 0.205 0.267 -0.011 -0.018 0.014  6870 ALA A N   
587  C CA  . ALA A 75  ? 0.392 0.222 0.283 -0.016 -0.022 0.012  6870 ALA A CA  
588  C C   . ALA A 75  ? 0.401 0.234 0.300 -0.023 -0.024 0.015  6870 ALA A C   
589  O O   . ALA A 75  ? 0.401 0.241 0.306 -0.026 -0.028 0.014  6870 ALA A O   
590  C CB  . ALA A 75  ? 0.403 0.222 0.285 -0.016 -0.025 0.008  6870 ALA A CB  
591  N N   . GLY A 76  ? 0.408 0.237 0.308 -0.025 -0.022 0.019  6871 GLY A N   
592  C CA  . GLY A 76  ? 0.427 0.261 0.336 -0.034 -0.023 0.022  6871 GLY A CA  
593  C C   . GLY A 76  ? 0.437 0.290 0.357 -0.034 -0.019 0.024  6871 GLY A C   
594  O O   . GLY A 76  ? 0.460 0.320 0.379 -0.027 -0.017 0.024  6871 GLY A O   
595  N N   . SER A 77  ? 0.461 0.322 0.391 -0.041 -0.019 0.026  6872 SER A N   
596  C CA  . SER A 77  ? 0.478 0.358 0.418 -0.042 -0.015 0.028  6872 SER A CA  
597  C C   . SER A 77  ? 0.488 0.374 0.436 -0.052 -0.013 0.031  6872 SER A C   
598  O O   . SER A 77  ? 0.485 0.359 0.432 -0.058 -0.016 0.032  6872 SER A O   
599  C CB  . SER A 77  ? 0.479 0.372 0.429 -0.038 -0.019 0.023  6872 SER A CB  
600  O OG  . SER A 77  ? 0.514 0.409 0.471 -0.044 -0.024 0.021  6872 SER A OG  
601  N N   . ASP A 78  ? 0.502 0.406 0.459 -0.053 -0.007 0.033  6873 ASP A N   
602  C CA  . ASP A 78  ? 0.535 0.448 0.501 -0.063 -0.004 0.037  6873 ASP A CA  
603  C C   . ASP A 78  ? 0.509 0.430 0.488 -0.069 -0.010 0.032  6873 ASP A C   
604  O O   . ASP A 78  ? 0.498 0.423 0.485 -0.079 -0.008 0.034  6873 ASP A O   
605  C CB  . ASP A 78  ? 0.595 0.527 0.565 -0.063 0.004  0.039  6873 ASP A CB  
606  C CG  . ASP A 78  ? 0.642 0.595 0.623 -0.055 0.003  0.033  6873 ASP A CG  
607  O OD1 . ASP A 78  ? 0.697 0.648 0.682 -0.050 -0.003 0.027  6873 ASP A OD1 
608  O OD2 . ASP A 78  ? 0.753 0.722 0.737 -0.053 0.010  0.033  6873 ASP A OD2 
609  N N   . LYS A 79  ? 0.481 0.403 0.463 -0.062 -0.016 0.026  6874 LYS A N   
610  C CA  . LYS A 79  ? 0.480 0.410 0.474 -0.066 -0.023 0.022  6874 LYS A CA  
611  C C   . LYS A 79  ? 0.462 0.373 0.449 -0.072 -0.028 0.021  6874 LYS A C   
612  O O   . LYS A 79  ? 0.478 0.395 0.475 -0.078 -0.034 0.018  6874 LYS A O   
613  C CB  . LYS A 79  ? 0.494 0.429 0.491 -0.057 -0.028 0.017  6874 LYS A CB  
614  C CG  . LYS A 79  ? 0.494 0.446 0.498 -0.049 -0.025 0.015  6874 LYS A CG  
615  C CD  . LYS A 79  ? 0.513 0.464 0.517 -0.041 -0.031 0.011  6874 LYS A CD  
616  C CE  . LYS A 79  ? 0.536 0.499 0.545 -0.033 -0.028 0.009  6874 LYS A CE  
617  N NZ  . LYS A 79  ? 0.561 0.548 0.589 -0.034 -0.025 0.007  6874 LYS A NZ  
618  N N   . GLY A 80  ? 0.442 0.331 0.412 -0.070 -0.028 0.024  6875 GLY A N   
619  C CA  . GLY A 80  ? 0.437 0.307 0.400 -0.075 -0.033 0.022  6875 GLY A CA  
620  C C   . GLY A 80  ? 0.425 0.289 0.381 -0.069 -0.040 0.016  6875 GLY A C   
621  O O   . GLY A 80  ? 0.437 0.287 0.387 -0.072 -0.045 0.013  6875 GLY A O   
622  N N   . VAL A 81  ? 0.397 0.270 0.353 -0.060 -0.040 0.015  6876 VAL A N   
623  C CA  . VAL A 81  ? 0.401 0.268 0.349 -0.055 -0.046 0.011  6876 VAL A CA  
624  C C   . VAL A 81  ? 0.399 0.262 0.336 -0.046 -0.042 0.012  6876 VAL A C   
625  O O   . VAL A 81  ? 0.406 0.270 0.343 -0.044 -0.036 0.015  6876 VAL A O   
626  C CB  . VAL A 81  ? 0.391 0.275 0.351 -0.054 -0.052 0.008  6876 VAL A CB  
627  C CG1 . VAL A 81  ? 0.400 0.289 0.371 -0.063 -0.058 0.006  6876 VAL A CG1 
628  C CG2 . VAL A 81  ? 0.381 0.282 0.353 -0.050 -0.049 0.010  6876 VAL A CG2 
629  N N   . ALA A 82  ? 0.389 0.246 0.317 -0.042 -0.046 0.009  6877 ALA A N   
630  C CA  . ALA A 82  ? 0.379 0.231 0.297 -0.034 -0.042 0.010  6877 ALA A CA  
631  C C   . ALA A 82  ? 0.373 0.233 0.293 -0.030 -0.045 0.009  6877 ALA A C   
632  O O   . ALA A 82  ? 0.367 0.220 0.276 -0.029 -0.049 0.008  6877 ALA A O   
633  C CB  . ALA A 82  ? 0.396 0.232 0.299 -0.034 -0.042 0.007  6877 ALA A CB  
634  N N   . PRO A 83  ? 0.365 0.237 0.296 -0.027 -0.043 0.011  6878 PRO A N   
635  C CA  . PRO A 83  ? 0.360 0.237 0.293 -0.023 -0.047 0.011  6878 PRO A CA  
636  C C   . PRO A 83  ? 0.351 0.219 0.271 -0.019 -0.045 0.011  6878 PRO A C   
637  O O   . PRO A 83  ? 0.361 0.225 0.275 -0.018 -0.049 0.011  6878 PRO A O   
638  C CB  . PRO A 83  ? 0.355 0.247 0.303 -0.020 -0.044 0.011  6878 PRO A CB  
639  C CG  . PRO A 83  ? 0.356 0.255 0.312 -0.025 -0.040 0.011  6878 PRO A CG  
640  C CD  . PRO A 83  ? 0.362 0.245 0.305 -0.029 -0.038 0.012  6878 PRO A CD  
641  N N   . GLY A 84  ? 0.342 0.209 0.260 -0.017 -0.038 0.011  6879 GLY A N   
642  C CA  . GLY A 84  ? 0.348 0.209 0.255 -0.013 -0.035 0.011  6879 GLY A CA  
643  C C   . GLY A 84  ? 0.359 0.209 0.252 -0.015 -0.037 0.009  6879 GLY A C   
644  O O   . GLY A 84  ? 0.370 0.217 0.256 -0.014 -0.038 0.010  6879 GLY A O   
645  N N   . THR A 85  ? 0.365 0.209 0.255 -0.018 -0.038 0.008  6880 THR A N   
646  C CA  . THR A 85  ? 0.382 0.216 0.258 -0.020 -0.040 0.005  6880 THR A CA  
647  C C   . THR A 85  ? 0.380 0.215 0.252 -0.022 -0.047 0.006  6880 THR A C   
648  O O   . THR A 85  ? 0.386 0.215 0.245 -0.022 -0.047 0.005  6880 THR A O   
649  C CB  . THR A 85  ? 0.392 0.218 0.266 -0.023 -0.041 0.002  6880 THR A CB  
650  O OG1 . THR A 85  ? 0.391 0.214 0.265 -0.020 -0.035 0.002  6880 THR A OG1 
651  C CG2 . THR A 85  ? 0.415 0.232 0.276 -0.025 -0.044 -0.002 6880 THR A CG2 
652  N N   . ALA A 86  ? 0.370 0.211 0.253 -0.024 -0.052 0.007  6881 ALA A N   
653  C CA  . ALA A 86  ? 0.381 0.222 0.261 -0.025 -0.060 0.008  6881 ALA A CA  
654  C C   . ALA A 86  ? 0.378 0.218 0.253 -0.022 -0.060 0.011  6881 ALA A C   
655  O O   . ALA A 86  ? 0.393 0.228 0.255 -0.023 -0.064 0.013  6881 ALA A O   
656  C CB  . ALA A 86  ? 0.378 0.229 0.274 -0.026 -0.066 0.008  6881 ALA A CB  
657  N N   . VAL A 87  ? 0.371 0.217 0.255 -0.018 -0.055 0.013  6882 VAL A N   
658  C CA  . VAL A 87  ? 0.373 0.216 0.252 -0.016 -0.054 0.016  6882 VAL A CA  
659  C C   . VAL A 87  ? 0.380 0.216 0.244 -0.017 -0.049 0.015  6882 VAL A C   
660  O O   . VAL A 87  ? 0.383 0.215 0.237 -0.018 -0.051 0.018  6882 VAL A O   
661  C CB  . VAL A 87  ? 0.363 0.214 0.257 -0.012 -0.050 0.016  6882 VAL A CB  
662  C CG1 . VAL A 87  ? 0.368 0.214 0.257 -0.011 -0.049 0.018  6882 VAL A CG1 
663  C CG2 . VAL A 87  ? 0.360 0.220 0.270 -0.010 -0.055 0.016  6882 VAL A CG2 
664  N N   . LEU A 88  ? 0.382 0.218 0.244 -0.017 -0.042 0.012  6883 LEU A N   
665  C CA  . LEU A 88  ? 0.395 0.228 0.245 -0.017 -0.037 0.010  6883 LEU A CA  
666  C C   . LEU A 88  ? 0.411 0.237 0.244 -0.020 -0.041 0.009  6883 LEU A C   
667  O O   . LEU A 88  ? 0.412 0.237 0.234 -0.022 -0.038 0.010  6883 LEU A O   
668  C CB  . LEU A 88  ? 0.393 0.226 0.244 -0.015 -0.031 0.005  6883 LEU A CB  
669  C CG  . LEU A 88  ? 0.387 0.226 0.250 -0.011 -0.026 0.006  6883 LEU A CG  
670  C CD1 . LEU A 88  ? 0.389 0.227 0.252 -0.009 -0.022 0.002  6883 LEU A CD1 
671  C CD2 . LEU A 88  ? 0.399 0.242 0.262 -0.010 -0.023 0.007  6883 LEU A CD2 
672  N N   A ARG A 89  ? 0.423 0.248 0.257 -0.022 -0.047 0.007  6884 ARG A N   
673  N N   B ARG A 89  ? 0.415 0.240 0.249 -0.022 -0.046 0.007  6884 ARG A N   
674  C CA  A ARG A 89  ? 0.455 0.274 0.272 -0.025 -0.051 0.006  6884 ARG A CA  
675  C CA  B ARG A 89  ? 0.441 0.260 0.260 -0.025 -0.052 0.006  6884 ARG A CA  
676  C C   A ARG A 89  ? 0.454 0.272 0.265 -0.027 -0.057 0.012  6884 ARG A C   
677  C C   B ARG A 89  ? 0.445 0.264 0.257 -0.026 -0.057 0.011  6884 ARG A C   
678  O O   A ARG A 89  ? 0.470 0.284 0.265 -0.029 -0.059 0.012  6884 ARG A O   
679  O O   B ARG A 89  ? 0.458 0.273 0.253 -0.029 -0.057 0.012  6884 ARG A O   
680  C CB  A ARG A 89  ? 0.479 0.296 0.300 -0.027 -0.056 0.001  6884 ARG A CB  
681  C CB  B ARG A 89  ? 0.452 0.271 0.278 -0.027 -0.058 0.003  6884 ARG A CB  
682  C CG  A ARG A 89  ? 0.525 0.337 0.331 -0.030 -0.063 -0.001 6884 ARG A CG  
683  C CG  B ARG A 89  ? 0.481 0.295 0.294 -0.030 -0.064 -0.001 6884 ARG A CG  
684  C CD  A ARG A 89  ? 0.552 0.360 0.356 -0.032 -0.064 -0.008 6884 ARG A CD  
685  C CD  B ARG A 89  ? 0.498 0.307 0.298 -0.030 -0.059 -0.007 6884 ARG A CD  
686  N NE  A ARG A 89  ? 0.597 0.402 0.392 -0.029 -0.056 -0.012 6884 ARG A NE  
687  N NE  B ARG A 89  ? 0.517 0.320 0.306 -0.033 -0.065 -0.013 6884 ARG A NE  
688  C CZ  A ARG A 89  ? 0.606 0.404 0.394 -0.029 -0.055 -0.020 6884 ARG A CZ  
689  C CZ  B ARG A 89  ? 0.533 0.331 0.312 -0.032 -0.061 -0.020 6884 ARG A CZ  
690  N NH1 A ARG A 89  ? 0.624 0.418 0.413 -0.032 -0.061 -0.024 6884 ARG A NH1 
691  N NH1 B ARG A 89  ? 0.548 0.342 0.319 -0.035 -0.067 -0.027 6884 ARG A NH1 
692  N NH2 A ARG A 89  ? 0.620 0.417 0.402 -0.026 -0.047 -0.024 6884 ARG A NH2 
693  N NH2 B ARG A 89  ? 0.544 0.342 0.322 -0.029 -0.052 -0.022 6884 ARG A NH2 
694  N N   . GLN A 90  ? 0.440 0.262 0.265 -0.025 -0.061 0.016  6885 GLN A N   
695  C CA  . GLN A 90  ? 0.439 0.257 0.259 -0.025 -0.067 0.022  6885 GLN A CA  
696  C C   . GLN A 90  ? 0.436 0.251 0.247 -0.026 -0.061 0.026  6885 GLN A C   
697  O O   . GLN A 90  ? 0.448 0.257 0.243 -0.029 -0.064 0.030  6885 GLN A O   
698  C CB  . GLN A 90  ? 0.427 0.250 0.266 -0.022 -0.072 0.024  6885 GLN A CB  
699  C CG  . GLN A 90  ? 0.436 0.255 0.273 -0.020 -0.079 0.031  6885 GLN A CG  
700  C CD  . GLN A 90  ? 0.426 0.251 0.283 -0.016 -0.083 0.031  6885 GLN A CD  
701  O OE1 . GLN A 90  ? 0.414 0.248 0.286 -0.014 -0.079 0.027  6885 GLN A OE1 
702  N NE2 . GLN A 90  ? 0.428 0.248 0.286 -0.013 -0.091 0.036  6885 GLN A NE2 
703  N N   . TRP A 91  ? 0.421 0.240 0.241 -0.024 -0.053 0.024  6886 TRP A N   
704  C CA  . TRP A 91  ? 0.424 0.242 0.239 -0.026 -0.046 0.027  6886 TRP A CA  
705  C C   . TRP A 91  ? 0.444 0.261 0.242 -0.029 -0.040 0.024  6886 TRP A C   
706  O O   . TRP A 91  ? 0.444 0.257 0.230 -0.033 -0.039 0.029  6886 TRP A O   
707  C CB  . TRP A 91  ? 0.405 0.229 0.237 -0.022 -0.040 0.023  6886 TRP A CB  
708  C CG  . TRP A 91  ? 0.404 0.229 0.235 -0.024 -0.033 0.024  6886 TRP A CG  
709  C CD1 . TRP A 91  ? 0.408 0.228 0.238 -0.026 -0.034 0.030  6886 TRP A CD1 
710  C CD2 . TRP A 91  ? 0.398 0.230 0.232 -0.023 -0.024 0.019  6886 TRP A CD2 
711  N NE1 . TRP A 91  ? 0.408 0.232 0.239 -0.028 -0.026 0.029  6886 TRP A NE1 
712  C CE2 . TRP A 91  ? 0.394 0.226 0.228 -0.025 -0.020 0.022  6886 TRP A CE2 
713  C CE3 . TRP A 91  ? 0.388 0.224 0.224 -0.020 -0.020 0.013  6886 TRP A CE3 
714  C CZ2 . TRP A 91  ? 0.394 0.234 0.232 -0.025 -0.012 0.018  6886 TRP A CZ2 
715  C CZ3 . TRP A 91  ? 0.380 0.223 0.219 -0.019 -0.012 0.009  6886 TRP A CZ3 
716  C CH2 . TRP A 91  ? 0.383 0.228 0.223 -0.021 -0.009 0.011  6886 TRP A CH2 
717  N N   . LEU A 92  ? 0.443 0.263 0.240 -0.028 -0.036 0.017  6887 LEU A N   
718  C CA  . LEU A 92  ? 0.460 0.281 0.242 -0.030 -0.030 0.013  6887 LEU A CA  
719  C C   . LEU A 92  ? 0.485 0.301 0.247 -0.034 -0.034 0.015  6887 LEU A C   
720  O O   . LEU A 92  ? 0.477 0.289 0.237 -0.034 -0.043 0.016  6887 LEU A O   
721  C CB  . LEU A 92  ? 0.453 0.277 0.241 -0.026 -0.026 0.005  6887 LEU A CB  
722  C CG  . LEU A 92  ? 0.439 0.267 0.243 -0.022 -0.021 0.003  6887 LEU A CG  
723  C CD1 . LEU A 92  ? 0.431 0.258 0.240 -0.019 -0.022 -0.003 6887 LEU A CD1 
724  C CD2 . LEU A 92  ? 0.441 0.276 0.244 -0.022 -0.013 0.001  6887 LEU A CD2 
725  N N   . PRO A 93  ? 0.500 0.319 0.247 -0.037 -0.028 0.014  6888 PRO A N   
726  C CA  . PRO A 93  ? 0.529 0.344 0.255 -0.041 -0.031 0.015  6888 PRO A CA  
727  C C   . PRO A 93  ? 0.534 0.347 0.257 -0.039 -0.036 0.007  6888 PRO A C   
728  O O   . PRO A 93  ? 0.507 0.322 0.240 -0.035 -0.033 0.000  6888 PRO A O   
729  C CB  . PRO A 93  ? 0.540 0.362 0.254 -0.044 -0.020 0.012  6888 PRO A CB  
730  C CG  . PRO A 93  ? 0.523 0.349 0.251 -0.044 -0.013 0.014  6888 PRO A CG  
731  C CD  . PRO A 93  ? 0.497 0.322 0.247 -0.038 -0.017 0.012  6888 PRO A CD  
732  N N   A THR A 94  ? 0.558 0.367 0.267 -0.041 -0.045 0.009  6889 THR A N   
733  N N   B THR A 94  ? 0.555 0.363 0.264 -0.041 -0.045 0.010  6889 THR A N   
734  C CA  A THR A 94  ? 0.568 0.375 0.276 -0.040 -0.051 0.002  6889 THR A CA  
735  C CA  B THR A 94  ? 0.566 0.372 0.271 -0.040 -0.051 0.002  6889 THR A CA  
736  C C   A THR A 94  ? 0.567 0.376 0.269 -0.038 -0.044 -0.010 6889 THR A C   
737  C C   B THR A 94  ? 0.568 0.378 0.264 -0.039 -0.043 -0.008 6889 THR A C   
738  O O   A THR A 94  ? 0.568 0.375 0.278 -0.036 -0.047 -0.017 6889 THR A O   
739  O O   B THR A 94  ? 0.572 0.385 0.254 -0.042 -0.036 -0.007 6889 THR A O   
740  C CB  A THR A 94  ? 0.596 0.399 0.288 -0.042 -0.061 0.005  6889 THR A CB  
741  C CB  B THR A 94  ? 0.592 0.394 0.282 -0.043 -0.062 0.007  6889 THR A CB  
742  O OG1 A THR A 94  ? 0.617 0.420 0.286 -0.046 -0.057 0.008  6889 THR A OG1 
743  O OG1 B THR A 94  ? 0.587 0.387 0.290 -0.042 -0.069 0.016  6889 THR A OG1 
744  C CG2 A THR A 94  ? 0.594 0.394 0.295 -0.042 -0.071 0.014  6889 THR A CG2 
745  C CG2 B THR A 94  ? 0.602 0.402 0.288 -0.043 -0.070 -0.001 6889 THR A CG2 
746  N N   A GLY A 95  ? 0.572 0.386 0.263 -0.039 -0.035 -0.012 6890 GLY A N   
747  N N   B GLY A 95  ? 0.561 0.369 0.264 -0.037 -0.045 -0.017 6890 GLY A N   
748  C CA  A GLY A 95  ? 0.572 0.389 0.257 -0.037 -0.028 -0.024 6890 GLY A CA  
749  C CA  B GLY A 95  ? 0.569 0.379 0.265 -0.034 -0.038 -0.028 6890 GLY A CA  
750  C C   A GLY A 95  ? 0.551 0.371 0.255 -0.031 -0.022 -0.029 6890 GLY A C   
751  C C   B GLY A 95  ? 0.555 0.368 0.266 -0.030 -0.029 -0.031 6890 GLY A C   
752  O O   A GLY A 95  ? 0.547 0.369 0.249 -0.028 -0.017 -0.040 6890 GLY A O   
753  O O   B GLY A 95  ? 0.553 0.367 0.263 -0.027 -0.025 -0.041 6890 GLY A O   
754  N N   A THR A 96  ? 0.530 0.350 0.251 -0.030 -0.022 -0.022 6891 THR A N   
755  N N   B THR A 96  ? 0.539 0.354 0.264 -0.030 -0.028 -0.023 6891 THR A N   
756  C CA  A THR A 96  ? 0.518 0.341 0.256 -0.025 -0.016 -0.026 6891 THR A CA  
757  C CA  B THR A 96  ? 0.524 0.343 0.264 -0.025 -0.020 -0.025 6891 THR A CA  
758  C C   A THR A 96  ? 0.518 0.333 0.265 -0.021 -0.021 -0.032 6891 THR A C   
759  C C   B THR A 96  ? 0.522 0.335 0.272 -0.021 -0.023 -0.031 6891 THR A C   
760  O O   A THR A 96  ? 0.527 0.336 0.275 -0.024 -0.030 -0.029 6891 THR A O   
761  O O   B THR A 96  ? 0.524 0.332 0.282 -0.022 -0.031 -0.028 6891 THR A O   
762  C CB  A THR A 96  ? 0.500 0.325 0.253 -0.025 -0.016 -0.017 6891 THR A CB  
763  C CB  B THR A 96  ? 0.506 0.328 0.260 -0.026 -0.020 -0.016 6891 THR A CB  
764  O OG1 A THR A 96  ? 0.501 0.331 0.247 -0.029 -0.011 -0.012 6891 THR A OG1 
765  O OG1 B THR A 96  ? 0.508 0.333 0.252 -0.030 -0.017 -0.009 6891 THR A OG1 
766  C CG2 A THR A 96  ? 0.490 0.318 0.260 -0.020 -0.011 -0.020 6891 THR A CG2 
767  C CG2 B THR A 96  ? 0.495 0.322 0.264 -0.021 -0.014 -0.018 6891 THR A CG2 
768  N N   A LEU A 97  ? 0.515 0.331 0.268 -0.016 -0.016 -0.039 6892 LEU A N   
769  N N   B LEU A 97  ? 0.523 0.338 0.275 -0.016 -0.017 -0.039 6892 LEU A N   
770  C CA  A LEU A 97  ? 0.519 0.326 0.280 -0.013 -0.020 -0.044 6892 LEU A CA  
771  C CA  B LEU A 97  ? 0.526 0.333 0.288 -0.012 -0.020 -0.045 6892 LEU A CA  
772  C C   A LEU A 97  ? 0.495 0.302 0.274 -0.011 -0.020 -0.037 6892 LEU A C   
773  C C   B LEU A 97  ? 0.499 0.307 0.279 -0.011 -0.020 -0.037 6892 LEU A C   
774  O O   A LEU A 97  ? 0.486 0.301 0.271 -0.008 -0.014 -0.036 6892 LEU A O   
775  O O   B LEU A 97  ? 0.490 0.305 0.276 -0.008 -0.014 -0.035 6892 LEU A O   
776  C CB  A LEU A 97  ? 0.538 0.344 0.297 -0.007 -0.016 -0.055 6892 LEU A CB  
777  C CB  B LEU A 97  ? 0.547 0.355 0.307 -0.006 -0.014 -0.055 6892 LEU A CB  
778  C CG  A LEU A 97  ? 0.569 0.375 0.309 -0.008 -0.015 -0.064 6892 LEU A CG  
779  C CG  B LEU A 97  ? 0.566 0.362 0.331 -0.002 -0.018 -0.061 6892 LEU A CG  
780  C CD1 A LEU A 97  ? 0.589 0.394 0.329 -0.001 -0.011 -0.077 6892 LEU A CD1 
781  C CD1 B LEU A 97  ? 0.597 0.385 0.349 -0.004 -0.023 -0.069 6892 LEU A CD1 
782  C CD2 A LEU A 97  ? 0.589 0.386 0.321 -0.013 -0.024 -0.065 6892 LEU A CD2 
783  C CD2 B LEU A 97  ? 0.573 0.370 0.343 0.006  -0.012 -0.069 6892 LEU A CD2 
784  N N   . LEU A 98  ? 0.493 0.293 0.279 -0.013 -0.027 -0.034 6893 LEU A N   
785  C CA  . LEU A 98  ? 0.470 0.272 0.273 -0.012 -0.027 -0.027 6893 LEU A CA  
786  C C   . LEU A 98  ? 0.466 0.258 0.275 -0.011 -0.029 -0.030 6893 LEU A C   
787  O O   . LEU A 98  ? 0.465 0.250 0.272 -0.015 -0.035 -0.031 6893 LEU A O   
788  C CB  . LEU A 98  ? 0.466 0.271 0.272 -0.016 -0.031 -0.020 6893 LEU A CB  
789  C CG  . LEU A 98  ? 0.449 0.259 0.272 -0.016 -0.031 -0.014 6893 LEU A CG  
790  C CD1 . LEU A 98  ? 0.447 0.262 0.275 -0.011 -0.024 -0.013 6893 LEU A CD1 
791  C CD2 . LEU A 98  ? 0.448 0.261 0.274 -0.019 -0.037 -0.008 6893 LEU A CD2 
792  N N   . VAL A 99  ? 0.457 0.248 0.272 -0.006 -0.025 -0.030 6894 VAL A N   
793  C CA  . VAL A 99  ? 0.464 0.244 0.286 -0.004 -0.028 -0.030 6894 VAL A CA  
794  C C   . VAL A 99  ? 0.448 0.233 0.281 -0.004 -0.026 -0.022 6894 VAL A C   
795  O O   . VAL A 99  ? 0.438 0.234 0.275 -0.001 -0.022 -0.020 6894 VAL A O   
796  C CB  . VAL A 99  ? 0.478 0.251 0.295 0.003  -0.025 -0.038 6894 VAL A CB  
797  C CG1 . VAL A 99  ? 0.484 0.245 0.308 0.005  -0.027 -0.036 6894 VAL A CG1 
798  C CG2 . VAL A 99  ? 0.494 0.263 0.300 0.003  -0.027 -0.047 6894 VAL A CG2 
799  N N   . ASP A 100 ? 0.444 0.224 0.284 -0.009 -0.030 -0.018 6895 ASP A N   
800  C CA  . ASP A 100 ? 0.433 0.219 0.283 -0.009 -0.028 -0.011 6895 ASP A CA  
801  C C   . ASP A 100 ? 0.448 0.222 0.300 -0.009 -0.029 -0.009 6895 ASP A C   
802  O O   . ASP A 100 ? 0.454 0.214 0.301 -0.009 -0.032 -0.013 6895 ASP A O   
803  C CB  . ASP A 100 ? 0.425 0.221 0.282 -0.014 -0.030 -0.006 6895 ASP A CB  
804  C CG  . ASP A 100 ? 0.434 0.225 0.293 -0.021 -0.036 -0.006 6895 ASP A CG  
805  O OD1 . ASP A 100 ? 0.450 0.229 0.305 -0.023 -0.038 -0.009 6895 ASP A OD1 
806  O OD2 . ASP A 100 ? 0.431 0.232 0.297 -0.025 -0.038 -0.003 6895 ASP A OD2 
807  N N   . SER A 101 ? 0.448 0.227 0.307 -0.008 -0.026 -0.003 6896 SER A N   
808  C CA  . SER A 101 ? 0.473 0.241 0.332 -0.007 -0.026 0.001  6896 SER A CA  
809  C C   . SER A 101 ? 0.455 0.232 0.322 -0.010 -0.024 0.009  6896 SER A C   
810  O O   . SER A 101 ? 0.425 0.218 0.296 -0.008 -0.021 0.010  6896 SER A O   
811  C CB  . SER A 101 ? 0.504 0.266 0.358 0.002  -0.025 -0.002 6896 SER A CB  
812  O OG  . SER A 101 ? 0.595 0.344 0.448 0.003  -0.026 0.002  6896 SER A OG  
813  N N   . ASP A 102 ? 0.457 0.224 0.324 -0.014 -0.024 0.014  6897 ASP A N   
814  C CA  . ASP A 102 ? 0.459 0.235 0.332 -0.017 -0.021 0.022  6897 ASP A CA  
815  C C   . ASP A 102 ? 0.477 0.236 0.345 -0.020 -0.022 0.028  6897 ASP A C   
816  O O   . ASP A 102 ? 0.470 0.212 0.336 -0.022 -0.026 0.025  6897 ASP A O   
817  C CB  . ASP A 102 ? 0.450 0.240 0.332 -0.024 -0.021 0.023  6897 ASP A CB  
818  C CG  . ASP A 102 ? 0.451 0.256 0.339 -0.025 -0.017 0.029  6897 ASP A CG  
819  O OD1 . ASP A 102 ? 0.482 0.283 0.370 -0.030 -0.015 0.036  6897 ASP A OD1 
820  O OD2 . ASP A 102 ? 0.430 0.250 0.322 -0.021 -0.015 0.028  6897 ASP A OD2 
821  N N   A LEU A 103 ? 0.482 0.246 0.351 -0.020 -0.019 0.035  6898 LEU A N   
822  N N   B LEU A 103 ? 0.478 0.242 0.347 -0.020 -0.019 0.035  6898 LEU A N   
823  C CA  A LEU A 103 ? 0.510 0.259 0.374 -0.024 -0.019 0.043  6898 LEU A CA  
824  C CA  B LEU A 103 ? 0.504 0.252 0.368 -0.024 -0.019 0.043  6898 LEU A CA  
825  C C   A LEU A 103 ? 0.519 0.263 0.389 -0.037 -0.020 0.046  6898 LEU A C   
826  C C   B LEU A 103 ? 0.516 0.259 0.386 -0.037 -0.020 0.045  6898 LEU A C   
827  O O   A LEU A 103 ? 0.538 0.262 0.404 -0.041 -0.023 0.049  6898 LEU A O   
828  O O   B LEU A 103 ? 0.535 0.258 0.401 -0.040 -0.024 0.048  6898 LEU A O   
829  C CB  A LEU A 103 ? 0.511 0.272 0.374 -0.022 -0.014 0.051  6898 LEU A CB  
830  C CB  B LEU A 103 ? 0.502 0.262 0.366 -0.023 -0.014 0.052  6898 LEU A CB  
831  C CG  A LEU A 103 ? 0.537 0.286 0.394 -0.026 -0.014 0.061  6898 LEU A CG  
832  C CG  B LEU A 103 ? 0.504 0.262 0.360 -0.012 -0.014 0.053  6898 LEU A CG  
833  C CD1 A LEU A 103 ? 0.572 0.294 0.418 -0.020 -0.018 0.062  6898 LEU A CD1 
834  C CD1 B LEU A 103 ? 0.501 0.275 0.356 -0.012 -0.010 0.059  6898 LEU A CD1 
835  C CD2 A LEU A 103 ? 0.534 0.299 0.389 -0.024 -0.009 0.067  6898 LEU A CD2 
836  C CD2 B LEU A 103 ? 0.528 0.260 0.374 -0.009 -0.018 0.056  6898 LEU A CD2 
837  N N   . ASN A 104 ? 0.505 0.268 0.385 -0.042 -0.019 0.044  6899 ASN A N   
838  C CA  . ASN A 104 ? 0.519 0.282 0.407 -0.055 -0.020 0.046  6899 ASN A CA  
839  C C   . ASN A 104 ? 0.514 0.277 0.407 -0.057 -0.025 0.037  6899 ASN A C   
840  O O   . ASN A 104 ? 0.483 0.255 0.375 -0.050 -0.026 0.031  6899 ASN A O   
841  C CB  . ASN A 104 ? 0.519 0.306 0.417 -0.060 -0.014 0.050  6899 ASN A CB  
842  C CG  . ASN A 104 ? 0.546 0.335 0.437 -0.057 -0.009 0.058  6899 ASN A CG  
843  O OD1 . ASN A 104 ? 0.563 0.334 0.446 -0.059 -0.009 0.065  6899 ASN A OD1 
844  N ND2 . ASN A 104 ? 0.516 0.325 0.410 -0.051 -0.005 0.058  6899 ASN A ND2 
845  N N   A ASP A 105 ? 0.522 0.276 0.419 -0.068 -0.028 0.037  6900 ASP A N   
846  N N   B ASP A 105 ? 0.521 0.276 0.419 -0.068 -0.028 0.037  6900 ASP A N   
847  C CA  A ASP A 105 ? 0.529 0.283 0.430 -0.070 -0.034 0.029  6900 ASP A CA  
848  C CA  B ASP A 105 ? 0.525 0.281 0.427 -0.072 -0.034 0.029  6900 ASP A CA  
849  C C   A ASP A 105 ? 0.501 0.280 0.412 -0.070 -0.034 0.026  6900 ASP A C   
850  C C   B ASP A 105 ? 0.498 0.278 0.409 -0.070 -0.034 0.026  6900 ASP A C   
851  O O   A ASP A 105 ? 0.489 0.286 0.409 -0.073 -0.029 0.031  6900 ASP A O   
852  O O   B ASP A 105 ? 0.484 0.282 0.404 -0.072 -0.029 0.031  6900 ASP A O   
853  C CB  A ASP A 105 ? 0.570 0.310 0.474 -0.082 -0.038 0.029  6900 ASP A CB  
854  C CB  B ASP A 105 ? 0.556 0.303 0.465 -0.085 -0.037 0.030  6900 ASP A CB  
855  C CG  A ASP A 105 ? 0.586 0.321 0.491 -0.084 -0.045 0.019  6900 ASP A CG  
856  C CG  B ASP A 105 ? 0.588 0.306 0.488 -0.087 -0.039 0.032  6900 ASP A CG  
857  O OD1 A ASP A 105 ? 0.577 0.314 0.475 -0.075 -0.047 0.012  6900 ASP A OD1 
858  O OD1 B ASP A 105 ? 0.602 0.305 0.491 -0.078 -0.041 0.027  6900 ASP A OD1 
859  O OD2 A ASP A 105 ? 0.627 0.358 0.538 -0.095 -0.049 0.018  6900 ASP A OD2 
860  O OD2 B ASP A 105 ? 0.624 0.336 0.528 -0.098 -0.038 0.038  6900 ASP A OD2 
861  N N   . PHE A 106 ? 0.486 0.267 0.395 -0.067 -0.039 0.018  6901 PHE A N   
862  C CA  . PHE A 106 ? 0.464 0.265 0.381 -0.066 -0.040 0.016  6901 PHE A CA  
863  C C   . PHE A 106 ? 0.473 0.268 0.385 -0.066 -0.047 0.008  6901 PHE A C   
864  O O   . PHE A 106 ? 0.477 0.255 0.378 -0.064 -0.049 0.004  6901 PHE A O   
865  C CB  . PHE A 106 ? 0.434 0.246 0.349 -0.056 -0.036 0.017  6901 PHE A CB  
866  C CG  . PHE A 106 ? 0.435 0.236 0.336 -0.047 -0.035 0.014  6901 PHE A CG  
867  C CD1 . PHE A 106 ? 0.444 0.232 0.337 -0.043 -0.033 0.016  6901 PHE A CD1 
868  C CD2 . PHE A 106 ? 0.436 0.242 0.334 -0.043 -0.038 0.010  6901 PHE A CD2 
869  C CE1 . PHE A 106 ? 0.440 0.221 0.323 -0.035 -0.032 0.012  6901 PHE A CE1 
870  C CE2 . PHE A 106 ? 0.434 0.234 0.321 -0.036 -0.037 0.007  6901 PHE A CE2 
871  C CZ  . PHE A 106 ? 0.436 0.225 0.317 -0.032 -0.034 0.007  6901 PHE A CZ  
872  N N   . VAL A 107 ? 0.464 0.275 0.384 -0.067 -0.051 0.006  6902 VAL A N   
873  C CA  . VAL A 107 ? 0.480 0.289 0.395 -0.067 -0.059 -0.001 6902 VAL A CA  
874  C C   . VAL A 107 ? 0.459 0.272 0.365 -0.058 -0.058 -0.001 6902 VAL A C   
875  O O   . VAL A 107 ? 0.425 0.253 0.339 -0.055 -0.056 0.002  6902 VAL A O   
876  C CB  . VAL A 107 ? 0.493 0.316 0.422 -0.074 -0.065 -0.002 6902 VAL A CB  
877  C CG1 . VAL A 107 ? 0.523 0.347 0.447 -0.073 -0.073 -0.008 6902 VAL A CG1 
878  C CG2 . VAL A 107 ? 0.522 0.341 0.460 -0.085 -0.065 -0.002 6902 VAL A CG2 
879  N N   . SER A 108 ? 0.453 0.256 0.345 -0.054 -0.061 -0.006 6903 SER A N   
880  C CA  . SER A 108 ? 0.457 0.262 0.339 -0.046 -0.058 -0.006 6903 SER A CA  
881  C C   . SER A 108 ? 0.463 0.267 0.335 -0.046 -0.064 -0.011 6903 SER A C   
882  O O   . SER A 108 ? 0.456 0.252 0.323 -0.050 -0.069 -0.016 6903 SER A O   
883  C CB  . SER A 108 ? 0.464 0.260 0.339 -0.041 -0.052 -0.006 6903 SER A CB  
884  O OG  . SER A 108 ? 0.460 0.257 0.325 -0.035 -0.050 -0.008 6903 SER A OG  
885  N N   . ASP A 109 ? 0.444 0.253 0.310 -0.041 -0.064 -0.009 6904 ASP A N   
886  C CA  . ASP A 109 ? 0.463 0.270 0.315 -0.040 -0.068 -0.012 6904 ASP A CA  
887  C C   . ASP A 109 ? 0.465 0.264 0.302 -0.036 -0.062 -0.015 6904 ASP A C   
888  O O   . ASP A 109 ? 0.460 0.258 0.283 -0.035 -0.064 -0.018 6904 ASP A O   
889  C CB  . ASP A 109 ? 0.459 0.276 0.314 -0.038 -0.071 -0.007 6904 ASP A CB  
890  C CG  . ASP A 109 ? 0.471 0.298 0.340 -0.041 -0.078 -0.006 6904 ASP A CG  
891  O OD1 . ASP A 109 ? 0.475 0.300 0.341 -0.045 -0.085 -0.010 6904 ASP A OD1 
892  O OD2 . ASP A 109 ? 0.461 0.298 0.344 -0.040 -0.076 -0.002 6904 ASP A OD2 
893  N N   . ALA A 110 ? 0.448 0.242 0.288 -0.033 -0.056 -0.016 6905 ALA A N   
894  C CA  . ALA A 110 ? 0.459 0.248 0.288 -0.028 -0.050 -0.020 6905 ALA A CA  
895  C C   . ALA A 110 ? 0.481 0.260 0.298 -0.030 -0.054 -0.028 6905 ALA A C   
896  O O   . ALA A 110 ? 0.491 0.263 0.311 -0.035 -0.060 -0.030 6905 ALA A O   
897  C CB  . ALA A 110 ? 0.458 0.245 0.293 -0.024 -0.044 -0.018 6905 ALA A CB  
898  N N   . ASP A 111 ? 0.488 0.265 0.292 -0.026 -0.050 -0.033 6906 ASP A N   
899  C CA  . ASP A 111 ? 0.513 0.280 0.305 -0.026 -0.053 -0.043 6906 ASP A CA  
900  C C   . ASP A 111 ? 0.521 0.275 0.320 -0.025 -0.053 -0.047 6906 ASP A C   
901  O O   . ASP A 111 ? 0.537 0.282 0.333 -0.028 -0.058 -0.053 6906 ASP A O   
902  C CB  . ASP A 111 ? 0.526 0.297 0.305 -0.021 -0.047 -0.048 6906 ASP A CB  
903  C CG  . ASP A 111 ? 0.540 0.321 0.311 -0.023 -0.047 -0.044 6906 ASP A CG  
904  O OD1 . ASP A 111 ? 0.554 0.334 0.318 -0.028 -0.054 -0.044 6906 ASP A OD1 
905  O OD2 . ASP A 111 ? 0.524 0.313 0.295 -0.021 -0.041 -0.039 6906 ASP A OD2 
906  N N   A SER A 112 ? 0.511 0.265 0.319 -0.021 -0.048 -0.042 6907 SER A N   
907  N N   B SER A 112 ? 0.508 0.262 0.316 -0.021 -0.048 -0.042 6907 SER A N   
908  C CA  A SER A 112 ? 0.521 0.261 0.335 -0.020 -0.048 -0.044 6907 SER A CA  
909  C CA  B SER A 112 ? 0.516 0.256 0.330 -0.020 -0.049 -0.044 6907 SER A CA  
910  C C   A SER A 112 ? 0.503 0.247 0.329 -0.020 -0.045 -0.034 6907 SER A C   
911  C C   B SER A 112 ? 0.501 0.245 0.327 -0.020 -0.045 -0.034 6907 SER A C   
912  O O   A SER A 112 ? 0.482 0.238 0.310 -0.017 -0.041 -0.029 6907 SER A O   
913  O O   B SER A 112 ? 0.484 0.240 0.312 -0.017 -0.041 -0.029 6907 SER A O   
914  C CB  A SER A 112 ? 0.536 0.268 0.343 -0.012 -0.046 -0.052 6907 SER A CB  
915  C CB  B SER A 112 ? 0.527 0.258 0.333 -0.013 -0.046 -0.052 6907 SER A CB  
916  O OG  A SER A 112 ? 0.562 0.290 0.357 -0.012 -0.048 -0.062 6907 SER A OG  
917  O OG  B SER A 112 ? 0.537 0.251 0.347 -0.012 -0.048 -0.053 6907 SER A OG  
918  N N   . THR A 113 ? 0.509 0.243 0.342 -0.024 -0.048 -0.031 6908 THR A N   
919  C CA  . THR A 113 ? 0.501 0.239 0.344 -0.025 -0.044 -0.021 6908 THR A CA  
920  C C   . THR A 113 ? 0.518 0.239 0.361 -0.022 -0.044 -0.020 6908 THR A C   
921  O O   . THR A 113 ? 0.516 0.221 0.357 -0.026 -0.049 -0.024 6908 THR A O   
922  C CB  . THR A 113 ? 0.503 0.249 0.357 -0.034 -0.047 -0.016 6908 THR A CB  
923  O OG1 . THR A 113 ? 0.484 0.244 0.337 -0.034 -0.048 -0.016 6908 THR A OG1 
924  C CG2 . THR A 113 ? 0.505 0.255 0.368 -0.035 -0.044 -0.007 6908 THR A CG2 
925  N N   . LEU A 114 ? 0.511 0.235 0.356 -0.016 -0.040 -0.016 6909 LEU A N   
926  C CA  . LEU A 114 ? 0.538 0.245 0.382 -0.012 -0.040 -0.014 6909 LEU A CA  
927  C C   . LEU A 114 ? 0.531 0.241 0.381 -0.017 -0.038 -0.002 6909 LEU A C   
928  O O   . LEU A 114 ? 0.490 0.218 0.345 -0.015 -0.034 0.002  6909 LEU A O   
929  C CB  . LEU A 114 ? 0.555 0.264 0.394 -0.001 -0.037 -0.018 6909 LEU A CB  
930  C CG  . LEU A 114 ? 0.584 0.291 0.416 0.004  -0.037 -0.029 6909 LEU A CG  
931  C CD1 . LEU A 114 ? 0.608 0.322 0.439 0.015  -0.034 -0.033 6909 LEU A CD1 
932  C CD2 . LEU A 114 ? 0.608 0.295 0.435 0.002  -0.043 -0.036 6909 LEU A CD2 
933  N N   . ILE A 115 ? 0.544 0.239 0.395 -0.023 -0.040 0.002  6910 ILE A N   
934  C CA  . ILE A 115 ? 0.544 0.242 0.401 -0.028 -0.037 0.013  6910 ILE A CA  
935  C C   . ILE A 115 ? 0.567 0.250 0.418 -0.022 -0.037 0.018  6910 ILE A C   
936  O O   . ILE A 115 ? 0.585 0.246 0.432 -0.020 -0.041 0.015  6910 ILE A O   
937  C CB  . ILE A 115 ? 0.567 0.261 0.430 -0.042 -0.040 0.016  6910 ILE A CB  
938  C CG1 . ILE A 115 ? 0.558 0.266 0.427 -0.047 -0.042 0.010  6910 ILE A CG1 
939  C CG2 . ILE A 115 ? 0.574 0.274 0.442 -0.048 -0.036 0.027  6910 ILE A CG2 
940  C CD1 . ILE A 115 ? 0.534 0.267 0.408 -0.044 -0.038 0.012  6910 ILE A CD1 
941  N N   . GLY A 116 ? 0.548 0.243 0.400 -0.019 -0.033 0.025  6911 GLY A N   
942  C CA  . GLY A 116 ? 0.561 0.243 0.407 -0.013 -0.033 0.032  6911 GLY A CA  
943  C C   . GLY A 116 ? 0.543 0.242 0.388 -0.003 -0.029 0.032  6911 GLY A C   
944  O O   . GLY A 116 ? 0.498 0.216 0.347 -0.001 -0.027 0.027  6911 GLY A O   
945  N N   . ASP A 117 ? 0.556 0.247 0.395 0.003  -0.030 0.038  6912 ASP A N   
946  C CA  . ASP A 117 ? 0.561 0.268 0.399 0.013  -0.027 0.038  6912 ASP A CA  
947  C C   . ASP A 117 ? 0.545 0.258 0.385 0.022  -0.028 0.026  6912 ASP A C   
948  O O   . ASP A 117 ? 0.542 0.239 0.379 0.025  -0.032 0.020  6912 ASP A O   
949  C CB  . ASP A 117 ? 0.605 0.299 0.435 0.019  -0.030 0.046  6912 ASP A CB  
950  C CG  . ASP A 117 ? 0.622 0.332 0.451 0.028  -0.028 0.047  6912 ASP A CG  
951  O OD1 . ASP A 117 ? 0.611 0.338 0.445 0.033  -0.026 0.039  6912 ASP A OD1 
952  O OD2 . ASP A 117 ? 0.724 0.428 0.546 0.030  -0.029 0.056  6912 ASP A OD2 
953  N N   . CYS A 118 ? 0.510 0.245 0.355 0.025  -0.024 0.023  6913 CYS A N   
954  C CA  . CYS A 118 ? 0.510 0.252 0.356 0.032  -0.024 0.012  6913 CYS A CA  
955  C C   . CYS A 118 ? 0.527 0.258 0.369 0.044  -0.027 0.008  6913 CYS A C   
956  O O   . CYS A 118 ? 0.525 0.256 0.368 0.049  -0.028 -0.001 6913 CYS A O   
957  C CB  . CYS A 118 ? 0.497 0.263 0.348 0.033  -0.020 0.010  6913 CYS A CB  
958  S SG  . CYS A 118 ? 0.502 0.278 0.353 0.040  -0.019 0.016  6913 CYS A SG  
959  N N   . ALA A 119 ? 0.531 0.254 0.369 0.048  -0.030 0.016  6914 ALA A N   
960  C CA  . ALA A 119 ? 0.550 0.261 0.385 0.060  -0.034 0.013  6914 ALA A CA  
961  C C   . ALA A 119 ? 0.568 0.256 0.400 0.061  -0.038 0.008  6914 ALA A C   
962  O O   . ALA A 119 ? 0.586 0.267 0.418 0.072  -0.042 0.001  6914 ALA A O   
963  C CB  . ALA A 119 ? 0.570 0.275 0.399 0.063  -0.037 0.023  6914 ALA A CB  
964  N N   . THR A 120 ? 0.575 0.253 0.406 0.049  -0.038 0.010  6915 THR A N   
965  C CA  . THR A 120 ? 0.593 0.248 0.421 0.048  -0.043 0.004  6915 THR A CA  
966  C C   . THR A 120 ? 0.595 0.259 0.426 0.048  -0.041 -0.009 6915 THR A C   
967  O O   . THR A 120 ? 0.603 0.251 0.432 0.049  -0.045 -0.016 6915 THR A O   
968  C CB  . THR A 120 ? 0.601 0.240 0.428 0.035  -0.044 0.013  6915 THR A CB  
969  O OG1 . THR A 120 ? 0.581 0.236 0.412 0.025  -0.040 0.012  6915 THR A OG1 
970  C CG2 . THR A 120 ? 0.627 0.256 0.449 0.033  -0.045 0.027  6915 THR A CG2 
971  N N   . VAL A 121 ? 0.581 0.269 0.415 0.048  -0.036 -0.012 6916 VAL A N   
972  C CA  . VAL A 121 ? 0.591 0.289 0.426 0.046  -0.034 -0.022 6916 VAL A CA  
973  C C   . VAL A 121 ? 0.620 0.322 0.455 0.059  -0.033 -0.033 6916 VAL A C   
974  O O   . VAL A 121 ? 0.592 0.307 0.431 0.066  -0.032 -0.033 6916 VAL A O   
975  C CB  . VAL A 121 ? 0.571 0.293 0.410 0.040  -0.029 -0.020 6916 VAL A CB  
976  C CG1 . VAL A 121 ? 0.573 0.305 0.410 0.040  -0.026 -0.030 6916 VAL A CG1 
977  C CG2 . VAL A 121 ? 0.572 0.292 0.412 0.028  -0.029 -0.011 6916 VAL A CG2 
978  N N   . HIS A 122 ? 0.646 0.340 0.478 0.060  -0.035 -0.044 6917 HIS A N   
979  C CA  . HIS A 122 ? 0.714 0.413 0.546 0.072  -0.034 -0.057 6917 HIS A CA  
980  C C   . HIS A 122 ? 0.717 0.430 0.547 0.067  -0.030 -0.066 6917 HIS A C   
981  O O   . HIS A 122 ? 0.717 0.423 0.542 0.058  -0.031 -0.065 6917 HIS A O   
982  C CB  . HIS A 122 ? 0.806 0.481 0.636 0.079  -0.040 -0.063 6917 HIS A CB  
983  C CG  . HIS A 122 ? 0.879 0.535 0.709 0.083  -0.046 -0.053 6917 HIS A CG  
984  N ND1 . HIS A 122 ? 0.945 0.608 0.779 0.093  -0.046 -0.050 6917 HIS A ND1 
985  C CD2 . HIS A 122 ? 0.931 0.561 0.758 0.078  -0.051 -0.046 6917 HIS A CD2 
986  C CE1 . HIS A 122 ? 0.967 0.609 0.798 0.094  -0.052 -0.040 6917 HIS A CE1 
987  N NE2 . HIS A 122 ? 0.977 0.598 0.804 0.084  -0.055 -0.037 6917 HIS A NE2 
988  N N   . THR A 123 ? 0.712 0.442 0.544 0.074  -0.025 -0.075 6918 THR A N   
989  C CA  . THR A 123 ? 0.710 0.454 0.537 0.071  -0.020 -0.084 6918 THR A CA  
990  C C   . THR A 123 ? 0.711 0.467 0.541 0.082  -0.017 -0.096 6918 THR A C   
991  O O   . THR A 123 ? 0.712 0.478 0.550 0.089  -0.015 -0.095 6918 THR A O   
992  C CB  . THR A 123 ? 0.695 0.455 0.522 0.061  -0.016 -0.076 6918 THR A CB  
993  O OG1 . THR A 123 ? 0.733 0.503 0.553 0.058  -0.012 -0.085 6918 THR A OG1 
994  C CG2 . THR A 123 ? 0.685 0.464 0.520 0.063  -0.012 -0.071 6918 THR A CG2 
995  N N   . ALA A 124 ? 0.717 0.473 0.541 0.083  -0.015 -0.108 6919 ALA A N   
996  C CA  . ALA A 124 ? 0.727 0.498 0.554 0.093  -0.011 -0.122 6919 ALA A CA  
997  C C   . ALA A 124 ? 0.698 0.496 0.524 0.087  -0.002 -0.123 6919 ALA A C   
998  O O   . ALA A 124 ? 0.737 0.553 0.566 0.093  0.004  -0.133 6919 ALA A O   
999  C CB  . ALA A 124 ? 0.767 0.525 0.587 0.098  -0.013 -0.136 6919 ALA A CB  
1000 N N   . ASN A 125 ? 0.669 0.471 0.491 0.075  0.000  -0.112 6920 ASN A N   
1001 C CA  . ASN A 125 ? 0.636 0.459 0.454 0.068  0.008  -0.111 6920 ASN A CA  
1002 C C   . ASN A 125 ? 0.589 0.426 0.416 0.064  0.010  -0.101 6920 ASN A C   
1003 O O   . ASN A 125 ? 0.545 0.372 0.378 0.065  0.006  -0.092 6920 ASN A O   
1004 C CB  . ASN A 125 ? 0.668 0.486 0.473 0.057  0.007  -0.108 6920 ASN A CB  
1005 C CG  . ASN A 125 ? 0.724 0.525 0.521 0.059  0.002  -0.117 6920 ASN A CG  
1006 O OD1 . ASN A 125 ? 0.767 0.549 0.567 0.061  -0.005 -0.115 6920 ASN A OD1 
1007 N ND2 . ASN A 125 ? 0.756 0.566 0.543 0.058  0.006  -0.127 6920 ASN A ND2 
1008 N N   . LYS A 126 ? 0.570 0.427 0.397 0.060  0.018  -0.102 6921 LYS A N   
1009 C CA  . LYS A 126 ? 0.544 0.414 0.379 0.055  0.021  -0.093 6921 LYS A CA  
1010 C C   . LYS A 126 ? 0.524 0.390 0.350 0.043  0.020  -0.083 6921 LYS A C   
1011 O O   . LYS A 126 ? 0.533 0.394 0.347 0.038  0.020  -0.085 6921 LYS A O   
1012 C CB  . LYS A 126 ? 0.562 0.456 0.403 0.057  0.029  -0.100 6921 LYS A CB  
1013 C CG  . LYS A 126 ? 0.589 0.490 0.442 0.070  0.029  -0.109 6921 LYS A CG  
1014 C CD  . LYS A 126 ? 0.619 0.547 0.481 0.070  0.037  -0.115 6921 LYS A CD  
1015 C CE  . LYS A 126 ? 0.639 0.575 0.515 0.084  0.036  -0.126 6921 LYS A CE  
1016 N NZ  . LYS A 126 ? 0.668 0.596 0.552 0.090  0.028  -0.118 6921 LYS A NZ  
1017 N N   . TRP A 127 ? 0.485 0.353 0.318 0.038  0.019  -0.073 6922 TRP A N   
1018 C CA  . TRP A 127 ? 0.470 0.333 0.298 0.029  0.017  -0.063 6922 TRP A CA  
1019 C C   . TRP A 127 ? 0.450 0.328 0.280 0.023  0.023  -0.059 6922 TRP A C   
1020 O O   . TRP A 127 ? 0.443 0.335 0.283 0.026  0.027  -0.063 6922 TRP A O   
1021 C CB  . TRP A 127 ? 0.473 0.323 0.306 0.029  0.011  -0.055 6922 TRP A CB  
1022 C CG  . TRP A 127 ? 0.490 0.324 0.319 0.033  0.005  -0.059 6922 TRP A CG  
1023 C CD1 . TRP A 127 ? 0.511 0.339 0.343 0.042  0.004  -0.065 6922 TRP A CD1 
1024 C CD2 . TRP A 127 ? 0.497 0.318 0.318 0.027  0.001  -0.057 6922 TRP A CD2 
1025 N NE1 . TRP A 127 ? 0.532 0.343 0.358 0.042  -0.001 -0.067 6922 TRP A NE1 
1026 C CE2 . TRP A 127 ? 0.529 0.335 0.348 0.033  -0.003 -0.062 6922 TRP A CE2 
1027 C CE3 . TRP A 127 ? 0.504 0.323 0.318 0.019  -0.002 -0.051 6922 TRP A CE3 
1028 C CZ2 . TRP A 127 ? 0.542 0.333 0.355 0.029  -0.009 -0.063 6922 TRP A CZ2 
1029 C CZ3 . TRP A 127 ? 0.509 0.314 0.317 0.016  -0.007 -0.052 6922 TRP A CZ3 
1030 C CH2 . TRP A 127 ? 0.534 0.326 0.341 0.020  -0.011 -0.058 6922 TRP A CH2 
1031 N N   . ASP A 128 ? 0.441 0.316 0.264 0.014  0.022  -0.052 6923 ASP A N   
1032 C CA  . ASP A 128 ? 0.442 0.329 0.266 0.007  0.027  -0.048 6923 ASP A CA  
1033 C C   . ASP A 128 ? 0.419 0.302 0.252 0.005  0.023  -0.039 6923 ASP A C   
1034 O O   . ASP A 128 ? 0.416 0.309 0.255 0.001  0.027  -0.036 6923 ASP A O   
1035 C CB  . ASP A 128 ? 0.462 0.346 0.271 -0.001 0.028  -0.045 6923 ASP A CB  
1036 C CG  . ASP A 128 ? 0.488 0.375 0.285 0.001  0.032  -0.055 6923 ASP A CG  
1037 O OD1 . ASP A 128 ? 0.496 0.395 0.301 0.006  0.037  -0.063 6923 ASP A OD1 
1038 O OD2 . ASP A 128 ? 0.517 0.396 0.300 -0.002 0.029  -0.055 6923 ASP A OD2 
1039 N N   . LEU A 129 ? 0.407 0.279 0.242 0.007  0.017  -0.035 6924 LEU A N   
1040 C CA  . LEU A 129 ? 0.392 0.262 0.236 0.005  0.013  -0.028 6924 LEU A CA  
1041 C C   . LEU A 129 ? 0.389 0.250 0.237 0.010  0.008  -0.027 6924 LEU A C   
1042 O O   . LEU A 129 ? 0.387 0.239 0.229 0.010  0.005  -0.028 6924 LEU A O   
1043 C CB  . LEU A 129 ? 0.402 0.267 0.240 -0.002 0.010  -0.021 6924 LEU A CB  
1044 C CG  . LEU A 129 ? 0.399 0.262 0.246 -0.003 0.006  -0.014 6924 LEU A CG  
1045 C CD1 . LEU A 129 ? 0.406 0.279 0.262 -0.003 0.010  -0.014 6924 LEU A CD1 
1046 C CD2 . LEU A 129 ? 0.416 0.273 0.256 -0.009 0.002  -0.008 6924 LEU A CD2 
1047 N N   . ILE A 130 ? 0.369 0.235 0.227 0.014  0.008  -0.025 6925 ILE A N   
1048 C CA  . ILE A 130 ? 0.370 0.229 0.232 0.018  0.004  -0.022 6925 ILE A CA  
1049 C C   . ILE A 130 ? 0.359 0.220 0.228 0.015  0.002  -0.016 6925 ILE A C   
1050 O O   . ILE A 130 ? 0.366 0.237 0.241 0.015  0.004  -0.016 6925 ILE A O   
1051 C CB  . ILE A 130 ? 0.372 0.235 0.239 0.026  0.005  -0.026 6925 ILE A CB  
1052 C CG1 . ILE A 130 ? 0.389 0.251 0.252 0.030  0.007  -0.034 6925 ILE A CG1 
1053 C CG2 . ILE A 130 ? 0.377 0.231 0.246 0.029  0.001  -0.022 6925 ILE A CG2 
1054 C CD1 . ILE A 130 ? 0.394 0.263 0.264 0.039  0.008  -0.039 6925 ILE A CD1 
1055 N N   . ILE A 131 ? 0.360 0.213 0.228 0.012  -0.002 -0.012 6926 ILE A N   
1056 C CA  . ILE A 131 ? 0.353 0.209 0.228 0.010  -0.004 -0.007 6926 ILE A CA  
1057 C C   . ILE A 131 ? 0.358 0.211 0.236 0.013  -0.006 -0.005 6926 ILE A C   
1058 O O   . ILE A 131 ? 0.380 0.223 0.253 0.012  -0.007 -0.005 6926 ILE A O   
1059 C CB  . ILE A 131 ? 0.353 0.205 0.226 0.004  -0.008 -0.003 6926 ILE A CB  
1060 C CG1 . ILE A 131 ? 0.361 0.214 0.228 0.001  -0.007 -0.004 6926 ILE A CG1 
1061 C CG2 . ILE A 131 ? 0.344 0.201 0.226 0.004  -0.010 0.000  6926 ILE A CG2 
1062 C CD1 . ILE A 131 ? 0.359 0.220 0.231 0.001  -0.004 -0.004 6926 ILE A CD1 
1063 N N   . SER A 132 ? 0.340 0.200 0.225 0.015  -0.005 -0.003 6927 SER A N   
1064 C CA  . SER A 132 ? 0.339 0.197 0.225 0.017  -0.006 0.001  6927 SER A CA  
1065 C C   . SER A 132 ? 0.331 0.196 0.224 0.015  -0.006 0.004  6927 SER A C   
1066 O O   . SER A 132 ? 0.320 0.195 0.218 0.016  -0.004 0.002  6927 SER A O   
1067 C CB  . SER A 132 ? 0.342 0.201 0.226 0.023  -0.004 -0.001 6927 SER A CB  
1068 O OG  . SER A 132 ? 0.340 0.196 0.224 0.024  -0.005 0.004  6927 SER A OG  
1069 N N   . ASP A 133 ? 0.339 0.201 0.233 0.011  -0.007 0.008  6928 ASP A N   
1070 C CA  . ASP A 133 ? 0.349 0.220 0.249 0.009  -0.007 0.010  6928 ASP A CA  
1071 C C   . ASP A 133 ? 0.350 0.220 0.249 0.010  -0.005 0.015  6928 ASP A C   
1072 O O   . ASP A 133 ? 0.355 0.231 0.258 0.007  -0.004 0.018  6928 ASP A O   
1073 C CB  . ASP A 133 ? 0.361 0.234 0.267 0.004  -0.009 0.011  6928 ASP A CB  
1074 C CG  . ASP A 133 ? 0.386 0.271 0.302 0.004  -0.009 0.012  6928 ASP A CG  
1075 O OD1 . ASP A 133 ? 0.396 0.289 0.314 0.008  -0.007 0.010  6928 ASP A OD1 
1076 O OD2 . ASP A 133 ? 0.402 0.290 0.323 0.000  -0.010 0.013  6928 ASP A OD2 
1077 N N   . MET A 134 ? 0.354 0.214 0.245 0.013  -0.005 0.015  6929 MET A N   
1078 C CA  . MET A 134 ? 0.367 0.222 0.253 0.013  -0.005 0.021  6929 MET A CA  
1079 C C   . MET A 134 ? 0.374 0.243 0.263 0.015  -0.002 0.022  6929 MET A C   
1080 O O   . MET A 134 ? 0.360 0.238 0.251 0.020  -0.002 0.018  6929 MET A O   
1081 C CB  . MET A 134 ? 0.385 0.228 0.264 0.018  -0.006 0.020  6929 MET A CB  
1082 C CG  . MET A 134 ? 0.399 0.227 0.274 0.016  -0.009 0.019  6929 MET A CG  
1083 S SD  . MET A 134 ? 0.418 0.229 0.284 0.023  -0.011 0.018  6929 MET A SD  
1084 C CE  . MET A 134 ? 0.406 0.229 0.274 0.031  -0.010 0.010  6929 MET A CE  
1085 N N   . TYR A 135 ? 0.395 0.265 0.283 0.011  -0.001 0.028  6930 TYR A N   
1086 C CA  . TYR A 135 ? 0.416 0.299 0.304 0.013  0.002  0.030  6930 TYR A CA  
1087 C C   . TYR A 135 ? 0.469 0.348 0.352 0.008  0.004  0.038  6930 TYR A C   
1088 O O   . TYR A 135 ? 0.459 0.332 0.344 0.000  0.004  0.041  6930 TYR A O   
1089 C CB  . TYR A 135 ? 0.407 0.307 0.307 0.011  0.004  0.026  6930 TYR A CB  
1090 C CG  . TYR A 135 ? 0.416 0.332 0.318 0.013  0.007  0.026  6930 TYR A CG  
1091 C CD1 . TYR A 135 ? 0.409 0.333 0.310 0.019  0.007  0.021  6930 TYR A CD1 
1092 C CD2 . TYR A 135 ? 0.457 0.380 0.360 0.007  0.010  0.030  6930 TYR A CD2 
1093 C CE1 . TYR A 135 ? 0.423 0.361 0.324 0.021  0.010  0.020  6930 TYR A CE1 
1094 C CE2 . TYR A 135 ? 0.476 0.415 0.380 0.009  0.014  0.029  6930 TYR A CE2 
1095 C CZ  . TYR A 135 ? 0.466 0.413 0.368 0.016  0.014  0.023  6930 TYR A CZ  
1096 O OH  . TYR A 135 ? 0.482 0.445 0.384 0.018  0.017  0.021  6930 TYR A OH  
1097 N N   . ASP A 136 ? 0.519 0.398 0.393 0.012  0.005  0.042  6931 ASP A N   
1098 C CA  . ASP A 136 ? 0.609 0.481 0.474 0.007  0.007  0.052  6931 ASP A CA  
1099 C C   . ASP A 136 ? 0.667 0.559 0.538 0.002  0.012  0.053  6931 ASP A C   
1100 O O   . ASP A 136 ? 0.635 0.542 0.505 0.007  0.014  0.050  6931 ASP A O   
1101 C CB  . ASP A 136 ? 0.634 0.497 0.487 0.014  0.004  0.056  6931 ASP A CB  
1102 C CG  . ASP A 136 ? 0.695 0.548 0.537 0.009  0.006  0.068  6931 ASP A CG  
1103 O OD1 . ASP A 136 ? 0.670 0.529 0.514 -0.001 0.010  0.072  6931 ASP A OD1 
1104 O OD2 . ASP A 136 ? 0.734 0.571 0.565 0.014  0.002  0.072  6931 ASP A OD2 
1105 N N   . PRO A 137 ? 0.775 0.947 0.748 -0.042 -0.017 -0.082 6932 PRO A N   
1106 C CA  . PRO A 137 ? 0.834 0.991 0.800 -0.058 -0.009 -0.062 6932 PRO A CA  
1107 C C   . PRO A 137 ? 0.907 0.962 0.864 -0.087 -0.003 -0.032 6932 PRO A C   
1108 O O   . PRO A 137 ? 0.962 1.024 0.907 -0.086 0.003  -0.013 6932 PRO A O   
1109 C CB  . PRO A 137 ? 0.858 1.086 0.859 -0.079 -0.010 -0.120 6932 PRO A CB  
1110 C CG  . PRO A 137 ? 0.859 1.083 0.902 -0.087 -0.022 -0.175 6932 PRO A CG  
1111 C CD  . PRO A 137 ? 0.816 1.059 0.833 -0.045 -0.028 -0.158 6932 PRO A CD  
1112 N N   . LYS A 138 ? 0.981 0.958 0.946 -0.103 -0.009 -0.031 6933 LYS A N   
1113 C CA  . LYS A 138 ? 1.042 0.940 0.992 -0.126 -0.006 0.008  6933 LYS A CA  
1114 C C   . LYS A 138 ? 1.022 0.911 0.943 -0.098 -0.003 0.037  6933 LYS A C   
1115 O O   . LYS A 138 ? 1.020 0.879 0.926 -0.108 -0.001 0.063  6933 LYS A O   
1116 C CB  . LYS A 138 ? 1.124 0.933 1.096 -0.139 -0.022 0.006  6933 LYS A CB  
1117 C CG  . LYS A 138 ? 1.218 1.010 1.243 -0.177 -0.029 -0.027 6933 LYS A CG  
1118 C CD  . LYS A 138 ? 1.336 1.008 1.401 -0.184 -0.056 -0.028 6933 LYS A CD  
1119 C CE  . LYS A 138 ? 1.434 1.072 1.577 -0.232 -0.067 -0.066 6933 LYS A CE  
1120 N NZ  . LYS A 138 ? 1.579 1.068 1.778 -0.235 -0.103 -0.062 6933 LYS A NZ  
1121 N N   . THR A 139 ? 0.978 0.902 0.897 -0.069 -0.003 0.035  6934 THR A N   
1122 C CA  . THR A 139 ? 0.969 0.878 0.882 -0.054 -0.002 0.059  6934 THR A CA  
1123 C C   . THR A 139 ? 1.012 0.931 0.932 -0.054 0.000  0.061  6934 THR A C   
1124 O O   . THR A 139 ? 1.047 0.949 0.976 -0.049 -0.001 0.063  6934 THR A O   
1125 C CB  . THR A 139 ? 0.910 0.858 0.827 -0.037 -0.003 0.073  6934 THR A CB  
1126 O OG1 . THR A 139 ? 0.861 0.836 0.777 -0.031 -0.007 0.052  6934 THR A OG1 
1127 C CG2 . THR A 139 ? 0.881 0.807 0.811 -0.036 -0.001 0.100  6934 THR A CG2 
1128 N N   . LYS A 140 ? 1.069 1.033 0.996 -0.055 0.001  0.045  6935 LYS A N   
1129 C CA  . LYS A 140 ? 1.135 1.136 1.078 -0.044 -0.002 0.027  6935 LYS A CA  
1130 C C   . LYS A 140 ? 1.171 1.230 1.104 -0.076 0.008  0.012  6935 LYS A C   
1131 O O   . LYS A 140 ? 1.185 1.306 1.130 -0.068 0.006  -0.012 6935 LYS A O   
1132 C CB  . LYS A 140 ? 1.186 1.222 1.150 -0.011 -0.014 0.018  6935 LYS A CB  
1133 C CG  . LYS A 140 ? 1.217 1.202 1.201 0.017  -0.028 0.053  6935 LYS A CG  
1134 C CD  . LYS A 140 ? 1.275 1.288 1.279 0.058  -0.047 0.060  6935 LYS A CD  
1135 C CE  . LYS A 140 ? 1.346 1.292 1.376 0.078  -0.062 0.119  6935 LYS A CE  
1136 N NZ  . LYS A 140 ? 1.423 1.389 1.470 0.127  -0.088 0.141  6935 LYS A NZ  
1137 N N   . ASN A 141 ? 1.265 1.316 1.187 -0.112 0.016  0.022  6936 ASN A N   
1138 C CA  . ASN A 141 ? 1.309 1.413 1.227 -0.160 0.028  0.029  6936 ASN A CA  
1139 C C   . ASN A 141 ? 1.341 1.446 1.235 -0.170 0.031  0.060  6936 ASN A C   
1140 O O   . ASN A 141 ? 1.361 1.568 1.248 -0.197 0.042  0.064  6936 ASN A O   
1141 C CB  . ASN A 141 ? 1.370 1.432 1.301 -0.205 0.031  0.038  6936 ASN A CB  
1142 C CG  . ASN A 141 ? 1.373 1.486 1.332 -0.200 0.029  -0.008 6936 ASN A CG  
1143 O OD1 . ASN A 141 ? 1.333 1.519 1.293 -0.162 0.026  -0.035 6936 ASN A OD1 
1144 N ND2 . ASN A 141 ? 1.427 1.507 1.417 -0.232 0.027  -0.023 6936 ASN A ND2 
1145 N N   . VAL A 142 ? 1.319 1.345 1.201 -0.147 0.023  0.079  6937 VAL A N   
1146 C CA  . VAL A 142 ? 1.325 1.367 1.183 -0.145 0.022  0.105  6937 VAL A CA  
1147 C C   . VAL A 142 ? 1.236 1.243 1.104 -0.102 0.011  0.082  6937 VAL A C   
1148 O O   . VAL A 142 ? 1.250 1.178 1.120 -0.091 0.005  0.088  6937 VAL A O   
1149 C CB  . VAL A 142 ? 1.401 1.380 1.236 -0.176 0.019  0.168  6937 VAL A CB  
1150 C CG1 . VAL A 142 ? 1.425 1.280 1.275 -0.164 0.005  0.166  6937 VAL A CG1 
1151 C CG2 . VAL A 142 ? 1.406 1.423 1.208 -0.163 0.015  0.202  6937 VAL A CG2 
1152 N N   . THR A 143 ? 1.122 1.203 1.006 -0.082 0.009  0.046  6938 THR A N   
1153 C CA  . THR A 143 ? 1.068 1.119 0.981 -0.053 -0.001 0.019  6938 THR A CA  
1154 C C   . THR A 143 ? 0.995 1.056 0.878 -0.049 -0.004 0.039  6938 THR A C   
1155 O O   . THR A 143 ? 1.044 1.187 0.898 -0.055 -0.001 0.056  6938 THR A O   
1156 C CB  . THR A 143 ? 1.091 1.201 1.060 -0.030 -0.011 -0.044 6938 THR A CB  
1157 O OG1 . THR A 143 ? 1.089 1.141 1.102 -0.018 -0.020 -0.062 6938 THR A OG1 
1158 C CG2 . THR A 143 ? 1.105 1.357 1.073 -0.024 -0.012 -0.083 6938 THR A CG2 
1159 N N   . LYS A 144 ? 0.843 0.843 0.734 -0.037 -0.009 0.040  6939 LYS A N   
1160 C CA  . LYS A 144 ? 0.756 0.768 0.623 -0.021 -0.017 0.052  6939 LYS A CA  
1161 C C   . LYS A 144 ? 0.641 0.677 0.552 -0.008 -0.021 0.004  6939 LYS A C   
1162 O O   . LYS A 144 ? 0.540 0.544 0.499 -0.019 -0.017 -0.017 6939 LYS A O   
1163 C CB  . LYS A 144 ? 0.826 0.751 0.670 -0.018 -0.025 0.088  6939 LYS A CB  
1164 C CG  . LYS A 144 ? 0.888 0.760 0.717 -0.042 -0.023 0.126  6939 LYS A CG  
1165 C CD  . LYS A 144 ? 0.994 0.890 0.789 -0.057 -0.025 0.178  6939 LYS A CD  
1166 C CE  . LYS A 144 ? 1.090 0.955 0.859 -0.030 -0.046 0.217  6939 LYS A CE  
1167 N NZ  . LYS A 144 ? 1.195 1.084 0.927 -0.051 -0.049 0.295  6939 LYS A NZ  
1168 N N   A GLU A 145 ? 0.716 0.524 0.424 0.020  -0.001 0.042  6940 GLU A N   
1169 N N   B GLU A 145 ? 0.711 0.518 0.418 0.020  -0.002 0.042  6940 GLU A N   
1170 C CA  A GLU A 145 ? 0.681 0.509 0.402 0.029  -0.011 0.036  6940 GLU A CA  
1171 C CA  B GLU A 145 ? 0.667 0.493 0.387 0.030  -0.011 0.036  6940 GLU A CA  
1172 C C   A GLU A 145 ? 0.630 0.470 0.379 0.034  -0.013 0.032  6940 GLU A C   
1173 C C   B GLU A 145 ? 0.620 0.459 0.370 0.034  -0.013 0.032  6940 GLU A C   
1174 O O   A GLU A 145 ? 0.620 0.446 0.367 0.037  -0.015 0.037  6940 GLU A O   
1175 O O   B GLU A 145 ? 0.613 0.440 0.363 0.036  -0.014 0.036  6940 GLU A O   
1176 C CB  A GLU A 145 ? 0.718 0.536 0.416 0.038  -0.022 0.041  6940 GLU A CB  
1177 C CB  B GLU A 145 ? 0.682 0.499 0.384 0.041  -0.024 0.041  6940 GLU A CB  
1178 C CG  A GLU A 145 ? 0.756 0.562 0.424 0.031  -0.018 0.044  6940 GLU A CG  
1179 C CG  B GLU A 145 ? 0.658 0.498 0.377 0.050  -0.034 0.034  6940 GLU A CG  
1180 C CD  A GLU A 145 ? 0.798 0.583 0.433 0.039  -0.028 0.052  6940 GLU A CD  
1181 C CD  B GLU A 145 ? 0.682 0.519 0.391 0.064  -0.048 0.038  6940 GLU A CD  
1182 O OE1 A GLU A 145 ? 0.806 0.570 0.412 0.031  -0.022 0.059  6940 GLU A OE1 
1183 O OE1 B GLU A 145 ? 0.715 0.528 0.396 0.068  -0.052 0.046  6940 GLU A OE1 
1184 O OE2 A GLU A 145 ? 0.838 0.629 0.476 0.052  -0.041 0.052  6940 GLU A OE2 
1185 O OE2 B GLU A 145 ? 0.646 0.503 0.375 0.072  -0.055 0.032  6940 GLU A OE2 
1186 N N   . ASN A 146 ? 0.571 0.433 0.343 0.034  -0.013 0.024  6941 ASN A N   
1187 C CA  . ASN A 146 ? 0.527 0.400 0.324 0.036  -0.014 0.021  6941 ASN A CA  
1188 C C   . ASN A 146 ? 0.520 0.396 0.321 0.048  -0.024 0.021  6941 ASN A C   
1189 O O   . ASN A 146 ? 0.498 0.394 0.316 0.050  -0.028 0.015  6941 ASN A O   
1190 C CB  . ASN A 146 ? 0.487 0.379 0.304 0.031  -0.009 0.013  6941 ASN A CB  
1191 C CG  . ASN A 146 ? 0.453 0.351 0.291 0.030  -0.007 0.011  6941 ASN A CG  
1192 O OD1 . ASN A 146 ? 0.442 0.330 0.279 0.032  -0.008 0.015  6941 ASN A OD1 
1193 N ND2 . ASN A 146 ? 0.421 0.333 0.276 0.027  -0.005 0.005  6941 ASN A ND2 
1194 N N   A ASP A 147 ? 0.539 0.398 0.328 0.053  -0.028 0.027  6942 ASP A N   
1195 N N   B ASP A 147 ? 0.538 0.396 0.326 0.053  -0.028 0.027  6942 ASP A N   
1196 C CA  A ASP A 147 ? 0.548 0.409 0.342 0.066  -0.037 0.027  6942 ASP A CA  
1197 C CA  B ASP A 147 ? 0.542 0.405 0.337 0.066  -0.037 0.026  6942 ASP A CA  
1198 C C   A ASP A 147 ? 0.519 0.383 0.331 0.065  -0.034 0.024  6942 ASP A C   
1199 C C   B ASP A 147 ? 0.518 0.381 0.329 0.065  -0.034 0.024  6942 ASP A C   
1200 O O   A ASP A 147 ? 0.507 0.365 0.322 0.056  -0.025 0.025  6942 ASP A O   
1201 O O   B ASP A 147 ? 0.509 0.367 0.323 0.056  -0.025 0.025  6942 ASP A O   
1202 C CB  A ASP A 147 ? 0.600 0.439 0.370 0.075  -0.044 0.034  6942 ASP A CB  
1203 C CB  B ASP A 147 ? 0.589 0.432 0.360 0.075  -0.045 0.033  6942 ASP A CB  
1204 C CG  A ASP A 147 ? 0.642 0.481 0.393 0.079  -0.051 0.036  6942 ASP A CG  
1205 C CG  B ASP A 147 ? 0.620 0.433 0.373 0.072  -0.040 0.041  6942 ASP A CG  
1206 O OD1 A ASP A 147 ? 0.638 0.500 0.401 0.080  -0.055 0.030  6942 ASP A OD1 
1207 O OD1 B ASP A 147 ? 0.616 0.426 0.375 0.061  -0.031 0.040  6942 ASP A OD1 
1208 O OD2 A ASP A 147 ? 0.690 0.504 0.414 0.080  -0.053 0.044  6942 ASP A OD2 
1209 O OD2 B ASP A 147 ? 0.693 0.485 0.425 0.080  -0.047 0.047  6942 ASP A OD2 
1210 N N   . SER A 148 ? 0.505 0.378 0.327 0.075  -0.040 0.021  6943 SER A N   
1211 C CA  . SER A 148 ? 0.476 0.349 0.312 0.076  -0.037 0.019  6943 SER A CA  
1212 C C   . SER A 148 ? 0.503 0.348 0.323 0.074  -0.034 0.025  6943 SER A C   
1213 O O   . SER A 148 ? 0.509 0.335 0.309 0.080  -0.038 0.030  6943 SER A O   
1214 C CB  . SER A 148 ? 0.467 0.353 0.313 0.088  -0.044 0.014  6943 SER A CB  
1215 O OG  . SER A 148 ? 0.434 0.322 0.293 0.088  -0.040 0.011  6943 SER A OG  
1216 N N   . LYS A 149 ? 0.472 0.316 0.301 0.066  -0.027 0.024  6944 LYS A N   
1217 C CA  . LYS A 149 ? 0.505 0.323 0.320 0.061  -0.023 0.028  6944 LYS A CA  
1218 C C   . LYS A 149 ? 0.523 0.332 0.339 0.070  -0.026 0.026  6944 LYS A C   
1219 O O   . LYS A 149 ? 0.490 0.317 0.324 0.072  -0.026 0.020  6944 LYS A O   
1220 C CB  . LYS A 149 ? 0.487 0.309 0.310 0.047  -0.015 0.027  6944 LYS A CB  
1221 C CG  . LYS A 149 ? 0.474 0.306 0.297 0.040  -0.011 0.028  6944 LYS A CG  
1222 C CD  . LYS A 149 ? 0.509 0.324 0.309 0.039  -0.011 0.033  6944 LYS A CD  
1223 C CE  . LYS A 149 ? 0.505 0.329 0.304 0.030  -0.005 0.033  6944 LYS A CE  
1224 N NZ  . LYS A 149 ? 0.487 0.334 0.300 0.033  -0.008 0.027  6944 LYS A NZ  
1225 N N   . GLU A 150 ? 0.570 0.351 0.367 0.073  -0.028 0.031  6945 GLU A N   
1226 C CA  . GLU A 150 ? 0.638 0.408 0.434 0.084  -0.031 0.029  6945 GLU A CA  
1227 C C   . GLU A 150 ? 0.678 0.421 0.462 0.077  -0.026 0.031  6945 GLU A C   
1228 O O   . GLU A 150 ? 0.815 0.534 0.585 0.085  -0.030 0.032  6945 GLU A O   
1229 C CB  . GLU A 150 ? 0.696 0.453 0.478 0.099  -0.040 0.032  6945 GLU A CB  
1230 C CG  . GLU A 150 ? 0.742 0.525 0.533 0.107  -0.046 0.030  6945 GLU A CG  
1231 C CD  . GLU A 150 ? 0.849 0.621 0.626 0.122  -0.056 0.034  6945 GLU A CD  
1232 O OE1 . GLU A 150 ? 0.928 0.719 0.710 0.127  -0.062 0.033  6945 GLU A OE1 
1233 O OE2 . GLU A 150 ? 0.910 0.652 0.669 0.130  -0.059 0.038  6945 GLU A OE2 
1234 N N   . GLY A 151 ? 0.644 0.392 0.435 0.062  -0.019 0.030  6946 GLY A N   
1235 C CA  . GLY A 151 ? 0.611 0.337 0.394 0.054  -0.016 0.030  6946 GLY A CA  
1236 C C   . GLY A 151 ? 0.557 0.295 0.355 0.055  -0.015 0.023  6946 GLY A C   
1237 O O   . GLY A 151 ? 0.556 0.294 0.356 0.067  -0.018 0.019  6946 GLY A O   
1238 N N   . PHE A 152 ? 0.513 0.264 0.323 0.042  -0.010 0.020  6947 PHE A N   
1239 C CA  . PHE A 152 ? 0.484 0.246 0.306 0.042  -0.010 0.014  6947 PHE A CA  
1240 C C   . PHE A 152 ? 0.456 0.242 0.293 0.051  -0.012 0.010  6947 PHE A C   
1241 O O   . PHE A 152 ? 0.463 0.254 0.305 0.055  -0.012 0.004  6947 PHE A O   
1242 C CB  . PHE A 152 ? 0.472 0.242 0.302 0.027  -0.006 0.013  6947 PHE A CB  
1243 C CG  . PHE A 152 ? 0.448 0.240 0.291 0.022  -0.005 0.014  6947 PHE A CG  
1244 C CD1 . PHE A 152 ? 0.428 0.244 0.286 0.026  -0.006 0.011  6947 PHE A CD1 
1245 C CD2 . PHE A 152 ? 0.467 0.256 0.307 0.013  -0.002 0.018  6947 PHE A CD2 
1246 C CE1 . PHE A 152 ? 0.410 0.243 0.279 0.022  -0.005 0.012  6947 PHE A CE1 
1247 C CE2 . PHE A 152 ? 0.450 0.260 0.302 0.009  0.000  0.018  6947 PHE A CE2 
1248 C CZ  . PHE A 152 ? 0.424 0.254 0.290 0.014  -0.002 0.015  6947 PHE A CZ  
1249 N N   . PHE A 153 ? 0.429 0.230 0.272 0.055  -0.014 0.012  6948 PHE A N   
1250 C CA  . PHE A 153 ? 0.422 0.247 0.279 0.062  -0.016 0.007  6948 PHE A CA  
1251 C C   . PHE A 153 ? 0.435 0.257 0.290 0.076  -0.019 0.003  6948 PHE A C   
1252 O O   . PHE A 153 ? 0.421 0.260 0.288 0.079  -0.019 -0.002 6948 PHE A O   
1253 C CB  . PHE A 153 ? 0.404 0.245 0.266 0.062  -0.018 0.009  6948 PHE A CB  
1254 C CG  . PHE A 153 ? 0.388 0.241 0.259 0.050  -0.014 0.010  6948 PHE A CG  
1255 C CD1 . PHE A 153 ? 0.377 0.245 0.261 0.046  -0.012 0.006  6948 PHE A CD1 
1256 C CD2 . PHE A 153 ? 0.397 0.244 0.262 0.044  -0.012 0.014  6948 PHE A CD2 
1257 C CE1 . PHE A 153 ? 0.362 0.239 0.254 0.037  -0.010 0.007  6948 PHE A CE1 
1258 C CE2 . PHE A 153 ? 0.374 0.234 0.249 0.035  -0.009 0.013  6948 PHE A CE2 
1259 C CZ  . PHE A 153 ? 0.364 0.237 0.252 0.033  -0.008 0.010  6948 PHE A CZ  
1260 N N   A THR A 154 ? 0.468 0.267 0.308 0.084  -0.023 0.007  6949 THR A N   
1261 N N   B THR A 154 ? 0.466 0.265 0.305 0.083  -0.022 0.007  6949 THR A N   
1262 C CA  A THR A 154 ? 0.489 0.286 0.329 0.099  -0.026 0.003  6949 THR A CA  
1263 C CA  B THR A 154 ? 0.487 0.281 0.325 0.099  -0.026 0.003  6949 THR A CA  
1264 C C   A THR A 154 ? 0.489 0.281 0.330 0.098  -0.022 -0.004 6949 THR A C   
1265 C C   B THR A 154 ? 0.489 0.279 0.329 0.098  -0.022 -0.003 6949 THR A C   
1266 O O   A THR A 154 ? 0.491 0.299 0.345 0.106  -0.022 -0.011 6949 THR A O   
1267 O O   B THR A 154 ? 0.493 0.297 0.344 0.109  -0.023 -0.010 6949 THR A O   
1268 C CB  A THR A 154 ? 0.527 0.297 0.347 0.110  -0.032 0.008  6949 THR A CB  
1269 C CB  B THR A 154 ? 0.523 0.287 0.340 0.107  -0.031 0.009  6949 THR A CB  
1270 O OG1 A THR A 154 ? 0.549 0.287 0.352 0.102  -0.029 0.011  6949 THR A OG1 
1271 O OG1 B THR A 154 ? 0.530 0.298 0.342 0.105  -0.034 0.015  6949 THR A OG1 
1272 C CG2 A THR A 154 ? 0.538 0.312 0.353 0.110  -0.036 0.014  6949 THR A CG2 
1273 C CG2 B THR A 154 ? 0.540 0.300 0.356 0.126  -0.036 0.005  6949 THR A CG2 
1274 N N   . TYR A 155 ? 0.491 0.264 0.323 0.086  -0.019 -0.002 6950 TYR A N   
1275 C CA  . TYR A 155 ? 0.502 0.269 0.333 0.084  -0.015 -0.008 6950 TYR A CA  
1276 C C   . TYR A 155 ? 0.471 0.268 0.320 0.079  -0.012 -0.013 6950 TYR A C   
1277 O O   . TYR A 155 ? 0.465 0.267 0.317 0.085  -0.010 -0.020 6950 TYR A O   
1278 C CB  . TYR A 155 ? 0.524 0.270 0.344 0.070  -0.012 -0.005 6950 TYR A CB  
1279 C CG  . TYR A 155 ? 0.537 0.278 0.355 0.066  -0.009 -0.012 6950 TYR A CG  
1280 C CD1 . TYR A 155 ? 0.567 0.285 0.373 0.074  -0.009 -0.016 6950 TYR A CD1 
1281 C CD2 . TYR A 155 ? 0.528 0.286 0.356 0.054  -0.007 -0.014 6950 TYR A CD2 
1282 C CE1 . TYR A 155 ? 0.585 0.298 0.389 0.070  -0.006 -0.023 6950 TYR A CE1 
1283 C CE2 . TYR A 155 ? 0.537 0.290 0.361 0.050  -0.005 -0.020 6950 TYR A CE2 
1284 C CZ  . TYR A 155 ? 0.568 0.300 0.380 0.057  -0.004 -0.025 6950 TYR A CZ  
1285 O OH  . TYR A 155 ? 0.603 0.329 0.410 0.053  -0.002 -0.032 6950 TYR A OH  
1286 N N   . ILE A 156 ? 0.452 0.265 0.310 0.069  -0.011 -0.010 6951 ILE A N   
1287 C CA  . ILE A 156 ? 0.435 0.272 0.306 0.064  -0.009 -0.013 6951 ILE A CA  
1288 C C   . ILE A 156 ? 0.422 0.278 0.304 0.074  -0.009 -0.019 6951 ILE A C   
1289 O O   . ILE A 156 ? 0.410 0.277 0.296 0.073  -0.006 -0.024 6951 ILE A O   
1290 C CB  . ILE A 156 ? 0.436 0.285 0.314 0.054  -0.009 -0.009 6951 ILE A CB  
1291 C CG1 . ILE A 156 ? 0.463 0.299 0.335 0.043  -0.008 -0.006 6951 ILE A CG1 
1292 C CG2 . ILE A 156 ? 0.422 0.294 0.312 0.051  -0.008 -0.012 6951 ILE A CG2 
1293 C CD1 . ILE A 156 ? 0.507 0.341 0.377 0.037  -0.007 -0.010 6951 ILE A CD1 
1294 N N   . CYS A 157 ? 0.419 0.280 0.303 0.083  -0.013 -0.017 6952 CYS A N   
1295 C CA  . CYS A 157 ? 0.417 0.302 0.315 0.093  -0.014 -0.023 6952 CYS A CA  
1296 C C   . CYS A 157 ? 0.426 0.305 0.322 0.103  -0.012 -0.030 6952 CYS A C   
1297 O O   . CYS A 157 ? 0.421 0.321 0.329 0.104  -0.008 -0.037 6952 CYS A O   
1298 C CB  . CYS A 157 ? 0.432 0.320 0.330 0.102  -0.020 -0.020 6952 CYS A CB  
1299 S SG  . CYS A 157 ? 0.447 0.348 0.350 0.092  -0.021 -0.015 6952 CYS A SG  
1300 N N   . GLY A 158 ? 0.441 0.294 0.323 0.109  -0.014 -0.029 6953 GLY A N   
1301 C CA  . GLY A 158 ? 0.464 0.308 0.344 0.119  -0.012 -0.036 6953 GLY A CA  
1302 C C   . GLY A 158 ? 0.457 0.302 0.335 0.109  -0.005 -0.041 6953 GLY A C   
1303 O O   . GLY A 158 ? 0.445 0.303 0.331 0.115  -0.001 -0.050 6953 GLY A O   
1304 N N   . PHE A 159 ? 0.445 0.281 0.316 0.094  -0.004 -0.037 6954 PHE A N   
1305 C CA  . PHE A 159 ? 0.451 0.287 0.319 0.084  0.001  -0.040 6954 PHE A CA  
1306 C C   . PHE A 159 ? 0.443 0.308 0.324 0.080  0.005  -0.045 6954 PHE A C   
1307 O O   . PHE A 159 ? 0.443 0.312 0.322 0.079  0.010  -0.052 6954 PHE A O   
1308 C CB  . PHE A 159 ? 0.451 0.273 0.310 0.070  0.000  -0.034 6954 PHE A CB  
1309 C CG  . PHE A 159 ? 0.456 0.271 0.307 0.060  0.003  -0.038 6954 PHE A CG  
1310 C CD1 . PHE A 159 ? 0.443 0.274 0.298 0.051  0.005  -0.039 6954 PHE A CD1 
1311 C CD2 . PHE A 159 ? 0.481 0.271 0.318 0.060  0.003  -0.040 6954 PHE A CD2 
1312 C CE1 . PHE A 159 ? 0.449 0.273 0.295 0.043  0.006  -0.042 6954 PHE A CE1 
1313 C CE2 . PHE A 159 ? 0.486 0.269 0.314 0.051  0.005  -0.044 6954 PHE A CE2 
1314 C CZ  . PHE A 159 ? 0.469 0.270 0.301 0.042  0.006  -0.045 6954 PHE A CZ  
1315 N N   . ILE A 160 ? 0.438 0.321 0.330 0.078  0.003  -0.040 6955 ILE A N   
1316 C CA  . ILE A 160 ? 0.434 0.343 0.338 0.073  0.007  -0.044 6955 ILE A CA  
1317 C C   . ILE A 160 ? 0.453 0.378 0.366 0.084  0.011  -0.053 6955 ILE A C   
1318 O O   . ILE A 160 ? 0.466 0.403 0.381 0.080  0.017  -0.059 6955 ILE A O   
1319 C CB  . ILE A 160 ? 0.418 0.341 0.332 0.069  0.004  -0.039 6955 ILE A CB  
1320 C CG1 . ILE A 160 ? 0.414 0.327 0.321 0.058  0.002  -0.031 6955 ILE A CG1 
1321 C CG2 . ILE A 160 ? 0.408 0.357 0.334 0.066  0.009  -0.043 6955 ILE A CG2 
1322 C CD1 . ILE A 160 ? 0.401 0.323 0.315 0.055  -0.001 -0.026 6955 ILE A CD1 
1323 N N   . GLN A 161 ? 0.462 0.387 0.380 0.098  0.007  -0.055 6956 GLN A N   
1324 C CA  . GLN A 161 ? 0.488 0.431 0.418 0.111  0.009  -0.064 6956 GLN A CA  
1325 C C   . GLN A 161 ? 0.494 0.425 0.417 0.117  0.014  -0.072 6956 GLN A C   
1326 O O   . GLN A 161 ? 0.495 0.445 0.428 0.125  0.019  -0.082 6956 GLN A O   
1327 C CB  . GLN A 161 ? 0.524 0.471 0.461 0.126  0.001  -0.063 6956 GLN A CB  
1328 C CG  . GLN A 161 ? 0.541 0.508 0.489 0.120  -0.002 -0.059 6956 GLN A CG  
1329 C CD  . GLN A 161 ? 0.580 0.550 0.532 0.135  -0.011 -0.057 6956 GLN A CD  
1330 O OE1 . GLN A 161 ? 0.637 0.582 0.575 0.140  -0.017 -0.050 6956 GLN A OE1 
1331 N NE2 . GLN A 161 ? 0.593 0.593 0.563 0.141  -0.012 -0.063 6956 GLN A NE2 
1332 N N   . GLN A 162 ? 0.508 0.409 0.412 0.113  0.014  -0.069 6957 GLN A N   
1333 C CA  . GLN A 162 ? 0.541 0.428 0.436 0.120  0.018  -0.078 6957 GLN A CA  
1334 C C   . GLN A 162 ? 0.517 0.394 0.398 0.105  0.024  -0.079 6957 GLN A C   
1335 O O   . GLN A 162 ? 0.518 0.396 0.397 0.107  0.030  -0.089 6957 GLN A O   
1336 C CB  . GLN A 162 ? 0.605 0.459 0.486 0.130  0.012  -0.075 6957 GLN A CB  
1337 C CG  . GLN A 162 ? 0.655 0.513 0.545 0.146  0.005  -0.073 6957 GLN A CG  
1338 C CD  . GLN A 162 ? 0.740 0.560 0.612 0.152  -0.001 -0.067 6957 GLN A CD  
1339 O OE1 . GLN A 162 ? 0.845 0.638 0.702 0.152  0.001  -0.069 6957 GLN A OE1 
1340 N NE2 . GLN A 162 ? 0.770 0.588 0.643 0.157  -0.009 -0.058 6957 GLN A NE2 
1341 N N   . LYS A 163 ? 0.484 0.355 0.359 0.090  0.021  -0.071 6958 LYS A N   
1342 C CA  . LYS A 163 ? 0.493 0.352 0.353 0.077  0.024  -0.071 6958 LYS A CA  
1343 C C   . LYS A 163 ? 0.472 0.349 0.336 0.063  0.025  -0.067 6958 LYS A C   
1344 O O   . LYS A 163 ? 0.493 0.360 0.345 0.052  0.025  -0.065 6958 LYS A O   
1345 C CB  . LYS A 163 ? 0.508 0.339 0.355 0.072  0.018  -0.065 6958 LYS A CB  
1346 C CG  . LYS A 163 ? 0.543 0.350 0.383 0.084  0.016  -0.067 6958 LYS A CG  
1347 C CD  . LYS A 163 ? 0.584 0.382 0.418 0.093  0.021  -0.078 6958 LYS A CD  
1348 C CE  . LYS A 163 ? 0.630 0.401 0.456 0.106  0.018  -0.080 6958 LYS A CE  
1349 N NZ  . LYS A 163 ? 0.680 0.440 0.498 0.115  0.023  -0.092 6958 LYS A NZ  
1350 N N   . LEU A 164 ? 0.442 0.342 0.321 0.064  0.027  -0.066 6959 LEU A N   
1351 C CA  . LEU A 164 ? 0.418 0.331 0.297 0.050  0.029  -0.063 6959 LEU A CA  
1352 C C   . LEU A 164 ? 0.413 0.345 0.296 0.049  0.038  -0.071 6959 LEU A C   
1353 O O   . LEU A 164 ? 0.403 0.353 0.300 0.058  0.041  -0.077 6959 LEU A O   
1354 C CB  . LEU A 164 ? 0.403 0.328 0.295 0.049  0.024  -0.055 6959 LEU A CB  
1355 C CG  . LEU A 164 ? 0.388 0.323 0.280 0.036  0.026  -0.051 6959 LEU A CG  
1356 C CD1 . LEU A 164 ? 0.396 0.313 0.273 0.026  0.022  -0.045 6959 LEU A CD1 
1357 C CD2 . LEU A 164 ? 0.378 0.323 0.282 0.036  0.022  -0.046 6959 LEU A CD2 
1358 N N   . ALA A 165 ? 0.425 0.353 0.294 0.038  0.042  -0.072 6960 ALA A N   
1359 C CA  . ALA A 165 ? 0.427 0.371 0.295 0.034  0.052  -0.080 6960 ALA A CA  
1360 C C   . ALA A 165 ? 0.416 0.384 0.300 0.029  0.054  -0.078 6960 ALA A C   
1361 O O   . ALA A 165 ? 0.394 0.360 0.281 0.025  0.048  -0.069 6960 ALA A O   
1362 C CB  . ALA A 165 ? 0.446 0.378 0.293 0.021  0.054  -0.078 6960 ALA A CB  
1363 N N   . LEU A 166 ? 0.424 0.415 0.318 0.031  0.064  -0.087 6961 LEU A N   
1364 C CA  . LEU A 166 ? 0.413 0.427 0.320 0.024  0.067  -0.086 6961 LEU A CA  
1365 C C   . LEU A 166 ? 0.412 0.415 0.302 0.007  0.068  -0.078 6961 LEU A C   
1366 O O   . LEU A 166 ? 0.427 0.417 0.298 0.001  0.071  -0.079 6961 LEU A O   
1367 C CB  . LEU A 166 ? 0.435 0.477 0.356 0.027  0.078  -0.099 6961 LEU A CB  
1368 C CG  . LEU A 166 ? 0.449 0.502 0.388 0.046  0.076  -0.107 6961 LEU A CG  
1369 C CD1 . LEU A 166 ? 0.471 0.556 0.425 0.048  0.087  -0.120 6961 LEU A CD1 
1370 C CD2 . LEU A 166 ? 0.445 0.504 0.399 0.053  0.066  -0.101 6961 LEU A CD2 
1371 N N   . GLY A 167 ? 0.388 0.395 0.283 0.000  0.064  -0.071 6962 GLY A N   
1372 C CA  . GLY A 167 ? 0.397 0.390 0.276 -0.014 0.063  -0.062 6962 GLY A CA  
1373 C C   . GLY A 167 ? 0.386 0.356 0.255 -0.013 0.052  -0.053 6962 GLY A C   
1374 O O   . GLY A 167 ? 0.402 0.361 0.261 -0.022 0.049  -0.044 6962 GLY A O   
1375 N N   . GLY A 168 ? 0.383 0.346 0.257 -0.001 0.047  -0.054 6963 GLY A N   
1376 C CA  . GLY A 168 ? 0.376 0.320 0.244 -0.001 0.037  -0.046 6963 GLY A CA  
1377 C C   . GLY A 168 ? 0.363 0.309 0.242 0.000  0.031  -0.039 6963 GLY A C   
1378 O O   . GLY A 168 ? 0.347 0.310 0.240 0.002  0.033  -0.041 6963 GLY A O   
1379 N N   . SER A 169 ? 0.354 0.287 0.229 -0.001 0.023  -0.031 6964 SER A N   
1380 C CA  . SER A 169 ? 0.344 0.278 0.229 -0.001 0.018  -0.025 6964 SER A CA  
1381 C C   . SER A 169 ? 0.335 0.259 0.223 0.005  0.011  -0.022 6964 SER A C   
1382 O O   . SER A 169 ? 0.354 0.267 0.234 0.006  0.010  -0.024 6964 SER A O   
1383 C CB  . SER A 169 ? 0.347 0.276 0.225 -0.010 0.016  -0.019 6964 SER A CB  
1384 O OG  . SER A 169 ? 0.357 0.294 0.232 -0.017 0.023  -0.021 6964 SER A OG  
1385 N N   . VAL A 170 ? 0.325 0.253 0.223 0.007  0.008  -0.019 6965 VAL A N   
1386 C CA  . VAL A 170 ? 0.319 0.238 0.219 0.011  0.003  -0.016 6965 VAL A CA  
1387 C C   . VAL A 170 ? 0.314 0.233 0.219 0.008  -0.001 -0.010 6965 VAL A C   
1388 O O   . VAL A 170 ? 0.307 0.234 0.217 0.005  0.001  -0.009 6965 VAL A O   
1389 C CB  . VAL A 170 ? 0.324 0.246 0.230 0.021  0.003  -0.019 6965 VAL A CB  
1390 C CG1 . VAL A 170 ? 0.340 0.263 0.243 0.026  0.007  -0.025 6965 VAL A CG1 
1391 C CG2 . VAL A 170 ? 0.320 0.255 0.237 0.023  0.004  -0.019 6965 VAL A CG2 
1392 N N   . ALA A 171 ? 0.310 0.222 0.216 0.008  -0.005 -0.007 6966 ALA A N   
1393 C CA  . ALA A 171 ? 0.299 0.211 0.211 0.007  -0.008 -0.003 6966 ALA A CA  
1394 C C   . ALA A 171 ? 0.303 0.211 0.217 0.010  -0.009 -0.002 6966 ALA A C   
1395 O O   . ALA A 171 ? 0.306 0.206 0.216 0.008  -0.011 -0.002 6966 ALA A O   
1396 C CB  . ALA A 171 ? 0.304 0.212 0.214 0.002  -0.012 0.001  6966 ALA A CB  
1397 N N   . ILE A 172 ? 0.291 0.204 0.210 0.015  -0.008 -0.002 6967 ILE A N   
1398 C CA  . ILE A 172 ? 0.305 0.211 0.222 0.018  -0.008 -0.001 6967 ILE A CA  
1399 C C   . ILE A 172 ? 0.300 0.210 0.224 0.016  -0.009 0.001  6967 ILE A C   
1400 O O   . ILE A 172 ? 0.295 0.212 0.223 0.018  -0.008 0.001  6967 ILE A O   
1401 C CB  . ILE A 172 ? 0.317 0.223 0.231 0.025  -0.007 -0.004 6967 ILE A CB  
1402 C CG1 . ILE A 172 ? 0.330 0.237 0.242 0.028  -0.006 -0.008 6967 ILE A CG1 
1403 C CG2 . ILE A 172 ? 0.330 0.225 0.239 0.028  -0.008 -0.001 6967 ILE A CG2 
1404 C CD1 . ILE A 172 ? 0.351 0.244 0.254 0.025  -0.006 -0.008 6967 ILE A CD1 
1405 N N   . LYS A 173 ? 0.301 0.205 0.224 0.013  -0.009 0.003  6968 LYS A N   
1406 C CA  . LYS A 173 ? 0.310 0.219 0.240 0.011  -0.008 0.005  6968 LYS A CA  
1407 C C   . LYS A 173 ? 0.310 0.217 0.235 0.015  -0.006 0.005  6968 LYS A C   
1408 O O   . LYS A 173 ? 0.306 0.204 0.223 0.017  -0.006 0.006  6968 LYS A O   
1409 C CB  . LYS A 173 ? 0.328 0.235 0.260 0.006  -0.009 0.005  6968 LYS A CB  
1410 C CG  . LYS A 173 ? 0.331 0.247 0.273 0.004  -0.007 0.006  6968 LYS A CG  
1411 C CD  . LYS A 173 ? 0.344 0.257 0.283 0.003  -0.003 0.006  6968 LYS A CD  
1412 C CE  . LYS A 173 ? 0.366 0.275 0.304 -0.003 -0.002 0.006  6968 LYS A CE  
1413 N NZ  . LYS A 173 ? 0.374 0.295 0.326 -0.006 -0.003 0.005  6968 LYS A NZ  
1414 N N   . ILE A 174 ? 0.308 0.223 0.238 0.016  -0.006 0.005  6969 ILE A N   
1415 C CA  . ILE A 174 ? 0.315 0.230 0.240 0.019  -0.005 0.005  6969 ILE A CA  
1416 C C   . ILE A 174 ? 0.310 0.229 0.240 0.015  -0.002 0.005  6969 ILE A C   
1417 O O   . ILE A 174 ? 0.286 0.210 0.225 0.013  -0.002 0.004  6969 ILE A O   
1418 C CB  . ILE A 174 ? 0.321 0.242 0.246 0.023  -0.006 0.003  6969 ILE A CB  
1419 C CG1 . ILE A 174 ? 0.321 0.251 0.255 0.021  -0.006 0.000  6969 ILE A CG1 
1420 C CG2 . ILE A 174 ? 0.327 0.245 0.248 0.028  -0.008 0.002  6969 ILE A CG2 
1421 C CD1 . ILE A 174 ? 0.332 0.271 0.267 0.024  -0.007 -0.002 6969 ILE A CD1 
1422 N N   . THR A 175 ? 0.307 0.224 0.231 0.016  0.000  0.005  6970 THR A N   
1423 C CA  . THR A 175 ? 0.307 0.230 0.234 0.013  0.004  0.003  6970 THR A CA  
1424 C C   . THR A 175 ? 0.305 0.228 0.224 0.016  0.003  0.003  6970 THR A C   
1425 O O   . THR A 175 ? 0.307 0.227 0.219 0.021  -0.001 0.004  6970 THR A O   
1426 C CB  . THR A 175 ? 0.320 0.240 0.247 0.008  0.008  0.005  6970 THR A CB  
1427 O OG1 . THR A 175 ? 0.335 0.243 0.246 0.008  0.009  0.008  6970 THR A OG1 
1428 C CG2 . THR A 175 ? 0.322 0.243 0.257 0.005  0.007  0.005  6970 THR A CG2 
1429 N N   . GLU A 176 ? 0.311 0.237 0.229 0.014  0.007  0.001  6971 GLU A N   
1430 C CA  . GLU A 176 ? 0.310 0.236 0.217 0.016  0.006  0.000  6971 GLU A CA  
1431 C C   . GLU A 176 ? 0.327 0.242 0.218 0.018  0.004  0.005  6971 GLU A C   
1432 O O   . GLU A 176 ? 0.337 0.252 0.221 0.024  -0.001 0.005  6971 GLU A O   
1433 C CB  . GLU A 176 ? 0.324 0.252 0.229 0.013  0.012  -0.003 6971 GLU A CB  
1434 C CG  . GLU A 176 ? 0.338 0.264 0.227 0.014  0.011  -0.003 6971 GLU A CG  
1435 C CD  . GLU A 176 ? 0.353 0.281 0.238 0.010  0.018  -0.007 6971 GLU A CD  
1436 O OE1 . GLU A 176 ? 0.347 0.279 0.242 0.007  0.024  -0.009 6971 GLU A OE1 
1437 O OE2 . GLU A 176 ? 0.354 0.282 0.226 0.011  0.017  -0.008 6971 GLU A OE2 
1438 N N   . HIS A 177 ? 0.331 0.236 0.216 0.014  0.008  0.008  6972 HIS A N   
1439 C CA  . HIS A 177 ? 0.362 0.252 0.228 0.016  0.007  0.014  6972 HIS A CA  
1440 C C   . HIS A 177 ? 0.364 0.245 0.230 0.019  0.003  0.016  6972 HIS A C   
1441 O O   . HIS A 177 ? 0.385 0.252 0.235 0.023  0.000  0.020  6972 HIS A O   
1442 C CB  . HIS A 177 ? 0.389 0.271 0.246 0.008  0.014  0.016  6972 HIS A CB  
1443 C CG  . HIS A 177 ? 0.398 0.286 0.249 0.005  0.018  0.013  6972 HIS A CG  
1444 N ND1 . HIS A 177 ? 0.429 0.310 0.261 0.008  0.016  0.015  6972 HIS A ND1 
1445 C CD2 . HIS A 177 ? 0.395 0.296 0.258 0.001  0.024  0.008  6972 HIS A CD2 
1446 C CE1 . HIS A 177 ? 0.431 0.320 0.262 0.005  0.021  0.011  6972 HIS A CE1 
1447 N NE2 . HIS A 177 ? 0.400 0.300 0.250 0.001  0.026  0.007  6972 HIS A NE2 
1448 N N   . SER A 178 ? 0.345 0.232 0.225 0.017  0.003  0.014  6973 SER A N   
1449 C CA  . SER A 178 ? 0.346 0.224 0.225 0.019  0.000  0.015  6973 SER A CA  
1450 C C   . SER A 178 ? 0.334 0.222 0.222 0.026  -0.004 0.012  6973 SER A C   
1451 O O   . SER A 178 ? 0.323 0.220 0.223 0.024  -0.004 0.009  6973 SER A O   
1452 C CB  . SER A 178 ? 0.346 0.223 0.232 0.012  0.003  0.015  6973 SER A CB  
1453 O OG  . SER A 178 ? 0.348 0.214 0.230 0.014  0.001  0.016  6973 SER A OG  
1454 N N   . TRP A 179 ? 0.343 0.229 0.224 0.034  -0.009 0.013  6974 TRP A N   
1455 C CA  . TRP A 179 ? 0.337 0.235 0.226 0.040  -0.012 0.009  6974 TRP A CA  
1456 C C   . TRP A 179 ? 0.352 0.244 0.233 0.050  -0.017 0.010  6974 TRP A C   
1457 O O   . TRP A 179 ? 0.370 0.247 0.235 0.052  -0.019 0.014  6974 TRP A O   
1458 C CB  . TRP A 179 ? 0.327 0.241 0.224 0.039  -0.013 0.006  6974 TRP A CB  
1459 C CG  . TRP A 179 ? 0.338 0.251 0.224 0.042  -0.015 0.007  6974 TRP A CG  
1460 C CD1 . TRP A 179 ? 0.351 0.255 0.225 0.039  -0.013 0.010  6974 TRP A CD1 
1461 C CD2 . TRP A 179 ? 0.346 0.267 0.230 0.050  -0.022 0.005  6974 TRP A CD2 
1462 N NE1 . TRP A 179 ? 0.362 0.267 0.226 0.043  -0.017 0.010  6974 TRP A NE1 
1463 C CE2 . TRP A 179 ? 0.362 0.277 0.232 0.051  -0.023 0.007  6974 TRP A CE2 
1464 C CE3 . TRP A 179 ? 0.339 0.273 0.233 0.056  -0.026 0.001  6974 TRP A CE3 
1465 C CZ2 . TRP A 179 ? 0.372 0.294 0.237 0.058  -0.031 0.006  6974 TRP A CZ2 
1466 C CZ3 . TRP A 179 ? 0.351 0.294 0.243 0.063  -0.032 -0.001 6974 TRP A CZ3 
1467 C CH2 . TRP A 179 ? 0.366 0.303 0.243 0.064  -0.035 0.002  6974 TRP A CH2 
1468 N N   . ASN A 180 ? 0.350 0.253 0.239 0.056  -0.020 0.006  6975 ASN A N   
1469 C CA  . ASN A 180 ? 0.370 0.271 0.255 0.067  -0.025 0.005  6975 ASN A CA  
1470 C C   . ASN A 180 ? 0.362 0.286 0.261 0.072  -0.028 -0.001 6975 ASN A C   
1471 O O   . ASN A 180 ? 0.340 0.277 0.251 0.067  -0.025 -0.005 6975 ASN A O   
1472 C CB  . ASN A 180 ? 0.386 0.271 0.266 0.070  -0.024 0.006  6975 ASN A CB  
1473 C CG  . ASN A 180 ? 0.413 0.295 0.290 0.083  -0.029 0.004  6975 ASN A CG  
1474 O OD1 . ASN A 180 ? 0.416 0.316 0.306 0.088  -0.030 -0.002 6975 ASN A OD1 
1475 N ND2 . ASN A 180 ? 0.435 0.295 0.296 0.089  -0.032 0.009  6975 ASN A ND2 
1476 N N   . ALA A 181 ? 0.369 0.299 0.265 0.081  -0.035 -0.001 6976 ALA A N   
1477 C CA  . ALA A 181 ? 0.368 0.323 0.278 0.084  -0.038 -0.008 6976 ALA A CA  
1478 C C   . ALA A 181 ? 0.365 0.331 0.288 0.089  -0.037 -0.013 6976 ALA A C   
1479 O O   . ALA A 181 ? 0.340 0.327 0.278 0.085  -0.035 -0.019 6976 ALA A O   
1480 C CB  . ALA A 181 ? 0.380 0.339 0.284 0.094  -0.047 -0.007 6976 ALA A CB  
1481 N N   . ASP A 182 ? 0.387 0.336 0.302 0.098  -0.038 -0.011 6977 ASP A N   
1482 C CA  . ASP A 182 ? 0.397 0.355 0.322 0.103  -0.036 -0.017 6977 ASP A CA  
1483 C C   . ASP A 182 ? 0.370 0.331 0.302 0.091  -0.027 -0.020 6977 ASP A C   
1484 O O   . ASP A 182 ? 0.363 0.341 0.307 0.092  -0.024 -0.026 6977 ASP A O   
1485 C CB  . ASP A 182 ? 0.435 0.370 0.349 0.115  -0.038 -0.015 6977 ASP A CB  
1486 C CG  . ASP A 182 ? 0.482 0.416 0.391 0.130  -0.047 -0.014 6977 ASP A CG  
1487 O OD1 . ASP A 182 ? 0.482 0.440 0.402 0.133  -0.052 -0.018 6977 ASP A OD1 
1488 O OD2 . ASP A 182 ? 0.571 0.478 0.463 0.137  -0.050 -0.010 6977 ASP A OD2 
1489 N N   . LEU A 183 ? 0.367 0.313 0.291 0.081  -0.024 -0.014 6978 LEU A N   
1490 C CA  . LEU A 183 ? 0.348 0.296 0.276 0.070  -0.018 -0.016 6978 LEU A CA  
1491 C C   . LEU A 183 ? 0.330 0.300 0.271 0.064  -0.016 -0.019 6978 LEU A C   
1492 O O   . LEU A 183 ? 0.314 0.293 0.261 0.059  -0.012 -0.023 6978 LEU A O   
1493 C CB  . LEU A 183 ? 0.351 0.281 0.269 0.062  -0.016 -0.010 6978 LEU A CB  
1494 C CG  . LEU A 183 ? 0.347 0.278 0.269 0.052  -0.012 -0.010 6978 LEU A CG  
1495 C CD1 . LEU A 183 ? 0.357 0.287 0.279 0.054  -0.009 -0.014 6978 LEU A CD1 
1496 C CD2 . LEU A 183 ? 0.353 0.269 0.268 0.045  -0.011 -0.005 6978 LEU A CD2 
1497 N N   . TYR A 184 ? 0.323 0.299 0.265 0.062  -0.019 -0.018 6979 TYR A N   
1498 C CA  . TYR A 184 ? 0.311 0.306 0.264 0.055  -0.018 -0.022 6979 TYR A CA  
1499 C C   . TYR A 184 ? 0.318 0.334 0.283 0.060  -0.018 -0.030 6979 TYR A C   
1500 O O   . TYR A 184 ? 0.304 0.333 0.277 0.052  -0.013 -0.034 6979 TYR A O   
1501 C CB  . TYR A 184 ? 0.314 0.311 0.265 0.054  -0.021 -0.021 6979 TYR A CB  
1502 C CG  . TYR A 184 ? 0.309 0.294 0.254 0.046  -0.019 -0.017 6979 TYR A CG  
1503 C CD1 . TYR A 184 ? 0.301 0.290 0.252 0.036  -0.015 -0.018 6979 TYR A CD1 
1504 C CD2 . TYR A 184 ? 0.320 0.291 0.254 0.047  -0.020 -0.012 6979 TYR A CD2 
1505 C CE1 . TYR A 184 ? 0.301 0.279 0.248 0.031  -0.013 -0.015 6979 TYR A CE1 
1506 C CE2 . TYR A 184 ? 0.315 0.278 0.246 0.041  -0.017 -0.010 6979 TYR A CE2 
1507 C CZ  . TYR A 184 ? 0.309 0.277 0.248 0.033  -0.014 -0.012 6979 TYR A CZ  
1508 O OH  . TYR A 184 ? 0.327 0.288 0.264 0.028  -0.012 -0.010 6979 TYR A OH  
1509 N N   . LYS A 185 ? 0.335 0.355 0.300 0.072  -0.023 -0.031 6980 LYS A N   
1510 C CA  . LYS A 185 ? 0.358 0.402 0.338 0.079  -0.024 -0.039 6980 LYS A CA  
1511 C C   . LYS A 185 ? 0.341 0.386 0.325 0.075  -0.016 -0.043 6980 LYS A C   
1512 O O   . LYS A 185 ? 0.318 0.384 0.315 0.070  -0.011 -0.049 6980 LYS A O   
1513 C CB  . LYS A 185 ? 0.405 0.448 0.383 0.095  -0.031 -0.040 6980 LYS A CB  
1514 C CG  . LYS A 185 ? 0.447 0.518 0.443 0.104  -0.033 -0.049 6980 LYS A CG  
1515 C CD  . LYS A 185 ? 0.502 0.574 0.497 0.123  -0.043 -0.049 6980 LYS A CD  
1516 C CE  . LYS A 185 ? 0.548 0.620 0.537 0.125  -0.052 -0.045 6980 LYS A CE  
1517 N NZ  . LYS A 185 ? 0.563 0.665 0.567 0.117  -0.053 -0.051 6980 LYS A NZ  
1518 N N   . LEU A 186 ? 0.347 0.369 0.318 0.076  -0.014 -0.038 6981 LEU A N   
1519 C CA  . LEU A 186 ? 0.356 0.375 0.327 0.073  -0.007 -0.042 6981 LEU A CA  
1520 C C   . LEU A 186 ? 0.330 0.354 0.302 0.058  -0.001 -0.041 6981 LEU A C   
1521 O O   . LEU A 186 ? 0.326 0.357 0.301 0.054  0.005  -0.046 6981 LEU A O   
1522 C CB  . LEU A 186 ? 0.393 0.386 0.349 0.076  -0.007 -0.037 6981 LEU A CB  
1523 C CG  . LEU A 186 ? 0.450 0.435 0.403 0.092  -0.011 -0.040 6981 LEU A CG  
1524 C CD1 . LEU A 186 ? 0.472 0.428 0.409 0.092  -0.010 -0.035 6981 LEU A CD1 
1525 C CD2 . LEU A 186 ? 0.461 0.467 0.427 0.099  -0.007 -0.049 6981 LEU A CD2 
1526 N N   . MET A 187 ? 0.315 0.335 0.285 0.050  -0.002 -0.037 6982 MET A N   
1527 C CA  . MET A 187 ? 0.317 0.338 0.287 0.036  0.003  -0.036 6982 MET A CA  
1528 C C   . MET A 187 ? 0.309 0.355 0.291 0.032  0.007  -0.044 6982 MET A C   
1529 O O   . MET A 187 ? 0.314 0.361 0.294 0.022  0.013  -0.044 6982 MET A O   
1530 C CB  . MET A 187 ? 0.320 0.333 0.287 0.030  0.000  -0.031 6982 MET A CB  
1531 C CG  . MET A 187 ? 0.333 0.326 0.290 0.031  -0.002 -0.024 6982 MET A CG  
1532 S SD  . MET A 187 ? 0.358 0.335 0.306 0.025  0.001  -0.021 6982 MET A SD  
1533 C CE  . MET A 187 ? 0.367 0.335 0.309 0.035  0.000  -0.022 6982 MET A CE  
1534 N N   . GLY A 188 ? 0.305 0.370 0.299 0.040  0.004  -0.049 6983 GLY A N   
1535 C CA  . GLY A 188 ? 0.310 0.402 0.319 0.036  0.008  -0.058 6983 GLY A CA  
1536 C C   . GLY A 188 ? 0.318 0.419 0.330 0.039  0.014  -0.064 6983 GLY A C   
1537 O O   . GLY A 188 ? 0.324 0.450 0.349 0.034  0.019  -0.072 6983 GLY A O   
1538 N N   . HIS A 189 ? 0.322 0.404 0.323 0.045  0.015  -0.061 6984 HIS A N   
1539 C CA  . HIS A 189 ? 0.336 0.423 0.338 0.048  0.021  -0.067 6984 HIS A CA  
1540 C C   . HIS A 189 ? 0.338 0.412 0.327 0.035  0.029  -0.064 6984 HIS A C   
1541 O O   . HIS A 189 ? 0.337 0.409 0.321 0.036  0.035  -0.068 6984 HIS A O   
1542 C CB  . HIS A 189 ? 0.357 0.428 0.353 0.064  0.017  -0.066 6984 HIS A CB  
1543 C CG  . HIS A 189 ? 0.367 0.451 0.375 0.079  0.010  -0.069 6984 HIS A CG  
1544 N ND1 . HIS A 189 ? 0.393 0.480 0.405 0.094  0.009  -0.076 6984 HIS A ND1 
1545 C CD2 . HIS A 189 ? 0.372 0.465 0.386 0.082  0.002  -0.068 6984 HIS A CD2 
1546 C CE1 . HIS A 189 ? 0.395 0.492 0.416 0.107  0.001  -0.077 6984 HIS A CE1 
1547 N NE2 . HIS A 189 ? 0.380 0.481 0.401 0.099  -0.004 -0.072 6984 HIS A NE2 
1548 N N   . PHE A 190 ? 0.319 0.383 0.301 0.023  0.028  -0.058 6985 PHE A N   
1549 C CA  . PHE A 190 ? 0.322 0.372 0.290 0.010  0.033  -0.054 6985 PHE A CA  
1550 C C   . PHE A 190 ? 0.326 0.390 0.299 -0.003 0.039  -0.056 6985 PHE A C   
1551 O O   . PHE A 190 ? 0.303 0.383 0.289 -0.003 0.037  -0.059 6985 PHE A O   
1552 C CB  . PHE A 190 ? 0.316 0.341 0.271 0.008  0.027  -0.044 6985 PHE A CB  
1553 C CG  . PHE A 190 ? 0.320 0.329 0.268 0.018  0.023  -0.041 6985 PHE A CG  
1554 C CD1 . PHE A 190 ? 0.316 0.324 0.269 0.029  0.017  -0.041 6985 PHE A CD1 
1555 C CD2 . PHE A 190 ? 0.324 0.317 0.258 0.015  0.025  -0.039 6985 PHE A CD2 
1556 C CE1 . PHE A 190 ? 0.324 0.315 0.269 0.036  0.014  -0.039 6985 PHE A CE1 
1557 C CE2 . PHE A 190 ? 0.325 0.303 0.253 0.022  0.021  -0.038 6985 PHE A CE2 
1558 C CZ  . PHE A 190 ? 0.322 0.298 0.254 0.032  0.016  -0.038 6985 PHE A CZ  
1559 N N   . ALA A 191 ? 0.334 0.392 0.296 -0.015 0.046  -0.055 6986 ALA A N   
1560 C CA  . ALA A 191 ? 0.344 0.410 0.306 -0.030 0.052  -0.056 6986 ALA A CA  
1561 C C   . ALA A 191 ? 0.347 0.401 0.308 -0.035 0.046  -0.050 6986 ALA A C   
1562 O O   . ALA A 191 ? 0.342 0.408 0.310 -0.043 0.048  -0.053 6986 ALA A O   
1563 C CB  . ALA A 191 ? 0.364 0.419 0.309 -0.042 0.060  -0.054 6986 ALA A CB  
1564 N N   . TRP A 192 ? 0.347 0.379 0.299 -0.029 0.039  -0.042 6987 TRP A N   
1565 C CA  . TRP A 192 ? 0.354 0.373 0.304 -0.032 0.033  -0.036 6987 TRP A CA  
1566 C C   . TRP A 192 ? 0.334 0.339 0.281 -0.021 0.025  -0.031 6987 TRP A C   
1567 O O   . TRP A 192 ? 0.326 0.325 0.267 -0.015 0.024  -0.030 6987 TRP A O   
1568 C CB  . TRP A 192 ? 0.403 0.404 0.338 -0.045 0.036  -0.030 6987 TRP A CB  
1569 C CG  . TRP A 192 ? 0.440 0.427 0.372 -0.047 0.031  -0.025 6987 TRP A CG  
1570 C CD1 . TRP A 192 ? 0.472 0.463 0.409 -0.054 0.031  -0.028 6987 TRP A CD1 
1571 C CD2 . TRP A 192 ? 0.456 0.421 0.380 -0.042 0.024  -0.017 6987 TRP A CD2 
1572 N NE1 . TRP A 192 ? 0.480 0.452 0.412 -0.053 0.026  -0.022 6987 TRP A NE1 
1573 C CE2 . TRP A 192 ? 0.480 0.437 0.405 -0.046 0.022  -0.016 6987 TRP A CE2 
1574 C CE3 . TRP A 192 ? 0.458 0.411 0.374 -0.036 0.020  -0.013 6987 TRP A CE3 
1575 C CZ2 . TRP A 192 ? 0.490 0.428 0.409 -0.042 0.016  -0.010 6987 TRP A CZ2 
1576 C CZ3 . TRP A 192 ? 0.463 0.399 0.374 -0.033 0.014  -0.007 6987 TRP A CZ3 
1577 C CH2 . TRP A 192 ? 0.459 0.388 0.373 -0.035 0.012  -0.005 6987 TRP A CH2 
1578 N N   . TRP A 193 ? 0.309 0.310 0.259 -0.019 0.020  -0.028 6988 TRP A N   
1579 C CA  . TRP A 193 ? 0.303 0.292 0.251 -0.011 0.013  -0.023 6988 TRP A CA  
1580 C C   . TRP A 193 ? 0.306 0.284 0.253 -0.013 0.010  -0.020 6988 TRP A C   
1581 O O   . TRP A 193 ? 0.301 0.283 0.250 -0.021 0.012  -0.022 6988 TRP A O   
1582 C CB  . TRP A 193 ? 0.292 0.292 0.248 0.000  0.011  -0.027 6988 TRP A CB  
1583 C CG  . TRP A 193 ? 0.289 0.302 0.255 0.002  0.008  -0.030 6988 TRP A CG  
1584 C CD1 . TRP A 193 ? 0.289 0.322 0.265 -0.001 0.010  -0.037 6988 TRP A CD1 
1585 C CD2 . TRP A 193 ? 0.282 0.288 0.247 0.005  0.003  -0.027 6988 TRP A CD2 
1586 N NE1 . TRP A 193 ? 0.280 0.319 0.261 0.001  0.006  -0.038 6988 TRP A NE1 
1587 C CE2 . TRP A 193 ? 0.282 0.304 0.256 0.005  0.002  -0.032 6988 TRP A CE2 
1588 C CE3 . TRP A 193 ? 0.282 0.272 0.241 0.008  0.000  -0.022 6988 TRP A CE3 
1589 C CZ2 . TRP A 193 ? 0.279 0.300 0.253 0.007  -0.002 -0.032 6988 TRP A CZ2 
1590 C CZ3 . TRP A 193 ? 0.278 0.268 0.238 0.011  -0.003 -0.021 6988 TRP A CZ3 
1591 C CH2 . TRP A 193 ? 0.281 0.285 0.247 0.010  -0.004 -0.026 6988 TRP A CH2 
1592 N N   . THR A 194 ? 0.294 0.260 0.238 -0.008 0.006  -0.015 6989 THR A N   
1593 C CA  . THR A 194 ? 0.296 0.254 0.240 -0.009 0.003  -0.013 6989 THR A CA  
1594 C C   . THR A 194 ? 0.287 0.240 0.232 -0.001 -0.001 -0.010 6989 THR A C   
1595 O O   . THR A 194 ? 0.292 0.244 0.235 0.003  -0.001 -0.009 6989 THR A O   
1596 C CB  . THR A 194 ? 0.305 0.249 0.243 -0.015 0.003  -0.009 6989 THR A CB  
1597 O OG1 . THR A 194 ? 0.318 0.258 0.258 -0.016 0.002  -0.009 6989 THR A OG1 
1598 C CG2 . THR A 194 ? 0.308 0.240 0.239 -0.013 0.001  -0.004 6989 THR A CG2 
1599 N N   . ALA A 195 ? 0.284 0.233 0.231 -0.001 -0.002 -0.009 6990 ALA A N   
1600 C CA  . ALA A 195 ? 0.283 0.226 0.230 0.004  -0.005 -0.007 6990 ALA A CA  
1601 C C   . ALA A 195 ? 0.287 0.219 0.233 0.002  -0.006 -0.003 6990 ALA A C   
1602 O O   . ALA A 195 ? 0.291 0.219 0.237 -0.001 -0.005 -0.005 6990 ALA A O   
1603 C CB  . ALA A 195 ? 0.281 0.230 0.231 0.007  -0.005 -0.009 6990 ALA A CB  
1604 N N   . PHE A 196 ? 0.279 0.206 0.224 0.004  -0.008 0.000  6991 PHE A N   
1605 C CA  . PHE A 196 ? 0.284 0.202 0.229 0.003  -0.011 0.003  6991 PHE A CA  
1606 C C   . PHE A 196 ? 0.276 0.195 0.228 0.008  -0.013 0.003  6991 PHE A C   
1607 O O   . PHE A 196 ? 0.276 0.199 0.229 0.009  -0.013 0.004  6991 PHE A O   
1608 C CB  . PHE A 196 ? 0.295 0.208 0.232 0.001  -0.013 0.006  6991 PHE A CB  
1609 C CG  . PHE A 196 ? 0.302 0.205 0.238 0.002  -0.018 0.010  6991 PHE A CG  
1610 C CD1 . PHE A 196 ? 0.320 0.213 0.252 0.000  -0.019 0.012  6991 PHE A CD1 
1611 C CD2 . PHE A 196 ? 0.310 0.214 0.249 0.004  -0.022 0.012  6991 PHE A CD2 
1612 C CE1 . PHE A 196 ? 0.326 0.209 0.256 0.002  -0.025 0.016  6991 PHE A CE1 
1613 C CE2 . PHE A 196 ? 0.318 0.215 0.257 0.006  -0.028 0.015  6991 PHE A CE2 
1614 C CZ  . PHE A 196 ? 0.327 0.213 0.261 0.006  -0.030 0.017  6991 PHE A CZ  
1615 N N   . VAL A 197 ? 0.281 0.196 0.237 0.009  -0.014 0.003  6992 VAL A N   
1616 C CA  . VAL A 197 ? 0.283 0.201 0.248 0.013  -0.014 0.002  6992 VAL A CA  
1617 C C   . VAL A 197 ? 0.285 0.198 0.253 0.016  -0.020 0.005  6992 VAL A C   
1618 O O   . VAL A 197 ? 0.287 0.190 0.250 0.016  -0.022 0.006  6992 VAL A O   
1619 C CB  . VAL A 197 ? 0.288 0.208 0.257 0.015  -0.011 -0.002 6992 VAL A CB  
1620 C CG1 . VAL A 197 ? 0.293 0.216 0.272 0.019  -0.011 -0.004 6992 VAL A CG1 
1621 C CG2 . VAL A 197 ? 0.290 0.215 0.256 0.013  -0.007 -0.005 6992 VAL A CG2 
1622 N N   . THR A 198 ? 0.276 0.195 0.249 0.017  -0.022 0.006  6993 THR A N   
1623 C CA  . THR A 198 ? 0.284 0.202 0.262 0.020  -0.029 0.008  6993 THR A CA  
1624 C C   . THR A 198 ? 0.288 0.207 0.277 0.026  -0.029 0.005  6993 THR A C   
1625 O O   . THR A 198 ? 0.276 0.203 0.272 0.027  -0.024 0.001  6993 THR A O   
1626 C CB  . THR A 198 ? 0.288 0.214 0.270 0.019  -0.032 0.009  6993 THR A CB  
1627 O OG1 . THR A 198 ? 0.297 0.235 0.291 0.020  -0.028 0.005  6993 THR A OG1 
1628 C CG2 . THR A 198 ? 0.294 0.217 0.264 0.014  -0.031 0.010  6993 THR A CG2 
1629 N N   . ASN A 199 ? 0.297 0.206 0.285 0.031  -0.035 0.008  6994 ASN A N   
1630 C CA  . ASN A 199 ? 0.306 0.215 0.306 0.038  -0.036 0.004  6994 ASN A CA  
1631 C C   . ASN A 199 ? 0.297 0.225 0.314 0.042  -0.036 0.001  6994 ASN A C   
1632 O O   . ASN A 199 ? 0.297 0.231 0.326 0.047  -0.032 -0.004 6994 ASN A O   
1633 C CB  . ASN A 199 ? 0.325 0.218 0.319 0.043  -0.043 0.008  6994 ASN A CB  
1634 C CG  . ASN A 199 ? 0.343 0.217 0.323 0.040  -0.040 0.009  6994 ASN A CG  
1635 O OD1 . ASN A 199 ? 0.329 0.206 0.309 0.037  -0.033 0.005  6994 ASN A OD1 
1636 N ND2 . ASN A 199 ? 0.366 0.221 0.335 0.042  -0.046 0.014  6994 ASN A ND2 
1637 N N   A VAL A 200 ? 0.292 0.229 0.313 0.040  -0.040 0.003  6995 VAL A N   
1638 N N   B VAL A 200 ? 0.291 0.228 0.312 0.040  -0.040 0.003  6995 VAL A N   
1639 C CA  A VAL A 200 ? 0.289 0.247 0.330 0.042  -0.040 -0.002 6995 VAL A CA  
1640 C CA  B VAL A 200 ? 0.289 0.246 0.328 0.042  -0.041 -0.001 6995 VAL A CA  
1641 C C   A VAL A 200 ? 0.279 0.247 0.323 0.037  -0.030 -0.006 6995 VAL A C   
1642 C C   B VAL A 200 ? 0.279 0.247 0.323 0.037  -0.030 -0.006 6995 VAL A C   
1643 O O   A VAL A 200 ? 0.276 0.259 0.336 0.039  -0.027 -0.011 6995 VAL A O   
1644 O O   B VAL A 200 ? 0.275 0.259 0.335 0.038  -0.028 -0.010 6995 VAL A O   
1645 C CB  A VAL A 200 ? 0.293 0.258 0.335 0.039  -0.048 0.001  6995 VAL A CB  
1646 C CB  B VAL A 200 ? 0.293 0.256 0.333 0.039  -0.049 0.002  6995 VAL A CB  
1647 C CG1 A VAL A 200 ? 0.306 0.263 0.346 0.046  -0.060 0.005  6995 VAL A CG1 
1648 C CG1 B VAL A 200 ? 0.286 0.249 0.316 0.029  -0.044 0.003  6995 VAL A CG1 
1649 C CG2 A VAL A 200 ? 0.289 0.249 0.316 0.030  -0.045 0.003  6995 VAL A CG2 
1650 C CG2 B VAL A 200 ? 0.292 0.275 0.354 0.043  -0.052 -0.003 6995 VAL A CG2 
1651 N N   . ASN A 201 ? 0.276 0.236 0.306 0.031  -0.025 -0.004 6996 ASN A N   
1652 C CA  . ASN A 201 ? 0.281 0.248 0.311 0.026  -0.016 -0.008 6996 ASN A CA  
1653 C C   . ASN A 201 ? 0.290 0.249 0.311 0.027  -0.010 -0.009 6996 ASN A C   
1654 O O   . ASN A 201 ? 0.291 0.250 0.305 0.022  -0.005 -0.010 6996 ASN A O   
1655 C CB  . ASN A 201 ? 0.283 0.248 0.303 0.019  -0.015 -0.005 6996 ASN A CB  
1656 C CG  . ASN A 201 ? 0.290 0.263 0.312 0.014  -0.008 -0.007 6996 ASN A CG  
1657 O OD1 . ASN A 201 ? 0.293 0.278 0.328 0.015  -0.004 -0.011 6996 ASN A OD1 
1658 N ND2 . ASN A 201 ? 0.284 0.250 0.294 0.009  -0.006 -0.005 6996 ASN A ND2 
1659 N N   . ALA A 202 ? 0.303 0.254 0.324 0.032  -0.012 -0.010 6997 ALA A N   
1660 C CA  . ALA A 202 ? 0.312 0.255 0.325 0.031  -0.008 -0.012 6997 ALA A CA  
1661 C C   . ALA A 202 ? 0.317 0.268 0.334 0.031  0.000  -0.018 6997 ALA A C   
1662 O O   . ALA A 202 ? 0.307 0.253 0.315 0.030  0.004  -0.020 6997 ALA A O   
1663 C CB  . ALA A 202 ? 0.333 0.263 0.345 0.036  -0.012 -0.013 6997 ALA A CB  
1664 N N   . SER A 203 ? 0.302 0.266 0.330 0.032  0.003  -0.021 6998 SER A N   
1665 C CA  . SER A 203 ? 0.311 0.284 0.342 0.030  0.012  -0.026 6998 SER A CA  
1666 C C   . SER A 203 ? 0.304 0.277 0.322 0.023  0.016  -0.023 6998 SER A C   
1667 O O   . SER A 203 ? 0.315 0.292 0.329 0.020  0.023  -0.027 6998 SER A O   
1668 C CB  . SER A 203 ? 0.320 0.309 0.369 0.034  0.014  -0.031 6998 SER A CB  
1669 O OG  . SER A 203 ? 0.331 0.328 0.387 0.030  0.011  -0.028 6998 SER A OG  
1670 N N   . SER A 204 ? 0.295 0.263 0.306 0.020  0.011  -0.018 6999 SER A N   
1671 C CA  . SER A 204 ? 0.299 0.263 0.296 0.014  0.013  -0.014 6999 SER A CA  
1672 C C   . SER A 204 ? 0.293 0.247 0.277 0.015  0.011  -0.012 6999 SER A C   
1673 O O   . SER A 204 ? 0.278 0.228 0.263 0.017  0.006  -0.012 6999 SER A O   
1674 C CB  . SER A 204 ? 0.298 0.263 0.298 0.011  0.010  -0.011 6999 SER A CB  
1675 O OG  . SER A 204 ? 0.300 0.258 0.285 0.007  0.011  -0.007 6999 SER A OG  
1676 N N   . SER A 205 ? 0.294 0.245 0.265 0.012  0.013  -0.011 7000 SER A N   
1677 C CA  . SER A 205 ? 0.297 0.242 0.257 0.013  0.010  -0.009 7000 SER A CA  
1678 C C   . SER A 205 ? 0.291 0.233 0.250 0.013  0.006  -0.005 7000 SER A C   
1679 O O   . SER A 205 ? 0.291 0.230 0.242 0.014  0.003  -0.004 7000 SER A O   
1680 C CB  . SER A 205 ? 0.304 0.247 0.251 0.012  0.013  -0.009 7000 SER A CB  
1681 O OG  . SER A 205 ? 0.314 0.253 0.256 0.009  0.015  -0.005 7000 SER A OG  
1682 N N   . GLU A 206 ? 0.288 0.230 0.252 0.011  0.005  -0.004 7001 GLU A N   
1683 C CA  . GLU A 206 ? 0.290 0.228 0.252 0.011  0.001  -0.001 7001 GLU A CA  
1684 C C   . GLU A 206 ? 0.285 0.221 0.247 0.013  -0.003 -0.001 7001 GLU A C   
1685 O O   . GLU A 206 ? 0.279 0.217 0.247 0.014  -0.003 -0.002 7001 GLU A O   
1686 C CB  . GLU A 206 ? 0.295 0.236 0.265 0.009  -0.001 0.000  7001 GLU A CB  
1687 C CG  . GLU A 206 ? 0.313 0.250 0.280 0.008  -0.006 0.002  7001 GLU A CG  
1688 C CD  . GLU A 206 ? 0.320 0.260 0.295 0.005  -0.008 0.002  7001 GLU A CD  
1689 O OE1 . GLU A 206 ? 0.324 0.264 0.298 0.001  -0.007 0.002  7001 GLU A OE1 
1690 O OE2 . GLU A 206 ? 0.326 0.270 0.309 0.008  -0.012 0.002  7001 GLU A OE2 
1691 N N   . ALA A 207 ? 0.285 0.218 0.241 0.013  -0.005 0.001  7002 ALA A N   
1692 C CA  . ALA A 207 ? 0.289 0.221 0.244 0.013  -0.007 0.001  7002 ALA A CA  
1693 C C   . ALA A 207 ? 0.291 0.220 0.240 0.012  -0.008 0.002  7002 ALA A C   
1694 O O   . ALA A 207 ? 0.292 0.218 0.236 0.013  -0.008 0.003  7002 ALA A O   
1695 C CB  . ALA A 207 ? 0.290 0.224 0.243 0.013  -0.006 -0.002 7002 ALA A CB  
1696 N N   . PHE A 208 ? 0.288 0.215 0.235 0.010  -0.010 0.003  7003 PHE A N   
1697 C CA  . PHE A 208 ? 0.298 0.222 0.238 0.010  -0.010 0.003  7003 PHE A CA  
1698 C C   . PHE A 208 ? 0.297 0.227 0.236 0.011  -0.008 0.000  7003 PHE A C   
1699 O O   . PHE A 208 ? 0.284 0.215 0.224 0.008  -0.008 0.000  7003 PHE A O   
1700 C CB  . PHE A 208 ? 0.312 0.233 0.250 0.007  -0.013 0.005  7003 PHE A CB  
1701 C CG  . PHE A 208 ? 0.321 0.239 0.261 0.006  -0.016 0.006  7003 PHE A CG  
1702 C CD1 . PHE A 208 ? 0.329 0.251 0.278 0.006  -0.018 0.007  7003 PHE A CD1 
1703 C CD2 . PHE A 208 ? 0.334 0.249 0.270 0.005  -0.016 0.005  7003 PHE A CD2 
1704 C CE1 . PHE A 208 ? 0.342 0.266 0.296 0.005  -0.020 0.007  7003 PHE A CE1 
1705 C CE2 . PHE A 208 ? 0.337 0.251 0.276 0.003  -0.018 0.006  7003 PHE A CE2 
1706 C CZ  . PHE A 208 ? 0.339 0.260 0.289 0.002  -0.020 0.006  7003 PHE A CZ  
1707 N N   . LEU A 209 ? 0.303 0.235 0.239 0.014  -0.007 -0.002 7004 LEU A N   
1708 C CA  . LEU A 209 ? 0.315 0.256 0.253 0.016  -0.006 -0.005 7004 LEU A CA  
1709 C C   . LEU A 209 ? 0.316 0.255 0.249 0.013  -0.004 -0.006 7004 LEU A C   
1710 O O   . LEU A 209 ? 0.318 0.250 0.246 0.015  -0.004 -0.006 7004 LEU A O   
1711 C CB  . LEU A 209 ? 0.331 0.275 0.268 0.022  -0.006 -0.007 7004 LEU A CB  
1712 C CG  . LEU A 209 ? 0.364 0.311 0.303 0.025  -0.007 -0.007 7004 LEU A CG  
1713 C CD1 . LEU A 209 ? 0.373 0.323 0.309 0.032  -0.009 -0.008 7004 LEU A CD1 
1714 C CD2 . LEU A 209 ? 0.368 0.323 0.312 0.021  -0.007 -0.009 7004 LEU A CD2 
1715 N N   . ILE A 210 ? 0.309 0.251 0.242 0.008  -0.002 -0.007 7005 ILE A N   
1716 C CA  . ILE A 210 ? 0.314 0.254 0.241 0.004  0.000  -0.007 7005 ILE A CA  
1717 C C   . ILE A 210 ? 0.321 0.274 0.251 0.003  0.004  -0.012 7005 ILE A C   
1718 O O   . ILE A 210 ? 0.313 0.274 0.248 0.000  0.006  -0.014 7005 ILE A O   
1719 C CB  . ILE A 210 ? 0.320 0.251 0.242 -0.003 -0.002 -0.003 7005 ILE A CB  
1720 C CG1 . ILE A 210 ? 0.317 0.240 0.239 -0.001 -0.007 0.001  7005 ILE A CG1 
1721 C CG2 . ILE A 210 ? 0.342 0.271 0.254 -0.008 0.001  -0.003 7005 ILE A CG2 
1722 C CD1 . ILE A 210 ? 0.329 0.244 0.248 -0.005 -0.010 0.005  7005 ILE A CD1 
1723 N N   . GLY A 211 ? 0.315 0.269 0.242 0.007  0.007  -0.016 7006 GLY A N   
1724 C CA  . GLY A 211 ? 0.328 0.297 0.259 0.007  0.012  -0.022 7006 GLY A CA  
1725 C C   . GLY A 211 ? 0.340 0.304 0.260 -0.001 0.016  -0.022 7006 GLY A C   
1726 O O   . GLY A 211 ? 0.334 0.287 0.245 0.000  0.015  -0.021 7006 GLY A O   
1727 N N   . CYS A 212 ? 0.356 0.327 0.276 -0.009 0.021  -0.024 7007 CYS A N   
1728 C CA  . CYS A 212 ? 0.396 0.361 0.302 -0.018 0.025  -0.023 7007 CYS A CA  
1729 C C   . CYS A 212 ? 0.384 0.365 0.293 -0.019 0.034  -0.031 7007 CYS A C   
1730 O O   . CYS A 212 ? 0.385 0.383 0.305 -0.022 0.038  -0.036 7007 CYS A O   
1731 C CB  . CYS A 212 ? 0.442 0.398 0.342 -0.028 0.025  -0.018 7007 CYS A CB  
1732 S SG  . CYS A 212 ? 0.564 0.503 0.441 -0.038 0.027  -0.013 7007 CYS A SG  
1733 N N   . ASN A 213 ? 0.383 0.361 0.284 -0.018 0.037  -0.034 7008 ASN A N   
1734 C CA  . ASN A 213 ? 0.381 0.374 0.283 -0.019 0.046  -0.043 7008 ASN A CA  
1735 C C   . ASN A 213 ? 0.365 0.377 0.286 -0.007 0.047  -0.051 7008 ASN A C   
1736 O O   . ASN A 213 ? 0.353 0.386 0.290 -0.008 0.049  -0.055 7008 ASN A O   
1737 C CB  . ASN A 213 ? 0.384 0.384 0.282 -0.033 0.054  -0.044 7008 ASN A CB  
1738 C CG  . ASN A 213 ? 0.412 0.389 0.289 -0.043 0.052  -0.035 7008 ASN A CG  
1739 O OD1 . ASN A 213 ? 0.425 0.396 0.299 -0.051 0.051  -0.029 7008 ASN A OD1 
1740 N ND2 . ASN A 213 ? 0.406 0.368 0.267 -0.042 0.050  -0.033 7008 ASN A ND2 
1741 N N   . TYR A 214 ? 0.369 0.375 0.289 0.004  0.045  -0.054 7009 TYR A N   
1742 C CA  . TYR A 214 ? 0.368 0.388 0.304 0.018  0.043  -0.060 7009 TYR A CA  
1743 C C   . TYR A 214 ? 0.376 0.421 0.323 0.019  0.052  -0.071 7009 TYR A C   
1744 O O   . TYR A 214 ? 0.385 0.428 0.322 0.014  0.060  -0.076 7009 TYR A O   
1745 C CB  . TYR A 214 ? 0.377 0.378 0.305 0.028  0.038  -0.059 7009 TYR A CB  
1746 C CG  . TYR A 214 ? 0.386 0.394 0.325 0.044  0.036  -0.065 7009 TYR A CG  
1747 C CD1 . TYR A 214 ? 0.387 0.402 0.338 0.050  0.030  -0.063 7009 TYR A CD1 
1748 C CD2 . TYR A 214 ? 0.402 0.404 0.336 0.052  0.039  -0.071 7009 TYR A CD2 
1749 C CE1 . TYR A 214 ? 0.401 0.421 0.360 0.066  0.026  -0.067 7009 TYR A CE1 
1750 C CE2 . TYR A 214 ? 0.419 0.424 0.362 0.068  0.036  -0.076 7009 TYR A CE2 
1751 C CZ  . TYR A 214 ? 0.417 0.431 0.373 0.075  0.029  -0.073 7009 TYR A CZ  
1752 O OH  . TYR A 214 ? 0.451 0.466 0.414 0.092  0.024  -0.077 7009 TYR A OH  
1753 N N   . LEU A 215 ? 0.373 0.441 0.339 0.025  0.052  -0.076 7010 LEU A N   
1754 C CA  . LEU A 215 ? 0.391 0.489 0.373 0.026  0.060  -0.088 7010 LEU A CA  
1755 C C   . LEU A 215 ? 0.406 0.511 0.399 0.045  0.058  -0.095 7010 LEU A C   
1756 O O   . LEU A 215 ? 0.408 0.539 0.414 0.049  0.065  -0.107 7010 LEU A O   
1757 C CB  . LEU A 215 ? 0.393 0.513 0.390 0.019  0.061  -0.089 7010 LEU A CB  
1758 C CG  . LEU A 215 ? 0.404 0.514 0.389 0.000  0.063  -0.082 7010 LEU A CG  
1759 C CD1 . LEU A 215 ? 0.414 0.546 0.416 -0.007 0.063  -0.084 7010 LEU A CD1 
1760 C CD2 . LEU A 215 ? 0.428 0.533 0.399 -0.012 0.074  -0.083 7010 LEU A CD2 
1761 N N   . GLY A 216 ? 0.408 0.494 0.396 0.057  0.048  -0.090 7011 GLY A N   
1762 C CA  . GLY A 216 ? 0.439 0.526 0.434 0.076  0.045  -0.096 7011 GLY A CA  
1763 C C   . GLY A 216 ? 0.460 0.576 0.478 0.087  0.041  -0.102 7011 GLY A C   
1764 O O   . GLY A 216 ? 0.481 0.602 0.507 0.104  0.038  -0.108 7011 GLY A O   
1765 N N   . LYS A 217 ? 0.461 0.593 0.488 0.077  0.039  -0.099 7012 LYS A N   
1766 C CA  . LYS A 217 ? 0.487 0.648 0.537 0.085  0.034  -0.105 7012 LYS A CA  
1767 C C   . LYS A 217 ? 0.473 0.637 0.523 0.073  0.030  -0.098 7012 LYS A C   
1768 O O   . LYS A 217 ? 0.457 0.607 0.495 0.057  0.034  -0.092 7012 LYS A O   
1769 C CB  . LYS A 217 ? 0.505 0.704 0.576 0.086  0.043  -0.118 7012 LYS A CB  
1770 C CG  . LYS A 217 ? 0.531 0.745 0.604 0.065  0.054  -0.121 7012 LYS A CG  
1771 C CD  . LYS A 217 ? 0.577 0.831 0.672 0.066  0.064  -0.136 7012 LYS A CD  
1772 C CE  . LYS A 217 ? 0.599 0.868 0.695 0.043  0.076  -0.139 7012 LYS A CE  
1773 N NZ  . LYS A 217 ? 0.627 0.938 0.747 0.043  0.086  -0.154 7012 LYS A NZ  
1774 N N   . PRO A 218 ? 0.488 0.667 0.551 0.080  0.021  -0.098 7013 PRO A N   
1775 C CA  . PRO A 218 ? 0.476 0.655 0.538 0.068  0.017  -0.093 7013 PRO A CA  
1776 C C   . PRO A 218 ? 0.490 0.695 0.564 0.051  0.025  -0.099 7013 PRO A C   
1777 O O   . PRO A 218 ? 0.501 0.739 0.596 0.054  0.028  -0.109 7013 PRO A O   
1778 C CB  . PRO A 218 ? 0.486 0.674 0.556 0.082  0.005  -0.093 7013 PRO A CB  
1779 C CG  . PRO A 218 ? 0.495 0.705 0.582 0.098  0.005  -0.103 7013 PRO A CG  
1780 C CD  . PRO A 218 ? 0.496 0.692 0.574 0.099  0.014  -0.105 7013 PRO A CD  
1781 N N   . ARG A 219 ? 0.471 0.660 0.533 0.034  0.030  -0.093 7014 ARG A N   
1782 C CA  . ARG A 219 ? 0.492 0.700 0.561 0.016  0.036  -0.097 7014 ARG A CA  
1783 C C   . ARG A 219 ? 0.484 0.698 0.560 0.015  0.028  -0.096 7014 ARG A C   
1784 O O   . ARG A 219 ? 0.483 0.719 0.571 0.003  0.031  -0.102 7014 ARG A O   
1785 C CB  . ARG A 219 ? 0.512 0.698 0.563 -0.001 0.045  -0.091 7014 ARG A CB  
1786 C CG  . ARG A 219 ? 0.549 0.700 0.581 -0.002 0.039  -0.079 7014 ARG A CG  
1787 C CD  . ARG A 219 ? 0.562 0.696 0.580 -0.020 0.044  -0.073 7014 ARG A CD  
1788 N NE  . ARG A 219 ? 0.601 0.746 0.627 -0.029 0.042  -0.075 7014 ARG A NE  
1789 C CZ  . ARG A 219 ? 0.608 0.740 0.630 -0.027 0.034  -0.070 7014 ARG A CZ  
1790 N NH1 . ARG A 219 ? 0.638 0.749 0.651 -0.016 0.027  -0.063 7014 ARG A NH1 
1791 N NH2 . ARG A 219 ? 0.620 0.762 0.649 -0.035 0.033  -0.073 7014 ARG A NH2 
1792 N N   . GLU A 220 ? 0.468 0.663 0.535 0.025  0.018  -0.088 7015 GLU A N   
1793 C CA  . GLU A 220 ? 0.460 0.658 0.529 0.025  0.009  -0.087 7015 GLU A CA  
1794 C C   . GLU A 220 ? 0.433 0.621 0.498 0.043  -0.002 -0.082 7015 GLU A C   
1795 O O   . GLU A 220 ? 0.409 0.571 0.459 0.049  -0.003 -0.076 7015 GLU A O   
1796 C CB  . GLU A 220 ? 0.497 0.671 0.551 0.010  0.011  -0.079 7015 GLU A CB  
1797 C CG  . GLU A 220 ? 0.535 0.708 0.588 0.009  0.003  -0.078 7015 GLU A CG  
1798 C CD  . GLU A 220 ? 0.585 0.790 0.656 0.003  0.001  -0.087 7015 GLU A CD  
1799 O OE1 . GLU A 220 ? 0.618 0.846 0.702 -0.004 0.008  -0.095 7015 GLU A OE1 
1800 O OE2 . GLU A 220 ? 0.667 0.872 0.736 0.003  -0.006 -0.087 7015 GLU A OE2 
1801 N N   . GLN A 221 ? 0.410 0.617 0.485 0.049  -0.011 -0.087 7016 GLN A N   
1802 C CA  . GLN A 221 ? 0.423 0.620 0.492 0.066  -0.022 -0.082 7016 GLN A CA  
1803 C C   . GLN A 221 ? 0.396 0.568 0.447 0.059  -0.026 -0.073 7016 GLN A C   
1804 O O   . GLN A 221 ? 0.399 0.581 0.454 0.049  -0.027 -0.076 7016 GLN A O   
1805 C CB  . GLN A 221 ? 0.460 0.689 0.546 0.077  -0.031 -0.090 7016 GLN A CB  
1806 C CG  . GLN A 221 ? 0.520 0.778 0.627 0.084  -0.028 -0.100 7016 GLN A CG  
1807 C CD  . GLN A 221 ? 0.586 0.827 0.686 0.099  -0.027 -0.098 7016 GLN A CD  
1808 O OE1 . GLN A 221 ? 0.696 0.910 0.780 0.110  -0.034 -0.090 7016 GLN A OE1 
1809 N NE2 . GLN A 221 ? 0.592 0.847 0.703 0.098  -0.017 -0.105 7016 GLN A NE2 
1810 N N   . ILE A 222 ? 0.372 0.514 0.406 0.064  -0.026 -0.064 7017 ILE A N   
1811 C CA  . ILE A 222 ? 0.355 0.474 0.373 0.058  -0.028 -0.057 7017 ILE A CA  
1812 C C   . ILE A 222 ? 0.369 0.475 0.375 0.071  -0.037 -0.052 7017 ILE A C   
1813 O O   . ILE A 222 ? 0.377 0.473 0.379 0.082  -0.039 -0.049 7017 ILE A O   
1814 C CB  . ILE A 222 ? 0.350 0.444 0.357 0.050  -0.020 -0.051 7017 ILE A CB  
1815 C CG1 . ILE A 222 ? 0.336 0.438 0.349 0.036  -0.012 -0.054 7017 ILE A CG1 
1816 C CG2 . ILE A 222 ? 0.346 0.417 0.338 0.048  -0.023 -0.043 7017 ILE A CG2 
1817 C CD1 . ILE A 222 ? 0.336 0.414 0.337 0.029  -0.006 -0.048 7017 ILE A CD1 
1818 N N   . ASP A 223 ? 0.374 0.481 0.376 0.068  -0.042 -0.050 7018 ASP A N   
1819 C CA  . ASP A 223 ? 0.383 0.475 0.369 0.077  -0.050 -0.044 7018 ASP A CA  
1820 C C   . ASP A 223 ? 0.367 0.430 0.337 0.070  -0.045 -0.037 7018 ASP A C   
1821 O O   . ASP A 223 ? 0.340 0.401 0.309 0.059  -0.041 -0.037 7018 ASP A O   
1822 C CB  . ASP A 223 ? 0.407 0.514 0.394 0.077  -0.058 -0.048 7018 ASP A CB  
1823 C CG  . ASP A 223 ? 0.441 0.531 0.408 0.085  -0.066 -0.041 7018 ASP A CG  
1824 O OD1 . ASP A 223 ? 0.443 0.507 0.395 0.084  -0.063 -0.034 7018 ASP A OD1 
1825 O OD2 . ASP A 223 ? 0.500 0.605 0.468 0.091  -0.076 -0.044 7018 ASP A OD2 
1826 N N   . GLY A 224 ? 0.367 0.409 0.326 0.077  -0.044 -0.031 7019 GLY A N   
1827 C CA  . GLY A 224 ? 0.366 0.383 0.312 0.071  -0.039 -0.024 7019 GLY A CA  
1828 C C   . GLY A 224 ? 0.369 0.377 0.303 0.067  -0.040 -0.020 7019 GLY A C   
1829 O O   . GLY A 224 ? 0.359 0.357 0.291 0.058  -0.034 -0.018 7019 GLY A O   
1830 N N   A TYR A 225 ? 0.384 0.393 0.310 0.074  -0.048 -0.019 7020 TYR A N   
1831 N N   B TYR A 225 ? 0.377 0.387 0.303 0.074  -0.048 -0.019 7020 TYR A N   
1832 C CA  A TYR A 225 ? 0.398 0.398 0.310 0.070  -0.049 -0.016 7020 TYR A CA  
1833 C CA  B TYR A 225 ? 0.388 0.389 0.300 0.070  -0.049 -0.016 7020 TYR A CA  
1834 C C   A TYR A 225 ? 0.381 0.394 0.301 0.059  -0.045 -0.022 7020 TYR A C   
1835 C C   B TYR A 225 ? 0.376 0.389 0.295 0.059  -0.046 -0.022 7020 TYR A C   
1836 O O   A TYR A 225 ? 0.386 0.388 0.300 0.051  -0.040 -0.020 7020 TYR A O   
1837 O O   B TYR A 225 ? 0.384 0.386 0.296 0.052  -0.041 -0.020 7020 TYR A O   
1838 C CB  A TYR A 225 ? 0.434 0.433 0.332 0.079  -0.058 -0.014 7020 TYR A CB  
1839 C CB  B TYR A 225 ? 0.415 0.415 0.314 0.081  -0.059 -0.015 7020 TYR A CB  
1840 C CG  A TYR A 225 ? 0.466 0.440 0.345 0.086  -0.060 -0.006 7020 TYR A CG  
1841 C CG  B TYR A 225 ? 0.432 0.414 0.319 0.092  -0.062 -0.008 7020 TYR A CG  
1842 C CD1 A TYR A 225 ? 0.473 0.441 0.353 0.097  -0.063 -0.004 7020 TYR A CD1 
1843 C CD1 B TYR A 225 ? 0.450 0.406 0.317 0.090  -0.060 0.000  7020 TYR A CD1 
1844 C CD2 A TYR A 225 ? 0.486 0.442 0.345 0.082  -0.058 0.000  7020 TYR A CD2 
1845 C CD2 B TYR A 225 ? 0.433 0.423 0.331 0.103  -0.067 -0.010 7020 TYR A CD2 
1846 C CE1 A TYR A 225 ? 0.502 0.443 0.362 0.102  -0.064 0.004  7020 TYR A CE1 
1847 C CE1 B TYR A 225 ? 0.469 0.404 0.323 0.099  -0.062 0.006  7020 TYR A CE1 
1848 C CE2 A TYR A 225 ? 0.512 0.443 0.352 0.086  -0.058 0.008  7020 TYR A CE2 
1849 C CE2 B TYR A 225 ? 0.455 0.424 0.340 0.114  -0.070 -0.005 7020 TYR A CE2 
1850 C CZ  A TYR A 225 ? 0.519 0.440 0.358 0.096  -0.062 0.010  7020 TYR A CZ  
1851 C CZ  B TYR A 225 ? 0.469 0.409 0.331 0.111  -0.068 0.004  7020 TYR A CZ  
1852 O OH  A TYR A 225 ? 0.557 0.451 0.376 0.100  -0.062 0.018  7020 TYR A OH  
1853 O OH  B TYR A 225 ? 0.498 0.414 0.346 0.120  -0.070 0.009  7020 TYR A OH  
1854 N N   . VAL A 226 ? 0.364 0.399 0.299 0.058  -0.048 -0.029 7021 VAL A N   
1855 C CA  . VAL A 226 ? 0.350 0.396 0.293 0.046  -0.045 -0.035 7021 VAL A CA  
1856 C C   . VAL A 226 ? 0.332 0.368 0.279 0.038  -0.036 -0.034 7021 VAL A C   
1857 O O   . VAL A 226 ? 0.329 0.357 0.273 0.030  -0.032 -0.034 7021 VAL A O   
1858 C CB  . VAL A 226 ? 0.361 0.434 0.319 0.046  -0.049 -0.044 7021 VAL A CB  
1859 C CG1 . VAL A 226 ? 0.367 0.448 0.333 0.032  -0.045 -0.050 7021 VAL A CG1 
1860 C CG2 . VAL A 226 ? 0.384 0.468 0.338 0.054  -0.060 -0.045 7021 VAL A CG2 
1861 N N   . MET A 227 ? 0.307 0.342 0.261 0.040  -0.033 -0.032 7022 MET A N   
1862 C CA  . MET A 227 ? 0.295 0.321 0.252 0.032  -0.025 -0.031 7022 MET A CA  
1863 C C   . MET A 227 ? 0.289 0.294 0.235 0.030  -0.022 -0.025 7022 MET A C   
1864 O O   . MET A 227 ? 0.287 0.286 0.235 0.023  -0.018 -0.026 7022 MET A O   
1865 C CB  . MET A 227 ? 0.293 0.322 0.257 0.034  -0.023 -0.031 7022 MET A CB  
1866 C CG  . MET A 227 ? 0.289 0.313 0.256 0.025  -0.016 -0.031 7022 MET A CG  
1867 S SD  . MET A 227 ? 0.298 0.335 0.274 0.013  -0.014 -0.037 7022 MET A SD  
1868 C CE  . MET A 227 ? 0.302 0.367 0.291 0.016  -0.016 -0.045 7022 MET A CE  
1869 N N   . HIS A 228 ? 0.297 0.292 0.233 0.037  -0.024 -0.021 7023 HIS A N   
1870 C CA  . HIS A 228 ? 0.292 0.271 0.220 0.034  -0.020 -0.016 7023 HIS A CA  
1871 C C   . HIS A 228 ? 0.301 0.280 0.225 0.029  -0.019 -0.019 7023 HIS A C   
1872 O O   . HIS A 228 ? 0.293 0.265 0.219 0.024  -0.015 -0.019 7023 HIS A O   
1873 C CB  . HIS A 228 ? 0.300 0.266 0.216 0.040  -0.022 -0.010 7023 HIS A CB  
1874 C CG  . HIS A 228 ? 0.299 0.251 0.210 0.036  -0.017 -0.006 7023 HIS A CG  
1875 N ND1 . HIS A 228 ? 0.290 0.238 0.208 0.032  -0.013 -0.006 7023 HIS A ND1 
1876 C CD2 . HIS A 228 ? 0.312 0.253 0.211 0.035  -0.015 -0.003 7023 HIS A CD2 
1877 C CE1 . HIS A 228 ? 0.290 0.229 0.204 0.029  -0.009 -0.003 7023 HIS A CE1 
1878 N NE2 . HIS A 228 ? 0.300 0.235 0.203 0.030  -0.009 -0.001 7023 HIS A NE2 
1879 N N   . ALA A 229 ? 0.303 0.292 0.224 0.031  -0.024 -0.022 7024 ALA A N   
1880 C CA  . ALA A 229 ? 0.311 0.300 0.228 0.026  -0.023 -0.026 7024 ALA A CA  
1881 C C   . ALA A 229 ? 0.301 0.293 0.228 0.018  -0.019 -0.031 7024 ALA A C   
1882 O O   . ALA A 229 ? 0.298 0.283 0.223 0.014  -0.016 -0.033 7024 ALA A O   
1883 C CB  . ALA A 229 ? 0.326 0.326 0.237 0.029  -0.031 -0.030 7024 ALA A CB  
1884 N N   . ASN A 230 ? 0.289 0.291 0.228 0.016  -0.020 -0.033 7025 ASN A N   
1885 C CA  . ASN A 230 ? 0.286 0.287 0.232 0.008  -0.016 -0.037 7025 ASN A CA  
1886 C C   . ASN A 230 ? 0.284 0.269 0.230 0.007  -0.011 -0.032 7025 ASN A C   
1887 O O   . ASN A 230 ? 0.285 0.263 0.232 0.002  -0.008 -0.034 7025 ASN A O   
1888 C CB  . ASN A 230 ? 0.289 0.304 0.245 0.005  -0.017 -0.039 7025 ASN A CB  
1889 C CG  . ASN A 230 ? 0.293 0.328 0.254 0.005  -0.022 -0.045 7025 ASN A CG  
1890 O OD1 . ASN A 230 ? 0.310 0.348 0.266 0.005  -0.025 -0.049 7025 ASN A OD1 
1891 N ND2 . ASN A 230 ? 0.277 0.328 0.249 0.006  -0.023 -0.048 7025 ASN A ND2 
1892 N N   . TYR A 231 ? 0.281 0.262 0.226 0.012  -0.011 -0.027 7026 TYR A N   
1893 C CA  . TYR A 231 ? 0.284 0.253 0.230 0.011  -0.008 -0.022 7026 TYR A CA  
1894 C C   . TYR A 231 ? 0.292 0.253 0.233 0.011  -0.005 -0.023 7026 TYR A C   
1895 O O   . TYR A 231 ? 0.292 0.246 0.237 0.009  -0.003 -0.024 7026 TYR A O   
1896 C CB  . TYR A 231 ? 0.284 0.250 0.228 0.016  -0.008 -0.017 7026 TYR A CB  
1897 C CG  . TYR A 231 ? 0.284 0.239 0.228 0.016  -0.006 -0.014 7026 TYR A CG  
1898 C CD1 . TYR A 231 ? 0.284 0.235 0.233 0.012  -0.005 -0.013 7026 TYR A CD1 
1899 C CD2 . TYR A 231 ? 0.288 0.239 0.227 0.018  -0.005 -0.011 7026 TYR A CD2 
1900 C CE1 . TYR A 231 ? 0.290 0.234 0.241 0.013  -0.004 -0.010 7026 TYR A CE1 
1901 C CE2 . TYR A 231 ? 0.289 0.233 0.231 0.017  -0.002 -0.009 7026 TYR A CE2 
1902 C CZ  . TYR A 231 ? 0.287 0.230 0.237 0.015  -0.002 -0.009 7026 TYR A CZ  
1903 O OH  . TYR A 231 ? 0.284 0.224 0.238 0.015  -0.001 -0.007 7026 TYR A OH  
1904 N N   A ILE A 232 ? 0.302 0.265 0.236 0.014  -0.006 -0.023 7027 ILE A N   
1905 N N   B ILE A 232 ? 0.299 0.262 0.233 0.014  -0.006 -0.023 7027 ILE A N   
1906 C CA  A ILE A 232 ? 0.312 0.269 0.241 0.014  -0.002 -0.024 7027 ILE A CA  
1907 C CA  B ILE A 232 ? 0.307 0.263 0.236 0.014  -0.002 -0.024 7027 ILE A CA  
1908 C C   A ILE A 232 ? 0.312 0.268 0.242 0.010  -0.001 -0.031 7027 ILE A C   
1909 C C   B ILE A 232 ? 0.311 0.268 0.241 0.010  -0.001 -0.031 7027 ILE A C   
1910 O O   A ILE A 232 ? 0.320 0.270 0.253 0.009  0.003  -0.032 7027 ILE A O   
1911 O O   B ILE A 232 ? 0.319 0.269 0.251 0.009  0.003  -0.033 7027 ILE A O   
1912 C CB  A ILE A 232 ? 0.326 0.284 0.243 0.016  -0.004 -0.023 7027 ILE A CB  
1913 C CB  B ILE A 232 ? 0.316 0.272 0.233 0.016  -0.003 -0.022 7027 ILE A CB  
1914 C CG1 A ILE A 232 ? 0.335 0.288 0.248 0.020  -0.004 -0.016 7027 ILE A CG1 
1915 C CG1 B ILE A 232 ? 0.315 0.267 0.231 0.019  -0.003 -0.016 7027 ILE A CG1 
1916 C CG2 A ILE A 232 ? 0.336 0.289 0.246 0.014  0.001  -0.025 7027 ILE A CG2 
1917 C CG2 B ILE A 232 ? 0.326 0.278 0.236 0.015  0.002  -0.025 7027 ILE A CG2 
1918 C CD1 A ILE A 232 ? 0.334 0.280 0.252 0.018  0.000  -0.013 7027 ILE A CD1 
1919 C CD1 B ILE A 232 ? 0.326 0.272 0.226 0.022  -0.004 -0.012 7027 ILE A CD1 
1920 N N   . PHE A 233 ? 0.316 0.280 0.246 0.007  -0.004 -0.035 7028 PHE A N   
1921 C CA  . PHE A 233 ? 0.324 0.286 0.254 0.002  -0.003 -0.042 7028 PHE A CA  
1922 C C   . PHE A 233 ? 0.306 0.257 0.243 0.000  0.000  -0.041 7028 PHE A C   
1923 O O   . PHE A 233 ? 0.309 0.252 0.246 -0.001 0.003  -0.045 7028 PHE A O   
1924 C CB  . PHE A 233 ? 0.340 0.314 0.270 -0.002 -0.008 -0.046 7028 PHE A CB  
1925 C CG  . PHE A 233 ? 0.360 0.331 0.291 -0.010 -0.007 -0.054 7028 PHE A CG  
1926 C CD1 . PHE A 233 ? 0.409 0.374 0.332 -0.011 -0.005 -0.059 7028 PHE A CD1 
1927 C CD2 . PHE A 233 ? 0.379 0.354 0.316 -0.016 -0.008 -0.056 7028 PHE A CD2 
1928 C CE1 . PHE A 233 ? 0.423 0.383 0.345 -0.018 -0.004 -0.067 7028 PHE A CE1 
1929 C CE2 . PHE A 233 ? 0.407 0.377 0.343 -0.024 -0.006 -0.063 7028 PHE A CE2 
1930 C CZ  . PHE A 233 ? 0.422 0.383 0.350 -0.025 -0.005 -0.069 7028 PHE A CZ  
1931 N N   . TRP A 234 ? 0.304 0.256 0.247 -0.001 -0.001 -0.037 7029 TRP A N   
1932 C CA  . TRP A 234 ? 0.305 0.246 0.252 -0.003 0.000  -0.035 7029 TRP A CA  
1933 C C   . TRP A 234 ? 0.303 0.236 0.252 0.003  0.003  -0.033 7029 TRP A C   
1934 O O   . TRP A 234 ? 0.314 0.236 0.264 0.003  0.004  -0.036 7029 TRP A O   
1935 C CB  . TRP A 234 ? 0.300 0.243 0.250 -0.004 -0.001 -0.030 7029 TRP A CB  
1936 C CG  . TRP A 234 ? 0.299 0.228 0.250 -0.004 0.000  -0.026 7029 TRP A CG  
1937 C CD1 . TRP A 234 ? 0.312 0.228 0.262 -0.007 0.000  -0.028 7029 TRP A CD1 
1938 C CD2 . TRP A 234 ? 0.294 0.221 0.247 -0.001 -0.001 -0.020 7029 TRP A CD2 
1939 N NE1 . TRP A 234 ? 0.311 0.217 0.261 -0.006 -0.001 -0.023 7029 TRP A NE1 
1940 C CE2 . TRP A 234 ? 0.303 0.217 0.256 -0.002 -0.002 -0.018 7029 TRP A CE2 
1941 C CE3 . TRP A 234 ? 0.294 0.228 0.248 0.002  -0.002 -0.017 7029 TRP A CE3 
1942 C CZ2 . TRP A 234 ? 0.306 0.214 0.259 0.000  -0.004 -0.013 7029 TRP A CZ2 
1943 C CZ3 . TRP A 234 ? 0.296 0.225 0.251 0.004  -0.004 -0.012 7029 TRP A CZ3 
1944 C CH2 . TRP A 234 ? 0.300 0.218 0.255 0.003  -0.005 -0.010 7029 TRP A CH2 
1945 N N   . ARG A 235 ? 0.295 0.233 0.245 0.007  0.003  -0.029 7030 ARG A N   
1946 C CA  . ARG A 235 ? 0.299 0.233 0.253 0.011  0.005  -0.028 7030 ARG A CA  
1947 C C   . ARG A 235 ? 0.307 0.239 0.259 0.012  0.009  -0.034 7030 ARG A C   
1948 O O   . ARG A 235 ? 0.301 0.228 0.259 0.015  0.011  -0.036 7030 ARG A O   
1949 C CB  . ARG A 235 ? 0.291 0.231 0.245 0.013  0.006  -0.023 7030 ARG A CB  
1950 C CG  . ARG A 235 ? 0.287 0.227 0.242 0.013  0.002  -0.018 7030 ARG A CG  
1951 C CD  . ARG A 235 ? 0.295 0.228 0.256 0.013  0.001  -0.016 7030 ARG A CD  
1952 N NE  . ARG A 235 ? 0.299 0.230 0.267 0.016  0.002  -0.017 7030 ARG A NE  
1953 C CZ  . ARG A 235 ? 0.302 0.237 0.275 0.018  0.002  -0.015 7030 ARG A CZ  
1954 N NH1 . ARG A 235 ? 0.290 0.228 0.260 0.016  0.002  -0.011 7030 ARG A NH1 
1955 N NH2 . ARG A 235 ? 0.319 0.255 0.301 0.021  0.003  -0.016 7030 ARG A NH2 
1956 N N   . ASN A 236 ? 0.317 0.253 0.260 0.010  0.010  -0.038 7031 ASN A N   
1957 C CA  . ASN A 236 ? 0.332 0.266 0.271 0.010  0.014  -0.045 7031 ASN A CA  
1958 C C   . ASN A 236 ? 0.347 0.272 0.288 0.008  0.015  -0.051 7031 ASN A C   
1959 O O   . ASN A 236 ? 0.346 0.267 0.287 0.010  0.019  -0.057 7031 ASN A O   
1960 C CB  . ASN A 236 ? 0.348 0.289 0.275 0.007  0.013  -0.047 7031 ASN A CB  
1961 C CG  . ASN A 236 ? 0.351 0.296 0.272 0.009  0.014  -0.042 7031 ASN A CG  
1962 O OD1 . ASN A 236 ? 0.365 0.309 0.292 0.011  0.017  -0.039 7031 ASN A OD1 
1963 N ND2 . ASN A 236 ? 0.352 0.301 0.260 0.008  0.012  -0.042 7031 ASN A ND2 
1964 N N   . THR A 237 ? 0.347 0.268 0.289 0.004  0.011  -0.050 7032 THR A N   
1965 C CA  . THR A 237 ? 0.373 0.281 0.312 0.001  0.012  -0.056 7032 THR A CA  
1966 C C   . THR A 237 ? 0.398 0.292 0.343 0.002  0.011  -0.053 7032 THR A C   
1967 O O   . THR A 237 ? 0.431 0.311 0.373 0.000  0.012  -0.058 7032 THR A O   
1968 C CB  . THR A 237 ? 0.381 0.294 0.315 -0.007 0.009  -0.060 7032 THR A CB  
1969 O OG1 . THR A 237 ? 0.355 0.275 0.292 -0.009 0.006  -0.054 7032 THR A OG1 
1970 C CG2 . THR A 237 ? 0.391 0.316 0.317 -0.008 0.009  -0.064 7032 THR A CG2 
1971 N N   . ASN A 238 ? 0.600 0.472 0.408 0.069  -0.071 -0.153 7033 ASN A N   
1972 C CA  . ASN A 238 ? 0.621 0.472 0.451 0.062  -0.072 -0.150 7033 ASN A CA  
1973 C C   . ASN A 238 ? 0.586 0.442 0.419 0.068  -0.058 -0.136 7033 ASN A C   
1974 O O   . ASN A 238 ? 0.565 0.429 0.405 0.062  -0.052 -0.118 7033 ASN A O   
1975 C CB  . ASN A 238 ? 0.648 0.490 0.496 0.044  -0.080 -0.144 7033 ASN A CB  
1976 C CG  . ASN A 238 ? 0.721 0.550 0.573 0.037  -0.094 -0.162 7033 ASN A CG  
1977 O OD1 . ASN A 238 ? 0.812 0.647 0.670 0.026  -0.101 -0.162 7033 ASN A OD1 
1978 N ND2 . ASN A 238 ? 0.751 0.561 0.600 0.044  -0.099 -0.178 7033 ASN A ND2 
1979 N N   . PRO A 239 ? 0.600 0.454 0.429 0.082  -0.053 -0.145 7034 PRO A N   
1980 C CA  . PRO A 239 ? 0.597 0.461 0.432 0.089  -0.040 -0.133 7034 PRO A CA  
1981 C C   . PRO A 239 ? 0.567 0.416 0.425 0.079  -0.042 -0.120 7034 PRO A C   
1982 O O   . PRO A 239 ? 0.581 0.409 0.449 0.072  -0.052 -0.125 7034 PRO A O   
1983 C CB  . PRO A 239 ? 0.630 0.491 0.461 0.105  -0.037 -0.150 7034 PRO A CB  
1984 C CG  . PRO A 239 ? 0.671 0.526 0.485 0.109  -0.046 -0.171 7034 PRO A CG  
1985 C CD  . PRO A 239 ? 0.653 0.497 0.472 0.092  -0.059 -0.169 7034 PRO A CD  
1986 N N   . ILE A 240 ? 0.535 0.397 0.399 0.076  -0.032 -0.103 7035 ILE A N   
1987 C CA  . ILE A 240 ? 0.510 0.362 0.393 0.068  -0.034 -0.089 7035 ILE A CA  
1988 C C   . ILE A 240 ? 0.513 0.372 0.407 0.079  -0.027 -0.088 7035 ILE A C   
1989 O O   . ILE A 240 ? 0.522 0.403 0.412 0.086  -0.016 -0.085 7035 ILE A O   
1990 C CB  . ILE A 240 ? 0.485 0.347 0.369 0.056  -0.031 -0.073 7035 ILE A CB  
1991 C CG1 . ILE A 240 ? 0.483 0.341 0.359 0.047  -0.038 -0.076 7035 ILE A CG1 
1992 C CG2 . ILE A 240 ? 0.473 0.326 0.372 0.048  -0.032 -0.060 7035 ILE A CG2 
1993 C CD1 . ILE A 240 ? 0.463 0.333 0.338 0.039  -0.035 -0.063 7035 ILE A CD1 
1994 N N   . GLN A 241 ? 0.518 0.358 0.425 0.081  -0.034 -0.091 7036 GLN A N   
1995 C CA  . GLN A 241 ? 0.526 0.371 0.448 0.092  -0.029 -0.090 7036 GLN A CA  
1996 C C   . GLN A 241 ? 0.476 0.335 0.409 0.085  -0.024 -0.072 7036 GLN A C   
1997 O O   . GLN A 241 ? 0.460 0.309 0.395 0.072  -0.030 -0.061 7036 GLN A O   
1998 C CB  . GLN A 241 ? 0.571 0.388 0.505 0.096  -0.041 -0.097 7036 GLN A CB  
1999 C CG  . GLN A 241 ? 0.600 0.419 0.553 0.105  -0.040 -0.093 7036 GLN A CG  
2000 C CD  . GLN A 241 ? 0.652 0.440 0.614 0.111  -0.052 -0.099 7036 GLN A CD  
2001 O OE1 . GLN A 241 ? 0.705 0.473 0.660 0.113  -0.059 -0.114 7036 GLN A OE1 
2002 N NE2 . GLN A 241 ? 0.664 0.449 0.644 0.114  -0.057 -0.089 7036 GLN A NE2 
2003 N N   . LEU A 242 ? 0.458 0.342 0.398 0.093  -0.013 -0.069 7037 LEU A N   
2004 C CA  . LEU A 242 ? 0.436 0.334 0.390 0.087  -0.009 -0.052 7037 LEU A CA  
2005 C C   . LEU A 242 ? 0.432 0.313 0.402 0.085  -0.020 -0.048 7037 LEU A C   
2006 O O   . LEU A 242 ? 0.440 0.312 0.419 0.097  -0.025 -0.058 7037 LEU A O   
2007 C CB  . LEU A 242 ? 0.438 0.364 0.401 0.096  0.005  -0.052 7037 LEU A CB  
2008 C CG  . LEU A 242 ? 0.442 0.388 0.389 0.094  0.017  -0.048 7037 LEU A CG  
2009 C CD1 . LEU A 242 ? 0.417 0.366 0.366 0.080  0.018  -0.032 7037 LEU A CD1 
2010 C CD2 . LEU A 242 ? 0.467 0.402 0.389 0.096  0.014  -0.059 7037 LEU A CD2 
2011 N N   . SER A 243 ? 0.407 0.285 0.381 0.073  -0.024 -0.034 7038 SER A N   
2012 C CA  . SER A 243 ? 0.409 0.271 0.395 0.071  -0.036 -0.029 7038 SER A CA  
2013 C C   . SER A 243 ? 0.383 0.252 0.373 0.060  -0.037 -0.014 7038 SER A C   
2014 O O   . SER A 243 ? 0.372 0.243 0.351 0.048  -0.035 -0.009 7038 SER A O   
2015 C CB  . SER A 243 ? 0.432 0.264 0.409 0.067  -0.046 -0.032 7038 SER A CB  
2016 O OG  . SER A 243 ? 0.442 0.258 0.426 0.065  -0.057 -0.024 7038 SER A OG  
2017 N N   . SER A 244 ? 0.381 0.254 0.389 0.064  -0.043 -0.009 7039 SER A N   
2018 C CA  . SER A 244 ? 0.376 0.254 0.388 0.054  -0.048 0.003  7039 SER A CA  
2019 C C   . SER A 244 ? 0.384 0.238 0.394 0.051  -0.062 0.009  7039 SER A C   
2020 O O   . SER A 244 ? 0.375 0.231 0.387 0.045  -0.069 0.018  7039 SER A O   
2021 C CB  . SER A 244 ? 0.372 0.276 0.407 0.059  -0.044 0.005  7039 SER A CB  
2022 O OG  . SER A 244 ? 0.395 0.301 0.448 0.074  -0.049 0.000  7039 SER A OG  
2023 N N   . TYR A 245 ? 0.407 0.238 0.411 0.056  -0.068 0.003  7040 TYR A N   
2024 C CA  . TYR A 245 ? 0.429 0.234 0.430 0.055  -0.082 0.010  7040 TYR A CA  
2025 C C   . TYR A 245 ? 0.422 0.220 0.408 0.039  -0.086 0.023  7040 TYR A C   
2026 O O   . TYR A 245 ? 0.418 0.210 0.405 0.038  -0.096 0.032  7040 TYR A O   
2027 C CB  . TYR A 245 ? 0.462 0.240 0.457 0.059  -0.086 0.003  7040 TYR A CB  
2028 C CG  . TYR A 245 ? 0.488 0.269 0.496 0.076  -0.083 -0.011 7040 TYR A CG  
2029 C CD1 . TYR A 245 ? 0.483 0.288 0.511 0.090  -0.080 -0.014 7040 TYR A CD1 
2030 C CD2 . TYR A 245 ? 0.521 0.279 0.522 0.080  -0.086 -0.021 7040 TYR A CD2 
2031 C CE1 . TYR A 245 ? 0.500 0.309 0.538 0.107  -0.077 -0.028 7040 TYR A CE1 
2032 C CE2 . TYR A 245 ? 0.549 0.307 0.560 0.097  -0.084 -0.036 7040 TYR A CE2 
2033 C CZ  . TYR A 245 ? 0.537 0.322 0.566 0.111  -0.079 -0.040 7040 TYR A CZ  
2034 O OH  . TYR A 245 ? 0.550 0.338 0.589 0.129  -0.076 -0.056 7040 TYR A OH  
2035 N N   . SER A 246 ? 0.407 0.207 0.378 0.027  -0.078 0.022  7041 SER A N   
2036 C CA  . SER A 246 ? 0.416 0.209 0.372 0.013  -0.081 0.032  7041 SER A CA  
2037 C C   . SER A 246 ? 0.410 0.220 0.371 0.011  -0.083 0.039  7041 SER A C   
2038 O O   . SER A 246 ? 0.424 0.227 0.372 0.002  -0.088 0.047  7041 SER A O   
2039 C CB  . SER A 246 ? 0.407 0.201 0.350 0.003  -0.072 0.029  7041 SER A CB  
2040 O OG  . SER A 246 ? 0.372 0.189 0.318 0.003  -0.063 0.027  7041 SER A OG  
2041 N N   . LEU A 247 ? 0.395 0.226 0.373 0.018  -0.079 0.035  7042 LEU A N   
2042 C CA  . LEU A 247 ? 0.396 0.244 0.381 0.014  -0.081 0.039  7042 LEU A CA  
2043 C C   . LEU A 247 ? 0.416 0.258 0.406 0.018  -0.096 0.046  7042 LEU A C   
2044 O O   . LEU A 247 ? 0.407 0.257 0.396 0.012  -0.101 0.051  7042 LEU A O   
2045 C CB  . LEU A 247 ? 0.387 0.259 0.392 0.020  -0.073 0.034  7042 LEU A CB  
2046 C CG  . LEU A 247 ? 0.389 0.269 0.389 0.019  -0.059 0.029  7042 LEU A CG  
2047 C CD1 . LEU A 247 ? 0.383 0.289 0.404 0.024  -0.050 0.027  7042 LEU A CD1 
2048 C CD2 . LEU A 247 ? 0.385 0.261 0.369 0.006  -0.055 0.032  7042 LEU A CD2 
2049 N N   . PHE A 248 ? 0.433 0.260 0.427 0.027  -0.103 0.046  7043 PHE A N   
2050 C CA  . PHE A 248 ? 0.466 0.288 0.467 0.034  -0.118 0.053  7043 PHE A CA  
2051 C C   . PHE A 248 ? 0.510 0.309 0.486 0.025  -0.128 0.064  7043 PHE A C   
2052 O O   . PHE A 248 ? 0.557 0.351 0.534 0.029  -0.142 0.072  7043 PHE A O   
2053 C CB  . PHE A 248 ? 0.470 0.288 0.490 0.050  -0.122 0.048  7043 PHE A CB  
2054 C CG  . PHE A 248 ? 0.445 0.294 0.493 0.060  -0.114 0.039  7043 PHE A CG  
2055 C CD1 . PHE A 248 ? 0.438 0.295 0.487 0.062  -0.099 0.030  7043 PHE A CD1 
2056 C CD2 . PHE A 248 ? 0.448 0.318 0.519 0.067  -0.122 0.041  7043 PHE A CD2 
2057 C CE1 . PHE A 248 ? 0.423 0.310 0.496 0.071  -0.090 0.023  7043 PHE A CE1 
2058 C CE2 . PHE A 248 ? 0.432 0.334 0.531 0.075  -0.113 0.034  7043 PHE A CE2 
2059 C CZ  . PHE A 248 ? 0.422 0.332 0.521 0.076  -0.096 0.025  7043 PHE A CZ  
2060 N N   . ASP A 249 ? 0.530 0.315 0.484 0.013  -0.121 0.066  7044 ASP A N   
2061 C CA  . ASP A 249 ? 0.563 0.328 0.492 0.004  -0.127 0.077  7044 ASP A CA  
2062 C C   . ASP A 249 ? 0.529 0.304 0.442 -0.009 -0.119 0.077  7044 ASP A C   
2063 O O   . ASP A 249 ? 0.521 0.294 0.426 -0.016 -0.108 0.073  7044 ASP A O   
2064 C CB  . ASP A 249 ? 0.616 0.353 0.535 0.002  -0.128 0.081  7044 ASP A CB  
2065 C CG  . ASP A 249 ? 0.655 0.371 0.549 -0.007 -0.135 0.096  7044 ASP A CG  
2066 O OD1 . ASP A 249 ? 0.659 0.383 0.539 -0.013 -0.138 0.101  7044 ASP A OD1 
2067 O OD2 . ASP A 249 ? 0.751 0.441 0.639 -0.009 -0.138 0.102  7044 ASP A OD2 
2068 N N   . MET A 250 ? 0.518 0.304 0.427 -0.012 -0.126 0.080  7045 MET A N   
2069 C CA  . MET A 250 ? 0.499 0.294 0.394 -0.023 -0.119 0.077  7045 MET A CA  
2070 C C   . MET A 250 ? 0.522 0.305 0.388 -0.031 -0.124 0.087  7045 MET A C   
2071 O O   . MET A 250 ? 0.507 0.296 0.358 -0.039 -0.120 0.084  7045 MET A O   
2072 C CB  . MET A 250 ? 0.490 0.307 0.401 -0.021 -0.123 0.072  7045 MET A CB  
2073 C CG  . MET A 250 ? 0.466 0.299 0.404 -0.015 -0.115 0.064  7045 MET A CG  
2074 S SD  . MET A 250 ? 0.437 0.272 0.368 -0.021 -0.097 0.057  7045 MET A SD  
2075 C CE  . MET A 250 ? 0.446 0.289 0.367 -0.031 -0.096 0.055  7045 MET A CE  
2076 N N   . SER A 251 ? 0.555 0.316 0.409 -0.030 -0.132 0.097  7046 SER A N   
2077 C CA  . SER A 251 ? 0.606 0.355 0.429 -0.038 -0.136 0.109  7046 SER A CA  
2078 C C   . SER A 251 ? 0.615 0.365 0.419 -0.051 -0.122 0.107  7046 SER A C   
2079 O O   . SER A 251 ? 0.662 0.415 0.443 -0.057 -0.122 0.110  7046 SER A O   
2080 C CB  . SER A 251 ? 0.633 0.357 0.449 -0.035 -0.146 0.122  7046 SER A CB  
2081 O OG  . SER A 251 ? 0.647 0.357 0.472 -0.036 -0.138 0.121  7046 SER A OG  
2082 N N   . LYS A 252 ? 0.607 0.356 0.421 -0.054 -0.109 0.102  7047 LYS A N   
2083 C CA  . LYS A 252 ? 0.639 0.394 0.438 -0.065 -0.096 0.100  7047 LYS A CA  
2084 C C   . LYS A 252 ? 0.582 0.356 0.394 -0.064 -0.086 0.086  7047 LYS A C   
2085 O O   . LYS A 252 ? 0.597 0.376 0.409 -0.069 -0.075 0.082  7047 LYS A O   
2086 C CB  . LYS A 252 ? 0.702 0.442 0.500 -0.071 -0.090 0.105  7047 LYS A CB  
2087 C CG  . LYS A 252 ? 0.782 0.497 0.565 -0.074 -0.099 0.122  7047 LYS A CG  
2088 C CD  . LYS A 252 ? 0.844 0.543 0.628 -0.082 -0.094 0.128  7047 LYS A CD  
2089 C CE  . LYS A 252 ? 0.917 0.589 0.685 -0.085 -0.104 0.146  7047 LYS A CE  
2090 N NZ  . LYS A 252 ? 0.982 0.635 0.752 -0.095 -0.098 0.152  7047 LYS A NZ  
2091 N N   . PHE A 253 ? 0.541 0.327 0.364 -0.057 -0.091 0.079  7048 PHE A N   
2092 C CA  . PHE A 253 ? 0.498 0.300 0.336 -0.056 -0.083 0.068  7048 PHE A CA  
2093 C C   . PHE A 253 ? 0.495 0.304 0.318 -0.062 -0.075 0.063  7048 PHE A C   
2094 O O   . PHE A 253 ? 0.469 0.285 0.298 -0.063 -0.065 0.056  7048 PHE A O   
2095 C CB  . PHE A 253 ? 0.469 0.281 0.326 -0.049 -0.089 0.064  7048 PHE A CB  
2096 C CG  . PHE A 253 ? 0.427 0.252 0.298 -0.048 -0.081 0.054  7048 PHE A CG  
2097 C CD1 . PHE A 253 ? 0.412 0.239 0.294 -0.044 -0.072 0.051  7048 PHE A CD1 
2098 C CD2 . PHE A 253 ? 0.418 0.251 0.289 -0.050 -0.082 0.050  7048 PHE A CD2 
2099 C CE1 . PHE A 253 ? 0.388 0.226 0.280 -0.043 -0.064 0.044  7048 PHE A CE1 
2100 C CE2 . PHE A 253 ? 0.406 0.248 0.290 -0.049 -0.074 0.043  7048 PHE A CE2 
2101 C CZ  . PHE A 253 ? 0.387 0.231 0.281 -0.046 -0.065 0.041  7048 PHE A CZ  
2102 N N   . PRO A 254 ? 0.519 0.327 0.323 -0.066 -0.080 0.064  7049 PRO A N   
2103 C CA  . PRO A 254 ? 0.522 0.338 0.313 -0.070 -0.073 0.057  7049 PRO A CA  
2104 C C   . PRO A 254 ? 0.519 0.337 0.302 -0.075 -0.060 0.056  7049 PRO A C   
2105 O O   . PRO A 254 ? 0.516 0.327 0.290 -0.079 -0.058 0.065  7049 PRO A O   
2106 C CB  . PRO A 254 ? 0.575 0.388 0.342 -0.072 -0.083 0.060  7049 PRO A CB  
2107 C CG  . PRO A 254 ? 0.577 0.384 0.351 -0.068 -0.098 0.068  7049 PRO A CG  
2108 C CD  . PRO A 254 ? 0.562 0.363 0.354 -0.065 -0.094 0.073  7049 PRO A CD  
2109 N N   . LEU A 255 ? 0.494 0.322 0.283 -0.074 -0.051 0.046  7050 LEU A N   
2110 C CA  . LEU A 255 ? 0.503 0.338 0.289 -0.077 -0.038 0.043  7050 LEU A CA  
2111 C C   . LEU A 255 ? 0.538 0.373 0.297 -0.084 -0.035 0.046  7050 LEU A C   
2112 O O   . LEU A 255 ? 0.547 0.382 0.292 -0.083 -0.040 0.042  7050 LEU A O   
2113 C CB  . LEU A 255 ? 0.480 0.324 0.276 -0.073 -0.032 0.031  7050 LEU A CB  
2114 C CG  . LEU A 255 ? 0.475 0.330 0.271 -0.074 -0.019 0.026  7050 LEU A CG  
2115 C CD1 . LEU A 255 ? 0.470 0.326 0.278 -0.077 -0.016 0.032  7050 LEU A CD1 
2116 C CD2 . LEU A 255 ? 0.463 0.325 0.270 -0.068 -0.016 0.016  7050 LEU A CD2 
2117 N N   . LYS A 256 ? 0.576 0.412 0.328 -0.090 -0.028 0.054  7051 LYS A N   
2118 C CA  . LYS A 256 ? 0.643 0.480 0.367 -0.097 -0.023 0.059  7051 LYS A CA  
2119 C C   . LYS A 256 ? 0.631 0.483 0.348 -0.096 -0.012 0.046  7051 LYS A C   
2120 O O   . LYS A 256 ? 0.579 0.443 0.314 -0.094 -0.003 0.039  7051 LYS A O   
2121 C CB  . LYS A 256 ? 0.723 0.556 0.444 -0.107 -0.018 0.072  7051 LYS A CB  
2122 C CG  . LYS A 256 ? 0.798 0.611 0.523 -0.107 -0.029 0.084  7051 LYS A CG  
2123 C CD  . LYS A 256 ? 0.881 0.685 0.602 -0.117 -0.025 0.098  7051 LYS A CD  
2124 C CE  . LYS A 256 ? 0.938 0.719 0.664 -0.115 -0.038 0.109  7051 LYS A CE  
2125 N NZ  . LYS A 256 ? 1.001 0.769 0.721 -0.127 -0.035 0.124  7051 LYS A NZ  
2126 N N   . LEU A 257 ? 0.651 0.504 0.343 -0.095 -0.014 0.043  7052 LEU A N   
2127 C CA  . LEU A 257 ? 0.657 0.523 0.340 -0.093 -0.004 0.029  7052 LEU A CA  
2128 C C   . LEU A 257 ? 0.665 0.545 0.338 -0.100 0.012  0.034  7052 LEU A C   
2129 O O   . LEU A 257 ? 0.693 0.573 0.337 -0.106 0.014  0.041  7052 LEU A O   
2130 C CB  . LEU A 257 ? 0.703 0.565 0.362 -0.090 -0.012 0.023  7052 LEU A CB  
2131 C CG  . LEU A 257 ? 0.723 0.596 0.368 -0.086 -0.003 0.007  7052 LEU A CG  
2132 C CD1 . LEU A 257 ? 0.697 0.577 0.370 -0.079 0.004  -0.006 7052 LEU A CD1 
2133 C CD2 . LEU A 257 ? 0.748 0.613 0.370 -0.083 -0.015 -0.002 7052 LEU A CD2 
2134 N N   . ARG A 258 ? 0.630 0.522 0.327 -0.100 0.022  0.030  7053 ARG A N   
2135 C CA  . ARG A 258 ? 0.633 0.544 0.329 -0.108 0.039  0.034  7053 ARG A CA  
2136 C C   . ARG A 258 ? 0.627 0.554 0.306 -0.105 0.051  0.022  7053 ARG A C   
2137 O O   . ARG A 258 ? 0.624 0.567 0.293 -0.113 0.064  0.027  7053 ARG A O   
2138 C CB  . ARG A 258 ? 0.621 0.543 0.351 -0.108 0.044  0.031  7053 ARG A CB  
2139 C CG  . ARG A 258 ? 0.637 0.543 0.385 -0.110 0.033  0.039  7053 ARG A CG  
2140 C CD  . ARG A 258 ? 0.633 0.551 0.412 -0.109 0.037  0.034  7053 ARG A CD  
2141 N NE  . ARG A 258 ? 0.680 0.616 0.465 -0.119 0.050  0.038  7053 ARG A NE  
2142 C CZ  . ARG A 258 ? 0.695 0.645 0.506 -0.121 0.054  0.034  7053 ARG A CZ  
2143 N NH1 . ARG A 258 ? 0.636 0.586 0.468 -0.111 0.047  0.026  7053 ARG A NH1 
2144 N NH2 . ARG A 258 ? 0.713 0.681 0.531 -0.132 0.066  0.038  7053 ARG A NH2 
2145 N N   . GLY A 259 ? 0.595 0.522 0.274 -0.094 0.046  0.006  7054 GLY A N   
2146 C CA  . GLY A 259 ? 0.611 0.553 0.275 -0.088 0.058  -0.008 7054 GLY A CA  
2147 C C   . GLY A 259 ? 0.591 0.558 0.278 -0.087 0.073  -0.014 7054 GLY A C   
2148 O O   . GLY A 259 ? 0.602 0.589 0.276 -0.088 0.088  -0.018 7054 GLY A O   
2149 N N   . THR A 260 ? 0.548 0.515 0.268 -0.083 0.070  -0.015 7055 THR A N   
2150 C CA  . THR A 260 ? 0.529 0.521 0.276 -0.081 0.081  -0.021 7055 THR A CA  
2151 C C   . THR A 260 ? 0.540 0.549 0.285 -0.069 0.091  -0.039 7055 THR A C   
2152 O O   . THR A 260 ? 0.542 0.536 0.281 -0.058 0.084  -0.051 7055 THR A O   
2153 C CB  . THR A 260 ? 0.495 0.480 0.272 -0.075 0.072  -0.022 7055 THR A CB  
2154 O OG1 . THR A 260 ? 0.482 0.450 0.260 -0.084 0.062  -0.007 7055 THR A OG1 
2155 C CG2 . THR A 260 ? 0.482 0.492 0.288 -0.072 0.081  -0.028 7055 THR A CG2 
2156 N N   . ALA A 261 ? 0.549 0.587 0.303 -0.071 0.108  -0.042 7056 ALA A N   
2157 C CA  . ALA A 261 ? 0.565 0.624 0.321 -0.059 0.119  -0.061 7056 ALA A CA  
2158 C C   . ALA A 261 ? 0.552 0.605 0.333 -0.043 0.112  -0.074 7056 ALA A C   
2159 O O   . ALA A 261 ? 0.511 0.564 0.319 -0.043 0.105  -0.068 7056 ALA A O   
2160 C CB  . ALA A 261 ? 0.579 0.673 0.345 -0.065 0.139  -0.060 7056 ALA A CB  
2161 N N   . VAL A 262 ? 0.570 0.620 0.342 -0.029 0.113  -0.091 7057 VAL A N   
2162 C CA  . VAL A 262 ? 0.573 0.616 0.366 -0.012 0.106  -0.104 7057 VAL A CA  
2163 C C   . VAL A 262 ? 0.609 0.680 0.411 0.001  0.121  -0.122 7057 VAL A C   
2164 O O   . VAL A 262 ? 0.624 0.698 0.400 0.003  0.129  -0.132 7057 VAL A O   
2165 C CB  . VAL A 262 ? 0.590 0.598 0.367 -0.006 0.091  -0.110 7057 VAL A CB  
2166 C CG1 . VAL A 262 ? 0.587 0.585 0.383 0.011  0.086  -0.124 7057 VAL A CG1 
2167 C CG2 . VAL A 262 ? 0.567 0.551 0.340 -0.018 0.077  -0.094 7057 VAL A CG2 
2168 N N   . MET A 263 ? 0.620 0.710 0.454 0.009  0.124  -0.125 7058 MET A N   
2169 C CA  . MET A 263 ? 0.658 0.778 0.506 0.023  0.138  -0.143 7058 MET A CA  
2170 C C   . MET A 263 ? 0.648 0.760 0.522 0.043  0.129  -0.153 7058 MET A C   
2171 O O   . MET A 263 ? 0.580 0.679 0.471 0.042  0.116  -0.143 7058 MET A O   
2172 C CB  . MET A 263 ? 0.689 0.852 0.558 0.015  0.153  -0.137 7058 MET A CB  
2173 C CG  . MET A 263 ? 0.735 0.907 0.580 -0.006 0.164  -0.124 7058 MET A CG  
2174 S SD  . MET A 263 ? 0.781 1.002 0.656 -0.019 0.182  -0.116 7058 MET A SD  
2175 C CE  . MET A 263 ? 0.810 1.071 0.700 0.001  0.200  -0.139 7058 MET A CE  
2176 N N   . SER A 264 ? 0.670 0.789 0.546 0.061  0.135  -0.173 7059 SER A N   
2177 C CA  . SER A 264 ? 0.706 0.816 0.606 0.082  0.126  -0.184 7059 SER A CA  
2178 C C   . SER A 264 ? 0.731 0.886 0.666 0.092  0.137  -0.190 7059 SER A C   
2179 O O   . SER A 264 ? 0.798 0.969 0.738 0.108  0.147  -0.208 7059 SER A O   
2180 C CB  . SER A 264 ? 0.731 0.814 0.613 0.097  0.123  -0.202 7059 SER A CB  
2181 O OG  . SER A 264 ? 0.752 0.858 0.620 0.101  0.140  -0.218 7059 SER A OG  
2182 N N   . LEU A 265 ? 0.747 0.921 0.705 0.082  0.135  -0.176 7060 LEU A N   
2183 C CA  . LEU A 265 ? 0.795 1.015 0.790 0.089  0.144  -0.180 7060 LEU A CA  
2184 C C   . LEU A 265 ? 0.846 1.058 0.868 0.110  0.130  -0.185 7060 LEU A C   
2185 O O   . LEU A 265 ? 0.853 1.028 0.867 0.110  0.113  -0.176 7060 LEU A O   
2186 C CB  . LEU A 265 ? 0.766 1.010 0.774 0.068  0.147  -0.163 7060 LEU A CB  
2187 C CG  . LEU A 265 ? 0.775 1.029 0.759 0.046  0.162  -0.156 7060 LEU A CG  
2188 C CD1 . LEU A 265 ? 0.747 1.014 0.744 0.025  0.161  -0.138 7060 LEU A CD1 
2189 C CD2 . LEU A 265 ? 0.798 1.092 0.786 0.052  0.184  -0.170 7060 LEU A CD2 
2190 N N   . LYS A 266 ? 0.932 1.179 0.985 0.127  0.137  -0.198 7061 LYS A N   
2191 C CA  . LYS A 266 ? 0.999 1.243 1.079 0.149  0.123  -0.202 7061 LYS A CA  
2192 C C   . LYS A 266 ? 1.023 1.283 1.127 0.140  0.113  -0.187 7061 LYS A C   
2193 O O   . LYS A 266 ? 1.039 1.320 1.144 0.118  0.120  -0.178 7061 LYS A O   
2194 C CB  . LYS A 266 ? 1.042 1.321 1.148 0.171  0.134  -0.222 7061 LYS A CB  
2195 C CG  . LYS A 266 ? 1.096 1.366 1.181 0.182  0.146  -0.241 7061 LYS A CG  
2196 C CD  . LYS A 266 ? 1.116 1.424 1.229 0.206  0.157  -0.262 7061 LYS A CD  
2197 C CE  . LYS A 266 ? 1.166 1.467 1.254 0.216  0.171  -0.283 7061 LYS A CE  
2198 N NZ  . LYS A 266 ? 1.184 1.424 1.245 0.225  0.156  -0.287 7061 LYS A NZ  
2199 N N   . GLU A 267 ? 1.068 1.318 1.189 0.155  0.097  -0.185 7062 GLU A N   
2200 C CA  . GLU A 267 ? 1.076 1.340 1.218 0.149  0.085  -0.172 7062 GLU A CA  
2201 C C   . GLU A 267 ? 1.044 1.368 1.223 0.146  0.095  -0.178 7062 GLU A C   
2202 O O   . GLU A 267 ? 1.044 1.385 1.236 0.132  0.090  -0.168 7062 GLU A O   
2203 C CB  . GLU A 267 ? 1.121 1.361 1.270 0.168  0.065  -0.169 7062 GLU A CB  
2204 C CG  . GLU A 267 ? 1.154 1.337 1.270 0.167  0.055  -0.160 7062 GLU A CG  
2205 C CD  . GLU A 267 ? 1.195 1.352 1.315 0.185  0.037  -0.154 7062 GLU A CD  
2206 O OE1 . GLU A 267 ? 1.211 1.388 1.357 0.205  0.032  -0.161 7062 GLU A OE1 
2207 O OE2 . GLU A 267 ? 1.232 1.350 1.330 0.178  0.027  -0.141 7062 GLU A OE2 
2208 N N   . GLY A 268 ? 1.026 1.380 1.221 0.160  0.109  -0.195 7063 GLY A N   
2209 C CA  . GLY A 268 ? 0.993 1.410 1.229 0.159  0.120  -0.201 7063 GLY A CA  
2210 C C   . GLY A 268 ? 0.968 1.410 1.196 0.133  0.141  -0.198 7063 GLY A C   
2211 O O   . GLY A 268 ? 0.979 1.474 1.240 0.128  0.153  -0.202 7063 GLY A O   
2212 N N   . GLN A 269 ? 0.948 1.354 1.135 0.117  0.145  -0.189 7064 GLN A N   
2213 C CA  . GLN A 269 ? 0.921 1.345 1.094 0.092  0.164  -0.184 7064 GLN A CA  
2214 C C   . GLN A 269 ? 0.879 1.285 1.042 0.066  0.155  -0.164 7064 GLN A C   
2215 O O   . GLN A 269 ? 0.900 1.318 1.054 0.043  0.168  -0.156 7064 GLN A O   
2216 C CB  . GLN A 269 ? 0.941 1.340 1.073 0.093  0.175  -0.190 7064 GLN A CB  
2217 C CG  . GLN A 269 ? 0.964 1.380 1.104 0.119  0.185  -0.212 7064 GLN A CG  
2218 C CD  . GLN A 269 ? 0.982 1.369 1.080 0.121  0.193  -0.220 7064 GLN A CD  
2219 O OE1 . GLN A 269 ? 0.964 1.313 1.025 0.107  0.188  -0.209 7064 GLN A OE1 
2220 N NE2 . GLN A 269 ? 1.028 1.434 1.130 0.141  0.206  -0.240 7064 GLN A NE2 
2221 N N   A ILE A 270 ? 0.845 1.222 1.008 0.070  0.133  -0.156 7065 ILE A N   
2222 N N   B ILE A 270 ? 0.840 1.217 1.003 0.070  0.133  -0.156 7065 ILE A N   
2223 C CA  A ILE A 270 ? 0.811 1.169 0.964 0.048  0.123  -0.140 7065 ILE A CA  
2224 C CA  B ILE A 270 ? 0.803 1.161 0.956 0.048  0.123  -0.140 7065 ILE A CA  
2225 C C   A ILE A 270 ? 0.786 1.187 0.977 0.035  0.125  -0.137 7065 ILE A C   
2226 C C   B ILE A 270 ? 0.781 1.183 0.972 0.035  0.125  -0.137 7065 ILE A C   
2227 O O   A ILE A 270 ? 0.794 1.207 1.011 0.046  0.111  -0.140 7065 ILE A O   
2228 O O   B ILE A 270 ? 0.789 1.203 1.007 0.046  0.111  -0.140 7065 ILE A O   
2229 C CB  A ILE A 270 ? 0.798 1.113 0.938 0.057  0.102  -0.134 7065 ILE A CB  
2230 C CB  B ILE A 270 ? 0.784 1.099 0.924 0.057  0.102  -0.134 7065 ILE A CB  
2231 C CG1 A ILE A 270 ? 0.805 1.080 0.915 0.071  0.100  -0.138 7065 ILE A CG1 
2232 C CG1 B ILE A 270 ? 0.785 1.060 0.894 0.071  0.100  -0.138 7065 ILE A CG1 
2233 C CG2 A ILE A 270 ? 0.783 1.078 0.911 0.037  0.093  -0.118 7065 ILE A CG2 
2234 C CG2 B ILE A 270 ? 0.769 1.064 0.897 0.037  0.093  -0.118 7065 ILE A CG2 
2235 C CD1 A ILE A 270 ? 0.805 1.041 0.904 0.080  0.080  -0.132 7065 ILE A CD1 
2236 C CD1 B ILE A 270 ? 0.790 1.043 0.865 0.056  0.109  -0.133 7065 ILE A CD1 
2237 N N   . ASN A 271 ? 0.698 0.957 0.994 -0.015 0.137  -0.056 7066 ASN A N   
2238 C CA  . ASN A 271 ? 0.672 0.963 0.997 -0.033 0.129  -0.049 7066 ASN A CA  
2239 C C   . ASN A 271 ? 0.654 0.923 0.900 -0.051 0.109  -0.049 7066 ASN A C   
2240 O O   . ASN A 271 ? 0.665 0.900 0.849 -0.047 0.101  -0.052 7066 ASN A O   
2241 C CB  . ASN A 271 ? 0.674 0.973 1.033 -0.038 0.170  -0.063 7066 ASN A CB  
2242 C CG  . ASN A 271 ? 0.690 0.942 0.966 -0.046 0.198  -0.084 7066 ASN A CG  
2243 O OD1 . ASN A 271 ? 0.666 0.888 0.866 -0.053 0.183  -0.085 7066 ASN A OD1 
2244 N ND2 . ASN A 271 ? 0.705 0.949 0.999 -0.048 0.241  -0.101 7066 ASN A ND2 
2245 N N   . ASP A 272 ? 0.635 0.922 0.887 -0.071 0.104  -0.046 7067 ASP A N   
2246 C CA  . ASP A 272 ? 0.646 0.908 0.828 -0.091 0.091  -0.047 7067 ASP A CA  
2247 C C   . ASP A 272 ? 0.651 0.870 0.766 -0.091 0.115  -0.063 7067 ASP A C   
2248 O O   . ASP A 272 ? 0.643 0.830 0.699 -0.097 0.106  -0.063 7067 ASP A O   
2249 C CB  . ASP A 272 ? 0.666 0.957 0.873 -0.115 0.080  -0.040 7067 ASP A CB  
2250 C CG  . ASP A 272 ? 0.673 1.003 0.933 -0.122 0.044  -0.018 7067 ASP A CG  
2251 O OD1 . ASP A 272 ? 0.673 0.998 0.931 -0.110 0.024  -0.009 7067 ASP A OD1 
2252 O OD2 . ASP A 272 ? 0.707 1.071 1.009 -0.141 0.033  -0.009 7067 ASP A OD2 
2253 N N   . MET A 273 ? 0.641 0.857 0.766 -0.088 0.147  -0.075 7068 MET A N   
2254 C CA  . MET A 273 ? 0.678 0.849 0.735 -0.093 0.165  -0.085 7068 MET A CA  
2255 C C   . MET A 273 ? 0.616 0.758 0.634 -0.079 0.154  -0.084 7068 MET A C   
2256 O O   . MET A 273 ? 0.595 0.705 0.560 -0.084 0.150  -0.082 7068 MET A O   
2257 C CB  . MET A 273 ? 0.767 0.933 0.831 -0.097 0.201  -0.099 7068 MET A CB  
2258 C CG  . MET A 273 ? 0.853 0.970 0.840 -0.106 0.213  -0.105 7068 MET A CG  
2259 S SD  . MET A 273 ? 1.058 1.155 1.031 -0.119 0.258  -0.123 7068 MET A SD  
2260 C CE  . MET A 273 ? 1.091 1.130 0.963 -0.133 0.251  -0.120 7068 MET A CE  
2261 N N   . ILE A 274 ? 0.583 0.737 0.635 -0.062 0.152  -0.083 7069 ILE A N   
2262 C CA  . ILE A 274 ? 0.564 0.692 0.585 -0.049 0.143  -0.081 7069 ILE A CA  
2263 C C   . ILE A 274 ? 0.538 0.660 0.537 -0.049 0.115  -0.071 7069 ILE A C   
2264 O O   . ILE A 274 ? 0.541 0.633 0.496 -0.048 0.111  -0.069 7069 ILE A O   
2265 C CB  . ILE A 274 ? 0.566 0.707 0.632 -0.032 0.149  -0.083 7069 ILE A CB  
2266 C CG1 . ILE A 274 ? 0.600 0.741 0.689 -0.034 0.186  -0.097 7069 ILE A CG1 
2267 C CG2 . ILE A 274 ? 0.569 0.684 0.601 -0.020 0.138  -0.081 7069 ILE A CG2 
2268 C CD1 . ILE A 274 ? 0.633 0.731 0.653 -0.048 0.206  -0.109 7069 ILE A CD1 
2269 N N   . LEU A 275 ? 0.514 0.662 0.543 -0.053 0.097  -0.062 7070 LEU A N   
2270 C CA  . LEU A 275 ? 0.525 0.660 0.524 -0.059 0.076  -0.055 7070 LEU A CA  
2271 C C   . LEU A 275 ? 0.527 0.632 0.479 -0.072 0.084  -0.059 7070 LEU A C   
2272 O O   . LEU A 275 ? 0.513 0.590 0.433 -0.071 0.080  -0.057 7070 LEU A O   
2273 C CB  . LEU A 275 ? 0.521 0.685 0.551 -0.071 0.056  -0.045 7070 LEU A CB  
2274 C CG  . LEU A 275 ? 0.519 0.712 0.603 -0.058 0.041  -0.034 7070 LEU A CG  
2275 C CD1 . LEU A 275 ? 0.534 0.759 0.651 -0.076 0.015  -0.018 7070 LEU A CD1 
2276 C CD2 . LEU A 275 ? 0.519 0.690 0.579 -0.045 0.031  -0.031 7070 LEU A CD2 
2277 N N   . SER A 276 ? 0.541 0.650 0.493 -0.083 0.099  -0.064 7071 SER A N   
2278 C CA  . SER A 276 ? 0.555 0.634 0.467 -0.096 0.108  -0.065 7071 SER A CA  
2279 C C   . SER A 276 ? 0.541 0.588 0.424 -0.086 0.113  -0.064 7071 SER A C   
2280 O O   . SER A 276 ? 0.539 0.559 0.399 -0.088 0.112  -0.059 7071 SER A O   
2281 C CB  . SER A 276 ? 0.589 0.680 0.509 -0.111 0.121  -0.070 7071 SER A CB  
2282 O OG  . SER A 276 ? 0.640 0.701 0.524 -0.124 0.129  -0.070 7071 SER A OG  
2283 N N   . LEU A 277 ? 0.527 0.578 0.415 -0.078 0.120  -0.067 7072 LEU A N   
2284 C CA  . LEU A 277 ? 0.535 0.555 0.391 -0.073 0.119  -0.062 7072 LEU A CA  
2285 C C   . LEU A 277 ? 0.506 0.518 0.364 -0.060 0.104  -0.055 7072 LEU A C   
2286 O O   . LEU A 277 ? 0.511 0.499 0.353 -0.059 0.099  -0.046 7072 LEU A O   
2287 C CB  . LEU A 277 ? 0.550 0.570 0.401 -0.074 0.131  -0.069 7072 LEU A CB  
2288 C CG  . LEU A 277 ? 0.587 0.605 0.428 -0.091 0.152  -0.077 7072 LEU A CG  
2289 C CD1 . LEU A 277 ? 0.619 0.630 0.452 -0.093 0.171  -0.088 7072 LEU A CD1 
2290 C CD2 . LEU A 277 ? 0.619 0.607 0.418 -0.105 0.149  -0.067 7072 LEU A CD2 
2291 N N   . LEU A 278 ? 0.485 0.517 0.367 -0.050 0.097  -0.058 7073 LEU A N   
2292 C CA  . LEU A 278 ? 0.479 0.502 0.362 -0.039 0.085  -0.053 7073 LEU A CA  
2293 C C   . LEU A 278 ? 0.483 0.486 0.352 -0.045 0.085  -0.048 7073 LEU A C   
2294 O O   . LEU A 278 ? 0.475 0.458 0.339 -0.039 0.083  -0.042 7073 LEU A O   
2295 C CB  . LEU A 278 ? 0.468 0.514 0.377 -0.031 0.077  -0.054 7073 LEU A CB  
2296 C CG  . LEU A 278 ? 0.470 0.531 0.402 -0.021 0.082  -0.059 7073 LEU A CG  
2297 C CD1 . LEU A 278 ? 0.466 0.553 0.437 -0.014 0.072  -0.055 7073 LEU A CD1 
2298 C CD2 . LEU A 278 ? 0.472 0.511 0.385 -0.013 0.082  -0.059 7073 LEU A CD2 
2299 N N   . SER A 279 ? 0.504 0.514 0.372 -0.059 0.088  -0.052 7074 SER A N   
2300 C CA  . SER A 279 ? 0.534 0.519 0.384 -0.070 0.094  -0.052 7074 SER A CA  
2301 C C   . SER A 279 ? 0.557 0.513 0.398 -0.070 0.105  -0.046 7074 SER A C   
2302 O O   . SER A 279 ? 0.557 0.486 0.393 -0.074 0.115  -0.046 7074 SER A O   
2303 C CB  . SER A 279 ? 0.540 0.537 0.386 -0.090 0.093  -0.057 7074 SER A CB  
2304 O OG  . SER A 279 ? 0.539 0.564 0.400 -0.091 0.077  -0.055 7074 SER A OG  
2305 N N   . LYS A 280 ? 0.594 0.553 0.436 -0.068 0.106  -0.042 7075 LYS A N   
2306 C CA  . LYS A 280 ? 0.615 0.546 0.453 -0.070 0.111  -0.030 7075 LYS A CA  
2307 C C   . LYS A 280 ? 0.578 0.500 0.424 -0.058 0.100  -0.017 7075 LYS A C   
2308 O O   . LYS A 280 ? 0.608 0.512 0.458 -0.059 0.099  -0.002 7075 LYS A O   
2309 C CB  . LYS A 280 ? 0.678 0.611 0.502 -0.082 0.115  -0.030 7075 LYS A CB  
2310 C CG  . LYS A 280 ? 0.733 0.673 0.551 -0.097 0.126  -0.040 7075 LYS A CG  
2311 C CD  . LYS A 280 ? 0.794 0.731 0.597 -0.110 0.133  -0.038 7075 LYS A CD  
2312 C CE  . LYS A 280 ? 0.840 0.786 0.641 -0.127 0.144  -0.048 7075 LYS A CE  
2313 N NZ  . LYS A 280 ? 0.859 0.843 0.680 -0.128 0.141  -0.059 7075 LYS A NZ  
2314 N N   . GLY A 281 ? 0.529 0.465 0.382 -0.047 0.092  -0.020 7076 GLY A N   
2315 C CA  . GLY A 281 ? 0.525 0.454 0.385 -0.038 0.079  -0.008 7076 GLY A CA  
2316 C C   . GLY A 281 ? 0.539 0.467 0.378 -0.047 0.071  -0.002 7076 GLY A C   
2317 O O   . GLY A 281 ? 0.555 0.471 0.394 -0.047 0.057  0.014  7076 GLY A O   
2318 N N   . ARG A 282 ? 0.544 0.482 0.364 -0.056 0.079  -0.015 7077 ARG A N   
2319 C CA  . ARG A 282 ? 0.583 0.513 0.372 -0.070 0.078  -0.013 7077 ARG A CA  
2320 C C   . ARG A 282 ? 0.561 0.501 0.342 -0.067 0.082  -0.027 7077 ARG A C   
2321 O O   . ARG A 282 ? 0.580 0.508 0.329 -0.082 0.089  -0.031 7077 ARG A O   
2322 C CB  . ARG A 282 ? 0.636 0.564 0.410 -0.084 0.092  -0.018 7077 ARG A CB  
2323 C CG  . ARG A 282 ? 0.692 0.602 0.471 -0.089 0.089  -0.002 7077 ARG A CG  
2324 C CD  . ARG A 282 ? 0.760 0.668 0.525 -0.104 0.104  -0.009 7077 ARG A CD  
2325 N NE  . ARG A 282 ? 0.856 0.759 0.586 -0.120 0.110  -0.013 7077 ARG A NE  
2326 C CZ  . ARG A 282 ? 0.892 0.794 0.606 -0.136 0.126  -0.022 7077 ARG A CZ  
2327 N NH1 . ARG A 282 ? 0.886 0.796 0.619 -0.136 0.135  -0.026 7077 ARG A NH1 
2328 N NH2 . ARG A 282 ? 0.956 0.847 0.634 -0.153 0.136  -0.028 7077 ARG A NH2 
2329 N N   . LEU A 283 ? 0.522 0.478 0.328 -0.051 0.081  -0.034 7078 LEU A N   
2330 C CA  . LEU A 283 ? 0.523 0.485 0.327 -0.048 0.088  -0.047 7078 LEU A CA  
2331 C C   . LEU A 283 ? 0.479 0.449 0.305 -0.031 0.078  -0.046 7078 LEU A C   
2332 O O   . LEU A 283 ? 0.453 0.433 0.301 -0.022 0.073  -0.043 7078 LEU A O   
2333 C CB  . LEU A 283 ? 0.536 0.520 0.359 -0.049 0.107  -0.061 7078 LEU A CB  
2334 C CG  . LEU A 283 ? 0.545 0.536 0.381 -0.044 0.122  -0.075 7078 LEU A CG  
2335 C CD1 . LEU A 283 ? 0.604 0.565 0.395 -0.059 0.133  -0.080 7078 LEU A CD1 
2336 C CD2 . LEU A 283 ? 0.546 0.564 0.420 -0.043 0.139  -0.084 7078 LEU A CD2 
2337 N N   . ILE A 284 ? 0.477 0.437 0.290 -0.031 0.078  -0.050 7079 ILE A N   
2338 C CA  . ILE A 284 ? 0.468 0.433 0.299 -0.016 0.071  -0.051 7079 ILE A CA  
2339 C C   . ILE A 284 ? 0.487 0.457 0.327 -0.012 0.088  -0.066 7079 ILE A C   
2340 O O   . ILE A 284 ? 0.511 0.463 0.321 -0.026 0.102  -0.074 7079 ILE A O   
2341 C CB  . ILE A 284 ? 0.484 0.429 0.297 -0.019 0.055  -0.039 7079 ILE A CB  
2342 C CG1 . ILE A 284 ? 0.479 0.424 0.308 -0.016 0.042  -0.023 7079 ILE A CG1 
2343 C CG2 . ILE A 284 ? 0.473 0.418 0.294 -0.009 0.054  -0.045 7079 ILE A CG2 
2344 C CD1 . ILE A 284 ? 0.464 0.420 0.322 0.000  0.042  -0.024 7079 ILE A CD1 
2345 N N   . ILE A 285 ? 0.461 0.451 0.339 0.003  0.089  -0.068 7080 ILE A N   
2346 C CA  . ILE A 285 ? 0.484 0.480 0.386 0.010  0.106  -0.079 7080 ILE A CA  
2347 C C   . ILE A 285 ? 0.479 0.468 0.389 0.022  0.099  -0.078 7080 ILE A C   
2348 O O   . ILE A 285 ? 0.465 0.466 0.394 0.033  0.082  -0.068 7080 ILE A O   
2349 C CB  . ILE A 285 ? 0.483 0.512 0.435 0.017  0.112  -0.080 7080 ILE A CB  
2350 C CG1 . ILE A 285 ? 0.512 0.547 0.457 0.003  0.123  -0.083 7080 ILE A CG1 
2351 C CG2 . ILE A 285 ? 0.492 0.529 0.488 0.029  0.129  -0.087 7080 ILE A CG2 
2352 C CD1 . ILE A 285 ? 0.506 0.576 0.501 0.006  0.123  -0.080 7080 ILE A CD1 
2353 N N   . ARG A 286 ? 0.510 0.474 0.397 0.017  0.112  -0.087 7081 ARG A N   
2354 C CA  . ARG A 286 ? 0.520 0.471 0.409 0.025  0.110  -0.089 7081 ARG A CA  
2355 C C   . ARG A 286 ? 0.575 0.491 0.426 0.010  0.132  -0.104 7081 ARG A C   
2356 O O   . ARG A 286 ? 0.568 0.468 0.379 -0.010 0.141  -0.109 7081 ARG A O   
2357 C CB  . ARG A 286 ? 0.496 0.440 0.367 0.026  0.084  -0.076 7081 ARG A CB  
2358 C CG  . ARG A 286 ? 0.510 0.436 0.338 0.007  0.073  -0.070 7081 ARG A CG  
2359 C CD  . ARG A 286 ? 0.497 0.417 0.321 0.009  0.053  -0.058 7081 ARG A CD  
2360 N NE  . ARG A 286 ? 0.498 0.408 0.299 -0.006 0.036  -0.044 7081 ARG A NE  
2361 C CZ  . ARG A 286 ? 0.534 0.422 0.296 -0.028 0.030  -0.042 7081 ARG A CZ  
2362 N NH1 . ARG A 286 ? 0.535 0.420 0.289 -0.041 0.009  -0.023 7081 ARG A NH1 
2363 N NH2 . ARG A 286 ? 0.576 0.442 0.307 -0.039 0.045  -0.057 7081 ARG A NH2 
2364 N N   . GLU A 287 ? 0.623 0.524 0.482 0.018  0.142  -0.110 7082 GLU A N   
2365 C CA  . GLU A 287 ? 0.712 0.570 0.523 -0.002 0.164  -0.127 7082 GLU A CA  
2366 C C   . GLU A 287 ? 0.728 0.567 0.483 -0.021 0.137  -0.117 7082 GLU A C   
2367 O O   . GLU A 287 ? 0.659 0.521 0.429 -0.012 0.107  -0.099 7082 GLU A O   
2368 C CB  . GLU A 287 ? 0.761 0.606 0.603 0.013  0.186  -0.137 7082 GLU A CB  
2369 C CG  . GLU A 287 ? 0.794 0.659 0.704 0.030  0.215  -0.144 7082 GLU A CG  
2370 C CD  . GLU A 287 ? 0.853 0.700 0.802 0.044  0.242  -0.153 7082 GLU A CD  
2371 O OE1 . GLU A 287 ? 0.910 0.734 0.835 0.043  0.234  -0.153 7082 GLU A OE1 
2372 O OE2 . GLU A 287 ? 0.908 0.765 0.917 0.055  0.273  -0.160 7082 GLU A OE2 
2373 N N   . ASN A 288 ? 0.797 0.594 0.491 -0.049 0.147  -0.127 7083 ASN A N   
2374 C CA  . ASN A 288 ? 0.858 0.639 0.503 -0.071 0.116  -0.113 7083 ASN A CA  
2375 C C   . ASN A 288 ? 0.898 0.641 0.508 -0.084 0.125  -0.124 7083 ASN A C   
2376 O O   . ASN A 288 ? 0.955 0.658 0.495 -0.120 0.127  -0.130 7083 ASN A O   
2377 C CB  . ASN A 288 ? 0.921 0.690 0.516 -0.100 0.106  -0.106 7083 ASN A CB  
2378 C CG  . ASN A 288 ? 1.002 0.763 0.564 -0.121 0.067  -0.083 7083 ASN A CG  
2379 O OD1 . ASN A 288 ? 0.979 0.769 0.576 -0.109 0.039  -0.061 7083 ASN A OD1 
2380 N ND2 . ASN A 288 ? 1.022 0.742 0.523 -0.152 0.065  -0.088 7083 ASN A ND2 
2381 N N   . ASN A 289 ? 0.886 0.640 0.542 -0.059 0.130  -0.127 7084 ASN A N   
2382 C CA  . ASN A 289 ? 0.952 0.671 0.586 -0.066 0.141  -0.138 7084 ASN A CA  
2383 C C   . ASN A 289 ? 0.938 0.658 0.554 -0.077 0.101  -0.119 7084 ASN A C   
2384 O O   . ASN A 289 ? 0.922 0.674 0.559 -0.070 0.071  -0.098 7084 ASN A O   
2385 C CB  . ASN A 289 ? 0.932 0.662 0.628 -0.033 0.161  -0.145 7084 ASN A CB  
2386 C CG  . ASN A 289 ? 0.938 0.674 0.673 -0.020 0.197  -0.159 7084 ASN A CG  
2387 O OD1 . ASN A 289 ? 0.977 0.686 0.675 -0.041 0.226  -0.175 7084 ASN A OD1 
2388 N ND2 . ASN A 289 ? 0.878 0.649 0.687 0.013  0.196  -0.150 7084 ASN A ND2 
2389 N N   . ARG A 290 ? 0.958 0.644 0.541 -0.093 0.104  -0.127 7085 ARG A N   
2390 C CA  . ARG A 290 ? 0.959 0.648 0.532 -0.104 0.067  -0.108 7085 ARG A CA  
2391 C C   . ARG A 290 ? 0.878 0.611 0.522 -0.069 0.050  -0.092 7085 ARG A C   
2392 O O   . ARG A 290 ? 0.831 0.569 0.512 -0.042 0.068  -0.100 7085 ARG A O   
2393 C CB  . ARG A 290 ? 1.050 0.693 0.577 -0.127 0.079  -0.123 7085 ARG A CB  
2394 C CG  . ARG A 290 ? 1.081 0.712 0.641 -0.101 0.114  -0.141 7085 ARG A CG  
2395 C CD  . ARG A 290 ? 1.200 0.772 0.704 -0.128 0.139  -0.163 7085 ARG A CD  
2396 N NE  . ARG A 290 ? 1.254 0.813 0.723 -0.153 0.107  -0.151 7085 ARG A NE  
2397 C CZ  . ARG A 290 ? 1.267 0.833 0.767 -0.139 0.096  -0.144 7085 ARG A CZ  
2398 N NH1 . ARG A 290 ? 1.311 0.866 0.779 -0.166 0.067  -0.133 7085 ARG A NH1 
2399 N NH2 . ARG A 290 ? 1.218 0.804 0.782 -0.098 0.111  -0.146 7085 ARG A NH2 
2400 N N   . VAL A 291 ? 0.825 0.584 0.487 -0.070 0.018  -0.069 7086 VAL A N   
2401 C CA  . VAL A 291 ? 0.736 0.530 0.458 -0.041 0.007  -0.055 7086 VAL A CA  
2402 C C   . VAL A 291 ? 0.719 0.502 0.449 -0.038 0.003  -0.055 7086 VAL A C   
2403 O O   . VAL A 291 ? 0.732 0.507 0.446 -0.060 -0.017 -0.045 7086 VAL A O   
2404 C CB  . VAL A 291 ? 0.727 0.546 0.472 -0.044 -0.019 -0.032 7086 VAL A CB  
2405 C CG1 . VAL A 291 ? 0.672 0.516 0.471 -0.020 -0.023 -0.022 7086 VAL A CG1 
2406 C CG2 . VAL A 291 ? 0.745 0.574 0.483 -0.046 -0.015 -0.032 7086 VAL A CG2 
2407 N N   . VAL A 292 ? 0.668 0.454 0.425 -0.014 0.019  -0.064 7087 VAL A N   
2408 C CA  . VAL A 292 ? 0.667 0.440 0.432 -0.008 0.020  -0.065 7087 VAL A CA  
2409 C C   . VAL A 292 ? 0.582 0.379 0.392 0.016  0.015  -0.054 7087 VAL A C   
2410 O O   . VAL A 292 ? 0.574 0.385 0.405 0.034  0.024  -0.056 7087 VAL A O   
2411 C CB  . VAL A 292 ? 0.735 0.476 0.485 -0.005 0.048  -0.085 7087 VAL A CB  
2412 C CG1 . VAL A 292 ? 0.763 0.489 0.523 0.002  0.050  -0.085 7087 VAL A CG1 
2413 C CG2 . VAL A 292 ? 0.809 0.515 0.502 -0.035 0.059  -0.099 7087 VAL A CG2 
2414 N N   A ILE A 293 ? 0.543 0.341 0.364 0.013  0.002  -0.044 7088 ILE A N   
2415 N N   B ILE A 293 ? 0.543 0.341 0.364 0.012  0.002  -0.044 7088 ILE A N   
2416 C CA  A ILE A 293 ? 0.503 0.316 0.357 0.030  0.002  -0.036 7088 ILE A CA  
2417 C CA  B ILE A 293 ? 0.503 0.317 0.357 0.029  0.000  -0.034 7088 ILE A CA  
2418 C C   A ILE A 293 ? 0.498 0.296 0.354 0.027  0.000  -0.033 7088 ILE A C   
2419 C C   B ILE A 293 ? 0.499 0.296 0.355 0.027  0.000  -0.033 7088 ILE A C   
2420 O O   A ILE A 293 ? 0.516 0.301 0.356 0.009  -0.008 -0.033 7088 ILE A O   
2421 O O   B ILE A 293 ? 0.521 0.303 0.358 0.009  -0.006 -0.035 7088 ILE A O   
2422 C CB  A ILE A 293 ? 0.474 0.311 0.351 0.030  -0.006 -0.023 7088 ILE A CB  
2423 C CB  B ILE A 293 ? 0.475 0.311 0.353 0.025  -0.011 -0.020 7088 ILE A CB  
2424 C CG1 A ILE A 293 ? 0.455 0.300 0.352 0.045  0.001  -0.020 7088 ILE A CG1 
2425 C CG1 B ILE A 293 ? 0.494 0.329 0.379 0.007  -0.026 -0.009 7088 ILE A CG1 
2426 C CG2 A ILE A 293 ? 0.481 0.323 0.370 0.014  -0.022 -0.011 7088 ILE A CG2 
2427 C CG2 B ILE A 293 ? 0.466 0.316 0.340 0.023  -0.012 -0.020 7088 ILE A CG2 
2428 C CD1 A ILE A 293 ? 0.437 0.299 0.355 0.045  0.001  -0.012 7088 ILE A CD1 
2429 C CD1 B ILE A 293 ? 0.484 0.341 0.409 0.004  -0.036 0.009  7088 ILE A CD1 
2430 N N   . SER A 294 ? 0.479 0.277 0.350 0.040  0.005  -0.030 7089 SER A N   
2431 C CA  . SER A 294 ? 0.506 0.287 0.378 0.037  0.005  -0.028 7089 SER A CA  
2432 C C   . SER A 294 ? 0.502 0.285 0.388 0.046  0.010  -0.021 7089 SER A C   
2433 O O   . SER A 294 ? 0.466 0.260 0.354 0.054  0.012  -0.020 7089 SER A O   
2434 C CB  . SER A 294 ? 0.544 0.298 0.397 0.039  0.013  -0.038 7089 SER A CB  
2435 O OG  . SER A 294 ? 0.552 0.305 0.412 0.057  0.020  -0.039 7089 SER A OG  
2436 N N   A SER A 295 ? 0.513 0.285 0.403 0.040  0.011  -0.017 7090 SER A N   
2437 N N   B SER A 295 ? 0.516 0.288 0.407 0.040  0.012  -0.017 7090 SER A N   
2438 C CA  A SER A 295 ? 0.526 0.290 0.419 0.043  0.020  -0.013 7090 SER A CA  
2439 C CA  B SER A 295 ? 0.529 0.294 0.422 0.043  0.020  -0.012 7090 SER A CA  
2440 C C   A SER A 295 ? 0.560 0.296 0.436 0.043  0.022  -0.013 7090 SER A C   
2441 C C   B SER A 295 ? 0.563 0.300 0.440 0.043  0.022  -0.013 7090 SER A C   
2442 O O   A SER A 295 ? 0.563 0.289 0.440 0.035  0.021  -0.016 7090 SER A O   
2443 O O   B SER A 295 ? 0.567 0.295 0.446 0.034  0.021  -0.015 7090 SER A O   
2444 C CB  A SER A 295 ? 0.514 0.287 0.433 0.034  0.026  -0.007 7090 SER A CB  
2445 C CB  B SER A 295 ? 0.518 0.292 0.436 0.035  0.027  -0.007 7090 SER A CB  
2446 O OG  A SER A 295 ? 0.536 0.290 0.447 0.031  0.040  -0.006 7090 SER A OG  
2447 O OG  B SER A 295 ? 0.537 0.309 0.473 0.024  0.024  -0.004 7090 SER A OG  
2448 N N   . ASP A 296 ? 0.587 0.310 0.448 0.050  0.023  -0.009 7091 ASP A N   
2449 C CA  . ASP A 296 ? 0.646 0.341 0.493 0.051  0.023  -0.006 7091 ASP A CA  
2450 C C   . ASP A 296 ? 0.672 0.352 0.517 0.038  0.032  -0.005 7091 ASP A C   
2451 O O   . ASP A 296 ? 0.656 0.344 0.510 0.030  0.040  -0.004 7091 ASP A O   
2452 C CB  . ASP A 296 ? 0.687 0.371 0.519 0.056  0.017  0.004  7091 ASP A CB  
2453 C CG  . ASP A 296 ? 0.704 0.402 0.548 0.070  0.008  0.007  7091 ASP A CG  
2454 O OD1 . ASP A 296 ? 0.731 0.435 0.590 0.077  0.012  -0.002 7091 ASP A OD1 
2455 O OD2 . ASP A 296 ? 0.822 0.523 0.659 0.070  -0.001 0.018  7091 ASP A OD2 
2456 N N   . VAL A 297 ? 0.735 0.392 0.573 0.036  0.032  -0.006 7092 VAL A N   
2457 C CA  . VAL A 297 ? 0.762 0.401 0.598 0.023  0.041  -0.005 7092 VAL A CA  
2458 C C   . VAL A 297 ? 0.786 0.392 0.596 0.025  0.041  0.003  7092 VAL A C   
2459 O O   . VAL A 297 ? 0.752 0.345 0.557 0.036  0.034  0.005  7092 VAL A O   
2460 C CB  . VAL A 297 ? 0.815 0.450 0.660 0.015  0.039  -0.011 7092 VAL A CB  
2461 C CG1 . VAL A 297 ? 0.852 0.467 0.697 0.001  0.047  -0.010 7092 VAL A CG1 
2462 C CG2 . VAL A 297 ? 0.800 0.467 0.670 0.008  0.032  -0.013 7092 VAL A CG2 
2463 N N   . LEU A 298 ? 0.802 0.394 0.594 0.014  0.050  0.008  7093 LEU A N   
2464 C CA  . LEU A 298 ? 0.886 0.442 0.644 0.010  0.047  0.019  7093 LEU A CA  
2465 C C   . LEU A 298 ? 0.899 0.431 0.658 0.003  0.054  0.016  7093 LEU A C   
2466 O O   . LEU A 298 ? 0.882 0.418 0.653 -0.009 0.069  0.010  7093 LEU A O   
2467 C CB  . LEU A 298 ? 0.955 0.496 0.682 -0.007 0.056  0.024  7093 LEU A CB  
2468 C CG  . LEU A 298 ? 1.059 0.557 0.740 -0.019 0.052  0.037  7093 LEU A CG  
2469 C CD1 . LEU A 298 ? 1.091 0.585 0.768 -0.006 0.025  0.054  7093 LEU A CD1 
2470 C CD2 . LEU A 298 ? 1.125 0.601 0.763 -0.043 0.066  0.038  7093 LEU A CD2 
2471 N N   . VAL A 299 ? 0.928 0.437 0.680 0.011  0.046  0.022  7094 VAL A N   
2472 C CA  . VAL A 299 ? 0.972 0.456 0.722 0.003  0.054  0.018  7094 VAL A CA  
2473 C C   . VAL A 299 ? 1.038 0.480 0.754 -0.006 0.055  0.031  7094 VAL A C   
2474 O O   . VAL A 299 ? 1.044 0.473 0.745 0.002  0.041  0.047  7094 VAL A O   
2475 C CB  . VAL A 299 ? 0.987 0.466 0.752 0.015  0.051  0.011  7094 VAL A CB  
2476 C CG1 . VAL A 299 ? 0.951 0.464 0.736 0.017  0.050  -0.002 7094 VAL A CG1 
2477 C CG2 . VAL A 299 ? 1.029 0.493 0.795 0.033  0.042  0.022  7094 VAL A CG2 
2478 N N   . ASN A 300 ? 1.087 0.511 0.793 -0.023 0.071  0.028  7095 ASN A N   
2479 C CA  . ASN A 300 ? 1.164 0.545 0.832 -0.037 0.075  0.039  7095 ASN A CA  
2480 C C   . ASN A 300 ? 1.200 0.565 0.872 -0.054 0.094  0.031  7095 ASN A C   
2481 O O   . ASN A 300 ? 1.112 0.508 0.821 -0.056 0.101  0.018  7095 ASN A O   
2482 C CB  . ASN A 300 ? 1.182 0.555 0.814 -0.050 0.076  0.048  7095 ASN A CB  
2483 C CG  . ASN A 300 ? 1.165 0.566 0.813 -0.059 0.096  0.034  7095 ASN A CG  
2484 O OD1 . ASN A 300 ? 1.158 0.579 0.844 -0.060 0.110  0.022  7095 ASN A OD1 
2485 N ND2 . ASN A 300 ? 1.186 0.587 0.807 -0.066 0.096  0.038  7095 ASN A ND2 
2486 N N   . ASN A 301 ? 1.303 0.624 0.941 -0.067 0.099  0.039  7096 ASN A N   
2487 C CA  . ASN A 301 ? 1.365 0.668 1.007 -0.084 0.118  0.032  7096 ASN A CA  
2488 C C   . ASN A 301 ? 1.418 0.738 1.073 -0.102 0.143  0.023  7096 ASN A C   
2489 O O   . ASN A 301 ? 1.482 0.804 1.119 -0.107 0.149  0.025  7096 ASN A O   
2490 C CB  . ASN A 301 ? 1.427 0.675 1.025 -0.094 0.118  0.045  7096 ASN A CB  
2491 C CG  . ASN A 301 ? 1.450 0.681 1.051 -0.075 0.099  0.055  7096 ASN A CG  
2492 O OD1 . ASN A 301 ? 1.502 0.697 1.072 -0.074 0.087  0.074  7096 ASN A OD1 
2493 N ND2 . ASN A 301 ? 1.417 0.669 1.054 -0.061 0.096  0.042  7096 ASN A ND2 
2494 O OXT . ASN A 301 ? 1.462 0.792 1.149 -0.114 0.158  0.015  7096 ASN A OXT 
2495 N N   . ALA B 21  ? 1.234 0.654 1.042 -0.031 -0.065 0.004  4271 ALA B N   
2496 C CA  . ALA B 21  ? 1.216 0.654 1.034 -0.035 -0.096 -0.011 4271 ALA B CA  
2497 C C   . ALA B 21  ? 1.128 0.655 1.026 -0.048 -0.097 -0.006 4271 ALA B C   
2498 O O   . ALA B 21  ? 1.119 0.667 1.022 -0.043 -0.111 -0.010 4271 ALA B O   
2499 C CB  . ALA B 21  ? 1.269 0.667 1.077 -0.052 -0.138 -0.040 4271 ALA B CB  
2500 N N   . PHE B 22  ? 1.052 0.619 0.999 -0.062 -0.080 0.003  4272 PHE B N   
2501 C CA  . PHE B 22  ? 0.969 0.610 0.981 -0.074 -0.078 0.008  4272 PHE B CA  
2502 C C   . PHE B 22  ? 0.942 0.614 0.951 -0.054 -0.067 0.024  4272 PHE B C   
2503 O O   . PHE B 22  ? 0.968 0.624 0.949 -0.034 -0.045 0.039  4272 PHE B O   
2504 C CB  . PHE B 22  ? 0.925 0.584 0.966 -0.085 -0.057 0.018  4272 PHE B CB  
2505 C CG  . PHE B 22  ? 0.841 0.560 0.931 -0.092 -0.052 0.025  4272 PHE B CG  
2506 C CD1 . PHE B 22  ? 0.800 0.551 0.939 -0.112 -0.066 0.011  4272 PHE B CD1 
2507 C CD2 . PHE B 22  ? 0.803 0.545 0.890 -0.078 -0.036 0.045  4272 PHE B CD2 
2508 C CE1 . PHE B 22  ? 0.760 0.557 0.934 -0.117 -0.059 0.018  4272 PHE B CE1 
2509 C CE2 . PHE B 22  ? 0.758 0.546 0.880 -0.084 -0.035 0.049  4272 PHE B CE2 
2510 C CZ  . PHE B 22  ? 0.741 0.553 0.901 -0.103 -0.044 0.037  4272 PHE B CZ  
2511 N N   . ALA B 23  ? 0.903 0.619 0.946 -0.061 -0.079 0.019  4273 ALA B N   
2512 C CA  . ALA B 23  ? 0.882 0.626 0.928 -0.048 -0.068 0.031  4273 ALA B CA  
2513 C C   . ALA B 23  ? 0.823 0.624 0.919 -0.062 -0.077 0.029  4273 ALA B C   
2514 O O   . ALA B 23  ? 0.820 0.626 0.931 -0.072 -0.099 0.014  4273 ALA B O   
2515 C CB  . ALA B 23  ? 0.922 0.623 0.916 -0.031 -0.072 0.026  4273 ALA B CB  
2516 N N   . VAL B 24  ? 0.782 0.622 0.904 -0.061 -0.062 0.043  4274 VAL B N   
2517 C CA  . VAL B 24  ? 0.738 0.624 0.897 -0.073 -0.068 0.043  4274 VAL B CA  
2518 C C   . VAL B 24  ? 0.716 0.605 0.867 -0.068 -0.076 0.037  4274 VAL B C   
2519 O O   . VAL B 24  ? 0.741 0.614 0.868 -0.055 -0.065 0.043  4274 VAL B O   
2520 C CB  . VAL B 24  ? 0.740 0.654 0.915 -0.070 -0.056 0.058  4274 VAL B CB  
2521 C CG1 . VAL B 24  ? 0.726 0.675 0.925 -0.079 -0.061 0.057  4274 VAL B CG1 
2522 C CG2 . VAL B 24  ? 0.766 0.664 0.935 -0.070 -0.048 0.063  4274 VAL B CG2 
2523 N N   . ASP B 25  ? 0.684 0.587 0.853 -0.078 -0.092 0.025  4275 ASP B N   
2524 C CA  . ASP B 25  ? 0.678 0.577 0.831 -0.070 -0.102 0.019  4275 ASP B CA  
2525 C C   . ASP B 25  ? 0.620 0.559 0.801 -0.077 -0.096 0.025  4275 ASP B C   
2526 O O   . ASP B 25  ? 0.600 0.557 0.805 -0.085 -0.106 0.017  4275 ASP B O   
2527 C CB  . ASP B 25  ? 0.711 0.590 0.859 -0.069 -0.131 0.000  4275 ASP B CB  
2528 C CG  . ASP B 25  ? 0.739 0.594 0.849 -0.053 -0.144 -0.006 4275 ASP B CG  
2529 O OD1 . ASP B 25  ? 0.731 0.592 0.828 -0.049 -0.126 0.004  4275 ASP B OD1 
2530 O OD2 . ASP B 25  ? 0.791 0.617 0.881 -0.045 -0.173 -0.023 4275 ASP B OD2 
2531 N N   . ALA B 26  ? 0.594 0.544 0.774 -0.075 -0.079 0.038  4276 ALA B N   
2532 C CA  . ALA B 26  ? 0.544 0.525 0.744 -0.083 -0.075 0.042  4276 ALA B CA  
2533 C C   . ALA B 26  ? 0.532 0.507 0.719 -0.081 -0.082 0.035  4276 ALA B C   
2534 O O   . ALA B 26  ? 0.515 0.509 0.718 -0.089 -0.085 0.033  4276 ALA B O   
2535 C CB  . ALA B 26  ? 0.536 0.530 0.745 -0.081 -0.062 0.053  4276 ALA B CB  
2536 N N   . ALA B 27  ? 0.556 0.496 0.707 -0.069 -0.080 0.031  4277 ALA B N   
2537 C CA  . ALA B 27  ? 0.581 0.502 0.704 -0.061 -0.087 0.025  4277 ALA B CA  
2538 C C   . ALA B 27  ? 0.583 0.521 0.728 -0.063 -0.110 0.013  4277 ALA B C   
2539 O O   . ALA B 27  ? 0.547 0.502 0.704 -0.066 -0.109 0.013  4277 ALA B O   
2540 C CB  . ALA B 27  ? 0.642 0.505 0.706 -0.043 -0.084 0.022  4277 ALA B CB  
2541 N N   . LYS B 28  ? 0.624 0.556 0.779 -0.061 -0.128 0.003  4278 LYS B N   
2542 C CA  . LYS B 28  ? 0.628 0.581 0.823 -0.063 -0.151 -0.011 4278 LYS B CA  
2543 C C   . LYS B 28  ? 0.555 0.550 0.799 -0.080 -0.135 -0.004 4278 LYS B C   
2544 O O   . LYS B 28  ? 0.534 0.548 0.805 -0.079 -0.140 -0.010 4278 LYS B O   
2545 C CB  . LYS B 28  ? 0.713 0.654 0.919 -0.064 -0.171 -0.023 4278 LYS B CB  
2546 C CG  . LYS B 28  ? 0.745 0.716 1.016 -0.072 -0.191 -0.040 4278 LYS B CG  
2547 C CD  . LYS B 28  ? 0.816 0.774 1.105 -0.078 -0.211 -0.054 4278 LYS B CD  
2548 C CE  . LYS B 28  ? 0.845 0.843 1.221 -0.092 -0.224 -0.071 4278 LYS B CE  
2549 N NZ  . LYS B 28  ? 0.877 0.893 1.279 -0.078 -0.252 -0.085 4278 LYS B NZ  
2550 N N   . ALA B 29  ? 0.517 0.521 0.769 -0.091 -0.116 0.007  4279 ALA B N   
2551 C CA  . ALA B 29  ? 0.508 0.534 0.787 -0.104 -0.099 0.014  4279 ALA B CA  
2552 C C   . ALA B 29  ? 0.481 0.514 0.747 -0.102 -0.092 0.020  4279 ALA B C   
2553 O O   . ALA B 29  ? 0.468 0.513 0.756 -0.107 -0.085 0.019  4279 ALA B O   
2554 C CB  . ALA B 29  ? 0.507 0.528 0.777 -0.109 -0.086 0.026  4279 ALA B CB  
2555 N N   . TYR B 30  ? 0.500 0.522 0.734 -0.097 -0.091 0.025  4280 TYR B N   
2556 C CA  . TYR B 30  ? 0.488 0.510 0.707 -0.099 -0.085 0.028  4280 TYR B CA  
2557 C C   . TYR B 30  ? 0.492 0.511 0.711 -0.089 -0.093 0.019  4280 TYR B C   
2558 O O   . TYR B 30  ? 0.479 0.504 0.703 -0.091 -0.086 0.020  4280 TYR B O   
2559 C CB  . TYR B 30  ? 0.499 0.511 0.695 -0.098 -0.078 0.034  4280 TYR B CB  
2560 C CG  . TYR B 30  ? 0.493 0.501 0.675 -0.104 -0.072 0.036  4280 TYR B CG  
2561 C CD1 . TYR B 30  ? 0.496 0.515 0.684 -0.114 -0.070 0.041  4280 TYR B CD1 
2562 C CD2 . TYR B 30  ? 0.512 0.497 0.665 -0.099 -0.067 0.034  4280 TYR B CD2 
2563 C CE1 . TYR B 30  ? 0.504 0.514 0.675 -0.121 -0.068 0.041  4280 TYR B CE1 
2564 C CE2 . TYR B 30  ? 0.512 0.489 0.651 -0.107 -0.059 0.035  4280 TYR B CE2 
2565 C CZ  . TYR B 30  ? 0.503 0.494 0.653 -0.119 -0.061 0.038  4280 TYR B CZ  
2566 O OH  . TYR B 30  ? 0.492 0.468 0.623 -0.128 -0.057 0.037  4280 TYR B OH  
2567 N N   . LYS B 31  ? 0.533 0.537 0.742 -0.076 -0.109 0.010  4281 LYS B N   
2568 C CA  . LYS B 31  ? 0.569 0.569 0.778 -0.061 -0.124 -0.001 4281 LYS B CA  
2569 C C   . LYS B 31  ? 0.552 0.585 0.821 -0.065 -0.126 -0.008 4281 LYS B C   
2570 O O   . LYS B 31  ? 0.540 0.580 0.818 -0.058 -0.124 -0.010 4281 LYS B O   
2571 C CB  . LYS B 31  ? 0.631 0.598 0.808 -0.043 -0.147 -0.011 4281 LYS B CB  
2572 C CG  . LYS B 31  ? 0.682 0.604 0.793 -0.036 -0.134 -0.004 4281 LYS B CG  
2573 C CD  . LYS B 31  ? 0.759 0.632 0.821 -0.016 -0.153 -0.012 4281 LYS B CD  
2574 C CE  . LYS B 31  ? 0.814 0.637 0.812 -0.011 -0.127 -0.003 4281 LYS B CE  
2575 N NZ  . LYS B 31  ? 0.892 0.654 0.829 0.011  -0.141 -0.010 4281 LYS B NZ  
2576 N N   . ASP B 32  ? 0.565 0.616 0.876 -0.077 -0.126 -0.011 4282 ASP B N   
2577 C CA  . ASP B 32  ? 0.559 0.641 0.938 -0.084 -0.119 -0.017 4282 ASP B CA  
2578 C C   . ASP B 32  ? 0.545 0.628 0.918 -0.092 -0.087 -0.004 4282 ASP B C   
2579 O O   . ASP B 32  ? 0.537 0.635 0.946 -0.089 -0.077 -0.007 4282 ASP B O   
2580 C CB  . ASP B 32  ? 0.587 0.676 1.005 -0.098 -0.120 -0.022 4282 ASP B CB  
2581 C CG  . ASP B 32  ? 0.617 0.700 1.043 -0.090 -0.155 -0.039 4282 ASP B CG  
2582 O OD1 . ASP B 32  ? 0.637 0.717 1.057 -0.071 -0.182 -0.050 4282 ASP B OD1 
2583 O OD2 . ASP B 32  ? 0.670 0.743 1.100 -0.099 -0.158 -0.041 4282 ASP B OD2 
2584 N N   . TYR B 33  ? 0.536 0.602 0.865 -0.100 -0.074 0.010  4283 TYR B N   
2585 C CA  . TYR B 33  ? 0.544 0.597 0.847 -0.105 -0.051 0.021  4283 TYR B CA  
2586 C C   . TYR B 33  ? 0.543 0.589 0.827 -0.096 -0.050 0.020  4283 TYR B C   
2587 O O   . TYR B 33  ? 0.538 0.579 0.828 -0.095 -0.031 0.023  4283 TYR B O   
2588 C CB  . TYR B 33  ? 0.562 0.600 0.825 -0.112 -0.051 0.032  4283 TYR B CB  
2589 C CG  . TYR B 33  ? 0.597 0.613 0.819 -0.115 -0.041 0.040  4283 TYR B CG  
2590 C CD1 . TYR B 33  ? 0.615 0.611 0.822 -0.118 -0.023 0.047  4283 TYR B CD1 
2591 C CD2 . TYR B 33  ? 0.605 0.614 0.796 -0.114 -0.049 0.041  4283 TYR B CD2 
2592 C CE1 . TYR B 33  ? 0.645 0.611 0.802 -0.118 -0.020 0.053  4283 TYR B CE1 
2593 C CE2 . TYR B 33  ? 0.624 0.610 0.778 -0.118 -0.046 0.046  4283 TYR B CE2 
2594 C CZ  . TYR B 33  ? 0.665 0.629 0.799 -0.119 -0.035 0.052  4283 TYR B CZ  
2595 O OH  . TYR B 33  ? 0.700 0.632 0.785 -0.121 -0.037 0.055  4283 TYR B OH  
2596 N N   . LEU B 34  ? 0.544 0.582 0.799 -0.087 -0.067 0.017  4284 LEU B N   
2597 C CA  . LEU B 34  ? 0.574 0.595 0.800 -0.076 -0.065 0.016  4284 LEU B CA  
2598 C C   . LEU B 34  ? 0.584 0.622 0.853 -0.062 -0.068 0.007  4284 LEU B C   
2599 O O   . LEU B 34  ? 0.585 0.616 0.847 -0.056 -0.053 0.010  4284 LEU B O   
2600 C CB  . LEU B 34  ? 0.594 0.593 0.778 -0.069 -0.078 0.015  4284 LEU B CB  
2601 C CG  . LEU B 34  ? 0.598 0.585 0.754 -0.083 -0.071 0.023  4284 LEU B CG  
2602 C CD1 . LEU B 34  ? 0.635 0.595 0.755 -0.074 -0.075 0.021  4284 LEU B CD1 
2603 C CD2 . LEU B 34  ? 0.620 0.595 0.753 -0.094 -0.059 0.029  4284 LEU B CD2 
2604 N N   . ALA B 35  ? 0.591 0.651 0.905 -0.055 -0.089 -0.005 4285 ALA B N   
2605 C CA  . ALA B 35  ? 0.620 0.706 0.993 -0.040 -0.100 -0.018 4285 ALA B CA  
2606 C C   . ALA B 35  ? 0.623 0.730 1.051 -0.050 -0.067 -0.014 4285 ALA B C   
2607 O O   . ALA B 35  ? 0.632 0.755 1.100 -0.036 -0.062 -0.020 4285 ALA B O   
2608 C CB  . ALA B 35  ? 0.609 0.712 1.022 -0.035 -0.133 -0.033 4285 ALA B CB  
2609 N N   . SER B 36  ? 0.632 0.733 1.056 -0.070 -0.044 -0.005 4286 SER B N   
2610 C CA  . SER B 36  ? 0.661 0.764 1.121 -0.079 -0.005 0.001  4286 SER B CA  
2611 C C   . SER B 36  ? 0.687 0.754 1.085 -0.075 0.021  0.014  4286 SER B C   
2612 O O   . SER B 36  ? 0.712 0.766 1.122 -0.077 0.059  0.019  4286 SER B O   
2613 C CB  . SER B 36  ? 0.688 0.784 1.153 -0.097 0.009  0.006  4286 SER B CB  
2614 O OG  . SER B 36  ? 0.695 0.820 1.220 -0.103 -0.012 -0.008 4286 SER B OG  
2615 N N   . GLY B 37  ? 0.678 0.721 1.007 -0.069 0.005  0.018  4287 GLY B N   
2616 C CA  . GLY B 37  ? 0.708 0.710 0.972 -0.067 0.025  0.027  4287 GLY B CA  
2617 C C   . GLY B 37  ? 0.718 0.688 0.919 -0.082 0.024  0.037  4287 GLY B C   
2618 O O   . GLY B 37  ? 0.749 0.677 0.893 -0.082 0.039  0.044  4287 GLY B O   
2619 N N   . GLY B 38  ? 0.678 0.663 0.887 -0.091 0.005  0.036  4288 GLY B N   
2620 C CA  . GLY B 38  ? 0.677 0.640 0.839 -0.102 -0.001 0.044  4288 GLY B CA  
2621 C C   . GLY B 38  ? 0.667 0.609 0.780 -0.104 -0.013 0.044  4288 GLY B C   
2622 O O   . GLY B 38  ? 0.651 0.600 0.767 -0.098 -0.021 0.039  4288 GLY B O   
2623 N N   . GLN B 39  ? 0.690 0.603 0.757 -0.112 -0.016 0.049  4289 GLN B N   
2624 C CA  . GLN B 39  ? 0.696 0.588 0.723 -0.119 -0.029 0.047  4289 GLN B CA  
2625 C C   . GLN B 39  ? 0.602 0.523 0.656 -0.127 -0.047 0.044  4289 GLN B C   
2626 O O   . GLN B 39  ? 0.579 0.518 0.653 -0.131 -0.057 0.046  4289 GLN B O   
2627 C CB  . GLN B 39  ? 0.785 0.635 0.758 -0.124 -0.033 0.051  4289 GLN B CB  
2628 C CG  . GLN B 39  ? 0.855 0.682 0.792 -0.134 -0.050 0.045  4289 GLN B CG  
2629 C CD  . GLN B 39  ? 0.980 0.761 0.860 -0.137 -0.064 0.046  4289 GLN B CD  
2630 O OE1 . GLN B 39  ? 1.060 0.820 0.918 -0.129 -0.060 0.051  4289 GLN B OE1 
2631 N NE2 . GLN B 39  ? 1.045 0.799 0.893 -0.148 -0.081 0.039  4289 GLN B NE2 
2632 N N   . PRO B 40  ? 0.521 0.582 0.783 -0.075 -0.033 0.103  4290 PRO B N   
2633 C CA  . PRO B 40  ? 0.498 0.526 0.727 -0.078 -0.051 0.091  4290 PRO B CA  
2634 C C   . PRO B 40  ? 0.480 0.483 0.665 -0.073 -0.043 0.088  4290 PRO B C   
2635 O O   . PRO B 40  ? 0.463 0.474 0.635 -0.063 -0.025 0.090  4290 PRO B O   
2636 C CB  . PRO B 40  ? 0.496 0.525 0.718 -0.067 -0.061 0.080  4290 PRO B CB  
2637 C CG  . PRO B 40  ? 0.501 0.566 0.768 -0.064 -0.057 0.087  4290 PRO B CG  
2638 C CD  . PRO B 40  ? 0.509 0.593 0.791 -0.064 -0.033 0.099  4290 PRO B CD  
2639 N N   . ILE B 41  ? 0.464 0.439 0.628 -0.080 -0.056 0.082  4291 ILE B N   
2640 C CA  . ILE B 41  ? 0.460 0.411 0.583 -0.075 -0.051 0.078  4291 ILE B CA  
2641 C C   . ILE B 41  ? 0.443 0.396 0.542 -0.060 -0.045 0.069  4291 ILE B C   
2642 O O   . ILE B 41  ? 0.415 0.371 0.517 -0.056 -0.055 0.061  4291 ILE B O   
2643 C CB  . ILE B 41  ? 0.477 0.399 0.584 -0.082 -0.067 0.070  4291 ILE B CB  
2644 C CG1 . ILE B 41  ? 0.492 0.408 0.621 -0.097 -0.072 0.079  4291 ILE B CG1 
2645 C CG2 . ILE B 41  ? 0.478 0.380 0.545 -0.073 -0.064 0.064  4291 ILE B CG2 
2646 C CD1 . ILE B 41  ? 0.512 0.399 0.628 -0.104 -0.090 0.070  4291 ILE B CD1 
2647 N N   A THR B 42  ? 0.444 0.394 0.521 -0.051 -0.032 0.070  4292 THR B N   
2648 N N   B THR B 42  ? 0.439 0.390 0.516 -0.051 -0.032 0.070  4292 THR B N   
2649 C CA  A THR B 42  ? 0.439 0.391 0.494 -0.037 -0.027 0.061  4292 THR B CA  
2650 C CA  B THR B 42  ? 0.431 0.383 0.486 -0.037 -0.027 0.061  4292 THR B CA  
2651 C C   A THR B 42  ? 0.431 0.360 0.452 -0.034 -0.032 0.054  4292 THR B C   
2652 C C   B THR B 42  ? 0.428 0.357 0.449 -0.034 -0.032 0.054  4292 THR B C   
2653 O O   A THR B 42  ? 0.416 0.328 0.430 -0.041 -0.039 0.055  4292 THR B O   
2654 O O   B THR B 42  ? 0.425 0.338 0.440 -0.041 -0.038 0.055  4292 THR B O   
2655 C CB  A THR B 42  ? 0.462 0.431 0.517 -0.028 -0.008 0.067  4292 THR B CB  
2656 C CB  B THR B 42  ? 0.441 0.411 0.497 -0.028 -0.009 0.067  4292 THR B CB  
2657 O OG1 A THR B 42  ? 0.471 0.433 0.511 -0.031 0.000  0.076  4292 THR B OG1 
2658 O OG1 B THR B 42  ? 0.435 0.405 0.474 -0.015 -0.008 0.056  4292 THR B OG1 
2659 C CG2 A THR B 42  ? 0.470 0.466 0.561 -0.029 0.000  0.075  4292 THR B CG2 
2660 C CG2 B THR B 42  ? 0.453 0.418 0.492 -0.028 0.002  0.075  4292 THR B CG2 
2661 N N   . ASN B 43  ? 0.419 0.347 0.421 -0.024 -0.030 0.046  4293 ASN B N   
2662 C CA  . ASN B 43  ? 0.426 0.336 0.399 -0.020 -0.034 0.038  4293 ASN B CA  
2663 C C   . ASN B 43  ? 0.417 0.314 0.387 -0.025 -0.047 0.032  4293 ASN B C   
2664 O O   . ASN B 43  ? 0.415 0.297 0.366 -0.025 -0.050 0.029  4293 ASN B O   
2665 C CB  . ASN B 43  ? 0.452 0.356 0.410 -0.019 -0.026 0.045  4293 ASN B CB  
2666 C CG  . ASN B 43  ? 0.482 0.400 0.435 -0.010 -0.012 0.048  4293 ASN B CG  
2667 O OD1 . ASN B 43  ? 0.533 0.457 0.481 -0.002 -0.010 0.041  4293 ASN B OD1 
2668 N ND2 . ASN B 43  ? 0.502 0.424 0.454 -0.012 -0.002 0.060  4293 ASN B ND2 
2669 N N   . CYS B 44  ? 0.400 0.301 0.385 -0.029 -0.055 0.031  4294 CYS B N   
2670 C CA  . CYS B 44  ? 0.399 0.286 0.374 -0.032 -0.068 0.025  4294 CYS B CA  
2671 C C   . CYS B 44  ? 0.400 0.284 0.359 -0.024 -0.066 0.018  4294 CYS B C   
2672 O O   . CYS B 44  ? 0.400 0.294 0.364 -0.018 -0.061 0.018  4294 CYS B O   
2673 C CB  . CYS B 44  ? 0.416 0.309 0.409 -0.037 -0.078 0.025  4294 CYS B CB  
2674 S SG  . CYS B 44  ? 0.431 0.327 0.448 -0.048 -0.082 0.032  4294 CYS B SG  
2675 N N   . VAL B 45  ? 0.392 0.264 0.333 -0.024 -0.070 0.014  4295 VAL B N   
2676 C CA  . VAL B 45  ? 0.381 0.251 0.310 -0.019 -0.069 0.009  4295 VAL B CA  
2677 C C   . VAL B 45  ? 0.372 0.240 0.303 -0.019 -0.075 0.007  4295 VAL B C   
2678 O O   . VAL B 45  ? 0.375 0.236 0.299 -0.022 -0.081 0.007  4295 VAL B O   
2679 C CB  . VAL B 45  ? 0.386 0.247 0.299 -0.018 -0.068 0.007  4295 VAL B CB  
2680 C CG1 . VAL B 45  ? 0.381 0.241 0.286 -0.014 -0.068 0.003  4295 VAL B CG1 
2681 C CG2 . VAL B 45  ? 0.395 0.255 0.305 -0.018 -0.063 0.010  4295 VAL B CG2 
2682 N N   . LYS B 46  ? 0.374 0.248 0.314 -0.014 -0.074 0.006  4296 LYS B N   
2683 C CA  . LYS B 46  ? 0.389 0.260 0.332 -0.013 -0.080 0.006  4296 LYS B CA  
2684 C C   . LYS B 46  ? 0.379 0.241 0.310 -0.012 -0.081 0.002  4296 LYS B C   
2685 O O   . LYS B 46  ? 0.374 0.237 0.301 -0.009 -0.076 -0.002 4296 LYS B O   
2686 C CB  . LYS B 46  ? 0.401 0.280 0.361 -0.007 -0.079 0.006  4296 LYS B CB  
2687 C CG  . LYS B 46  ? 0.434 0.308 0.399 -0.006 -0.088 0.007  4296 LYS B CG  
2688 C CD  . LYS B 46  ? 0.457 0.340 0.443 0.000  -0.088 0.008  4296 LYS B CD  
2689 C CE  . LYS B 46  ? 0.471 0.356 0.460 0.010  -0.081 0.002  4296 LYS B CE  
2690 N NZ  . LYS B 46  ? 0.485 0.377 0.495 0.018  -0.083 0.003  4296 LYS B NZ  
2691 N N   . MET B 47  ? 0.373 0.229 0.299 -0.016 -0.087 0.005  4297 MET B N   
2692 C CA  . MET B 47  ? 0.383 0.233 0.301 -0.017 -0.086 0.004  4297 MET B CA  
2693 C C   . MET B 47  ? 0.395 0.240 0.321 -0.015 -0.090 0.004  4297 MET B C   
2694 O O   . MET B 47  ? 0.380 0.224 0.314 -0.013 -0.095 0.007  4297 MET B O   
2695 C CB  . MET B 47  ? 0.395 0.241 0.302 -0.022 -0.088 0.007  4297 MET B CB  
2696 C CG  . MET B 47  ? 0.396 0.242 0.295 -0.023 -0.087 0.006  4297 MET B CG  
2697 S SD  . MET B 47  ? 0.400 0.250 0.298 -0.021 -0.080 0.002  4297 MET B SD  
2698 C CE  . MET B 47  ? 0.400 0.251 0.295 -0.020 -0.077 0.001  4297 MET B CE  
2699 N N   . LEU B 48  ? 0.398 0.238 0.323 -0.016 -0.090 0.002  4298 LEU B N   
2700 C CA  . LEU B 48  ? 0.409 0.239 0.341 -0.016 -0.095 0.003  4298 LEU B CA  
2701 C C   . LEU B 48  ? 0.421 0.246 0.348 -0.022 -0.097 0.012  4298 LEU B C   
2702 O O   . LEU B 48  ? 0.422 0.251 0.340 -0.026 -0.093 0.014  4298 LEU B O   
2703 C CB  . LEU B 48  ? 0.409 0.235 0.342 -0.015 -0.095 -0.004 4298 LEU B CB  
2704 C CG  . LEU B 48  ? 0.417 0.245 0.350 -0.007 -0.093 -0.014 4298 LEU B CG  
2705 C CD1 . LEU B 48  ? 0.427 0.254 0.357 -0.008 -0.094 -0.021 4298 LEU B CD1 
2706 C CD2 . LEU B 48  ? 0.428 0.248 0.370 -0.001 -0.096 -0.017 4298 LEU B CD2 
2707 N N   . CYS B 49  ? 0.441 0.259 0.373 -0.021 -0.103 0.018  4299 CYS B N   
2708 C CA  . CYS B 49  ? 0.455 0.268 0.379 -0.027 -0.105 0.029  4299 CYS B CA  
2709 C C   . CYS B 49  ? 0.458 0.257 0.390 -0.025 -0.112 0.035  4299 CYS B C   
2710 O O   . CYS B 49  ? 0.444 0.240 0.388 -0.019 -0.115 0.029  4299 CYS B O   
2711 C CB  . CYS B 49  ? 0.476 0.294 0.387 -0.028 -0.106 0.032  4299 CYS B CB  
2712 S SG  . CYS B 49  ? 0.508 0.330 0.427 -0.022 -0.113 0.031  4299 CYS B SG  
2713 N N   . THR B 50  ? 0.472 0.264 0.398 -0.030 -0.114 0.046  4300 THR B N   
2714 C CA  . THR B 50  ? 0.483 0.259 0.416 -0.030 -0.122 0.055  4300 THR B CA  
2715 C C   . THR B 50  ? 0.484 0.260 0.419 -0.023 -0.130 0.058  4300 THR B C   
2716 O O   . THR B 50  ? 0.487 0.250 0.433 -0.018 -0.137 0.062  4300 THR B O   
2717 C CB  . THR B 50  ? 0.501 0.270 0.425 -0.038 -0.120 0.069  4300 THR B CB  
2718 O OG1 . THR B 50  ? 0.505 0.283 0.409 -0.038 -0.119 0.075  4300 THR B OG1 
2719 C CG2 . THR B 50  ? 0.501 0.274 0.430 -0.045 -0.112 0.068  4300 THR B CG2 
2720 N N   . HIS B 51  ? 0.472 0.259 0.397 -0.021 -0.130 0.057  4301 HIS B N   
2721 C CA  . HIS B 51  ? 0.491 0.281 0.420 -0.016 -0.140 0.061  4301 HIS B CA  
2722 C C   . HIS B 51  ? 0.512 0.290 0.430 -0.018 -0.148 0.076  4301 HIS B C   
2723 O O   . HIS B 51  ? 0.535 0.308 0.462 -0.012 -0.159 0.081  4301 HIS B O   
2724 C CB  . HIS B 51  ? 0.489 0.282 0.442 -0.007 -0.143 0.053  4301 HIS B CB  
2725 C CG  . HIS B 51  ? 0.468 0.275 0.427 -0.006 -0.135 0.041  4301 HIS B CG  
2726 N ND1 . HIS B 51  ? 0.465 0.286 0.428 -0.004 -0.136 0.039  4301 HIS B ND1 
2727 C CD2 . HIS B 51  ? 0.464 0.273 0.423 -0.006 -0.126 0.032  4301 HIS B CD2 
2728 C CE1 . HIS B 51  ? 0.455 0.286 0.422 -0.004 -0.127 0.030  4301 HIS B CE1 
2729 N NE2 . HIS B 51  ? 0.450 0.273 0.413 -0.004 -0.121 0.025  4301 HIS B NE2 
2730 N N   . THR B 52  ? 0.524 0.298 0.424 -0.025 -0.143 0.083  4302 THR B N   
2731 C CA  . THR B 52  ? 0.555 0.317 0.438 -0.027 -0.148 0.100  4302 THR B CA  
2732 C C   . THR B 52  ? 0.565 0.334 0.418 -0.031 -0.143 0.102  4302 THR B C   
2733 O O   . THR B 52  ? 0.592 0.355 0.426 -0.035 -0.140 0.115  4302 THR B O   
2734 C CB  . THR B 52  ? 0.566 0.314 0.455 -0.032 -0.144 0.110  4302 THR B CB  
2735 O OG1 . THR B 52  ? 0.543 0.298 0.430 -0.039 -0.131 0.105  4302 THR B OG1 
2736 C CG2 . THR B 52  ? 0.566 0.302 0.482 -0.027 -0.149 0.106  4302 THR B CG2 
2737 N N   . GLY B 53  ? 0.565 0.346 0.415 -0.030 -0.142 0.090  4303 GLY B N   
2738 C CA  . GLY B 53  ? 0.570 0.357 0.392 -0.032 -0.139 0.088  4303 GLY B CA  
2739 C C   . GLY B 53  ? 0.586 0.370 0.388 -0.029 -0.152 0.093  4303 GLY B C   
2740 O O   . GLY B 53  ? 0.593 0.372 0.404 -0.026 -0.164 0.100  4303 GLY B O   
2741 N N   . THR B 54  ? 0.597 0.383 0.371 -0.030 -0.150 0.089  4304 THR B N   
2742 C CA  . THR B 54  ? 0.633 0.414 0.379 -0.028 -0.163 0.092  4304 THR B CA  
2743 C C   . THR B 54  ? 0.622 0.408 0.385 -0.026 -0.180 0.084  4304 THR B C   
2744 O O   . THR B 54  ? 0.625 0.408 0.375 -0.023 -0.196 0.089  4304 THR B O   
2745 C CB  . THR B 54  ? 0.654 0.436 0.366 -0.028 -0.156 0.085  4304 THR B CB  
2746 O OG1 . THR B 54  ? 0.617 0.405 0.342 -0.029 -0.153 0.069  4304 THR B OG1 
2747 C CG2 . THR B 54  ? 0.670 0.451 0.366 -0.030 -0.138 0.094  4304 THR B CG2 
2748 N N   . GLY B 55  ? 0.585 0.380 0.377 -0.026 -0.176 0.073  4305 GLY B N   
2749 C CA  . GLY B 55  ? 0.589 0.392 0.401 -0.025 -0.190 0.066  4305 GLY B CA  
2750 C C   . GLY B 55  ? 0.601 0.405 0.396 -0.028 -0.196 0.056  4305 GLY B C   
2751 O O   . GLY B 55  ? 0.612 0.422 0.425 -0.029 -0.209 0.051  4305 GLY B O   
2752 N N   . GLN B 56  ? 0.611 0.407 0.374 -0.029 -0.187 0.052  4306 GLN B N   
2753 C CA  . GLN B 56  ? 0.633 0.425 0.377 -0.031 -0.192 0.039  4306 GLN B CA  
2754 C C   . GLN B 56  ? 0.589 0.389 0.364 -0.034 -0.188 0.029  4306 GLN B C   
2755 O O   . GLN B 56  ? 0.545 0.351 0.342 -0.034 -0.175 0.030  4306 GLN B O   
2756 C CB  . GLN B 56  ? 0.672 0.456 0.377 -0.029 -0.182 0.037  4306 GLN B CB  
2757 C CG  . GLN B 56  ? 0.742 0.518 0.412 -0.026 -0.187 0.048  4306 GLN B CG  
2758 C CD  . GLN B 56  ? 0.798 0.566 0.425 -0.023 -0.177 0.043  4306 GLN B CD  
2759 O OE1 . GLN B 56  ? 0.840 0.612 0.468 -0.022 -0.158 0.041  4306 GLN B OE1 
2760 N NE2 . GLN B 56  ? 0.860 0.619 0.450 -0.020 -0.190 0.042  4306 GLN B NE2 
2761 N N   . ALA B 57  ? 0.590 0.387 0.363 -0.037 -0.200 0.020  4307 ALA B N   
2762 C CA  . ALA B 57  ? 0.574 0.377 0.376 -0.041 -0.198 0.012  4307 ALA B CA  
2763 C C   . ALA B 57  ? 0.561 0.361 0.361 -0.041 -0.180 0.006  4307 ALA B C   
2764 O O   . ALA B 57  ? 0.540 0.350 0.367 -0.041 -0.171 0.008  4307 ALA B O   
2765 C CB  . ALA B 57  ? 0.603 0.400 0.401 -0.046 -0.217 0.004  4307 ALA B CB  
2766 N N   . ILE B 58  ? 0.583 0.371 0.351 -0.039 -0.176 -0.001 4308 ILE B N   
2767 C CA  . ILE B 58  ? 0.573 0.359 0.340 -0.037 -0.160 -0.007 4308 ILE B CA  
2768 C C   . ILE B 58  ? 0.578 0.362 0.319 -0.032 -0.147 -0.004 4308 ILE B C   
2769 O O   . ILE B 58  ? 0.599 0.374 0.307 -0.029 -0.151 -0.006 4308 ILE B O   
2770 C CB  . ILE B 58  ? 0.596 0.370 0.358 -0.039 -0.166 -0.019 4308 ILE B CB  
2771 C CG1 . ILE B 58  ? 0.594 0.371 0.384 -0.047 -0.180 -0.019 4308 ILE B CG1 
2772 C CG2 . ILE B 58  ? 0.587 0.358 0.349 -0.036 -0.150 -0.023 4308 ILE B CG2 
2773 C CD1 . ILE B 58  ? 0.617 0.380 0.403 -0.051 -0.190 -0.031 4308 ILE B CD1 
2774 N N   . THR B 59  ? 0.543 0.336 0.297 -0.030 -0.132 0.001  4309 THR B N   
2775 C CA  . THR B 59  ? 0.551 0.345 0.288 -0.027 -0.119 0.006  4309 THR B CA  
2776 C C   . THR B 59  ? 0.538 0.338 0.285 -0.024 -0.104 0.003  4309 THR B C   
2777 O O   . THR B 59  ? 0.520 0.322 0.288 -0.026 -0.103 -0.001 4309 THR B O   
2778 C CB  . THR B 59  ? 0.554 0.354 0.301 -0.029 -0.120 0.019  4309 THR B CB  
2779 O OG1 . THR B 59  ? 0.523 0.331 0.303 -0.031 -0.120 0.020  4309 THR B OG1 
2780 C CG2 . THR B 59  ? 0.584 0.379 0.318 -0.029 -0.136 0.024  4309 THR B CG2 
2781 N N   . VAL B 60  ? 0.549 0.353 0.281 -0.021 -0.091 0.006  4310 VAL B N   
2782 C CA  . VAL B 60  ? 0.542 0.353 0.283 -0.017 -0.077 0.003  4310 VAL B CA  
2783 C C   . VAL B 60  ? 0.516 0.338 0.286 -0.021 -0.073 0.010  4310 VAL B C   
2784 O O   . VAL B 60  ? 0.480 0.309 0.264 -0.019 -0.066 0.007  4310 VAL B O   
2785 C CB  . VAL B 60  ? 0.575 0.389 0.293 -0.012 -0.064 0.005  4310 VAL B CB  
2786 C CG1 . VAL B 60  ? 0.621 0.422 0.306 -0.006 -0.068 -0.005 4310 VAL B CG1 
2787 C CG2 . VAL B 60  ? 0.586 0.407 0.300 -0.016 -0.060 0.019  4310 VAL B CG2 
2788 N N   . THR B 61  ? 0.516 0.338 0.294 -0.025 -0.079 0.019  4311 THR B N   
2789 C CA  . THR B 61  ? 0.518 0.347 0.322 -0.029 -0.078 0.024  4311 THR B CA  
2790 C C   . THR B 61  ? 0.509 0.334 0.323 -0.031 -0.090 0.027  4311 THR B C   
2791 O O   . THR B 61  ? 0.524 0.343 0.324 -0.031 -0.098 0.028  4311 THR B O   
2792 C CB  . THR B 61  ? 0.543 0.379 0.349 -0.031 -0.069 0.033  4311 THR B CB  
2793 O OG1 . THR B 61  ? 0.570 0.411 0.401 -0.033 -0.068 0.034  4311 THR B OG1 
2794 C CG2 . THR B 61  ? 0.568 0.398 0.360 -0.033 -0.072 0.044  4311 THR B CG2 
2795 N N   . PRO B 62  ? 0.485 0.313 0.322 -0.032 -0.091 0.026  4312 PRO B N   
2796 C CA  . PRO B 62  ? 0.478 0.303 0.326 -0.032 -0.101 0.029  4312 PRO B CA  
2797 C C   . PRO B 62  ? 0.492 0.311 0.331 -0.033 -0.107 0.039  4312 PRO B C   
2798 O O   . PRO B 62  ? 0.495 0.313 0.331 -0.035 -0.102 0.046  4312 PRO B O   
2799 C CB  . PRO B 62  ? 0.462 0.291 0.331 -0.031 -0.098 0.027  4312 PRO B CB  
2800 C CG  . PRO B 62  ? 0.458 0.293 0.328 -0.030 -0.090 0.020  4312 PRO B CG  
2801 C CD  . PRO B 62  ? 0.479 0.314 0.331 -0.031 -0.084 0.022  4312 PRO B CD  
2802 N N   . GLU B 63  ? 0.504 0.321 0.340 -0.032 -0.118 0.040  4313 GLU B N   
2803 C CA  . GLU B 63  ? 0.522 0.332 0.346 -0.032 -0.126 0.050  4313 GLU B CA  
2804 C C   . GLU B 63  ? 0.517 0.328 0.360 -0.029 -0.138 0.053  4313 GLU B C   
2805 O O   . GLU B 63  ? 0.543 0.349 0.376 -0.028 -0.149 0.060  4313 GLU B O   
2806 C CB  . GLU B 63  ? 0.550 0.355 0.342 -0.032 -0.130 0.050  4313 GLU B CB  
2807 C CG  . GLU B 63  ? 0.565 0.371 0.337 -0.032 -0.116 0.051  4313 GLU B CG  
2808 C CD  . GLU B 63  ? 0.591 0.395 0.358 -0.034 -0.110 0.065  4313 GLU B CD  
2809 O OE1 . GLU B 63  ? 0.605 0.403 0.381 -0.035 -0.118 0.075  4313 GLU B OE1 
2810 O OE2 . GLU B 63  ? 0.602 0.409 0.359 -0.035 -0.097 0.068  4313 GLU B OE2 
2811 N N   . ALA B 64  ? 0.486 0.303 0.355 -0.028 -0.136 0.047  4314 ALA B N   
2812 C CA  . ALA B 64  ? 0.487 0.307 0.378 -0.024 -0.146 0.049  4314 ALA B CA  
2813 C C   . ALA B 64  ? 0.502 0.312 0.393 -0.021 -0.152 0.060  4314 ALA B C   
2814 O O   . ALA B 64  ? 0.482 0.284 0.367 -0.023 -0.145 0.065  4314 ALA B O   
2815 C CB  . ALA B 64  ? 0.473 0.301 0.388 -0.021 -0.139 0.041  4314 ALA B CB  
2816 N N   . ASN B 65  ? 0.515 0.327 0.414 -0.017 -0.165 0.064  4315 ASN B N   
2817 C CA  . ASN B 65  ? 0.541 0.343 0.444 -0.013 -0.173 0.076  4315 ASN B CA  
2818 C C   . ASN B 65  ? 0.537 0.344 0.473 -0.006 -0.173 0.071  4315 ASN B C   
2819 O O   . ASN B 65  ? 0.489 0.306 0.438 -0.006 -0.164 0.060  4315 ASN B O   
2820 C CB  . ASN B 65  ? 0.561 0.361 0.450 -0.012 -0.189 0.085  4315 ASN B CB  
2821 C CG  . ASN B 65  ? 0.557 0.371 0.463 -0.010 -0.201 0.079  4315 ASN B CG  
2822 O OD1 . ASN B 65  ? 0.533 0.359 0.468 -0.007 -0.197 0.072  4315 ASN B OD1 
2823 N ND2 . ASN B 65  ? 0.581 0.395 0.470 -0.011 -0.215 0.083  4315 ASN B ND2 
2824 N N   A MET B 66  ? 0.558 0.358 0.507 0.000  -0.181 0.079  4316 MET B N   
2825 N N   B MET B 66  ? 0.558 0.358 0.507 0.000  -0.181 0.079  4316 MET B N   
2826 C CA  A MET B 66  ? 0.567 0.369 0.546 0.009  -0.180 0.073  4316 MET B CA  
2827 C CA  B MET B 66  ? 0.567 0.369 0.546 0.010  -0.180 0.074  4316 MET B CA  
2828 C C   A MET B 66  ? 0.547 0.371 0.548 0.014  -0.182 0.067  4316 MET B C   
2829 C C   B MET B 66  ? 0.548 0.372 0.550 0.014  -0.183 0.067  4316 MET B C   
2830 O O   A MET B 66  ? 0.541 0.373 0.566 0.021  -0.175 0.059  4316 MET B O   
2831 O O   B MET B 66  ? 0.543 0.374 0.569 0.022  -0.177 0.060  4316 MET B O   
2832 C CB  A MET B 66  ? 0.611 0.399 0.599 0.017  -0.190 0.084  4316 MET B CB  
2833 C CB  B MET B 66  ? 0.612 0.400 0.599 0.016  -0.191 0.085  4316 MET B CB  
2834 C CG  A MET B 66  ? 0.624 0.410 0.640 0.028  -0.187 0.076  4316 MET B CG  
2835 C CG  B MET B 66  ? 0.643 0.433 0.626 0.019  -0.207 0.095  4316 MET B CG  
2836 S SD  A MET B 66  ? 0.673 0.439 0.702 0.038  -0.200 0.088  4316 MET B SD  
2837 S SD  B MET B 66  ? 0.711 0.479 0.692 0.025  -0.220 0.113  4316 MET B SD  
2838 C CE  A MET B 66  ? 0.693 0.475 0.731 0.043  -0.217 0.097  4316 MET B CE  
2839 C CE  B MET B 66  ? 0.713 0.476 0.731 0.037  -0.216 0.105  4316 MET B CE  
2840 N N   . ASP B 67  ? 0.537 0.372 0.533 0.009  -0.191 0.069  4317 ASP B N   
2841 C CA  . ASP B 67  ? 0.525 0.381 0.546 0.011  -0.194 0.064  4317 ASP B CA  
2842 C C   . ASP B 67  ? 0.490 0.356 0.504 0.003  -0.186 0.056  4317 ASP B C   
2843 O O   . ASP B 67  ? 0.466 0.349 0.499 0.001  -0.191 0.054  4317 ASP B O   
2844 C CB  . ASP B 67  ? 0.560 0.422 0.587 0.012  -0.214 0.073  4317 ASP B CB  
2845 C CG  . ASP B 67  ? 0.589 0.441 0.625 0.023  -0.223 0.082  4317 ASP B CG  
2846 O OD1 . ASP B 67  ? 0.591 0.442 0.648 0.031  -0.215 0.079  4317 ASP B OD1 
2847 O OD2 . ASP B 67  ? 0.643 0.487 0.664 0.022  -0.238 0.092  4317 ASP B OD2 
2848 N N   . GLN B 68  ? 0.469 0.325 0.462 -0.002 -0.174 0.052  4318 GLN B N   
2849 C CA  . GLN B 68  ? 0.450 0.313 0.436 -0.009 -0.167 0.044  4318 GLN B CA  
2850 C C   . GLN B 68  ? 0.438 0.298 0.421 -0.009 -0.150 0.038  4318 GLN B C   
2851 O O   . GLN B 68  ? 0.420 0.270 0.400 -0.005 -0.146 0.039  4318 GLN B O   
2852 C CB  . GLN B 68  ? 0.466 0.318 0.420 -0.017 -0.171 0.046  4318 GLN B CB  
2853 C CG  . GLN B 68  ? 0.483 0.335 0.431 -0.018 -0.189 0.050  4318 GLN B CG  
2854 C CD  . GLN B 68  ? 0.497 0.335 0.407 -0.023 -0.191 0.051  4318 GLN B CD  
2855 O OE1 . GLN B 68  ? 0.501 0.329 0.392 -0.023 -0.181 0.053  4318 GLN B OE1 
2856 N NE2 . GLN B 68  ? 0.507 0.344 0.403 -0.026 -0.205 0.050  4318 GLN B NE2 
2857 N N   . GLU B 69  ? 0.429 0.297 0.413 -0.013 -0.143 0.032  4319 GLU B N   
2858 C CA  . GLU B 69  ? 0.428 0.293 0.404 -0.013 -0.129 0.026  4319 GLU B CA  
2859 C C   . GLU B 69  ? 0.428 0.287 0.381 -0.020 -0.128 0.024  4319 GLU B C   
2860 O O   . GLU B 69  ? 0.441 0.302 0.393 -0.025 -0.136 0.025  4319 GLU B O   
2861 C CB  . GLU B 69  ? 0.434 0.314 0.430 -0.010 -0.120 0.023  4319 GLU B CB  
2862 C CG  . GLU B 69  ? 0.457 0.344 0.475 0.000  -0.118 0.023  4319 GLU B CG  
2863 C CD  . GLU B 69  ? 0.487 0.364 0.497 0.006  -0.112 0.018  4319 GLU B CD  
2864 O OE1 . GLU B 69  ? 0.503 0.385 0.526 0.015  -0.106 0.014  4319 GLU B OE1 
2865 O OE2 . GLU B 69  ? 0.514 0.376 0.503 0.001  -0.112 0.017  4319 GLU B OE2 
2866 N N   . SER B 70  ? 0.426 0.278 0.364 -0.021 -0.120 0.022  4320 SER B N   
2867 C CA  . SER B 70  ? 0.420 0.267 0.339 -0.026 -0.117 0.019  4320 SER B CA  
2868 C C   . SER B 70  ? 0.408 0.260 0.331 -0.026 -0.108 0.014  4320 SER B C   
2869 O O   . SER B 70  ? 0.405 0.260 0.336 -0.022 -0.101 0.012  4320 SER B O   
2870 C CB  . SER B 70  ? 0.432 0.270 0.333 -0.027 -0.114 0.021  4320 SER B CB  
2871 O OG  . SER B 70  ? 0.449 0.281 0.341 -0.027 -0.122 0.028  4320 SER B OG  
2872 N N   . PHE B 71  ? 0.403 0.254 0.321 -0.029 -0.109 0.012  4321 PHE B N   
2873 C CA  . PHE B 71  ? 0.390 0.243 0.311 -0.029 -0.101 0.009  4321 PHE B CA  
2874 C C   . PHE B 71  ? 0.397 0.241 0.299 -0.031 -0.099 0.006  4321 PHE B C   
2875 O O   . PHE B 71  ? 0.412 0.248 0.300 -0.033 -0.105 0.005  4321 PHE B O   
2876 C CB  . PHE B 71  ? 0.389 0.249 0.327 -0.033 -0.103 0.011  4321 PHE B CB  
2877 C CG  . PHE B 71  ? 0.383 0.256 0.344 -0.030 -0.102 0.014  4321 PHE B CG  
2878 C CD1 . PHE B 71  ? 0.389 0.266 0.360 -0.029 -0.112 0.017  4321 PHE B CD1 
2879 C CD2 . PHE B 71  ? 0.378 0.261 0.349 -0.026 -0.092 0.015  4321 PHE B CD2 
2880 C CE1 . PHE B 71  ? 0.386 0.277 0.381 -0.025 -0.110 0.020  4321 PHE B CE1 
2881 C CE2 . PHE B 71  ? 0.373 0.269 0.364 -0.021 -0.089 0.017  4321 PHE B CE2 
2882 C CZ  . PHE B 71  ? 0.378 0.279 0.384 -0.020 -0.098 0.019  4321 PHE B CZ  
2883 N N   . GLY B 72  ? 0.398 0.242 0.298 -0.029 -0.091 0.004  4322 GLY B N   
2884 C CA  . GLY B 72  ? 0.410 0.245 0.296 -0.029 -0.089 0.001  4322 GLY B CA  
2885 C C   . GLY B 72  ? 0.424 0.252 0.312 -0.034 -0.096 0.000  4322 GLY B C   
2886 O O   . GLY B 72  ? 0.425 0.258 0.329 -0.037 -0.097 0.003  4322 GLY B O   
2887 N N   . GLY B 73  ? 0.454 0.271 0.326 -0.034 -0.101 -0.005 4323 GLY B N   
2