data_6WLY
# 
_entry.id   6WLY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.331 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WLY         
WWPDB D_1000248182 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WLY 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chetty, A.K.' 1 ? 
'Ha, B.H.'     2 ? 
'Boggon, T.J.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_id_ASTM           JSBIEM 
_citation.journal_id_CSD            0803 
_citation.journal_id_ISSN           1095-8657 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            211 
_citation.language                  ? 
_citation.page_first                107553 
_citation.page_last                 107553 
_citation.title                     'Recognition of physiological phosphorylation sites by p21-activated kinase 4.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2020.107553 
_citation.pdbx_database_id_PubMed   32585314 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chetty, A.K.' 1 ? 
primary 'Sexton, J.A.' 2 ? 
primary 'Ha, B.H.'     3 ? 
primary 'Turk, B.E.'   4 ? 
primary 'Boggon, T.J.' 5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WLY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     61.626 
_cell.length_a_esd                 ? 
_cell.length_b                     61.626 
_cell.length_b_esd                 ? 
_cell.length_c                     179.596 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WLY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Serine/threonine-protein kinase PAK 4' 39123.133 1   2.7.11.1 ? ? ? 
2 polymer syn 'LIM Kinase 1 peptide'                  1224.456  1   2.7.11.1 ? ? ? 
3 water   nat water                                   18.015    135 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'p21-activated kinase 4,PAK-4' 
2 LIMK-1                         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MGSSHHHHHHSSGLVPRGSHMENLYFQGARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFI
KIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTD
IVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRK(SEP)LVGTPYW
MAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRA
TAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
;MGSSHHHHHHSSGLVPRGSHMENLYFQGARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFI
KIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTD
IVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPE
LISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAE
LLKHPFLAKAGPPASIVPLMRQNRTR
;
A ? 
2 'polypeptide(L)' no no  RKKRYTVVGN RKKRYTVVGN B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  GLU n 
1 23  ASN n 
1 24  LEU n 
1 25  TYR n 
1 26  PHE n 
1 27  GLN n 
1 28  GLY n 
1 29  ALA n 
1 30  ARG n 
1 31  ALA n 
1 32  ARG n 
1 33  GLN n 
1 34  GLU n 
1 35  ASN n 
1 36  GLY n 
1 37  MET n 
1 38  PRO n 
1 39  GLU n 
1 40  LYS n 
1 41  PRO n 
1 42  PRO n 
1 43  GLY n 
1 44  PRO n 
1 45  ARG n 
1 46  SER n 
1 47  PRO n 
1 48  GLN n 
1 49  ARG n 
1 50  GLU n 
1 51  PRO n 
1 52  GLN n 
1 53  ARG n 
1 54  VAL n 
1 55  SER n 
1 56  HIS n 
1 57  GLU n 
1 58  GLN n 
1 59  PHE n 
1 60  ARG n 
1 61  ALA n 
1 62  ALA n 
1 63  LEU n 
1 64  GLN n 
1 65  LEU n 
1 66  VAL n 
1 67  VAL n 
1 68  ASP n 
1 69  PRO n 
1 70  GLY n 
1 71  ASP n 
1 72  PRO n 
1 73  ARG n 
1 74  SER n 
1 75  TYR n 
1 76  LEU n 
1 77  ASP n 
1 78  ASN n 
1 79  PHE n 
1 80  ILE n 
1 81  LYS n 
1 82  ILE n 
1 83  GLY n 
1 84  GLU n 
1 85  GLY n 
1 86  SER n 
1 87  THR n 
1 88  GLY n 
1 89  ILE n 
1 90  VAL n 
1 91  CYS n 
1 92  ILE n 
1 93  ALA n 
1 94  THR n 
1 95  VAL n 
1 96  ARG n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 LYS n 
1 101 LEU n 
1 102 VAL n 
1 103 ALA n 
1 104 VAL n 
1 105 LYS n 
1 106 LYS n 
1 107 MET n 
1 108 ASP n 
1 109 LEU n 
1 110 ARG n 
1 111 LYS n 
1 112 GLN n 
1 113 GLN n 
1 114 ARG n 
1 115 ARG n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 PHE n 
1 120 ASN n 
1 121 GLU n 
1 122 VAL n 
1 123 VAL n 
1 124 ILE n 
1 125 MET n 
1 126 ARG n 
1 127 ASP n 
1 128 TYR n 
1 129 GLN n 
1 130 HIS n 
1 131 GLU n 
1 132 ASN n 
1 133 VAL n 
1 134 VAL n 
1 135 GLU n 
1 136 MET n 
1 137 TYR n 
1 138 ASN n 
1 139 SER n 
1 140 TYR n 
1 141 LEU n 
1 142 VAL n 
1 143 GLY n 
1 144 ASP n 
1 145 GLU n 
1 146 LEU n 
1 147 TRP n 
1 148 VAL n 
1 149 VAL n 
1 150 MET n 
1 151 GLU n 
1 152 PHE n 
1 153 LEU n 
1 154 GLU n 
1 155 GLY n 
1 156 GLY n 
1 157 ALA n 
1 158 LEU n 
1 159 THR n 
1 160 ASP n 
1 161 ILE n 
1 162 VAL n 
1 163 THR n 
1 164 HIS n 
1 165 THR n 
1 166 ARG n 
1 167 MET n 
1 168 ASN n 
1 169 GLU n 
1 170 GLU n 
1 171 GLN n 
1 172 ILE n 
1 173 ALA n 
1 174 ALA n 
1 175 VAL n 
1 176 CYS n 
1 177 LEU n 
1 178 ALA n 
1 179 VAL n 
1 180 LEU n 
1 181 GLN n 
1 182 ALA n 
1 183 LEU n 
1 184 SER n 
1 185 VAL n 
1 186 LEU n 
1 187 HIS n 
1 188 ALA n 
1 189 GLN n 
1 190 GLY n 
1 191 VAL n 
1 192 ILE n 
1 193 HIS n 
1 194 ARG n 
1 195 ASP n 
1 196 ILE n 
1 197 LYS n 
1 198 SER n 
1 199 ASP n 
1 200 SER n 
1 201 ILE n 
1 202 LEU n 
1 203 LEU n 
1 204 THR n 
1 205 HIS n 
1 206 ASP n 
1 207 GLY n 
1 208 ARG n 
1 209 VAL n 
1 210 LYS n 
1 211 LEU n 
1 212 SER n 
1 213 ASP n 
1 214 PHE n 
1 215 GLY n 
1 216 PHE n 
1 217 CYS n 
1 218 ALA n 
1 219 GLN n 
1 220 VAL n 
1 221 SER n 
1 222 LYS n 
1 223 GLU n 
1 224 VAL n 
1 225 PRO n 
1 226 ARG n 
1 227 ARG n 
1 228 LYS n 
1 229 SEP n 
1 230 LEU n 
1 231 VAL n 
1 232 GLY n 
1 233 THR n 
1 234 PRO n 
1 235 TYR n 
1 236 TRP n 
1 237 MET n 
1 238 ALA n 
1 239 PRO n 
1 240 GLU n 
1 241 LEU n 
1 242 ILE n 
1 243 SER n 
1 244 ARG n 
1 245 LEU n 
1 246 PRO n 
1 247 TYR n 
1 248 GLY n 
1 249 PRO n 
1 250 GLU n 
1 251 VAL n 
1 252 ASP n 
1 253 ILE n 
1 254 TRP n 
1 255 SER n 
1 256 LEU n 
1 257 GLY n 
1 258 ILE n 
1 259 MET n 
1 260 VAL n 
1 261 ILE n 
1 262 GLU n 
1 263 MET n 
1 264 VAL n 
1 265 ASP n 
1 266 GLY n 
1 267 GLU n 
1 268 PRO n 
1 269 PRO n 
1 270 TYR n 
1 271 PHE n 
1 272 ASN n 
1 273 GLU n 
1 274 PRO n 
1 275 PRO n 
1 276 LEU n 
1 277 LYS n 
1 278 ALA n 
1 279 MET n 
1 280 LYS n 
1 281 MET n 
1 282 ILE n 
1 283 ARG n 
1 284 ASP n 
1 285 ASN n 
1 286 LEU n 
1 287 PRO n 
1 288 PRO n 
1 289 ARG n 
1 290 LEU n 
1 291 LYS n 
1 292 ASN n 
1 293 LEU n 
1 294 HIS n 
1 295 LYS n 
1 296 VAL n 
1 297 SER n 
1 298 PRO n 
1 299 SER n 
1 300 LEU n 
1 301 LYS n 
1 302 GLY n 
1 303 PHE n 
1 304 LEU n 
1 305 ASP n 
1 306 ARG n 
1 307 LEU n 
1 308 LEU n 
1 309 VAL n 
1 310 ARG n 
1 311 ASP n 
1 312 PRO n 
1 313 ALA n 
1 314 GLN n 
1 315 ARG n 
1 316 ALA n 
1 317 THR n 
1 318 ALA n 
1 319 ALA n 
1 320 GLU n 
1 321 LEU n 
1 322 LEU n 
1 323 LYS n 
1 324 HIS n 
1 325 PRO n 
1 326 PHE n 
1 327 LEU n 
1 328 ALA n 
1 329 LYS n 
1 330 ALA n 
1 331 GLY n 
1 332 PRO n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 ILE n 
1 337 VAL n 
1 338 PRO n 
1 339 LEU n 
1 340 MET n 
1 341 ARG n 
1 342 GLN n 
1 343 ASN n 
1 344 ARG n 
1 345 THR n 
1 346 ARG n 
2 1   ARG n 
2 2   LYS n 
2 3   LYS n 
2 4   ARG n 
2 5   TYR n 
2 6   THR n 
2 7   VAL n 
2 8   VAL n 
2 9   GLY n 
2 10  ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   346 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PAK4, KIAA1142' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       10 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PAK4_HUMAN  O96013 O96013-2 1 
;ARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMD
LRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHA
QGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEP
PYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
109 
2 UNP LIMK1_HUMAN P53667 ?        2 RKKRYTVVGN 503 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WLY A 29 ? 346 ? O96013 109 ? 426 ? 274 591 
2 2 6WLY B 1  ? 10  ? P53667 503 ? 512 ? 503 512 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WLY MET A 1  ? UNP O96013 ? ? 'expression tag' 246 1  
1 6WLY GLY A 2  ? UNP O96013 ? ? 'expression tag' 247 2  
1 6WLY SER A 3  ? UNP O96013 ? ? 'expression tag' 248 3  
1 6WLY SER A 4  ? UNP O96013 ? ? 'expression tag' 249 4  
1 6WLY HIS A 5  ? UNP O96013 ? ? 'expression tag' 250 5  
1 6WLY HIS A 6  ? UNP O96013 ? ? 'expression tag' 251 6  
1 6WLY HIS A 7  ? UNP O96013 ? ? 'expression tag' 252 7  
1 6WLY HIS A 8  ? UNP O96013 ? ? 'expression tag' 253 8  
1 6WLY HIS A 9  ? UNP O96013 ? ? 'expression tag' 254 9  
1 6WLY HIS A 10 ? UNP O96013 ? ? 'expression tag' 255 10 
1 6WLY SER A 11 ? UNP O96013 ? ? 'expression tag' 256 11 
1 6WLY SER A 12 ? UNP O96013 ? ? 'expression tag' 257 12 
1 6WLY GLY A 13 ? UNP O96013 ? ? 'expression tag' 258 13 
1 6WLY LEU A 14 ? UNP O96013 ? ? 'expression tag' 259 14 
1 6WLY VAL A 15 ? UNP O96013 ? ? 'expression tag' 260 15 
1 6WLY PRO A 16 ? UNP O96013 ? ? 'expression tag' 261 16 
1 6WLY ARG A 17 ? UNP O96013 ? ? 'expression tag' 262 17 
1 6WLY GLY A 18 ? UNP O96013 ? ? 'expression tag' 263 18 
1 6WLY SER A 19 ? UNP O96013 ? ? 'expression tag' 264 19 
1 6WLY HIS A 20 ? UNP O96013 ? ? 'expression tag' 265 20 
1 6WLY MET A 21 ? UNP O96013 ? ? 'expression tag' 266 21 
1 6WLY GLU A 22 ? UNP O96013 ? ? 'expression tag' 267 22 
1 6WLY ASN A 23 ? UNP O96013 ? ? 'expression tag' 268 23 
1 6WLY LEU A 24 ? UNP O96013 ? ? 'expression tag' 269 24 
1 6WLY TYR A 25 ? UNP O96013 ? ? 'expression tag' 270 25 
1 6WLY PHE A 26 ? UNP O96013 ? ? 'expression tag' 271 26 
1 6WLY GLN A 27 ? UNP O96013 ? ? 'expression tag' 272 27 
1 6WLY GLY A 28 ? UNP O96013 ? ? 'expression tag' 273 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WLY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.79 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, 2M Na acetate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K, 2mM peptide' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-07-07 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6WLY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.900 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28404 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  20.300 
_reflns.pdbx_Rmerge_I_obs                0.140 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.984 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.143 
_reflns.pdbx_Rpim_I_all                  0.030 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         576393 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
1.900 1.970  ? ? ? ? ? ? 2747 99.900  ? ? ? ? 1.502 ? ? ? ? ? ? ? ? 15.300 ? 0.837 ? ? 1.553 0.386 ? 1  1 0.615 ? ? 
1.970 2.050  ? ? ? ? ? ? 2778 99.900  ? ? ? ? 1.054 ? ? ? ? ? ? ? ? 20.300 ? 0.676 ? ? 1.080 0.232 ? 2  1 0.864 ? ? 
2.050 2.140  ? ? ? ? ? ? 2795 99.900  ? ? ? ? 0.756 ? ? ? ? ? ? ? ? 21.500 ? 0.737 ? ? 0.774 0.161 ? 3  1 0.943 ? ? 
2.140 2.250  ? ? ? ? ? ? 2770 99.900  ? ? ? ? 0.623 ? ? ? ? ? ? ? ? 20.100 ? 1.041 ? ? 0.639 0.138 ? 4  1 0.952 ? ? 
2.250 2.390  ? ? ? ? ? ? 2796 99.800  ? ? ? ? 0.412 ? ? ? ? ? ? ? ? 20.100 ? 1.034 ? ? 0.423 0.091 ? 5  1 0.978 ? ? 
2.390 2.580  ? ? ? ? ? ? 2833 100.000 ? ? ? ? 0.291 ? ? ? ? ? ? ? ? 19.300 ? 1.065 ? ? 0.299 0.066 ? 6  1 0.983 ? ? 
2.580 2.840  ? ? ? ? ? ? 2813 99.800  ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 17.300 ? 1.098 ? ? 0.207 0.049 ? 7  1 0.991 ? ? 
2.840 3.250  ? ? ? ? ? ? 2866 100.000 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 23.800 ? 1.126 ? ? 0.142 0.029 ? 8  1 0.997 ? ? 
3.250 4.090  ? ? ? ? ? ? 2900 100.000 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 23.900 ? 1.071 ? ? 0.105 0.021 ? 9  1 0.998 ? ? 
4.090 50.000 ? ? ? ? ? ? 3106 99.600  ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 20.900 ? 1.083 ? ? 0.125 0.027 ? 10 1 0.996 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                108.100 
_refine.B_iso_mean                               45.0861 
_refine.B_iso_min                                28.980 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WLY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9000 
_refine.ls_d_res_low                             43.5800 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28228 
_refine.ls_number_reflns_R_free                  1412 
_refine.ls_number_reflns_R_work                  26816 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8900 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1871 
_refine.ls_R_factor_R_free                       0.2053 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1861 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4FIJ 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.3900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.9000 
_refine_hist.d_res_low                        43.5800 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               2518 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       301 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          47.85 
_refine_hist.pdbx_number_atoms_protein        2383 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9000 1.9700  2759 . 138 2621 100.0000 . . . 0.3207 0.0000 0.3151 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.9700 2.0500  2760 . 138 2622 100.0000 . . . 0.3024 0.0000 0.2571 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.0500 2.1400  2758 . 138 2620 100.0000 . . . 0.2402 0.0000 0.2336 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.1400 2.2500  2754 . 137 2617 100.0000 . . . 0.2573 0.0000 0.2359 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.2500 2.3900  2800 . 141 2659 100.0000 . . . 0.2809 0.0000 0.2269 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.3900 2.5800  2807 . 140 2667 100.0000 . . . 0.2625 0.0000 0.2221 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.5800 2.8400  2802 . 140 2662 100.0000 . . . 0.2284 0.0000 0.2068 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.8400 3.2500  2852 . 143 2709 100.0000 . . . 0.2216 0.0000 0.2043 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.2500 4.0900  2877 . 143 2734 100.0000 . . . 0.1880 0.0000 0.1599 . . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 4.0900 43.5800 3059 . 154 2905 100.0000 . . . 0.1600 0.0000 0.1532 . . . . . . . 10 . . . 
# 
_struct.entry_id                     6WLY 
_struct.title                        'PAK4 kinase domain in complex with LIMK1 Thr508 substrate peptide' 
_struct.pdbx_descriptor              'Serine/threonine-protein kinase PAK 4 (E.C.2.7.11.1), LIM Kinase 1 peptide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WLY 
_struct_keywords.text            'serine/threonine kinase PAK4, LIM kinase 1, LIMK1, phosphopeptide, Thr508, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 55  ? VAL A 67  ? SER A 300 VAL A 312 1 ? 13 
HELX_P HELX_P2  AA2 ASP A 71  ? SER A 74  ? ASP A 316 SER A 319 5 ? 4  
HELX_P HELX_P3  AA3 ARG A 110 ? GLN A 112 ? ARG A 355 GLN A 357 5 ? 3  
HELX_P HELX_P4  AA4 ARG A 114 ? LEU A 117 ? ARG A 359 LEU A 362 5 ? 4  
HELX_P HELX_P5  AA5 LEU A 118 ? TYR A 128 ? LEU A 363 TYR A 373 1 ? 11 
HELX_P HELX_P6  AA6 LEU A 158 ? THR A 163 ? LEU A 403 THR A 408 1 ? 6  
HELX_P HELX_P7  AA7 ASN A 168 ? GLN A 189 ? ASN A 413 GLN A 434 1 ? 22 
HELX_P HELX_P8  AA8 LYS A 197 ? ASP A 199 ? LYS A 442 ASP A 444 5 ? 3  
HELX_P HELX_P9  AA9 THR A 233 ? MET A 237 ? THR A 478 MET A 482 5 ? 5  
HELX_P HELX_P10 AB1 ALA A 238 ? SER A 243 ? ALA A 483 SER A 488 1 ? 6  
HELX_P HELX_P11 AB2 PRO A 249 ? GLY A 266 ? PRO A 494 GLY A 511 1 ? 18 
HELX_P HELX_P12 AB3 PRO A 274 ? ASN A 285 ? PRO A 519 ASN A 530 1 ? 12 
HELX_P HELX_P13 AB4 ASN A 292 ? VAL A 296 ? ASN A 537 VAL A 541 5 ? 5  
HELX_P HELX_P14 AB5 SER A 297 ? LEU A 308 ? SER A 542 LEU A 553 1 ? 12 
HELX_P HELX_P15 AB6 THR A 317 ? LEU A 322 ? THR A 562 LEU A 567 1 ? 6  
HELX_P HELX_P16 AB7 LYS A 323 ? ALA A 330 ? LYS A 568 ALA A 575 5 ? 8  
HELX_P HELX_P17 AB8 PRO A 332 ? MET A 340 ? PRO A 577 MET A 585 5 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A LYS 228 C ? ? ? 1_555 A SEP 229 N ? ? A LYS 473 A SEP 474 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2 covale both ? A SEP 229 C ? ? ? 1_555 A LEU 230 N ? ? A SEP 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 76  ? GLU A 84  ? LEU A 321 GLU A 329 
AA1 2 ILE A 89  ? VAL A 95  ? ILE A 334 VAL A 340 
AA1 3 LEU A 101 ? ASP A 108 ? LEU A 346 ASP A 353 
AA1 4 GLU A 145 ? MET A 150 ? GLU A 390 MET A 395 
AA1 5 MET A 136 ? VAL A 142 ? MET A 381 VAL A 387 
AA2 1 GLY A 156 ? ALA A 157 ? GLY A 401 ALA A 402 
AA2 2 ILE A 201 ? LEU A 203 ? ILE A 446 LEU A 448 
AA2 3 VAL A 209 ? LEU A 211 ? VAL A 454 LEU A 456 
AA3 1 VAL A 191 ? ILE A 192 ? VAL A 436 ILE A 437 
AA3 2 ALA A 218 ? GLN A 219 ? ALA A 463 GLN A 464 
AA4 1 VAL A 231 ? GLY A 232 ? VAL A 476 GLY A 477 
AA4 2 VAL B 7   ? VAL B 8   ? VAL B 509 VAL B 510 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 77  ? N ASP A 322 O THR A 94  ? O THR A 339 
AA1 2 3 N ILE A 89  ? N ILE A 334 O LYS A 106 ? O LYS A 351 
AA1 3 4 N ALA A 103 ? N ALA A 348 O MET A 150 ? O MET A 395 
AA1 4 5 O GLU A 145 ? O GLU A 390 N VAL A 142 ? N VAL A 387 
AA2 1 2 N GLY A 156 ? N GLY A 401 O LEU A 203 ? O LEU A 448 
AA2 2 3 N LEU A 202 ? N LEU A 447 O LYS A 210 ? O LYS A 455 
AA3 1 2 N ILE A 192 ? N ILE A 437 O ALA A 218 ? O ALA A 463 
AA4 1 2 N GLY A 232 ? N GLY A 477 O VAL B 7   ? O VAL B 509 
# 
_atom_sites.entry_id                    6WLY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.016227 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016227 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005568 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 54  ? -0.872 -25.931 19.749  1.00 70.74  ? 299 VAL A N   1 
ATOM   2    C CA  . VAL A 1 54  ? -1.122 -24.631 19.141  1.00 69.19  ? 299 VAL A CA  1 
ATOM   3    C C   . VAL A 1 54  ? -1.413 -23.626 20.248  1.00 65.54  ? 299 VAL A C   1 
ATOM   4    O O   . VAL A 1 54  ? -1.451 -22.420 20.013  1.00 65.93  ? 299 VAL A O   1 
ATOM   5    C CB  . VAL A 1 54  ? -2.285 -24.687 18.105  1.00 66.97  ? 299 VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 54  ? -3.647 -24.610 18.796  1.00 62.97  ? 299 VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 54  ? -2.135 -23.593 17.045  1.00 64.59  ? 299 VAL A CG2 1 
ATOM   8    N N   . SER A 1 55  ? -1.611 -24.137 21.460  1.00 56.04  ? 300 SER A N   1 
ATOM   9    C CA  . SER A 1 55  ? -1.983 -23.275 22.568  1.00 54.95  ? 300 SER A CA  1 
ATOM   10   C C   . SER A 1 55  ? -0.897 -22.239 22.829  1.00 54.47  ? 300 SER A C   1 
ATOM   11   O O   . SER A 1 55  ? 0.302  -22.535 22.784  1.00 51.63  ? 300 SER A O   1 
ATOM   12   C CB  . SER A 1 55  ? -2.233 -24.108 23.822  1.00 60.14  ? 300 SER A CB  1 
ATOM   13   O OG  . SER A 1 55  ? -2.354 -23.276 24.958  1.00 62.21  ? 300 SER A OG  1 
ATOM   14   N N   . HIS A 1 56  ? -1.331 -21.003 23.075  1.00 50.32  ? 301 HIS A N   1 
ATOM   15   C CA  . HIS A 1 56  ? -0.394 -19.944 23.418  1.00 49.47  ? 301 HIS A CA  1 
ATOM   16   C C   . HIS A 1 56  ? 0.357  -20.278 24.700  1.00 46.91  ? 301 HIS A C   1 
ATOM   17   O O   . HIS A 1 56  ? 1.585  -20.131 24.775  1.00 44.82  ? 301 HIS A O   1 
ATOM   18   C CB  . HIS A 1 56  ? -1.146 -18.621 23.559  1.00 51.62  ? 301 HIS A CB  1 
ATOM   19   C CG  . HIS A 1 56  ? -0.314 -17.502 24.100  1.00 49.67  ? 301 HIS A CG  1 
ATOM   20   N ND1 . HIS A 1 56  ? 0.761  -16.977 23.417  1.00 50.55  ? 301 HIS A ND1 1 
ATOM   21   C CD2 . HIS A 1 56  ? -0.411 -16.796 25.252  1.00 51.83  ? 301 HIS A CD2 1 
ATOM   22   C CE1 . HIS A 1 56  ? 1.293  -15.996 24.125  1.00 52.06  ? 301 HIS A CE1 1 
ATOM   23   N NE2 . HIS A 1 56  ? 0.600  -15.865 25.242  1.00 51.78  ? 301 HIS A NE2 1 
ATOM   24   N N   . GLU A 1 57  ? -0.369 -20.717 25.730  1.00 49.40  ? 302 GLU A N   1 
ATOM   25   C CA  . GLU A 1 57  ? 0.290  -21.041 26.991  1.00 52.69  ? 302 GLU A CA  1 
ATOM   26   C C   . GLU A 1 57  ? 1.220  -22.238 26.837  1.00 50.15  ? 302 GLU A C   1 
ATOM   27   O O   . GLU A 1 57  ? 2.238  -22.324 27.534  1.00 47.55  ? 302 GLU A O   1 
ATOM   28   C CB  . GLU A 1 57  ? -0.748 -21.294 28.092  1.00 52.76  ? 302 GLU A CB  1 
ATOM   29   C CG  . GLU A 1 57  ? -1.502 -20.041 28.554  1.00 57.81  ? 302 GLU A CG  1 
ATOM   30   C CD  . GLU A 1 57  ? -0.603 -18.951 29.139  1.00 63.49  ? 302 GLU A CD  1 
ATOM   31   O OE1 . GLU A 1 57  ? 0.459  -19.270 29.725  1.00 66.45  ? 302 GLU A OE1 1 
ATOM   32   O OE2 . GLU A 1 57  ? -0.967 -17.762 29.015  1.00 67.61  ? 302 GLU A OE2 1 
ATOM   33   N N   . GLN A 1 58  ? 0.899  -23.161 25.928  1.00 51.39  ? 303 GLN A N   1 
ATOM   34   C CA  . GLN A 1 58  ? 1.806  -24.274 25.673  1.00 49.97  ? 303 GLN A CA  1 
ATOM   35   C C   . GLN A 1 58  ? 3.111  -23.780 25.069  1.00 44.89  ? 303 GLN A C   1 
ATOM   36   O O   . GLN A 1 58  ? 4.197  -24.205 25.482  1.00 46.03  ? 303 GLN A O   1 
ATOM   37   C CB  . GLN A 1 58  ? 1.148  -25.296 24.758  1.00 51.20  ? 303 GLN A CB  1 
ATOM   38   C CG  . GLN A 1 58  ? 2.000  -26.537 24.528  1.00 51.78  ? 303 GLN A CG  1 
ATOM   39   C CD  . GLN A 1 58  ? 1.207  -27.667 23.918  1.00 58.43  ? 303 GLN A CD  1 
ATOM   40   O OE1 . GLN A 1 58  ? -0.028 -27.670 23.961  1.00 61.04  ? 303 GLN A OE1 1 
ATOM   41   N NE2 . GLN A 1 58  ? 1.909  -28.639 23.343  1.00 53.55  ? 303 GLN A NE2 1 
ATOM   42   N N   . PHE A 1 59  ? 3.032  -22.850 24.116  1.00 48.76  ? 304 PHE A N   1 
ATOM   43   C CA  . PHE A 1 59  ? 4.263  -22.341 23.526  1.00 46.76  ? 304 PHE A CA  1 
ATOM   44   C C   . PHE A 1 59  ? 5.039  -21.451 24.494  1.00 46.35  ? 304 PHE A C   1 
ATOM   45   O O   . PHE A 1 59  ? 6.277  -21.451 24.466  1.00 41.46  ? 304 PHE A O   1 
ATOM   46   C CB  . PHE A 1 59  ? 3.963  -21.589 22.231  1.00 50.93  ? 304 PHE A CB  1 
ATOM   47   C CG  . PHE A 1 59  ? 5.143  -21.500 21.322  1.00 49.63  ? 304 PHE A CG  1 
ATOM   48   C CD1 . PHE A 1 59  ? 5.452  -22.548 20.468  1.00 51.03  ? 304 PHE A CD1 1 
ATOM   49   C CD2 . PHE A 1 59  ? 5.970  -20.389 21.348  1.00 54.91  ? 304 PHE A CD2 1 
ATOM   50   C CE1 . PHE A 1 59  ? 6.553  -22.485 19.641  1.00 49.03  ? 304 PHE A CE1 1 
ATOM   51   C CE2 . PHE A 1 59  ? 7.074  -20.315 20.519  1.00 58.26  ? 304 PHE A CE2 1 
ATOM   52   C CZ  . PHE A 1 59  ? 7.364  -21.365 19.664  1.00 58.31  ? 304 PHE A CZ  1 
ATOM   53   N N   . ARG A 1 60  ? 4.348  -20.679 25.344  1.00 44.15  ? 305 ARG A N   1 
ATOM   54   C CA  . ARG A 1 60  ? 5.054  -19.907 26.370  1.00 42.76  ? 305 ARG A CA  1 
ATOM   55   C C   . ARG A 1 60  ? 5.909  -20.816 27.245  1.00 39.89  ? 305 ARG A C   1 
ATOM   56   O O   . ARG A 1 60  ? 7.063  -20.499 27.559  1.00 40.59  ? 305 ARG A O   1 
ATOM   57   C CB  . ARG A 1 60  ? 4.065  -19.144 27.259  1.00 42.91  ? 305 ARG A CB  1 
ATOM   58   C CG  . ARG A 1 60  ? 3.467  -17.889 26.674  1.00 46.85  ? 305 ARG A CG  1 
ATOM   59   C CD  . ARG A 1 60  ? 2.647  -17.151 27.735  1.00 48.45  ? 305 ARG A CD  1 
ATOM   60   N NE  . ARG A 1 60  ? 3.508  -16.398 28.645  1.00 45.14  ? 305 ARG A NE  1 
ATOM   61   C CZ  . ARG A 1 60  ? 3.698  -16.673 29.934  1.00 44.91  ? 305 ARG A CZ  1 
ATOM   62   N NH1 . ARG A 1 60  ? 3.079  -17.694 30.512  1.00 47.09  ? 305 ARG A NH1 1 
ATOM   63   N NH2 . ARG A 1 60  ? 4.519  -15.907 30.650  1.00 44.90  ? 305 ARG A NH2 1 
ATOM   64   N N   . ALA A 1 61  ? 5.339  -21.943 27.675  1.00 39.91  ? 306 ALA A N   1 
ATOM   65   C CA  . ALA A 1 61  ? 6.067  -22.858 28.547  1.00 41.27  ? 306 ALA A CA  1 
ATOM   66   C C   . ALA A 1 61  ? 7.299  -23.422 27.847  1.00 41.79  ? 306 ALA A C   1 
ATOM   67   O O   . ALA A 1 61  ? 8.385  -23.477 28.435  1.00 40.84  ? 306 ALA A O   1 
ATOM   68   C CB  . ALA A 1 61  ? 5.143  -23.981 29.008  1.00 41.28  ? 306 ALA A CB  1 
ATOM   69   N N   . ALA A 1 62  ? 7.145  -23.845 26.588  1.00 42.38  ? 307 ALA A N   1 
ATOM   70   C CA  . ALA A 1 62  ? 8.281  -24.352 25.821  1.00 39.83  ? 307 ALA A CA  1 
ATOM   71   C C   . ALA A 1 62  ? 9.397  -23.317 25.732  1.00 39.48  ? 307 ALA A C   1 
ATOM   72   O O   . ALA A 1 62  ? 10.566 -23.629 25.984  1.00 39.96  ? 307 ALA A O   1 
ATOM   73   C CB  . ALA A 1 62  ? 7.818  -24.761 24.425  1.00 43.00  ? 307 ALA A CB  1 
ATOM   74   N N   . LEU A 1 63  ? 9.051  -22.076 25.380  1.00 38.57  ? 308 LEU A N   1 
ATOM   75   C CA  . LEU A 1 63  ? 10.048 -21.011 25.296  1.00 37.62  ? 308 LEU A CA  1 
ATOM   76   C C   . LEU A 1 63  ? 10.740 -20.777 26.630  1.00 38.45  ? 308 LEU A C   1 
ATOM   77   O O   . LEU A 1 63  ? 11.951 -20.540 26.671  1.00 37.18  ? 308 LEU A O   1 
ATOM   78   C CB  . LEU A 1 63  ? 9.384  -19.717 24.830  1.00 40.20  ? 308 LEU A CB  1 
ATOM   79   C CG  . LEU A 1 63  ? 9.594  -19.347 23.373  1.00 42.25  ? 308 LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 63  ? 8.928  -18.018 23.092  1.00 43.09  ? 308 LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 63  ? 11.076 -19.279 23.085  1.00 40.69  ? 308 LEU A CD2 1 
ATOM   82   N N   . GLN A 1 64  ? 9.989  -20.837 27.735  1.00 36.79  ? 309 GLN A N   1 
ATOM   83   C CA  . GLN A 1 64  ? 10.605 -20.641 29.046  1.00 39.76  ? 309 GLN A CA  1 
ATOM   84   C C   . GLN A 1 64  ? 11.724 -21.640 29.312  1.00 41.58  ? 309 GLN A C   1 
ATOM   85   O O   . GLN A 1 64  ? 12.690 -21.315 30.009  1.00 42.25  ? 309 GLN A O   1 
ATOM   86   C CB  . GLN A 1 64  ? 9.562  -20.738 30.157  1.00 38.97  ? 309 GLN A CB  1 
ATOM   87   C CG  . GLN A 1 64  ? 10.116 -20.366 31.515  1.00 42.30  ? 309 GLN A CG  1 
ATOM   88   C CD  . GLN A 1 64  ? 10.378 -18.867 31.618  1.00 45.41  ? 309 GLN A CD  1 
ATOM   89   O OE1 . GLN A 1 64  ? 9.447  -18.082 31.759  1.00 45.32  ? 309 GLN A OE1 1 
ATOM   90   N NE2 . GLN A 1 64  ? 11.643 -18.471 31.533  1.00 46.05  ? 309 GLN A NE2 1 
ATOM   91   N N   . LEU A 1 65  ? 11.620 -22.858 28.772  1.00 39.07  ? 310 LEU A N   1 
ATOM   92   C CA  . LEU A 1 65  ? 12.654 -23.856 29.025  1.00 41.35  ? 310 LEU A CA  1 
ATOM   93   C C   . LEU A 1 65  ? 13.965 -23.552 28.314  1.00 41.52  ? 310 LEU A C   1 
ATOM   94   O O   . LEU A 1 65  ? 14.993 -24.119 28.696  1.00 45.72  ? 310 LEU A O   1 
ATOM   95   C CB  . LEU A 1 65  ? 12.183 -25.249 28.601  1.00 40.71  ? 310 LEU A CB  1 
ATOM   96   C CG  . LEU A 1 65  ? 11.042 -25.809 29.432  1.00 43.94  ? 310 LEU A CG  1 
ATOM   97   C CD1 . LEU A 1 65  ? 10.739 -27.225 28.995  1.00 46.27  ? 310 LEU A CD1 1 
ATOM   98   C CD2 . LEU A 1 65  ? 11.385 -25.749 30.916  1.00 45.63  ? 310 LEU A CD2 1 
ATOM   99   N N   . VAL A 1 66  ? 13.959 -22.706 27.284  1.00 37.13  ? 311 VAL A N   1 
ATOM   100  C CA  . VAL A 1 66  ? 15.168 -22.455 26.511  1.00 38.79  ? 311 VAL A CA  1 
ATOM   101  C C   . VAL A 1 66  ? 15.744 -21.057 26.722  1.00 38.91  ? 311 VAL A C   1 
ATOM   102  O O   . VAL A 1 66  ? 16.927 -20.850 26.418  1.00 38.78  ? 311 VAL A O   1 
ATOM   103  C CB  . VAL A 1 66  ? 14.949 -22.715 25.005  1.00 40.18  ? 311 VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 66  ? 14.564 -24.164 24.761  1.00 45.48  ? 311 VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 66  ? 13.909 -21.785 24.432  1.00 42.75  ? 311 VAL A CG2 1 
ATOM   106  N N   . VAL A 1 67  ? 14.966 -20.096 27.217  1.00 37.69  ? 312 VAL A N   1 
ATOM   107  C CA  . VAL A 1 67  ? 15.492 -18.740 27.385  1.00 38.50  ? 312 VAL A CA  1 
ATOM   108  C C   . VAL A 1 67  ? 16.169 -18.620 28.744  1.00 39.20  ? 312 VAL A C   1 
ATOM   109  O O   . VAL A 1 67  ? 16.093 -19.533 29.574  1.00 39.19  ? 312 VAL A O   1 
ATOM   110  C CB  . VAL A 1 67  ? 14.388 -17.673 27.230  1.00 35.68  ? 312 VAL A CB  1 
ATOM   111  C CG1 . VAL A 1 67  ? 13.752 -17.772 25.861  1.00 35.85  ? 312 VAL A CG1 1 
ATOM   112  C CG2 . VAL A 1 67  ? 13.358 -17.827 28.336  1.00 36.28  ? 312 VAL A CG2 1 
ATOM   113  N N   . ASP A 1 68  ? 16.837 -17.501 28.981  1.00 37.39  ? 313 ASP A N   1 
ATOM   114  C CA  . ASP A 1 68  ? 17.409 -17.276 30.296  1.00 36.85  ? 313 ASP A CA  1 
ATOM   115  C C   . ASP A 1 68  ? 16.304 -16.917 31.291  1.00 39.39  ? 313 ASP A C   1 
ATOM   116  O O   . ASP A 1 68  ? 15.263 -16.373 30.907  1.00 39.65  ? 313 ASP A O   1 
ATOM   117  C CB  . ASP A 1 68  ? 18.446 -16.155 30.223  1.00 37.29  ? 313 ASP A CB  1 
ATOM   118  C CG  . ASP A 1 68  ? 19.529 -16.447 29.195  1.00 41.66  ? 313 ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 68  ? 20.193 -17.502 29.313  1.00 43.68  ? 313 ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 68  ? 19.698 -15.649 28.250  1.00 39.57  ? 313 ASP A OD2 1 
ATOM   121  N N   . PRO A 1 69  ? 16.487 -17.236 32.568  1.00 39.78  ? 314 PRO A N   1 
ATOM   122  C CA  . PRO A 1 69  ? 15.473 -16.880 33.565  1.00 41.51  ? 314 PRO A CA  1 
ATOM   123  C C   . PRO A 1 69  ? 15.516 -15.395 33.892  1.00 44.19  ? 314 PRO A C   1 
ATOM   124  O O   . PRO A 1 69  ? 16.524 -14.713 33.696  1.00 42.56  ? 314 PRO A O   1 
ATOM   125  C CB  . PRO A 1 69  ? 15.868 -17.721 34.781  1.00 43.76  ? 314 PRO A CB  1 
ATOM   126  C CG  . PRO A 1 69  ? 17.342 -17.855 34.649  1.00 45.75  ? 314 PRO A CG  1 
ATOM   127  C CD  . PRO A 1 69  ? 17.591 -18.006 33.167  1.00 41.69  ? 314 PRO A CD  1 
ATOM   128  N N   . GLY A 1 70  ? 14.396 -14.900 34.404  1.00 43.94  ? 315 GLY A N   1 
ATOM   129  C CA  . GLY A 1 70  ? 14.315 -13.529 34.860  1.00 44.49  ? 315 GLY A CA  1 
ATOM   130  C C   . GLY A 1 70  ? 13.720 -12.588 33.831  1.00 46.43  ? 315 GLY A C   1 
ATOM   131  O O   . GLY A 1 70  ? 13.166 -12.981 32.802  1.00 43.23  ? 315 GLY A O   1 
ATOM   132  N N   . ASP A 1 71  ? 13.857 -11.303 34.139  1.00 44.46  ? 316 ASP A N   1 
ATOM   133  C CA  . ASP A 1 71  ? 13.263 -10.189 33.420  1.00 45.00  ? 316 ASP A CA  1 
ATOM   134  C C   . ASP A 1 71  ? 14.322 -9.100  33.297  1.00 43.14  ? 316 ASP A C   1 
ATOM   135  O O   . ASP A 1 71  ? 14.783 -8.569  34.318  1.00 42.69  ? 316 ASP A O   1 
ATOM   136  C CB  . ASP A 1 71  ? 12.021 -9.698  34.178  1.00 45.44  ? 316 ASP A CB  1 
ATOM   137  C CG  . ASP A 1 71  ? 11.276 -8.579  33.465  1.00 49.16  ? 316 ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 71  ? 11.888 -7.793  32.712  1.00 47.93  ? 316 ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 71  ? 10.051 -8.470  33.688  1.00 54.48  ? 316 ASP A OD2 1 
ATOM   140  N N   . PRO A 1 72  ? 14.732 -8.734  32.076  1.00 40.66  ? 317 PRO A N   1 
ATOM   141  C CA  . PRO A 1 72  ? 15.808 -7.739  31.935  1.00 38.36  ? 317 PRO A CA  1 
ATOM   142  C C   . PRO A 1 72  ? 15.407 -6.344  32.374  1.00 42.00  ? 317 PRO A C   1 
ATOM   143  O O   . PRO A 1 72  ? 16.274 -5.460  32.441  1.00 38.35  ? 317 PRO A O   1 
ATOM   144  C CB  . PRO A 1 72  ? 16.120 -7.772  30.435  1.00 38.65  ? 317 PRO A CB  1 
ATOM   145  C CG  . PRO A 1 72  ? 14.825 -8.163  29.810  1.00 36.05  ? 317 PRO A CG  1 
ATOM   146  C CD  . PRO A 1 72  ? 14.136 -9.091  30.773  1.00 37.61  ? 317 PRO A CD  1 
ATOM   147  N N   . ARG A 1 73  ? 14.128 -6.100  32.658  1.00 40.30  ? 318 ARG A N   1 
ATOM   148  C CA  . ARG A 1 73  ? 13.767 -4.793  33.180  1.00 40.70  ? 318 ARG A CA  1 
ATOM   149  C C   . ARG A 1 73  ? 14.391 -4.555  34.539  1.00 41.02  ? 318 ARG A C   1 
ATOM   150  O O   . ARG A 1 73  ? 14.503 -3.404  34.962  1.00 44.29  ? 318 ARG A O   1 
ATOM   151  C CB  . ARG A 1 73  ? 12.251 -4.642  33.244  1.00 44.88  ? 318 ARG A CB  1 
ATOM   152  C CG  . ARG A 1 73  ? 11.644 -4.337  31.890  1.00 50.69  ? 318 ARG A CG  1 
ATOM   153  C CD  . ARG A 1 73  ? 10.134 -4.326  31.946  1.00 53.13  ? 318 ARG A CD  1 
ATOM   154  N NE  . ARG A 1 73  ? 9.602  -5.594  32.430  1.00 52.38  ? 318 ARG A NE  1 
ATOM   155  C CZ  . ARG A 1 73  ? 8.311  -5.911  32.405  1.00 59.00  ? 318 ARG A CZ  1 
ATOM   156  N NH1 . ARG A 1 73  ? 7.429  -5.050  31.909  1.00 57.94  ? 318 ARG A NH1 1 
ATOM   157  N NH2 . ARG A 1 73  ? 7.900  -7.083  32.874  1.00 55.39  ? 318 ARG A NH2 1 
ATOM   158  N N   . SER A 1 74  ? 14.843 -5.615  35.210  1.00 41.75  ? 319 SER A N   1 
ATOM   159  C CA  . SER A 1 74  ? 15.542 -5.446  36.475  1.00 45.68  ? 319 SER A CA  1 
ATOM   160  C C   . SER A 1 74  ? 16.917 -4.814  36.301  1.00 41.25  ? 319 SER A C   1 
ATOM   161  O O   . SER A 1 74  ? 17.507 -4.375  37.292  1.00 43.29  ? 319 SER A O   1 
ATOM   162  C CB  . SER A 1 74  ? 15.684 -6.792  37.189  1.00 45.41  ? 319 SER A CB  1 
ATOM   163  O OG  . SER A 1 74  ? 16.550 -7.651  36.465  1.00 50.70  ? 319 SER A OG  1 
ATOM   164  N N   . TYR A 1 75  ? 17.460 -4.764  35.083  1.00 38.85  ? 320 TYR A N   1 
ATOM   165  C CA  . TYR A 1 75  ? 18.732 -4.074  34.898  1.00 39.36  ? 320 TYR A CA  1 
ATOM   166  C C   . TYR A 1 75  ? 18.758 -3.094  33.734  1.00 38.82  ? 320 TYR A C   1 
ATOM   167  O O   . TYR A 1 75  ? 19.800 -2.474  33.507  1.00 38.52  ? 320 TYR A O   1 
ATOM   168  C CB  . TYR A 1 75  ? 19.897 -5.081  34.759  1.00 37.60  ? 320 TYR A CB  1 
ATOM   169  C CG  . TYR A 1 75  ? 19.851 -6.027  33.564  1.00 38.84  ? 320 TYR A CG  1 
ATOM   170  C CD1 . TYR A 1 75  ? 19.329 -7.313  33.688  1.00 39.72  ? 320 TYR A CD1 1 
ATOM   171  C CD2 . TYR A 1 75  ? 20.365 -5.649  32.329  1.00 37.78  ? 320 TYR A CD2 1 
ATOM   172  C CE1 . TYR A 1 75  ? 19.298 -8.195  32.603  1.00 39.92  ? 320 TYR A CE1 1 
ATOM   173  C CE2 . TYR A 1 75  ? 20.327 -6.526  31.227  1.00 36.37  ? 320 TYR A CE2 1 
ATOM   174  C CZ  . TYR A 1 75  ? 19.795 -7.795  31.378  1.00 37.71  ? 320 TYR A CZ  1 
ATOM   175  O OH  . TYR A 1 75  ? 19.764 -8.672  30.304  1.00 38.36  ? 320 TYR A OH  1 
ATOM   176  N N   . LEU A 1 76  ? 17.646 -2.894  33.026  1.00 39.32  ? 321 LEU A N   1 
ATOM   177  C CA  . LEU A 1 76  ? 17.573 -1.957  31.911  1.00 35.74  ? 321 LEU A CA  1 
ATOM   178  C C   . LEU A 1 76  ? 16.613 -0.809  32.220  1.00 40.35  ? 321 LEU A C   1 
ATOM   179  O O   . LEU A 1 76  ? 15.578 -1.011  32.863  1.00 42.37  ? 321 LEU A O   1 
ATOM   180  C CB  . LEU A 1 76  ? 17.128 -2.675  30.627  1.00 35.94  ? 321 LEU A CB  1 
ATOM   181  C CG  . LEU A 1 76  ? 18.056 -3.778  30.110  1.00 38.13  ? 321 LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 76  ? 17.513 -4.367  28.810  1.00 35.94  ? 321 LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 76  ? 19.454 -3.232  29.910  1.00 37.92  ? 321 LEU A CD2 1 
ATOM   184  N N   . ASP A 1 77  ? 16.957 0.398   31.746  1.00 37.37  ? 322 ASP A N   1 
ATOM   185  C CA  . ASP A 1 77  ? 16.130 1.595   31.884  1.00 38.21  ? 322 ASP A CA  1 
ATOM   186  C C   . ASP A 1 77  ? 15.841 2.205   30.516  1.00 38.39  ? 322 ASP A C   1 
ATOM   187  O O   . ASP A 1 77  ? 16.563 1.968   29.543  1.00 38.93  ? 322 ASP A O   1 
ATOM   188  C CB  . ASP A 1 77  ? 16.806 2.681   32.755  1.00 37.70  ? 322 ASP A CB  1 
ATOM   189  C CG  . ASP A 1 77  ? 16.902 2.291   34.217  1.00 45.01  ? 322 ASP A CG  1 
ATOM   190  O OD1 . ASP A 1 77  ? 15.960 1.663   34.738  1.00 48.93  ? 322 ASP A OD1 1 
ATOM   191  O OD2 . ASP A 1 77  ? 17.921 2.641   34.852  1.00 50.21  ? 322 ASP A OD2 1 
ATOM   192  N N   . ASN A 1 78  ? 14.765 3.001   30.461  1.00 39.62  ? 323 ASN A N   1 
ATOM   193  C CA  . ASN A 1 78  ? 14.518 3.971   29.383  1.00 38.91  ? 323 ASN A CA  1 
ATOM   194  C C   . ASN A 1 78  ? 14.393 3.301   28.013  1.00 37.82  ? 323 ASN A C   1 
ATOM   195  O O   . ASN A 1 78  ? 15.105 3.637   27.060  1.00 37.91  ? 323 ASN A O   1 
ATOM   196  C CB  . ASN A 1 78  ? 15.617 5.040   29.350  1.00 39.69  ? 323 ASN A CB  1 
ATOM   197  C CG  . ASN A 1 78  ? 15.305 6.220   30.231  1.00 48.29  ? 323 ASN A CG  1 
ATOM   198  O OD1 . ASN A 1 78  ? 14.276 6.253   30.907  1.00 51.78  ? 323 ASN A OD1 1 
ATOM   199  N ND2 . ASN A 1 78  ? 16.199 7.204   30.233  1.00 50.95  ? 323 ASN A ND2 1 
ATOM   200  N N   . PHE A 1 79  ? 13.456 2.365   27.919  1.00 37.73  ? 324 PHE A N   1 
ATOM   201  C CA  . PHE A 1 79  ? 13.189 1.722   26.639  1.00 37.81  ? 324 PHE A CA  1 
ATOM   202  C C   . PHE A 1 79  ? 12.647 2.744   25.645  1.00 37.20  ? 324 PHE A C   1 
ATOM   203  O O   . PHE A 1 79  ? 11.714 3.487   25.951  1.00 39.15  ? 324 PHE A O   1 
ATOM   204  C CB  . PHE A 1 79  ? 12.190 0.575   26.824  1.00 36.96  ? 324 PHE A CB  1 
ATOM   205  C CG  . PHE A 1 79  ? 12.760 -0.627  27.516  1.00 35.86  ? 324 PHE A CG  1 
ATOM   206  C CD1 . PHE A 1 79  ? 13.104 -0.581  28.863  1.00 39.19  ? 324 PHE A CD1 1 
ATOM   207  C CD2 . PHE A 1 79  ? 12.947 -1.807  26.824  1.00 36.76  ? 324 PHE A CD2 1 
ATOM   208  C CE1 . PHE A 1 79  ? 13.624 -1.691  29.497  1.00 38.50  ? 324 PHE A CE1 1 
ATOM   209  C CE2 . PHE A 1 79  ? 13.466 -2.928  27.454  1.00 38.30  ? 324 PHE A CE2 1 
ATOM   210  C CZ  . PHE A 1 79  ? 13.809 -2.866  28.794  1.00 37.81  ? 324 PHE A CZ  1 
ATOM   211  N N   . ILE A 1 80  ? 13.243 2.801   24.456  1.00 33.82  ? 325 ILE A N   1 
ATOM   212  C CA  . ILE A 1 80  ? 12.779 3.698   23.400  1.00 36.50  ? 325 ILE A CA  1 
ATOM   213  C C   . ILE A 1 80  ? 12.692 2.894   22.112  1.00 36.50  ? 325 ILE A C   1 
ATOM   214  O O   . ILE A 1 80  ? 13.692 2.317   21.674  1.00 34.35  ? 325 ILE A O   1 
ATOM   215  C CB  . ILE A 1 80  ? 13.707 4.913   23.215  1.00 37.90  ? 325 ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 80  ? 13.791 5.740   24.500  1.00 40.62  ? 325 ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 80  ? 13.230 5.773   22.055  1.00 37.06  ? 325 ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 80  ? 14.966 6.706   24.513  1.00 40.32  ? 325 ILE A CD1 1 
ATOM   219  N N   . LYS A 1 81  ? 11.513 2.868   21.498  1.00 37.02  ? 326 LYS A N   1 
ATOM   220  C CA  . LYS A 1 81  ? 11.340 2.096   20.273  1.00 36.98  ? 326 LYS A CA  1 
ATOM   221  C C   . LYS A 1 81  ? 12.084 2.765   19.122  1.00 38.17  ? 326 LYS A C   1 
ATOM   222  O O   . LYS A 1 81  ? 11.932 3.966   18.894  1.00 36.13  ? 326 LYS A O   1 
ATOM   223  C CB  . LYS A 1 81  ? 9.855  1.961   19.942  1.00 38.09  ? 326 LYS A CB  1 
ATOM   224  C CG  . LYS A 1 81  ? 9.563  1.208   18.656  1.00 39.55  ? 326 LYS A CG  1 
ATOM   225  C CD  . LYS A 1 81  ? 8.055  1.134   18.412  1.00 43.89  ? 326 LYS A CD  1 
ATOM   226  C CE  . LYS A 1 81  ? 7.735  0.466   17.081  1.00 48.91  ? 326 LYS A CE  1 
ATOM   227  N NZ  . LYS A 1 81  ? 6.267  0.402   16.822  1.00 53.50  ? 326 LYS A NZ  1 
ATOM   228  N N   . ILE A 1 82  ? 12.906 2.001   18.406  1.00 38.17  ? 327 ILE A N   1 
ATOM   229  C CA  . ILE A 1 82  ? 13.613 2.547   17.253  1.00 43.46  ? 327 ILE A CA  1 
ATOM   230  C C   . ILE A 1 82  ? 13.203 1.910   15.933  1.00 50.02  ? 327 ILE A C   1 
ATOM   231  O O   . ILE A 1 82  ? 13.378 2.544   14.880  1.00 49.67  ? 327 ILE A O   1 
ATOM   232  C CB  . ILE A 1 82  ? 15.143 2.458   17.429  1.00 40.92  ? 327 ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 82  ? 15.593 1.014   17.655  1.00 39.21  ? 327 ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 82  ? 15.579 3.353   18.566  1.00 41.11  ? 327 ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 82  ? 17.107 0.835   17.698  1.00 38.96  ? 327 ILE A CD1 1 
ATOM   236  N N   . GLY A 1 83  ? 12.659 0.697   15.927  1.00 44.70  ? 328 GLY A N   1 
ATOM   237  C CA  . GLY A 1 83  ? 12.301 0.078   14.667  1.00 43.42  ? 328 GLY A CA  1 
ATOM   238  C C   . GLY A 1 83  ? 11.188 -0.924  14.840  1.00 41.94  ? 328 GLY A C   1 
ATOM   239  O O   . GLY A 1 83  ? 10.889 -1.367  15.951  1.00 40.12  ? 328 GLY A O   1 
ATOM   240  N N   . GLU A 1 84  ? 10.559 -1.259  13.724  1.00 44.34  ? 329 GLU A N   1 
ATOM   241  C CA  . GLU A 1 84  ? 9.570  -2.321  13.675  1.00 45.46  ? 329 GLU A CA  1 
ATOM   242  C C   . GLU A 1 84  ? 9.978  -3.267  12.560  1.00 52.16  ? 329 GLU A C   1 
ATOM   243  O O   . GLU A 1 84  ? 10.390 -2.824  11.484  1.00 56.71  ? 329 GLU A O   1 
ATOM   244  C CB  . GLU A 1 84  ? 8.163  -1.765  13.449  1.00 51.20  ? 329 GLU A CB  1 
ATOM   245  C CG  . GLU A 1 84  ? 7.060  -2.783  13.681  1.00 60.84  ? 329 GLU A CG  1 
ATOM   246  C CD  . GLU A 1 84  ? 5.735  -2.129  14.008  1.00 69.58  ? 329 GLU A CD  1 
ATOM   247  O OE1 . GLU A 1 84  ? 5.633  -0.889  13.872  1.00 72.75  ? 329 GLU A OE1 1 
ATOM   248  O OE2 . GLU A 1 84  ? 4.800  -2.854  14.407  1.00 72.53  ? 329 GLU A OE2 1 
ATOM   249  N N   . GLY A 1 85  ? 9.903  -4.562  12.834  1.00 50.80  ? 330 GLY A N   1 
ATOM   250  C CA  . GLY A 1 85  ? 10.271 -5.553  11.851  1.00 49.58  ? 330 GLY A CA  1 
ATOM   251  C C   . GLY A 1 85  ? 9.118  -6.484  11.568  1.00 50.90  ? 330 GLY A C   1 
ATOM   252  O O   . GLY A 1 85  ? 7.975  -6.201  11.941  1.00 49.14  ? 330 GLY A O   1 
ATOM   253  N N   . SER A 1 86  ? 9.412  -7.615  10.929  1.00 55.27  ? 331 SER A N   1 
ATOM   254  C CA  . SER A 1 86  ? 8.355  -8.538  10.533  1.00 57.85  ? 331 SER A CA  1 
ATOM   255  C C   . SER A 1 86  ? 7.815  -9.325  11.720  1.00 52.55  ? 331 SER A C   1 
ATOM   256  O O   . SER A 1 86  ? 6.649  -9.737  11.712  1.00 53.56  ? 331 SER A O   1 
ATOM   257  C CB  . SER A 1 86  ? 8.876  -9.484  9.456   1.00 62.36  ? 331 SER A CB  1 
ATOM   258  O OG  . SER A 1 86  ? 10.062 -8.967  8.867   1.00 62.99  ? 331 SER A OG  1 
ATOM   259  N N   . THR A 1 87  ? 8.640  -9.544  12.746  1.00 47.91  ? 332 THR A N   1 
ATOM   260  C CA  . THR A 1 87  ? 8.263  -10.364 13.888  1.00 49.13  ? 332 THR A CA  1 
ATOM   261  C C   . THR A 1 87  ? 8.080  -9.574  15.178  1.00 45.78  ? 332 THR A C   1 
ATOM   262  O O   . THR A 1 87  ? 7.652  -10.154 16.181  1.00 42.25  ? 332 THR A O   1 
ATOM   263  C CB  . THR A 1 87  ? 9.313  -11.460 14.127  1.00 48.42  ? 332 THR A CB  1 
ATOM   264  O OG1 . THR A 1 87  ? 10.586 -10.857 14.389  1.00 47.88  ? 332 THR A OG1 1 
ATOM   265  C CG2 . THR A 1 87  ? 9.429  -12.367 12.907  1.00 48.91  ? 332 THR A CG2 1 
ATOM   266  N N   . GLY A 1 88  ? 8.397  -8.285  15.189  1.00 43.07  ? 333 GLY A N   1 
ATOM   267  C CA  . GLY A 1 88  ? 8.239  -7.519  16.416  1.00 41.50  ? 333 GLY A CA  1 
ATOM   268  C C   . GLY A 1 88  ? 8.840  -6.141  16.289  1.00 45.57  ? 333 GLY A C   1 
ATOM   269  O O   . GLY A 1 88  ? 8.922  -5.579  15.192  1.00 51.79  ? 333 GLY A O   1 
ATOM   270  N N   . ILE A 1 89  ? 9.256  -5.600  17.429  1.00 35.50  ? 334 ILE A N   1 
ATOM   271  C CA  . ILE A 1 89  ? 9.815  -4.257  17.466  1.00 39.29  ? 334 ILE A CA  1 
ATOM   272  C C   . ILE A 1 89  ? 11.209 -4.331  18.076  1.00 36.48  ? 334 ILE A C   1 
ATOM   273  O O   . ILE A 1 89  ? 11.585 -5.317  18.708  1.00 34.95  ? 334 ILE A O   1 
ATOM   274  C CB  . ILE A 1 89  ? 8.920  -3.268  18.244  1.00 38.52  ? 334 ILE A CB  1 
ATOM   275  C CG1 . ILE A 1 89  ? 8.914  -3.609  19.737  1.00 38.50  ? 334 ILE A CG1 1 
ATOM   276  C CG2 . ILE A 1 89  ? 7.498  -3.257  17.667  1.00 37.09  ? 334 ILE A CG2 1 
ATOM   277  C CD1 . ILE A 1 89  ? 8.323  -2.516  20.609  1.00 39.62  ? 334 ILE A CD1 1 
ATOM   278  N N   . VAL A 1 90  ? 11.986 -3.273  17.857  1.00 34.05  ? 335 VAL A N   1 
ATOM   279  C CA  . VAL A 1 90  ? 13.333 -3.153  18.399  1.00 34.52  ? 335 VAL A CA  1 
ATOM   280  C C   . VAL A 1 90  ? 13.407 -1.861  19.200  1.00 35.61  ? 335 VAL A C   1 
ATOM   281  O O   . VAL A 1 90  ? 13.020 -0.793  18.707  1.00 34.37  ? 335 VAL A O   1 
ATOM   282  C CB  . VAL A 1 90  ? 14.408 -3.178  17.292  1.00 38.47  ? 335 VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 90  ? 15.790 -2.967  17.893  1.00 37.48  ? 335 VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 90  ? 14.368 -4.491  16.525  1.00 37.90  ? 335 VAL A CG2 1 
ATOM   285  N N   . CYS A 1 91  ? 13.908 -1.965  20.428  1.00 32.34  ? 336 CYS A N   1 
ATOM   286  C CA  . CYS A 1 91  ? 14.089 -0.827  21.320  1.00 33.84  ? 336 CYS A CA  1 
ATOM   287  C C   . CYS A 1 91  ? 15.552 -0.663  21.705  1.00 33.93  ? 336 CYS A C   1 
ATOM   288  O O   . CYS A 1 91  ? 16.305 -1.633  21.779  1.00 34.99  ? 336 CYS A O   1 
ATOM   289  C CB  . CYS A 1 91  ? 13.297 -0.985  22.625  1.00 35.90  ? 336 CYS A CB  1 
ATOM   290  S SG  . CYS A 1 91  ? 11.523 -1.164  22.435  1.00 40.02  ? 336 CYS A SG  1 
ATOM   291  N N   . ILE A 1 92  ? 15.936 0.581   21.966  1.00 33.01  ? 337 ILE A N   1 
ATOM   292  C CA  A ILE A 1 92  ? 17.154 0.902   22.703  0.37 34.12  ? 337 ILE A CA  1 
ATOM   293  C CA  B ILE A 1 92  ? 17.165 0.850   22.699  0.63 33.26  ? 337 ILE A CA  1 
ATOM   294  C C   . ILE A 1 92  ? 16.820 0.864   24.184  1.00 33.85  ? 337 ILE A C   1 
ATOM   295  O O   . ILE A 1 92  ? 15.709 1.225   24.587  1.00 33.10  ? 337 ILE A O   1 
ATOM   296  C CB  A ILE A 1 92  ? 17.701 2.290   22.312  0.37 37.68  ? 337 ILE A CB  1 
ATOM   297  C CB  B ILE A 1 92  ? 17.811 2.172   22.221  0.63 37.34  ? 337 ILE A CB  1 
ATOM   298  C CG1 A ILE A 1 92  ? 18.101 2.352   20.847  0.37 38.06  ? 337 ILE A CG1 1 
ATOM   299  C CG1 B ILE A 1 92  ? 19.205 2.368   22.807  0.63 41.54  ? 337 ILE A CG1 1 
ATOM   300  C CG2 A ILE A 1 92  ? 18.903 2.675   23.173  0.37 41.06  ? 337 ILE A CG2 1 
ATOM   301  C CG2 B ILE A 1 92  ? 16.943 3.375   22.553  0.63 37.95  ? 337 ILE A CG2 1 
ATOM   302  C CD1 A ILE A 1 92  ? 18.460 3.759   20.441  0.37 37.95  ? 337 ILE A CD1 1 
ATOM   303  C CD1 B ILE A 1 92  ? 19.824 3.695   22.391  0.63 44.58  ? 337 ILE A CD1 1 
ATOM   304  N N   . ALA A 1 93  ? 17.772 0.434   25.004  1.00 35.16  ? 338 ALA A N   1 
ATOM   305  C CA  . ALA A 1 93  ? 17.641 0.500   26.450  1.00 34.34  ? 338 ALA A CA  1 
ATOM   306  C C   . ALA A 1 93  ? 19.001 0.842   27.034  1.00 37.26  ? 338 ALA A C   1 
ATOM   307  O O   . ALA A 1 93  ? 20.039 0.570   26.422  1.00 35.97  ? 338 ALA A O   1 
ATOM   308  C CB  . ALA A 1 93  ? 17.139 -0.816  27.057  1.00 32.98  ? 338 ALA A CB  1 
ATOM   309  N N   . THR A 1 94  ? 18.985 1.428   28.226  1.00 37.98  ? 339 THR A N   1 
ATOM   310  C CA  . THR A 1 94  ? 20.196 1.824   28.935  1.00 37.19  ? 339 THR A CA  1 
ATOM   311  C C   . THR A 1 94  ? 20.474 0.811   30.036  1.00 38.53  ? 339 THR A C   1 
ATOM   312  O O   . THR A 1 94  ? 19.583 0.500   30.833  1.00 36.83  ? 339 THR A O   1 
ATOM   313  C CB  . THR A 1 94  ? 20.041 3.224   29.538  1.00 37.17  ? 339 THR A CB  1 
ATOM   314  O OG1 . THR A 1 94  ? 19.772 4.176   28.494  1.00 39.53  ? 339 THR A OG1 1 
ATOM   315  C CG2 . THR A 1 94  ? 21.309 3.647   30.288  1.00 36.65  ? 339 THR A CG2 1 
ATOM   316  N N   . VAL A 1 95  ? 21.697 0.280   30.067  1.00 38.38  ? 340 VAL A N   1 
ATOM   317  C CA  . VAL A 1 95  ? 22.108 -0.578  31.179  1.00 37.25  ? 340 VAL A CA  1 
ATOM   318  C C   . VAL A 1 95  ? 22.289 0.291   32.414  1.00 37.63  ? 340 VAL A C   1 
ATOM   319  O O   . VAL A 1 95  ? 23.139 1.189   32.437  1.00 40.36  ? 340 VAL A O   1 
ATOM   320  C CB  . VAL A 1 95  ? 23.403 -1.338  30.851  1.00 38.30  ? 340 VAL A CB  1 
ATOM   321  C CG1 . VAL A 1 95  ? 23.862 -2.135  32.059  1.00 38.09  ? 340 VAL A CG1 1 
ATOM   322  C CG2 . VAL A 1 95  ? 23.186 -2.263  29.683  1.00 37.58  ? 340 VAL A CG2 1 
ATOM   323  N N   . ARG A 1 96  ? 21.501 0.016   33.457  1.00 37.93  ? 341 ARG A N   1 
ATOM   324  C CA  . ARG A 1 96  ? 21.476 0.915   34.607  1.00 43.00  ? 341 ARG A CA  1 
ATOM   325  C C   . ARG A 1 96  ? 22.833 0.996   35.297  1.00 47.08  ? 341 ARG A C   1 
ATOM   326  O O   . ARG A 1 96  ? 23.224 2.057   35.795  1.00 47.79  ? 341 ARG A O   1 
ATOM   327  C CB  . ARG A 1 96  ? 20.414 0.456   35.600  1.00 41.51  ? 341 ARG A CB  1 
ATOM   328  C CG  . ARG A 1 96  ? 20.241 1.380   36.821  1.00 43.76  ? 341 ARG A CG  1 
ATOM   329  C CD  . ARG A 1 96  ? 19.008 0.966   37.613  1.00 44.85  ? 341 ARG A CD  1 
ATOM   330  N NE  . ARG A 1 96  ? 17.945 0.549   36.702  1.00 44.38  ? 341 ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 96  ? 17.448 -0.682  36.633  1.00 43.88  ? 341 ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 96  ? 17.892 -1.626  37.451  1.00 46.50  ? 341 ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 96  ? 16.494 -0.966  35.756  1.00 38.08  ? 341 ARG A NH2 1 
ATOM   334  N N   . SER A 1 97  ? 23.574 -0.112  35.323  1.00 40.63  ? 342 SER A N   1 
ATOM   335  C CA  A SER A 1 97  ? 24.823 -0.144  36.075  0.62 44.04  ? 342 SER A CA  1 
ATOM   336  C CA  B SER A 1 97  ? 24.821 -0.141  36.076  0.38 43.57  ? 342 SER A CA  1 
ATOM   337  C C   . SER A 1 97  ? 25.935 0.608   35.356  1.00 42.94  ? 342 SER A C   1 
ATOM   338  O O   . SER A 1 97  ? 26.805 1.194   36.005  1.00 49.17  ? 342 SER A O   1 
ATOM   339  C CB  A SER A 1 97  ? 25.244 -1.595  36.326  0.62 41.27  ? 342 SER A CB  1 
ATOM   340  C CB  B SER A 1 97  ? 25.229 -1.593  36.341  0.38 41.92  ? 342 SER A CB  1 
ATOM   341  O OG  A SER A 1 97  ? 25.493 -2.260  35.097  0.62 40.35  ? 342 SER A OG  1 
ATOM   342  O OG  B SER A 1 97  ? 26.444 -1.667  37.064  0.38 41.60  ? 342 SER A OG  1 
ATOM   343  N N   . SER A 1 98  ? 25.922 0.604   34.026  1.00 44.90  ? 343 SER A N   1 
ATOM   344  C CA  . SER A 1 98  ? 27.020 1.134   33.238  1.00 48.27  ? 343 SER A CA  1 
ATOM   345  C C   . SER A 1 98  ? 26.680 2.380   32.443  1.00 48.70  ? 343 SER A C   1 
ATOM   346  O O   . SER A 1 98  ? 27.597 3.105   32.050  1.00 47.34  ? 343 SER A O   1 
ATOM   347  C CB  . SER A 1 98  ? 27.505 0.067   32.254  1.00 43.01  ? 343 SER A CB  1 
ATOM   348  O OG  . SER A 1 98  ? 26.438 -0.309  31.417  1.00 46.02  ? 343 SER A OG  1 
ATOM   349  N N   . GLY A 1 99  ? 25.404 2.632   32.171  1.00 43.74  ? 344 GLY A N   1 
ATOM   350  C CA  . GLY A 1 99  ? 25.043 3.642   31.203  1.00 45.01  ? 344 GLY A CA  1 
ATOM   351  C C   . GLY A 1 99  ? 25.226 3.227   29.761  1.00 45.79  ? 344 GLY A C   1 
ATOM   352  O O   . GLY A 1 99  ? 24.953 4.033   28.866  1.00 41.91  ? 344 GLY A O   1 
ATOM   353  N N   . LYS A 1 100 ? 25.679 2.001   29.503  1.00 41.32  ? 345 LYS A N   1 
ATOM   354  C CA  . LYS A 1 100 ? 25.809 1.519   28.138  1.00 42.19  ? 345 LYS A CA  1 
ATOM   355  C C   . LYS A 1 100 ? 24.439 1.276   27.527  1.00 40.94  ? 345 LYS A C   1 
ATOM   356  O O   . LYS A 1 100 ? 23.462 0.992   28.228  1.00 40.34  ? 345 LYS A O   1 
ATOM   357  C CB  . LYS A 1 100 ? 26.617 0.218   28.093  1.00 43.61  ? 345 LYS A CB  1 
ATOM   358  C CG  . LYS A 1 100 ? 28.126 0.407   27.951  1.00 49.10  ? 345 LYS A CG  1 
ATOM   359  C CD  . LYS A 1 100 ? 28.804 -0.948  27.771  1.00 51.37  ? 345 LYS A CD  1 
ATOM   360  C CE  . LYS A 1 100 ? 30.258 -0.800  27.359  1.00 58.01  ? 345 LYS A CE  1 
ATOM   361  N NZ  . LYS A 1 100 ? 31.033 -2.044  27.654  1.00 58.48  ? 345 LYS A NZ  1 
ATOM   362  N N   . LEU A 1 101 ? 24.381 1.360   26.204  1.00 37.12  ? 346 LEU A N   1 
ATOM   363  C CA  . LEU A 1 101 ? 23.153 1.102   25.465  1.00 35.65  ? 346 LEU A CA  1 
ATOM   364  C C   . LEU A 1 101 ? 23.183 -0.291  24.858  1.00 40.66  ? 346 LEU A C   1 
ATOM   365  O O   . LEU A 1 101 ? 24.206 -0.717  24.309  1.00 40.14  ? 346 LEU A O   1 
ATOM   366  C CB  . LEU A 1 101 ? 22.958 2.133   24.354  1.00 36.60  ? 346 LEU A CB  1 
ATOM   367  C CG  . LEU A 1 101 ? 23.107 3.562   24.873  1.00 39.86  ? 346 LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 101 ? 23.038 4.539   23.727  1.00 42.94  ? 346 LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 101 ? 22.037 3.861   25.919  1.00 39.57  ? 346 LEU A CD2 1 
ATOM   370  N N   . VAL A 1 102 ? 22.055 -0.993  24.965  1.00 36.33  ? 347 VAL A N   1 
ATOM   371  C CA  . VAL A 1 102 ? 21.831 -2.266  24.288  1.00 34.56  ? 347 VAL A CA  1 
ATOM   372  C C   . VAL A 1 102 ? 20.549 -2.152  23.477  1.00 36.24  ? 347 VAL A C   1 
ATOM   373  O O   . VAL A 1 102 ? 19.758 -1.222  23.649  1.00 35.62  ? 347 VAL A O   1 
ATOM   374  C CB  . VAL A 1 102 ? 21.737 -3.452  25.265  1.00 34.20  ? 347 VAL A CB  1 
ATOM   375  C CG1 . VAL A 1 102 ? 23.064 -3.663  25.965  1.00 35.66  ? 347 VAL A CG1 1 
ATOM   376  C CG2 . VAL A 1 102 ? 20.607 -3.225  26.268  1.00 35.23  ? 347 VAL A CG2 1 
ATOM   377  N N   . ALA A 1 103 ? 20.357 -3.109  22.572  1.00 31.38  ? 348 ALA A N   1 
ATOM   378  C CA  . ALA A 1 103 ? 19.118 -3.223  21.820  1.00 33.06  ? 348 ALA A CA  1 
ATOM   379  C C   . ALA A 1 103 ? 18.307 -4.378  22.389  1.00 33.43  ? 348 ALA A C   1 
ATOM   380  O O   . ALA A 1 103 ? 18.863 -5.350  22.900  1.00 34.64  ? 348 ALA A O   1 
ATOM   381  C CB  . ALA A 1 103 ? 19.380 -3.448  20.323  1.00 34.63  ? 348 ALA A CB  1 
ATOM   382  N N   . VAL A 1 104 ? 16.986 -4.247  22.331  1.00 32.32  ? 349 VAL A N   1 
ATOM   383  C CA  . VAL A 1 104 ? 16.081 -5.275  22.836  1.00 34.50  ? 349 VAL A CA  1 
ATOM   384  C C   . VAL A 1 104 ? 15.043 -5.534  21.759  1.00 31.83  ? 349 VAL A C   1 
ATOM   385  O O   . VAL A 1 104 ? 14.261 -4.641  21.419  1.00 33.76  ? 349 VAL A O   1 
ATOM   386  C CB  . VAL A 1 104 ? 15.402 -4.876  24.160  1.00 33.19  ? 349 VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 104 ? 14.555 -6.041  24.699  1.00 30.86  ? 349 VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 104 ? 16.453 -4.452  25.215  1.00 32.33  ? 349 VAL A CG2 1 
ATOM   389  N N   . LYS A 1 105 ? 15.045 -6.747  21.220  1.00 31.26  ? 350 LYS A N   1 
ATOM   390  C CA  . LYS A 1 105 ? 14.046 -7.159  20.246  1.00 30.72  ? 350 LYS A CA  1 
ATOM   391  C C   . LYS A 1 105 ? 12.889 -7.811  20.994  1.00 32.48  ? 350 LYS A C   1 
ATOM   392  O O   . LYS A 1 105 ? 13.102 -8.724  21.794  1.00 33.05  ? 350 LYS A O   1 
ATOM   393  C CB  . LYS A 1 105 ? 14.670 -8.123  19.235  1.00 32.00  ? 350 LYS A CB  1 
ATOM   394  C CG  . LYS A 1 105 ? 13.861 -8.354  17.975  1.00 36.09  ? 350 LYS A CG  1 
ATOM   395  C CD  . LYS A 1 105 ? 14.642 -9.256  17.039  1.00 39.60  ? 350 LYS A CD  1 
ATOM   396  C CE  . LYS A 1 105 ? 13.875 -9.531  15.761  1.00 45.96  ? 350 LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 105 ? 14.723 -10.323 14.831  1.00 49.30  ? 350 LYS A NZ  1 
ATOM   398  N N   . LYS A 1 106 ? 11.675 -7.312  20.766  1.00 32.29  ? 351 LYS A N   1 
ATOM   399  C CA  . LYS A 1 106 ? 10.481 -7.810  21.436  1.00 34.20  ? 351 LYS A CA  1 
ATOM   400  C C   . LYS A 1 106 ? 9.550  -8.421  20.402  1.00 33.86  ? 351 LYS A C   1 
ATOM   401  O O   . LYS A 1 106 ? 9.199  -7.765  19.418  1.00 34.71  ? 351 LYS A O   1 
ATOM   402  C CB  . LYS A 1 106 ? 9.769  -6.688  22.192  1.00 37.64  ? 351 LYS A CB  1 
ATOM   403  C CG  . LYS A 1 106 ? 10.632 -6.016  23.248  1.00 33.59  ? 351 LYS A CG  1 
ATOM   404  C CD  . LYS A 1 106 ? 9.867  -4.894  23.930  1.00 36.53  ? 351 LYS A CD  1 
ATOM   405  C CE  . LYS A 1 106 ? 10.723 -4.156  24.946  1.00 39.94  ? 351 LYS A CE  1 
ATOM   406  N NZ  . LYS A 1 106 ? 9.906  -3.173  25.724  1.00 42.60  ? 351 LYS A NZ  1 
ATOM   407  N N   . MET A 1 107 ? 9.163  -9.678  20.612  1.00 33.93  ? 352 MET A N   1 
ATOM   408  C CA  . MET A 1 107 ? 8.348  -10.412 19.650  1.00 31.91  ? 352 MET A CA  1 
ATOM   409  C C   . MET A 1 107 ? 7.166  -11.023 20.385  1.00 35.63  ? 352 MET A C   1 
ATOM   410  O O   . MET A 1 107 ? 7.353  -11.859 21.273  1.00 37.97  ? 352 MET A O   1 
ATOM   411  C CB  . MET A 1 107 ? 9.191  -11.482 18.951  1.00 34.79  ? 352 MET A CB  1 
ATOM   412  C CG  . MET A 1 107 ? 10.366 -10.893 18.118  1.00 37.88  ? 352 MET A CG  1 
ATOM   413  S SD  . MET A 1 107 ? 11.815 -11.984 18.052  1.00 41.22  ? 352 MET A SD  1 
ATOM   414  C CE  . MET A 1 107 ? 12.448 -11.766 19.713  1.00 36.23  ? 352 MET A CE  1 
ATOM   415  N N   . ASP A 1 108 ? 5.956  -10.589 20.036  1.00 35.70  ? 353 ASP A N   1 
ATOM   416  C CA  . ASP A 1 108 ? 4.756  -11.131 20.667  1.00 38.81  ? 353 ASP A CA  1 
ATOM   417  C C   . ASP A 1 108 ? 4.504  -12.528 20.127  1.00 40.60  ? 353 ASP A C   1 
ATOM   418  O O   . ASP A 1 108 ? 4.358  -12.710 18.914  1.00 41.73  ? 353 ASP A O   1 
ATOM   419  C CB  . ASP A 1 108 ? 3.554  -10.226 20.399  1.00 41.04  ? 353 ASP A CB  1 
ATOM   420  C CG  . ASP A 1 108 ? 2.348  -10.561 21.281  1.00 48.15  ? 353 ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 108 ? 2.025  -11.760 21.476  1.00 47.12  ? 353 ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 108 ? 1.721  -9.609  21.783  1.00 47.56  ? 353 ASP A OD2 1 
ATOM   423  N N   . LEU A 1 109 ? 4.435  -13.515 21.023  1.00 39.99  ? 354 LEU A N   1 
ATOM   424  C CA  . LEU A 1 109 ? 4.200  -14.885 20.571  1.00 40.54  ? 354 LEU A CA  1 
ATOM   425  C C   . LEU A 1 109 ? 2.885  -15.019 19.813  1.00 43.64  ? 354 LEU A C   1 
ATOM   426  O O   . LEU A 1 109 ? 2.766  -15.867 18.919  1.00 43.15  ? 354 LEU A O   1 
ATOM   427  C CB  . LEU A 1 109 ? 4.196  -15.846 21.767  1.00 42.25  ? 354 LEU A CB  1 
ATOM   428  C CG  . LEU A 1 109 ? 5.512  -16.454 22.243  1.00 43.78  ? 354 LEU A CG  1 
ATOM   429  C CD1 . LEU A 1 109 ? 6.593  -15.400 22.412  1.00 43.58  ? 354 LEU A CD1 1 
ATOM   430  C CD2 . LEU A 1 109 ? 5.254  -17.177 23.551  1.00 45.67  ? 354 LEU A CD2 1 
ATOM   431  N N   . ARG A 1 110 ? 1.890  -14.203 20.162  1.00 46.02  ? 355 ARG A N   1 
ATOM   432  C CA  . ARG A 1 110 ? 0.557  -14.310 19.581  1.00 48.09  ? 355 ARG A CA  1 
ATOM   433  C C   . ARG A 1 110 ? 0.468  -13.721 18.183  1.00 46.36  ? 355 ARG A C   1 
ATOM   434  O O   . ARG A 1 110 ? -0.483 -14.030 17.460  1.00 50.18  ? 355 ARG A O   1 
ATOM   435  C CB  . ARG A 1 110 ? -0.463 -13.615 20.487  1.00 47.18  ? 355 ARG A CB  1 
ATOM   436  C CG  . ARG A 1 110 ? -0.660 -14.290 21.841  1.00 47.89  ? 355 ARG A CG  1 
ATOM   437  C CD  . ARG A 1 110 ? -1.287 -13.325 22.846  1.00 53.87  ? 355 ARG A CD  1 
ATOM   438  N NE  . ARG A 1 110 ? -0.446 -12.148 23.063  1.00 53.72  ? 355 ARG A NE  1 
ATOM   439  C CZ  . ARG A 1 110 ? -0.795 -11.106 23.813  1.00 62.49  ? 355 ARG A CZ  1 
ATOM   440  N NH1 . ARG A 1 110 ? -1.979 -11.089 24.420  1.00 64.60  ? 355 ARG A NH1 1 
ATOM   441  N NH2 . ARG A 1 110 ? 0.036  -10.079 23.957  1.00 57.40  ? 355 ARG A NH2 1 
ATOM   442  N N   . LYS A 1 111 ? 1.428  -12.885 17.788  1.00 42.72  ? 356 LYS A N   1 
ATOM   443  C CA  . LYS A 1 111 ? 1.417  -12.218 16.493  1.00 48.17  ? 356 LYS A CA  1 
ATOM   444  C C   . LYS A 1 111 ? 2.260  -12.928 15.443  1.00 48.85  ? 356 LYS A C   1 
ATOM   445  O O   . LYS A 1 111 ? 2.382  -12.422 14.327  1.00 49.65  ? 356 LYS A O   1 
ATOM   446  C CB  . LYS A 1 111 ? 1.912  -10.776 16.640  1.00 46.39  ? 356 LYS A CB  1 
ATOM   447  C CG  . LYS A 1 111 ? 1.092  -9.921  17.591  1.00 49.22  ? 356 LYS A CG  1 
ATOM   448  C CD  . LYS A 1 111 ? 1.692  -8.518  17.706  1.00 53.04  ? 356 LYS A CD  1 
ATOM   449  C CE  . LYS A 1 111 ? 0.876  -7.627  18.630  1.00 59.30  ? 356 LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 111 ? 1.424  -6.236  18.670  1.00 62.08  ? 356 LYS A NZ  1 
ATOM   451  N N   . GLN A 1 112 ? 2.851  -14.073 15.764  1.00 44.85  ? 357 GLN A N   1 
ATOM   452  C CA  . GLN A 1 112 ? 3.747  -14.756 14.840  1.00 44.23  ? 357 GLN A CA  1 
ATOM   453  C C   . GLN A 1 112 ? 2.954  -15.658 13.906  1.00 49.36  ? 357 GLN A C   1 
ATOM   454  O O   . GLN A 1 112 ? 2.079  -16.407 14.350  1.00 49.37  ? 357 GLN A O   1 
ATOM   455  C CB  . GLN A 1 112 ? 4.787  -15.581 15.601  1.00 42.91  ? 357 GLN A CB  1 
ATOM   456  C CG  . GLN A 1 112 ? 5.568  -14.784 16.626  1.00 40.14  ? 357 GLN A CG  1 
ATOM   457  C CD  . GLN A 1 112 ? 6.253  -13.571 16.015  1.00 42.69  ? 357 GLN A CD  1 
ATOM   458  O OE1 . GLN A 1 112 ? 6.871  -13.660 14.955  1.00 44.34  ? 357 GLN A OE1 1 
ATOM   459  N NE2 . GLN A 1 112 ? 6.135  -12.429 16.677  1.00 40.94  ? 357 GLN A NE2 1 
ATOM   460  N N   . GLN A 1 113 ? 3.264  -15.574 12.611  1.00 45.99  ? 358 GLN A N   1 
ATOM   461  C CA  . GLN A 1 113 ? 2.691  -16.506 11.646  1.00 51.02  ? 358 GLN A CA  1 
ATOM   462  C C   . GLN A 1 113 ? 3.187  -17.927 11.898  1.00 54.05  ? 358 GLN A C   1 
ATOM   463  O O   . GLN A 1 113 ? 2.400  -18.880 11.875  1.00 52.22  ? 358 GLN A O   1 
ATOM   464  C CB  . GLN A 1 113 ? 3.035  -16.053 10.226  1.00 59.14  ? 358 GLN A CB  1 
ATOM   465  C CG  . GLN A 1 113 ? 2.135  -16.635 9.146   1.00 72.19  ? 358 GLN A CG  1 
ATOM   466  C CD  . GLN A 1 113 ? 0.673  -16.277 9.349   1.00 79.63  ? 358 GLN A CD  1 
ATOM   467  O OE1 . GLN A 1 113 ? -0.194 -17.151 9.356   1.00 82.12  ? 358 GLN A OE1 1 
ATOM   468  N NE2 . GLN A 1 113 ? 0.393  -14.988 9.511   1.00 80.17  ? 358 GLN A NE2 1 
ATOM   469  N N   . ARG A 1 114 ? 4.485  -18.090 12.151  1.00 45.38  ? 359 ARG A N   1 
ATOM   470  C CA  . ARG A 1 114 ? 5.063  -19.385 12.514  1.00 45.44  ? 359 ARG A CA  1 
ATOM   471  C C   . ARG A 1 114 ? 5.803  -19.192 13.828  1.00 44.47  ? 359 ARG A C   1 
ATOM   472  O O   . ARG A 1 114 ? 6.955  -18.752 13.830  1.00 44.61  ? 359 ARG A O   1 
ATOM   473  C CB  . ARG A 1 114 ? 5.987  -19.918 11.422  1.00 47.59  ? 359 ARG A CB  1 
ATOM   474  C CG  . ARG A 1 114 ? 5.252  -20.619 10.304  1.00 51.31  ? 359 ARG A CG  1 
ATOM   475  C CD  . ARG A 1 114 ? 6.190  -21.141 9.219   1.00 54.74  ? 359 ARG A CD  1 
ATOM   476  N NE  . ARG A 1 114 ? 7.127  -22.147 9.695   1.00 51.57  ? 359 ARG A NE  1 
ATOM   477  C CZ  . ARG A 1 114 ? 8.257  -22.467 9.073   1.00 52.42  ? 359 ARG A CZ  1 
ATOM   478  N NH1 . ARG A 1 114 ? 8.600  -21.852 7.946   1.00 46.97  ? 359 ARG A NH1 1 
ATOM   479  N NH2 . ARG A 1 114 ? 9.051  -23.398 9.587   1.00 55.43  ? 359 ARG A NH2 1 
ATOM   480  N N   . ARG A 1 115 ? 5.142  -19.508 14.947  1.00 44.66  ? 360 ARG A N   1 
ATOM   481  C CA  . ARG A 1 115 ? 5.762  -19.268 16.247  1.00 45.52  ? 360 ARG A CA  1 
ATOM   482  C C   . ARG A 1 115 ? 7.049  -20.058 16.409  1.00 42.53  ? 360 ARG A C   1 
ATOM   483  O O   . ARG A 1 115 ? 7.974  -19.600 17.091  1.00 41.94  ? 360 ARG A O   1 
ATOM   484  C CB  . ARG A 1 115 ? 4.799  -19.615 17.379  1.00 44.31  ? 360 ARG A CB  1 
ATOM   485  C CG  . ARG A 1 115 ? 3.627  -18.685 17.479  1.00 52.06  ? 360 ARG A CG  1 
ATOM   486  C CD  . ARG A 1 115 ? 2.669  -19.168 18.544  1.00 51.95  ? 360 ARG A CD  1 
ATOM   487  N NE  . ARG A 1 115 ? 2.372  -20.581 18.373  1.00 51.76  ? 360 ARG A NE  1 
ATOM   488  C CZ  . ARG A 1 115 ? 1.457  -21.238 19.076  1.00 58.19  ? 360 ARG A CZ  1 
ATOM   489  N NH1 . ARG A 1 115 ? 0.745  -20.603 20.000  1.00 54.08  ? 360 ARG A NH1 1 
ATOM   490  N NH2 . ARG A 1 115 ? 1.255  -22.529 18.856  1.00 55.32  ? 360 ARG A NH2 1 
ATOM   491  N N   . GLU A 1 116 ? 7.131  -21.242 15.799  1.00 42.75  ? 361 GLU A N   1 
ATOM   492  C CA  . GLU A 1 116 ? 8.312  -22.078 15.975  1.00 41.58  ? 361 GLU A CA  1 
ATOM   493  C C   . GLU A 1 116 ? 9.576  -21.442 15.411  1.00 43.36  ? 361 GLU A C   1 
ATOM   494  O O   . GLU A 1 116 ? 10.679 -21.825 15.822  1.00 40.65  ? 361 GLU A O   1 
ATOM   495  C CB  . GLU A 1 116 ? 8.097  -23.456 15.332  1.00 42.84  ? 361 GLU A CB  1 
ATOM   496  C CG  . GLU A 1 116 ? 8.207  -23.475 13.823  1.00 45.61  ? 361 GLU A CG  1 
ATOM   497  C CD  . GLU A 1 116 ? 6.866  -23.336 13.130  1.00 53.11  ? 361 GLU A CD  1 
ATOM   498  O OE1 . GLU A 1 116 ? 5.912  -22.818 13.757  1.00 49.84  ? 361 GLU A OE1 1 
ATOM   499  O OE2 . GLU A 1 116 ? 6.763  -23.756 11.958  1.00 50.58  ? 361 GLU A OE2 1 
ATOM   500  N N   . LEU A 1 117 ? 9.454  -20.472 14.497  1.00 40.29  ? 362 LEU A N   1 
ATOM   501  C CA  . LEU A 1 117 ? 10.653 -19.784 14.030  1.00 39.69  ? 362 LEU A CA  1 
ATOM   502  C C   . LEU A 1 117 ? 11.296 -18.939 15.124  1.00 41.64  ? 362 LEU A C   1 
ATOM   503  O O   . LEU A 1 117 ? 12.475 -18.595 15.004  1.00 39.44  ? 362 LEU A O   1 
ATOM   504  C CB  . LEU A 1 117 ? 10.340 -18.911 12.810  1.00 41.15  ? 362 LEU A CB  1 
ATOM   505  C CG  . LEU A 1 117 ? 9.969  -19.655 11.520  1.00 44.17  ? 362 LEU A CG  1 
ATOM   506  C CD1 . LEU A 1 117 ? 9.596  -18.677 10.405  1.00 47.77  ? 362 LEU A CD1 1 
ATOM   507  C CD2 . LEU A 1 117 ? 11.101 -20.565 11.067  1.00 51.26  ? 362 LEU A CD2 1 
ATOM   508  N N   . LEU A 1 118 ? 10.570 -18.613 16.200  1.00 38.62  ? 363 LEU A N   1 
ATOM   509  C CA  . LEU A 1 118 ? 11.188 -17.850 17.287  1.00 37.79  ? 363 LEU A CA  1 
ATOM   510  C C   . LEU A 1 118 ? 12.379 -18.571 17.918  1.00 38.67  ? 363 LEU A C   1 
ATOM   511  O O   . LEU A 1 118 ? 13.248 -17.911 18.513  1.00 36.08  ? 363 LEU A O   1 
ATOM   512  C CB  . LEU A 1 118 ? 10.174 -17.535 18.378  1.00 36.61  ? 363 LEU A CB  1 
ATOM   513  C CG  . LEU A 1 118 ? 9.020  -16.608 17.984  1.00 41.40  ? 363 LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 118 ? 8.067  -16.434 19.153  1.00 40.82  ? 363 LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 118 ? 9.532  -15.259 17.484  1.00 40.13  ? 363 LEU A CD2 1 
ATOM   516  N N   . PHE A 1 119 ? 12.433 -19.904 17.831  1.00 38.74  ? 364 PHE A N   1 
ATOM   517  C CA  . PHE A 1 119 ? 13.605 -20.623 18.318  1.00 39.82  ? 364 PHE A CA  1 
ATOM   518  C C   . PHE A 1 119 ? 14.859 -20.296 17.517  1.00 43.03  ? 364 PHE A C   1 
ATOM   519  O O   . PHE A 1 119 ? 15.961 -20.544 18.010  1.00 45.33  ? 364 PHE A O   1 
ATOM   520  C CB  . PHE A 1 119 ? 13.372 -22.137 18.299  1.00 40.41  ? 364 PHE A CB  1 
ATOM   521  C CG  . PHE A 1 119 ? 12.350 -22.607 19.308  1.00 44.27  ? 364 PHE A CG  1 
ATOM   522  C CD1 . PHE A 1 119 ? 12.587 -22.478 20.668  1.00 41.67  ? 364 PHE A CD1 1 
ATOM   523  C CD2 . PHE A 1 119 ? 11.155 -23.169 18.895  1.00 48.21  ? 364 PHE A CD2 1 
ATOM   524  C CE1 . PHE A 1 119 ? 11.650 -22.900 21.600  1.00 44.42  ? 364 PHE A CE1 1 
ATOM   525  C CE2 . PHE A 1 119 ? 10.212 -23.598 19.822  1.00 50.70  ? 364 PHE A CE2 1 
ATOM   526  C CZ  . PHE A 1 119 ? 10.459 -23.464 21.172  1.00 45.74  ? 364 PHE A CZ  1 
ATOM   527  N N   . ASN A 1 120 ? 14.716 -19.751 16.302  1.00 41.61  ? 365 ASN A N   1 
ATOM   528  C CA  . ASN A 1 120 ? 15.890 -19.370 15.517  1.00 40.98  ? 365 ASN A CA  1 
ATOM   529  C C   . ASN A 1 120 ? 16.761 -18.379 16.275  1.00 43.43  ? 365 ASN A C   1 
ATOM   530  O O   . ASN A 1 120 ? 17.993 -18.460 16.225  1.00 50.59  ? 365 ASN A O   1 
ATOM   531  C CB  . ASN A 1 120 ? 15.468 -18.776 14.170  1.00 42.23  ? 365 ASN A CB  1 
ATOM   532  C CG  . ASN A 1 120 ? 15.055 -19.835 13.168  1.00 47.33  ? 365 ASN A CG  1 
ATOM   533  O OD1 . ASN A 1 120 ? 15.499 -20.975 13.246  1.00 49.99  ? 365 ASN A OD1 1 
ATOM   534  N ND2 . ASN A 1 120 ? 14.202 -19.460 12.216  1.00 46.64  ? 365 ASN A ND2 1 
ATOM   535  N N   . GLU A 1 121 ? 16.135 -17.438 16.981  1.00 42.40  ? 366 GLU A N   1 
ATOM   536  C CA  . GLU A 1 121 ? 16.889 -16.494 17.799  1.00 51.39  ? 366 GLU A CA  1 
ATOM   537  C C   . GLU A 1 121 ? 17.739 -17.224 18.836  1.00 54.05  ? 366 GLU A C   1 
ATOM   538  O O   . GLU A 1 121 ? 18.888 -16.845 19.090  1.00 52.72  ? 366 GLU A O   1 
ATOM   539  C CB  . GLU A 1 121 ? 15.930 -15.510 18.470  1.00 43.13  ? 366 GLU A CB  1 
ATOM   540  C CG  . GLU A 1 121 ? 14.869 -14.902 17.529  1.00 50.90  ? 366 GLU A CG  1 
ATOM   541  C CD  . GLU A 1 121 ? 15.392 -13.736 16.681  1.00 56.56  ? 366 GLU A CD  1 
ATOM   542  O OE1 . GLU A 1 121 ? 16.578 -13.364 16.826  1.00 56.53  ? 366 GLU A OE1 1 
ATOM   543  O OE2 . GLU A 1 121 ? 14.608 -13.186 15.871  1.00 52.62  ? 366 GLU A OE2 1 
ATOM   544  N N   . VAL A 1 122 ? 17.204 -18.297 19.417  1.00 50.94  ? 367 VAL A N   1 
ATOM   545  C CA  . VAL A 1 122 ? 17.941 -19.048 20.429  1.00 46.11  ? 367 VAL A CA  1 
ATOM   546  C C   . VAL A 1 122 ? 19.058 -19.868 19.792  1.00 44.85  ? 367 VAL A C   1 
ATOM   547  O O   . VAL A 1 122 ? 20.202 -19.851 20.261  1.00 44.57  ? 367 VAL A O   1 
ATOM   548  C CB  . VAL A 1 122 ? 16.970 -19.933 21.241  1.00 51.06  ? 367 VAL A CB  1 
ATOM   549  C CG1 . VAL A 1 122 ? 17.726 -20.763 22.283  1.00 50.48  ? 367 VAL A CG1 1 
ATOM   550  C CG2 . VAL A 1 122 ? 15.898 -19.076 21.908  1.00 44.60  ? 367 VAL A CG2 1 
ATOM   551  N N   . VAL A 1 123 ? 18.748 -20.610 18.724  1.00 44.94  ? 368 VAL A N   1 
ATOM   552  C CA  . VAL A 1 123 ? 19.760 -21.429 18.057  1.00 43.69  ? 368 VAL A CA  1 
ATOM   553  C C   . VAL A 1 123 ? 20.937 -20.570 17.593  1.00 46.57  ? 368 VAL A C   1 
ATOM   554  O O   . VAL A 1 123 ? 22.099 -20.954 17.750  1.00 50.11  ? 368 VAL A O   1 
ATOM   555  C CB  . VAL A 1 123 ? 19.133 -22.204 16.882  1.00 50.08  ? 368 VAL A CB  1 
ATOM   556  C CG1 . VAL A 1 123 ? 20.215 -22.951 16.073  1.00 53.35  ? 368 VAL A CG1 1 
ATOM   557  C CG2 . VAL A 1 123 ? 18.069 -23.188 17.386  1.00 48.82  ? 368 VAL A CG2 1 
ATOM   558  N N   . ILE A 1 124 ? 20.664 -19.393 17.028  1.00 43.53  ? 369 ILE A N   1 
ATOM   559  C CA  . ILE A 1 124 ? 21.757 -18.592 16.480  1.00 47.50  ? 369 ILE A CA  1 
ATOM   560  C C   . ILE A 1 124 ? 22.592 -17.991 17.602  1.00 52.70  ? 369 ILE A C   1 
ATOM   561  O O   . ILE A 1 124 ? 23.827 -17.954 17.527  1.00 54.35  ? 369 ILE A O   1 
ATOM   562  C CB  . ILE A 1 124 ? 21.205 -17.508 15.539  1.00 51.61  ? 369 ILE A CB  1 
ATOM   563  C CG1 . ILE A 1 124 ? 20.598 -18.157 14.291  1.00 46.31  ? 369 ILE A CG1 1 
ATOM   564  C CG2 . ILE A 1 124 ? 22.303 -16.526 15.164  1.00 53.37  ? 369 ILE A CG2 1 
ATOM   565  C CD1 . ILE A 1 124 ? 21.621 -18.780 13.370  1.00 53.16  ? 369 ILE A CD1 1 
ATOM   566  N N   . MET A 1 125 ? 21.927 -17.520 18.661  1.00 46.57  ? 370 MET A N   1 
ATOM   567  C CA  . MET A 1 125 ? 22.617 -16.972 19.823  1.00 47.38  ? 370 MET A CA  1 
ATOM   568  C C   . MET A 1 125 ? 23.539 -18.002 20.463  1.00 51.17  ? 370 MET A C   1 
ATOM   569  O O   . MET A 1 125 ? 24.655 -17.675 20.883  1.00 50.88  ? 370 MET A O   1 
ATOM   570  C CB  . MET A 1 125 ? 21.580 -16.483 20.838  1.00 48.67  ? 370 MET A CB  1 
ATOM   571  C CG  . MET A 1 125 ? 22.137 -15.717 22.025  1.00 56.03  ? 370 MET A CG  1 
ATOM   572  S SD  . MET A 1 125 ? 20.839 -15.123 23.137  1.00 52.95  ? 370 MET A SD  1 
ATOM   573  C CE  . MET A 1 125 ? 19.543 -14.742 21.965  1.00 51.46  ? 370 MET A CE  1 
ATOM   574  N N   . ARG A 1 126 ? 23.094 -19.257 20.533  1.00 53.82  ? 371 ARG A N   1 
ATOM   575  C CA  . ARG A 1 126 ? 23.848 -20.275 21.258  1.00 58.05  ? 371 ARG A CA  1 
ATOM   576  C C   . ARG A 1 126 ? 25.056 -20.791 20.487  1.00 60.26  ? 371 ARG A C   1 
ATOM   577  O O   . ARG A 1 126 ? 26.023 -21.245 21.108  1.00 66.17  ? 371 ARG A O   1 
ATOM   578  C CB  . ARG A 1 126 ? 22.941 -21.456 21.617  1.00 55.49  ? 371 ARG A CB  1 
ATOM   579  C CG  . ARG A 1 126 ? 21.897 -21.147 22.682  1.00 54.83  ? 371 ARG A CG  1 
ATOM   580  C CD  . ARG A 1 126 ? 21.279 -22.431 23.214  1.00 58.71  ? 371 ARG A CD  1 
ATOM   581  N NE  . ARG A 1 126 ? 20.363 -22.195 24.329  1.00 58.66  ? 371 ARG A NE  1 
ATOM   582  C CZ  . ARG A 1 126 ? 19.897 -23.159 25.120  1.00 60.10  ? 371 ARG A CZ  1 
ATOM   583  N NH1 . ARG A 1 126 ? 20.267 -24.422 24.919  1.00 56.25  ? 371 ARG A NH1 1 
ATOM   584  N NH2 . ARG A 1 126 ? 19.068 -22.867 26.116  1.00 55.49  ? 371 ARG A NH2 1 
ATOM   585  N N   . ASP A 1 127 ? 25.035 -20.741 19.153  1.00 56.48  ? 372 ASP A N   1 
ATOM   586  C CA  . ASP A 1 127 ? 25.986 -21.535 18.387  1.00 61.97  ? 372 ASP A CA  1 
ATOM   587  C C   . ASP A 1 127 ? 26.741 -20.803 17.289  1.00 58.49  ? 372 ASP A C   1 
ATOM   588  O O   . ASP A 1 127 ? 27.733 -21.353 16.797  1.00 62.87  ? 372 ASP A O   1 
ATOM   589  C CB  . ASP A 1 127 ? 25.275 -22.746 17.761  1.00 67.44  ? 372 ASP A CB  1 
ATOM   590  C CG  . ASP A 1 127 ? 24.766 -23.723 18.803  1.00 72.32  ? 372 ASP A CG  1 
ATOM   591  O OD1 . ASP A 1 127 ? 25.589 -24.212 19.609  1.00 71.01  ? 372 ASP A OD1 1 
ATOM   592  O OD2 . ASP A 1 127 ? 23.542 -23.987 18.827  1.00 74.19  ? 372 ASP A OD2 1 
ATOM   593  N N   . TYR A 1 128 ? 26.325 -19.605 16.883  1.00 59.99  ? 373 TYR A N   1 
ATOM   594  C CA  . TYR A 1 128 ? 26.925 -18.936 15.729  1.00 60.17  ? 373 TYR A CA  1 
ATOM   595  C C   . TYR A 1 128 ? 27.239 -17.489 16.087  1.00 61.29  ? 373 TYR A C   1 
ATOM   596  O O   . TYR A 1 128 ? 26.330 -16.665 16.229  1.00 64.87  ? 373 TYR A O   1 
ATOM   597  C CB  . TYR A 1 128 ? 26.004 -19.033 14.506  1.00 58.31  ? 373 TYR A CB  1 
ATOM   598  C CG  . TYR A 1 128 ? 25.594 -20.464 14.196  1.00 61.18  ? 373 TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 128 ? 26.388 -21.280 13.399  1.00 60.61  ? 373 TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 128 ? 24.427 -21.009 14.726  1.00 64.15  ? 373 TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 128 ? 26.027 -22.593 13.129  1.00 63.03  ? 373 TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 128 ? 24.057 -22.321 14.462  1.00 61.60  ? 373 TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 128 ? 24.862 -23.108 13.663  1.00 64.88  ? 373 TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 128 ? 24.501 -24.410 13.394  1.00 64.20  ? 373 TYR A OH  1 
ATOM   605  N N   . GLN A 1 129 ? 28.528 -17.186 16.242  1.00 62.65  ? 374 GLN A N   1 
ATOM   606  C CA  . GLN A 1 129 ? 29.002 -15.843 16.545  1.00 60.16  ? 374 GLN A CA  1 
ATOM   607  C C   . GLN A 1 129 ? 30.118 -15.493 15.575  1.00 60.38  ? 374 GLN A C   1 
ATOM   608  O O   . GLN A 1 129 ? 30.918 -16.358 15.210  1.00 70.27  ? 374 GLN A O   1 
ATOM   609  C CB  . GLN A 1 129 ? 29.501 -15.727 17.992  1.00 62.30  ? 374 GLN A CB  1 
ATOM   610  C CG  . GLN A 1 129 ? 28.443 -16.055 19.051  1.00 69.50  ? 374 GLN A CG  1 
ATOM   611  C CD  . GLN A 1 129 ? 28.451 -17.520 19.472  1.00 75.03  ? 374 GLN A CD  1 
ATOM   612  O OE1 . GLN A 1 129 ? 29.439 -18.234 19.273  1.00 80.33  ? 374 GLN A OE1 1 
ATOM   613  N NE2 . GLN A 1 129 ? 27.347 -17.971 20.064  1.00 69.37  ? 374 GLN A NE2 1 
ATOM   614  N N   . HIS A 1 130 ? 30.172 -14.228 15.157  1.00 54.84  ? 375 HIS A N   1 
ATOM   615  C CA  . HIS A 1 130 ? 31.090 -13.831 14.094  1.00 54.33  ? 375 HIS A CA  1 
ATOM   616  C C   . HIS A 1 130 ? 31.230 -12.317 14.100  1.00 57.44  ? 375 HIS A C   1 
ATOM   617  O O   . HIS A 1 130 ? 30.339 -11.597 14.559  1.00 58.50  ? 375 HIS A O   1 
ATOM   618  C CB  . HIS A 1 130 ? 30.594 -14.333 12.733  1.00 56.16  ? 375 HIS A CB  1 
ATOM   619  C CG  . HIS A 1 130 ? 31.500 -14.006 11.587  1.00 57.31  ? 375 HIS A CG  1 
ATOM   620  N ND1 . HIS A 1 130 ? 31.402 -12.831 10.873  1.00 55.59  ? 375 HIS A ND1 1 
ATOM   621  C CD2 . HIS A 1 130 ? 32.499 -14.714 11.010  1.00 58.78  ? 375 HIS A CD2 1 
ATOM   622  C CE1 . HIS A 1 130 ? 32.315 -12.820 9.919   1.00 59.20  ? 375 HIS A CE1 1 
ATOM   623  N NE2 . HIS A 1 130 ? 32.994 -13.951 9.980   1.00 61.25  ? 375 HIS A NE2 1 
ATOM   624  N N   . GLU A 1 131 ? 32.369 -11.851 13.579  1.00 57.57  ? 376 GLU A N   1 
ATOM   625  C CA  . GLU A 1 131 ? 32.667 -10.421 13.536  1.00 59.22  ? 376 GLU A CA  1 
ATOM   626  C C   . GLU A 1 131 ? 31.564 -9.622  12.854  1.00 57.14  ? 376 GLU A C   1 
ATOM   627  O O   . GLU A 1 131 ? 31.274 -8.489  13.252  1.00 56.71  ? 376 GLU A O   1 
ATOM   628  C CB  . GLU A 1 131 ? 33.987 -10.196 12.801  1.00 66.73  ? 376 GLU A CB  1 
ATOM   629  C CG  . GLU A 1 131 ? 35.134 -9.728  13.672  1.00 78.69  ? 376 GLU A CG  1 
ATOM   630  C CD  . GLU A 1 131 ? 36.452 -10.348 13.256  1.00 89.57  ? 376 GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 131 ? 36.477 -11.575 13.017  1.00 92.93  ? 376 GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 131 ? 37.459 -9.614  13.160  1.00 93.58  ? 376 GLU A OE2 1 
ATOM   633  N N   . ASN A 1 132 ? 30.951 -10.189 11.814  1.00 55.07  ? 377 ASN A N   1 
ATOM   634  C CA  . ASN A 1 132 ? 29.986 -9.483  10.984  1.00 50.23  ? 377 ASN A CA  1 
ATOM   635  C C   . ASN A 1 132 ? 28.561 -9.946  11.233  1.00 47.25  ? 377 ASN A C   1 
ATOM   636  O O   . ASN A 1 132 ? 27.704 -9.819  10.352  1.00 47.05  ? 377 ASN A O   1 
ATOM   637  C CB  . ASN A 1 132 ? 30.357 -9.638  9.511   1.00 51.06  ? 377 ASN A CB  1 
ATOM   638  C CG  . ASN A 1 132 ? 31.701 -9.022  9.195   1.00 57.20  ? 377 ASN A CG  1 
ATOM   639  O OD1 . ASN A 1 132 ? 32.600 -9.691  8.708   1.00 55.07  ? 377 ASN A OD1 1 
ATOM   640  N ND2 . ASN A 1 132 ? 31.845 -7.738  9.489   1.00 60.81  ? 377 ASN A ND2 1 
ATOM   641  N N   . VAL A 1 133 ? 28.299 -10.484 12.416  1.00 46.08  ? 378 VAL A N   1 
ATOM   642  C CA  . VAL A 1 133 ? 26.975 -10.907 12.843  1.00 48.05  ? 378 VAL A CA  1 
ATOM   643  C C   . VAL A 1 133 ? 26.692 -10.194 14.153  1.00 47.20  ? 378 VAL A C   1 
ATOM   644  O O   . VAL A 1 133 ? 27.567 -10.117 15.021  1.00 48.12  ? 378 VAL A O   1 
ATOM   645  C CB  . VAL A 1 133 ? 26.899 -12.434 13.011  1.00 44.68  ? 378 VAL A CB  1 
ATOM   646  C CG1 . VAL A 1 133 ? 25.551 -12.847 13.560  1.00 45.78  ? 378 VAL A CG1 1 
ATOM   647  C CG2 . VAL A 1 133 ? 27.210 -13.121 11.681  1.00 48.01  ? 378 VAL A CG2 1 
ATOM   648  N N   . VAL A 1 134 ? 25.494 -9.632  14.279  1.00 42.16  ? 379 VAL A N   1 
ATOM   649  C CA  . VAL A 1 134 ? 25.160 -8.915  15.499  1.00 43.54  ? 379 VAL A CA  1 
ATOM   650  C C   . VAL A 1 134 ? 25.220 -9.875  16.672  1.00 45.27  ? 379 VAL A C   1 
ATOM   651  O O   . VAL A 1 134 ? 24.772 -11.024 16.587  1.00 43.82  ? 379 VAL A O   1 
ATOM   652  C CB  . VAL A 1 134 ? 23.776 -8.257  15.394  1.00 41.62  ? 379 VAL A CB  1 
ATOM   653  C CG1 . VAL A 1 134 ? 23.428 -7.630  16.706  1.00 43.39  ? 379 VAL A CG1 1 
ATOM   654  C CG2 . VAL A 1 134 ? 23.797 -7.199  14.289  1.00 43.79  ? 379 VAL A CG2 1 
ATOM   655  N N   . GLU A 1 135 ? 25.810 -9.424  17.768  1.00 44.56  ? 380 GLU A N   1 
ATOM   656  C CA  . GLU A 1 135 ? 25.963 -10.300 18.913  1.00 44.05  ? 380 GLU A CA  1 
ATOM   657  C C   . GLU A 1 135 ? 24.702 -10.261 19.756  1.00 42.93  ? 380 GLU A C   1 
ATOM   658  O O   . GLU A 1 135 ? 24.122 -9.199  19.987  1.00 38.70  ? 380 GLU A O   1 
ATOM   659  C CB  . GLU A 1 135 ? 27.169 -9.895  19.749  1.00 51.34  ? 380 GLU A CB  1 
ATOM   660  C CG  . GLU A 1 135 ? 27.646 -11.007 20.668  1.00 64.42  ? 380 GLU A CG  1 
ATOM   661  C CD  . GLU A 1 135 ? 28.913 -10.642 21.399  1.00 69.50  ? 380 GLU A CD  1 
ATOM   662  O OE1 . GLU A 1 135 ? 29.510 -9.598  21.055  1.00 70.85  ? 380 GLU A OE1 1 
ATOM   663  O OE2 . GLU A 1 135 ? 29.305 -11.394 22.316  1.00 70.87  ? 380 GLU A OE2 1 
ATOM   664  N N   . MET A 1 136 ? 24.267 -11.430 20.196  1.00 39.59  ? 381 MET A N   1 
ATOM   665  C CA  A MET A 1 136 ? 23.078 -11.571 21.025  0.17 41.56  ? 381 MET A CA  1 
ATOM   666  C CA  C MET A 1 136 ? 23.077 -11.568 21.026  0.83 41.19  ? 381 MET A CA  1 
ATOM   667  C C   . MET A 1 136 ? 23.505 -12.016 22.418  1.00 42.14  ? 381 MET A C   1 
ATOM   668  O O   . MET A 1 136 ? 24.248 -12.991 22.557  1.00 43.37  ? 381 MET A O   1 
ATOM   669  C CB  A MET A 1 136 ? 22.106 -12.571 20.396  0.17 44.49  ? 381 MET A CB  1 
ATOM   670  C CB  C MET A 1 136 ? 22.090 -12.550 20.388  0.83 42.30  ? 381 MET A CB  1 
ATOM   671  C CG  A MET A 1 136 ? 22.019 -12.445 18.876  0.17 51.59  ? 381 MET A CG  1 
ATOM   672  C CG  C MET A 1 136 ? 21.332 -11.946 19.187  0.83 51.39  ? 381 MET A CG  1 
ATOM   673  S SD  A MET A 1 136 ? 21.081 -13.761 18.070  0.17 54.14  ? 381 MET A SD  1 
ATOM   674  S SD  C MET A 1 136 ? 20.757 -13.118 17.923  0.83 59.28  ? 381 MET A SD  1 
ATOM   675  C CE  A MET A 1 136 ? 19.404 -13.287 18.488  0.17 53.40  ? 381 MET A CE  1 
ATOM   676  C CE  C MET A 1 136 ? 22.318 -13.677 17.244  0.83 51.96  ? 381 MET A CE  1 
ATOM   677  N N   . TYR A 1 137 ? 23.053 -11.289 23.445  1.00 37.22  ? 382 TYR A N   1 
ATOM   678  C CA  . TYR A 1 137 ? 23.535 -11.522 24.807  1.00 37.14  ? 382 TYR A CA  1 
ATOM   679  C C   . TYR A 1 137 ? 22.649 -12.474 25.611  1.00 36.33  ? 382 TYR A C   1 
ATOM   680  O O   . TYR A 1 137 ? 23.149 -13.441 26.193  1.00 39.60  ? 382 TYR A O   1 
ATOM   681  C CB  . TYR A 1 137 ? 23.677 -10.184 25.550  1.00 39.05  ? 382 TYR A CB  1 
ATOM   682  C CG  . TYR A 1 137 ? 24.529 -9.181  24.808  1.00 40.75  ? 382 TYR A CG  1 
ATOM   683  C CD1 . TYR A 1 137 ? 25.778 -9.536  24.310  1.00 42.36  ? 382 TYR A CD1 1 
ATOM   684  C CD2 . TYR A 1 137 ? 24.069 -7.889  24.575  1.00 37.77  ? 382 TYR A CD2 1 
ATOM   685  C CE1 . TYR A 1 137 ? 26.558 -8.620  23.608  1.00 43.37  ? 382 TYR A CE1 1 
ATOM   686  C CE2 . TYR A 1 137 ? 24.839 -6.968  23.878  1.00 38.81  ? 382 TYR A CE2 1 
ATOM   687  C CZ  . TYR A 1 137 ? 26.083 -7.345  23.397  1.00 41.74  ? 382 TYR A CZ  1 
ATOM   688  O OH  . TYR A 1 137 ? 26.851 -6.437  22.701  1.00 46.41  ? 382 TYR A OH  1 
ATOM   689  N N   . ASN A 1 138 ? 21.345 -12.209 25.686  1.00 34.81  ? 383 ASN A N   1 
ATOM   690  C CA  . ASN A 1 138 ? 20.461 -13.023 26.512  1.00 33.75  ? 383 ASN A CA  1 
ATOM   691  C C   . ASN A 1 138 ? 19.065 -12.996 25.913  1.00 33.13  ? 383 ASN A C   1 
ATOM   692  O O   . ASN A 1 138 ? 18.727 -12.109 25.129  1.00 32.20  ? 383 ASN A O   1 
ATOM   693  C CB  . ASN A 1 138 ? 20.412 -12.530 27.969  1.00 34.74  ? 383 ASN A CB  1 
ATOM   694  C CG  . ASN A 1 138 ? 21.753 -12.647 28.681  1.00 39.86  ? 383 ASN A CG  1 
ATOM   695  O OD1 . ASN A 1 138 ? 22.535 -11.690 28.737  1.00 40.74  ? 383 ASN A OD1 1 
ATOM   696  N ND2 . ASN A 1 138 ? 22.025 -13.821 29.228  1.00 37.45  ? 383 ASN A ND2 1 
ATOM   697  N N   . SER A 1 139 ? 18.261 -13.991 26.280  1.00 34.39  ? 384 SER A N   1 
ATOM   698  C CA  . SER A 1 139 ? 16.873 -14.065 25.853  1.00 33.01  ? 384 SER A CA  1 
ATOM   699  C C   . SER A 1 139 ? 16.001 -14.295 27.080  1.00 32.41  ? 384 SER A C   1 
ATOM   700  O O   . SER A 1 139 ? 16.429 -14.929 28.047  1.00 33.83  ? 384 SER A O   1 
ATOM   701  C CB  . SER A 1 139 ? 16.661 -15.178 24.810  1.00 33.71  ? 384 SER A CB  1 
ATOM   702  O OG  . SER A 1 139 ? 16.980 -16.461 25.333  1.00 37.72  ? 384 SER A OG  1 
ATOM   703  N N   . TYR A 1 140 ? 14.779 -13.757 27.038  1.00 32.29  ? 385 TYR A N   1 
ATOM   704  C CA  . TYR A 1 140 ? 13.865 -13.809 28.171  1.00 34.14  ? 385 TYR A CA  1 
ATOM   705  C C   . TYR A 1 140 ? 12.441 -13.960 27.665  1.00 37.05  ? 385 TYR A C   1 
ATOM   706  O O   . TYR A 1 140 ? 12.100 -13.500 26.570  1.00 37.91  ? 385 TYR A O   1 
ATOM   707  C CB  . TYR A 1 140 ? 13.951 -12.539 29.047  1.00 32.27  ? 385 TYR A CB  1 
ATOM   708  C CG  . TYR A 1 140 ? 15.352 -12.187 29.489  1.00 35.87  ? 385 TYR A CG  1 
ATOM   709  C CD1 . TYR A 1 140 ? 15.876 -12.695 30.673  1.00 35.48  ? 385 TYR A CD1 1 
ATOM   710  C CD2 . TYR A 1 140 ? 16.153 -11.356 28.718  1.00 34.34  ? 385 TYR A CD2 1 
ATOM   711  C CE1 . TYR A 1 140 ? 17.157 -12.380 31.073  1.00 37.10  ? 385 TYR A CE1 1 
ATOM   712  C CE2 . TYR A 1 140 ? 17.437 -11.034 29.110  1.00 32.65  ? 385 TYR A CE2 1 
ATOM   713  C CZ  . TYR A 1 140 ? 17.929 -11.542 30.286  1.00 35.25  ? 385 TYR A CZ  1 
ATOM   714  O OH  . TYR A 1 140 ? 19.204 -11.217 30.674  1.00 37.12  ? 385 TYR A OH  1 
ATOM   715  N N   . LEU A 1 141 ? 11.607 -14.605 28.479  1.00 36.35  ? 386 LEU A N   1 
ATOM   716  C CA  . LEU A 1 141 ? 10.162 -14.612 28.276  1.00 34.92  ? 386 LEU A CA  1 
ATOM   717  C C   . LEU A 1 141 ? 9.581  -13.571 29.219  1.00 38.09  ? 386 LEU A C   1 
ATOM   718  O O   . LEU A 1 141 ? 9.678  -13.714 30.439  1.00 39.57  ? 386 LEU A O   1 
ATOM   719  C CB  . LEU A 1 141 ? 9.559  -15.991 28.548  1.00 36.32  ? 386 LEU A CB  1 
ATOM   720  C CG  . LEU A 1 141 ? 8.029  -16.081 28.456  1.00 39.08  ? 386 LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 141 ? 7.557  -15.854 27.027  1.00 39.74  ? 386 LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 141 ? 7.533  -17.432 28.983  1.00 44.77  ? 386 LEU A CD2 1 
ATOM   723  N N   . VAL A 1 142 ? 8.992  -12.522 28.660  1.00 38.94  ? 387 VAL A N   1 
ATOM   724  C CA  . VAL A 1 142 ? 8.398  -11.446 29.448  1.00 39.08  ? 387 VAL A CA  1 
ATOM   725  C C   . VAL A 1 142 ? 6.922  -11.398 29.079  1.00 43.34  ? 387 VAL A C   1 
ATOM   726  O O   . VAL A 1 142 ? 6.559  -10.936 27.992  1.00 44.93  ? 387 VAL A O   1 
ATOM   727  C CB  . VAL A 1 142 ? 9.084  -10.102 29.195  1.00 40.12  ? 387 VAL A CB  1 
ATOM   728  C CG1 . VAL A 1 142 ? 8.514  -9.048  30.117  1.00 39.75  ? 387 VAL A CG1 1 
ATOM   729  C CG2 . VAL A 1 142 ? 10.609 -10.234 29.370  1.00 39.19  ? 387 VAL A CG2 1 
ATOM   730  N N   . GLY A 1 143 ? 6.071  -11.877 29.973  1.00 42.35  ? 388 GLY A N   1 
ATOM   731  C CA  . GLY A 1 143 ? 4.654  -11.972 29.664  1.00 42.71  ? 388 GLY A CA  1 
ATOM   732  C C   . GLY A 1 143 ? 4.427  -12.831 28.430  1.00 43.47  ? 388 GLY A C   1 
ATOM   733  O O   . GLY A 1 143 ? 4.818  -14.005 28.366  1.00 45.46  ? 388 GLY A O   1 
ATOM   734  N N   . ASP A 1 144 ? 3.776  -12.250 27.427  1.00 44.59  ? 389 ASP A N   1 
ATOM   735  C CA  . ASP A 1 144 ? 3.483  -12.952 26.189  1.00 44.89  ? 389 ASP A CA  1 
ATOM   736  C C   . ASP A 1 144 ? 4.537  -12.708 25.116  1.00 43.72  ? 389 ASP A C   1 
ATOM   737  O O   . ASP A 1 144 ? 4.300  -13.036 23.950  1.00 43.06  ? 389 ASP A O   1 
ATOM   738  C CB  . ASP A 1 144 ? 2.104  -12.535 25.671  1.00 50.08  ? 389 ASP A CB  1 
ATOM   739  C CG  . ASP A 1 144 ? 0.999  -12.804 26.682  1.00 56.15  ? 389 ASP A CG  1 
ATOM   740  O OD1 . ASP A 1 144 ? 0.909  -13.952 27.173  1.00 55.46  ? 389 ASP A OD1 1 
ATOM   741  O OD2 . ASP A 1 144 ? 0.237  -11.864 26.996  1.00 57.11  ? 389 ASP A OD2 1 
ATOM   742  N N   . GLU A 1 145 ? 5.693  -12.155 25.485  1.00 39.04  ? 390 GLU A N   1 
ATOM   743  C CA  . GLU A 1 145 ? 6.678  -11.699 24.518  1.00 39.00  ? 390 GLU A CA  1 
ATOM   744  C C   . GLU A 1 145 ? 8.027  -12.357 24.757  1.00 39.15  ? 390 GLU A C   1 
ATOM   745  O O   . GLU A 1 145 ? 8.447  -12.550 25.902  1.00 39.21  ? 390 GLU A O   1 
ATOM   746  C CB  . GLU A 1 145 ? 6.835  -10.173 24.585  1.00 37.04  ? 390 GLU A CB  1 
ATOM   747  C CG  . GLU A 1 145 ? 5.548  -9.432  24.297  1.00 40.21  ? 390 GLU A CG  1 
ATOM   748  C CD  . GLU A 1 145 ? 5.693  -7.918  24.408  1.00 45.19  ? 390 GLU A CD  1 
ATOM   749  O OE1 . GLU A 1 145 ? 6.757  -7.431  24.859  1.00 40.29  ? 390 GLU A OE1 1 
ATOM   750  O OE2 . GLU A 1 145 ? 4.733  -7.219  24.044  1.00 45.25  ? 390 GLU A OE2 1 
ATOM   751  N N   . LEU A 1 146 ? 8.698  -12.695 23.664  1.00 34.59  ? 391 LEU A N   1 
ATOM   752  C CA  . LEU A 1 146 ? 10.107 -13.061 23.698  1.00 34.23  ? 391 LEU A CA  1 
ATOM   753  C C   . LEU A 1 146 ? 10.931 -11.792 23.530  1.00 35.90  ? 391 LEU A C   1 
ATOM   754  O O   . LEU A 1 146 ? 10.708 -11.026 22.583  1.00 35.59  ? 391 LEU A O   1 
ATOM   755  C CB  . LEU A 1 146 ? 10.438 -14.057 22.582  1.00 34.13  ? 391 LEU A CB  1 
ATOM   756  C CG  . LEU A 1 146 ? 11.923 -14.421 22.409  1.00 35.95  ? 391 LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 146 ? 12.417 -15.213 23.606  1.00 35.57  ? 391 LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 146 ? 12.148 -15.211 21.119  1.00 36.29  ? 391 LEU A CD2 1 
ATOM   759  N N   . TRP A 1 147 ? 11.847 -11.552 24.470  1.00 33.09  ? 392 TRP A N   1 
ATOM   760  C CA  . TRP A 1 147 ? 12.765 -10.421 24.417  1.00 32.17  ? 392 TRP A CA  1 
ATOM   761  C C   . TRP A 1 147 ? 14.186 -10.934 24.238  1.00 36.74  ? 392 TRP A C   1 
ATOM   762  O O   . TRP A 1 147 ? 14.637 -11.805 24.994  1.00 37.01  ? 392 TRP A O   1 
ATOM   763  C CB  . TRP A 1 147 ? 12.706 -9.562  25.690  1.00 31.54  ? 392 TRP A CB  1 
ATOM   764  C CG  . TRP A 1 147 ? 11.443 -8.818  25.907  1.00 33.36  ? 392 TRP A CG  1 
ATOM   765  C CD1 . TRP A 1 147 ? 10.255 -9.002  25.256  1.00 34.18  ? 392 TRP A CD1 1 
ATOM   766  C CD2 . TRP A 1 147 ? 11.228 -7.756  26.845  1.00 36.56  ? 392 TRP A CD2 1 
ATOM   767  N NE1 . TRP A 1 147 ? 9.316  -8.119  25.734  1.00 35.00  ? 392 TRP A NE1 1 
ATOM   768  C CE2 . TRP A 1 147 ? 9.888  -7.348  26.713  1.00 35.77  ? 392 TRP A CE2 1 
ATOM   769  C CE3 . TRP A 1 147 ? 12.038 -7.120  27.792  1.00 39.23  ? 392 TRP A CE3 1 
ATOM   770  C CZ2 . TRP A 1 147 ? 9.337  -6.324  27.489  1.00 37.62  ? 392 TRP A CZ2 1 
ATOM   771  C CZ3 . TRP A 1 147 ? 11.485 -6.104  28.565  1.00 36.35  ? 392 TRP A CZ3 1 
ATOM   772  C CH2 . TRP A 1 147 ? 10.156 -5.716  28.402  1.00 36.41  ? 392 TRP A CH2 1 
ATOM   773  N N   . VAL A 1 148 ? 14.897 -10.380 23.262  1.00 29.39  ? 393 VAL A N   1 
ATOM   774  C CA  . VAL A 1 148 ? 16.298 -10.709 23.040  1.00 30.07  ? 393 VAL A CA  1 
ATOM   775  C C   . VAL A 1 148 ? 17.107 -9.431  23.259  1.00 31.48  ? 393 VAL A C   1 
ATOM   776  O O   . VAL A 1 148 ? 16.898 -8.432  22.563  1.00 32.49  ? 393 VAL A O   1 
ATOM   777  C CB  . VAL A 1 148 ? 16.539 -11.283 21.638  1.00 32.60  ? 393 VAL A CB  1 
ATOM   778  C CG1 . VAL A 1 148 ? 18.044 -11.484 21.394  1.00 31.91  ? 393 VAL A CG1 1 
ATOM   779  C CG2 . VAL A 1 148 ? 15.788 -12.624 21.471  1.00 33.08  ? 393 VAL A CG2 1 
ATOM   780  N N   . VAL A 1 149 ? 18.009 -9.466  24.229  1.00 30.66  ? 394 VAL A N   1 
ATOM   781  C CA  . VAL A 1 149 ? 18.916 -8.358  24.505  1.00 33.80  ? 394 VAL A CA  1 
ATOM   782  C C   . VAL A 1 149 ? 20.167 -8.596  23.673  1.00 29.66  ? 394 VAL A C   1 
ATOM   783  O O   . VAL A 1 149 ? 20.805 -9.653  23.776  1.00 30.42  ? 394 VAL A O   1 
ATOM   784  C CB  . VAL A 1 149 ? 19.248 -8.270  26.001  1.00 34.73  ? 394 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 149 ? 20.167 -7.070  26.295  1.00 32.33  ? 394 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 149 ? 17.958 -8.200  26.814  1.00 32.18  ? 394 VAL A CG2 1 
ATOM   787  N N   . MET A 1 150 ? 20.497 -7.633  22.822  1.00 32.31  ? 395 MET A N   1 
ATOM   788  C CA  . MET A 1 150 ? 21.548 -7.826  21.844  1.00 34.46  ? 395 MET A CA  1 
ATOM   789  C C   . MET A 1 150 ? 22.344 -6.543  21.686  1.00 35.97  ? 395 MET A C   1 
ATOM   790  O O   . MET A 1 150 ? 21.986 -5.478  22.209  1.00 34.74  ? 395 MET A O   1 
ATOM   791  C CB  . MET A 1 150 ? 20.968 -8.268  20.494  1.00 38.04  ? 395 MET A CB  1 
ATOM   792  C CG  . MET A 1 150 ? 20.032 -7.249  19.876  1.00 38.68  ? 395 MET A CG  1 
ATOM   793  S SD  . MET A 1 150 ? 19.031 -7.921  18.513  1.00 42.79  ? 395 MET A SD  1 
ATOM   794  C CE  . MET A 1 150 ? 20.135 -7.805  17.139  1.00 47.60  ? 395 MET A CE  1 
ATOM   795  N N   . GLU A 1 151 ? 23.435 -6.680  20.941  1.00 39.31  ? 396 GLU A N   1 
ATOM   796  C CA  . GLU A 1 151 ? 24.272 -5.558  20.560  1.00 41.53  ? 396 GLU A CA  1 
ATOM   797  C C   . GLU A 1 151 ? 23.440 -4.465  19.905  1.00 41.89  ? 396 GLU A C   1 
ATOM   798  O O   . GLU A 1 151 ? 22.600 -4.738  19.046  1.00 41.22  ? 396 GLU A O   1 
ATOM   799  C CB  . GLU A 1 151 ? 25.346 -6.055  19.587  1.00 42.12  ? 396 GLU A CB  1 
ATOM   800  C CG  . GLU A 1 151 ? 26.448 -5.072  19.291  1.00 46.66  ? 396 GLU A CG  1 
ATOM   801  C CD  . GLU A 1 151 ? 27.391 -5.578  18.207  1.00 46.14  ? 396 GLU A CD  1 
ATOM   802  O OE1 . GLU A 1 151 ? 27.218 -6.734  17.742  1.00 42.31  ? 396 GLU A OE1 1 
ATOM   803  O OE2 . GLU A 1 151 ? 28.298 -4.815  17.816  1.00 51.25  ? 396 GLU A OE2 1 
ATOM   804  N N   . PHE A 1 152 ? 23.690 -3.218  20.297  1.00 40.70  ? 397 PHE A N   1 
ATOM   805  C CA  . PHE A 1 152 ? 23.051 -2.070  19.664  1.00 40.57  ? 397 PHE A CA  1 
ATOM   806  C C   . PHE A 1 152 ? 23.932 -1.564  18.523  1.00 41.39  ? 397 PHE A C   1 
ATOM   807  O O   . PHE A 1 152 ? 25.085 -1.182  18.743  1.00 44.12  ? 397 PHE A O   1 
ATOM   808  C CB  . PHE A 1 152 ? 22.797 -0.964  20.690  1.00 42.34  ? 397 PHE A CB  1 
ATOM   809  C CG  . PHE A 1 152 ? 22.250 0.301   20.098  1.00 47.91  ? 397 PHE A CG  1 
ATOM   810  C CD1 . PHE A 1 152 ? 21.236 0.265   19.154  1.00 47.36  ? 397 PHE A CD1 1 
ATOM   811  C CD2 . PHE A 1 152 ? 22.736 1.535   20.509  1.00 52.04  ? 397 PHE A CD2 1 
ATOM   812  C CE1 . PHE A 1 152 ? 20.728 1.437   18.621  1.00 50.21  ? 397 PHE A CE1 1 
ATOM   813  C CE2 . PHE A 1 152 ? 22.232 2.701   19.983  1.00 52.66  ? 397 PHE A CE2 1 
ATOM   814  C CZ  . PHE A 1 152 ? 21.231 2.651   19.032  1.00 49.77  ? 397 PHE A CZ  1 
ATOM   815  N N   . LEU A 1 153 ? 23.392 -1.579  17.309  1.00 40.09  ? 398 LEU A N   1 
ATOM   816  C CA  . LEU A 1 153 ? 24.107 -1.127  16.114  1.00 39.13  ? 398 LEU A CA  1 
ATOM   817  C C   . LEU A 1 153 ? 23.674 0.316   15.867  1.00 41.52  ? 398 LEU A C   1 
ATOM   818  O O   . LEU A 1 153 ? 22.696 0.585   15.162  1.00 41.18  ? 398 LEU A O   1 
ATOM   819  C CB  . LEU A 1 153 ? 23.804 -2.037  14.929  1.00 39.64  ? 398 LEU A CB  1 
ATOM   820  C CG  . LEU A 1 153 ? 24.644 -3.321  14.806  1.00 41.61  ? 398 LEU A CG  1 
ATOM   821  C CD1 . LEU A 1 153 ? 26.035 -3.000  14.288  1.00 41.78  ? 398 LEU A CD1 1 
ATOM   822  C CD2 . LEU A 1 153 ? 24.750 -4.048  16.123  1.00 37.58  ? 398 LEU A CD2 1 
ATOM   823  N N   . GLU A 1 154 ? 24.412 1.250   16.472  1.00 41.99  ? 399 GLU A N   1 
ATOM   824  C CA  . GLU A 1 154 ? 23.944 2.629   16.591  1.00 43.00  ? 399 GLU A CA  1 
ATOM   825  C C   . GLU A 1 154 ? 23.908 3.365   15.258  1.00 43.28  ? 399 GLU A C   1 
ATOM   826  O O   . GLU A 1 154 ? 23.260 4.417   15.167  1.00 44.80  ? 399 GLU A O   1 
ATOM   827  C CB  . GLU A 1 154 ? 24.815 3.396   17.593  1.00 45.17  ? 399 GLU A CB  1 
ATOM   828  C CG  . GLU A 1 154 ? 26.293 3.478   17.232  1.00 48.06  ? 399 GLU A CG  1 
ATOM   829  C CD  . GLU A 1 154 ? 27.075 2.240   17.631  1.00 50.56  ? 399 GLU A CD  1 
ATOM   830  O OE1 . GLU A 1 154 ? 26.554 1.437   18.432  1.00 50.09  ? 399 GLU A OE1 1 
ATOM   831  O OE2 . GLU A 1 154 ? 28.211 2.075   17.136  1.00 50.36  ? 399 GLU A OE2 1 
ATOM   832  N N   . GLY A 1 155 ? 24.585 2.845   14.229  1.00 40.70  ? 400 GLY A N   1 
ATOM   833  C CA  . GLY A 1 155 ? 24.562 3.409   12.895  1.00 41.49  ? 400 GLY A CA  1 
ATOM   834  C C   . GLY A 1 155 ? 23.298 3.148   12.106  1.00 42.46  ? 400 GLY A C   1 
ATOM   835  O O   . GLY A 1 155 ? 23.149 3.664   10.994  1.00 43.04  ? 400 GLY A O   1 
ATOM   836  N N   . GLY A 1 156 ? 22.379 2.362   12.650  1.00 40.87  ? 401 GLY A N   1 
ATOM   837  C CA  . GLY A 1 156 ? 21.124 2.100   11.985  1.00 42.10  ? 401 GLY A CA  1 
ATOM   838  C C   . GLY A 1 156 ? 21.278 1.077   10.878  1.00 40.75  ? 401 GLY A C   1 
ATOM   839  O O   . GLY A 1 156 ? 22.274 0.359   10.777  1.00 38.97  ? 401 GLY A O   1 
ATOM   840  N N   . ALA A 1 157 ? 20.264 1.024   10.024  1.00 38.93  ? 402 ALA A N   1 
ATOM   841  C CA  . ALA A 1 157 ? 20.230 0.014   8.980   1.00 37.27  ? 402 ALA A CA  1 
ATOM   842  C C   . ALA A 1 157 ? 20.683 0.594   7.647   1.00 35.97  ? 402 ALA A C   1 
ATOM   843  O O   . ALA A 1 157 ? 20.599 1.803   7.395   1.00 36.06  ? 402 ALA A O   1 
ATOM   844  C CB  . ALA A 1 157 ? 18.833 -0.593  8.841   1.00 37.02  ? 402 ALA A CB  1 
ATOM   845  N N   . LEU A 1 158 ? 21.151 -0.304  6.782   1.00 34.32  ? 403 LEU A N   1 
ATOM   846  C CA  . LEU A 1 158 ? 21.588 0.099   5.450   1.00 34.08  ? 403 LEU A CA  1 
ATOM   847  C C   . LEU A 1 158 ? 20.436 0.676   4.638   1.00 35.31  ? 403 LEU A C   1 
ATOM   848  O O   . LEU A 1 158 ? 20.660 1.507   3.751   1.00 35.22  ? 403 LEU A O   1 
ATOM   849  C CB  . LEU A 1 158 ? 22.220 -1.094  4.736   1.00 31.00  ? 403 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 158 ? 22.788 -0.921  3.319   1.00 34.74  ? 403 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 158 ? 23.972 0.052   3.294   1.00 35.72  ? 403 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 158 ? 23.191 -2.268  2.744   1.00 36.98  ? 403 LEU A CD2 1 
ATOM   853  N N   . THR A 1 159 ? 19.196 0.269   4.938   1.00 34.32  ? 404 THR A N   1 
ATOM   854  C CA  . THR A 1 159 ? 18.050 0.804   4.204   1.00 34.37  ? 404 THR A CA  1 
ATOM   855  C C   . THR A 1 159 ? 18.019 2.327   4.242   1.00 40.63  ? 404 THR A C   1 
ATOM   856  O O   . THR A 1 159 ? 17.722 2.977   3.230   1.00 37.51  ? 404 THR A O   1 
ATOM   857  C CB  . THR A 1 159 ? 16.746 0.246   4.772   1.00 35.12  ? 404 THR A CB  1 
ATOM   858  O OG1 . THR A 1 159 ? 16.813 -1.177  4.754   1.00 36.26  ? 404 THR A OG1 1 
ATOM   859  C CG2 . THR A 1 159 ? 15.582 0.683   3.928   1.00 34.02  ? 404 THR A CG2 1 
ATOM   860  N N   . ASP A 1 160 ? 18.333 2.919   5.396   1.00 35.37  ? 405 ASP A N   1 
ATOM   861  C CA  . ASP A 1 160 ? 18.260 4.373   5.492   1.00 37.13  ? 405 ASP A CA  1 
ATOM   862  C C   . ASP A 1 160 ? 19.291 5.034   4.586   1.00 41.87  ? 405 ASP A C   1 
ATOM   863  O O   . ASP A 1 160 ? 19.077 6.155   4.113   1.00 44.23  ? 405 ASP A O   1 
ATOM   864  C CB  . ASP A 1 160 ? 18.452 4.827   6.939   1.00 40.67  ? 405 ASP A CB  1 
ATOM   865  C CG  . ASP A 1 160 ? 18.321 6.339   7.099   1.00 48.32  ? 405 ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 160 ? 17.190 6.855   6.995   1.00 48.71  ? 405 ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 160 ? 19.352 7.011   7.316   1.00 48.31  ? 405 ASP A OD2 1 
ATOM   868  N N   . ILE A 1 161 ? 20.400 4.352   4.316   1.00 39.57  ? 406 ILE A N   1 
ATOM   869  C CA  . ILE A 1 161 ? 21.425 4.911   3.441   1.00 38.72  ? 406 ILE A CA  1 
ATOM   870  C C   . ILE A 1 161 ? 21.009 4.807   1.980   1.00 41.71  ? 406 ILE A C   1 
ATOM   871  O O   . ILE A 1 161 ? 21.082 5.784   1.222   1.00 41.51  ? 406 ILE A O   1 
ATOM   872  C CB  . ILE A 1 161 ? 22.761 4.197   3.686   1.00 36.68  ? 406 ILE A CB  1 
ATOM   873  C CG1 . ILE A 1 161 ? 23.315 4.611   5.047   1.00 35.26  ? 406 ILE A CG1 1 
ATOM   874  C CG2 . ILE A 1 161 ? 23.729 4.472   2.525   1.00 36.71  ? 406 ILE A CG2 1 
ATOM   875  C CD1 . ILE A 1 161 ? 24.409 3.690   5.546   1.00 38.64  ? 406 ILE A CD1 1 
ATOM   876  N N   . VAL A 1 162 ? 20.577 3.612   1.574   1.00 35.76  ? 407 VAL A N   1 
ATOM   877  C CA  A VAL A 1 162 ? 20.231 3.332   0.184   0.17 37.49  ? 407 VAL A CA  1 
ATOM   878  C CA  B VAL A 1 162 ? 20.279 3.392   0.164   0.83 37.69  ? 407 VAL A CA  1 
ATOM   879  C C   . VAL A 1 162 ? 19.061 4.190   -0.270  1.00 40.36  ? 407 VAL A C   1 
ATOM   880  O O   . VAL A 1 162 ? 18.952 4.557   -1.448  1.00 40.68  ? 407 VAL A O   1 
ATOM   881  C CB  A VAL A 1 162 ? 19.930 1.825   0.046   0.17 36.37  ? 407 VAL A CB  1 
ATOM   882  C CB  B VAL A 1 162 ? 20.097 1.892   -0.145  0.83 35.76  ? 407 VAL A CB  1 
ATOM   883  C CG1 A VAL A 1 162 ? 18.875 1.557   -1.009  0.17 35.42  ? 407 VAL A CG1 1 
ATOM   884  C CG1 B VAL A 1 162 ? 21.282 1.096   0.381   0.83 36.77  ? 407 VAL A CG1 1 
ATOM   885  C CG2 A VAL A 1 162 ? 21.207 1.054   -0.243  0.17 36.01  ? 407 VAL A CG2 1 
ATOM   886  C CG2 B VAL A 1 162 ? 18.779 1.367   0.421   0.83 35.56  ? 407 VAL A CG2 1 
ATOM   887  N N   . THR A 1 163 ? 18.148 4.501   0.643   1.00 39.70  ? 408 THR A N   1 
ATOM   888  C CA  . THR A 1 163 ? 16.990 5.274   0.232   1.00 39.18  ? 408 THR A CA  1 
ATOM   889  C C   . THR A 1 163 ? 17.250 6.777   0.249   1.00 41.92  ? 408 THR A C   1 
ATOM   890  O O   . THR A 1 163 ? 16.415 7.538   -0.246  1.00 45.08  ? 408 THR A O   1 
ATOM   891  C CB  . THR A 1 163 ? 15.771 4.939   1.110   1.00 41.41  ? 408 THR A CB  1 
ATOM   892  O OG1 . THR A 1 163 ? 16.069 5.212   2.483   1.00 44.88  ? 408 THR A OG1 1 
ATOM   893  C CG2 . THR A 1 163 ? 15.372 3.473   0.961   1.00 37.63  ? 408 THR A CG2 1 
ATOM   894  N N   . HIS A 1 164 ? 18.390 7.231   0.779   1.00 38.48  ? 409 HIS A N   1 
ATOM   895  C CA  . HIS A 1 164 ? 18.634 8.662   0.899   1.00 42.84  ? 409 HIS A CA  1 
ATOM   896  C C   . HIS A 1 164 ? 19.923 9.176   0.273   1.00 45.76  ? 409 HIS A C   1 
ATOM   897  O O   . HIS A 1 164 ? 20.062 10.395  0.144   1.00 43.31  ? 409 HIS A O   1 
ATOM   898  C CB  . HIS A 1 164 ? 18.624 9.088   2.373   1.00 39.70  ? 409 HIS A CB  1 
ATOM   899  C CG  . HIS A 1 164 ? 17.272 9.033   2.998   1.00 42.68  ? 409 HIS A CG  1 
ATOM   900  N ND1 . HIS A 1 164 ? 16.873 7.997   3.815   1.00 46.49  ? 409 HIS A ND1 1 
ATOM   901  C CD2 . HIS A 1 164 ? 16.216 9.876   2.913   1.00 44.58  ? 409 HIS A CD2 1 
ATOM   902  C CE1 . HIS A 1 164 ? 15.630 8.206   4.210   1.00 45.91  ? 409 HIS A CE1 1 
ATOM   903  N NE2 . HIS A 1 164 ? 15.209 9.339   3.678   1.00 47.46  ? 409 HIS A NE2 1 
ATOM   904  N N   . THR A 1 165 ? 20.872 8.320   -0.101  1.00 43.97  ? 410 THR A N   1 
ATOM   905  C CA  A THR A 1 165 ? 22.129 8.793   -0.664  0.36 45.20  ? 410 THR A CA  1 
ATOM   906  C CA  B THR A 1 165 ? 22.106 8.814   -0.692  0.64 45.51  ? 410 THR A CA  1 
ATOM   907  C C   . THR A 1 165 ? 22.626 7.794   -1.696  1.00 43.75  ? 410 THR A C   1 
ATOM   908  O O   . THR A 1 165 ? 22.062 6.711   -1.868  1.00 45.68  ? 410 THR A O   1 
ATOM   909  C CB  A THR A 1 165 ? 23.191 9.012   0.422   0.36 45.65  ? 410 THR A CB  1 
ATOM   910  C CB  B THR A 1 165 ? 23.155 9.134   0.386   0.64 46.26  ? 410 THR A CB  1 
ATOM   911  O OG1 A THR A 1 165 ? 22.992 8.073   1.485   0.36 42.76  ? 410 THR A OG1 1 
ATOM   912  O OG1 B THR A 1 165 ? 24.172 9.976   -0.169  0.64 47.35  ? 410 THR A OG1 1 
ATOM   913  C CG2 A THR A 1 165 ? 23.110 10.425  0.966   0.36 46.31  ? 410 THR A CG2 1 
ATOM   914  C CG2 B THR A 1 165 ? 23.791 7.860   0.927   0.64 43.34  ? 410 THR A CG2 1 
ATOM   915  N N   . ARG A 1 166 ? 23.706 8.163   -2.375  1.00 42.46  ? 411 ARG A N   1 
ATOM   916  C CA  . ARG A 1 166 ? 24.327 7.291   -3.362  1.00 45.13  ? 411 ARG A CA  1 
ATOM   917  C C   . ARG A 1 166 ? 25.621 6.728   -2.797  1.00 45.21  ? 411 ARG A C   1 
ATOM   918  O O   . ARG A 1 166 ? 26.476 7.480   -2.319  1.00 47.89  ? 411 ARG A O   1 
ATOM   919  C CB  . ARG A 1 166 ? 24.615 8.042   -4.667  1.00 49.97  ? 411 ARG A CB  1 
ATOM   920  C CG  . ARG A 1 166 ? 23.394 8.313   -5.535  1.00 56.33  ? 411 ARG A CG  1 
ATOM   921  C CD  . ARG A 1 166 ? 23.816 8.816   -6.920  1.00 62.20  ? 411 ARG A CD  1 
ATOM   922  N NE  . ARG A 1 166 ? 22.682 9.350   -7.667  1.00 63.13  ? 411 ARG A NE  1 
ATOM   923  C CZ  . ARG A 1 166 ? 22.310 10.626  -7.638  1.00 66.51  ? 411 ARG A CZ  1 
ATOM   924  N NH1 . ARG A 1 166 ? 22.992 11.503  -6.908  1.00 62.73  ? 411 ARG A NH1 1 
ATOM   925  N NH2 . ARG A 1 166 ? 21.259 11.028  -8.343  1.00 69.64  ? 411 ARG A NH2 1 
ATOM   926  N N   . MET A 1 167 ? 25.768 5.415   -2.864  1.00 40.47  ? 412 MET A N   1 
ATOM   927  C CA  . MET A 1 167 ? 27.013 4.775   -2.477  1.00 38.26  ? 412 MET A CA  1 
ATOM   928  C C   . MET A 1 167 ? 27.951 4.693   -3.675  1.00 39.47  ? 412 MET A C   1 
ATOM   929  O O   . MET A 1 167 ? 27.513 4.496   -4.811  1.00 43.12  ? 412 MET A O   1 
ATOM   930  C CB  . MET A 1 167 ? 26.729 3.379   -1.924  1.00 37.93  ? 412 MET A CB  1 
ATOM   931  C CG  . MET A 1 167 ? 25.779 3.399   -0.739  1.00 43.31  ? 412 MET A CG  1 
ATOM   932  S SD  . MET A 1 167 ? 25.330 1.759   -0.141  1.00 38.00  ? 412 MET A SD  1 
ATOM   933  C CE  . MET A 1 167 ? 26.958 1.132   0.279   1.00 35.65  ? 412 MET A CE  1 
ATOM   934  N N   . ASN A 1 168 ? 29.244 4.869   -3.422  1.00 41.47  ? 413 ASN A N   1 
ATOM   935  C CA  . ASN A 1 168 ? 30.235 4.589   -4.449  1.00 36.45  ? 413 ASN A CA  1 
ATOM   936  C C   . ASN A 1 168 ? 30.678 3.134   -4.334  1.00 38.12  ? 413 ASN A C   1 
ATOM   937  O O   . ASN A 1 168 ? 30.295 2.414   -3.411  1.00 36.58  ? 413 ASN A O   1 
ATOM   938  C CB  . ASN A 1 168 ? 31.421 5.563   -4.359  1.00 40.04  ? 413 ASN A CB  1 
ATOM   939  C CG  . ASN A 1 168 ? 32.165 5.489   -3.033  1.00 39.64  ? 413 ASN A CG  1 
ATOM   940  O OD1 . ASN A 1 168 ? 32.254 4.442   -2.406  1.00 39.36  ? 413 ASN A OD1 1 
ATOM   941  N ND2 . ASN A 1 168 ? 32.735 6.626   -2.617  1.00 41.81  ? 413 ASN A ND2 1 
ATOM   942  N N   . GLU A 1 169 ? 31.488 2.686   -5.294  1.00 38.79  ? 414 GLU A N   1 
ATOM   943  C CA  . GLU A 1 169 ? 31.732 1.251   -5.372  1.00 39.11  ? 414 GLU A CA  1 
ATOM   944  C C   . GLU A 1 169 ? 32.668 0.774   -4.270  1.00 36.02  ? 414 GLU A C   1 
ATOM   945  O O   . GLU A 1 169 ? 32.574 -0.380  -3.837  1.00 41.68  ? 414 GLU A O   1 
ATOM   946  C CB  . GLU A 1 169 ? 32.249 0.893   -6.761  1.00 42.65  ? 414 GLU A CB  1 
ATOM   947  C CG  . GLU A 1 169 ? 31.171 1.098   -7.821  1.00 42.38  ? 414 GLU A CG  1 
ATOM   948  C CD  . GLU A 1 169 ? 31.481 0.374   -9.107  1.00 45.91  ? 414 GLU A CD  1 
ATOM   949  O OE1 . GLU A 1 169 ? 32.548 -0.276  -9.175  1.00 43.52  ? 414 GLU A OE1 1 
ATOM   950  O OE2 . GLU A 1 169 ? 30.658 0.448   -10.043 1.00 44.18  ? 414 GLU A OE2 1 
ATOM   951  N N   . GLU A 1 170 ? 33.553 1.649   -3.787  1.00 38.17  ? 415 GLU A N   1 
ATOM   952  C CA  . GLU A 1 170 ? 34.349 1.335   -2.604  1.00 39.96  ? 415 GLU A CA  1 
ATOM   953  C C   . GLU A 1 170 ? 33.461 1.035   -1.400  1.00 38.74  ? 415 GLU A C   1 
ATOM   954  O O   . GLU A 1 170 ? 33.754 0.131   -0.609  1.00 38.87  ? 415 GLU A O   1 
ATOM   955  C CB  . GLU A 1 170 ? 35.293 2.505   -2.301  1.00 44.11  ? 415 GLU A CB  1 
ATOM   956  C CG  . GLU A 1 170 ? 35.939 2.434   -0.940  1.00 46.73  ? 415 GLU A CG  1 
ATOM   957  C CD  . GLU A 1 170 ? 36.881 3.588   -0.661  1.00 56.01  ? 415 GLU A CD  1 
ATOM   958  O OE1 . GLU A 1 170 ? 36.540 4.741   -1.003  1.00 57.13  ? 415 GLU A OE1 1 
ATOM   959  O OE2 . GLU A 1 170 ? 37.966 3.339   -0.095  1.00 56.70  ? 415 GLU A OE2 1 
ATOM   960  N N   . GLN A 1 171 ? 32.370 1.785   -1.243  1.00 36.45  ? 416 GLN A N   1 
ATOM   961  C CA  . GLN A 1 171 ? 31.449 1.529   -0.137  1.00 36.92  ? 416 GLN A CA  1 
ATOM   962  C C   . GLN A 1 171 ? 30.599 0.287   -0.399  1.00 38.07  ? 416 GLN A C   1 
ATOM   963  O O   . GLN A 1 171 ? 30.343 -0.503  0.518   1.00 36.44  ? 416 GLN A O   1 
ATOM   964  C CB  . GLN A 1 171 ? 30.561 2.753   0.103   1.00 35.08  ? 416 GLN A CB  1 
ATOM   965  C CG  . GLN A 1 171 ? 31.354 3.986   0.548   1.00 38.09  ? 416 GLN A CG  1 
ATOM   966  C CD  . GLN A 1 171 ? 30.613 5.290   0.300   1.00 42.71  ? 416 GLN A CD  1 
ATOM   967  O OE1 . GLN A 1 171 ? 29.827 5.400   -0.643  1.00 41.13  ? 416 GLN A OE1 1 
ATOM   968  N NE2 . GLN A 1 171 ? 30.867 6.289   1.145   1.00 40.01  ? 416 GLN A NE2 1 
ATOM   969  N N   . ILE A 1 172 ? 30.150 0.099   -1.640  1.00 37.92  ? 417 ILE A N   1 
ATOM   970  C CA  . ILE A 1 172 ? 29.383 -1.094  -1.980  1.00 36.71  ? 417 ILE A CA  1 
ATOM   971  C C   . ILE A 1 172 ? 30.234 -2.341  -1.782  1.00 36.54  ? 417 ILE A C   1 
ATOM   972  O O   . ILE A 1 172 ? 29.795 -3.324  -1.172  1.00 35.90  ? 417 ILE A O   1 
ATOM   973  C CB  . ILE A 1 172 ? 28.848 -0.997  -3.418  1.00 36.03  ? 417 ILE A CB  1 
ATOM   974  C CG1 . ILE A 1 172 ? 27.866 0.168   -3.521  1.00 34.95  ? 417 ILE A CG1 1 
ATOM   975  C CG2 . ILE A 1 172 ? 28.193 -2.328  -3.834  1.00 33.25  ? 417 ILE A CG2 1 
ATOM   976  C CD1 . ILE A 1 172 ? 27.438 0.517   -4.938  1.00 37.15  ? 417 ILE A CD1 1 
ATOM   977  N N   . ALA A 1 173 ? 31.472 -2.314  -2.280  1.00 35.13  ? 418 ALA A N   1 
ATOM   978  C CA  . ALA A 1 173 ? 32.356 -3.459  -2.095  1.00 35.40  ? 418 ALA A CA  1 
ATOM   979  C C   . ALA A 1 173 ? 32.583 -3.742  -0.611  1.00 38.35  ? 418 ALA A C   1 
ATOM   980  O O   . ALA A 1 173 ? 32.633 -4.906  -0.197  1.00 39.42  ? 418 ALA A O   1 
ATOM   981  C CB  . ALA A 1 173 ? 33.683 -3.230  -2.821  1.00 34.18  ? 418 ALA A CB  1 
ATOM   982  N N   . ALA A 1 174 ? 32.689 -2.690  0.212   1.00 35.83  ? 419 ALA A N   1 
ATOM   983  C CA  . ALA A 1 174 ? 32.900 -2.905  1.641   1.00 35.74  ? 419 ALA A CA  1 
ATOM   984  C C   . ALA A 1 174 ? 31.698 -3.589  2.286   1.00 36.95  ? 419 ALA A C   1 
ATOM   985  O O   . ALA A 1 174 ? 31.869 -4.482  3.122   1.00 37.11  ? 419 ALA A O   1 
ATOM   986  C CB  . ALA A 1 174 ? 33.205 -1.583  2.347   1.00 36.10  ? 419 ALA A CB  1 
ATOM   987  N N   . VAL A 1 175 ? 30.475 -3.184  1.922   1.00 35.70  ? 420 VAL A N   1 
ATOM   988  C CA  . VAL A 1 175 ? 29.288 -3.861  2.452   1.00 33.15  ? 420 VAL A CA  1 
ATOM   989  C C   . VAL A 1 175 ? 29.259 -5.317  1.987   1.00 37.25  ? 420 VAL A C   1 
ATOM   990  O O   . VAL A 1 175 ? 29.056 -6.240  2.788   1.00 35.26  ? 420 VAL A O   1 
ATOM   991  C CB  . VAL A 1 175 ? 28.003 -3.109  2.056   1.00 32.29  ? 420 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 175 ? 26.769 -3.935  2.414   1.00 35.90  ? 420 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 175 ? 27.942 -1.760  2.759   1.00 34.80  ? 420 VAL A CG2 1 
ATOM   994  N N   . CYS A 1 176 ? 29.497 -5.545  0.692   1.00 36.16  ? 421 CYS A N   1 
ATOM   995  C CA  . CYS A 1 176 ? 29.404 -6.900  0.149   1.00 36.14  ? 421 CYS A CA  1 
ATOM   996  C C   . CYS A 1 176 ? 30.450 -7.822  0.759   1.00 38.14  ? 421 CYS A C   1 
ATOM   997  O O   . CYS A 1 176 ? 30.165 -8.993  1.047   1.00 38.23  ? 421 CYS A O   1 
ATOM   998  C CB  . CYS A 1 176 ? 29.549 -6.870  -1.370  1.00 37.14  ? 421 CYS A CB  1 
ATOM   999  S SG  . CYS A 1 176 ? 28.127 -6.152  -2.227  1.00 38.10  ? 421 CYS A SG  1 
ATOM   1000 N N   . LEU A 1 177 ? 31.673 -7.321  0.955   1.00 35.21  ? 422 LEU A N   1 
ATOM   1001 C CA  . LEU A 1 177 ? 32.709 -8.147  1.568   1.00 36.15  ? 422 LEU A CA  1 
ATOM   1002 C C   . LEU A 1 177 ? 32.307 -8.566  2.978   1.00 34.71  ? 422 LEU A C   1 
ATOM   1003 O O   . LEU A 1 177 ? 32.454 -9.736  3.362   1.00 36.59  ? 422 LEU A O   1 
ATOM   1004 C CB  . LEU A 1 177 ? 34.037 -7.377  1.581   1.00 37.06  ? 422 LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 177 ? 35.202 -8.029  2.315   1.00 36.25  ? 422 LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 177 ? 35.596 -9.355  1.652   1.00 38.50  ? 422 LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 177 ? 36.394 -7.057  2.380   1.00 40.88  ? 422 LEU A CD2 1 
ATOM   1008 N N   . ALA A 1 178 ? 31.792 -7.619  3.766   1.00 36.90  ? 423 ALA A N   1 
ATOM   1009 C CA  . ALA A 1 178 ? 31.386 -7.924  5.132   1.00 37.85  ? 423 ALA A CA  1 
ATOM   1010 C C   . ALA A 1 178 ? 30.225 -8.915  5.154   1.00 35.32  ? 423 ALA A C   1 
ATOM   1011 O O   . ALA A 1 178 ? 30.228 -9.866  5.944   1.00 35.49  ? 423 ALA A O   1 
ATOM   1012 C CB  . ALA A 1 178 ? 31.008 -6.634  5.869   1.00 37.96  ? 423 ALA A CB  1 
ATOM   1013 N N   . VAL A 1 179 ? 29.221 -8.712  4.297   1.00 33.28  ? 424 VAL A N   1 
ATOM   1014 C CA  . VAL A 1 179 ? 28.099 -9.652  4.266   1.00 33.46  ? 424 VAL A CA  1 
ATOM   1015 C C   . VAL A 1 179 ? 28.577 -11.031 3.821   1.00 35.68  ? 424 VAL A C   1 
ATOM   1016 O O   . VAL A 1 179 ? 28.224 -12.054 4.423   1.00 34.87  ? 424 VAL A O   1 
ATOM   1017 C CB  . VAL A 1 179 ? 26.970 -9.124  3.366   1.00 32.00  ? 424 VAL A CB  1 
ATOM   1018 C CG1 . VAL A 1 179 ? 25.952 -10.240 3.099   1.00 29.41  ? 424 VAL A CG1 1 
ATOM   1019 C CG2 . VAL A 1 179 ? 26.291 -7.913  4.018   1.00 31.16  ? 424 VAL A CG2 1 
ATOM   1020 N N   . LEU A 1 180 ? 29.416 -11.076 2.783   1.00 33.92  ? 425 LEU A N   1 
ATOM   1021 C CA  . LEU A 1 180 ? 29.897 -12.355 2.273   1.00 33.30  ? 425 LEU A CA  1 
ATOM   1022 C C   . LEU A 1 180 ? 30.776 -13.088 3.282   1.00 36.77  ? 425 LEU A C   1 
ATOM   1023 O O   . LEU A 1 180 ? 30.781 -14.327 3.305   1.00 34.69  ? 425 LEU A O   1 
ATOM   1024 C CB  . LEU A 1 180 ? 30.639 -12.145 0.946   1.00 33.28  ? 425 LEU A CB  1 
ATOM   1025 C CG  . LEU A 1 180 ? 29.662 -11.939 -0.219  1.00 36.91  ? 425 LEU A CG  1 
ATOM   1026 C CD1 . LEU A 1 180 ? 30.399 -11.432 -1.442  1.00 37.37  ? 425 LEU A CD1 1 
ATOM   1027 C CD2 . LEU A 1 180 ? 28.911 -13.244 -0.545  1.00 34.52  ? 425 LEU A CD2 1 
ATOM   1028 N N   . GLN A 1 181 ? 31.531 -12.367 4.119   1.00 35.07  ? 426 GLN A N   1 
ATOM   1029 C CA  . GLN A 1 181 ? 32.301 -13.068 5.145   1.00 35.31  ? 426 GLN A CA  1 
ATOM   1030 C C   . GLN A 1 181 ? 31.371 -13.756 6.138   1.00 34.62  ? 426 GLN A C   1 
ATOM   1031 O O   . GLN A 1 181 ? 31.604 -14.909 6.518   1.00 36.54  ? 426 GLN A O   1 
ATOM   1032 C CB  . GLN A 1 181 ? 33.255 -12.107 5.865   1.00 38.59  ? 426 GLN A CB  1 
ATOM   1033 C CG  . GLN A 1 181 ? 34.492 -11.734 5.034   1.00 39.60  ? 426 GLN A CG  1 
ATOM   1034 C CD  . GLN A 1 181 ? 35.284 -10.580 5.629   1.00 44.10  ? 426 GLN A CD  1 
ATOM   1035 O OE1 . GLN A 1 181 ? 34.822 -9.897  6.546   1.00 44.84  ? 426 GLN A OE1 1 
ATOM   1036 N NE2 . GLN A 1 181 ? 36.486 -10.360 5.109   1.00 44.73  ? 426 GLN A NE2 1 
ATOM   1037 N N   . ALA A 1 182 ? 30.301 -13.068 6.542   1.00 34.97  ? 427 ALA A N   1 
ATOM   1038 C CA  . ALA A 1 182 ? 29.305 -13.664 7.426   1.00 37.03  ? 427 ALA A CA  1 
ATOM   1039 C C   . ALA A 1 182 ? 28.623 -14.858 6.764   1.00 35.59  ? 427 ALA A C   1 
ATOM   1040 O O   . ALA A 1 182 ? 28.488 -15.926 7.370   1.00 35.42  ? 427 ALA A O   1 
ATOM   1041 C CB  . ALA A 1 182 ? 28.276 -12.605 7.834   1.00 31.81  ? 427 ALA A CB  1 
ATOM   1042 N N   . LEU A 1 183 ? 28.175 -14.692 5.518   1.00 35.58  ? 428 LEU A N   1 
ATOM   1043 C CA  . LEU A 1 183 ? 27.489 -15.785 4.843   1.00 33.68  ? 428 LEU A CA  1 
ATOM   1044 C C   . LEU A 1 183 ? 28.415 -16.968 4.580   1.00 36.23  ? 428 LEU A C   1 
ATOM   1045 O O   . LEU A 1 183 ? 27.964 -18.116 4.618   1.00 37.35  ? 428 LEU A O   1 
ATOM   1046 C CB  . LEU A 1 183 ? 26.854 -15.309 3.531   1.00 32.02  ? 428 LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 183 ? 25.670 -14.340 3.607   1.00 31.80  ? 428 LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 183 ? 25.232 -13.942 2.203   1.00 33.76  ? 428 LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 183 ? 24.507 -14.921 4.397   1.00 32.22  ? 428 LEU A CD2 1 
ATOM   1050 N N   . SER A 1 184 ? 29.704 -16.733 4.319   1.00 39.16  ? 429 SER A N   1 
ATOM   1051 C CA  . SER A 1 184 ? 30.583 -17.874 4.072   1.00 37.24  ? 429 SER A CA  1 
ATOM   1052 C C   . SER A 1 184 ? 30.673 -18.769 5.304   1.00 38.27  ? 429 SER A C   1 
ATOM   1053 O O   . SER A 1 184 ? 30.739 -19.997 5.184   1.00 37.34  ? 429 SER A O   1 
ATOM   1054 C CB  . SER A 1 184 ? 31.976 -17.410 3.637   1.00 40.40  ? 429 SER A CB  1 
ATOM   1055 O OG  . SER A 1 184 ? 32.652 -16.759 4.698   1.00 44.75  ? 429 SER A OG  1 
ATOM   1056 N N   . VAL A 1 185 ? 30.645 -18.173 6.499   1.00 37.23  ? 430 VAL A N   1 
ATOM   1057 C CA  . VAL A 1 185 ? 30.755 -18.956 7.729   1.00 39.27  ? 430 VAL A CA  1 
ATOM   1058 C C   . VAL A 1 185 ? 29.425 -19.629 8.063   1.00 34.61  ? 430 VAL A C   1 
ATOM   1059 O O   . VAL A 1 185 ? 29.391 -20.802 8.456   1.00 35.93  ? 430 VAL A O   1 
ATOM   1060 C CB  . VAL A 1 185 ? 31.254 -18.056 8.879   1.00 39.19  ? 430 VAL A CB  1 
ATOM   1061 C CG1 . VAL A 1 185 ? 31.140 -18.766 10.218  1.00 41.88  ? 430 VAL A CG1 1 
ATOM   1062 C CG2 . VAL A 1 185 ? 32.700 -17.629 8.623   1.00 41.02  ? 430 VAL A CG2 1 
ATOM   1063 N N   . LEU A 1 186 ? 28.317 -18.905 7.901   1.00 34.52  ? 431 LEU A N   1 
ATOM   1064 C CA  . LEU A 1 186 ? 26.998 -19.486 8.139   1.00 35.67  ? 431 LEU A CA  1 
ATOM   1065 C C   . LEU A 1 186 ? 26.717 -20.635 7.173   1.00 36.10  ? 431 LEU A C   1 
ATOM   1066 O O   . LEU A 1 186 ? 26.341 -21.737 7.594   1.00 36.24  ? 431 LEU A O   1 
ATOM   1067 C CB  . LEU A 1 186 ? 25.929 -18.401 8.025   1.00 33.97  ? 431 LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 186 ? 25.941 -17.342 9.131   1.00 35.58  ? 431 LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 186 ? 25.108 -16.128 8.737   1.00 36.07  ? 431 LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 186 ? 25.437 -17.933 10.453  1.00 35.67  ? 431 LEU A CD2 1 
ATOM   1071 N N   . HIS A 1 187 ? 26.925 -20.400 5.871   1.00 33.96  ? 432 HIS A N   1 
ATOM   1072 C CA  . HIS A 1 187 ? 26.651 -21.431 4.869   1.00 38.07  ? 432 HIS A CA  1 
ATOM   1073 C C   . HIS A 1 187 ? 27.511 -22.668 5.081   1.00 39.91  ? 432 HIS A C   1 
ATOM   1074 O O   . HIS A 1 187 ? 27.040 -23.796 4.895   1.00 38.78  ? 432 HIS A O   1 
ATOM   1075 C CB  . HIS A 1 187 ? 26.864 -20.870 3.466   1.00 35.16  ? 432 HIS A CB  1 
ATOM   1076 C CG  . HIS A 1 187 ? 25.863 -19.829 3.091   1.00 33.03  ? 432 HIS A CG  1 
ATOM   1077 N ND1 . HIS A 1 187 ? 25.923 -19.122 1.910   1.00 33.25  ? 432 HIS A ND1 1 
ATOM   1078 C CD2 . HIS A 1 187 ? 24.764 -19.382 3.745   1.00 31.63  ? 432 HIS A CD2 1 
ATOM   1079 C CE1 . HIS A 1 187 ? 24.903 -18.283 1.853   1.00 31.69  ? 432 HIS A CE1 1 
ATOM   1080 N NE2 . HIS A 1 187 ? 24.184 -18.423 2.954   1.00 33.40  ? 432 HIS A NE2 1 
ATOM   1081 N N   . ALA A 1 188 ? 28.780 -22.480 5.463   1.00 38.49  ? 433 ALA A N   1 
ATOM   1082 C CA  . ALA A 1 188 ? 29.634 -23.625 5.738   1.00 42.39  ? 433 ALA A CA  1 
ATOM   1083 C C   . ALA A 1 188 ? 29.093 -24.478 6.881   1.00 42.15  ? 433 ALA A C   1 
ATOM   1084 O O   . ALA A 1 188 ? 29.387 -25.675 6.939   1.00 40.58  ? 433 ALA A O   1 
ATOM   1085 C CB  . ALA A 1 188 ? 31.061 -23.154 6.044   1.00 40.64  ? 433 ALA A CB  1 
ATOM   1086 N N   . GLN A 1 189 ? 28.303 -23.904 7.785   1.00 41.33  ? 434 GLN A N   1 
ATOM   1087 C CA  . GLN A 1 189 ? 27.686 -24.678 8.854   1.00 44.87  ? 434 GLN A CA  1 
ATOM   1088 C C   . GLN A 1 189 ? 26.241 -25.048 8.550   1.00 43.09  ? 434 GLN A C   1 
ATOM   1089 O O   . GLN A 1 189 ? 25.544 -25.545 9.436   1.00 43.67  ? 434 GLN A O   1 
ATOM   1090 C CB  . GLN A 1 189 ? 27.757 -23.920 10.178  1.00 45.56  ? 434 GLN A CB  1 
ATOM   1091 C CG  . GLN A 1 189 ? 29.158 -23.491 10.557  1.00 52.54  ? 434 GLN A CG  1 
ATOM   1092 C CD  . GLN A 1 189 ? 29.307 -23.244 12.040  1.00 62.84  ? 434 GLN A CD  1 
ATOM   1093 O OE1 . GLN A 1 189 ? 29.339 -22.096 12.490  1.00 68.08  ? 434 GLN A OE1 1 
ATOM   1094 N NE2 . GLN A 1 189 ? 29.406 -24.323 12.813  1.00 64.83  ? 434 GLN A NE2 1 
ATOM   1095 N N   . GLY A 1 190 ? 25.777 -24.815 7.326   1.00 41.77  ? 435 GLY A N   1 
ATOM   1096 C CA  . GLY A 1 190 ? 24.434 -25.196 6.938   1.00 38.70  ? 435 GLY A CA  1 
ATOM   1097 C C   . GLY A 1 190 ? 23.343 -24.194 7.245   1.00 41.10  ? 435 GLY A C   1 
ATOM   1098 O O   . GLY A 1 190 ? 22.166 -24.515 7.054   1.00 41.04  ? 435 GLY A O   1 
ATOM   1099 N N   . VAL A 1 191 ? 23.678 -22.991 7.700   1.00 33.89  ? 436 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 191 ? 22.660 -22.017 8.079   1.00 33.10  ? 436 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 191 ? 22.368 -21.101 6.896   1.00 34.60  ? 436 VAL A C   1 
ATOM   1102 O O   . VAL A 1 191 ? 23.280 -20.499 6.321   1.00 33.55  ? 436 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 191 ? 23.098 -21.206 9.309   1.00 35.26  ? 436 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 191 ? 22.074 -20.136 9.599   1.00 36.21  ? 436 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 191 ? 23.254 -22.122 10.511  1.00 37.72  ? 436 VAL A CG2 1 
ATOM   1106 N N   . ILE A 1 192 ? 21.095 -21.014 6.523   1.00 31.69  ? 437 ILE A N   1 
ATOM   1107 C CA  . ILE A 1 192 ? 20.611 -20.109 5.487   1.00 30.93  ? 437 ILE A CA  1 
ATOM   1108 C C   . ILE A 1 192 ? 19.880 -18.967 6.176   1.00 31.49  ? 437 ILE A C   1 
ATOM   1109 O O   . ILE A 1 192 ? 19.003 -19.207 7.008   1.00 33.65  ? 437 ILE A O   1 
ATOM   1110 C CB  . ILE A 1 192 ? 19.669 -20.829 4.504   1.00 32.71  ? 437 ILE A CB  1 
ATOM   1111 C CG1 . ILE A 1 192 ? 20.237 -22.187 4.095   1.00 36.10  ? 437 ILE A CG1 1 
ATOM   1112 C CG2 . ILE A 1 192 ? 19.418 -19.966 3.263   1.00 33.89  ? 437 ILE A CG2 1 
ATOM   1113 C CD1 . ILE A 1 192 ? 19.243 -23.011 3.305   1.00 35.59  ? 437 ILE A CD1 1 
ATOM   1114 N N   . HIS A 1 193 ? 20.226 -17.727 5.826   1.00 30.50  ? 438 HIS A N   1 
ATOM   1115 C CA  . HIS A 1 193 ? 19.605 -16.587 6.495   1.00 28.98  ? 438 HIS A CA  1 
ATOM   1116 C C   . HIS A 1 193 ? 18.157 -16.394 6.040   1.00 31.00  ? 438 HIS A C   1 
ATOM   1117 O O   . HIS A 1 193 ? 17.259 -16.186 6.864   1.00 31.30  ? 438 HIS A O   1 
ATOM   1118 C CB  . HIS A 1 193 ? 20.425 -15.316 6.230   1.00 29.51  ? 438 HIS A CB  1 
ATOM   1119 C CG  . HIS A 1 193 ? 19.930 -14.117 6.980   1.00 30.09  ? 438 HIS A CG  1 
ATOM   1120 N ND1 . HIS A 1 193 ? 18.826 -13.401 6.584   1.00 30.87  ? 438 HIS A ND1 1 
ATOM   1121 C CD2 . HIS A 1 193 ? 20.385 -13.513 8.105   1.00 32.37  ? 438 HIS A CD2 1 
ATOM   1122 C CE1 . HIS A 1 193 ? 18.619 -12.405 7.427   1.00 33.86  ? 438 HIS A CE1 1 
ATOM   1123 N NE2 . HIS A 1 193 ? 19.552 -12.449 8.359   1.00 31.56  ? 438 HIS A NE2 1 
ATOM   1124 N N   . ARG A 1 194 ? 17.930 -16.401 4.726   1.00 30.59  ? 439 ARG A N   1 
ATOM   1125 C CA  . ARG A 1 194 ? 16.635 -16.340 4.052   1.00 30.72  ? 439 ARG A CA  1 
ATOM   1126 C C   . ARG A 1 194 ? 15.957 -14.972 4.106   1.00 32.37  ? 439 ARG A C   1 
ATOM   1127 O O   . ARG A 1 194 ? 14.835 -14.844 3.607   1.00 32.43  ? 439 ARG A O   1 
ATOM   1128 C CB  . ARG A 1 194 ? 15.642 -17.390 4.577   1.00 31.82  ? 439 ARG A CB  1 
ATOM   1129 C CG  . ARG A 1 194 ? 16.182 -18.796 4.500   1.00 31.85  ? 439 ARG A CG  1 
ATOM   1130 C CD  . ARG A 1 194 ? 15.080 -19.821 4.472   1.00 34.40  ? 439 ARG A CD  1 
ATOM   1131 N NE  . ARG A 1 194 ? 14.424 -19.964 5.767   1.00 34.30  ? 439 ARG A NE  1 
ATOM   1132 C CZ  . ARG A 1 194 ? 13.583 -20.947 6.060   1.00 38.03  ? 439 ARG A CZ  1 
ATOM   1133 N NH1 . ARG A 1 194 ? 13.305 -21.869 5.142   1.00 34.83  ? 439 ARG A NH1 1 
ATOM   1134 N NH2 . ARG A 1 194 ? 13.034 -21.024 7.265   1.00 36.87  ? 439 ARG A NH2 1 
ATOM   1135 N N   . ASP A 1 195 ? 16.585 -13.942 4.662   1.00 32.79  ? 440 ASP A N   1 
ATOM   1136 C CA  . ASP A 1 195 ? 15.993 -12.605 4.600   1.00 32.00  ? 440 ASP A CA  1 
ATOM   1137 C C   . ASP A 1 195 ? 17.080 -11.543 4.407   1.00 32.34  ? 440 ASP A C   1 
ATOM   1138 O O   . ASP A 1 195 ? 17.101 -10.504 5.070   1.00 33.04  ? 440 ASP A O   1 
ATOM   1139 C CB  . ASP A 1 195 ? 15.139 -12.329 5.841   1.00 32.24  ? 440 ASP A CB  1 
ATOM   1140 C CG  . ASP A 1 195 ? 14.044 -11.281 5.579   1.00 37.26  ? 440 ASP A CG  1 
ATOM   1141 O OD1 . ASP A 1 195 ? 13.707 -11.044 4.396   1.00 38.13  ? 440 ASP A OD1 1 
ATOM   1142 O OD2 . ASP A 1 195 ? 13.523 -10.691 6.550   1.00 37.45  ? 440 ASP A OD2 1 
ATOM   1143 N N   . ILE A 1 196 ? 17.990 -11.797 3.468   1.00 31.34  ? 441 ILE A N   1 
ATOM   1144 C CA  . ILE A 1 196 ? 19.016 -10.822 3.103   1.00 30.45  ? 441 ILE A CA  1 
ATOM   1145 C C   . ILE A 1 196 ? 18.361 -9.675  2.345   1.00 32.29  ? 441 ILE A C   1 
ATOM   1146 O O   . ILE A 1 196 ? 17.680 -9.887  1.336   1.00 32.73  ? 441 ILE A O   1 
ATOM   1147 C CB  . ILE A 1 196 ? 20.117 -11.480 2.262   1.00 29.78  ? 441 ILE A CB  1 
ATOM   1148 C CG1 . ILE A 1 196 ? 20.793 -12.606 3.054   1.00 30.80  ? 441 ILE A CG1 1 
ATOM   1149 C CG2 . ILE A 1 196 ? 21.135 -10.433 1.732   1.00 30.24  ? 441 ILE A CG2 1 
ATOM   1150 C CD1 . ILE A 1 196 ? 21.540 -12.117 4.270   1.00 31.77  ? 441 ILE A CD1 1 
ATOM   1151 N N   . LYS A 1 197 ? 18.555 -8.459  2.842   1.00 32.11  ? 442 LYS A N   1 
ATOM   1152 C CA  . LYS A 1 197 ? 18.070 -7.212  2.266   1.00 30.14  ? 442 LYS A CA  1 
ATOM   1153 C C   . LYS A 1 197 ? 18.683 -6.092  3.095   1.00 34.75  ? 442 LYS A C   1 
ATOM   1154 O O   . LYS A 1 197 ? 19.187 -6.338  4.192   1.00 31.24  ? 442 LYS A O   1 
ATOM   1155 C CB  . LYS A 1 197 ? 16.544 -7.128  2.282   1.00 31.64  ? 442 LYS A CB  1 
ATOM   1156 C CG  . LYS A 1 197 ? 15.949 -7.254  3.675   1.00 32.80  ? 442 LYS A CG  1 
ATOM   1157 C CD  . LYS A 1 197 ? 14.440 -7.162  3.652   1.00 33.78  ? 442 LYS A CD  1 
ATOM   1158 C CE  . LYS A 1 197 ? 13.873 -7.439  5.038   1.00 38.95  ? 442 LYS A CE  1 
ATOM   1159 N NZ  . LYS A 1 197 ? 12.387 -7.547  5.024   1.00 40.42  ? 442 LYS A NZ  1 
ATOM   1160 N N   . SER A 1 198 ? 18.648 -4.863  2.561   1.00 31.80  ? 443 SER A N   1 
ATOM   1161 C CA  . SER A 1 198 ? 19.294 -3.758  3.271   1.00 31.82  ? 443 SER A CA  1 
ATOM   1162 C C   . SER A 1 198 ? 18.761 -3.593  4.696   1.00 33.93  ? 443 SER A C   1 
ATOM   1163 O O   . SER A 1 198 ? 19.518 -3.210  5.598   1.00 33.55  ? 443 SER A O   1 
ATOM   1164 C CB  . SER A 1 198 ? 19.134 -2.448  2.494   1.00 29.86  ? 443 SER A CB  1 
ATOM   1165 O OG  . SER A 1 198 ? 17.778 -2.050  2.431   1.00 32.27  ? 443 SER A OG  1 
ATOM   1166 N N   . ASP A 1 199 ? 17.474 -3.890  4.925   1.00 34.20  ? 444 ASP A N   1 
ATOM   1167 C CA  . ASP A 1 199 ? 16.902 -3.756  6.266   1.00 32.02  ? 444 ASP A CA  1 
ATOM   1168 C C   . ASP A 1 199 ? 17.573 -4.678  7.272   1.00 33.52  ? 444 ASP A C   1 
ATOM   1169 O O   . ASP A 1 199 ? 17.533 -4.410  8.477   1.00 34.72  ? 444 ASP A O   1 
ATOM   1170 C CB  . ASP A 1 199 ? 15.394 -4.058  6.249   1.00 34.10  ? 444 ASP A CB  1 
ATOM   1171 C CG  . ASP A 1 199 ? 14.688 -3.495  5.025   1.00 37.76  ? 444 ASP A CG  1 
ATOM   1172 O OD1 . ASP A 1 199 ? 15.119 -3.775  3.881   1.00 37.59  ? 444 ASP A OD1 1 
ATOM   1173 O OD2 . ASP A 1 199 ? 13.678 -2.792  5.206   1.00 39.43  ? 444 ASP A OD2 1 
ATOM   1174 N N   . SER A 1 200 ? 18.162 -5.779  6.807   1.00 33.48  ? 445 SER A N   1 
ATOM   1175 C CA  . SER A 1 200 ? 18.799 -6.757  7.678   1.00 33.44  ? 445 SER A CA  1 
ATOM   1176 C C   . SER A 1 200 ? 20.264 -6.462  7.936   1.00 34.30  ? 445 SER A C   1 
ATOM   1177 O O   . SER A 1 200 ? 20.903 -7.210  8.681   1.00 32.11  ? 445 SER A O   1 
ATOM   1178 C CB  . SER A 1 200 ? 18.674 -8.166  7.080   1.00 32.31  ? 445 SER A CB  1 
ATOM   1179 O OG  . SER A 1 200 ? 17.314 -8.525  6.965   1.00 35.41  ? 445 SER A OG  1 
ATOM   1180 N N   . ILE A 1 201 ? 20.813 -5.409  7.339   1.00 31.00  ? 446 ILE A N   1 
ATOM   1181 C CA  . ILE A 1 201 ? 22.225 -5.072  7.472   1.00 31.54  ? 446 ILE A CA  1 
ATOM   1182 C C   . ILE A 1 201 ? 22.332 -3.836  8.361   1.00 34.57  ? 446 ILE A C   1 
ATOM   1183 O O   . ILE A 1 201 ? 21.794 -2.774  8.022   1.00 35.28  ? 446 ILE A O   1 
ATOM   1184 C CB  . ILE A 1 201 ? 22.879 -4.818  6.102   1.00 32.34  ? 446 ILE A CB  1 
ATOM   1185 C CG1 . ILE A 1 201 ? 22.685 -6.004  5.145   1.00 34.38  ? 446 ILE A CG1 1 
ATOM   1186 C CG2 . ILE A 1 201 ? 24.339 -4.473  6.272   1.00 32.99  ? 446 ILE A CG2 1 
ATOM   1187 C CD1 . ILE A 1 201 ? 23.092 -7.349  5.716   1.00 32.44  ? 446 ILE A CD1 1 
ATOM   1188 N N   . LEU A 1 202 ? 23.019 -3.970  9.492   1.00 35.40  ? 447 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 202 ? 23.130 -2.891  10.465  1.00 34.46  ? 447 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 202 ? 24.571 -2.393  10.537  1.00 38.39  ? 447 LEU A C   1 
ATOM   1191 O O   . LEU A 1 202 ? 25.517 -3.085  10.146  1.00 36.29  ? 447 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 202 ? 22.657 -3.357  11.840  1.00 35.08  ? 447 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 202 ? 21.249 -3.959  11.918  1.00 36.85  ? 447 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 202 ? 20.899 -4.288  13.354  1.00 37.75  ? 447 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 202 ? 20.227 -2.987  11.346  1.00 36.84  ? 447 LEU A CD2 1 
ATOM   1196 N N   . LEU A 1 203 ? 24.735 -1.172  11.049  1.00 36.99  ? 448 LEU A N   1 
ATOM   1197 C CA  A LEU A 1 203 ? 26.027 -0.507  11.041  0.56 38.42  ? 448 LEU A CA  1 
ATOM   1198 C CA  B LEU A 1 203 ? 26.014 -0.475  11.034  0.44 38.76  ? 448 LEU A CA  1 
ATOM   1199 C C   . LEU A 1 203 ? 26.377 0.007   12.431  1.00 41.69  ? 448 LEU A C   1 
ATOM   1200 O O   . LEU A 1 203 ? 25.505 0.397   13.214  1.00 40.22  ? 448 LEU A O   1 
ATOM   1201 C CB  A LEU A 1 203 ? 26.036 0.657   10.038  0.56 40.14  ? 448 LEU A CB  1 
ATOM   1202 C CB  B LEU A 1 203 ? 25.980 0.742   10.090  0.44 40.22  ? 448 LEU A CB  1 
ATOM   1203 C CG  A LEU A 1 203 ? 26.115 0.371   8.530   0.56 42.83  ? 448 LEU A CG  1 
ATOM   1204 C CG  B LEU A 1 203 ? 25.796 0.568   8.579   0.44 43.21  ? 448 LEU A CG  1 
ATOM   1205 C CD1 A LEU A 1 203 ? 24.909 -0.384  7.979   0.56 41.39  ? 448 LEU A CD1 1 
ATOM   1206 C CD1 B LEU A 1 203 ? 26.797 -0.430  8.048   0.44 40.98  ? 448 LEU A CD1 1 
ATOM   1207 C CD2 A LEU A 1 203 ? 26.268 1.683   7.797   0.56 42.29  ? 448 LEU A CD2 1 
ATOM   1208 C CD2 B LEU A 1 203 ? 24.369 0.180   8.189   0.44 43.99  ? 448 LEU A CD2 1 
ATOM   1209 N N   . THR A 1 204 ? 27.674 0.000   12.732  1.00 41.57  ? 449 THR A N   1 
ATOM   1210 C CA  . THR A 1 204 ? 28.181 0.672   13.919  1.00 45.72  ? 449 THR A CA  1 
ATOM   1211 C C   . THR A 1 204 ? 28.489 2.129   13.578  1.00 44.36  ? 449 THR A C   1 
ATOM   1212 O O   . THR A 1 204 ? 28.531 2.526   12.408  1.00 43.41  ? 449 THR A O   1 
ATOM   1213 C CB  . THR A 1 204 ? 29.451 0.012   14.457  1.00 46.96  ? 449 THR A CB  1 
ATOM   1214 O OG1 . THR A 1 204 ? 30.514 0.228   13.524  1.00 41.90  ? 449 THR A OG1 1 
ATOM   1215 C CG2 . THR A 1 204 ? 29.260 -1.481  14.682  1.00 45.03  ? 449 THR A CG2 1 
ATOM   1216 N N   . HIS A 1 205 ? 28.747 2.923   14.618  1.00 43.85  ? 450 HIS A N   1 
ATOM   1217 C CA  . HIS A 1 205 ? 29.053 4.331   14.395  1.00 47.73  ? 450 HIS A CA  1 
ATOM   1218 C C   . HIS A 1 205 ? 30.308 4.497   13.551  1.00 49.49  ? 450 HIS A C   1 
ATOM   1219 O O   . HIS A 1 205 ? 30.439 5.486   12.822  1.00 46.14  ? 450 HIS A O   1 
ATOM   1220 C CB  . HIS A 1 205 ? 29.222 5.061   15.733  1.00 47.44  ? 450 HIS A CB  1 
ATOM   1221 C CG  . HIS A 1 205 ? 30.547 4.819   16.391  1.00 51.82  ? 450 HIS A CG  1 
ATOM   1222 N ND1 . HIS A 1 205 ? 30.775 3.757   17.238  1.00 51.86  ? 450 HIS A ND1 1 
ATOM   1223 C CD2 . HIS A 1 205 ? 31.713 5.506   16.328  1.00 52.72  ? 450 HIS A CD2 1 
ATOM   1224 C CE1 . HIS A 1 205 ? 32.023 3.797   17.669  1.00 52.72  ? 450 HIS A CE1 1 
ATOM   1225 N NE2 . HIS A 1 205 ? 32.614 4.849   17.132  1.00 55.15  ? 450 HIS A NE2 1 
ATOM   1226 N N   . ASP A 1 206 ? 31.242 3.549   13.637  1.00 43.69  ? 451 ASP A N   1 
ATOM   1227 C CA  . ASP A 1 206 ? 32.498 3.639   12.906  1.00 44.63  ? 451 ASP A CA  1 
ATOM   1228 C C   . ASP A 1 206 ? 32.482 2.826   11.612  1.00 44.10  ? 451 ASP A C   1 
ATOM   1229 O O   . ASP A 1 206 ? 33.546 2.544   11.048  1.00 44.29  ? 451 ASP A O   1 
ATOM   1230 C CB  . ASP A 1 206 ? 33.676 3.229   13.799  1.00 48.54  ? 451 ASP A CB  1 
ATOM   1231 C CG  . ASP A 1 206 ? 33.474 1.881   14.484  1.00 57.46  ? 451 ASP A CG  1 
ATOM   1232 O OD1 . ASP A 1 206 ? 32.358 1.320   14.422  1.00 53.29  ? 451 ASP A OD1 1 
ATOM   1233 O OD2 . ASP A 1 206 ? 34.446 1.386   15.096  1.00 58.54  ? 451 ASP A OD2 1 
ATOM   1234 N N   . GLY A 1 207 ? 31.299 2.462   11.118  1.00 41.55  ? 452 GLY A N   1 
ATOM   1235 C CA  . GLY A 1 207 ? 31.177 1.914   9.781   1.00 41.31  ? 452 GLY A CA  1 
ATOM   1236 C C   . GLY A 1 207 ? 31.314 0.412   9.656   1.00 40.44  ? 452 GLY A C   1 
ATOM   1237 O O   . GLY A 1 207 ? 31.338 -0.098  8.527   1.00 39.58  ? 452 GLY A O   1 
ATOM   1238 N N   . ARG A 1 208 ? 31.411 -0.316  10.764  1.00 40.39  ? 453 ARG A N   1 
ATOM   1239 C CA  A ARG A 1 208 ? 31.424 -1.771  10.700  0.57 40.32  ? 453 ARG A CA  1 
ATOM   1240 C CA  B ARG A 1 208 ? 31.428 -1.769  10.690  0.43 40.76  ? 453 ARG A CA  1 
ATOM   1241 C C   . ARG A 1 208 ? 30.042 -2.295  10.321  1.00 44.56  ? 453 ARG A C   1 
ATOM   1242 O O   . ARG A 1 208 ? 29.017 -1.778  10.777  1.00 41.61  ? 453 ARG A O   1 
ATOM   1243 C CB  A ARG A 1 208 ? 31.865 -2.360  12.041  0.57 42.46  ? 453 ARG A CB  1 
ATOM   1244 C CB  B ARG A 1 208 ? 31.912 -2.358  12.017  0.43 42.49  ? 453 ARG A CB  1 
ATOM   1245 C CG  A ARG A 1 208 ? 33.365 -2.293  12.303  0.57 44.67  ? 453 ARG A CG  1 
ATOM   1246 C CG  B ARG A 1 208 ? 33.334 -1.920  12.367  0.43 44.43  ? 453 ARG A CG  1 
ATOM   1247 C CD  A ARG A 1 208 ? 33.659 -2.642  13.753  0.57 47.68  ? 453 ARG A CD  1 
ATOM   1248 C CD  B ARG A 1 208 ? 33.814 -2.463  13.705  0.43 47.97  ? 453 ARG A CD  1 
ATOM   1249 N NE  A ARG A 1 208 ? 33.313 -1.535  14.641  0.57 52.07  ? 453 ARG A NE  1 
ATOM   1250 N NE  B ARG A 1 208 ? 35.119 -1.910  14.061  0.43 52.64  ? 453 ARG A NE  1 
ATOM   1251 C CZ  A ARG A 1 208 ? 32.923 -1.674  15.906  0.57 54.21  ? 453 ARG A CZ  1 
ATOM   1252 C CZ  B ARG A 1 208 ? 35.752 -2.151  15.205  0.43 52.80  ? 453 ARG A CZ  1 
ATOM   1253 N NH1 A ARG A 1 208 ? 32.805 -2.885  16.442  0.57 53.13  ? 453 ARG A NH1 1 
ATOM   1254 N NH1 B ARG A 1 208 ? 35.200 -2.941  16.116  0.43 52.79  ? 453 ARG A NH1 1 
ATOM   1255 N NH2 A ARG A 1 208 ? 32.635 -0.595  16.632  0.57 44.58  ? 453 ARG A NH2 1 
ATOM   1256 N NH2 B ARG A 1 208 ? 36.936 -1.601  15.439  0.43 51.97  ? 453 ARG A NH2 1 
ATOM   1257 N N   . VAL A 1 209 ? 30.016 -3.324  9.475   1.00 36.72  ? 454 VAL A N   1 
ATOM   1258 C CA  . VAL A 1 209 ? 28.790 -3.840  8.867   1.00 35.54  ? 454 VAL A CA  1 
ATOM   1259 C C   . VAL A 1 209 ? 28.473 -5.198  9.479   1.00 34.62  ? 454 VAL A C   1 
ATOM   1260 O O   . VAL A 1 209 ? 29.345 -6.070  9.544   1.00 37.46  ? 454 VAL A O   1 
ATOM   1261 C CB  . VAL A 1 209 ? 28.952 -3.958  7.342   1.00 40.19  ? 454 VAL A CB  1 
ATOM   1262 C CG1 . VAL A 1 209 ? 27.755 -4.625  6.704   1.00 38.27  ? 454 VAL A CG1 1 
ATOM   1263 C CG2 . VAL A 1 209 ? 29.206 -2.599  6.744   1.00 38.32  ? 454 VAL A CG2 1 
ATOM   1264 N N   . LYS A 1 210 ? 27.225 -5.391  9.911   1.00 36.75  ? 455 LYS A N   1 
ATOM   1265 C CA  . LYS A 1 210 ? 26.876 -6.650  10.554  1.00 34.95  ? 455 LYS A CA  1 
ATOM   1266 C C   . LYS A 1 210 ? 25.500 -7.122  10.107  1.00 34.78  ? 455 LYS A C   1 
ATOM   1267 O O   . LYS A 1 210 ? 24.571 -6.326  9.953   1.00 34.95  ? 455 LYS A O   1 
ATOM   1268 C CB  . LYS A 1 210 ? 26.908 -6.542  12.090  1.00 36.24  ? 455 LYS A CB  1 
ATOM   1269 C CG  . LYS A 1 210 ? 28.224 -5.996  12.670  1.00 39.17  ? 455 LYS A CG  1 
ATOM   1270 C CD  . LYS A 1 210 ? 28.377 -6.289  14.155  1.00 41.24  ? 455 LYS A CD  1 
ATOM   1271 C CE  . LYS A 1 210 ? 29.712 -5.733  14.687  1.00 43.06  ? 455 LYS A CE  1 
ATOM   1272 N NZ  . LYS A 1 210 ? 29.957 -6.088  16.113  1.00 45.69  ? 455 LYS A NZ  1 
ATOM   1273 N N   . LEU A 1 211 ? 25.384 -8.433  9.937   1.00 32.69  ? 456 LEU A N   1 
ATOM   1274 C CA  . LEU A 1 211 ? 24.134 -9.068  9.558   1.00 32.34  ? 456 LEU A CA  1 
ATOM   1275 C C   . LEU A 1 211 ? 23.272 -9.293  10.793  1.00 33.50  ? 456 LEU A C   1 
ATOM   1276 O O   . LEU A 1 211 ? 23.780 -9.661  11.859  1.00 34.32  ? 456 LEU A O   1 
ATOM   1277 C CB  . LEU A 1 211 ? 24.447 -10.394 8.868   1.00 33.40  ? 456 LEU A CB  1 
ATOM   1278 C CG  . LEU A 1 211 ? 23.366 -11.287 8.291   1.00 35.63  ? 456 LEU A CG  1 
ATOM   1279 C CD1 . LEU A 1 211 ? 22.522 -10.528 7.274   1.00 34.74  ? 456 LEU A CD1 1 
ATOM   1280 C CD2 . LEU A 1 211 ? 24.065 -12.500 7.657   1.00 31.23  ? 456 LEU A CD2 1 
ATOM   1281 N N   . SER A 1 212 ? 21.967 -9.051  10.658  1.00 33.85  ? 457 SER A N   1 
ATOM   1282 C CA  A SER A 1 212 ? 21.034 -9.183  11.772  0.62 35.40  ? 457 SER A CA  1 
ATOM   1283 C CA  B SER A 1 212 ? 21.034 -9.189  11.771  0.38 35.02  ? 457 SER A CA  1 
ATOM   1284 C C   . SER A 1 212 ? 19.768 -9.882  11.273  1.00 32.12  ? 457 SER A C   1 
ATOM   1285 O O   . SER A 1 212 ? 19.693 -10.331 10.125  1.00 32.98  ? 457 SER A O   1 
ATOM   1286 C CB  A SER A 1 212 ? 20.723 -7.810  12.386  0.62 37.19  ? 457 SER A CB  1 
ATOM   1287 C CB  B SER A 1 212 ? 20.705 -7.820  12.374  0.38 36.94  ? 457 SER A CB  1 
ATOM   1288 O OG  A SER A 1 212 ? 19.905 -7.941  13.538  0.62 40.89  ? 457 SER A OG  1 
ATOM   1289 O OG  B SER A 1 212 ? 19.871 -7.098  11.488  0.38 31.93  ? 457 SER A OG  1 
ATOM   1290 N N   . ASP A 1 213 ? 18.768 -9.956  12.155  1.00 33.12  ? 458 ASP A N   1 
ATOM   1291 C CA  . ASP A 1 213 ? 17.427 -10.481 11.858  1.00 35.60  ? 458 ASP A CA  1 
ATOM   1292 C C   . ASP A 1 213 ? 17.491 -11.923 11.347  1.00 33.28  ? 458 ASP A C   1 
ATOM   1293 O O   . ASP A 1 213 ? 17.150 -12.237 10.200  1.00 32.82  ? 458 ASP A O   1 
ATOM   1294 C CB  . ASP A 1 213 ? 16.685 -9.588  10.855  1.00 41.26  ? 458 ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 213 ? 16.094 -8.347  11.499  1.00 54.79  ? 458 ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 213 ? 15.979 -8.320  12.746  1.00 55.67  ? 458 ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 213 ? 15.720 -7.421  10.743  1.00 56.54  ? 458 ASP A OD2 1 
ATOM   1298 N N   . PHE A 1 214 ? 17.900 -12.799 12.260  1.00 32.44  ? 459 PHE A N   1 
ATOM   1299 C CA  . PHE A 1 214 ? 17.977 -14.229 11.997  1.00 35.41  ? 459 PHE A CA  1 
ATOM   1300 C C   . PHE A 1 214 ? 16.685 -14.960 12.317  1.00 37.45  ? 459 PHE A C   1 
ATOM   1301 O O   . PHE A 1 214 ? 16.682 -16.194 12.359  1.00 35.84  ? 459 PHE A O   1 
ATOM   1302 C CB  . PHE A 1 214 ? 19.134 -14.832 12.790  1.00 35.40  ? 459 PHE A CB  1 
ATOM   1303 C CG  . PHE A 1 214 ? 20.479 -14.449 12.245  1.00 36.14  ? 459 PHE A CG  1 
ATOM   1304 C CD1 . PHE A 1 214 ? 21.039 -13.224 12.543  1.00 37.91  ? 459 PHE A CD1 1 
ATOM   1305 C CD2 . PHE A 1 214 ? 21.164 -15.307 11.403  1.00 36.24  ? 459 PHE A CD2 1 
ATOM   1306 C CE1 . PHE A 1 214 ? 22.271 -12.870 12.020  1.00 38.58  ? 459 PHE A CE1 1 
ATOM   1307 C CE2 . PHE A 1 214 ? 22.387 -14.959 10.880  1.00 38.55  ? 459 PHE A CE2 1 
ATOM   1308 C CZ  . PHE A 1 214 ? 22.940 -13.736 11.191  1.00 37.40  ? 459 PHE A CZ  1 
ATOM   1309 N N   . GLY A 1 215 ? 15.585 -14.237 12.522  1.00 33.39  ? 460 GLY A N   1 
ATOM   1310 C CA  . GLY A 1 215 ? 14.345 -14.892 12.904  1.00 35.77  ? 460 GLY A CA  1 
ATOM   1311 C C   . GLY A 1 215 ? 13.800 -15.875 11.880  1.00 36.11  ? 460 GLY A C   1 
ATOM   1312 O O   . GLY A 1 215 ? 12.945 -16.700 12.223  1.00 38.40  ? 460 GLY A O   1 
ATOM   1313 N N   . PHE A 1 216 ? 14.281 -15.823 10.638  1.00 34.19  ? 461 PHE A N   1 
ATOM   1314 C CA  . PHE A 1 216 ? 13.724 -16.644 9.563   1.00 35.50  ? 461 PHE A CA  1 
ATOM   1315 C C   . PHE A 1 216 ? 14.692 -17.694 9.045   1.00 37.43  ? 461 PHE A C   1 
ATOM   1316 O O   . PHE A 1 216 ? 14.392 -18.355 8.041   1.00 35.35  ? 461 PHE A O   1 
ATOM   1317 C CB  . PHE A 1 216 ? 13.266 -15.745 8.408   1.00 35.64  ? 461 PHE A CB  1 
ATOM   1318 C CG  . PHE A 1 216 ? 12.312 -14.677 8.836   1.00 44.42  ? 461 PHE A CG  1 
ATOM   1319 C CD1 . PHE A 1 216 ? 12.767 -13.398 9.124   1.00 43.53  ? 461 PHE A CD1 1 
ATOM   1320 C CD2 . PHE A 1 216 ? 10.961 -14.960 8.995   1.00 45.74  ? 461 PHE A CD2 1 
ATOM   1321 C CE1 . PHE A 1 216 ? 11.888 -12.416 9.537   1.00 47.00  ? 461 PHE A CE1 1 
ATOM   1322 C CE2 . PHE A 1 216 ? 10.077 -13.977 9.412   1.00 46.72  ? 461 PHE A CE2 1 
ATOM   1323 C CZ  . PHE A 1 216 ? 10.544 -12.708 9.681   1.00 43.69  ? 461 PHE A CZ  1 
ATOM   1324 N N   . CYS A 1 217 ? 15.835 -17.880 9.707   1.00 33.18  ? 462 CYS A N   1 
ATOM   1325 C CA  A CYS A 1 217 ? 16.833 -18.777 9.159   0.70 33.73  ? 462 CYS A CA  1 
ATOM   1326 C CA  B CYS A 1 217 ? 16.867 -18.799 9.249   0.30 33.16  ? 462 CYS A CA  1 
ATOM   1327 C C   . CYS A 1 217 ? 16.363 -20.237 9.228   1.00 34.21  ? 462 CYS A C   1 
ATOM   1328 O O   . CYS A 1 217 ? 15.354 -20.589 9.858   1.00 35.47  ? 462 CYS A O   1 
ATOM   1329 C CB  A CYS A 1 217 ? 18.171 -18.602 9.880   0.70 32.36  ? 462 CYS A CB  1 
ATOM   1330 C CB  B CYS A 1 217 ? 18.094 -18.748 10.157  0.30 33.60  ? 462 CYS A CB  1 
ATOM   1331 S SG  A CYS A 1 217 ? 18.127 -19.000 11.623  0.70 37.33  ? 462 CYS A SG  1 
ATOM   1332 S SG  B CYS A 1 217 ? 19.078 -17.282 10.012  0.30 37.01  ? 462 CYS A SG  1 
ATOM   1333 N N   . ALA A 1 218 ? 17.118 -21.090 8.537   1.00 32.32  ? 463 ALA A N   1 
ATOM   1334 C CA  . ALA A 1 218 ? 16.871 -22.523 8.551   1.00 36.62  ? 463 ALA A CA  1 
ATOM   1335 C C   . ALA A 1 218 ? 18.200 -23.235 8.369   1.00 35.50  ? 463 ALA A C   1 
ATOM   1336 O O   . ALA A 1 218 ? 19.177 -22.656 7.883   1.00 36.49  ? 463 ALA A O   1 
ATOM   1337 C CB  . ALA A 1 218 ? 15.880 -22.945 7.462   1.00 38.08  ? 463 ALA A CB  1 
ATOM   1338 N N   . GLN A 1 219 ? 18.232 -24.502 8.752   1.00 35.58  ? 464 GLN A N   1 
ATOM   1339 C CA  . GLN A 1 219 ? 19.460 -25.276 8.698   1.00 39.28  ? 464 GLN A CA  1 
ATOM   1340 C C   . GLN A 1 219 ? 19.319 -26.408 7.692   1.00 41.15  ? 464 GLN A C   1 
ATOM   1341 O O   . GLN A 1 219 ? 18.278 -27.074 7.632   1.00 39.48  ? 464 GLN A O   1 
ATOM   1342 C CB  . GLN A 1 219 ? 19.810 -25.832 10.082  1.00 44.79  ? 464 GLN A CB  1 
ATOM   1343 C CG  . GLN A 1 219 ? 20.010 -24.742 11.124  1.00 51.49  ? 464 GLN A CG  1 
ATOM   1344 C CD  . GLN A 1 219 ? 20.534 -25.275 12.446  1.00 60.08  ? 464 GLN A CD  1 
ATOM   1345 O OE1 . GLN A 1 219 ? 21.691 -25.053 12.798  1.00 64.47  ? 464 GLN A OE1 1 
ATOM   1346 N NE2 . GLN A 1 219 ? 19.681 -25.973 13.187  1.00 62.82  ? 464 GLN A NE2 1 
ATOM   1347 N N   . VAL A 1 220 ? 20.366 -26.616 6.899   1.00 36.23  ? 465 VAL A N   1 
ATOM   1348 C CA  . VAL A 1 220 ? 20.460 -27.775 6.024   1.00 40.01  ? 465 VAL A CA  1 
ATOM   1349 C C   . VAL A 1 220 ? 21.633 -28.633 6.483   1.00 39.95  ? 465 VAL A C   1 
ATOM   1350 O O   . VAL A 1 220 ? 22.528 -28.177 7.199   1.00 41.60  ? 465 VAL A O   1 
ATOM   1351 C CB  . VAL A 1 220 ? 20.612 -27.392 4.539   1.00 39.17  ? 465 VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 220 ? 19.349 -26.696 4.039   1.00 37.89  ? 465 VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 220 ? 21.838 -26.518 4.346   1.00 41.03  ? 465 VAL A CG2 1 
ATOM   1354 N N   . SER A 1 221 ? 21.619 -29.889 6.050   1.00 38.51  ? 466 SER A N   1 
ATOM   1355 C CA  . SER A 1 221 ? 22.597 -30.879 6.481   1.00 40.47  ? 466 SER A CA  1 
ATOM   1356 C C   . SER A 1 221 ? 22.481 -32.084 5.559   1.00 43.58  ? 466 SER A C   1 
ATOM   1357 O O   . SER A 1 221 ? 21.657 -32.105 4.643   1.00 44.70  ? 466 SER A O   1 
ATOM   1358 C CB  . SER A 1 221 ? 22.368 -31.282 7.938   1.00 44.03  ? 466 SER A CB  1 
ATOM   1359 O OG  . SER A 1 221 ? 21.126 -31.951 8.069   1.00 47.97  ? 466 SER A OG  1 
ATOM   1360 N N   . LYS A 1 222 ? 23.310 -33.100 5.816   1.00 46.50  ? 467 LYS A N   1 
ATOM   1361 C CA  . LYS A 1 222 ? 23.265 -34.307 4.989   1.00 48.18  ? 467 LYS A CA  1 
ATOM   1362 C C   . LYS A 1 222 ? 21.884 -34.955 5.042   1.00 50.82  ? 467 LYS A C   1 
ATOM   1363 O O   . LYS A 1 222 ? 21.395 -35.480 4.031   1.00 49.65  ? 467 LYS A O   1 
ATOM   1364 C CB  . LYS A 1 222 ? 24.353 -35.294 5.431   1.00 57.53  ? 467 LYS A CB  1 
ATOM   1365 C CG  . LYS A 1 222 ? 24.708 -36.386 4.393   1.00 64.61  ? 467 LYS A CG  1 
ATOM   1366 C CD  . LYS A 1 222 ? 23.810 -37.625 4.490   1.00 70.69  ? 467 LYS A CD  1 
ATOM   1367 C CE  . LYS A 1 222 ? 24.124 -38.670 3.407   1.00 72.84  ? 467 LYS A CE  1 
ATOM   1368 N NZ  . LYS A 1 222 ? 23.301 -38.517 2.165   1.00 72.78  ? 467 LYS A NZ  1 
ATOM   1369 N N   . GLU A 1 223 ? 21.229 -34.915 6.207   1.00 45.80  ? 468 GLU A N   1 
ATOM   1370 C CA  . GLU A 1 223 ? 19.914 -35.530 6.355   1.00 47.26  ? 468 GLU A CA  1 
ATOM   1371 C C   . GLU A 1 223 ? 18.783 -34.618 5.889   1.00 45.93  ? 468 GLU A C   1 
ATOM   1372 O O   . GLU A 1 223 ? 17.705 -35.114 5.545   1.00 48.79  ? 468 GLU A O   1 
ATOM   1373 C CB  . GLU A 1 223 ? 19.682 -35.939 7.818   1.00 53.23  ? 468 GLU A CB  1 
ATOM   1374 C CG  . GLU A 1 223 ? 20.738 -36.879 8.417   1.00 59.89  ? 468 GLU A CG  1 
ATOM   1375 C CD  . GLU A 1 223 ? 22.056 -36.175 8.757   1.00 68.03  ? 468 GLU A CD  1 
ATOM   1376 O OE1 . GLU A 1 223 ? 22.047 -34.942 8.991   1.00 66.43  ? 468 GLU A OE1 1 
ATOM   1377 O OE2 . GLU A 1 223 ? 23.102 -36.859 8.781   1.00 68.03  ? 468 GLU A OE2 1 
ATOM   1378 N N   . VAL A 1 224 ? 19.001 -33.305 5.873   1.00 41.65  ? 469 VAL A N   1 
ATOM   1379 C CA  . VAL A 1 224 ? 18.027 -32.338 5.362   1.00 41.59  ? 469 VAL A CA  1 
ATOM   1380 C C   . VAL A 1 224 ? 18.732 -31.461 4.336   1.00 38.35  ? 469 VAL A C   1 
ATOM   1381 O O   . VAL A 1 224 ? 19.092 -30.319 4.655   1.00 38.21  ? 469 VAL A O   1 
ATOM   1382 C CB  . VAL A 1 224 ? 17.439 -31.471 6.488   1.00 43.60  ? 469 VAL A CB  1 
ATOM   1383 C CG1 . VAL A 1 224 ? 16.189 -30.720 6.004   1.00 46.30  ? 469 VAL A CG1 1 
ATOM   1384 C CG2 . VAL A 1 224 ? 17.137 -32.310 7.714   1.00 47.62  ? 469 VAL A CG2 1 
ATOM   1385 N N   . PRO A 1 225 ? 18.960 -31.937 3.108   1.00 44.60  ? 470 PRO A N   1 
ATOM   1386 C CA  . PRO A 1 225 ? 19.845 -31.187 2.196   1.00 44.26  ? 470 PRO A CA  1 
ATOM   1387 C C   . PRO A 1 225 ? 19.259 -29.881 1.678   1.00 45.22  ? 470 PRO A C   1 
ATOM   1388 O O   . PRO A 1 225 ? 20.030 -29.001 1.274   1.00 41.40  ? 470 PRO A O   1 
ATOM   1389 C CB  . PRO A 1 225 ? 20.093 -32.185 1.054   1.00 47.28  ? 470 PRO A CB  1 
ATOM   1390 C CG  . PRO A 1 225 ? 18.955 -33.140 1.119   1.00 48.20  ? 470 PRO A CG  1 
ATOM   1391 C CD  . PRO A 1 225 ? 18.584 -33.255 2.563   1.00 47.51  ? 470 PRO A CD  1 
ATOM   1392 N N   . ARG A 1 226 ? 17.932 -29.726 1.669   1.00 42.08  ? 471 ARG A N   1 
ATOM   1393 C CA  . ARG A 1 226 ? 17.286 -28.557 1.081   1.00 41.17  ? 471 ARG A CA  1 
ATOM   1394 C C   . ARG A 1 226 ? 16.097 -28.147 1.939   1.00 41.51  ? 471 ARG A C   1 
ATOM   1395 O O   . ARG A 1 226 ? 15.499 -28.969 2.634   1.00 41.27  ? 471 ARG A O   1 
ATOM   1396 C CB  . ARG A 1 226 ? 16.788 -28.822 -0.352  1.00 46.34  ? 471 ARG A CB  1 
ATOM   1397 C CG  . ARG A 1 226 ? 17.746 -29.555 -1.285  1.00 51.66  ? 471 ARG A CG  1 
ATOM   1398 C CD  . ARG A 1 226 ? 19.056 -28.794 -1.504  1.00 53.13  ? 471 ARG A CD  1 
ATOM   1399 N NE  . ARG A 1 226 ? 19.015 -27.836 -2.600  1.00 58.19  ? 471 ARG A NE  1 
ATOM   1400 C CZ  . ARG A 1 226 ? 20.000 -26.984 -2.882  1.00 60.04  ? 471 ARG A CZ  1 
ATOM   1401 N NH1 . ARG A 1 226 ? 21.105 -26.962 -2.144  1.00 56.58  ? 471 ARG A NH1 1 
ATOM   1402 N NH2 . ARG A 1 226 ? 19.878 -26.148 -3.903  1.00 61.49  ? 471 ARG A NH2 1 
ATOM   1403 N N   . ARG A 1 227 ? 15.743 -26.866 1.871   1.00 39.82  ? 472 ARG A N   1 
ATOM   1404 C CA  . ARG A 1 227 ? 14.540 -26.357 2.518   1.00 38.64  ? 472 ARG A CA  1 
ATOM   1405 C C   . ARG A 1 227 ? 13.434 -26.188 1.472   1.00 42.57  ? 472 ARG A C   1 
ATOM   1406 O O   . ARG A 1 227 ? 13.695 -26.109 0.271   1.00 42.01  ? 472 ARG A O   1 
ATOM   1407 C CB  . ARG A 1 227 ? 14.813 -25.024 3.228   1.00 37.85  ? 472 ARG A CB  1 
ATOM   1408 C CG  . ARG A 1 227 ? 15.988 -25.026 4.234   1.00 35.98  ? 472 ARG A CG  1 
ATOM   1409 C CD  . ARG A 1 227 ? 15.850 -26.096 5.324   1.00 36.96  ? 472 ARG A CD  1 
ATOM   1410 N NE  . ARG A 1 227 ? 14.582 -26.029 6.056   1.00 40.72  ? 472 ARG A NE  1 
ATOM   1411 C CZ  . ARG A 1 227 ? 14.361 -26.669 7.202   1.00 44.13  ? 472 ARG A CZ  1 
ATOM   1412 N NH1 . ARG A 1 227 ? 15.328 -27.404 7.748   1.00 40.48  ? 472 ARG A NH1 1 
ATOM   1413 N NH2 . ARG A 1 227 ? 13.180 -26.580 7.804   1.00 40.36  ? 472 ARG A NH2 1 
ATOM   1414 N N   . LYS A 1 228 ? 12.187 -26.146 1.937   1.00 38.99  ? 473 LYS A N   1 
ATOM   1415 C CA  . LYS A 1 228 ? 11.054 -26.014 1.015   1.00 41.17  ? 473 LYS A CA  1 
ATOM   1416 C C   . LYS A 1 228 ? 10.100 -24.879 1.377   1.00 48.21  ? 473 LYS A C   1 
ATOM   1417 O O   . LYS A 1 228 ? 9.146  -24.611 0.646   1.00 50.99  ? 473 LYS A O   1 
ATOM   1418 C CB  . LYS A 1 228 ? 10.265 -27.328 0.950   1.00 41.10  ? 473 LYS A CB  1 
ATOM   1419 C CG  . LYS A 1 228 ? 11.091 -28.477 0.411   1.00 49.08  ? 473 LYS A CG  1 
ATOM   1420 C CD  . LYS A 1 228 ? 10.536 -29.828 0.790   1.00 55.55  ? 473 LYS A CD  1 
ATOM   1421 C CE  . LYS A 1 228 ? 11.489 -30.915 0.318   1.00 57.67  ? 473 LYS A CE  1 
ATOM   1422 N NZ  . LYS A 1 228 ? 11.140 -32.236 0.878   1.00 52.43  ? 473 LYS A NZ  1 
HETATM 1423 N N   . SEP A 1 229 ? 10.352 -24.212 2.497   1.00 39.64  ? 474 SEP A N   1 
HETATM 1424 C CA  . SEP A 1 229 ? 9.403  -23.225 3.010   1.00 43.52  ? 474 SEP A CA  1 
HETATM 1425 C CB  . SEP A 1 229 ? 9.701  -22.930 4.476   1.00 39.52  ? 474 SEP A CB  1 
HETATM 1426 O OG  . SEP A 1 229 ? 9.542  -24.097 5.258   1.00 38.84  ? 474 SEP A OG  1 
HETATM 1427 C C   . SEP A 1 229 ? 9.404  -21.923 2.217   1.00 40.72  ? 474 SEP A C   1 
HETATM 1428 O O   . SEP A 1 229 ? 10.452 -21.442 1.796   1.00 39.99  ? 474 SEP A O   1 
HETATM 1429 P P   . SEP A 1 229 ? 10.887 -24.408 6.095   1.00 40.06  ? 474 SEP A P   1 
HETATM 1430 O O1P . SEP A 1 229 ? 12.126 -24.454 5.086   1.00 40.20  ? 474 SEP A O1P 1 
HETATM 1431 O O2P . SEP A 1 229 ? 10.682 -25.834 6.811   1.00 39.25  ? 474 SEP A O2P 1 
HETATM 1432 O O3P . SEP A 1 229 ? 11.150 -23.277 7.196   1.00 37.97  ? 474 SEP A O3P 1 
ATOM   1433 N N   . LEU A 1 230 ? 8.220  -21.348 2.027   1.00 40.15  ? 475 LEU A N   1 
ATOM   1434 C CA  . LEU A 1 230 ? 8.107  -20.008 1.452   1.00 39.01  ? 475 LEU A CA  1 
ATOM   1435 C C   . LEU A 1 230 ? 8.408  -18.944 2.526   1.00 39.38  ? 475 LEU A C   1 
ATOM   1436 O O   . LEU A 1 230 ? 7.563  -18.622 3.360   1.00 38.85  ? 475 LEU A O   1 
ATOM   1437 C CB  . LEU A 1 230 ? 6.705  -19.801 0.850   1.00 42.01  ? 475 LEU A CB  1 
ATOM   1438 C CG  . LEU A 1 230 ? 6.489  -18.472 0.110   1.00 46.83  ? 475 LEU A CG  1 
ATOM   1439 C CD1 . LEU A 1 230 ? 7.389  -18.365 -1.106  1.00 44.05  ? 475 LEU A CD1 1 
ATOM   1440 C CD2 . LEU A 1 230 ? 5.028  -18.323 -0.295  1.00 52.76  ? 475 LEU A CD2 1 
ATOM   1441 N N   . VAL A 1 231 ? 9.631  -18.421 2.508   1.00 38.08  ? 476 VAL A N   1 
ATOM   1442 C CA  . VAL A 1 231 ? 10.125 -17.497 3.526   1.00 35.58  ? 476 VAL A CA  1 
ATOM   1443 C C   . VAL A 1 231 ? 10.994 -16.453 2.835   1.00 35.42  ? 476 VAL A C   1 
ATOM   1444 O O   . VAL A 1 231 ? 11.897 -16.805 2.068   1.00 37.61  ? 476 VAL A O   1 
ATOM   1445 C CB  . VAL A 1 231 ? 10.950 -18.228 4.611   1.00 37.96  ? 476 VAL A CB  1 
ATOM   1446 C CG1 . VAL A 1 231 ? 11.673 -17.231 5.499   1.00 38.44  ? 476 VAL A CG1 1 
ATOM   1447 C CG2 . VAL A 1 231 ? 10.059 -19.155 5.453   1.00 37.09  ? 476 VAL A CG2 1 
ATOM   1448 N N   . GLY A 1 232 ? 10.763 -15.188 3.136   1.00 36.87  ? 477 GLY A N   1 
ATOM   1449 C CA  . GLY A 1 232 ? 11.600 -14.127 2.619   1.00 35.45  ? 477 GLY A CA  1 
ATOM   1450 C C   . GLY A 1 232 ? 10.770 -12.883 2.389   1.00 36.48  ? 477 GLY A C   1 
ATOM   1451 O O   . GLY A 1 232 ? 9.617  -12.798 2.796   1.00 38.59  ? 477 GLY A O   1 
ATOM   1452 N N   . THR A 1 233 ? 11.386 -11.911 1.726   1.00 36.99  ? 478 THR A N   1 
ATOM   1453 C CA  . THR A 1 233 ? 10.695 -10.679 1.390   1.00 37.29  ? 478 THR A CA  1 
ATOM   1454 C C   . THR A 1 233 ? 10.534 -10.633 -0.117  1.00 37.72  ? 478 THR A C   1 
ATOM   1455 O O   . THR A 1 233 ? 11.538 -10.729 -0.840  1.00 36.57  ? 478 THR A O   1 
ATOM   1456 C CB  . THR A 1 233 ? 11.451 -9.453  1.894   1.00 38.40  ? 478 THR A CB  1 
ATOM   1457 O OG1 . THR A 1 233 ? 11.748 -9.617  3.287   1.00 36.45  ? 478 THR A OG1 1 
ATOM   1458 C CG2 . THR A 1 233 ? 10.599 -8.196  1.718   1.00 39.22  ? 478 THR A CG2 1 
ATOM   1459 N N   . PRO A 1 234 ? 9.295  -10.518 -0.615  1.00 38.25  ? 479 PRO A N   1 
ATOM   1460 C CA  . PRO A 1 234 ? 9.002  -10.776 -2.033  1.00 43.57  ? 479 PRO A CA  1 
ATOM   1461 C C   . PRO A 1 234 ? 10.024 -10.271 -3.044  1.00 42.40  ? 479 PRO A C   1 
ATOM   1462 O O   . PRO A 1 234 ? 10.521 -11.062 -3.852  1.00 39.51  ? 479 PRO A O   1 
ATOM   1463 C CB  . PRO A 1 234 ? 7.650  -10.080 -2.210  1.00 45.76  ? 479 PRO A CB  1 
ATOM   1464 C CG  . PRO A 1 234 ? 6.973  -10.329 -0.889  1.00 41.90  ? 479 PRO A CG  1 
ATOM   1465 C CD  . PRO A 1 234 ? 8.064  -10.261 0.155   1.00 40.95  ? 479 PRO A CD  1 
ATOM   1466 N N   . TYR A 1 235 ? 10.360 -8.977  -3.005  1.00 40.49  ? 480 TYR A N   1 
ATOM   1467 C CA  . TYR A 1 235 ? 11.254 -8.405  -4.013  1.00 37.54  ? 480 TYR A CA  1 
ATOM   1468 C C   . TYR A 1 235 ? 12.656 -8.991  -3.961  1.00 39.58  ? 480 TYR A C   1 
ATOM   1469 O O   . TYR A 1 235 ? 13.369 -8.915  -4.967  1.00 36.96  ? 480 TYR A O   1 
ATOM   1470 C CB  . TYR A 1 235 ? 11.318 -6.883  -3.861  1.00 36.38  ? 480 TYR A CB  1 
ATOM   1471 C CG  . TYR A 1 235 ? 9.936  -6.278  -3.853  1.00 40.11  ? 480 TYR A CG  1 
ATOM   1472 C CD1 . TYR A 1 235 ? 9.285  -5.979  -5.044  1.00 41.28  ? 480 TYR A CD1 1 
ATOM   1473 C CD2 . TYR A 1 235 ? 9.264  -6.054  -2.659  1.00 37.72  ? 480 TYR A CD2 1 
ATOM   1474 C CE1 . TYR A 1 235 ? 8.007  -5.452  -5.044  1.00 46.85  ? 480 TYR A CE1 1 
ATOM   1475 C CE2 . TYR A 1 235 ? 7.991  -5.525  -2.654  1.00 39.23  ? 480 TYR A CE2 1 
ATOM   1476 C CZ  . TYR A 1 235 ? 7.369  -5.225  -3.850  1.00 47.21  ? 480 TYR A CZ  1 
ATOM   1477 O OH  . TYR A 1 235 ? 6.096  -4.695  -3.862  1.00 49.94  ? 480 TYR A OH  1 
ATOM   1478 N N   . TRP A 1 236 ? 13.059 -9.584  -2.831  1.00 34.55  ? 481 TRP A N   1 
ATOM   1479 C CA  . TRP A 1 236 ? 14.401 -10.129 -2.672  1.00 38.65  ? 481 TRP A CA  1 
ATOM   1480 C C   . TRP A 1 236 ? 14.469 -11.646 -2.816  1.00 37.99  ? 481 TRP A C   1 
ATOM   1481 O O   . TRP A 1 236 ? 15.555 -12.205 -2.670  1.00 36.68  ? 481 TRP A O   1 
ATOM   1482 C CB  . TRP A 1 236 ? 14.989 -9.743  -1.304  1.00 33.33  ? 481 TRP A CB  1 
ATOM   1483 C CG  . TRP A 1 236 ? 15.322 -8.277  -1.148  1.00 36.78  ? 481 TRP A CG  1 
ATOM   1484 C CD1 . TRP A 1 236 ? 16.560 -7.695  -1.265  1.00 32.60  ? 481 TRP A CD1 1 
ATOM   1485 C CD2 . TRP A 1 236 ? 14.415 -7.221  -0.810  1.00 34.31  ? 481 TRP A CD2 1 
ATOM   1486 N NE1 . TRP A 1 236 ? 16.469 -6.340  -1.042  1.00 33.04  ? 481 TRP A NE1 1 
ATOM   1487 C CE2 . TRP A 1 236 ? 15.165 -6.024  -0.757  1.00 32.51  ? 481 TRP A CE2 1 
ATOM   1488 C CE3 . TRP A 1 236 ? 13.042 -7.168  -0.555  1.00 34.68  ? 481 TRP A CE3 1 
ATOM   1489 C CZ2 . TRP A 1 236 ? 14.584 -4.790  -0.459  1.00 34.41  ? 481 TRP A CZ2 1 
ATOM   1490 C CZ3 . TRP A 1 236 ? 12.470 -5.949  -0.261  1.00 37.80  ? 481 TRP A CZ3 1 
ATOM   1491 C CH2 . TRP A 1 236 ? 13.235 -4.775  -0.217  1.00 37.04  ? 481 TRP A CH2 1 
ATOM   1492 N N   . MET A 1 237 ? 13.354 -12.325 -3.093  1.00 37.01  ? 482 MET A N   1 
ATOM   1493 C CA  . MET A 1 237 ? 13.351 -13.788 -3.054  1.00 36.16  ? 482 MET A CA  1 
ATOM   1494 C C   . MET A 1 237 ? 14.004 -14.392 -4.291  1.00 39.03  ? 482 MET A C   1 
ATOM   1495 O O   . MET A 1 237 ? 13.826 -13.902 -5.410  1.00 39.66  ? 482 MET A O   1 
ATOM   1496 C CB  . MET A 1 237 ? 11.925 -14.318 -2.950  1.00 39.24  ? 482 MET A CB  1 
ATOM   1497 C CG  . MET A 1 237 ? 11.211 -14.000 -1.657  1.00 39.99  ? 482 MET A CG  1 
ATOM   1498 S SD  . MET A 1 237 ? 9.514  -14.638 -1.796  1.00 42.53  ? 482 MET A SD  1 
ATOM   1499 C CE  . MET A 1 237 ? 8.933  -14.250 -0.150  1.00 47.75  ? 482 MET A CE  1 
ATOM   1500 N N   . ALA A 1 238 ? 14.757 -15.474 -4.083  1.00 38.71  ? 483 ALA A N   1 
ATOM   1501 C CA  . ALA A 1 238 ? 15.359 -16.194 -5.197  1.00 38.94  ? 483 ALA A CA  1 
ATOM   1502 C C   . ALA A 1 238 ? 14.272 -16.824 -6.068  1.00 41.56  ? 483 ALA A C   1 
ATOM   1503 O O   . ALA A 1 238 ? 13.204 -17.190 -5.568  1.00 41.45  ? 483 ALA A O   1 
ATOM   1504 C CB  . ALA A 1 238 ? 16.298 -17.282 -4.678  1.00 37.43  ? 483 ALA A CB  1 
ATOM   1505 N N   . PRO A 1 239 ? 14.511 -16.961 -7.379  1.00 43.65  ? 484 PRO A N   1 
ATOM   1506 C CA  . PRO A 1 239 ? 13.465 -17.555 -8.230  1.00 43.18  ? 484 PRO A CA  1 
ATOM   1507 C C   . PRO A 1 239 ? 13.151 -19.004 -7.892  1.00 44.16  ? 484 PRO A C   1 
ATOM   1508 O O   . PRO A 1 239 ? 11.977 -19.386 -7.924  1.00 43.29  ? 484 PRO A O   1 
ATOM   1509 C CB  . PRO A 1 239 ? 14.035 -17.403 -9.651  1.00 46.78  ? 484 PRO A CB  1 
ATOM   1510 C CG  . PRO A 1 239 ? 15.502 -17.225 -9.464  1.00 48.07  ? 484 PRO A CG  1 
ATOM   1511 C CD  . PRO A 1 239 ? 15.645 -16.464 -8.176  1.00 42.57  ? 484 PRO A CD  1 
ATOM   1512 N N   . GLU A 1 240 ? 14.155 -19.825 -7.556  1.00 44.62  ? 485 GLU A N   1 
ATOM   1513 C CA  . GLU A 1 240 ? 13.855 -21.214 -7.217  1.00 44.23  ? 485 GLU A CA  1 
ATOM   1514 C C   . GLU A 1 240 ? 13.029 -21.305 -5.940  1.00 46.90  ? 485 GLU A C   1 
ATOM   1515 O O   . GLU A 1 240 ? 12.291 -22.276 -5.746  1.00 47.65  ? 485 GLU A O   1 
ATOM   1516 C CB  . GLU A 1 240 ? 15.142 -22.035 -7.080  1.00 44.34  ? 485 GLU A CB  1 
ATOM   1517 C CG  . GLU A 1 240 ? 15.992 -21.719 -5.849  1.00 44.53  ? 485 GLU A CG  1 
ATOM   1518 C CD  . GLU A 1 240 ? 17.035 -20.628 -6.091  1.00 46.17  ? 485 GLU A CD  1 
ATOM   1519 O OE1 . GLU A 1 240 ? 16.849 -19.803 -7.015  1.00 46.25  ? 485 GLU A OE1 1 
ATOM   1520 O OE2 . GLU A 1 240 ? 18.052 -20.603 -5.353  1.00 42.12  ? 485 GLU A OE2 1 
ATOM   1521 N N   . LEU A 1 241 ? 13.138 -20.305 -5.063  1.00 43.22  ? 486 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 241 ? 12.335 -20.296 -3.844  1.00 40.48  ? 486 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 241 ? 10.893 -19.911 -4.149  1.00 39.84  ? 486 LEU A C   1 
ATOM   1524 O O   . LEU A 1 241 ? 9.955  -20.527 -3.629  1.00 42.90  ? 486 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 241 ? 12.968 -19.339 -2.822  1.00 40.50  ? 486 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 241 ? 12.401 -19.216 -1.407  1.00 42.06  ? 486 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 241 ? 13.485 -18.714 -0.477  1.00 39.08  ? 486 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 241 ? 11.203 -18.272 -1.358  1.00 44.26  ? 486 LEU A CD2 1 
ATOM   1529 N N   . ILE A 1 242 ? 10.695 -18.894 -4.994  1.00 40.50  ? 487 ILE A N   1 
ATOM   1530 C CA  . ILE A 1 242 ? 9.347  -18.548 -5.451  1.00 41.27  ? 487 ILE A CA  1 
ATOM   1531 C C   . ILE A 1 242 ? 8.744  -19.692 -6.257  1.00 44.75  ? 487 ILE A C   1 
ATOM   1532 O O   . ILE A 1 242 ? 7.531  -19.935 -6.203  1.00 44.07  ? 487 ILE A O   1 
ATOM   1533 C CB  . ILE A 1 242 ? 9.378  -17.241 -6.272  1.00 42.66  ? 487 ILE A CB  1 
ATOM   1534 C CG1 . ILE A 1 242 ? 9.910  -16.082 -5.426  1.00 39.70  ? 487 ILE A CG1 1 
ATOM   1535 C CG2 . ILE A 1 242 ? 7.989  -16.909 -6.822  1.00 46.61  ? 487 ILE A CG2 1 
ATOM   1536 C CD1 . ILE A 1 242 ? 10.145 -14.821 -6.235  1.00 40.45  ? 487 ILE A CD1 1 
ATOM   1537 N N   . SER A 1 243 ? 9.570  -20.418 -7.010  1.00 43.64  ? 488 SER A N   1 
ATOM   1538 C CA  . SER A 1 243 ? 9.053  -21.558 -7.760  1.00 45.01  ? 488 SER A CA  1 
ATOM   1539 C C   . SER A 1 243 ? 8.691  -22.732 -6.867  1.00 46.84  ? 488 SER A C   1 
ATOM   1540 O O   . SER A 1 243 ? 8.193  -23.745 -7.376  1.00 46.77  ? 488 SER A O   1 
ATOM   1541 C CB  . SER A 1 243 ? 10.068 -22.011 -8.812  1.00 48.25  ? 488 SER A CB  1 
ATOM   1542 O OG  . SER A 1 243 ? 10.278 -20.994 -9.772  1.00 52.32  ? 488 SER A OG  1 
ATOM   1543 N N   . ARG A 1 244 ? 8.932  -22.625 -5.561  1.00 42.60  ? 489 ARG A N   1 
ATOM   1544 C CA  . ARG A 1 244 ? 8.632  -23.692 -4.600  1.00 42.56  ? 489 ARG A CA  1 
ATOM   1545 C C   . ARG A 1 244 ? 9.475  -24.942 -4.856  1.00 48.19  ? 489 ARG A C   1 
ATOM   1546 O O   . ARG A 1 244 ? 9.065  -26.062 -4.542  1.00 47.15  ? 489 ARG A O   1 
ATOM   1547 C CB  . ARG A 1 244 ? 7.137  -24.047 -4.578  1.00 44.05  ? 489 ARG A CB  1 
ATOM   1548 C CG  . ARG A 1 244 ? 6.164  -22.855 -4.534  1.00 44.26  ? 489 ARG A CG  1 
ATOM   1549 C CD  . ARG A 1 244 ? 6.548  -21.820 -3.477  1.00 42.49  ? 489 ARG A CD  1 
ATOM   1550 N NE  . ARG A 1 244 ? 7.024  -22.448 -2.245  1.00 48.97  ? 489 ARG A NE  1 
ATOM   1551 C CZ  . ARG A 1 244 ? 6.230  -22.902 -1.288  1.00 49.56  ? 489 ARG A CZ  1 
ATOM   1552 N NH1 . ARG A 1 244 ? 4.914  -22.797 -1.422  1.00 56.17  ? 489 ARG A NH1 1 
ATOM   1553 N NH2 . ARG A 1 244 ? 6.750  -23.463 -0.200  1.00 47.43  ? 489 ARG A NH2 1 
ATOM   1554 N N   . LEU A 1 245 ? 10.650 -24.764 -5.413  1.00 48.21  ? 490 LEU A N   1 
ATOM   1555 C CA  . LEU A 1 245 ? 11.593 -25.866 -5.527  1.00 51.02  ? 490 LEU A CA  1 
ATOM   1556 C C   . LEU A 1 245 ? 12.428 -25.968 -4.254  1.00 48.24  ? 490 LEU A C   1 
ATOM   1557 O O   . LEU A 1 245 ? 12.614 -24.970 -3.550  1.00 48.28  ? 490 LEU A O   1 
ATOM   1558 C CB  . LEU A 1 245 ? 12.513 -25.656 -6.728  1.00 48.85  ? 490 LEU A CB  1 
ATOM   1559 C CG  . LEU A 1 245 ? 11.798 -25.503 -8.075  1.00 52.04  ? 490 LEU A CG  1 
ATOM   1560 C CD1 . LEU A 1 245 ? 12.770 -25.133 -9.179  1.00 51.81  ? 490 LEU A CD1 1 
ATOM   1561 C CD2 . LEU A 1 245 ? 11.069 -26.780 -8.419  1.00 55.31  ? 490 LEU A CD2 1 
ATOM   1562 N N   . PRO A 1 246 ? 12.933 -27.158 -3.913  1.00 46.83  ? 491 PRO A N   1 
ATOM   1563 C CA  . PRO A 1 246 ? 13.839 -27.262 -2.761  1.00 42.62  ? 491 PRO A CA  1 
ATOM   1564 C C   . PRO A 1 246 ? 15.088 -26.426 -3.006  1.00 41.17  ? 491 PRO A C   1 
ATOM   1565 O O   . PRO A 1 246 ? 15.629 -26.401 -4.111  1.00 46.27  ? 491 PRO A O   1 
ATOM   1566 C CB  . PRO A 1 246 ? 14.161 -28.759 -2.691  1.00 41.67  ? 491 PRO A CB  1 
ATOM   1567 C CG  . PRO A 1 246 ? 13.058 -29.428 -3.456  1.00 46.77  ? 491 PRO A CG  1 
ATOM   1568 C CD  . PRO A 1 246 ? 12.706 -28.461 -4.555  1.00 44.68  ? 491 PRO A CD  1 
ATOM   1569 N N   . TYR A 1 247 ? 15.530 -25.710 -1.975  1.00 39.37  ? 492 TYR A N   1 
ATOM   1570 C CA  . TYR A 1 247 ? 16.600 -24.737 -2.151  1.00 39.22  ? 492 TYR A CA  1 
ATOM   1571 C C   . TYR A 1 247 ? 17.605 -24.844 -1.014  1.00 39.88  ? 492 TYR A C   1 
ATOM   1572 O O   . TYR A 1 247 ? 17.351 -25.464 0.020   1.00 39.90  ? 492 TYR A O   1 
ATOM   1573 C CB  . TYR A 1 247 ? 16.045 -23.309 -2.244  1.00 38.89  ? 492 TYR A CB  1 
ATOM   1574 C CG  . TYR A 1 247 ? 15.237 -22.870 -1.032  1.00 38.60  ? 492 TYR A CG  1 
ATOM   1575 C CD1 . TYR A 1 247 ? 13.853 -23.010 -1.008  1.00 39.85  ? 492 TYR A CD1 1 
ATOM   1576 C CD2 . TYR A 1 247 ? 15.856 -22.302 0.074   1.00 36.57  ? 492 TYR A CD2 1 
ATOM   1577 C CE1 . TYR A 1 247 ? 13.099 -22.609 0.104   1.00 39.61  ? 492 TYR A CE1 1 
ATOM   1578 C CE2 . TYR A 1 247 ? 15.125 -21.893 1.186   1.00 38.09  ? 492 TYR A CE2 1 
ATOM   1579 C CZ  . TYR A 1 247 ? 13.749 -22.050 1.198   1.00 38.72  ? 492 TYR A CZ  1 
ATOM   1580 O OH  . TYR A 1 247 ? 13.038 -21.643 2.302   1.00 37.85  ? 492 TYR A OH  1 
ATOM   1581 N N   . GLY A 1 248 ? 18.756 -24.213 -1.214  1.00 38.63  ? 493 GLY A N   1 
ATOM   1582 C CA  . GLY A 1 248 ? 19.797 -24.220 -0.217  1.00 36.56  ? 493 GLY A CA  1 
ATOM   1583 C C   . GLY A 1 248 ? 20.369 -22.837 0.018   1.00 35.51  ? 493 GLY A C   1 
ATOM   1584 O O   . GLY A 1 248 ? 19.731 -21.813 -0.256  1.00 38.63  ? 493 GLY A O   1 
ATOM   1585 N N   . PRO A 1 249 ? 21.601 -22.787 0.532   1.00 36.02  ? 494 PRO A N   1 
ATOM   1586 C CA  . PRO A 1 249 ? 22.235 -21.485 0.831   1.00 37.24  ? 494 PRO A CA  1 
ATOM   1587 C C   . PRO A 1 249 ? 22.302 -20.554 -0.363  1.00 38.04  ? 494 PRO A C   1 
ATOM   1588 O O   . PRO A 1 249 ? 22.494 -19.343 -0.176  1.00 36.34  ? 494 PRO A O   1 
ATOM   1589 C CB  . PRO A 1 249 ? 23.643 -21.873 1.305   1.00 37.83  ? 494 PRO A CB  1 
ATOM   1590 C CG  . PRO A 1 249 ? 23.549 -23.323 1.684   1.00 41.35  ? 494 PRO A CG  1 
ATOM   1591 C CD  . PRO A 1 249 ? 22.497 -23.924 0.788   1.00 36.77  ? 494 PRO A CD  1 
ATOM   1592 N N   . GLU A 1 250 ? 22.129 -21.074 -1.579  1.00 37.03  ? 495 GLU A N   1 
ATOM   1593 C CA  . GLU A 1 250 ? 22.188 -20.245 -2.782  1.00 38.11  ? 495 GLU A CA  1 
ATOM   1594 C C   . GLU A 1 250 ? 21.165 -19.110 -2.773  1.00 37.61  ? 495 GLU A C   1 
ATOM   1595 O O   . GLU A 1 250 ? 21.380 -18.089 -3.438  1.00 37.61  ? 495 GLU A O   1 
ATOM   1596 C CB  . GLU A 1 250 ? 21.980 -21.128 -4.021  1.00 41.20  ? 495 GLU A CB  1 
ATOM   1597 C CG  . GLU A 1 250 ? 22.956 -22.306 -4.158  1.00 42.46  ? 495 GLU A CG  1 
ATOM   1598 C CD  . GLU A 1 250 ? 22.484 -23.582 -3.461  1.00 47.19  ? 495 GLU A CD  1 
ATOM   1599 O OE1 . GLU A 1 250 ? 21.395 -23.580 -2.858  1.00 45.85  ? 495 GLU A OE1 1 
ATOM   1600 O OE2 . GLU A 1 250 ? 23.216 -24.589 -3.520  1.00 53.47  ? 495 GLU A OE2 1 
ATOM   1601 N N   . VAL A 1 251 ? 20.051 -19.254 -2.047  1.00 36.76  ? 496 VAL A N   1 
ATOM   1602 C CA  . VAL A 1 251 ? 19.044 -18.194 -2.091  1.00 35.04  ? 496 VAL A CA  1 
ATOM   1603 C C   . VAL A 1 251 ? 19.548 -16.920 -1.418  1.00 35.88  ? 496 VAL A C   1 
ATOM   1604 O O   . VAL A 1 251 ? 19.123 -15.822 -1.784  1.00 36.14  ? 496 VAL A O   1 
ATOM   1605 C CB  . VAL A 1 251 ? 17.711 -18.650 -1.474  1.00 35.54  ? 496 VAL A CB  1 
ATOM   1606 C CG1 . VAL A 1 251 ? 17.164 -19.869 -2.219  1.00 36.07  ? 496 VAL A CG1 1 
ATOM   1607 C CG2 . VAL A 1 251 ? 17.873 -18.930 0.019   1.00 33.72  ? 496 VAL A CG2 1 
ATOM   1608 N N   . ASP A 1 252 ? 20.446 -17.029 -0.431  1.00 34.83  ? 497 ASP A N   1 
ATOM   1609 C CA  . ASP A 1 252 ? 21.002 -15.811 0.155   1.00 32.61  ? 497 ASP A CA  1 
ATOM   1610 C C   . ASP A 1 252 ? 21.860 -15.062 -0.854  1.00 32.02  ? 497 ASP A C   1 
ATOM   1611 O O   . ASP A 1 252 ? 21.949 -13.830 -0.799  1.00 32.66  ? 497 ASP A O   1 
ATOM   1612 C CB  . ASP A 1 252 ? 21.841 -16.121 1.397   1.00 30.06  ? 497 ASP A CB  1 
ATOM   1613 C CG  . ASP A 1 252 ? 21.001 -16.602 2.586   1.00 33.06  ? 497 ASP A CG  1 
ATOM   1614 O OD1 . ASP A 1 252 ? 19.802 -16.264 2.668   1.00 32.32  ? 497 ASP A OD1 1 
ATOM   1615 O OD2 . ASP A 1 252 ? 21.569 -17.312 3.453   1.00 33.47  ? 497 ASP A OD2 1 
ATOM   1616 N N   . ILE A 1 253 ? 22.519 -15.787 -1.761  1.00 32.92  ? 498 ILE A N   1 
ATOM   1617 C CA  . ILE A 1 253 ? 23.382 -15.132 -2.739  1.00 31.02  ? 498 ILE A CA  1 
ATOM   1618 C C   . ILE A 1 253 ? 22.546 -14.336 -3.733  1.00 32.26  ? 498 ILE A C   1 
ATOM   1619 O O   . ILE A 1 253 ? 22.917 -13.226 -4.133  1.00 34.52  ? 498 ILE A O   1 
ATOM   1620 C CB  . ILE A 1 253 ? 24.268 -16.167 -3.458  1.00 34.98  ? 498 ILE A CB  1 
ATOM   1621 C CG1 . ILE A 1 253 ? 25.085 -16.996 -2.455  1.00 39.10  ? 498 ILE A CG1 1 
ATOM   1622 C CG2 . ILE A 1 253 ? 25.153 -15.467 -4.479  1.00 38.76  ? 498 ILE A CG2 1 
ATOM   1623 C CD1 . ILE A 1 253 ? 25.965 -16.163 -1.521  1.00 36.48  ? 498 ILE A CD1 1 
ATOM   1624 N N   . TRP A 1 254 ? 21.422 -14.902 -4.173  1.00 36.90  ? 499 TRP A N   1 
ATOM   1625 C CA  . TRP A 1 254 ? 20.513 -14.146 -5.028  1.00 38.01  ? 499 TRP A CA  1 
ATOM   1626 C C   . TRP A 1 254 ? 20.031 -12.885 -4.318  1.00 34.94  ? 499 TRP A C   1 
ATOM   1627 O O   . TRP A 1 254 ? 20.071 -11.785 -4.881  1.00 33.11  ? 499 TRP A O   1 
ATOM   1628 C CB  . TRP A 1 254 ? 19.321 -15.017 -5.448  1.00 35.58  ? 499 TRP A CB  1 
ATOM   1629 C CG  . TRP A 1 254 ? 18.308 -14.232 -6.250  1.00 38.30  ? 499 TRP A CG  1 
ATOM   1630 C CD1 . TRP A 1 254 ? 17.338 -13.389 -5.756  1.00 35.31  ? 499 TRP A CD1 1 
ATOM   1631 C CD2 . TRP A 1 254 ? 18.179 -14.193 -7.680  1.00 40.43  ? 499 TRP A CD2 1 
ATOM   1632 N NE1 . TRP A 1 254 ? 16.614 -12.847 -6.794  1.00 37.55  ? 499 TRP A NE1 1 
ATOM   1633 C CE2 . TRP A 1 254 ? 17.109 -13.320 -7.983  1.00 37.17  ? 499 TRP A CE2 1 
ATOM   1634 C CE3 . TRP A 1 254 ? 18.857 -14.815 -8.732  1.00 39.01  ? 499 TRP A CE3 1 
ATOM   1635 C CZ2 . TRP A 1 254 ? 16.707 -13.055 -9.293  1.00 38.06  ? 499 TRP A CZ2 1 
ATOM   1636 C CZ3 . TRP A 1 254 ? 18.451 -14.556 -10.029 1.00 42.45  ? 499 TRP A CZ3 1 
ATOM   1637 C CH2 . TRP A 1 254 ? 17.384 -13.683 -10.298 1.00 44.58  ? 499 TRP A CH2 1 
ATOM   1638 N N   . SER A 1 255 ? 19.562 -13.037 -3.075  1.00 33.17  ? 500 SER A N   1 
ATOM   1639 C CA  . SER A 1 255 ? 19.064 -11.899 -2.313  1.00 34.52  ? 500 SER A CA  1 
ATOM   1640 C C   . SER A 1 255 ? 20.139 -10.837 -2.143  1.00 30.59  ? 500 SER A C   1 
ATOM   1641 O O   . SER A 1 255 ? 19.839 -9.640  -2.124  1.00 31.91  ? 500 SER A O   1 
ATOM   1642 C CB  . SER A 1 255 ? 18.557 -12.373 -0.953  1.00 33.48  ? 500 SER A CB  1 
ATOM   1643 O OG  . SER A 1 255 ? 17.441 -13.253 -1.094  1.00 33.50  ? 500 SER A OG  1 
ATOM   1644 N N   . LEU A 1 256 ? 21.391 -11.259 -1.969  1.00 31.08  ? 501 LEU A N   1 
ATOM   1645 C CA  . LEU A 1 256 ? 22.487 -10.299 -1.912  1.00 33.60  ? 501 LEU A CA  1 
ATOM   1646 C C   . LEU A 1 256 ? 22.593 -9.512  -3.211  1.00 31.94  ? 501 LEU A C   1 
ATOM   1647 O O   . LEU A 1 256 ? 22.816 -8.295  -3.195  1.00 34.19  ? 501 LEU A O   1 
ATOM   1648 C CB  . LEU A 1 256 ? 23.793 -11.029 -1.622  1.00 30.32  ? 501 LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 256 ? 25.047 -10.169 -1.706  1.00 34.09  ? 501 LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 256 ? 24.982 -9.034  -0.685  1.00 32.68  ? 501 LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 256 ? 26.258 -11.046 -1.472  1.00 34.50  ? 501 LEU A CD2 1 
ATOM   1652 N N   . GLY A 1 257 ? 22.435 -10.192 -4.346  1.00 35.06  ? 502 GLY A N   1 
ATOM   1653 C CA  . GLY A 1 257 ? 22.418 -9.494  -5.616  1.00 31.87  ? 502 GLY A CA  1 
ATOM   1654 C C   . GLY A 1 257 ? 21.339 -8.431  -5.673  1.00 35.10  ? 502 GLY A C   1 
ATOM   1655 O O   . GLY A 1 257 ? 21.584 -7.313  -6.134  1.00 35.01  ? 502 GLY A O   1 
ATOM   1656 N N   . ILE A 1 258 ? 20.130 -8.763  -5.206  1.00 34.20  ? 503 ILE A N   1 
ATOM   1657 C CA  . ILE A 1 258 ? 19.056 -7.773  -5.164  1.00 33.44  ? 503 ILE A CA  1 
ATOM   1658 C C   . ILE A 1 258 ? 19.452 -6.605  -4.276  1.00 32.60  ? 503 ILE A C   1 
ATOM   1659 O O   . ILE A 1 258 ? 19.156 -5.443  -4.586  1.00 33.68  ? 503 ILE A O   1 
ATOM   1660 C CB  . ILE A 1 258 ? 17.733 -8.409  -4.690  1.00 35.81  ? 503 ILE A CB  1 
ATOM   1661 C CG1 . ILE A 1 258 ? 17.286 -9.540  -5.623  1.00 33.95  ? 503 ILE A CG1 1 
ATOM   1662 C CG2 . ILE A 1 258 ? 16.634 -7.337  -4.602  1.00 34.17  ? 503 ILE A CG2 1 
ATOM   1663 C CD1 . ILE A 1 258 ? 17.031 -9.085  -7.064  1.00 36.57  ? 503 ILE A CD1 1 
ATOM   1664 N N   . MET A 1 259 ? 20.128 -6.892  -3.156  1.00 31.05  ? 504 MET A N   1 
ATOM   1665 C CA  . MET A 1 259 ? 20.629 -5.806  -2.315  1.00 32.31  ? 504 MET A CA  1 
ATOM   1666 C C   . MET A 1 259 ? 21.688 -4.972  -3.027  1.00 34.52  ? 504 MET A C   1 
ATOM   1667 O O   . MET A 1 259 ? 21.789 -3.765  -2.784  1.00 33.59  ? 504 MET A O   1 
ATOM   1668 C CB  . MET A 1 259 ? 21.197 -6.355  -1.001  1.00 32.13  ? 504 MET A CB  1 
ATOM   1669 C CG  . MET A 1 259 ? 21.315 -5.282  0.091   1.00 33.95  ? 504 MET A CG  1 
ATOM   1670 S SD  . MET A 1 259 ? 21.892 -5.950  1.677   1.00 34.42  ? 504 MET A SD  1 
ATOM   1671 C CE  . MET A 1 259 ? 23.624 -6.238  1.292   1.00 34.46  ? 504 MET A CE  1 
ATOM   1672 N N   . VAL A 1 260 ? 22.499 -5.581  -3.889  1.00 33.45  ? 505 VAL A N   1 
ATOM   1673 C CA  . VAL A 1 260 ? 23.420 -4.769  -4.673  1.00 32.40  ? 505 VAL A CA  1 
ATOM   1674 C C   . VAL A 1 260 ? 22.632 -3.803  -5.554  1.00 34.53  ? 505 VAL A C   1 
ATOM   1675 O O   . VAL A 1 260 ? 22.993 -2.630  -5.681  1.00 37.89  ? 505 VAL A O   1 
ATOM   1676 C CB  . VAL A 1 260 ? 24.379 -5.654  -5.495  1.00 36.25  ? 505 VAL A CB  1 
ATOM   1677 C CG1 . VAL A 1 260 ? 25.245 -4.789  -6.424  1.00 38.57  ? 505 VAL A CG1 1 
ATOM   1678 C CG2 . VAL A 1 260 ? 25.281 -6.472  -4.570  1.00 33.95  ? 505 VAL A CG2 1 
ATOM   1679 N N   . ILE A 1 261 ? 21.514 -4.264  -6.127  1.00 35.51  ? 506 ILE A N   1 
ATOM   1680 C CA  . ILE A 1 261 ? 20.673 -3.369  -6.926  1.00 37.18  ? 506 ILE A CA  1 
ATOM   1681 C C   . ILE A 1 261 ? 20.102 -2.260  -6.052  1.00 38.26  ? 506 ILE A C   1 
ATOM   1682 O O   . ILE A 1 261 ? 20.014 -1.103  -6.476  1.00 37.30  ? 506 ILE A O   1 
ATOM   1683 C CB  . ILE A 1 261 ? 19.569 -4.162  -7.650  1.00 38.68  ? 506 ILE A CB  1 
ATOM   1684 C CG1 . ILE A 1 261 ? 20.203 -5.056  -8.719  1.00 40.41  ? 506 ILE A CG1 1 
ATOM   1685 C CG2 . ILE A 1 261 ? 18.530 -3.214  -8.281  1.00 39.67  ? 506 ILE A CG2 1 
ATOM   1686 C CD1 . ILE A 1 261 ? 19.241 -5.945  -9.443  1.00 40.61  ? 506 ILE A CD1 1 
ATOM   1687 N N   . GLU A 1 262 ? 19.734 -2.584  -4.809  1.00 36.50  ? 507 GLU A N   1 
ATOM   1688 C CA  . GLU A 1 262 ? 19.341 -1.540  -3.865  1.00 34.04  ? 507 GLU A CA  1 
ATOM   1689 C C   . GLU A 1 262 ? 20.427 -0.482  -3.732  1.00 36.84  ? 507 GLU A C   1 
ATOM   1690 O O   . GLU A 1 262 ? 20.150 0.723   -3.749  1.00 37.33  ? 507 GLU A O   1 
ATOM   1691 C CB  . GLU A 1 262 ? 19.085 -2.143  -2.489  1.00 33.87  ? 507 GLU A CB  1 
ATOM   1692 C CG  . GLU A 1 262 ? 17.758 -2.823  -2.256  1.00 35.53  ? 507 GLU A CG  1 
ATOM   1693 C CD  . GLU A 1 262 ? 17.603 -3.094  -0.772  1.00 36.34  ? 507 GLU A CD  1 
ATOM   1694 O OE1 . GLU A 1 262 ? 18.040 -4.172  -0.302  1.00 33.24  ? 507 GLU A OE1 1 
ATOM   1695 O OE2 . GLU A 1 262 ? 17.094 -2.199  -0.073  1.00 34.17  ? 507 GLU A OE2 1 
ATOM   1696 N N   . MET A 1 263 ? 21.673 -0.923  -3.561  1.00 35.07  ? 508 MET A N   1 
ATOM   1697 C CA  . MET A 1 263 ? 22.752 0.022   -3.293  1.00 35.76  ? 508 MET A CA  1 
ATOM   1698 C C   . MET A 1 263 ? 23.060 0.900   -4.493  1.00 39.67  ? 508 MET A C   1 
ATOM   1699 O O   . MET A 1 263 ? 23.542 2.024   -4.308  1.00 40.63  ? 508 MET A O   1 
ATOM   1700 C CB  . MET A 1 263 ? 24.006 -0.719  -2.841  1.00 36.00  ? 508 MET A CB  1 
ATOM   1701 C CG  . MET A 1 263 ? 23.871 -1.297  -1.447  1.00 35.55  ? 508 MET A CG  1 
ATOM   1702 S SD  . MET A 1 263 ? 25.367 -2.034  -0.784  1.00 35.68  ? 508 MET A SD  1 
ATOM   1703 C CE  . MET A 1 263 ? 25.345 -3.638  -1.588  1.00 33.97  ? 508 MET A CE  1 
ATOM   1704 N N   . VAL A 1 264 ? 22.777 0.427   -5.705  1.00 38.76  ? 509 VAL A N   1 
ATOM   1705 C CA  . VAL A 1 264 ? 23.007 1.224   -6.909  1.00 39.76  ? 509 VAL A CA  1 
ATOM   1706 C C   . VAL A 1 264 ? 21.773 2.038   -7.291  1.00 43.12  ? 509 VAL A C   1 
ATOM   1707 O O   . VAL A 1 264 ? 21.886 3.212   -7.646  1.00 45.51  ? 509 VAL A O   1 
ATOM   1708 C CB  . VAL A 1 264 ? 23.454 0.312   -8.073  1.00 39.49  ? 509 VAL A CB  1 
ATOM   1709 C CG1 . VAL A 1 264 ? 23.639 1.139   -9.363  1.00 41.82  ? 509 VAL A CG1 1 
ATOM   1710 C CG2 . VAL A 1 264 ? 24.726 -0.432  -7.726  1.00 36.09  ? 509 VAL A CG2 1 
ATOM   1711 N N   . ASP A 1 265 ? 20.581 1.434   -7.245  1.00 42.80  ? 510 ASP A N   1 
ATOM   1712 C CA  . ASP A 1 265 ? 19.360 2.069   -7.731  1.00 43.99  ? 510 ASP A CA  1 
ATOM   1713 C C   . ASP A 1 265 ? 18.510 2.681   -6.628  1.00 44.74  ? 510 ASP A C   1 
ATOM   1714 O O   . ASP A 1 265 ? 17.609 3.466   -6.938  1.00 41.05  ? 510 ASP A O   1 
ATOM   1715 C CB  . ASP A 1 265 ? 18.489 1.058   -8.491  1.00 46.94  ? 510 ASP A CB  1 
ATOM   1716 C CG  . ASP A 1 265 ? 19.087 0.635   -9.823  1.00 52.96  ? 510 ASP A CG  1 
ATOM   1717 O OD1 . ASP A 1 265 ? 20.091 1.238   -10.255 1.00 57.94  ? 510 ASP A OD1 1 
ATOM   1718 O OD2 . ASP A 1 265 ? 18.541 -0.308  -10.443 1.00 48.54  ? 510 ASP A OD2 1 
ATOM   1719 N N   . GLY A 1 266 ? 18.747 2.322   -5.364  1.00 41.09  ? 511 GLY A N   1 
ATOM   1720 C CA  . GLY A 1 266 ? 17.945 2.813   -4.263  1.00 42.81  ? 511 GLY A CA  1 
ATOM   1721 C C   . GLY A 1 266 ? 16.758 1.940   -3.895  1.00 44.62  ? 511 GLY A C   1 
ATOM   1722 O O   . GLY A 1 266 ? 16.180 2.125   -2.817  1.00 40.88  ? 511 GLY A O   1 
ATOM   1723 N N   . GLU A 1 267 ? 16.372 1.001   -4.752  1.00 39.82  ? 512 GLU A N   1 
ATOM   1724 C CA  . GLU A 1 267 ? 15.217 0.153   -4.496  1.00 39.89  ? 512 GLU A CA  1 
ATOM   1725 C C   . GLU A 1 267 ? 15.411 -1.153  -5.249  1.00 42.25  ? 512 GLU A C   1 
ATOM   1726 O O   . GLU A 1 267 ? 16.162 -1.192  -6.234  1.00 40.58  ? 512 GLU A O   1 
ATOM   1727 C CB  . GLU A 1 267 ? 13.911 0.840   -4.930  1.00 42.85  ? 512 GLU A CB  1 
ATOM   1728 C CG  . GLU A 1 267 ? 13.820 1.142   -6.412  1.00 54.02  ? 512 GLU A CG  1 
ATOM   1729 C CD  . GLU A 1 267 ? 12.554 1.906   -6.769  1.00 60.52  ? 512 GLU A CD  1 
ATOM   1730 O OE1 . GLU A 1 267 ? 12.139 2.781   -5.979  1.00 57.74  ? 512 GLU A OE1 1 
ATOM   1731 O OE2 . GLU A 1 267 ? 11.969 1.622   -7.834  1.00 63.58  ? 512 GLU A OE2 1 
ATOM   1732 N N   . PRO A 1 268 ? 14.778 -2.235  -4.806  1.00 41.99  ? 513 PRO A N   1 
ATOM   1733 C CA  . PRO A 1 268 ? 14.904 -3.502  -5.521  1.00 37.61  ? 513 PRO A CA  1 
ATOM   1734 C C   . PRO A 1 268 ? 14.106 -3.457  -6.811  1.00 38.32  ? 513 PRO A C   1 
ATOM   1735 O O   . PRO A 1 268 ? 13.283 -2.553  -7.002  1.00 40.74  ? 513 PRO A O   1 
ATOM   1736 C CB  . PRO A 1 268 ? 14.327 -4.520  -4.526  1.00 37.84  ? 513 PRO A CB  1 
ATOM   1737 C CG  . PRO A 1 268 ? 13.313 -3.743  -3.769  1.00 38.75  ? 513 PRO A CG  1 
ATOM   1738 C CD  . PRO A 1 268 ? 13.892 -2.353  -3.632  1.00 40.11  ? 513 PRO A CD  1 
ATOM   1739 N N   . PRO A 1 269 ? 14.326 -4.398  -7.729  1.00 40.16  ? 514 PRO A N   1 
ATOM   1740 C CA  . PRO A 1 269 ? 13.539 -4.410  -8.967  1.00 43.05  ? 514 PRO A CA  1 
ATOM   1741 C C   . PRO A 1 269 ? 12.056 -4.581  -8.674  1.00 45.21  ? 514 PRO A C   1 
ATOM   1742 O O   . PRO A 1 269 ? 11.665 -5.162  -7.658  1.00 44.16  ? 514 PRO A O   1 
ATOM   1743 C CB  . PRO A 1 269 ? 14.093 -5.618  -9.731  1.00 44.13  ? 514 PRO A CB  1 
ATOM   1744 C CG  . PRO A 1 269 ? 15.418 -5.922  -9.092  1.00 42.76  ? 514 PRO A CG  1 
ATOM   1745 C CD  . PRO A 1 269 ? 15.295 -5.506  -7.670  1.00 42.98  ? 514 PRO A CD  1 
ATOM   1746 N N   . TYR A 1 270 ? 11.228 -4.058  -9.578  1.00 42.90  ? 515 TYR A N   1 
ATOM   1747 C CA  . TYR A 1 270 ? 9.772  -4.233  -9.553  1.00 46.22  ? 515 TYR A CA  1 
ATOM   1748 C C   . TYR A 1 270 ? 9.141  -3.673  -8.288  1.00 47.49  ? 515 TYR A C   1 
ATOM   1749 O O   . TYR A 1 270 ? 8.024  -4.062  -7.926  1.00 47.60  ? 515 TYR A O   1 
ATOM   1750 C CB  . TYR A 1 270 ? 9.382  -5.708  -9.703  1.00 47.04  ? 515 TYR A CB  1 
ATOM   1751 C CG  . TYR A 1 270 ? 10.114 -6.431  -10.806 1.00 49.60  ? 515 TYR A CG  1 
ATOM   1752 C CD1 . TYR A 1 270 ? 10.179 -5.902  -12.089 1.00 54.02  ? 515 TYR A CD1 1 
ATOM   1753 C CD2 . TYR A 1 270 ? 10.749 -7.641  -10.562 1.00 49.67  ? 515 TYR A CD2 1 
ATOM   1754 C CE1 . TYR A 1 270 ? 10.850 -6.565  -13.099 1.00 56.24  ? 515 TYR A CE1 1 
ATOM   1755 C CE2 . TYR A 1 270 ? 11.425 -8.313  -11.565 1.00 49.39  ? 515 TYR A CE2 1 
ATOM   1756 C CZ  . TYR A 1 270 ? 11.474 -7.769  -12.831 1.00 56.06  ? 515 TYR A CZ  1 
ATOM   1757 O OH  . TYR A 1 270 ? 12.147 -8.436  -13.830 1.00 60.14  ? 515 TYR A OH  1 
ATOM   1758 N N   . PHE A 1 271 ? 9.853  -2.781  -7.596  1.00 46.11  ? 516 PHE A N   1 
ATOM   1759 C CA  . PHE A 1 271 ? 9.358  -2.235  -6.339  1.00 46.81  ? 516 PHE A CA  1 
ATOM   1760 C C   . PHE A 1 271 ? 8.082  -1.430  -6.534  1.00 51.19  ? 516 PHE A C   1 
ATOM   1761 O O   . PHE A 1 271 ? 7.315  -1.260  -5.580  1.00 50.71  ? 516 PHE A O   1 
ATOM   1762 C CB  . PHE A 1 271 ? 10.449 -1.380  -5.691  1.00 44.77  ? 516 PHE A CB  1 
ATOM   1763 C CG  . PHE A 1 271 ? 10.299 -1.220  -4.206  1.00 45.41  ? 516 PHE A CG  1 
ATOM   1764 C CD1 . PHE A 1 271 ? 10.211 -2.330  -3.381  1.00 44.92  ? 516 PHE A CD1 1 
ATOM   1765 C CD2 . PHE A 1 271 ? 10.267 0.041   -3.631  1.00 46.91  ? 516 PHE A CD2 1 
ATOM   1766 C CE1 . PHE A 1 271 ? 10.080 -2.186  -2.011  1.00 44.35  ? 516 PHE A CE1 1 
ATOM   1767 C CE2 . PHE A 1 271 ? 10.140 0.191   -2.263  1.00 46.51  ? 516 PHE A CE2 1 
ATOM   1768 C CZ  . PHE A 1 271 ? 10.047 -0.927  -1.452  1.00 47.63  ? 516 PHE A CZ  1 
ATOM   1769 N N   . ASN A 1 272 ? 7.839  -0.934  -7.750  1.00 51.74  ? 517 ASN A N   1 
ATOM   1770 C CA  A ASN A 1 272 ? 6.606  -0.222  -8.061  0.49 54.41  ? 517 ASN A CA  1 
ATOM   1771 C CA  B ASN A 1 272 ? 6.602  -0.220  -8.031  0.51 54.31  ? 517 ASN A CA  1 
ATOM   1772 C C   . ASN A 1 272 ? 5.405  -1.152  -8.167  1.00 59.27  ? 517 ASN A C   1 
ATOM   1773 O O   . ASN A 1 272 ? 4.265  -0.679  -8.135  1.00 63.93  ? 517 ASN A O   1 
ATOM   1774 C CB  A ASN A 1 272 ? 6.769  0.539   -9.375  0.49 57.43  ? 517 ASN A CB  1 
ATOM   1775 C CB  B ASN A 1 272 ? 6.752  0.612   -9.310  0.51 57.36  ? 517 ASN A CB  1 
ATOM   1776 C CG  A ASN A 1 272 ? 7.036  -0.388  -10.550 0.49 57.97  ? 517 ASN A CG  1 
ATOM   1777 C CG  B ASN A 1 272 ? 7.966  1.522   -9.281  0.51 57.39  ? 517 ASN A CG  1 
ATOM   1778 O OD1 A ASN A 1 272 ? 8.176  -0.789  -10.792 0.49 61.33  ? 517 ASN A OD1 1 
ATOM   1779 O OD1 B ASN A 1 272 ? 8.342  2.049   -8.232  0.51 56.21  ? 517 ASN A OD1 1 
ATOM   1780 N ND2 A ASN A 1 272 ? 5.981  -0.746  -11.275 0.49 57.54  ? 517 ASN A ND2 1 
ATOM   1781 N ND2 B ASN A 1 272 ? 8.588  1.712   -10.440 0.51 60.32  ? 517 ASN A ND2 1 
ATOM   1782 N N   . GLU A 1 273 ? 5.636  -2.477  -8.310  1.00 56.12  ? 518 GLU A N   1 
ATOM   1783 C CA  . GLU A 1 273 ? 4.615  -3.495  -8.501  1.00 55.42  ? 518 GLU A CA  1 
ATOM   1784 C C   . GLU A 1 273 ? 4.180  -4.094  -7.168  1.00 56.37  ? 518 GLU A C   1 
ATOM   1785 O O   . GLU A 1 273 ? 4.949  -4.098  -6.202  1.00 55.55  ? 518 GLU A O   1 
ATOM   1786 C CB  . GLU A 1 273 ? 5.141  -4.607  -9.404  1.00 52.87  ? 518 GLU A CB  1 
ATOM   1787 C CG  . GLU A 1 273 ? 5.594  -4.146  -10.773 1.00 57.54  ? 518 GLU A CG  1 
ATOM   1788 C CD  . GLU A 1 273 ? 4.438  -3.732  -11.674 1.00 68.96  ? 518 GLU A CD  1 
ATOM   1789 O OE1 . GLU A 1 273 ? 3.271  -3.748  -11.223 1.00 70.86  ? 518 GLU A OE1 1 
ATOM   1790 O OE2 . GLU A 1 273 ? 4.703  -3.393  -12.846 1.00 76.40  ? 518 GLU A OE2 1 
ATOM   1791 N N   . PRO A 1 274 ? 2.949  -4.597  -7.089  1.00 59.55  ? 519 PRO A N   1 
ATOM   1792 C CA  . PRO A 1 274 ? 2.534  -5.307  -5.881  1.00 55.41  ? 519 PRO A CA  1 
ATOM   1793 C C   . PRO A 1 274 ? 3.429  -6.496  -5.632  1.00 55.90  ? 519 PRO A C   1 
ATOM   1794 O O   . PRO A 1 274 ? 3.960  -7.110  -6.581  1.00 53.15  ? 519 PRO A O   1 
ATOM   1795 C CB  . PRO A 1 274 ? 1.095  -5.737  -6.207  1.00 53.66  ? 519 PRO A CB  1 
ATOM   1796 C CG  . PRO A 1 274 ? 0.634  -4.751  -7.238  1.00 60.79  ? 519 PRO A CG  1 
ATOM   1797 C CD  . PRO A 1 274 ? 1.848  -4.451  -8.059  1.00 59.82  ? 519 PRO A CD  1 
ATOM   1798 N N   . PRO A 1 275 ? 3.633  -6.877  -4.362  1.00 57.57  ? 520 PRO A N   1 
ATOM   1799 C CA  . PRO A 1 275 ? 4.613  -7.938  -4.058  1.00 56.15  ? 520 PRO A CA  1 
ATOM   1800 C C   . PRO A 1 275 ? 4.351  -9.255  -4.771  1.00 51.90  ? 520 PRO A C   1 
ATOM   1801 O O   . PRO A 1 275 ? 5.304  -9.890  -5.241  1.00 51.03  ? 520 PRO A O   1 
ATOM   1802 C CB  . PRO A 1 275 ? 4.500  -8.084  -2.534  1.00 55.18  ? 520 PRO A CB  1 
ATOM   1803 C CG  . PRO A 1 275 ? 4.010  -6.760  -2.066  1.00 56.85  ? 520 PRO A CG  1 
ATOM   1804 C CD  . PRO A 1 275 ? 3.060  -6.292  -3.137  1.00 60.20  ? 520 PRO A CD  1 
ATOM   1805 N N   . LEU A 1 276 ? 3.088  -9.684  -4.874  1.00 54.05  ? 521 LEU A N   1 
ATOM   1806 C CA  . LEU A 1 276 ? 2.786  -10.924 -5.587  1.00 57.09  ? 521 LEU A CA  1 
ATOM   1807 C C   . LEU A 1 276 ? 3.049  -10.790 -7.081  1.00 59.99  ? 521 LEU A C   1 
ATOM   1808 O O   . LEU A 1 276 ? 3.472  -11.758 -7.724  1.00 57.58  ? 521 LEU A O   1 
ATOM   1809 C CB  . LEU A 1 276 ? 1.335  -11.340 -5.334  1.00 57.43  ? 521 LEU A CB  1 
ATOM   1810 C CG  . LEU A 1 276 ? 1.100  -12.110 -4.034  1.00 62.48  ? 521 LEU A CG  1 
ATOM   1811 C CD1 . LEU A 1 276 ? -0.378 -12.140 -3.672  1.00 66.16  ? 521 LEU A CD1 1 
ATOM   1812 C CD2 . LEU A 1 276 ? 1.650  -13.524 -4.158  1.00 61.57  ? 521 LEU A CD2 1 
ATOM   1813 N N   . LYS A 1 277 ? 2.810  -9.605  -7.646  1.00 56.58  ? 522 LYS A N   1 
ATOM   1814 C CA  . LYS A 1 277 ? 3.150  -9.374  -9.045  1.00 56.19  ? 522 LYS A CA  1 
ATOM   1815 C C   . LYS A 1 277 ? 4.657  -9.443  -9.260  1.00 52.02  ? 522 LYS A C   1 
ATOM   1816 O O   . LYS A 1 277 ? 5.125  -10.042 -10.237 1.00 55.42  ? 522 LYS A O   1 
ATOM   1817 C CB  . LYS A 1 277 ? 2.599  -8.020  -9.497  1.00 58.52  ? 522 LYS A CB  1 
ATOM   1818 C CG  . LYS A 1 277 ? 2.960  -7.634  -10.917 1.00 62.05  ? 522 LYS A CG  1 
ATOM   1819 C CD  . LYS A 1 277 ? 1.730  -7.180  -11.687 1.00 71.43  ? 522 LYS A CD  1 
ATOM   1820 C CE  . LYS A 1 277 ? 2.099  -6.258  -12.837 1.00 75.08  ? 522 LYS A CE  1 
ATOM   1821 N NZ  . LYS A 1 277 ? 3.169  -6.835  -13.695 1.00 77.98  ? 522 LYS A NZ  1 
ATOM   1822 N N   . ALA A 1 278 ? 5.431  -8.845  -8.352  1.00 47.42  ? 523 ALA A N   1 
ATOM   1823 C CA  . ALA A 1 278 ? 6.883  -8.849  -8.496  1.00 47.08  ? 523 ALA A CA  1 
ATOM   1824 C C   . ALA A 1 278 ? 7.444  -10.260 -8.393  1.00 48.11  ? 523 ALA A C   1 
ATOM   1825 O O   . ALA A 1 278 ? 8.414  -10.600 -9.079  1.00 48.66  ? 523 ALA A O   1 
ATOM   1826 C CB  . ALA A 1 278 ? 7.518  -7.945  -7.437  1.00 45.18  ? 523 ALA A CB  1 
ATOM   1827 N N   . MET A 1 279 ? 6.846  -11.095 -7.540  1.00 47.15  ? 524 MET A N   1 
ATOM   1828 C CA  . MET A 1 279 ? 7.303  -12.473 -7.406  1.00 49.68  ? 524 MET A CA  1 
ATOM   1829 C C   . MET A 1 279 ? 7.101  -13.255 -8.696  1.00 50.97  ? 524 MET A C   1 
ATOM   1830 O O   . MET A 1 279 ? 7.984  -14.012 -9.118  1.00 53.42  ? 524 MET A O   1 
ATOM   1831 C CB  . MET A 1 279 ? 6.573  -13.142 -6.249  1.00 48.42  ? 524 MET A CB  1 
ATOM   1832 C CG  . MET A 1 279 ? 7.064  -12.648 -4.894  1.00 48.32  ? 524 MET A CG  1 
ATOM   1833 S SD  . MET A 1 279 ? 5.969  -13.203 -3.585  1.00 50.01  ? 524 MET A SD  1 
ATOM   1834 C CE  . MET A 1 279 ? 6.094  -14.980 -3.819  1.00 51.75  ? 524 MET A CE  1 
ATOM   1835 N N   . LYS A 1 280 ? 5.947  -13.078 -9.340  1.00 51.89  ? 525 LYS A N   1 
ATOM   1836 C CA  . LYS A 1 280 ? 5.717  -13.728 -10.625 1.00 56.31  ? 525 LYS A CA  1 
ATOM   1837 C C   . LYS A 1 280 ? 6.749  -13.285 -11.658 1.00 57.23  ? 525 LYS A C   1 
ATOM   1838 O O   . LYS A 1 280 ? 7.218  -14.094 -12.468 1.00 59.41  ? 525 LYS A O   1 
ATOM   1839 C CB  . LYS A 1 280 ? 4.295  -13.432 -11.102 1.00 57.41  ? 525 LYS A CB  1 
ATOM   1840 C CG  . LYS A 1 280 ? 3.857  -14.216 -12.320 1.00 67.62  ? 525 LYS A CG  1 
ATOM   1841 C CD  . LYS A 1 280 ? 2.351  -14.093 -12.527 1.00 72.83  ? 525 LYS A CD  1 
ATOM   1842 C CE  . LYS A 1 280 ? 1.896  -14.746 -13.825 1.00 71.18  ? 525 LYS A CE  1 
ATOM   1843 N NZ  . LYS A 1 280 ? 0.418  -14.643 -13.996 1.00 75.79  ? 525 LYS A NZ  1 
ATOM   1844 N N   . MET A 1 281 ? 7.143  -12.011 -11.625 1.00 58.21  ? 526 MET A N   1 
ATOM   1845 C CA  . MET A 1 281 ? 8.100  -11.522 -12.612 1.00 55.44  ? 526 MET A CA  1 
ATOM   1846 C C   . MET A 1 281 ? 9.500  -12.037 -12.322 1.00 54.43  ? 526 MET A C   1 
ATOM   1847 O O   . MET A 1 281 ? 10.251 -12.367 -13.247 1.00 57.77  ? 526 MET A O   1 
ATOM   1848 C CB  . MET A 1 281 ? 8.078  -9.996  -12.650 1.00 59.26  ? 526 MET A CB  1 
ATOM   1849 C CG  . MET A 1 281 ? 6.708  -9.422  -12.948 1.00 65.03  ? 526 MET A CG  1 
ATOM   1850 S SD  . MET A 1 281 ? 6.720  -7.627  -12.941 1.00 66.80  ? 526 MET A SD  1 
ATOM   1851 C CE  . MET A 1 281 ? 7.685  -7.303  -14.414 1.00 70.86  ? 526 MET A CE  1 
ATOM   1852 N N   . ILE A 1 282 ? 9.869  -12.108 -11.040 1.00 50.51  ? 527 ILE A N   1 
ATOM   1853 C CA  . ILE A 1 282 ? 11.135 -12.717 -10.651 1.00 45.14  ? 527 ILE A CA  1 
ATOM   1854 C C   . ILE A 1 282 ? 11.189 -14.164 -11.115 1.00 47.47  ? 527 ILE A C   1 
ATOM   1855 O O   . ILE A 1 282 ? 12.212 -14.639 -11.626 1.00 52.43  ? 527 ILE A O   1 
ATOM   1856 C CB  . ILE A 1 282 ? 11.315 -12.615 -9.127  1.00 45.67  ? 527 ILE A CB  1 
ATOM   1857 C CG1 . ILE A 1 282 ? 11.494 -11.152 -8.709  1.00 47.17  ? 527 ILE A CG1 1 
ATOM   1858 C CG2 . ILE A 1 282 ? 12.472 -13.496 -8.665  1.00 45.94  ? 527 ILE A CG2 1 
ATOM   1859 C CD1 . ILE A 1 282 ? 11.096 -10.884 -7.277  1.00 52.22  ? 527 ILE A CD1 1 
ATOM   1860 N N   . ARG A 1 283 ? 10.089 -14.888 -10.935 1.00 48.81  ? 528 ARG A N   1 
ATOM   1861 C CA  . ARG A 1 283 ? 10.067 -16.307 -11.264 1.00 50.71  ? 528 ARG A CA  1 
ATOM   1862 C C   . ARG A 1 283 ? 10.113 -16.543 -12.768 1.00 51.93  ? 528 ARG A C   1 
ATOM   1863 O O   . ARG A 1 283 ? 10.816 -17.447 -13.234 1.00 54.13  ? 528 ARG A O   1 
ATOM   1864 C CB  . ARG A 1 283 ? 8.819  -16.943 -10.675 1.00 55.66  ? 528 ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 283 ? 8.672  -18.408 -10.991 1.00 53.77  ? 528 ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 283 ? 7.290  -18.844 -10.627 1.00 55.20  ? 528 ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 283 ? 6.295  -18.153 -11.435 1.00 57.53  ? 528 ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 283 ? 4.996  -18.155 -11.165 1.00 63.46  ? 528 ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 283 ? 4.549  -18.806 -10.100 1.00 61.95  ? 528 ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 283 ? 4.148  -17.504 -11.951 1.00 64.98  ? 528 ARG A NH2 1 
ATOM   1871 N N   . ASP A 1 284 ? 9.372  -15.748 -13.543 1.00 52.58  ? 529 ASP A N   1 
ATOM   1872 C CA  . ASP A 1 284 ? 9.163  -16.044 -14.956 1.00 56.92  ? 529 ASP A CA  1 
ATOM   1873 C C   . ASP A 1 284 ? 10.115 -15.318 -15.897 1.00 59.29  ? 529 ASP A C   1 
ATOM   1874 O O   . ASP A 1 284 ? 10.283 -15.760 -17.039 1.00 63.25  ? 529 ASP A O   1 
ATOM   1875 C CB  . ASP A 1 284 ? 7.725  -15.704 -15.361 1.00 60.04  ? 529 ASP A CB  1 
ATOM   1876 C CG  . ASP A 1 284 ? 6.707  -16.577 -14.659 1.00 64.44  ? 529 ASP A CG  1 
ATOM   1877 O OD1 . ASP A 1 284 ? 7.101  -17.649 -14.158 1.00 64.00  ? 529 ASP A OD1 1 
ATOM   1878 O OD2 . ASP A 1 284 ? 5.519  -16.193 -14.610 1.00 66.39  ? 529 ASP A OD2 1 
ATOM   1879 N N   . ASN A 1 285 ? 10.743 -14.234 -15.463 1.00 56.49  ? 530 ASN A N   1 
ATOM   1880 C CA  . ASN A 1 285 ? 11.529 -13.412 -16.370 1.00 59.27  ? 530 ASN A CA  1 
ATOM   1881 C C   . ASN A 1 285 ? 13.020 -13.639 -16.166 1.00 59.55  ? 530 ASN A C   1 
ATOM   1882 O O   . ASN A 1 285 ? 13.464 -14.198 -15.158 1.00 54.35  ? 530 ASN A O   1 
ATOM   1883 C CB  . ASN A 1 285 ? 11.199 -11.928 -16.187 1.00 57.07  ? 530 ASN A CB  1 
ATOM   1884 C CG  . ASN A 1 285 ? 9.786  -11.591 -16.616 1.00 57.91  ? 530 ASN A CG  1 
ATOM   1885 O OD1 . ASN A 1 285 ? 9.146  -12.360 -17.328 1.00 65.18  ? 530 ASN A OD1 1 
ATOM   1886 N ND2 . ASN A 1 285 ? 9.295  -10.432 -16.193 1.00 60.02  ? 530 ASN A ND2 1 
ATOM   1887 N N   . LEU A 1 286 ? 13.793 -13.197 -17.157 1.00 57.31  ? 531 LEU A N   1 
ATOM   1888 C CA  . LEU A 1 286 ? 15.241 -13.201 -17.048 1.00 54.96  ? 531 LEU A CA  1 
ATOM   1889 C C   . LEU A 1 286 ? 15.659 -12.386 -15.827 1.00 50.17  ? 531 LEU A C   1 
ATOM   1890 O O   . LEU A 1 286 ? 14.869 -11.594 -15.309 1.00 50.59  ? 531 LEU A O   1 
ATOM   1891 C CB  . LEU A 1 286 ? 15.862 -12.630 -18.321 1.00 56.22  ? 531 LEU A CB  1 
ATOM   1892 C CG  . LEU A 1 286 ? 15.437 -13.339 -19.607 1.00 60.58  ? 531 LEU A CG  1 
ATOM   1893 C CD1 . LEU A 1 286 ? 14.210 -12.664 -20.233 1.00 65.13  ? 531 LEU A CD1 1 
ATOM   1894 C CD2 . LEU A 1 286 ? 16.600 -13.383 -20.579 1.00 62.88  ? 531 LEU A CD2 1 
ATOM   1895 N N   . PRO A 1 287 ? 16.886 -12.579 -15.339 1.00 53.60  ? 532 PRO A N   1 
ATOM   1896 C CA  . PRO A 1 287 ? 17.331 -11.868 -14.132 1.00 47.84  ? 532 PRO A CA  1 
ATOM   1897 C C   . PRO A 1 287 ? 17.085 -10.375 -14.245 1.00 47.54  ? 532 PRO A C   1 
ATOM   1898 O O   . PRO A 1 287 ? 17.226 -9.793  -15.330 1.00 46.44  ? 532 PRO A O   1 
ATOM   1899 C CB  . PRO A 1 287 ? 18.832 -12.180 -14.076 1.00 49.29  ? 532 PRO A CB  1 
ATOM   1900 C CG  . PRO A 1 287 ? 18.944 -13.514 -14.704 1.00 53.48  ? 532 PRO A CG  1 
ATOM   1901 C CD  . PRO A 1 287 ? 17.899 -13.553 -15.795 1.00 56.32  ? 532 PRO A CD  1 
ATOM   1902 N N   . PRO A 1 288 ? 16.706 -9.724  -13.150 1.00 43.78  ? 533 PRO A N   1 
ATOM   1903 C CA  . PRO A 1 288 ? 16.390 -8.296  -13.216 1.00 47.85  ? 533 PRO A CA  1 
ATOM   1904 C C   . PRO A 1 288 ? 17.619 -7.459  -13.535 1.00 47.18  ? 533 PRO A C   1 
ATOM   1905 O O   . PRO A 1 288 ? 18.749 -7.805  -13.181 1.00 44.75  ? 533 PRO A O   1 
ATOM   1906 C CB  . PRO A 1 288 ? 15.864 -7.989  -11.813 1.00 43.05  ? 533 PRO A CB  1 
ATOM   1907 C CG  . PRO A 1 288 ? 16.568 -8.984  -10.940 1.00 43.55  ? 533 PRO A CG  1 
ATOM   1908 C CD  . PRO A 1 288 ? 16.682 -10.237 -11.767 1.00 41.50  ? 533 PRO A CD  1 
ATOM   1909 N N   . ARG A 1 289 ? 17.380 -6.339  -14.211 1.00 45.03  ? 534 ARG A N   1 
ATOM   1910 C CA  . ARG A 1 289 ? 18.440 -5.453  -14.668 1.00 47.25  ? 534 ARG A CA  1 
ATOM   1911 C C   . ARG A 1 289 ? 18.544 -4.223  -13.773 1.00 49.91  ? 534 ARG A C   1 
ATOM   1912 O O   . ARG A 1 289 ? 17.551 -3.753  -13.209 1.00 47.13  ? 534 ARG A O   1 
ATOM   1913 C CB  . ARG A 1 289 ? 18.194 -5.003  -16.109 1.00 51.41  ? 534 ARG A CB  1 
ATOM   1914 C CG  . ARG A 1 289 ? 18.046 -6.124  -17.115 1.00 56.83  ? 534 ARG A CG  1 
ATOM   1915 C CD  . ARG A 1 289 ? 17.282 -5.611  -18.326 1.00 65.45  ? 534 ARG A CD  1 
ATOM   1916 N NE  . ARG A 1 289 ? 15.898 -5.295  -17.979 1.00 74.83  ? 534 ARG A NE  1 
ATOM   1917 C CZ  . ARG A 1 289 ? 15.172 -4.339  -18.553 1.00 79.76  ? 534 ARG A CZ  1 
ATOM   1918 N NH1 . ARG A 1 289 ? 15.698 -3.579  -19.506 1.00 82.27  ? 534 ARG A NH1 1 
ATOM   1919 N NH2 . ARG A 1 289 ? 13.919 -4.132  -18.165 1.00 79.64  ? 534 ARG A NH2 1 
ATOM   1920 N N   . LEU A 1 290 ? 19.765 -3.705  -13.651 1.00 47.13  ? 535 LEU A N   1 
ATOM   1921 C CA  . LEU A 1 290 ? 19.945 -2.373  -13.094 1.00 42.91  ? 535 LEU A CA  1 
ATOM   1922 C C   . LEU A 1 290 ? 19.217 -1.361  -13.961 1.00 44.66  ? 535 LEU A C   1 
ATOM   1923 O O   . LEU A 1 290 ? 19.226 -1.450  -15.193 1.00 48.61  ? 535 LEU A O   1 
ATOM   1924 C CB  . LEU A 1 290 ? 21.433 -2.014  -13.022 1.00 42.51  ? 535 LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 290 ? 22.256 -2.863  -12.059 1.00 41.95  ? 535 LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 290 ? 23.725 -2.912  -12.488 1.00 44.39  ? 535 LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 290 ? 22.127 -2.283  -10.665 1.00 39.83  ? 535 LEU A CD2 1 
ATOM   1928 N N   . LYS A 1 291 ? 18.585 -0.385  -13.320 1.00 44.34  ? 536 LYS A N   1 
ATOM   1929 C CA  . LYS A 1 291 ? 18.031 0.705   -14.104 1.00 51.10  ? 536 LYS A CA  1 
ATOM   1930 C C   . LYS A 1 291 ? 19.127 1.661   -14.550 1.00 49.85  ? 536 LYS A C   1 
ATOM   1931 O O   . LYS A 1 291 ? 18.985 2.321   -15.583 1.00 52.88  ? 536 LYS A O   1 
ATOM   1932 C CB  . LYS A 1 291 ? 16.945 1.436   -13.308 1.00 55.82  ? 536 LYS A CB  1 
ATOM   1933 C CG  . LYS A 1 291 ? 17.452 2.363   -12.226 1.00 62.11  ? 536 LYS A CG  1 
ATOM   1934 C CD  . LYS A 1 291 ? 16.321 3.206   -11.645 1.00 66.44  ? 536 LYS A CD  1 
ATOM   1935 C CE  . LYS A 1 291 ? 16.853 4.321   -10.747 1.00 68.03  ? 536 LYS A CE  1 
ATOM   1936 N NZ  . LYS A 1 291 ? 15.789 5.300   -10.379 1.00 69.80  ? 536 LYS A NZ  1 
ATOM   1937 N N   . ASN A 1 292 ? 20.237 1.707   -13.809 1.00 54.05  ? 537 ASN A N   1 
ATOM   1938 C CA  . ASN A 1 292 ? 21.370 2.567   -14.130 1.00 60.32  ? 537 ASN A CA  1 
ATOM   1939 C C   . ASN A 1 292 ? 22.610 1.746   -14.457 1.00 51.79  ? 537 ASN A C   1 
ATOM   1940 O O   . ASN A 1 292 ? 23.637 1.875   -13.783 1.00 49.98  ? 537 ASN A O   1 
ATOM   1941 C CB  . ASN A 1 292 ? 21.671 3.508   -12.961 1.00 64.22  ? 537 ASN A CB  1 
ATOM   1942 C CG  . ASN A 1 292 ? 20.507 4.416   -12.626 1.00 63.85  ? 537 ASN A CG  1 
ATOM   1943 O OD1 . ASN A 1 292 ? 20.126 4.553   -11.463 1.00 65.37  ? 537 ASN A OD1 1 
ATOM   1944 N ND2 . ASN A 1 292 ? 19.938 5.047   -13.647 1.00 66.36  ? 537 ASN A ND2 1 
ATOM   1945 N N   . LEU A 1 293 ? 22.525 0.888   -15.476 1.00 50.33  ? 538 LEU A N   1 
ATOM   1946 C CA  . LEU A 1 293 ? 23.676 0.065   -15.829 1.00 51.81  ? 538 LEU A CA  1 
ATOM   1947 C C   . LEU A 1 293 ? 24.886 0.922   -16.184 1.00 52.71  ? 538 LEU A C   1 
ATOM   1948 O O   . LEU A 1 293 ? 26.027 0.533   -15.911 1.00 50.11  ? 538 LEU A O   1 
ATOM   1949 C CB  . LEU A 1 293 ? 23.314 -0.868  -16.981 1.00 55.42  ? 538 LEU A CB  1 
ATOM   1950 C CG  . LEU A 1 293 ? 24.395 -1.828  -17.474 1.00 54.78  ? 538 LEU A CG  1 
ATOM   1951 C CD1 . LEU A 1 293 ? 24.984 -2.624  -16.324 1.00 51.91  ? 538 LEU A CD1 1 
ATOM   1952 C CD2 . LEU A 1 293 ? 23.799 -2.760  -18.520 1.00 54.59  ? 538 LEU A CD2 1 
ATOM   1953 N N   . HIS A 1 294 ? 24.660 2.106   -16.752 1.00 49.85  ? 539 HIS A N   1 
ATOM   1954 C CA  . HIS A 1 294 ? 25.761 3.006   -17.065 1.00 50.95  ? 539 HIS A CA  1 
ATOM   1955 C C   . HIS A 1 294 ? 26.454 3.554   -15.828 1.00 49.99  ? 539 HIS A C   1 
ATOM   1956 O O   . HIS A 1 294 ? 27.476 4.233   -15.970 1.00 61.66  ? 539 HIS A O   1 
ATOM   1957 C CB  . HIS A 1 294 ? 25.259 4.161   -17.939 1.00 60.38  ? 539 HIS A CB  1 
ATOM   1958 C CG  . HIS A 1 294 ? 24.089 4.902   -17.364 1.00 58.31  ? 539 HIS A CG  1 
ATOM   1959 N ND1 . HIS A 1 294 ? 22.853 4.317   -17.175 1.00 59.55  ? 539 HIS A ND1 1 
ATOM   1960 C CD2 . HIS A 1 294 ? 23.967 6.184   -16.944 1.00 57.37  ? 539 HIS A CD2 1 
ATOM   1961 C CE1 . HIS A 1 294 ? 22.024 5.204   -16.655 1.00 60.95  ? 539 HIS A CE1 1 
ATOM   1962 N NE2 . HIS A 1 294 ? 22.674 6.347   -16.510 1.00 58.25  ? 539 HIS A NE2 1 
ATOM   1963 N N   . LYS A 1 295 ? 25.949 3.274   -14.626 1.00 45.53  ? 540 LYS A N   1 
ATOM   1964 C CA  . LYS A 1 295 ? 26.523 3.800   -13.394 1.00 49.04  ? 540 LYS A CA  1 
ATOM   1965 C C   . LYS A 1 295 ? 27.278 2.748   -12.590 1.00 56.16  ? 540 LYS A C   1 
ATOM   1966 O O   . LYS A 1 295 ? 27.578 2.983   -11.411 1.00 58.14  ? 540 LYS A O   1 
ATOM   1967 C CB  . LYS A 1 295 ? 25.432 4.429   -12.522 1.00 49.24  ? 540 LYS A CB  1 
ATOM   1968 C CG  . LYS A 1 295 ? 24.843 5.729   -13.068 1.00 53.32  ? 540 LYS A CG  1 
ATOM   1969 C CD  . LYS A 1 295 ? 23.763 6.298   -12.138 1.00 59.08  ? 540 LYS A CD  1 
ATOM   1970 C CE  . LYS A 1 295 ? 24.318 7.257   -11.080 1.00 62.51  ? 540 LYS A CE  1 
ATOM   1971 N NZ  . LYS A 1 295 ? 25.253 6.643   -10.086 1.00 63.40  ? 540 LYS A NZ  1 
ATOM   1972 N N   . VAL A 1 296 ? 27.577 1.590   -13.173 1.00 49.79  ? 541 VAL A N   1 
ATOM   1973 C CA  . VAL A 1 296 ? 28.336 0.558   -12.479 1.00 43.91  ? 541 VAL A CA  1 
ATOM   1974 C C   . VAL A 1 296 ? 29.551 0.202   -13.325 1.00 43.07  ? 541 VAL A C   1 
ATOM   1975 O O   . VAL A 1 296 ? 29.491 0.205   -14.560 1.00 43.34  ? 541 VAL A O   1 
ATOM   1976 C CB  . VAL A 1 296 ? 27.490 -0.699  -12.163 1.00 49.09  ? 541 VAL A CB  1 
ATOM   1977 C CG1 . VAL A 1 296 ? 26.212 -0.306  -11.445 1.00 47.22  ? 541 VAL A CG1 1 
ATOM   1978 C CG2 . VAL A 1 296 ? 27.188 -1.509  -13.421 1.00 45.81  ? 541 VAL A CG2 1 
ATOM   1979 N N   . SER A 1 297 ? 30.663 -0.069  -12.653 1.00 43.66  ? 542 SER A N   1 
ATOM   1980 C CA  . SER A 1 297 ? 31.884 -0.449  -13.340 1.00 45.33  ? 542 SER A CA  1 
ATOM   1981 C C   . SER A 1 297 ? 31.728 -1.851  -13.923 1.00 45.29  ? 542 SER A C   1 
ATOM   1982 O O   . SER A 1 297 ? 30.919 -2.644  -13.440 1.00 42.61  ? 542 SER A O   1 
ATOM   1983 C CB  . SER A 1 297 ? 33.055 -0.420  -12.366 1.00 42.27  ? 542 SER A CB  1 
ATOM   1984 O OG  . SER A 1 297 ? 32.865 -1.378  -11.341 1.00 44.66  ? 542 SER A OG  1 
ATOM   1985 N N   . PRO A 1 298 ? 32.494 -2.187  -14.961 1.00 46.39  ? 543 PRO A N   1 
ATOM   1986 C CA  . PRO A 1 298 ? 32.451 -3.573  -15.457 1.00 46.62  ? 543 PRO A CA  1 
ATOM   1987 C C   . PRO A 1 298 ? 32.755 -4.589  -14.377 1.00 47.82  ? 543 PRO A C   1 
ATOM   1988 O O   . PRO A 1 298 ? 32.229 -5.708  -14.418 1.00 48.29  ? 543 PRO A O   1 
ATOM   1989 C CB  . PRO A 1 298 ? 33.513 -3.571  -16.568 1.00 47.71  ? 543 PRO A CB  1 
ATOM   1990 C CG  . PRO A 1 298 ? 33.514 -2.169  -17.048 1.00 49.04  ? 543 PRO A CG  1 
ATOM   1991 C CD  . PRO A 1 298 ? 33.340 -1.332  -15.808 1.00 47.08  ? 543 PRO A CD  1 
ATOM   1992 N N   . SER A 1 299 ? 33.574 -4.218  -13.391 1.00 45.46  ? 544 SER A N   1 
ATOM   1993 C CA  . SER A 1 299 ? 33.856 -5.112  -12.275 1.00 44.62  ? 544 SER A CA  1 
ATOM   1994 C C   . SER A 1 299 ? 32.602 -5.370  -11.443 1.00 42.82  ? 544 SER A C   1 
ATOM   1995 O O   . SER A 1 299 ? 32.309 -6.518  -11.077 1.00 42.35  ? 544 SER A O   1 
ATOM   1996 C CB  . SER A 1 299 ? 34.971 -4.519  -11.414 1.00 49.58  ? 544 SER A CB  1 
ATOM   1997 O OG  . SER A 1 299 ? 35.302 -5.388  -10.349 1.00 50.28  ? 544 SER A OG  1 
ATOM   1998 N N   . LEU A 1 300 ? 31.852 -4.311  -11.113 1.00 41.91  ? 545 LEU A N   1 
ATOM   1999 C CA  A LEU A 1 300 ? 30.617 -4.502  -10.356 0.47 39.12  ? 545 LEU A CA  1 
ATOM   2000 C CA  B LEU A 1 300 ? 30.616 -4.498  -10.358 0.53 38.84  ? 545 LEU A CA  1 
ATOM   2001 C C   . LEU A 1 300 ? 29.598 -5.299  -11.162 1.00 39.40  ? 545 LEU A C   1 
ATOM   2002 O O   . LEU A 1 300 ? 28.947 -6.204  -10.626 1.00 39.82  ? 545 LEU A O   1 
ATOM   2003 C CB  A LEU A 1 300 ? 30.036 -3.151  -9.927  0.47 39.83  ? 545 LEU A CB  1 
ATOM   2004 C CB  B LEU A 1 300 ? 30.048 -3.139  -9.945  0.53 39.91  ? 545 LEU A CB  1 
ATOM   2005 C CG  A LEU A 1 300 ? 28.892 -3.184  -8.901  0.47 37.55  ? 545 LEU A CG  1 
ATOM   2006 C CG  B LEU A 1 300 ? 28.738 -3.132  -9.152  0.53 38.09  ? 545 LEU A CG  1 
ATOM   2007 C CD1 A LEU A 1 300 ? 28.911 -1.926  -8.049  0.47 36.24  ? 545 LEU A CD1 1 
ATOM   2008 C CD1 B LEU A 1 300 ? 28.759 -4.161  -8.034  0.53 37.12  ? 545 LEU A CD1 1 
ATOM   2009 C CD2 A LEU A 1 300 ? 27.526 -3.347  -9.569  0.47 40.33  ? 545 LEU A CD2 1 
ATOM   2010 C CD2 B LEU A 1 300 ? 28.487 -1.739  -8.595  0.53 37.49  ? 545 LEU A CD2 1 
ATOM   2011 N N   . LYS A 1 301 ? 29.454 -4.986  -12.452 1.00 41.33  ? 546 LYS A N   1 
ATOM   2012 C CA  . LYS A 1 301 ? 28.530 -5.736  -13.298 1.00 42.26  ? 546 LYS A CA  1 
ATOM   2013 C C   . LYS A 1 301 ? 28.909 -7.213  -13.361 1.00 44.89  ? 546 LYS A C   1 
ATOM   2014 O O   . LYS A 1 301 ? 28.040 -8.084  -13.264 1.00 43.03  ? 546 LYS A O   1 
ATOM   2015 C CB  . LYS A 1 301 ? 28.489 -5.132  -14.705 1.00 45.78  ? 546 LYS A CB  1 
ATOM   2016 C CG  . LYS A 1 301 ? 27.497 -5.830  -15.647 1.00 48.55  ? 546 LYS A CG  1 
ATOM   2017 C CD  . LYS A 1 301 ? 26.098 -5.888  -15.030 1.00 48.50  ? 546 LYS A CD  1 
ATOM   2018 C CE  . LYS A 1 301 ? 25.033 -6.262  -16.057 1.00 48.38  ? 546 LYS A CE  1 
ATOM   2019 N NZ  . LYS A 1 301 ? 25.315 -7.563  -16.717 1.00 52.48  ? 546 LYS A NZ  1 
ATOM   2020 N N   . GLY A 1 302 ? 30.201 -7.515  -13.531 1.00 42.36  ? 547 GLY A N   1 
ATOM   2021 C CA  . GLY A 1 302 ? 30.629 -8.908  -13.533 1.00 44.72  ? 547 GLY A CA  1 
ATOM   2022 C C   . GLY A 1 302 ? 30.359 -9.598  -12.208 1.00 42.83  ? 547 GLY A C   1 
ATOM   2023 O O   . GLY A 1 302 ? 29.962 -10.764 -12.176 1.00 42.40  ? 547 GLY A O   1 
ATOM   2024 N N   . PHE A 1 303 ? 30.569 -8.882  -11.097 1.00 43.45  ? 548 PHE A N   1 
ATOM   2025 C CA  . PHE A 1 303 ? 30.205 -9.388  -9.773  1.00 41.61  ? 548 PHE A CA  1 
ATOM   2026 C C   . PHE A 1 303 ? 28.712 -9.700  -9.696  1.00 44.52  ? 548 PHE A C   1 
ATOM   2027 O O   . PHE A 1 303 ? 28.310 -10.826 -9.365  1.00 40.82  ? 548 PHE A O   1 
ATOM   2028 C CB  . PHE A 1 303 ? 30.613 -8.353  -8.717  1.00 40.65  ? 548 PHE A CB  1 
ATOM   2029 C CG  . PHE A 1 303 ? 30.354 -8.769  -7.281  1.00 38.63  ? 548 PHE A CG  1 
ATOM   2030 C CD1 . PHE A 1 303 ? 31.175 -9.691  -6.648  1.00 39.24  ? 548 PHE A CD1 1 
ATOM   2031 C CD2 . PHE A 1 303 ? 29.339 -8.173  -6.548  1.00 39.65  ? 548 PHE A CD2 1 
ATOM   2032 C CE1 . PHE A 1 303 ? 30.955 -10.047 -5.325  1.00 37.75  ? 548 PHE A CE1 1 
ATOM   2033 C CE2 . PHE A 1 303 ? 29.120 -8.514  -5.219  1.00 35.51  ? 548 PHE A CE2 1 
ATOM   2034 C CZ  . PHE A 1 303 ? 29.930 -9.469  -4.615  1.00 35.71  ? 548 PHE A CZ  1 
ATOM   2035 N N   . LEU A 1 304 ? 27.872 -8.709  -10.019 1.00 42.73  ? 549 LEU A N   1 
ATOM   2036 C CA  . LEU A 1 304 ? 26.426 -8.904  -9.991  1.00 42.52  ? 549 LEU A CA  1 
ATOM   2037 C C   . LEU A 1 304 ? 25.996 -10.062 -10.879 1.00 40.94  ? 549 LEU A C   1 
ATOM   2038 O O   . LEU A 1 304 ? 25.021 -10.755 -10.569 1.00 42.83  ? 549 LEU A O   1 
ATOM   2039 C CB  . LEU A 1 304 ? 25.722 -7.618  -10.430 1.00 41.87  ? 549 LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 304 ? 24.202 -7.604  -10.248 1.00 41.37  ? 549 LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 304 ? 23.866 -7.826  -8.785  1.00 39.59  ? 549 LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 304 ? 23.605 -6.293  -10.750 1.00 41.19  ? 549 LEU A CD2 1 
ATOM   2043 N N   . ASP A 1 305 ? 26.700 -10.276 -11.992 1.00 41.62  ? 550 ASP A N   1 
ATOM   2044 C CA  . ASP A 1 305 ? 26.352 -11.360 -12.905 1.00 44.54  ? 550 ASP A CA  1 
ATOM   2045 C C   . ASP A 1 305 ? 26.556 -12.735 -12.280 1.00 46.67  ? 550 ASP A C   1 
ATOM   2046 O O   . ASP A 1 305 ? 25.932 -13.702 -12.729 1.00 45.79  ? 550 ASP A O   1 
ATOM   2047 C CB  . ASP A 1 305 ? 27.168 -11.241 -14.192 1.00 45.29  ? 550 ASP A CB  1 
ATOM   2048 C CG  . ASP A 1 305 ? 26.587 -10.216 -15.158 1.00 51.23  ? 550 ASP A CG  1 
ATOM   2049 O OD1 . ASP A 1 305 ? 25.488 -9.683  -14.879 1.00 47.90  ? 550 ASP A OD1 1 
ATOM   2050 O OD2 . ASP A 1 305 ? 27.226 -9.945  -16.202 1.00 53.30  ? 550 ASP A OD2 1 
ATOM   2051 N N   . ARG A 1 306 ? 27.406 -12.848 -11.259 1.00 43.55  ? 551 ARG A N   1 
ATOM   2052 C CA  . ARG A 1 306 ? 27.591 -14.117 -10.564 1.00 41.63  ? 551 ARG A CA  1 
ATOM   2053 C C   . ARG A 1 306 ? 26.579 -14.329 -9.448  1.00 42.18  ? 551 ARG A C   1 
ATOM   2054 O O   . ARG A 1 306 ? 26.449 -15.460 -8.952  1.00 41.41  ? 551 ARG A O   1 
ATOM   2055 C CB  . ARG A 1 306 ? 29.013 -14.205 -9.991  1.00 40.51  ? 551 ARG A CB  1 
ATOM   2056 C CG  . ARG A 1 306 ? 30.130 -14.139 -11.040 1.00 44.23  ? 551 ARG A CG  1 
ATOM   2057 C CD  . ARG A 1 306 ? 30.170 -15.364 -11.947 1.00 49.95  ? 551 ARG A CD  1 
ATOM   2058 N NE  . ARG A 1 306 ? 30.427 -16.598 -11.211 1.00 53.11  ? 551 ARG A NE  1 
ATOM   2059 C CZ  . ARG A 1 306 ? 29.580 -17.623 -11.146 1.00 54.10  ? 551 ARG A CZ  1 
ATOM   2060 N NH1 . ARG A 1 306 ? 28.420 -17.573 -11.794 1.00 51.97  ? 551 ARG A NH1 1 
ATOM   2061 N NH2 . ARG A 1 306 ? 29.897 -18.703 -10.440 1.00 53.65  ? 551 ARG A NH2 1 
ATOM   2062 N N   . LEU A 1 307 ? 25.860 -13.277 -9.052  1.00 39.43  ? 552 LEU A N   1 
ATOM   2063 C CA  . LEU A 1 307 ? 24.842 -13.349 -8.010  1.00 40.58  ? 552 LEU A CA  1 
ATOM   2064 C C   . LEU A 1 307 ? 23.460 -13.631 -8.586  1.00 39.64  ? 552 LEU A C   1 
ATOM   2065 O O   . LEU A 1 307 ? 22.748 -14.523 -8.116  1.00 39.78  ? 552 LEU A O   1 
ATOM   2066 C CB  . LEU A 1 307 ? 24.790 -12.033 -7.228  1.00 36.98  ? 552 LEU A CB  1 
ATOM   2067 C CG  . LEU A 1 307 ? 26.090 -11.446 -6.682  1.00 43.57  ? 552 LEU A CG  1 
ATOM   2068 C CD1 . LEU A 1 307 ? 25.814 -10.125 -6.020  1.00 38.58  ? 552 LEU A CD1 1 
ATOM   2069 C CD2 . LEU A 1 307 ? 26.679 -12.382 -5.682  1.00 42.73  ? 552 LEU A CD2 1 
ATOM   2070 N N   . LEU A 1 308 ? 23.059 -12.863 -9.591  1.00 39.60  ? 553 LEU A N   1 
ATOM   2071 C CA  . LEU A 1 308 ? 21.714 -12.981 -10.150 1.00 41.98  ? 553 LEU A CA  1 
ATOM   2072 C C   . LEU A 1 308 ? 21.697 -14.017 -11.276 1.00 42.97  ? 553 LEU A C   1 
ATOM   2073 O O   . LEU A 1 308 ? 21.450 -13.722 -12.441 1.00 43.59  ? 553 LEU A O   1 
ATOM   2074 C CB  . LEU A 1 308 ? 21.220 -11.620 -10.627 1.00 42.12  ? 553 LEU A CB  1 
ATOM   2075 C CG  . LEU A 1 308 ? 21.143 -10.556 -9.524  1.00 41.72  ? 553 LEU A CG  1 
ATOM   2076 C CD1 . LEU A 1 308 ? 20.768 -9.208  -10.113 1.00 38.12  ? 553 LEU A CD1 1 
ATOM   2077 C CD2 . LEU A 1 308 ? 20.164 -10.961 -8.407  1.00 41.67  ? 553 LEU A CD2 1 
ATOM   2078 N N   . VAL A 1 309 ? 21.981 -15.261 -10.902 1.00 40.28  ? 554 VAL A N   1 
ATOM   2079 C CA  . VAL A 1 309 ? 21.924 -16.394 -11.819 1.00 42.22  ? 554 VAL A CA  1 
ATOM   2080 C C   . VAL A 1 309 ? 20.687 -17.209 -11.474 1.00 45.49  ? 554 VAL A C   1 
ATOM   2081 O O   . VAL A 1 309 ? 20.494 -17.595 -10.314 1.00 43.44  ? 554 VAL A O   1 
ATOM   2082 C CB  . VAL A 1 309 ? 23.200 -17.248 -11.740 1.00 41.95  ? 554 VAL A CB  1 
ATOM   2083 C CG1 . VAL A 1 309 ? 23.115 -18.425 -12.690 1.00 46.55  ? 554 VAL A CG1 1 
ATOM   2084 C CG2 . VAL A 1 309 ? 24.420 -16.382 -12.066 1.00 42.91  ? 554 VAL A CG2 1 
ATOM   2085 N N   . ARG A 1 310 ? 19.840 -17.452 -12.475 1.00 44.52  ? 555 ARG A N   1 
ATOM   2086 C CA  . ARG A 1 310 ? 18.590 -18.162 -12.217 1.00 48.67  ? 555 ARG A CA  1 
ATOM   2087 C C   . ARG A 1 310 ? 18.845 -19.594 -11.755 1.00 47.37  ? 555 ARG A C   1 
ATOM   2088 O O   . ARG A 1 310 ? 18.238 -20.057 -10.781 1.00 47.80  ? 555 ARG A O   1 
ATOM   2089 C CB  . ARG A 1 310 ? 17.707 -18.146 -13.460 1.00 50.91  ? 555 ARG A CB  1 
ATOM   2090 C CG  . ARG A 1 310 ? 17.112 -16.782 -13.740 1.00 52.77  ? 555 ARG A CG  1 
ATOM   2091 C CD  . ARG A 1 310 ? 16.173 -16.834 -14.926 1.00 53.46  ? 555 ARG A CD  1 
ATOM   2092 N NE  . ARG A 1 310 ? 15.174 -17.882 -14.757 1.00 61.71  ? 555 ARG A NE  1 
ATOM   2093 C CZ  . ARG A 1 310 ? 14.054 -17.749 -14.052 1.00 64.88  ? 555 ARG A CZ  1 
ATOM   2094 N NH1 . ARG A 1 310 ? 13.781 -16.607 -13.437 1.00 61.98  ? 555 ARG A NH1 1 
ATOM   2095 N NH2 . ARG A 1 310 ? 13.206 -18.763 -13.963 1.00 68.85  ? 555 ARG A NH2 1 
ATOM   2096 N N   . ASP A 1 311 ? 19.728 -20.306 -12.439 1.00 46.94  ? 556 ASP A N   1 
ATOM   2097 C CA  . ASP A 1 311 ? 20.064 -21.676 -12.061 1.00 46.86  ? 556 ASP A CA  1 
ATOM   2098 C C   . ASP A 1 311 ? 20.923 -21.665 -10.802 1.00 46.53  ? 556 ASP A C   1 
ATOM   2099 O O   . ASP A 1 311 ? 22.085 -21.245 -10.870 1.00 48.44  ? 556 ASP A O   1 
ATOM   2100 C CB  . ASP A 1 311 ? 20.798 -22.366 -13.211 1.00 50.54  ? 556 ASP A CB  1 
ATOM   2101 C CG  . ASP A 1 311 ? 21.062 -23.845 -12.948 1.00 53.77  ? 556 ASP A CG  1 
ATOM   2102 O OD1 . ASP A 1 311 ? 20.860 -24.317 -11.811 1.00 55.39  ? 556 ASP A OD1 1 
ATOM   2103 O OD2 . ASP A 1 311 ? 21.475 -24.541 -13.897 1.00 60.20  ? 556 ASP A OD2 1 
ATOM   2104 N N   . PRO A 1 312 ? 20.417 -22.119 -9.651  1.00 48.44  ? 557 PRO A N   1 
ATOM   2105 C CA  . PRO A 1 312 ? 21.216 -22.027 -8.418  1.00 49.17  ? 557 PRO A CA  1 
ATOM   2106 C C   . PRO A 1 312 ? 22.487 -22.864 -8.451  1.00 49.29  ? 557 PRO A C   1 
ATOM   2107 O O   . PRO A 1 312 ? 23.442 -22.546 -7.730  1.00 47.37  ? 557 PRO A O   1 
ATOM   2108 C CB  . PRO A 1 312 ? 20.243 -22.508 -7.333  1.00 49.08  ? 557 PRO A CB  1 
ATOM   2109 C CG  . PRO A 1 312 ? 19.264 -23.363 -8.053  1.00 48.64  ? 557 PRO A CG  1 
ATOM   2110 C CD  . PRO A 1 312 ? 19.110 -22.756 -9.419  1.00 51.55  ? 557 PRO A CD  1 
ATOM   2111 N N   . ALA A 1 313 ? 22.542 -23.909 -9.280  1.00 47.88  ? 558 ALA A N   1 
ATOM   2112 C CA  . ALA A 1 313 ? 23.786 -24.658 -9.437  1.00 51.90  ? 558 ALA A CA  1 
ATOM   2113 C C   . ALA A 1 313 ? 24.886 -23.809 -10.075 1.00 55.65  ? 558 ALA A C   1 
ATOM   2114 O O   . ALA A 1 313 ? 26.072 -24.058 -9.835  1.00 53.76  ? 558 ALA A O   1 
ATOM   2115 C CB  . ALA A 1 313 ? 23.537 -25.924 -10.265 1.00 51.26  ? 558 ALA A CB  1 
ATOM   2116 N N   . GLN A 1 314 ? 24.519 -22.804 -10.875 1.00 52.96  ? 559 GLN A N   1 
ATOM   2117 C CA  . GLN A 1 314 ? 25.484 -21.959 -11.574 1.00 48.78  ? 559 GLN A CA  1 
ATOM   2118 C C   . GLN A 1 314 ? 25.780 -20.653 -10.850 1.00 45.61  ? 559 GLN A C   1 
ATOM   2119 O O   . GLN A 1 314 ? 26.729 -19.956 -11.223 1.00 48.58  ? 559 GLN A O   1 
ATOM   2120 C CB  . GLN A 1 314 ? 24.987 -21.643 -12.990 1.00 54.02  ? 559 GLN A CB  1 
ATOM   2121 C CG  . GLN A 1 314 ? 24.824 -22.862 -13.859 1.00 58.39  ? 559 GLN A CG  1 
ATOM   2122 C CD  . GLN A 1 314 ? 26.091 -23.694 -13.915 1.00 66.30  ? 559 GLN A CD  1 
ATOM   2123 O OE1 . GLN A 1 314 ? 27.189 -23.164 -14.098 1.00 65.85  ? 559 GLN A OE1 1 
ATOM   2124 N NE2 . GLN A 1 314 ? 25.948 -25.004 -13.743 1.00 66.78  ? 559 GLN A NE2 1 
ATOM   2125 N N   . ARG A 1 315 ? 24.974 -20.298 -9.858  1.00 44.08  ? 560 ARG A N   1 
ATOM   2126 C CA  . ARG A 1 315 ? 25.231 -19.139 -9.022  1.00 44.08  ? 560 ARG A CA  1 
ATOM   2127 C C   . ARG A 1 315 ? 26.527 -19.336 -8.250  1.00 43.42  ? 560 ARG A C   1 
ATOM   2128 O O   . ARG A 1 315 ? 26.837 -20.444 -7.812  1.00 45.68  ? 560 ARG A O   1 
ATOM   2129 C CB  . ARG A 1 315 ? 24.061 -18.967 -8.053  1.00 41.21  ? 560 ARG A CB  1 
ATOM   2130 C CG  . ARG A 1 315 ? 23.786 -17.537 -7.581  1.00 41.02  ? 560 ARG A CG  1 
ATOM   2131 C CD  . ARG A 1 315 ? 22.431 -17.526 -6.837  1.00 38.83  ? 560 ARG A CD  1 
ATOM   2132 N NE  . ARG A 1 315 ? 21.317 -17.909 -7.706  1.00 39.83  ? 560 ARG A NE  1 
ATOM   2133 C CZ  . ARG A 1 315 ? 20.177 -18.451 -7.268  1.00 45.57  ? 560 ARG A CZ  1 
ATOM   2134 N NH1 . ARG A 1 315 ? 19.997 -18.683 -5.967  1.00 39.57  ? 560 ARG A NH1 1 
ATOM   2135 N NH2 . ARG A 1 315 ? 19.215 -18.778 -8.124  1.00 42.88  ? 560 ARG A NH2 1 
ATOM   2136 N N   . ALA A 1 316 ? 27.286 -18.257 -8.071  1.00 43.34  ? 561 ALA A N   1 
ATOM   2137 C CA  . ALA A 1 316 ? 28.493 -18.349 -7.262  1.00 45.13  ? 561 ALA A CA  1 
ATOM   2138 C C   . ALA A 1 316 ? 28.144 -18.578 -5.791  1.00 41.34  ? 561 ALA A C   1 
ATOM   2139 O O   . ALA A 1 316 ? 27.072 -18.191 -5.318  1.00 41.08  ? 561 ALA A O   1 
ATOM   2140 C CB  . ALA A 1 316 ? 29.331 -17.085 -7.407  1.00 41.75  ? 561 ALA A CB  1 
ATOM   2141 N N   . THR A 1 317 ? 29.050 -19.236 -5.068  1.00 41.17  ? 562 THR A N   1 
ATOM   2142 C CA  . THR A 1 317 ? 28.893 -19.397 -3.626  1.00 40.46  ? 562 THR A CA  1 
ATOM   2143 C C   . THR A 1 317 ? 29.567 -18.241 -2.886  1.00 41.34  ? 562 THR A C   1 
ATOM   2144 O O   . THR A 1 317 ? 30.365 -17.491 -3.449  1.00 39.71  ? 562 THR A O   1 
ATOM   2145 C CB  . THR A 1 317 ? 29.490 -20.720 -3.146  1.00 42.30  ? 562 THR A CB  1 
ATOM   2146 O OG1 . THR A 1 317 ? 30.917 -20.676 -3.306  1.00 44.23  ? 562 THR A OG1 1 
ATOM   2147 C CG2 . THR A 1 317 ? 28.932 -21.894 -3.942  1.00 43.68  ? 562 THR A CG2 1 
ATOM   2148 N N   . ALA A 1 318 ? 29.252 -18.113 -1.595  1.00 38.23  ? 563 ALA A N   1 
ATOM   2149 C CA  . ALA A 1 318 ? 29.877 -17.063 -0.794  1.00 39.84  ? 563 ALA A CA  1 
ATOM   2150 C C   . ALA A 1 318 ? 31.391 -17.227 -0.756  1.00 41.90  ? 563 ALA A C   1 
ATOM   2151 O O   . ALA A 1 318 ? 32.132 -16.238 -0.838  1.00 39.32  ? 563 ALA A O   1 
ATOM   2152 C CB  . ALA A 1 318 ? 29.302 -17.058 0.625   1.00 35.88  ? 563 ALA A CB  1 
ATOM   2153 N N   . ALA A 1 319 ? 31.870 -18.471 -0.638  1.00 41.91  ? 564 ALA A N   1 
ATOM   2154 C CA  . ALA A 1 319 ? 33.311 -18.707 -0.585  1.00 42.54  ? 564 ALA A CA  1 
ATOM   2155 C C   . ALA A 1 319 ? 33.985 -18.330 -1.900  1.00 45.39  ? 564 ALA A C   1 
ATOM   2156 O O   . ALA A 1 319 ? 35.117 -17.833 -1.900  1.00 44.86  ? 564 ALA A O   1 
ATOM   2157 C CB  . ALA A 1 319 ? 33.593 -20.174 -0.234  1.00 41.79  ? 564 ALA A CB  1 
ATOM   2158 N N   . GLU A 1 320 ? 33.312 -18.574 -3.031  1.00 43.08  ? 565 GLU A N   1 
ATOM   2159 C CA  . GLU A 1 320 ? 33.862 -18.183 -4.325  1.00 43.55  ? 565 GLU A CA  1 
ATOM   2160 C C   . GLU A 1 320 ? 33.868 -16.668 -4.483  1.00 41.57  ? 565 GLU A C   1 
ATOM   2161 O O   . GLU A 1 320 ? 34.838 -16.094 -4.992  1.00 45.52  ? 565 GLU A O   1 
ATOM   2162 C CB  . GLU A 1 320 ? 33.067 -18.826 -5.462  1.00 46.05  ? 565 GLU A CB  1 
ATOM   2163 C CG  . GLU A 1 320 ? 33.150 -20.341 -5.515  1.00 51.67  ? 565 GLU A CG  1 
ATOM   2164 C CD  . GLU A 1 320 ? 32.059 -20.966 -6.377  1.00 57.49  ? 565 GLU A CD  1 
ATOM   2165 O OE1 . GLU A 1 320 ? 31.178 -20.229 -6.865  1.00 53.38  ? 565 GLU A OE1 1 
ATOM   2166 O OE2 . GLU A 1 320 ? 32.082 -22.204 -6.559  1.00 57.72  ? 565 GLU A OE2 1 
ATOM   2167 N N   . LEU A 1 321 ? 32.787 -16.006 -4.054  1.00 42.55  ? 566 LEU A N   1 
ATOM   2168 C CA  . LEU A 1 321 ? 32.662 -14.565 -4.242  1.00 42.61  ? 566 LEU A CA  1 
ATOM   2169 C C   . LEU A 1 321 ? 33.677 -13.792 -3.411  1.00 44.30  ? 566 LEU A C   1 
ATOM   2170 O O   . LEU A 1 321 ? 34.060 -12.681 -3.791  1.00 45.33  ? 566 LEU A O   1 
ATOM   2171 C CB  . LEU A 1 321 ? 31.240 -14.115 -3.901  1.00 40.01  ? 566 LEU A CB  1 
ATOM   2172 C CG  . LEU A 1 321 ? 30.144 -14.611 -4.845  1.00 39.30  ? 566 LEU A CG  1 
ATOM   2173 C CD1 . LEU A 1 321 ? 28.774 -14.564 -4.169  1.00 39.89  ? 566 LEU A CD1 1 
ATOM   2174 C CD2 . LEU A 1 321 ? 30.139 -13.819 -6.146  1.00 37.89  ? 566 LEU A CD2 1 
ATOM   2175 N N   . LEU A 1 322 ? 34.117 -14.347 -2.274  1.00 40.48  ? 567 LEU A N   1 
ATOM   2176 C CA  . LEU A 1 322 ? 35.147 -13.681 -1.484  1.00 44.64  ? 567 LEU A CA  1 
ATOM   2177 C C   . LEU A 1 322 ? 36.423 -13.479 -2.283  1.00 45.91  ? 567 LEU A C   1 
ATOM   2178 O O   . LEU A 1 322 ? 37.227 -12.604 -1.940  1.00 46.33  ? 567 LEU A O   1 
ATOM   2179 C CB  . LEU A 1 322 ? 35.442 -14.471 -0.206  1.00 41.55  ? 567 LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 322 ? 34.321 -14.368 0.845   1.00 41.30  ? 567 LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 322 ? 34.585 -15.303 2.018   1.00 43.89  ? 567 LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 322 ? 34.175 -12.930 1.321   1.00 40.51  ? 567 LEU A CD2 1 
ATOM   2183 N N   . LYS A 1 323 ? 36.613 -14.258 -3.346  1.00 45.04  ? 568 LYS A N   1 
ATOM   2184 C CA  . LYS A 1 323 ? 37.775 -14.138 -4.209  1.00 46.29  ? 568 LYS A CA  1 
ATOM   2185 C C   . LYS A 1 323 ? 37.509 -13.286 -5.450  1.00 44.91  ? 568 LYS A C   1 
ATOM   2186 O O   . LYS A 1 323 ? 38.399 -13.151 -6.289  1.00 44.83  ? 568 LYS A O   1 
ATOM   2187 C CB  . LYS A 1 323 ? 38.270 -15.540 -4.617  1.00 47.16  ? 568 LYS A CB  1 
ATOM   2188 C CG  . LYS A 1 323 ? 39.215 -16.206 -3.606  1.00 56.43  ? 568 LYS A CG  1 
ATOM   2189 C CD  . LYS A 1 323 ? 38.631 -16.267 -2.191  1.00 64.68  ? 568 LYS A CD  1 
ATOM   2190 C CE  . LYS A 1 323 ? 39.694 -16.510 -1.119  1.00 69.56  ? 568 LYS A CE  1 
ATOM   2191 N NZ  . LYS A 1 323 ? 39.128 -16.366 0.259   1.00 66.59  ? 568 LYS A NZ  1 
ATOM   2192 N N   . HIS A 1 324 ? 36.320 -12.696 -5.586  1.00 46.01  ? 569 HIS A N   1 
ATOM   2193 C CA  . HIS A 1 324 ? 36.022 -11.950 -6.803  1.00 44.66  ? 569 HIS A CA  1 
ATOM   2194 C C   . HIS A 1 324 ? 36.773 -10.618 -6.805  1.00 44.62  ? 569 HIS A C   1 
ATOM   2195 O O   . HIS A 1 324 ? 36.869 -9.956  -5.767  1.00 43.95  ? 569 HIS A O   1 
ATOM   2196 C CB  . HIS A 1 324 ? 34.519 -11.706 -6.949  1.00 45.72  ? 569 HIS A CB  1 
ATOM   2197 C CG  . HIS A 1 324 ? 34.124 -11.228 -8.312  1.00 47.02  ? 569 HIS A CG  1 
ATOM   2198 N ND1 . HIS A 1 324 ? 34.180 -9.900  -8.680  1.00 45.82  ? 569 HIS A ND1 1 
ATOM   2199 C CD2 . HIS A 1 324 ? 33.708 -11.906 -9.409  1.00 45.80  ? 569 HIS A CD2 1 
ATOM   2200 C CE1 . HIS A 1 324 ? 33.795 -9.778  -9.938  1.00 48.71  ? 569 HIS A CE1 1 
ATOM   2201 N NE2 . HIS A 1 324 ? 33.502 -10.980 -10.402 1.00 46.35  ? 569 HIS A NE2 1 
ATOM   2202 N N   . PRO A 1 325 ? 37.312 -10.201 -7.955  1.00 45.95  ? 570 PRO A N   1 
ATOM   2203 C CA  . PRO A 1 325 ? 38.109 -8.964  -7.994  1.00 47.15  ? 570 PRO A CA  1 
ATOM   2204 C C   . PRO A 1 325 ? 37.347 -7.710  -7.616  1.00 44.26  ? 570 PRO A C   1 
ATOM   2205 O O   . PRO A 1 325 ? 37.978 -6.743  -7.172  1.00 44.16  ? 570 PRO A O   1 
ATOM   2206 C CB  . PRO A 1 325 ? 38.580 -8.896  -9.452  1.00 49.54  ? 570 PRO A CB  1 
ATOM   2207 C CG  . PRO A 1 325 ? 38.504 -10.285 -9.944  1.00 48.26  ? 570 PRO A CG  1 
ATOM   2208 C CD  . PRO A 1 325 ? 37.350 -10.916 -9.241  1.00 46.96  ? 570 PRO A CD  1 
ATOM   2209 N N   . PHE A 1 326 ? 36.027 -7.673  -7.805  1.00 41.32  ? 571 PHE A N   1 
ATOM   2210 C CA  . PHE A 1 326 ? 35.270 -6.498  -7.388  1.00 43.15  ? 571 PHE A CA  1 
ATOM   2211 C C   . PHE A 1 326 ? 35.491 -6.174  -5.917  1.00 44.61  ? 571 PHE A C   1 
ATOM   2212 O O   . PHE A 1 326 ? 35.502 -4.997  -5.539  1.00 42.02  ? 571 PHE A O   1 
ATOM   2213 C CB  . PHE A 1 326 ? 33.772 -6.680  -7.656  1.00 41.04  ? 571 PHE A CB  1 
ATOM   2214 C CG  . PHE A 1 326 ? 32.921 -5.591  -7.050  1.00 40.73  ? 571 PHE A CG  1 
ATOM   2215 C CD1 . PHE A 1 326 ? 32.977 -4.295  -7.545  1.00 39.17  ? 571 PHE A CD1 1 
ATOM   2216 C CD2 . PHE A 1 326 ? 32.096 -5.852  -5.972  1.00 39.11  ? 571 PHE A CD2 1 
ATOM   2217 C CE1 . PHE A 1 326 ? 32.217 -3.281  -6.989  1.00 38.79  ? 571 PHE A CE1 1 
ATOM   2218 C CE2 . PHE A 1 326 ? 31.324 -4.841  -5.406  1.00 42.99  ? 571 PHE A CE2 1 
ATOM   2219 C CZ  . PHE A 1 326 ? 31.389 -3.548  -5.917  1.00 40.12  ? 571 PHE A CZ  1 
ATOM   2220 N N   . LEU A 1 327 ? 35.683 -7.193  -5.075  1.00 41.89  ? 572 LEU A N   1 
ATOM   2221 C CA  . LEU A 1 327 ? 35.858 -6.951  -3.647  1.00 40.03  ? 572 LEU A CA  1 
ATOM   2222 C C   . LEU A 1 327 ? 37.219 -6.356  -3.312  1.00 44.12  ? 572 LEU A C   1 
ATOM   2223 O O   . LEU A 1 327 ? 37.397 -5.871  -2.189  1.00 43.03  ? 572 LEU A O   1 
ATOM   2224 C CB  . LEU A 1 327 ? 35.654 -8.244  -2.860  1.00 37.99  ? 572 LEU A CB  1 
ATOM   2225 C CG  . LEU A 1 327 ? 34.249 -8.851  -2.893  1.00 37.53  ? 572 LEU A CG  1 
ATOM   2226 C CD1 . LEU A 1 327 ? 34.224 -10.094 -2.022  1.00 42.50  ? 572 LEU A CD1 1 
ATOM   2227 C CD2 . LEU A 1 327 ? 33.187 -7.860  -2.426  1.00 36.23  ? 572 LEU A CD2 1 
ATOM   2228 N N   . ALA A 1 328 ? 38.174 -6.384  -4.247  1.00 41.93  ? 573 ALA A N   1 
ATOM   2229 C CA  . ALA A 1 328 ? 39.419 -5.639  -4.072  1.00 47.37  ? 573 ALA A CA  1 
ATOM   2230 C C   . ALA A 1 328 ? 39.184 -4.142  -3.941  1.00 48.88  ? 573 ALA A C   1 
ATOM   2231 O O   . ALA A 1 328 ? 40.085 -3.420  -3.494  1.00 45.64  ? 573 ALA A O   1 
ATOM   2232 C CB  . ALA A 1 328 ? 40.369 -5.890  -5.248  1.00 46.53  ? 573 ALA A CB  1 
ATOM   2233 N N   . LYS A 1 329 ? 38.010 -3.655  -4.347  1.00 43.51  ? 574 LYS A N   1 
ATOM   2234 C CA  . LYS A 1 329 ? 37.677 -2.243  -4.212  1.00 45.24  ? 574 LYS A CA  1 
ATOM   2235 C C   . LYS A 1 329 ? 37.226 -1.883  -2.805  1.00 44.09  ? 574 LYS A C   1 
ATOM   2236 O O   . LYS A 1 329 ? 37.052 -0.695  -2.519  1.00 43.59  ? 574 LYS A O   1 
ATOM   2237 C CB  . LYS A 1 329 ? 36.570 -1.854  -5.196  1.00 43.46  ? 574 LYS A CB  1 
ATOM   2238 C CG  . LYS A 1 329 ? 36.961 -1.870  -6.662  1.00 45.10  ? 574 LYS A CG  1 
ATOM   2239 C CD  . LYS A 1 329 ? 35.741 -1.576  -7.533  1.00 48.74  ? 574 LYS A CD  1 
ATOM   2240 C CE  . LYS A 1 329 ? 36.047 -1.695  -9.018  1.00 54.14  ? 574 LYS A CE  1 
ATOM   2241 N NZ  . LYS A 1 329 ? 36.930 -0.603  -9.518  1.00 61.33  ? 574 LYS A NZ  1 
ATOM   2242 N N   . ALA A 1 330 ? 37.030 -2.874  -1.936  1.00 40.69  ? 575 ALA A N   1 
ATOM   2243 C CA  . ALA A 1 330 ? 36.395 -2.630  -0.647  1.00 40.28  ? 575 ALA A CA  1 
ATOM   2244 C C   . ALA A 1 330 ? 37.200 -1.627  0.167   1.00 43.75  ? 575 ALA A C   1 
ATOM   2245 O O   . ALA A 1 330 ? 38.417 -1.755  0.306   1.00 43.25  ? 575 ALA A O   1 
ATOM   2246 C CB  . ALA A 1 330 ? 36.245 -3.943  0.117   1.00 41.42  ? 575 ALA A CB  1 
ATOM   2247 N N   . GLY A 1 331 ? 36.524 -0.605  0.676   1.00 42.02  ? 576 GLY A N   1 
ATOM   2248 C CA  . GLY A 1 331 ? 37.168 0.341   1.554   1.00 43.96  ? 576 GLY A CA  1 
ATOM   2249 C C   . GLY A 1 331 ? 37.121 -0.130  2.992   1.00 44.23  ? 576 GLY A C   1 
ATOM   2250 O O   . GLY A 1 331 ? 36.462 -1.124  3.324   1.00 39.09  ? 576 GLY A O   1 
ATOM   2251 N N   . PRO A 1 332 ? 37.812 0.579   3.880   1.00 42.49  ? 577 PRO A N   1 
ATOM   2252 C CA  . PRO A 1 332 ? 37.717 0.271   5.310   1.00 41.59  ? 577 PRO A CA  1 
ATOM   2253 C C   . PRO A 1 332 ? 36.369 0.708   5.853   1.00 40.53  ? 577 PRO A C   1 
ATOM   2254 O O   . PRO A 1 332 ? 35.646 1.468   5.188   1.00 42.04  ? 577 PRO A O   1 
ATOM   2255 C CB  . PRO A 1 332 ? 38.858 1.096   5.923   1.00 45.16  ? 577 PRO A CB  1 
ATOM   2256 C CG  . PRO A 1 332 ? 38.958 2.281   5.018   1.00 49.45  ? 577 PRO A CG  1 
ATOM   2257 C CD  . PRO A 1 332 ? 38.658 1.760   3.627   1.00 47.35  ? 577 PRO A CD  1 
ATOM   2258 N N   . PRO A 1 333 ? 35.991 0.255   7.054   1.00 41.16  ? 578 PRO A N   1 
ATOM   2259 C CA  . PRO A 1 333 ? 34.727 0.732   7.642   1.00 42.82  ? 578 PRO A CA  1 
ATOM   2260 C C   . PRO A 1 333 ? 34.618 2.249   7.669   1.00 41.61  ? 578 PRO A C   1 
ATOM   2261 O O   . PRO A 1 333 ? 33.511 2.790   7.532   1.00 43.75  ? 578 PRO A O   1 
ATOM   2262 C CB  . PRO A 1 333 ? 34.761 0.141   9.058   1.00 43.93  ? 578 PRO A CB  1 
ATOM   2263 C CG  . PRO A 1 333 ? 35.606 -1.087  8.923   1.00 45.64  ? 578 PRO A CG  1 
ATOM   2264 C CD  . PRO A 1 333 ? 36.674 -0.716  7.930   1.00 43.62  ? 578 PRO A CD  1 
ATOM   2265 N N   . ALA A 1 334 ? 35.747 2.949   7.819   1.00 43.80  ? 579 ALA A N   1 
ATOM   2266 C CA  . ALA A 1 334 ? 35.717 4.409   7.866   1.00 44.15  ? 579 ALA A CA  1 
ATOM   2267 C C   . ALA A 1 334 ? 35.051 5.005   6.632   1.00 44.38  ? 579 ALA A C   1 
ATOM   2268 O O   . ALA A 1 334 ? 34.421 6.065   6.721   1.00 44.15  ? 579 ALA A O   1 
ATOM   2269 C CB  . ALA A 1 334 ? 37.134 4.954   8.027   1.00 46.10  ? 579 ALA A CB  1 
ATOM   2270 N N   . SER A 1 335 ? 35.145 4.327   5.484   1.00 41.67  ? 580 SER A N   1 
ATOM   2271 C CA  . SER A 1 335 ? 34.586 4.874   4.251   1.00 44.08  ? 580 SER A CA  1 
ATOM   2272 C C   . SER A 1 335 ? 33.063 4.844   4.248   1.00 41.49  ? 580 SER A C   1 
ATOM   2273 O O   . SER A 1 335 ? 32.447 5.552   3.445   1.00 40.39  ? 580 SER A O   1 
ATOM   2274 C CB  . SER A 1 335 ? 35.136 4.115   3.044   1.00 41.70  ? 580 SER A CB  1 
ATOM   2275 O OG  . SER A 1 335 ? 34.631 2.794   3.026   1.00 43.74  ? 580 SER A OG  1 
ATOM   2276 N N   . ILE A 1 336 ? 32.461 4.036   5.119   1.00 40.33  ? 581 ILE A N   1 
ATOM   2277 C CA  A ILE A 1 336 ? 31.009 3.969   5.248   0.34 39.95  ? 581 ILE A CA  1 
ATOM   2278 C CA  B ILE A 1 336 ? 31.008 3.972   5.242   0.66 39.41  ? 581 ILE A CA  1 
ATOM   2279 C C   . ILE A 1 336 ? 30.467 5.051   6.184   1.00 42.21  ? 581 ILE A C   1 
ATOM   2280 O O   . ILE A 1 336 ? 29.324 5.497   6.021   1.00 45.09  ? 581 ILE A O   1 
ATOM   2281 C CB  A ILE A 1 336 ? 30.601 2.566   5.734   0.34 40.40  ? 581 ILE A CB  1 
ATOM   2282 C CB  B ILE A 1 336 ? 30.611 2.553   5.700   0.66 40.21  ? 581 ILE A CB  1 
ATOM   2283 C CG1 A ILE A 1 336 ? 31.175 1.489   4.813   0.34 40.23  ? 581 ILE A CG1 1 
ATOM   2284 C CG1 B ILE A 1 336 ? 30.812 1.560   4.551   0.66 39.87  ? 581 ILE A CG1 1 
ATOM   2285 C CG2 A ILE A 1 336 ? 29.092 2.426   5.787   0.34 41.32  ? 581 ILE A CG2 1 
ATOM   2286 C CG2 B ILE A 1 336 ? 29.175 2.488   6.217   0.66 41.33  ? 581 ILE A CG2 1 
ATOM   2287 C CD1 A ILE A 1 336 ? 30.538 1.474   3.453   0.34 37.61  ? 581 ILE A CD1 1 
ATOM   2288 C CD1 B ILE A 1 336 ? 30.713 0.119   4.966   0.66 39.24  ? 581 ILE A CD1 1 
ATOM   2289 N N   . VAL A 1 337 ? 31.276 5.492   7.155   1.00 44.93  ? 582 VAL A N   1 
ATOM   2290 C CA  . VAL A 1 337 ? 30.826 6.482   8.143   1.00 45.36  ? 582 VAL A CA  1 
ATOM   2291 C C   . VAL A 1 337 ? 30.088 7.676   7.533   1.00 46.87  ? 582 VAL A C   1 
ATOM   2292 O O   . VAL A 1 337 ? 29.021 8.038   8.050   1.00 46.25  ? 582 VAL A O   1 
ATOM   2293 C CB  . VAL A 1 337 ? 32.004 6.912   9.031   1.00 46.97  ? 582 VAL A CB  1 
ATOM   2294 C CG1 . VAL A 1 337 ? 31.607 8.082   9.943   1.00 45.68  ? 582 VAL A CG1 1 
ATOM   2295 C CG2 . VAL A 1 337 ? 32.502 5.731   9.845   1.00 49.18  ? 582 VAL A CG2 1 
ATOM   2296 N N   . PRO A 1 338 ? 30.589 8.338   6.480   1.00 46.17  ? 583 PRO A N   1 
ATOM   2297 C CA  . PRO A 1 338 ? 29.893 9.546   5.989   1.00 47.12  ? 583 PRO A CA  1 
ATOM   2298 C C   . PRO A 1 338 ? 28.505 9.279   5.419   1.00 42.14  ? 583 PRO A C   1 
ATOM   2299 O O   . PRO A 1 338 ? 27.743 10.235  5.252   1.00 42.77  ? 583 PRO A O   1 
ATOM   2300 C CB  . PRO A 1 338 ? 30.839 10.100  4.912   1.00 46.44  ? 583 PRO A CB  1 
ATOM   2301 C CG  . PRO A 1 338 ? 31.734 8.981   4.549   1.00 49.79  ? 583 PRO A CG  1 
ATOM   2302 C CD  . PRO A 1 338 ? 31.865 8.123   5.770   1.00 45.82  ? 583 PRO A CD  1 
ATOM   2303 N N   . LEU A 1 339 ? 28.143 8.028   5.141   1.00 38.96  ? 584 LEU A N   1 
ATOM   2304 C CA  . LEU A 1 339 ? 26.821 7.731   4.604   1.00 40.57  ? 584 LEU A CA  1 
ATOM   2305 C C   . LEU A 1 339 ? 25.711 7.831   5.647   1.00 43.80  ? 584 LEU A C   1 
ATOM   2306 O O   . LEU A 1 339 ? 24.545 8.005   5.272   1.00 40.88  ? 584 LEU A O   1 
ATOM   2307 C CB  . LEU A 1 339 ? 26.807 6.326   3.989   1.00 40.43  ? 584 LEU A CB  1 
ATOM   2308 C CG  . LEU A 1 339 ? 27.760 6.042   2.820   1.00 43.83  ? 584 LEU A CG  1 
ATOM   2309 C CD1 . LEU A 1 339 ? 27.821 4.549   2.533   1.00 43.56  ? 584 LEU A CD1 1 
ATOM   2310 C CD2 . LEU A 1 339 ? 27.328 6.808   1.578   1.00 45.29  ? 584 LEU A CD2 1 
ATOM   2311 N N   . MET A 1 340 ? 26.033 7.727   6.934   1.00 40.66  ? 585 MET A N   1 
ATOM   2312 C CA  . MET A 1 340 ? 25.001 7.607   7.957   1.00 41.88  ? 585 MET A CA  1 
ATOM   2313 C C   . MET A 1 340 ? 24.348 8.957   8.254   1.00 42.03  ? 585 MET A C   1 
ATOM   2314 O O   . MET A 1 340 ? 24.942 10.017  8.068   1.00 42.67  ? 585 MET A O   1 
ATOM   2315 C CB  . MET A 1 340 ? 25.589 7.010   9.225   1.00 41.87  ? 585 MET A CB  1 
ATOM   2316 C CG  . MET A 1 340 ? 25.940 5.539   9.037   1.00 45.84  ? 585 MET A CG  1 
ATOM   2317 S SD  . MET A 1 340 ? 26.624 4.779   10.512  1.00 47.80  ? 585 MET A SD  1 
ATOM   2318 C CE  . MET A 1 340 ? 28.310 5.361   10.432  1.00 45.41  ? 585 MET A CE  1 
ATOM   2319 N N   . ARG A 1 341 ? 23.100 8.892   8.738   1.00 41.27  ? 586 ARG A N   1 
ATOM   2320 C CA  . ARG A 1 341 ? 22.270 10.086  8.877   1.00 42.03  ? 586 ARG A CA  1 
ATOM   2321 C C   . ARG A 1 341 ? 22.950 11.165  9.723   1.00 48.54  ? 586 ARG A C   1 
ATOM   2322 O O   . ARG A 1 341 ? 22.970 12.341  9.338   1.00 51.39  ? 586 ARG A O   1 
ATOM   2323 C CB  . ARG A 1 341 ? 20.907 9.705   9.477   1.00 43.28  ? 586 ARG A CB  1 
ATOM   2324 C CG  . ARG A 1 341 ? 20.017 10.908  9.758   1.00 46.89  ? 586 ARG A CG  1 
ATOM   2325 C CD  . ARG A 1 341 ? 18.601 10.496  10.187  1.00 50.27  ? 586 ARG A CD  1 
ATOM   2326 N NE  . ARG A 1 341 ? 17.916 9.739   9.144   1.00 53.94  ? 586 ARG A NE  1 
ATOM   2327 C CZ  . ARG A 1 341 ? 17.334 10.293  8.082   1.00 56.41  ? 586 ARG A CZ  1 
ATOM   2328 N NH1 . ARG A 1 341 ? 17.356 11.611  7.918   1.00 52.02  ? 586 ARG A NH1 1 
ATOM   2329 N NH2 . ARG A 1 341 ? 16.731 9.529   7.180   1.00 51.52  ? 586 ARG A NH2 1 
ATOM   2330 N N   . GLN A 1 342 ? 23.524 10.789  10.870  1.00 49.66  ? 587 GLN A N   1 
ATOM   2331 C CA  . GLN A 1 342 ? 24.169 11.766  11.749  1.00 46.50  ? 587 GLN A CA  1 
ATOM   2332 C C   . GLN A 1 342 ? 25.350 12.474  11.103  1.00 45.93  ? 587 GLN A C   1 
ATOM   2333 O O   . GLN A 1 342 ? 25.839 13.471  11.658  1.00 46.55  ? 587 GLN A O   1 
ATOM   2334 C CB  . GLN A 1 342 ? 24.654 11.093  13.036  1.00 50.60  ? 587 GLN A CB  1 
ATOM   2335 C CG  . GLN A 1 342 ? 25.779 10.073  12.826  1.00 51.27  ? 587 GLN A CG  1 
ATOM   2336 C CD  . GLN A 1 342 ? 25.269 8.680   12.499  1.00 47.71  ? 587 GLN A CD  1 
ATOM   2337 O OE1 . GLN A 1 342 ? 24.092 8.487   12.187  1.00 46.72  ? 587 GLN A OE1 1 
ATOM   2338 N NE2 . GLN A 1 342 ? 26.157 7.696   12.575  1.00 50.12  ? 587 GLN A NE2 1 
ATOM   2339 N N   . ASN A 1 343 ? 25.833 11.999  9.957   1.00 43.87  ? 588 ASN A N   1 
ATOM   2340 C CA  . ASN A 1 343 ? 27.008 12.613  9.346   1.00 46.63  ? 588 ASN A CA  1 
ATOM   2341 C C   . ASN A 1 343 ? 26.764 13.217  7.972   1.00 47.93  ? 588 ASN A C   1 
ATOM   2342 O O   . ASN A 1 343 ? 27.600 13.997  7.512   1.00 49.90  ? 588 ASN A O   1 
ATOM   2343 C CB  . ASN A 1 343 ? 28.153 11.591  9.237   1.00 47.37  ? 588 ASN A CB  1 
ATOM   2344 C CG  . ASN A 1 343 ? 28.553 11.028  10.583  1.00 46.51  ? 588 ASN A CG  1 
ATOM   2345 O OD1 . ASN A 1 343 ? 28.644 11.758  11.570  1.00 47.89  ? 588 ASN A OD1 1 
ATOM   2346 N ND2 . ASN A 1 343 ? 28.767 9.714   10.636  1.00 44.30  ? 588 ASN A ND2 1 
ATOM   2347 N N   . ARG A 1 344 ? 25.668 12.890  7.303   1.00 51.19  ? 589 ARG A N   1 
ATOM   2348 C CA  . ARG A 1 344 ? 25.521 13.392  5.948   1.00 58.86  ? 589 ARG A CA  1 
ATOM   2349 C C   . ARG A 1 344 ? 24.739 14.707  5.942   1.00 66.49  ? 589 ARG A C   1 
ATOM   2350 O O   . ARG A 1 344 ? 24.175 15.137  6.953   1.00 65.23  ? 589 ARG A O   1 
ATOM   2351 C CB  . ARG A 1 344 ? 24.878 12.337  5.038   1.00 52.84  ? 589 ARG A CB  1 
ATOM   2352 C CG  . ARG A 1 344 ? 23.621 11.689  5.563   1.00 51.82  ? 589 ARG A CG  1 
ATOM   2353 C CD  . ARG A 1 344 ? 22.971 10.796  4.517   1.00 45.90  ? 589 ARG A CD  1 
ATOM   2354 N NE  . ARG A 1 344 ? 21.553 10.619  4.817   1.00 43.33  ? 589 ARG A NE  1 
ATOM   2355 C CZ  . ARG A 1 344 ? 21.007 9.514   5.314   1.00 42.96  ? 589 ARG A CZ  1 
ATOM   2356 N NH1 . ARG A 1 344 ? 19.701 9.486   5.567   1.00 44.42  ? 589 ARG A NH1 1 
ATOM   2357 N NH2 . ARG A 1 344 ? 21.748 8.429   5.540   1.00 40.93  ? 589 ARG A NH2 1 
ATOM   2358 N N   . THR A 1 345 ? 24.746 15.368  4.785   1.00 71.66  ? 590 THR A N   1 
ATOM   2359 C CA  . THR A 1 345 ? 24.079 16.660  4.622   1.00 73.91  ? 590 THR A CA  1 
ATOM   2360 C C   . THR A 1 345 ? 23.112 16.656  3.437   1.00 72.82  ? 590 THR A C   1 
ATOM   2361 O O   . THR A 1 345 ? 22.013 16.100  3.518   1.00 69.89  ? 590 THR A O   1 
ATOM   2362 C CB  . THR A 1 345 ? 25.100 17.806  4.430   1.00 71.21  ? 590 THR A CB  1 
ATOM   2363 O OG1 . THR A 1 345 ? 24.406 19.031  4.157   1.00 73.33  ? 590 THR A OG1 1 
ATOM   2364 C CG2 . THR A 1 345 ? 26.058 17.496  3.278   1.00 66.46  ? 590 THR A CG2 1 
ATOM   2365 N N   . LYS B 2 2   ? 3.909  -1.783  4.218   1.00 81.67  ? 504 LYS B N   1 
ATOM   2366 C CA  . LYS B 2 2   ? 4.593  -2.975  4.713   1.00 74.84  ? 504 LYS B CA  1 
ATOM   2367 C C   . LYS B 2 2   ? 5.213  -3.764  3.559   1.00 67.41  ? 504 LYS B C   1 
ATOM   2368 O O   . LYS B 2 2   ? 5.428  -4.978  3.652   1.00 63.51  ? 504 LYS B O   1 
ATOM   2369 C CB  . LYS B 2 2   ? 3.626  -3.847  5.519   1.00 79.92  ? 504 LYS B CB  1 
ATOM   2370 C CG  . LYS B 2 2   ? 3.021  -3.122  6.722   1.00 83.82  ? 504 LYS B CG  1 
ATOM   2371 C CD  . LYS B 2 2   ? 2.684  -4.073  7.867   1.00 85.23  ? 504 LYS B CD  1 
ATOM   2372 C CE  . LYS B 2 2   ? 1.355  -4.780  7.656   1.00 87.43  ? 504 LYS B CE  1 
ATOM   2373 N NZ  . LYS B 2 2   ? 0.964  -5.602  8.837   1.00 87.61  ? 504 LYS B NZ  1 
ATOM   2374 N N   . LYS B 2 3   ? 5.521  -3.045  2.475   1.00 63.99  ? 505 LYS B N   1 
ATOM   2375 C CA  . LYS B 2 3   ? 6.118  -3.642  1.282   1.00 61.38  ? 505 LYS B CA  1 
ATOM   2376 C C   . LYS B 2 3   ? 7.492  -4.251  1.546   1.00 54.86  ? 505 LYS B C   1 
ATOM   2377 O O   . LYS B 2 3   ? 7.941  -5.114  0.780   1.00 54.82  ? 505 LYS B O   1 
ATOM   2378 C CB  . LYS B 2 3   ? 6.234  -2.579  0.193   1.00 65.31  ? 505 LYS B CB  1 
ATOM   2379 C CG  . LYS B 2 3   ? 6.016  -3.088  -1.205  1.00 69.42  ? 505 LYS B CG  1 
ATOM   2380 C CD  . LYS B 2 3   ? 5.611  -1.958  -2.135  1.00 65.98  ? 505 LYS B CD  1 
ATOM   2381 C CE  . LYS B 2 3   ? 6.629  -0.838  -2.093  1.00 62.81  ? 505 LYS B CE  1 
ATOM   2382 N NZ  . LYS B 2 3   ? 6.417  0.146   -3.187  1.00 66.28  ? 505 LYS B NZ  1 
ATOM   2383 N N   . ARG B 2 4   ? 8.180  -3.813  2.596   1.00 53.58  ? 506 ARG B N   1 
ATOM   2384 C CA  . ARG B 2 4   ? 9.507  -4.320  2.922   1.00 49.47  ? 506 ARG B CA  1 
ATOM   2385 C C   . ARG B 2 4   ? 9.468  -5.440  3.966   1.00 56.24  ? 506 ARG B C   1 
ATOM   2386 O O   . ARG B 2 4   ? 10.527 -5.886  4.426   1.00 49.44  ? 506 ARG B O   1 
ATOM   2387 C CB  . ARG B 2 4   ? 10.407 -3.174  3.409   1.00 48.31  ? 506 ARG B CB  1 
ATOM   2388 C CG  . ARG B 2 4   ? 10.452 -1.914  2.506   1.00 47.56  ? 506 ARG B CG  1 
ATOM   2389 C CD  . ARG B 2 4   ? 11.534 -0.915  2.965   1.00 42.30  ? 506 ARG B CD  1 
ATOM   2390 N NE  . ARG B 2 4   ? 12.863 -1.516  2.845   1.00 36.96  ? 506 ARG B NE  1 
ATOM   2391 C CZ  . ARG B 2 4   ? 13.666 -1.348  1.798   1.00 35.20  ? 506 ARG B CZ  1 
ATOM   2392 N NH1 . ARG B 2 4   ? 14.843 -1.947  1.764   1.00 29.16  ? 506 ARG B NH1 1 
ATOM   2393 N NH2 . ARG B 2 4   ? 13.293 -0.564  0.786   1.00 35.55  ? 506 ARG B NH2 1 
ATOM   2394 N N   . TYR B 2 5   ? 8.280  -5.914  4.342   1.00 58.86  ? 507 TYR B N   1 
ATOM   2395 C CA  . TYR B 2 5   ? 8.156  -6.870  5.435   1.00 57.68  ? 507 TYR B CA  1 
ATOM   2396 C C   . TYR B 2 5   ? 8.305  -8.305  4.940   1.00 57.73  ? 507 TYR B C   1 
ATOM   2397 O O   . TYR B 2 5   ? 7.854  -8.658  3.844   1.00 58.14  ? 507 TYR B O   1 
ATOM   2398 C CB  . TYR B 2 5   ? 6.820  -6.705  6.162   1.00 61.28  ? 507 TYR B CB  1 
ATOM   2399 C CG  . TYR B 2 5   ? 6.833  -5.640  7.238   1.00 66.92  ? 507 TYR B CG  1 
ATOM   2400 C CD1 . TYR B 2 5   ? 7.829  -4.670  7.273   1.00 68.62  ? 507 TYR B CD1 1 
ATOM   2401 C CD2 . TYR B 2 5   ? 5.858  -5.614  8.228   1.00 71.69  ? 507 TYR B CD2 1 
ATOM   2402 C CE1 . TYR B 2 5   ? 7.846  -3.698  8.255   1.00 72.00  ? 507 TYR B CE1 1 
ATOM   2403 C CE2 . TYR B 2 5   ? 5.867  -4.647  9.214   1.00 73.80  ? 507 TYR B CE2 1 
ATOM   2404 C CZ  . TYR B 2 5   ? 6.863  -3.691  9.223   1.00 75.33  ? 507 TYR B CZ  1 
ATOM   2405 O OH  . TYR B 2 5   ? 6.876  -2.726  10.204  1.00 81.39  ? 507 TYR B OH  1 
ATOM   2406 N N   . THR B 2 6   ? 8.950  -9.124  5.767   1.00 55.12  ? 508 THR B N   1 
ATOM   2407 C CA  . THR B 2 6   ? 9.123  -10.542 5.482   1.00 53.82  ? 508 THR B CA  1 
ATOM   2408 C C   . THR B 2 6   ? 7.782  -11.261 5.474   1.00 57.39  ? 508 THR B C   1 
ATOM   2409 O O   . THR B 2 6   ? 6.901  -10.970 6.285   1.00 59.57  ? 508 THR B O   1 
ATOM   2410 C CB  . THR B 2 6   ? 10.018 -11.184 6.542   1.00 51.95  ? 508 THR B CB  1 
ATOM   2411 O OG1 . THR B 2 6   ? 11.137 -10.333 6.810   1.00 49.72  ? 508 THR B OG1 1 
ATOM   2412 C CG2 . THR B 2 6   ? 10.498 -12.565 6.096   1.00 50.05  ? 508 THR B CG2 1 
ATOM   2413 N N   . VAL B 2 7   ? 7.644  -12.235 4.582   1.00 57.82  ? 509 VAL B N   1 
ATOM   2414 C CA  . VAL B 2 7   ? 6.436  -13.046 4.546   1.00 61.13  ? 509 VAL B CA  1 
ATOM   2415 C C   . VAL B 2 7   ? 6.819  -14.496 4.803   1.00 60.27  ? 509 VAL B C   1 
ATOM   2416 O O   . VAL B 2 7   ? 7.906  -14.960 4.443   1.00 57.57  ? 509 VAL B O   1 
ATOM   2417 C CB  . VAL B 2 7   ? 5.654  -12.900 3.221   1.00 63.78  ? 509 VAL B CB  1 
ATOM   2418 C CG1 . VAL B 2 7   ? 5.474  -11.419 2.860   1.00 64.25  ? 509 VAL B CG1 1 
ATOM   2419 C CG2 . VAL B 2 7   ? 6.332  -13.657 2.104   1.00 63.89  ? 509 VAL B CG2 1 
ATOM   2420 N N   . VAL B 2 8   ? 5.915  -15.205 5.463   1.00 62.63  ? 510 VAL B N   1 
ATOM   2421 C CA  . VAL B 2 8   ? 6.111  -16.602 5.814   1.00 67.71  ? 510 VAL B CA  1 
ATOM   2422 C C   . VAL B 2 8   ? 4.930  -17.371 5.246   1.00 66.90  ? 510 VAL B C   1 
ATOM   2423 O O   . VAL B 2 8   ? 3.775  -17.071 5.574   1.00 70.52  ? 510 VAL B O   1 
ATOM   2424 C CB  . VAL B 2 8   ? 6.241  -16.794 7.332   1.00 64.78  ? 510 VAL B CB  1 
ATOM   2425 C CG1 . VAL B 2 8   ? 6.531  -18.218 7.634   1.00 66.15  ? 510 VAL B CG1 1 
ATOM   2426 C CG2 . VAL B 2 8   ? 7.360  -15.917 7.867   1.00 57.99  ? 510 VAL B CG2 1 
ATOM   2427 N N   . GLY B 2 9   ? 5.223  -18.341 4.379   1.00 70.84  ? 511 GLY B N   1 
ATOM   2428 C CA  . GLY B 2 9   ? 4.187  -18.974 3.583   1.00 75.63  ? 511 GLY B CA  1 
ATOM   2429 C C   . GLY B 2 9   ? 3.155  -19.695 4.425   1.00 85.63  ? 511 GLY B C   1 
ATOM   2430 O O   . GLY B 2 9   ? 3.391  -20.077 5.574   1.00 88.87  ? 511 GLY B O   1 
ATOM   2431 N N   . ASN B 2 10  ? 1.988  -19.895 3.816   1.00 93.64  ? 512 ASN B N   1 
ATOM   2432 C CA  . ASN B 2 10  ? 0.839  -20.470 4.504   1.00 95.84  ? 512 ASN B CA  1 
ATOM   2433 C C   . ASN B 2 10  ? 0.971  -21.984 4.723   1.00 96.67  ? 512 ASN B C   1 
ATOM   2434 O O   . ASN B 2 10  ? 1.204  -22.755 3.789   1.00 93.23  ? 512 ASN B O   1 
ATOM   2435 C CB  . ASN B 2 10  ? -0.452 -20.152 3.731   1.00 102.93 ? 512 ASN B CB  1 
ATOM   2436 C CG  . ASN B 2 10  ? -0.456 -20.720 2.318   1.00 105.90 ? 512 ASN B CG  1 
ATOM   2437 O OD1 . ASN B 2 10  ? 0.585  -20.813 1.664   1.00 102.91 ? 512 ASN B OD1 1 
ATOM   2438 N ND2 . ASN B 2 10  ? -1.637 -21.105 1.842   1.00 108.10 ? 512 ASN B ND2 1 
HETATM 2439 O O   . HOH C 3 .   ? 12.083 -2.155  10.095  1.00 30.17  ? 601 HOH A O   1 
HETATM 2440 O O   . HOH C 3 .   ? 21.472 6.474   8.045   1.00 35.17  ? 602 HOH A O   1 
HETATM 2441 O O   . HOH C 3 .   ? 17.258 -5.728  11.216  1.00 64.12  ? 603 HOH A O   1 
HETATM 2442 O O   . HOH C 3 .   ? 15.240 -7.284  8.403   1.00 46.97  ? 604 HOH A O   1 
HETATM 2443 O O   . HOH C 3 .   ? 25.202 -32.777 7.256   1.00 53.61  ? 605 HOH A O   1 
HETATM 2444 O O   . HOH C 3 .   ? 23.413 -9.582  -13.529 1.00 57.76  ? 606 HOH A O   1 
HETATM 2445 O O   . HOH C 3 .   ? 26.860 -0.567  20.435  1.00 52.18  ? 607 HOH A O   1 
HETATM 2446 O O   . HOH C 3 .   ? 10.285 -12.768 32.737  1.00 55.04  ? 608 HOH A O   1 
HETATM 2447 O O   . HOH C 3 .   ? 25.601 -22.268 -6.362  1.00 42.11  ? 609 HOH A O   1 
HETATM 2448 O O   . HOH C 3 .   ? 21.192 -7.873  -13.985 1.00 50.23  ? 610 HOH A O   1 
HETATM 2449 O O   . HOH C 3 .   ? 22.299 -27.635 0.035   1.00 61.08  ? 611 HOH A O   1 
HETATM 2450 O O   . HOH C 3 .   ? 2.374  -21.386 29.928  1.00 45.46  ? 612 HOH A O   1 
HETATM 2451 O O   . HOH C 3 .   ? 13.391 1.847   34.709  1.00 46.69  ? 613 HOH A O   1 
HETATM 2452 O O   . HOH C 3 .   ? 12.235 -13.140 14.833  1.00 40.80  ? 614 HOH A O   1 
HETATM 2453 O O   . HOH C 3 .   ? 36.883 -18.158 -0.023  1.00 46.36  ? 615 HOH A O   1 
HETATM 2454 O O   . HOH C 3 .   ? 25.413 -20.064 -4.561  1.00 38.00  ? 616 HOH A O   1 
HETATM 2455 O O   . HOH C 3 .   ? 12.802 -15.475 31.071  1.00 37.98  ? 617 HOH A O   1 
HETATM 2456 O O   . HOH C 3 .   ? 27.380 -19.873 -0.141  1.00 36.27  ? 618 HOH A O   1 
HETATM 2457 O O   . HOH C 3 .   ? 36.243 6.030   -3.276  1.00 59.73  ? 619 HOH A O   1 
HETATM 2458 O O   . HOH C 3 .   ? 31.169 -21.259 2.913   1.00 42.29  ? 620 HOH A O   1 
HETATM 2459 O O   . HOH C 3 .   ? 21.979 3.892   8.629   1.00 36.70  ? 621 HOH A O   1 
HETATM 2460 O O   . HOH C 3 .   ? 21.847 8.844   -16.143 1.00 41.02  ? 622 HOH A O   1 
HETATM 2461 O O   . HOH C 3 .   ? 12.097 -0.840  -8.829  1.00 47.06  ? 623 HOH A O   1 
HETATM 2462 O O   . HOH C 3 .   ? 29.597 -8.693  16.516  1.00 55.44  ? 624 HOH A O   1 
HETATM 2463 O O   . HOH C 3 .   ? 36.545 -11.740 10.354  1.00 65.68  ? 625 HOH A O   1 
HETATM 2464 O O   . HOH C 3 .   ? 8.875  -15.460 32.293  1.00 44.57  ? 626 HOH A O   1 
HETATM 2465 O O   . HOH C 3 .   ? 35.343 7.985   8.335   1.00 50.91  ? 627 HOH A O   1 
HETATM 2466 O O   . HOH C 3 .   ? 19.189 -14.817 33.884  1.00 57.75  ? 628 HOH A O   1 
HETATM 2467 O O   . HOH C 3 .   ? 14.286 -11.606 12.523  1.00 44.50  ? 629 HOH A O   1 
HETATM 2468 O O   . HOH C 3 .   ? 0.781  -17.806 20.871  1.00 49.90  ? 630 HOH A O   1 
HETATM 2469 O O   . HOH C 3 .   ? 29.005 7.935   -1.560  1.00 44.77  ? 631 HOH A O   1 
HETATM 2470 O O   . HOH C 3 .   ? 26.238 2.353   38.363  1.00 30.17  ? 632 HOH A O   1 
HETATM 2471 O O   . HOH C 3 .   ? 22.412 6.748   13.371  1.00 46.13  ? 633 HOH A O   1 
HETATM 2472 O O   . HOH C 3 .   ? 17.376 -25.156 -5.741  1.00 61.34  ? 634 HOH A O   1 
HETATM 2473 O O   . HOH C 3 .   ? 14.535 -13.780 -12.719 1.00 55.70  ? 635 HOH A O   1 
HETATM 2474 O O   . HOH C 3 .   ? 24.282 4.486   -5.124  1.00 46.07  ? 636 HOH A O   1 
HETATM 2475 O O   . HOH C 3 .   ? 15.499 -0.272  -1.126  1.00 38.46  ? 637 HOH A O   1 
HETATM 2476 O O   . HOH C 3 .   ? 17.703 4.171   26.462  1.00 39.33  ? 638 HOH A O   1 
HETATM 2477 O O   . HOH C 3 .   ? 13.248 3.341   32.694  1.00 50.22  ? 639 HOH A O   1 
HETATM 2478 O O   . HOH C 3 .   ? 22.173 -11.873 -14.304 1.00 49.86  ? 640 HOH A O   1 
HETATM 2479 O O   . HOH C 3 .   ? 20.827 4.850   -3.453  1.00 57.08  ? 641 HOH A O   1 
HETATM 2480 O O   . HOH C 3 .   ? 29.652 0.047   18.287  1.00 47.27  ? 642 HOH A O   1 
HETATM 2481 O O   . HOH C 3 .   ? 12.497 -7.919  -7.370  1.00 52.28  ? 643 HOH A O   1 
HETATM 2482 O O   . HOH C 3 .   ? 14.250 -15.671 1.055   1.00 35.87  ? 644 HOH A O   1 
HETATM 2483 O O   . HOH C 3 .   ? 30.751 -12.510 -14.145 1.00 50.11  ? 645 HOH A O   1 
HETATM 2484 O O   . HOH C 3 .   ? 13.396 8.125   32.719  1.00 42.59  ? 646 HOH A O   1 
HETATM 2485 O O   . HOH C 3 .   ? 16.380 -14.653 9.135   1.00 38.74  ? 647 HOH A O   1 
HETATM 2486 O O   . HOH C 3 .   ? 18.842 6.611   29.711  1.00 39.90  ? 648 HOH A O   1 
HETATM 2487 O O   . HOH C 3 .   ? 38.519 -10.422 -3.571  1.00 60.83  ? 649 HOH A O   1 
HETATM 2488 O O   . HOH C 3 .   ? 5.453  -9.011  17.791  1.00 40.81  ? 650 HOH A O   1 
HETATM 2489 O O   . HOH C 3 .   ? 12.825 -1.254  33.279  1.00 44.48  ? 651 HOH A O   1 
HETATM 2490 O O   . HOH C 3 .   ? 18.074 -11.930 14.949  1.00 44.44  ? 652 HOH A O   1 
HETATM 2491 O O   . HOH C 3 .   ? 20.144 -12.373 33.042  1.00 54.38  ? 653 HOH A O   1 
HETATM 2492 O O   . HOH C 3 .   ? 24.360 -13.565 -15.045 1.00 56.53  ? 654 HOH A O   1 
HETATM 2493 O O   . HOH C 3 .   ? 18.708 -22.966 -3.987  1.00 41.40  ? 655 HOH A O   1 
HETATM 2494 O O   . HOH C 3 .   ? 15.818 -15.563 -1.480  1.00 32.44  ? 656 HOH A O   1 
HETATM 2495 O O   . HOH C 3 .   ? 29.096 8.142   12.945  1.00 54.91  ? 657 HOH A O   1 
HETATM 2496 O O   . HOH C 3 .   ? 13.230 -29.431 4.246   1.00 43.98  ? 658 HOH A O   1 
HETATM 2497 O O   . HOH C 3 .   ? 17.752 -24.536 28.265  1.00 53.01  ? 659 HOH A O   1 
HETATM 2498 O O   . HOH C 3 .   ? 17.993 -14.274 1.788   1.00 31.92  ? 660 HOH A O   1 
HETATM 2499 O O   . HOH C 3 .   ? 15.023 -10.778 1.791   1.00 34.81  ? 661 HOH A O   1 
HETATM 2500 O O   . HOH C 3 .   ? 14.307 -11.254 -6.323  1.00 35.95  ? 662 HOH A O   1 
HETATM 2501 O O   . HOH C 3 .   ? 11.428 -27.370 4.535   1.00 36.11  ? 663 HOH A O   1 
HETATM 2502 O O   . HOH C 3 .   ? 19.869 12.975  -9.886  1.00 30.17  ? 664 HOH A O   1 
HETATM 2503 O O   . HOH C 3 .   ? 16.123 -25.168 10.550  1.00 39.91  ? 665 HOH A O   1 
HETATM 2504 O O   . HOH C 3 .   ? 6.817  -20.974 5.900   1.00 51.66  ? 666 HOH A O   1 
HETATM 2505 O O   . HOH C 3 .   ? 19.400 -19.607 25.728  1.00 51.76  ? 667 HOH A O   1 
HETATM 2506 O O   . HOH C 3 .   ? 5.828  -22.459 3.115   1.00 36.56  ? 668 HOH A O   1 
HETATM 2507 O O   . HOH C 3 .   ? 34.250 -4.878  4.644   1.00 39.37  ? 669 HOH A O   1 
HETATM 2508 O O   . HOH C 3 .   ? 34.436 6.524   -0.248  1.00 47.93  ? 670 HOH A O   1 
HETATM 2509 O O   . HOH C 3 .   ? 29.478 -22.097 -8.249  1.00 56.94  ? 671 HOH A O   1 
HETATM 2510 O O   . HOH C 3 .   ? 14.338 -19.985 31.965  1.00 46.84  ? 672 HOH A O   1 
HETATM 2511 O O   . HOH C 3 .   ? 32.509 8.904   -4.371  1.00 41.68  ? 673 HOH A O   1 
HETATM 2512 O O   . HOH C 3 .   ? 15.447 -31.755 1.883   1.00 48.80  ? 674 HOH A O   1 
HETATM 2513 O O   . HOH C 3 .   ? 36.227 3.596   11.321  1.00 55.23  ? 675 HOH A O   1 
HETATM 2514 O O   . HOH C 3 .   ? 29.596 14.492  11.497  1.00 53.43  ? 676 HOH A O   1 
HETATM 2515 O O   . HOH C 3 .   ? 35.270 -14.532 8.286   1.00 58.53  ? 677 HOH A O   1 
HETATM 2516 O O   . HOH C 3 .   ? 16.044 -1.276  -9.335  1.00 47.43  ? 678 HOH A O   1 
HETATM 2517 O O   . HOH C 3 .   ? 38.038 2.078   9.369   1.00 45.00  ? 679 HOH A O   1 
HETATM 2518 O O   . HOH C 3 .   ? 2.938  -9.476  27.570  1.00 51.04  ? 680 HOH A O   1 
HETATM 2519 O O   . HOH C 3 .   ? 11.195 -8.137  13.581  1.00 57.52  ? 681 HOH A O   1 
HETATM 2520 O O   . HOH C 3 .   ? 22.210 -2.672  35.169  1.00 39.73  ? 682 HOH A O   1 
HETATM 2521 O O   . HOH C 3 .   ? 13.841 -12.850 0.475   1.00 33.05  ? 683 HOH A O   1 
HETATM 2522 O O   . HOH C 3 .   ? 6.554  -16.065 11.791  1.00 42.26  ? 684 HOH A O   1 
HETATM 2523 O O   . HOH C 3 .   ? 6.646  -4.688  25.859  1.00 49.39  ? 685 HOH A O   1 
HETATM 2524 O O   . HOH C 3 .   ? 22.499 -35.299 1.330   1.00 57.22  ? 686 HOH A O   1 
HETATM 2525 O O   . HOH C 3 .   ? 5.545  -8.091  27.440  1.00 58.80  ? 687 HOH A O   1 
HETATM 2526 O O   . HOH C 3 .   ? 11.148 -15.616 14.265  1.00 34.68  ? 688 HOH A O   1 
HETATM 2527 O O   . HOH C 3 .   ? 15.601 -25.698 31.093  1.00 54.98  ? 689 HOH A O   1 
HETATM 2528 O O   . HOH C 3 .   ? 20.588 -16.727 -15.218 1.00 48.00  ? 690 HOH A O   1 
HETATM 2529 O O   . HOH C 3 .   ? 2.641  -21.041 14.854  1.00 51.10  ? 691 HOH A O   1 
HETATM 2530 O O   . HOH C 3 .   ? 0.604  -8.650  -3.695  1.00 55.76  ? 692 HOH A O   1 
HETATM 2531 O O   . HOH C 3 .   ? 14.377 -6.051  -15.579 1.00 59.01  ? 693 HOH A O   1 
HETATM 2532 O O   . HOH C 3 .   ? 1.364  -13.774 30.085  1.00 60.85  ? 694 HOH A O   1 
HETATM 2533 O O   . HOH C 3 .   ? 15.810 -2.315  9.649   1.00 41.08  ? 695 HOH A O   1 
HETATM 2534 O O   . HOH C 3 .   ? 27.457 -15.949 -14.068 1.00 49.38  ? 696 HOH A O   1 
HETATM 2535 O O   . HOH C 3 .   ? 30.150 -20.632 0.457   1.00 35.76  ? 697 HOH A O   1 
HETATM 2536 O O   . HOH C 3 .   ? 23.590 3.002   38.589  1.00 57.14  ? 698 HOH A O   1 
HETATM 2537 O O   . HOH C 3 .   ? 32.823 -16.609 -9.439  1.00 58.06  ? 699 HOH A O   1 
HETATM 2538 O O   . HOH C 3 .   ? 19.853 4.672   33.787  1.00 44.52  ? 700 HOH A O   1 
HETATM 2539 O O   . HOH C 3 .   ? 8.307  -16.045 13.832  1.00 39.47  ? 701 HOH A O   1 
HETATM 2540 O O   . HOH C 3 .   ? 19.439 -28.560 14.743  1.00 48.57  ? 702 HOH A O   1 
HETATM 2541 O O   . HOH C 3 .   ? 9.163  4.530   22.451  1.00 42.69  ? 703 HOH A O   1 
HETATM 2542 O O   . HOH C 3 .   ? 28.250 -12.429 16.873  1.00 51.69  ? 704 HOH A O   1 
HETATM 2543 O O   . HOH C 3 .   ? 23.040 -26.983 10.402  1.00 60.39  ? 705 HOH A O   1 
HETATM 2544 O O   . HOH C 3 .   ? 20.759 -19.636 -15.228 1.00 54.26  ? 706 HOH A O   1 
HETATM 2545 O O   . HOH C 3 .   ? 37.975 -12.558 3.598   1.00 57.01  ? 707 HOH A O   1 
HETATM 2546 O O   . HOH C 3 .   ? 22.087 -5.201  -14.958 1.00 45.91  ? 708 HOH A O   1 
HETATM 2547 O O   . HOH C 3 .   ? 26.750 2.514   24.606  1.00 51.84  ? 709 HOH A O   1 
HETATM 2548 O O   . HOH C 3 .   ? 9.886  5.680   24.784  1.00 55.12  ? 710 HOH A O   1 
HETATM 2549 O O   . HOH C 3 .   ? 14.279 -23.182 11.176  1.00 46.00  ? 711 HOH A O   1 
HETATM 2550 O O   . HOH C 3 .   ? 0.336  -15.580 30.872  1.00 57.17  ? 712 HOH A O   1 
HETATM 2551 O O   . HOH C 3 .   ? 26.085 -14.028 19.821  1.00 56.71  ? 713 HOH A O   1 
HETATM 2552 O O   . HOH C 3 .   ? 25.973 -24.041 -1.957  1.00 59.86  ? 714 HOH A O   1 
HETATM 2553 O O   . HOH C 3 .   ? 5.162  -13.173 11.619  1.00 61.53  ? 715 HOH A O   1 
HETATM 2554 O O   . HOH C 3 .   ? 31.060 -22.980 -1.064  1.00 60.05  ? 716 HOH A O   1 
HETATM 2555 O O   . HOH C 3 .   ? 19.208 5.827   10.415  1.00 49.14  ? 717 HOH A O   1 
HETATM 2556 O O   . HOH C 3 .   ? 15.404 6.329   -3.281  1.00 30.17  ? 718 HOH A O   1 
HETATM 2557 O O   . HOH C 3 .   ? 17.451 2.912   10.865  1.00 30.17  ? 719 HOH A O   1 
HETATM 2558 O O   . HOH C 3 .   ? 16.287 -11.341 36.700  1.00 30.17  ? 720 HOH A O   1 
HETATM 2559 O O   . HOH C 3 .   ? 13.797 -3.676  10.640  1.00 30.17  ? 721 HOH A O   1 
HETATM 2560 O O   . HOH C 3 .   ? 20.906 6.186   -5.827  1.00 30.17  ? 722 HOH A O   1 
HETATM 2561 O O   . HOH C 3 .   ? 13.831 2.645   11.227  1.00 30.17  ? 723 HOH A O   1 
HETATM 2562 O O   . HOH C 3 .   ? 25.797 -21.240 -2.017  1.00 38.28  ? 724 HOH A O   1 
HETATM 2563 O O   . HOH C 3 .   ? 14.937 -0.504  8.007   1.00 51.38  ? 725 HOH A O   1 
HETATM 2564 O O   . HOH C 3 .   ? 38.936 -11.121 1.474   1.00 68.52  ? 726 HOH A O   1 
HETATM 2565 O O   . HOH C 3 .   ? 39.565 -9.437  0.150   1.00 70.38  ? 727 HOH A O   1 
HETATM 2566 O O   . HOH C 3 .   ? 23.119 -15.852 -16.006 1.00 57.11  ? 728 HOH A O   1 
HETATM 2567 O O   . HOH C 3 .   ? 18.930 -16.510 -17.094 1.00 57.23  ? 729 HOH A O   1 
HETATM 2568 O O   . HOH C 3 .   ? 24.580 -26.728 1.256   1.00 54.27  ? 730 HOH A O   1 
HETATM 2569 O O   . HOH D 3 .   ? 11.668 1.802   0.736   1.00 47.62  ? 601 HOH B O   1 
HETATM 2570 O O   . HOH D 3 .   ? 6.506  -7.772  1.458   1.00 50.49  ? 602 HOH B O   1 
HETATM 2571 O O   . HOH D 3 .   ? 7.254  -1.504  4.366   1.00 48.49  ? 603 HOH B O   1 
HETATM 2572 O O   . HOH D 3 .   ? 9.189  -0.737  9.414   1.00 58.08  ? 604 HOH B O   1 
HETATM 2573 O O   . HOH D 3 .   ? 4.902  -12.547 8.797   1.00 60.80  ? 605 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 54  ? 0.9490 0.7503 0.9884 -0.1962 -0.0507 -0.0361 299 VAL A N   
2    C CA  . VAL A 54  ? 0.9068 0.7526 0.9696 -0.1843 -0.0599 -0.0381 299 VAL A CA  
3    C C   . VAL A 54  ? 0.8374 0.7217 0.9311 -0.1759 -0.0476 -0.0303 299 VAL A C   
4    O O   . VAL A 54  ? 0.8244 0.7414 0.9393 -0.1610 -0.0524 -0.0300 299 VAL A O   
5    C CB  . VAL A 54  ? 0.8633 0.7341 0.9472 -0.2032 -0.0780 -0.0451 299 VAL A CB  
6    C CG1 . VAL A 54  ? 0.7831 0.6958 0.9139 -0.2212 -0.0739 -0.0421 299 VAL A CG1 
7    C CG2 . VAL A 54  ? 0.8240 0.7183 0.9118 -0.1895 -0.0948 -0.0466 299 VAL A CG2 
8    N N   . SER A 55  ? 0.7195 0.5969 0.8130 -0.1869 -0.0315 -0.0244 300 SER A N   
9    C CA  . SER A 55  ? 0.6848 0.5984 0.8046 -0.1838 -0.0163 -0.0205 300 SER A CA  
10   C C   . SER A 55  ? 0.6826 0.5961 0.7908 -0.1566 -0.0131 -0.0174 300 SER A C   
11   O O   . SER A 55  ? 0.6707 0.5475 0.7435 -0.1443 -0.0146 -0.0135 300 SER A O   
12   C CB  . SER A 55  ? 0.7595 0.6581 0.8675 -0.2040 0.0011  -0.0136 300 SER A CB  
13   O OG  . SER A 55  ? 0.7717 0.6989 0.8932 -0.2004 0.0189  -0.0114 300 SER A OG  
14   N N   . HIS A 56  ? 0.6045 0.5603 0.7472 -0.1470 -0.0092 -0.0200 301 HIS A N   
15   C CA  . HIS A 56  ? 0.5962 0.5532 0.7303 -0.1241 -0.0053 -0.0177 301 HIS A CA  
16   C C   . HIS A 56  ? 0.5823 0.5153 0.6849 -0.1254 0.0108  -0.0106 301 HIS A C   
17   O O   . HIS A 56  ? 0.5734 0.4822 0.6472 -0.1101 0.0085  -0.0056 301 HIS A O   
18   C CB  . HIS A 56  ? 0.5922 0.5960 0.7732 -0.1158 -0.0027 -0.0233 301 HIS A CB  
19   C CG  . HIS A 56  ? 0.5693 0.5742 0.7435 -0.0960 0.0042  -0.0223 301 HIS A CG  
20   N ND1 . HIS A 56  ? 0.5936 0.5810 0.7463 -0.0780 -0.0079 -0.0187 301 HIS A ND1 
21   C CD2 . HIS A 56  ? 0.5875 0.6092 0.7728 -0.0936 0.0226  -0.0259 301 HIS A CD2 
22   C CE1 . HIS A 56  ? 0.6110 0.6037 0.7632 -0.0653 0.0011  -0.0189 301 HIS A CE1 
23   N NE2 . HIS A 56  ? 0.5949 0.6071 0.7654 -0.0741 0.0194  -0.0240 301 HIS A NE2 
24   N N   . GLU A 57  ? 0.6093 0.5505 0.7170 -0.1452 0.0266  -0.0094 302 GLU A N   
25   C CA  . GLU A 57  ? 0.6707 0.5881 0.7431 -0.1505 0.0397  -0.0002 302 GLU A CA  
26   C C   . GLU A 57  ? 0.6696 0.5344 0.7014 -0.1514 0.0297  0.0104  302 GLU A C   
27   O O   . GLU A 57  ? 0.6554 0.4949 0.6565 -0.1444 0.0308  0.0202  302 GLU A O   
28   C CB  . GLU A 57  ? 0.6618 0.5992 0.7438 -0.1763 0.0602  -0.0012 302 GLU A CB  
29   C CG  . GLU A 57  ? 0.6953 0.6837 0.8177 -0.1729 0.0760  -0.0140 302 GLU A CG  
30   C CD  . GLU A 57  ? 0.7722 0.7605 0.8798 -0.1539 0.0814  -0.0150 302 GLU A CD  
31   O OE1 . GLU A 57  ? 0.8366 0.7903 0.8980 -0.1527 0.0801  -0.0037 302 GLU A OE1 
32   O OE2 . GLU A 57  ? 0.8006 0.8229 0.9453 -0.1404 0.0855  -0.0269 302 GLU A OE2 
33   N N   . GLN A 58  ? 0.6908 0.5379 0.7238 -0.1595 0.0189  0.0080  303 GLN A N   
34   C CA  . GLN A 58  ? 0.7013 0.4960 0.7014 -0.1569 0.0095  0.0147  303 GLN A CA  
35   C C   . GLN A 58  ? 0.6443 0.4278 0.6336 -0.1288 0.0005  0.0131  303 GLN A C   
36   O O   . GLN A 58  ? 0.6775 0.4285 0.6430 -0.1191 -0.0017 0.0218  303 GLN A O   
37   C CB  . GLN A 58  ? 0.7210 0.4990 0.7251 -0.1723 0.0008  0.0084  303 GLN A CB  
38   C CG  . GLN A 58  ? 0.7582 0.4775 0.7318 -0.1704 -0.0071 0.0126  303 GLN A CG  
39   C CD  . GLN A 58  ? 0.8497 0.5470 0.8234 -0.1928 -0.0127 0.0068  303 GLN A CD  
40   O OE1 . GLN A 58  ? 0.8664 0.5919 0.8609 -0.2150 -0.0092 0.0039  303 GLN A OE1 
41   N NE2 . GLN A 58  ? 0.8113 0.4588 0.7646 -0.1874 -0.0210 0.0036  303 GLN A NE2 
42   N N   . PHE A 59  ? 0.6776 0.4893 0.6859 -0.1162 -0.0052 0.0032  304 PHE A N   
43   C CA  . PHE A 59  ? 0.6585 0.4625 0.6558 -0.0928 -0.0115 0.0016  304 PHE A CA  
44   C C   . PHE A 59  ? 0.6516 0.4655 0.6440 -0.0798 -0.0050 0.0090  304 PHE A C   
45   O O   . PHE A 59  ? 0.6006 0.3969 0.5777 -0.0643 -0.0083 0.0125  304 PHE A O   
46   C CB  . PHE A 59  ? 0.6982 0.5262 0.7109 -0.0867 -0.0209 -0.0084 304 PHE A CB  
47   C CG  . PHE A 59  ? 0.6931 0.5048 0.6879 -0.0702 -0.0270 -0.0126 304 PHE A CG  
48   C CD1 . PHE A 59  ? 0.7269 0.5077 0.7045 -0.0732 -0.0315 -0.0203 304 PHE A CD1 
49   C CD2 . PHE A 59  ? 0.7549 0.5814 0.7499 -0.0531 -0.0263 -0.0103 304 PHE A CD2 
50   C CE1 . PHE A 59  ? 0.7106 0.4792 0.6730 -0.0590 -0.0330 -0.0271 304 PHE A CE1 
51   C CE2 . PHE A 59  ? 0.8063 0.6214 0.7861 -0.0403 -0.0293 -0.0147 304 PHE A CE2 
52   C CZ  . PHE A 59  ? 0.8212 0.6091 0.7854 -0.0431 -0.0315 -0.0238 304 PHE A CZ  
53   N N   . ARG A 60  ? 0.6092 0.4524 0.6161 -0.0864 0.0049  0.0098  305 ARG A N   
54   C CA  . ARG A 60  ? 0.5931 0.4418 0.5897 -0.0782 0.0118  0.0156  305 ARG A CA  
55   C C   . ARG A 60  ? 0.5793 0.3923 0.5442 -0.0814 0.0112  0.0288  305 ARG A C   
56   O O   . ARG A 60  ? 0.5956 0.3999 0.5468 -0.0678 0.0072  0.0347  305 ARG A O   
57   C CB  . ARG A 60  ? 0.5782 0.4595 0.5927 -0.0890 0.0264  0.0113  305 ARG A CB  
58   C CG  . ARG A 60  ? 0.6039 0.5218 0.6543 -0.0793 0.0260  0.0002  305 ARG A CG  
59   C CD  . ARG A 60  ? 0.6079 0.5555 0.6773 -0.0876 0.0441  -0.0066 305 ARG A CD  
60   N NE  . ARG A 60  ? 0.5745 0.5177 0.6230 -0.0804 0.0511  -0.0049 305 ARG A NE  
61   C CZ  . ARG A 60  ? 0.5843 0.5179 0.6043 -0.0940 0.0639  -0.0003 305 ARG A CZ  
62   N NH1 . ARG A 60  ? 0.6183 0.5445 0.6264 -0.1163 0.0725  0.0044  305 ARG A NH1 
63   N NH2 . ARG A 60  ? 0.5918 0.5221 0.5922 -0.0876 0.0671  0.0004  305 ARG A NH2 
64   N N   . ALA A 61  ? 0.5899 0.3823 0.5443 -0.1007 0.0136  0.0349  306 ALA A N   
65   C CA  . ALA A 61  ? 0.6299 0.3841 0.5540 -0.1056 0.0098  0.0509  306 ALA A CA  
66   C C   . ALA A 61  ? 0.6487 0.3720 0.5673 -0.0854 -0.0043 0.0533  306 ALA A C   
67   O O   . ALA A 61  ? 0.6466 0.3539 0.5511 -0.0752 -0.0108 0.0645  306 ALA A O   
68   C CB  . ALA A 61  ? 0.6399 0.3744 0.5540 -0.1325 0.0140  0.0576  306 ALA A CB  
69   N N   . ALA A 62  ? 0.6543 0.3706 0.5854 -0.0802 -0.0090 0.0416  307 ALA A N   
70   C CA  . ALA A 62  ? 0.6312 0.3217 0.5607 -0.0608 -0.0181 0.0385  307 ALA A CA  
71   C C   . ALA A 62  ? 0.6182 0.3292 0.5527 -0.0392 -0.0195 0.0374  307 ALA A C   
72   O O   . ALA A 62  ? 0.6315 0.3245 0.5623 -0.0251 -0.0258 0.0443  307 ALA A O   
73   C CB  . ALA A 62  ? 0.6698 0.3560 0.6081 -0.0622 -0.0200 0.0219  307 ALA A CB  
74   N N   . LEU A 63  ? 0.5904 0.3390 0.5361 -0.0368 -0.0149 0.0295  308 LEU A N   
75   C CA  . LEU A 63  ? 0.5706 0.3387 0.5202 -0.0197 -0.0159 0.0288  308 LEU A CA  
76   C C   . LEU A 63  ? 0.5857 0.3514 0.5238 -0.0182 -0.0168 0.0428  308 LEU A C   
77   O O   . LEU A 63  ? 0.5695 0.3348 0.5083 -0.0034 -0.0222 0.0462  308 LEU A O   
78   C CB  . LEU A 63  ? 0.5869 0.3907 0.5500 -0.0205 -0.0121 0.0204  308 LEU A CB  
79   C CG  . LEU A 63  ? 0.6076 0.4200 0.5775 -0.0118 -0.0163 0.0094  308 LEU A CG  
80   C CD1 . LEU A 63  ? 0.6030 0.4470 0.5870 -0.0128 -0.0163 0.0059  308 LEU A CD1 
81   C CD2 . LEU A 63  ? 0.5919 0.3977 0.5566 0.0045  -0.0181 0.0095  308 LEU A CD2 
82   N N   . GLN A 64  ? 0.5683 0.3342 0.4952 -0.0355 -0.0116 0.0506  309 GLN A N   
83   C CA  . GLN A 64  ? 0.6137 0.3753 0.5216 -0.0386 -0.0136 0.0644  309 GLN A CA  
84   C C   . GLN A 64  ? 0.6508 0.3793 0.5496 -0.0300 -0.0275 0.0783  309 GLN A C   
85   O O   . GLN A 64  ? 0.6617 0.3912 0.5525 -0.0237 -0.0352 0.0885  309 GLN A O   
86   C CB  . GLN A 64  ? 0.6087 0.3720 0.5001 -0.0630 -0.0035 0.0697  309 GLN A CB  
87   C CG  . GLN A 64  ? 0.6601 0.4220 0.5250 -0.0703 -0.0045 0.0820  309 GLN A CG  
88   C CD  . GLN A 64  ? 0.6864 0.4804 0.5586 -0.0622 0.0015  0.0717  309 GLN A CD  
89   O OE1 . GLN A 64  ? 0.6742 0.4926 0.5549 -0.0703 0.0162  0.0594  309 GLN A OE1 
90   N NE2 . GLN A 64  ? 0.6944 0.4884 0.5668 -0.0462 -0.0099 0.0759  309 GLN A NE2 
91   N N   . LEU A 65  ? 0.6280 0.3263 0.5303 -0.0294 -0.0323 0.0787  310 LEU A N   
92   C CA  . LEU A 65  ? 0.6690 0.3326 0.5693 -0.0188 -0.0467 0.0916  310 LEU A CA  
93   C C   . LEU A 65  ? 0.6605 0.3340 0.5832 0.0075  -0.0522 0.0847  310 LEU A C   
94   O O   . LEU A 65  ? 0.7181 0.3726 0.6464 0.0195  -0.0653 0.0964  310 LEU A O   
95   C CB  . LEU A 65  ? 0.6742 0.2982 0.5745 -0.0247 -0.0495 0.0914  310 LEU A CB  
96   C CG  . LEU A 65  ? 0.7284 0.3356 0.6056 -0.0532 -0.0461 0.1027  310 LEU A CG  
97   C CD1 . LEU A 65  ? 0.7728 0.3350 0.6503 -0.0586 -0.0514 0.1033  310 LEU A CD1 
98   C CD2 . LEU A 65  ? 0.7614 0.3604 0.6120 -0.0642 -0.0533 0.1259  310 LEU A CD2 
99   N N   . VAL A 66  ? 0.5903 0.2930 0.5273 0.0158  -0.0432 0.0669  311 VAL A N   
100  C CA  . VAL A 66  ? 0.6009 0.3148 0.5584 0.0375  -0.0450 0.0584  311 VAL A CA  
101  C C   . VAL A 66  ? 0.5891 0.3395 0.5497 0.0420  -0.0435 0.0586  311 VAL A C   
102  O O   . VAL A 66  ? 0.5782 0.3396 0.5558 0.0579  -0.0468 0.0565  311 VAL A O   
103  C CB  . VAL A 66  ? 0.6152 0.3283 0.5831 0.0427  -0.0367 0.0375  311 VAL A CB  
104  C CG1 . VAL A 66  ? 0.6965 0.3687 0.6627 0.0394  -0.0390 0.0352  311 VAL A CG1 
105  C CG2 . VAL A 66  ? 0.6413 0.3800 0.6029 0.0308  -0.0283 0.0278  311 VAL A CG2 
106  N N   . VAL A 67  ? 0.5716 0.3412 0.5193 0.0286  -0.0380 0.0595  312 VAL A N   
107  C CA  . VAL A 67  ? 0.5712 0.3706 0.5212 0.0321  -0.0367 0.0582  312 VAL A CA  
108  C C   . VAL A 67  ? 0.5848 0.3821 0.5227 0.0290  -0.0462 0.0742  312 VAL A C   
109  O O   . VAL A 67  ? 0.5972 0.3701 0.5217 0.0222  -0.0539 0.0878  312 VAL A O   
110  C CB  . VAL A 67  ? 0.5298 0.3496 0.4763 0.0216  -0.0266 0.0494  312 VAL A CB  
111  C CG1 . VAL A 67  ? 0.5274 0.3501 0.4845 0.0233  -0.0219 0.0362  312 VAL A CG1 
112  C CG2 . VAL A 67  ? 0.5449 0.3585 0.4750 0.0039  -0.0222 0.0553  312 VAL A CG2 
113  N N   . ASP A 68  ? 0.5534 0.3740 0.4932 0.0318  -0.0474 0.0737  313 ASP A N   
114  C CA  . ASP A 68  ? 0.5521 0.3724 0.4757 0.0250  -0.0575 0.0879  313 ASP A CA  
115  C C   . ASP A 68  ? 0.5948 0.4124 0.4895 0.0039  -0.0494 0.0894  313 ASP A C   
116  O O   . ASP A 68  ? 0.5940 0.4217 0.4908 -0.0017 -0.0352 0.0764  313 ASP A O   
117  C CB  . ASP A 68  ? 0.5454 0.3917 0.4797 0.0319  -0.0608 0.0852  313 ASP A CB  
118  C CG  . ASP A 68  ? 0.5871 0.4425 0.5531 0.0510  -0.0644 0.0809  313 ASP A CG  
119  O OD1 . ASP A 68  ? 0.6129 0.4546 0.5920 0.0609  -0.0753 0.0896  313 ASP A OD1 
120  O OD2 . ASP A 68  ? 0.5499 0.4250 0.5285 0.0558  -0.0558 0.0686  313 ASP A OD2 
121  N N   . PRO A 69  ? 0.6130 0.4176 0.4810 -0.0089 -0.0582 0.1047  314 PRO A N   
122  C CA  . PRO A 69  ? 0.6453 0.4493 0.4825 -0.0317 -0.0468 0.1036  314 PRO A CA  
123  C C   . PRO A 69  ? 0.6729 0.5010 0.5050 -0.0360 -0.0384 0.0917  314 PRO A C   
124  O O   . PRO A 69  ? 0.6444 0.4854 0.4872 -0.0258 -0.0467 0.0909  314 PRO A O   
125  C CB  . PRO A 69  ? 0.6925 0.4724 0.4978 -0.0453 -0.0619 0.1261  314 PRO A CB  
126  C CG  . PRO A 69  ? 0.7118 0.4925 0.5340 -0.0280 -0.0834 0.1371  314 PRO A CG  
127  C CD  . PRO A 69  ? 0.6435 0.4324 0.5082 -0.0043 -0.0795 0.1244  314 PRO A CD  
128  N N   . GLY A 70  ? 0.6726 0.5066 0.4904 -0.0519 -0.0208 0.0811  315 GLY A N   
129  C CA  . GLY A 70  ? 0.6761 0.5274 0.4871 -0.0577 -0.0108 0.0676  315 GLY A CA  
130  C C   . GLY A 70  ? 0.6833 0.5529 0.5279 -0.0456 0.0012  0.0486  315 GLY A C   
131  O O   . GLY A 70  ? 0.6338 0.5053 0.5036 -0.0361 0.0036  0.0449  315 GLY A O   
132  N N   . ASP A 71  ? 0.6552 0.5361 0.4981 -0.0472 0.0068  0.0371  316 ASP A N   
133  C CA  . ASP A 71  ? 0.6479 0.5427 0.5192 -0.0383 0.0171  0.0198  316 ASP A CA  
134  C C   . ASP A 71  ? 0.6224 0.5215 0.4952 -0.0321 0.0087  0.0179  316 ASP A C   
135  O O   . ASP A 71  ? 0.6260 0.5226 0.4734 -0.0437 0.0086  0.0162  316 ASP A O   
136  C CB  . ASP A 71  ? 0.6525 0.5537 0.5205 -0.0513 0.0383  0.0035  316 ASP A CB  
137  C CG  . ASP A 71  ? 0.6828 0.5972 0.5877 -0.0401 0.0474  -0.0140 316 ASP A CG  
138  O OD1 . ASP A 71  ? 0.6618 0.5772 0.5820 -0.0274 0.0377  -0.0144 316 ASP A OD1 
139  O OD2 . ASP A 71  ? 0.7418 0.6661 0.6622 -0.0451 0.0643  -0.0272 316 ASP A OD2 
140  N N   . PRO A 72  ? 0.5805 0.4854 0.4791 -0.0169 0.0015  0.0180  317 PRO A N   
141  C CA  . PRO A 72  ? 0.5496 0.4587 0.4493 -0.0138 -0.0066 0.0179  317 PRO A CA  
142  C C   . PRO A 72  ? 0.5960 0.5049 0.4949 -0.0192 0.0027  0.0026  317 PRO A C   
143  O O   . PRO A 72  ? 0.5509 0.4600 0.4462 -0.0208 -0.0036 0.0017  317 PRO A O   
144  C CB  . PRO A 72  ? 0.5428 0.4576 0.4682 0.0007  -0.0129 0.0210  317 PRO A CB  
145  C CG  . PRO A 72  ? 0.5050 0.4192 0.4457 0.0045  -0.0052 0.0156  317 PRO A CG  
146  C CD  . PRO A 72  ? 0.5317 0.4400 0.4573 -0.0053 0.0018  0.0168  317 PRO A CD  
147  N N   . ARG A 73  ? 0.5721 0.4810 0.4780 -0.0221 0.0181  -0.0108 318 ARG A N   
148  C CA  . ARG A 73  ? 0.5775 0.4839 0.4852 -0.0263 0.0286  -0.0283 318 ARG A CA  
149  C C   . ARG A 73  ? 0.5965 0.4964 0.4656 -0.0436 0.0304  -0.0313 318 ARG A C   
150  O O   . ARG A 73  ? 0.6413 0.5354 0.5059 -0.0482 0.0354  -0.0453 318 ARG A O   
151  C CB  . ARG A 73  ? 0.6211 0.5329 0.5513 -0.0248 0.0463  -0.0440 318 ARG A CB  
152  C CG  . ARG A 73  ? 0.6789 0.5961 0.6508 -0.0081 0.0411  -0.0440 318 ARG A CG  
153  C CD  . ARG A 73  ? 0.6963 0.6244 0.6982 -0.0060 0.0562  -0.0579 318 ARG A CD  
154  N NE  . ARG A 73  ? 0.6884 0.6237 0.6779 -0.0164 0.0648  -0.0544 318 ARG A NE  
155  C CZ  . ARG A 73  ? 0.7585 0.7082 0.7748 -0.0172 0.0772  -0.0633 318 ARG A CZ  
156  N NH1 . ARG A 73  ? 0.7267 0.6868 0.7880 -0.0056 0.0808  -0.0761 318 ARG A NH1 
157  N NH2 . ARG A 73  ? 0.7166 0.6703 0.7175 -0.0301 0.0848  -0.0586 318 ARG A NH2 
158  N N   . SER A 74  ? 0.6161 0.5143 0.4558 -0.0539 0.0241  -0.0177 319 SER A N   
159  C CA  . SER A 74  ? 0.6818 0.5737 0.4801 -0.0726 0.0205  -0.0167 319 SER A CA  
160  C C   . SER A 74  ? 0.6258 0.5187 0.4227 -0.0710 0.0024  -0.0099 319 SER A C   
161  O O   . SER A 74  ? 0.6639 0.5521 0.4289 -0.0875 -0.0019 -0.0122 319 SER A O   
162  C CB  . SER A 74  ? 0.6901 0.5775 0.4579 -0.0843 0.0136  0.0007  319 SER A CB  
163  O OG  . SER A 74  ? 0.7515 0.6409 0.5341 -0.0715 -0.0066 0.0215  319 SER A OG  
164  N N   . TYR A 75  ? 0.5826 0.4826 0.4112 -0.0544 -0.0082 -0.0018 320 TYR A N   
165  C CA  . TYR A 75  ? 0.5867 0.4912 0.4175 -0.0552 -0.0226 0.0030  320 TYR A CA  
166  C C   . TYR A 75  ? 0.5693 0.4751 0.4306 -0.0438 -0.0212 -0.0031 320 TYR A C   
167  O O   . TYR A 75  ? 0.5630 0.4732 0.4275 -0.0465 -0.0317 0.0007  320 TYR A O   
168  C CB  . TYR A 75  ? 0.5600 0.4754 0.3932 -0.0515 -0.0419 0.0241  320 TYR A CB  
169  C CG  . TYR A 75  ? 0.5636 0.4858 0.4265 -0.0333 -0.0438 0.0333  320 TYR A CG  
170  C CD1 . TYR A 75  ? 0.5780 0.4945 0.4367 -0.0302 -0.0429 0.0412  320 TYR A CD1 
171  C CD2 . TYR A 75  ? 0.5373 0.4698 0.4285 -0.0218 -0.0462 0.0339  320 TYR A CD2 
172  C CE1 . TYR A 75  ? 0.5712 0.4908 0.4549 -0.0148 -0.0442 0.0471  320 TYR A CE1 
173  C CE2 . TYR A 75  ? 0.5103 0.4480 0.4237 -0.0073 -0.0462 0.0395  320 TYR A CE2 
174  C CZ  . TYR A 75  ? 0.5307 0.4614 0.4408 -0.0034 -0.0452 0.0451  320 TYR A CZ  
175  O OH  . TYR A 75  ? 0.5316 0.4643 0.4615 0.0096  -0.0447 0.0480  320 TYR A OH  
176  N N   . LEU A 76  ? 0.5697 0.4716 0.4526 -0.0334 -0.0100 -0.0116 321 LEU A N   
177  C CA  . LEU A 76  ? 0.5168 0.4158 0.4254 -0.0240 -0.0114 -0.0145 321 LEU A CA  
178  C C   . LEU A 76  ? 0.5775 0.4622 0.4936 -0.0248 0.0006  -0.0335 321 LEU A C   
179  O O   . LEU A 76  ? 0.6039 0.4872 0.5188 -0.0261 0.0146  -0.0455 321 LEU A O   
180  C CB  . LEU A 76  ? 0.5092 0.4151 0.4411 -0.0100 -0.0132 -0.0061 321 LEU A CB  
181  C CG  . LEU A 76  ? 0.5330 0.4512 0.4645 -0.0061 -0.0227 0.0092  321 LEU A CG  
182  C CD1 . LEU A 76  ? 0.4980 0.4194 0.4482 0.0054  -0.0224 0.0131  321 LEU A CD1 
183  C CD2 . LEU A 76  ? 0.5280 0.4537 0.4589 -0.0103 -0.0327 0.0155  321 LEU A CD2 
184  N N   . ASP A 77  ? 0.5399 0.4138 0.4662 -0.0241 -0.0044 -0.0367 322 ASP A N   
185  C CA  . ASP A 77  ? 0.5516 0.4076 0.4927 -0.0215 0.0042  -0.0543 322 ASP A CA  
186  C C   . ASP A 77  ? 0.5462 0.3949 0.5176 -0.0091 -0.0046 -0.0472 322 ASP A C   
187  O O   . ASP A 77  ? 0.5507 0.4059 0.5225 -0.0079 -0.0167 -0.0303 322 ASP A O   
188  C CB  . ASP A 77  ? 0.5573 0.3972 0.4780 -0.0358 0.0047  -0.0662 322 ASP A CB  
189  C CG  . ASP A 77  ? 0.6607 0.5030 0.5464 -0.0513 0.0139  -0.0767 322 ASP A CG  
190  O OD1 . ASP A 77  ? 0.7091 0.5573 0.5926 -0.0504 0.0281  -0.0849 322 ASP A OD1 
191  O OD2 . ASP A 77  ? 0.7367 0.5754 0.5956 -0.0669 0.0065  -0.0763 322 ASP A OD2 
192  N N   . ASN A 78  ? 0.5577 0.3928 0.5549 -0.0004 0.0018  -0.0608 323 ASN A N   
193  C CA  . ASN A 78  ? 0.5455 0.3639 0.5691 0.0087  -0.0097 -0.0552 323 ASN A CA  
194  C C   . ASN A 78  ? 0.5240 0.3544 0.5587 0.0164  -0.0221 -0.0351 323 ASN A C   
195  O O   . ASN A 78  ? 0.5290 0.3534 0.5582 0.0132  -0.0356 -0.0197 323 ASN A O   
196  C CB  . ASN A 78  ? 0.5671 0.3655 0.5756 -0.0023 -0.0188 -0.0521 323 ASN A CB  
197  C CG  . ASN A 78  ? 0.6830 0.4556 0.6960 -0.0048 -0.0103 -0.0744 323 ASN A CG  
198  O OD1 . ASN A 78  ? 0.7224 0.4943 0.7509 0.0022  0.0048  -0.0941 323 ASN A OD1 
199  N ND2 . ASN A 78  ? 0.7281 0.4794 0.7284 -0.0160 -0.0185 -0.0730 323 ASN A ND2 
200  N N   . PHE A 79  ? 0.5127 0.3596 0.5613 0.0244  -0.0166 -0.0364 324 PHE A N   
201  C CA  . PHE A 79  ? 0.5073 0.3639 0.5654 0.0304  -0.0280 -0.0205 324 PHE A CA  
202  C C   . PHE A 79  ? 0.4967 0.3365 0.5804 0.0381  -0.0425 -0.0142 324 PHE A C   
203  O O   . PHE A 79  ? 0.5143 0.3445 0.6288 0.0471  -0.0403 -0.0259 324 PHE A O   
204  C CB  . PHE A 79  ? 0.4862 0.3618 0.5561 0.0355  -0.0194 -0.0250 324 PHE A CB  
205  C CG  . PHE A 79  ? 0.4773 0.3660 0.5194 0.0275  -0.0107 -0.0240 324 PHE A CG  
206  C CD1 . PHE A 79  ? 0.5263 0.4136 0.5490 0.0189  0.0011  -0.0347 324 PHE A CD1 
207  C CD2 . PHE A 79  ? 0.4875 0.3875 0.5217 0.0279  -0.0156 -0.0123 324 PHE A CD2 
208  C CE1 . PHE A 79  ? 0.5232 0.4197 0.5201 0.0112  0.0049  -0.0302 324 PHE A CE1 
209  C CE2 . PHE A 79  ? 0.5117 0.4195 0.5241 0.0222  -0.0100 -0.0099 324 PHE A CE2 
210  C CZ  . PHE A 79  ? 0.5122 0.4181 0.5063 0.0141  -0.0012 -0.0171 324 PHE A CZ  
211  N N   . ILE A 80  ? 0.4592 0.2951 0.5308 0.0339  -0.0576 0.0044  325 ILE A N   
212  C CA  . ILE A 80  ? 0.4935 0.3110 0.5824 0.0381  -0.0757 0.0158  325 ILE A CA  
213  C C   . ILE A 80  ? 0.4928 0.3221 0.5719 0.0358  -0.0872 0.0324  325 ILE A C   
214  O O   . ILE A 80  ? 0.4727 0.3108 0.5215 0.0256  -0.0856 0.0404  325 ILE A O   
215  C CB  . ILE A 80  ? 0.5246 0.3162 0.5994 0.0287  -0.0841 0.0230  325 ILE A CB  
216  C CG1 . ILE A 80  ? 0.5618 0.3383 0.6435 0.0291  -0.0728 0.0039  325 ILE A CG1 
217  C CG2 . ILE A 80  ? 0.5169 0.2858 0.6053 0.0311  -0.1062 0.0394  325 ILE A CG2 
218  C CD1 . ILE A 80  ? 0.5724 0.3273 0.6322 0.0147  -0.0780 0.0093  325 ILE A CD1 
219  N N   . LYS A 81  ? 0.4901 0.3205 0.5961 0.0447  -0.0987 0.0362  326 LYS A N   
220  C CA  . LYS A 81  ? 0.4905 0.3308 0.5838 0.0402  -0.1107 0.0504  326 LYS A CA  
221  C C   . LYS A 81  ? 0.5206 0.3427 0.5870 0.0281  -0.1271 0.0700  326 LYS A C   
222  O O   . LYS A 81  ? 0.4991 0.2969 0.5769 0.0290  -0.1414 0.0781  326 LYS A O   
223  C CB  . LYS A 81  ? 0.4895 0.3370 0.6208 0.0511  -0.1219 0.0502  326 LYS A CB  
224  C CG  . LYS A 81  ? 0.5100 0.3660 0.6268 0.0443  -0.1371 0.0642  326 LYS A CG  
225  C CD  . LYS A 81  ? 0.5468 0.4131 0.7077 0.0545  -0.1507 0.0639  326 LYS A CD  
226  C CE  . LYS A 81  ? 0.6144 0.4866 0.7573 0.0449  -0.1696 0.0785  326 LYS A CE  
227  N NZ  . LYS A 81  ? 0.6526 0.5382 0.8420 0.0535  -0.1863 0.0795  326 LYS A NZ  
228  N N   . ILE A 82  ? 0.5289 0.3616 0.5598 0.0158  -0.1241 0.0770  327 ILE A N   
229  C CA  . ILE A 82  ? 0.6106 0.4296 0.6109 0.0002  -0.1365 0.0950  327 ILE A CA  
230  C C   . ILE A 82  ? 0.6984 0.5225 0.6797 -0.0077 -0.1491 0.1064  327 ILE A C   
231  O O   . ILE A 82  ? 0.7069 0.5146 0.6656 -0.0211 -0.1656 0.1243  327 ILE A O   
232  C CB  . ILE A 82  ? 0.5856 0.4119 0.5572 -0.0124 -0.1211 0.0931  327 ILE A CB  
233  C CG1 . ILE A 82  ? 0.5579 0.4118 0.5200 -0.0108 -0.1032 0.0817  327 ILE A CG1 
234  C CG2 . ILE A 82  ? 0.5874 0.4025 0.5720 -0.0097 -0.1150 0.0856  327 ILE A CG2 
235  C CD1 . ILE A 82  ? 0.5574 0.4242 0.4988 -0.0218 -0.0896 0.0803  327 ILE A CD1 
236  N N   . GLY A 83  ? 0.6229 0.4667 0.6088 -0.0026 -0.1428 0.0973  328 GLY A N   
237  C CA  . GLY A 83  ? 0.6132 0.4602 0.5765 -0.0128 -0.1547 0.1060  328 GLY A CA  
238  C C   . GLY A 83  ? 0.5816 0.4441 0.5677 -0.0035 -0.1551 0.0965  328 GLY A C   
239  O O   . GLY A 83  ? 0.5458 0.4199 0.5586 0.0090  -0.1407 0.0820  328 GLY A O   
240  N N   . GLU A 84  ? 0.6165 0.4788 0.5895 -0.0123 -0.1726 0.1057  329 GLU A N   
241  C CA  . GLU A 84  ? 0.6205 0.4981 0.6087 -0.0087 -0.1744 0.0975  329 GLU A CA  
242  C C   . GLU A 84  ? 0.7203 0.5998 0.6619 -0.0261 -0.1733 0.0976  329 GLU A C   
243  O O   . GLU A 84  ? 0.7940 0.6618 0.6988 -0.0422 -0.1851 0.1108  329 GLU A O   
244  C CB  . GLU A 84  ? 0.6801 0.5576 0.7075 -0.0019 -0.2008 0.1069  329 GLU A CB  
245  C CG  . GLU A 84  ? 0.7858 0.6841 0.8416 0.0030  -0.2001 0.0961  329 GLU A CG  
246  C CD  . GLU A 84  ? 0.8737 0.7801 0.9898 0.0168  -0.2174 0.0989  329 GLU A CD  
247  O OE1 . GLU A 84  ? 0.9131 0.8046 1.0465 0.0227  -0.2344 0.1113  329 GLU A OE1 
248  O OE2 . GLU A 84  ? 0.8930 0.8207 1.0419 0.0216  -0.2135 0.0883  329 GLU A OE2 
249  N N   . GLY A 85  ? 0.6992 0.5911 0.6399 -0.0244 -0.1577 0.0820  330 GLY A N   
250  C CA  . GLY A 85  ? 0.6976 0.5895 0.5968 -0.0396 -0.1533 0.0769  330 GLY A CA  
251  C C   . GLY A 85  ? 0.7088 0.6073 0.6178 -0.0422 -0.1631 0.0716  330 GLY A C   
252  O O   . GLY A 85  ? 0.6708 0.5764 0.6198 -0.0341 -0.1777 0.0758  330 GLY A O   
253  N N   . SER A 86  ? 0.7756 0.6728 0.6515 -0.0536 -0.1539 0.0606  331 SER A N   
254  C CA  . SER A 86  ? 0.8060 0.7069 0.6851 -0.0605 -0.1645 0.0551  331 SER A CA  
255  C C   . SER A 86  ? 0.7223 0.6330 0.6413 -0.0469 -0.1517 0.0430  331 SER A C   
256  O O   . SER A 86  ? 0.7247 0.6437 0.6665 -0.0494 -0.1640 0.0422  331 SER A O   
257  C CB  . SER A 86  ? 0.8833 0.7755 0.7108 -0.0787 -0.1573 0.0444  331 SER A CB  
258  O OG  . SER A 86  ? 0.9062 0.7916 0.6955 -0.0872 -0.1482 0.0472  331 SER A OG  
259  N N   . THR A 87  ? 0.6609 0.5715 0.5880 -0.0346 -0.1282 0.0347  332 THR A N   
260  C CA  . THR A 87  ? 0.6652 0.5812 0.6202 -0.0252 -0.1147 0.0246  332 THR A CA  
261  C C   . THR A 87  ? 0.6075 0.5322 0.5998 -0.0108 -0.1095 0.0278  332 THR A C   
262  O O   . THR A 87  ? 0.5536 0.4840 0.5678 -0.0057 -0.0988 0.0209  332 THR A O   
263  C CB  . THR A 87  ? 0.6666 0.5730 0.6001 -0.0237 -0.0929 0.0120  332 THR A CB  
264  O OG1 . THR A 87  ? 0.6631 0.5687 0.5873 -0.0170 -0.0818 0.0141  332 THR A OG1 
265  C CG2 . THR A 87  ? 0.6881 0.5840 0.5863 -0.0379 -0.0940 0.0033  332 THR A CG2 
266  N N   . GLY A 88  ? 0.5718 0.4958 0.5689 -0.0061 -0.1159 0.0373  333 GLY A N   
267  C CA  . GLY A 88  ? 0.5390 0.4687 0.5691 0.0066  -0.1093 0.0368  333 GLY A CA  
268  C C   . GLY A 88  ? 0.5943 0.5161 0.6211 0.0095  -0.1158 0.0464  333 GLY A C   
269  O O   . GLY A 88  ? 0.6814 0.5956 0.6908 0.0016  -0.1324 0.0576  333 GLY A O   
270  N N   . ILE A 89  ? 0.4622 0.3839 0.5028 0.0186  -0.1033 0.0423  334 ILE A N   
271  C CA  . ILE A 89  ? 0.5137 0.4252 0.5538 0.0208  -0.1083 0.0498  334 ILE A CA  
272  C C   . ILE A 89  ? 0.4863 0.3952 0.5046 0.0201  -0.0913 0.0457  334 ILE A C   
273  O O   . ILE A 89  ? 0.4667 0.3820 0.4792 0.0216  -0.0766 0.0373  334 ILE A O   
274  C CB  . ILE A 89  ? 0.4895 0.4017 0.5722 0.0320  -0.1123 0.0475  334 ILE A CB  
275  C CG1 . ILE A 89  ? 0.4819 0.4025 0.5786 0.0384  -0.0904 0.0326  334 ILE A CG1 
276  C CG2 . ILE A 89  ? 0.4580 0.3787 0.5727 0.0343  -0.1305 0.0512  334 ILE A CG2 
277  C CD1 . ILE A 89  ? 0.4844 0.4037 0.6171 0.0482  -0.0879 0.0257  334 ILE A CD1 
278  N N   . VAL A 90  ? 0.4625 0.3615 0.4699 0.0168  -0.0954 0.0534  335 VAL A N   
279  C CA  . VAL A 90  ? 0.4735 0.3730 0.4651 0.0147  -0.0822 0.0509  335 VAL A CA  
280  C C   . VAL A 90  ? 0.4855 0.3750 0.4925 0.0184  -0.0837 0.0513  335 VAL A C   
281  O O   . VAL A 90  ? 0.4720 0.3476 0.4863 0.0174  -0.0981 0.0600  335 VAL A O   
282  C CB  . VAL A 90  ? 0.5344 0.4335 0.4940 0.0025  -0.0825 0.0579  335 VAL A CB  
283  C CG1 . VAL A 90  ? 0.5223 0.4270 0.4748 0.0004  -0.0700 0.0553  335 VAL A CG1 
284  C CG2 . VAL A 90  ? 0.5300 0.4367 0.4733 -0.0013 -0.0781 0.0530  335 VAL A CG2 
285  N N   . CYS A 91  ? 0.4415 0.3356 0.4517 0.0218  -0.0702 0.0421  336 CYS A N   
286  C CA  . CYS A 91  ? 0.4607 0.3444 0.4806 0.0232  -0.0687 0.0385  336 CYS A CA  
287  C C   . CYS A 91  ? 0.4676 0.3538 0.4679 0.0154  -0.0620 0.0392  336 CYS A C   
288  O O   . CYS A 91  ? 0.4802 0.3809 0.4686 0.0136  -0.0545 0.0382  336 CYS A O   
289  C CB  . CYS A 91  ? 0.4790 0.3663 0.5188 0.0310  -0.0581 0.0245  336 CYS A CB  
290  S SG  . CYS A 91  ? 0.5179 0.4100 0.5925 0.0404  -0.0625 0.0199  336 CYS A SG  
291  N N   . ILE A 92  ? 0.4604 0.3323 0.4614 0.0110  -0.0659 0.0406  337 ILE A N   
292  C CA  A ILE A 92  ? 0.4775 0.3523 0.4667 0.0032  -0.0599 0.0381  337 ILE A CA  
293  C CA  B ILE A 92  ? 0.4665 0.3421 0.4554 0.0033  -0.0597 0.0381  337 ILE A CA  
294  C C   . ILE A 92  ? 0.4719 0.3462 0.4680 0.0076  -0.0510 0.0242  337 ILE A C   
295  O O   . ILE A 92  ? 0.4600 0.3245 0.4733 0.0149  -0.0495 0.0158  337 ILE A O   
296  C CB  A ILE A 92  ? 0.5306 0.3867 0.5146 -0.0070 -0.0685 0.0455  337 ILE A CB  
297  C CB  B ILE A 92  ? 0.5260 0.3849 0.5080 -0.0077 -0.0681 0.0465  337 ILE A CB  
298  C CG1 A ILE A 92  ? 0.5401 0.3965 0.5096 -0.0162 -0.0763 0.0606  337 ILE A CG1 
299  C CG1 B ILE A 92  ? 0.5798 0.4483 0.5502 -0.0189 -0.0631 0.0453  337 ILE A CG1 
300  C CG2 A ILE A 92  ? 0.5751 0.4354 0.5497 -0.0169 -0.0634 0.0416  337 ILE A CG2 
301  C CG2 B ILE A 92  ? 0.5373 0.3690 0.5358 -0.0031 -0.0749 0.0426  337 ILE A CG2 
302  C CD1 A ILE A 92  ? 0.5486 0.3811 0.5120 -0.0280 -0.0866 0.0704  337 ILE A CD1 
303  C CD1 B ILE A 92  ? 0.6267 0.4771 0.5900 -0.0328 -0.0709 0.0533  337 ILE A CD1 
304  N N   . ALA A 93  ? 0.4888 0.3749 0.4724 0.0022  -0.0451 0.0215  338 ALA A N   
305  C CA  . ALA A 93  ? 0.4803 0.3641 0.4603 0.0007  -0.0377 0.0096  338 ALA A CA  
306  C C   . ALA A 93  ? 0.5207 0.4093 0.4858 -0.0111 -0.0400 0.0112  338 ALA A C   
307  O O   . ALA A 93  ? 0.5006 0.4033 0.4628 -0.0153 -0.0442 0.0210  338 ALA A O   
308  C CB  . ALA A 93  ? 0.4598 0.3559 0.4376 0.0057  -0.0301 0.0060  338 ALA A CB  
309  N N   . THR A 94  ? 0.5359 0.4145 0.4925 -0.0176 -0.0364 0.0000  339 THR A N   
310  C CA  . THR A 94  ? 0.5298 0.4122 0.4712 -0.0314 -0.0406 0.0002  339 THR A CA  
311  C C   . THR A 94  ? 0.5470 0.4436 0.4734 -0.0344 -0.0387 -0.0008 339 THR A C   
312  O O   . THR A 94  ? 0.5301 0.4204 0.4490 -0.0328 -0.0303 -0.0104 339 THR A O   
313  C CB  . THR A 94  ? 0.5396 0.3967 0.4761 -0.0400 -0.0395 -0.0125 339 THR A CB  
314  O OG1 . THR A 94  ? 0.5706 0.4095 0.5217 -0.0371 -0.0444 -0.0084 339 THR A OG1 
315  C CG2 . THR A 94  ? 0.5375 0.3987 0.4561 -0.0576 -0.0456 -0.0128 339 THR A CG2 
316  N N   . VAL A 95  ? 0.5393 0.4560 0.4629 -0.0393 -0.0470 0.0097  340 VAL A N   
317  C CA  . VAL A 95  ? 0.5265 0.4539 0.4351 -0.0441 -0.0509 0.0122  340 VAL A CA  
318  C C   . VAL A 95  ? 0.5433 0.4585 0.4281 -0.0608 -0.0522 0.0019  340 VAL A C   
319  O O   . VAL A 95  ? 0.5782 0.4935 0.4618 -0.0721 -0.0592 0.0014  340 VAL A O   
320  C CB  . VAL A 95  ? 0.5268 0.4806 0.4476 -0.0426 -0.0617 0.0263  340 VAL A CB  
321  C CG1 . VAL A 95  ? 0.5265 0.4881 0.4324 -0.0482 -0.0709 0.0319  340 VAL A CG1 
322  C CG2 . VAL A 95  ? 0.5081 0.4712 0.4485 -0.0271 -0.0575 0.0324  340 VAL A CG2 
323  N N   . ARG A 96  ? 0.5577 0.4623 0.4212 -0.0648 -0.0447 -0.0072 341 ARG A N   
324  C CA  . ARG A 96  ? 0.6361 0.5250 0.4725 -0.0821 -0.0417 -0.0222 341 ARG A CA  
325  C C   . ARG A 96  ? 0.6900 0.5901 0.5087 -0.0990 -0.0585 -0.0144 341 ARG A C   
326  O O   . ARG A 96  ? 0.7077 0.5964 0.5119 -0.1146 -0.0608 -0.0248 341 ARG A O   
327  C CB  . ARG A 96  ? 0.6280 0.5078 0.4416 -0.0859 -0.0280 -0.0334 341 ARG A CB  
328  C CG  . ARG A 96  ? 0.6732 0.5348 0.4545 -0.1052 -0.0197 -0.0541 341 ARG A CG  
329  C CD  . ARG A 96  ? 0.6951 0.5500 0.4590 -0.1082 0.0001  -0.0683 341 ARG A CD  
330  N NE  . ARG A 96  ? 0.6759 0.5351 0.4752 -0.0876 0.0108  -0.0679 341 ARG A NE  
331  C CZ  . ARG A 96  ? 0.6654 0.5357 0.4661 -0.0822 0.0133  -0.0574 341 ARG A CZ  
332  N NH1 . ARG A 96  ? 0.7078 0.5832 0.4757 -0.0950 0.0060  -0.0452 341 ARG A NH1 
333  N NH2 . ARG A 96  ? 0.5795 0.4540 0.4136 -0.0652 0.0215  -0.0581 341 ARG A NH2 
334  N N   . SER A 97  ? 0.5997 0.5218 0.4224 -0.0962 -0.0718 0.0037  342 SER A N   
335  C CA  A SER A 97  ? 0.6423 0.5788 0.4522 -0.1119 -0.0912 0.0129  342 SER A CA  
336  C CA  B SER A 97  ? 0.6364 0.5728 0.4461 -0.1119 -0.0912 0.0128  342 SER A CA  
337  C C   . SER A 97  ? 0.6149 0.5666 0.4499 -0.1151 -0.1005 0.0170  342 SER A C   
338  O O   . SER A 97  ? 0.6963 0.6530 0.5189 -0.1338 -0.1133 0.0166  342 SER A O   
339  C CB  A SER A 97  ? 0.6002 0.5545 0.4133 -0.1054 -0.1046 0.0322  342 SER A CB  
340  C CB  B SER A 97  ? 0.6088 0.5627 0.4212 -0.1055 -0.1045 0.0320  342 SER A CB  
341  O OG  A SER A 97  ? 0.5695 0.5408 0.4228 -0.0847 -0.1043 0.0422  342 SER A OG  
342  O OG  B SER A 97  ? 0.6016 0.5720 0.4070 -0.1195 -0.1272 0.0433  342 SER A OG  
343  N N   . SER A 98  ? 0.6263 0.5858 0.4940 -0.1000 -0.0942 0.0209  343 SER A N   
344  C CA  . SER A 98  ? 0.6541 0.6329 0.5470 -0.1041 -0.1011 0.0271  343 SER A CA  
345  C C   . SER A 98  ? 0.6649 0.6237 0.5619 -0.1074 -0.0916 0.0184  343 SER A C   
346  O O   . SER A 98  ? 0.6407 0.6093 0.5487 -0.1192 -0.0974 0.0216  343 SER A O   
347  C CB  . SER A 98  ? 0.5666 0.5742 0.4934 -0.0871 -0.1021 0.0402  343 SER A CB  
348  O OG  . SER A 98  ? 0.6077 0.6018 0.5392 -0.0707 -0.0879 0.0374  343 SER A OG  
349  N N   . GLY A 99  ? 0.6128 0.5447 0.5043 -0.0977 -0.0784 0.0090  344 GLY A N   
350  C CA  . GLY A 99  ? 0.6320 0.5447 0.5336 -0.0966 -0.0727 0.0058  344 GLY A CA  
351  C C   . GLY A 99  ? 0.6288 0.5575 0.5536 -0.0859 -0.0710 0.0183  344 GLY A C   
352  O O   . GLY A 99  ? 0.5834 0.4954 0.5134 -0.0868 -0.0688 0.0194  344 GLY A O   
353  N N   . LYS A 100 ? 0.5582 0.5162 0.4955 -0.0767 -0.0723 0.0275  345 LYS A N   
354  C CA  . LYS A 100 ? 0.5582 0.5308 0.5139 -0.0673 -0.0676 0.0356  345 LYS A CA  
355  C C   . LYS A 100 ? 0.5499 0.5023 0.5034 -0.0533 -0.0597 0.0328  345 LYS A C   
356  O O   . LYS A 100 ? 0.5499 0.4878 0.4950 -0.0464 -0.0565 0.0258  345 LYS A O   
357  C CB  . LYS A 100 ? 0.5589 0.5659 0.5322 -0.0592 -0.0699 0.0426  345 LYS A CB  
358  C CG  . LYS A 100 ? 0.6112 0.6508 0.6036 -0.0703 -0.0759 0.0483  345 LYS A CG  
359  C CD  . LYS A 100 ? 0.6200 0.6927 0.6390 -0.0569 -0.0768 0.0535  345 LYS A CD  
360  C CE  . LYS A 100 ? 0.6811 0.7930 0.7299 -0.0654 -0.0788 0.0574  345 LYS A CE  
361  N NZ  . LYS A 100 ? 0.6656 0.8100 0.7462 -0.0521 -0.0852 0.0616  345 LYS A NZ  
362  N N   . LEU A 101 ? 0.4986 0.4523 0.4594 -0.0509 -0.0565 0.0385  346 LEU A N   
363  C CA  . LEU A 101 ? 0.4853 0.4234 0.4459 -0.0392 -0.0524 0.0381  346 LEU A CA  
364  C C   . LEU A 101 ? 0.5395 0.4977 0.5076 -0.0279 -0.0477 0.0411  346 LEU A C   
365  O O   . LEU A 101 ? 0.5223 0.5043 0.4986 -0.0305 -0.0455 0.0451  346 LEU A O   
366  C CB  . LEU A 101 ? 0.5040 0.4248 0.4618 -0.0462 -0.0551 0.0440  346 LEU A CB  
367  C CG  . LEU A 101 ? 0.5549 0.4523 0.5073 -0.0587 -0.0606 0.0414  346 LEU A CG  
368  C CD1 . LEU A 101 ? 0.6017 0.4796 0.5501 -0.0675 -0.0659 0.0512  346 LEU A CD1 
369  C CD2 . LEU A 101 ? 0.5590 0.4334 0.5110 -0.0509 -0.0593 0.0286  346 LEU A CD2 
370  N N   . VAL A 102 ? 0.4880 0.4367 0.4555 -0.0161 -0.0449 0.0374  347 VAL A N   
371  C CA  . VAL A 102 ? 0.4605 0.4197 0.4330 -0.0059 -0.0406 0.0387  347 VAL A CA  
372  C C   . VAL A 102 ? 0.4881 0.4306 0.4583 -0.0015 -0.0406 0.0382  347 VAL A C   
373  O O   . VAL A 102 ? 0.4864 0.4104 0.4566 -0.0027 -0.0441 0.0366  347 VAL A O   
374  C CB  . VAL A 102 ? 0.4534 0.4183 0.4279 0.0023  -0.0396 0.0365  347 VAL A CB  
375  C CG1 . VAL A 102 ? 0.4636 0.4475 0.4439 -0.0013 -0.0440 0.0398  347 VAL A CG1 
376  C CG2 . VAL A 102 ? 0.4751 0.4220 0.4416 0.0028  -0.0388 0.0307  347 VAL A CG2 
377  N N   . ALA A 103 ? 0.4242 0.3732 0.3947 0.0037  -0.0374 0.0390  348 ALA A N   
378  C CA  . ALA A 103 ? 0.4503 0.3869 0.4191 0.0072  -0.0399 0.0391  348 ALA A CA  
379  C C   . ALA A 103 ? 0.4532 0.3895 0.4275 0.0166  -0.0364 0.0336  348 ALA A C   
380  O O   . ALA A 103 ? 0.4651 0.4104 0.4406 0.0204  -0.0322 0.0320  348 ALA A O   
381  C CB  . ALA A 103 ? 0.4721 0.4132 0.4306 0.0020  -0.0395 0.0431  348 ALA A CB  
382  N N   . VAL A 104 ? 0.4407 0.3665 0.4208 0.0197  -0.0393 0.0317  349 VAL A N   
383  C CA  . VAL A 104 ? 0.4664 0.3921 0.4523 0.0252  -0.0354 0.0267  349 VAL A CA  
384  C C   . VAL A 104 ? 0.4322 0.3548 0.4223 0.0260  -0.0406 0.0275  349 VAL A C   
385  O O   . VAL A 104 ? 0.4555 0.3720 0.4554 0.0259  -0.0482 0.0293  349 VAL A O   
386  C CB  . VAL A 104 ? 0.4488 0.3701 0.4421 0.0260  -0.0313 0.0205  349 VAL A CB  
387  C CG1 . VAL A 104 ? 0.4178 0.3408 0.4140 0.0280  -0.0254 0.0166  349 VAL A CG1 
388  C CG2 . VAL A 104 ? 0.4406 0.3633 0.4243 0.0216  -0.0291 0.0201  349 VAL A CG2 
389  N N   . LYS A 105 ? 0.4261 0.3515 0.4100 0.0267  -0.0382 0.0261  350 LYS A N   
390  C CA  . LYS A 105 ? 0.4198 0.3426 0.4047 0.0249  -0.0442 0.0258  350 LYS A CA  
391  C C   . LYS A 105 ? 0.4371 0.3601 0.4368 0.0275  -0.0415 0.0209  350 LYS A C   
392  O O   . LYS A 105 ? 0.4455 0.3679 0.4426 0.0289  -0.0335 0.0179  350 LYS A O   
393  C CB  . LYS A 105 ? 0.4415 0.3651 0.4093 0.0218  -0.0413 0.0238  350 LYS A CB  
394  C CG  . LYS A 105 ? 0.4975 0.4172 0.4565 0.0152  -0.0498 0.0242  350 LYS A CG  
395  C CD  . LYS A 105 ? 0.5490 0.4684 0.4873 0.0109  -0.0427 0.0181  350 LYS A CD  
396  C CE  . LYS A 105 ? 0.6368 0.5508 0.5585 0.0006  -0.0516 0.0173  350 LYS A CE  
397  N NZ  . LYS A 105 ? 0.6874 0.6004 0.5855 -0.0051 -0.0411 0.0078  350 LYS A NZ  
398  N N   . LYS A 106 ? 0.4284 0.3529 0.4457 0.0274  -0.0489 0.0209  351 LYS A N   
399  C CA  . LYS A 106 ? 0.4441 0.3741 0.4811 0.0280  -0.0449 0.0151  351 LYS A CA  
400  C C   . LYS A 106 ? 0.4370 0.3699 0.4796 0.0237  -0.0546 0.0158  351 LYS A C   
401  O O   . LYS A 106 ? 0.4463 0.3794 0.4931 0.0224  -0.0688 0.0213  351 LYS A O   
402  C CB  . LYS A 106 ? 0.4775 0.4121 0.5405 0.0322  -0.0435 0.0113  351 LYS A CB  
403  C CG  . LYS A 106 ? 0.4307 0.3607 0.4849 0.0337  -0.0345 0.0087  351 LYS A CG  
404  C CD  . LYS A 106 ? 0.4587 0.3904 0.5391 0.0378  -0.0313 0.0009  351 LYS A CD  
405  C CE  . LYS A 106 ? 0.5087 0.4329 0.5761 0.0366  -0.0232 -0.0034 351 LYS A CE  
406  N NZ  . LYS A 106 ? 0.5338 0.4581 0.6268 0.0403  -0.0157 -0.0161 351 LYS A NZ  
407  N N   . MET A 107 ? 0.4386 0.3715 0.4790 0.0196  -0.0487 0.0114  352 MET A N   
408  C CA  . MET A 107 ? 0.4122 0.3462 0.4541 0.0127  -0.0578 0.0105  352 MET A CA  
409  C C   . MET A 107 ? 0.4483 0.3917 0.5138 0.0087  -0.0524 0.0054  352 MET A C   
410  O O   . MET A 107 ? 0.4824 0.4201 0.5402 0.0063  -0.0398 0.0025  352 MET A O   
411  C CB  . MET A 107 ? 0.4633 0.3840 0.4747 0.0086  -0.0554 0.0085  352 MET A CB  
412  C CG  . MET A 107 ? 0.5114 0.4276 0.5001 0.0098  -0.0578 0.0119  352 MET A CG  
413  S SD  . MET A 107 ? 0.5652 0.4706 0.5304 0.0123  -0.0444 0.0055  352 MET A SD  
414  C CE  . MET A 107 ? 0.4971 0.4050 0.4746 0.0216  -0.0349 0.0087  352 MET A CE  
415  N N   . ASP A 108 ? 0.4340 0.3926 0.5298 0.0072  -0.0625 0.0052  353 ASP A N   
416  C CA  . ASP A 108 ? 0.4589 0.4325 0.5831 0.0014  -0.0563 -0.0008 353 ASP A CA  
417  C C   . ASP A 108 ? 0.4895 0.4552 0.5980 -0.0107 -0.0588 -0.0023 353 ASP A C   
418  O O   . ASP A 108 ? 0.5078 0.4705 0.6074 -0.0158 -0.0744 -0.0000 353 ASP A O   
419  C CB  . ASP A 108 ? 0.4643 0.4606 0.6344 0.0049  -0.0678 -0.0012 353 ASP A CB  
420  C CG  . ASP A 108 ? 0.5338 0.5531 0.7425 0.0001  -0.0557 -0.0101 353 ASP A CG  
421  O OD1 . ASP A 108 ? 0.5238 0.5426 0.7239 -0.0125 -0.0488 -0.0128 353 ASP A OD1 
422  O OD2 . ASP A 108 ? 0.5068 0.5445 0.7557 0.0082  -0.0521 -0.0153 353 ASP A OD2 
423  N N   . LEU A 109 ? 0.4858 0.4457 0.5881 -0.0174 -0.0443 -0.0059 354 LEU A N   
424  C CA  . LEU A 109 ? 0.5020 0.4489 0.5896 -0.0297 -0.0464 -0.0079 354 LEU A CA  
425  C C   . LEU A 109 ? 0.5263 0.4914 0.6404 -0.0401 -0.0598 -0.0101 354 LEU A C   
426  O O   . LEU A 109 ? 0.5295 0.4827 0.6271 -0.0503 -0.0690 -0.0120 354 LEU A O   
427  C CB  . LEU A 109 ? 0.5298 0.4660 0.6096 -0.0371 -0.0303 -0.0086 354 LEU A CB  
428  C CG  . LEU A 109 ? 0.5698 0.4779 0.6157 -0.0321 -0.0232 -0.0049 354 LEU A CG  
429  C CD1 . LEU A 109 ? 0.5692 0.4791 0.6073 -0.0175 -0.0224 -0.0019 354 LEU A CD1 
430  C CD2 . LEU A 109 ? 0.5976 0.4984 0.6393 -0.0420 -0.0103 -0.0022 354 LEU A CD2 
431  N N   . ARG A 110 ? 0.5323 0.5267 0.6895 -0.0379 -0.0611 -0.0111 355 ARG A N   
432  C CA  . ARG A 110 ? 0.5385 0.5571 0.7318 -0.0475 -0.0747 -0.0126 355 ARG A CA  
433  C C   . ARG A 110 ? 0.5159 0.5369 0.7089 -0.0454 -0.1013 -0.0065 355 ARG A C   
434  O O   . ARG A 110 ? 0.5531 0.5886 0.7650 -0.0566 -0.1181 -0.0061 355 ARG A O   
435  C CB  . ARG A 110 ? 0.4973 0.5502 0.7451 -0.0440 -0.0653 -0.0176 355 ARG A CB  
436  C CG  . ARG A 110 ? 0.5056 0.5607 0.7533 -0.0534 -0.0390 -0.0240 355 ARG A CG  
437  C CD  . ARG A 110 ? 0.5565 0.6416 0.8485 -0.0462 -0.0233 -0.0320 355 ARG A CD  
438  N NE  . ARG A 110 ? 0.5606 0.6362 0.8443 -0.0280 -0.0221 -0.0311 355 ARG A NE  
439  C CZ  . ARG A 110 ? 0.6538 0.7485 0.9719 -0.0181 -0.0101 -0.0398 355 ARG A CZ  
440  N NH1 . ARG A 110 ? 0.6533 0.7815 1.0196 -0.0239 0.0037  -0.0512 355 ARG A NH1 
441  N NH2 . ARG A 110 ? 0.5981 0.6787 0.9040 -0.0035 -0.0106 -0.0388 355 ARG A NH2 
442  N N   . LYS A 111 ? 0.4818 0.4891 0.6523 -0.0339 -0.1065 -0.0006 356 LYS A N   
443  C CA  . LYS A 111 ? 0.5534 0.5599 0.7169 -0.0341 -0.1320 0.0081  356 LYS A CA  
444  C C   . LYS A 111 ? 0.5894 0.5697 0.6969 -0.0443 -0.1371 0.0081  356 LYS A C   
445  O O   . LYS A 111 ? 0.6068 0.5831 0.6965 -0.0482 -0.1567 0.0157  356 LYS A O   
446  C CB  . LYS A 111 ? 0.5279 0.5343 0.7005 -0.0182 -0.1350 0.0152  356 LYS A CB  
447  C CG  . LYS A 111 ? 0.5366 0.5671 0.7666 -0.0064 -0.1297 0.0122  356 LYS A CG  
448  C CD  . LYS A 111 ? 0.5864 0.6087 0.8202 0.0086  -0.1328 0.0181  356 LYS A CD  
449  C CE  . LYS A 111 ? 0.6387 0.6824 0.9318 0.0216  -0.1260 0.0113  356 LYS A CE  
450  N NZ  . LYS A 111 ? 0.6770 0.7073 0.9742 0.0354  -0.1313 0.0166  356 LYS A NZ  
451  N N   . GLN A 112 ? 0.5545 0.5159 0.6338 -0.0491 -0.1198 -0.0003 357 GLN A N   
452  C CA  . GLN A 112 ? 0.5716 0.5076 0.6014 -0.0563 -0.1197 -0.0046 357 GLN A CA  
453  C C   . GLN A 112 ? 0.6410 0.5740 0.6606 -0.0755 -0.1336 -0.0098 357 GLN A C   
454  O O   . GLN A 112 ? 0.6314 0.5712 0.6731 -0.0838 -0.1319 -0.0143 357 GLN A O   
455  C CB  . GLN A 112 ? 0.5686 0.4835 0.5782 -0.0502 -0.0965 -0.0117 357 GLN A CB  
456  C CG  . GLN A 112 ? 0.5296 0.4479 0.5478 -0.0340 -0.0837 -0.0069 357 GLN A CG  
457  C CD  . GLN A 112 ? 0.5645 0.4857 0.5717 -0.0274 -0.0912 -0.0000 357 GLN A CD  
458  O OE1 . GLN A 112 ? 0.5997 0.5101 0.5749 -0.0328 -0.0956 -0.0013 357 GLN A OE1 
459  N NE2 . GLN A 112 ? 0.5296 0.4640 0.5618 -0.0174 -0.0916 0.0065  357 GLN A NE2 
460  N N   . GLN A 113 ? 0.6137 0.5366 0.5971 -0.0851 -0.1472 -0.0096 358 GLN A N   
461  C CA  . GLN A 113 ? 0.6874 0.6019 0.6493 -0.1062 -0.1595 -0.0172 358 GLN A CA  
462  C C   . GLN A 113 ? 0.7425 0.6297 0.6816 -0.1105 -0.1394 -0.0333 358 GLN A C   
463  O O   . GLN A 113 ? 0.7187 0.6018 0.6637 -0.1248 -0.1428 -0.0403 358 GLN A O   
464  C CB  . GLN A 113 ? 0.8070 0.7141 0.7260 -0.1177 -0.1764 -0.0139 358 GLN A CB  
465  C CG  . GLN A 113 ? 0.9783 0.8848 0.8799 -0.1425 -0.1990 -0.0174 358 GLN A CG  
466  C CD  . GLN A 113 ? 1.0445 0.9819 0.9992 -0.1461 -0.2229 -0.0064 358 GLN A CD  
467  O OE1 . GLN A 113 ? 1.0697 1.0120 1.0383 -0.1602 -0.2283 -0.0135 358 GLN A OE1 
468  N NE2 . GLN A 113 ? 1.0330 0.9918 1.0211 -0.1335 -0.2372 0.0104  358 GLN A NE2 
469  N N   . ARG A 114 ? 0.6466 0.5146 0.5631 -0.0984 -0.1193 -0.0389 359 ARG A N   
470  C CA  . ARG A 114 ? 0.6615 0.5012 0.5638 -0.0974 -0.1006 -0.0526 359 ARG A CA  
471  C C   . ARG A 114 ? 0.6429 0.4826 0.5644 -0.0773 -0.0833 -0.0469 359 ARG A C   
472  O O   . ARG A 114 ? 0.6497 0.4863 0.5590 -0.0645 -0.0738 -0.0466 359 ARG A O   
473  C CB  . ARG A 114 ? 0.7120 0.5274 0.5688 -0.1030 -0.0939 -0.0678 359 ARG A CB  
474  C CG  . ARG A 114 ? 0.7715 0.5758 0.6023 -0.1271 -0.1070 -0.0790 359 ARG A CG  
475  C CD  . ARG A 114 ? 0.8392 0.6189 0.6216 -0.1340 -0.0962 -0.0983 359 ARG A CD  
476  N NE  . ARG A 114 ? 0.8087 0.5606 0.5900 -0.1213 -0.0724 -0.1136 359 ARG A NE  
477  C CZ  . ARG A 114 ? 0.8344 0.5698 0.5877 -0.1175 -0.0551 -0.1311 359 ARG A CZ  
478  N NH1 . ARG A 114 ? 0.7746 0.5184 0.4918 -0.1287 -0.0569 -0.1355 359 ARG A NH1 
479  N NH2 . ARG A 114 ? 0.8774 0.5882 0.6403 -0.1029 -0.0358 -0.1439 359 ARG A NH2 
480  N N   . ARG A 115 ? 0.6340 0.4787 0.5843 -0.0767 -0.0794 -0.0421 360 ARG A N   
481  C CA  . ARG A 115 ? 0.6399 0.4854 0.6042 -0.0611 -0.0653 -0.0351 360 ARG A CA  
482  C C   . ARG A 115 ? 0.6187 0.4352 0.5621 -0.0514 -0.0520 -0.0414 360 ARG A C   
483  O O   . ARG A 115 ? 0.6093 0.4283 0.5559 -0.0365 -0.0438 -0.0358 360 ARG A O   
484  C CB  . ARG A 115 ? 0.6130 0.4664 0.6043 -0.0673 -0.0616 -0.0303 360 ARG A CB  
485  C CG  . ARG A 115 ? 0.6881 0.5769 0.7131 -0.0715 -0.0709 -0.0247 360 ARG A CG  
486  C CD  . ARG A 115 ? 0.6750 0.5733 0.7257 -0.0812 -0.0631 -0.0233 360 ARG A CD  
487  N NE  . ARG A 115 ? 0.6854 0.5591 0.7221 -0.0974 -0.0624 -0.0290 360 ARG A NE  
488  C CZ  . ARG A 115 ? 0.7598 0.6377 0.8136 -0.1126 -0.0570 -0.0283 360 ARG A CZ  
489  N NH1 . ARG A 115 ? 0.6863 0.5956 0.7729 -0.1133 -0.0496 -0.0240 360 ARG A NH1 
490  N NH2 . ARG A 115 ? 0.7381 0.5879 0.7761 -0.1284 -0.0577 -0.0331 360 ARG A NH2 
491  N N   . GLU A 116 ? 0.6368 0.4258 0.5618 -0.0594 -0.0503 -0.0538 361 GLU A N   
492  C CA  . GLU A 116 ? 0.6353 0.3955 0.5491 -0.0478 -0.0380 -0.0611 361 GLU A CA  
493  C C   . GLU A 116 ? 0.6593 0.4265 0.5616 -0.0346 -0.0314 -0.0656 361 GLU A C   
494  O O   . GLU A 116 ? 0.6281 0.3826 0.5339 -0.0197 -0.0211 -0.0680 361 GLU A O   
495  C CB  . GLU A 116 ? 0.6681 0.3940 0.5656 -0.0593 -0.0371 -0.0769 361 GLU A CB  
496  C CG  . GLU A 116 ? 0.7135 0.4361 0.5834 -0.0688 -0.0393 -0.0936 361 GLU A CG  
497  C CD  . GLU A 116 ? 0.8062 0.5413 0.6704 -0.0916 -0.0556 -0.0937 361 GLU A CD  
498  O OE1 . GLU A 116 ? 0.7485 0.5075 0.6377 -0.0959 -0.0650 -0.0793 361 GLU A OE1 
499  O OE2 . GLU A 116 ? 0.7880 0.5101 0.6238 -0.1058 -0.0590 -0.1092 361 GLU A OE2 
500  N N   . LEU A 117 ? 0.6174 0.4054 0.5082 -0.0403 -0.0380 -0.0656 362 LEU A N   
501  C CA  . LEU A 117 ? 0.6104 0.4075 0.4900 -0.0307 -0.0303 -0.0681 362 LEU A CA  
502  C C   . LEU A 117 ? 0.6225 0.4361 0.5234 -0.0149 -0.0266 -0.0541 362 LEU A C   
503  O O   . LEU A 117 ? 0.5937 0.4129 0.4919 -0.0050 -0.0177 -0.0563 362 LEU A O   
504  C CB  . LEU A 117 ? 0.6314 0.4435 0.4886 -0.0442 -0.0403 -0.0679 362 LEU A CB  
505  C CG  . LEU A 117 ? 0.6858 0.4818 0.5107 -0.0626 -0.0433 -0.0841 362 LEU A CG  
506  C CD1 . LEU A 117 ? 0.7347 0.5461 0.5344 -0.0783 -0.0580 -0.0783 362 LEU A CD1 
507  C CD2 . LEU A 117 ? 0.7882 0.5632 0.5962 -0.0576 -0.0234 -0.1054 362 LEU A CD2 
508  N N   . LEU A 118 ? 0.5743 0.3968 0.4962 -0.0138 -0.0321 -0.0412 363 LEU A N   
509  C CA  . LEU A 118 ? 0.5545 0.3897 0.4916 -0.0011 -0.0282 -0.0300 363 LEU A CA  
510  C C   . LEU A 118 ? 0.5693 0.3902 0.5098 0.0120  -0.0186 -0.0316 363 LEU A C   
511  O O   . LEU A 118 ? 0.5300 0.3628 0.4781 0.0222  -0.0158 -0.0248 363 LEU A O   
512  C CB  . LEU A 118 ? 0.5300 0.3748 0.4861 -0.0043 -0.0322 -0.0198 363 LEU A CB  
513  C CG  . LEU A 118 ? 0.5803 0.4457 0.5471 -0.0125 -0.0429 -0.0162 363 LEU A CG  
514  C CD1 . LEU A 118 ? 0.5613 0.4378 0.5519 -0.0149 -0.0414 -0.0105 363 LEU A CD1 
515  C CD2 . LEU A 118 ? 0.5602 0.4404 0.5240 -0.0074 -0.0474 -0.0115 363 LEU A CD2 
516  N N   . PHE A 119 ? 0.5799 0.3746 0.5172 0.0119  -0.0152 -0.0400 364 PHE A N   
517  C CA  . PHE A 119 ? 0.5958 0.3754 0.5417 0.0266  -0.0087 -0.0414 364 PHE A CA  
518  C C   . PHE A 119 ? 0.6328 0.4238 0.5782 0.0364  0.0001  -0.0518 364 PHE A C   
519  O O   . PHE A 119 ? 0.6568 0.4472 0.6184 0.0512  0.0043  -0.0506 364 PHE A O   
520  C CB  . PHE A 119 ? 0.6157 0.3595 0.5602 0.0248  -0.0078 -0.0491 364 PHE A CB  
521  C CG  . PHE A 119 ? 0.6682 0.3987 0.6150 0.0148  -0.0144 -0.0367 364 PHE A CG  
522  C CD1 . PHE A 119 ? 0.6322 0.3635 0.5874 0.0197  -0.0171 -0.0198 364 PHE A CD1 
523  C CD2 . PHE A 119 ? 0.7249 0.4434 0.6633 -0.0024 -0.0178 -0.0421 364 PHE A CD2 
524  C CE1 . PHE A 119 ? 0.6716 0.3918 0.6245 0.0068  -0.0206 -0.0087 364 PHE A CE1 
525  C CE2 . PHE A 119 ? 0.7583 0.4678 0.7000 -0.0145 -0.0215 -0.0312 364 PHE A CE2 
526  C CZ  . PHE A 119 ? 0.6933 0.4035 0.6410 -0.0102 -0.0217 -0.0147 364 PHE A CZ  
527  N N   . ASN A 120 ? 0.6170 0.4197 0.5445 0.0270  0.0023  -0.0612 365 ASN A N   
528  C CA  . ASN A 120 ? 0.6055 0.4222 0.5294 0.0322  0.0135  -0.0713 365 ASN A CA  
529  C C   . ASN A 120 ? 0.6228 0.4636 0.5637 0.0422  0.0135  -0.0584 365 ASN A C   
530  O O   . ASN A 120 ? 0.7057 0.5560 0.6605 0.0532  0.0233  -0.0644 365 ASN A O   
531  C CB  . ASN A 120 ? 0.6283 0.4537 0.5225 0.0152  0.0130  -0.0785 365 ASN A CB  
532  C CG  . ASN A 120 ? 0.7077 0.5103 0.5805 0.0047  0.0172  -0.0980 365 ASN A CG  
533  O OD1 . ASN A 120 ? 0.7453 0.5269 0.6272 0.0135  0.0268  -0.1118 365 ASN A OD1 
534  N ND2 . ASN A 120 ? 0.7077 0.5124 0.5521 -0.0146 0.0086  -0.0992 365 ASN A ND2 
535  N N   . GLU A 121 ? 0.6055 0.4575 0.5481 0.0381  0.0031  -0.0421 366 GLU A N   
536  C CA  . GLU A 121 ? 0.7083 0.5796 0.6646 0.0454  0.0019  -0.0304 366 GLU A CA  
537  C C   . GLU A 121 ? 0.7368 0.6022 0.7146 0.0598  0.0030  -0.0269 366 GLU A C   
538  O O   . GLU A 121 ? 0.7096 0.5916 0.7019 0.0682  0.0059  -0.0249 366 GLU A O   
539  C CB  . GLU A 121 ? 0.6017 0.4800 0.5571 0.0387  -0.0082 -0.0170 366 GLU A CB  
540  C CG  . GLU A 121 ? 0.7040 0.5852 0.6448 0.0258  -0.0147 -0.0177 366 GLU A CG  
541  C CD  . GLU A 121 ? 0.7745 0.6705 0.7038 0.0206  -0.0152 -0.0157 366 GLU A CD  
542  O OE1 . GLU A 121 ? 0.7690 0.6759 0.7029 0.0261  -0.0082 -0.0153 366 GLU A OE1 
543  O OE2 . GLU A 121 ? 0.7287 0.6255 0.6449 0.0097  -0.0240 -0.0133 366 GLU A OE2 
544  N N   . VAL A 122 ? 0.7045 0.5459 0.6852 0.0616  -0.0008 -0.0252 367 VAL A N   
545  C CA  . VAL A 122 ? 0.6408 0.4714 0.6399 0.0741  -0.0042 -0.0181 367 VAL A CA  
546  C C   . VAL A 122 ? 0.6202 0.4465 0.6372 0.0881  0.0041  -0.0320 367 VAL A C   
547  O O   . VAL A 122 ? 0.6047 0.4431 0.6456 0.1012  0.0030  -0.0281 367 VAL A O   
548  C CB  . VAL A 122 ? 0.7148 0.5175 0.7077 0.0685  -0.0115 -0.0098 367 VAL A CB  
549  C CG1 . VAL A 122 ? 0.7080 0.4940 0.7161 0.0799  -0.0188 0.0011  367 VAL A CG1 
550  C CG2 . VAL A 122 ? 0.6336 0.4465 0.6145 0.0551  -0.0159 0.0008  367 VAL A CG2 
551  N N   . VAL A 123 ? 0.6298 0.4398 0.6379 0.0852  0.0126  -0.0498 368 VAL A N   
552  C CA  . VAL A 123 ? 0.6096 0.4143 0.6364 0.0987  0.0243  -0.0682 368 VAL A CA  
553  C C   . VAL A 123 ? 0.6292 0.4707 0.6695 0.1039  0.0349  -0.0742 368 VAL A C   
554  O O   . VAL A 123 ? 0.6599 0.5104 0.7337 0.1207  0.0398  -0.0794 368 VAL A O   
555  C CB  . VAL A 123 ? 0.7049 0.4865 0.7112 0.0897  0.0336  -0.0896 368 VAL A CB  
556  C CG1 . VAL A 123 ? 0.7410 0.5197 0.7662 0.1031  0.0509  -0.1144 368 VAL A CG1 
557  C CG2 . VAL A 123 ? 0.7043 0.4482 0.7025 0.0841  0.0233  -0.0841 368 VAL A CG2 
558  N N   . ILE A 124 ? 0.5910 0.4546 0.6084 0.0893  0.0375  -0.0726 369 ILE A N   
559  C CA  . ILE A 124 ? 0.6273 0.5242 0.6533 0.0899  0.0491  -0.0787 369 ILE A CA  
560  C C   . ILE A 124 ? 0.6766 0.5954 0.7305 0.0996  0.0406  -0.0621 369 ILE A C   
561  O O   . ILE A 124 ? 0.6798 0.6224 0.7631 0.1095  0.0488  -0.0682 369 ILE A O   
562  C CB  . ILE A 124 ? 0.6875 0.5961 0.6773 0.0693  0.0515  -0.0789 369 ILE A CB  
563  C CG1 . ILE A 124 ? 0.6362 0.5265 0.5971 0.0580  0.0603  -0.0978 369 ILE A CG1 
564  C CG2 . ILE A 124 ? 0.6963 0.6388 0.6926 0.0662  0.0614  -0.0797 369 ILE A CG2 
565  C CD1 . ILE A 124 ? 0.7181 0.6151 0.6867 0.0626  0.0829  -0.1232 369 ILE A CD1 
566  N N   . MET A 125 ? 0.6037 0.5162 0.6494 0.0955  0.0244  -0.0423 370 MET A N   
567  C CA  . MET A 125 ? 0.6020 0.5311 0.6672 0.1014  0.0140  -0.0263 370 MET A CA  
568  C C   . MET A 125 ? 0.6391 0.5644 0.7407 0.1202  0.0095  -0.0251 370 MET A C   
569  O O   . MET A 125 ? 0.6177 0.5683 0.7474 0.1280  0.0065  -0.0204 370 MET A O   
570  C CB  . MET A 125 ? 0.6290 0.5459 0.6743 0.0922  0.0002  -0.0093 370 MET A CB  
571  C CG  . MET A 125 ? 0.7143 0.6467 0.7680 0.0924  -0.0106 0.0061  370 MET A CG  
572  S SD  . MET A 125 ? 0.6889 0.6071 0.7160 0.0795  -0.0207 0.0198  370 MET A SD  
573  C CE  . MET A 125 ? 0.6793 0.5910 0.6851 0.0685  -0.0129 0.0100  370 MET A CE  
574  N N   . ARG A 126 ? 0.6828 0.5758 0.7865 0.1273  0.0072  -0.0286 371 ARG A N   
575  C CA  . ARG A 126 ? 0.7285 0.6101 0.8669 0.1458  -0.0022 -0.0232 371 ARG A CA  
576  C C   . ARG A 126 ? 0.7375 0.6354 0.9168 0.1631  0.0113  -0.0425 371 ARG A C   
577  O O   . ARG A 126 ? 0.7962 0.7010 1.0170 0.1806  0.0019  -0.0362 371 ARG A O   
578  C CB  . ARG A 126 ? 0.7153 0.5515 0.8415 0.1461  -0.0101 -0.0191 371 ARG A CB  
579  C CG  . ARG A 126 ? 0.7220 0.5438 0.8176 0.1310  -0.0241 0.0018  371 ARG A CG  
580  C CD  . ARG A 126 ? 0.7875 0.5655 0.8779 0.1317  -0.0336 0.0093  371 ARG A CD  
581  N NE  . ARG A 126 ? 0.8001 0.5667 0.8622 0.1157  -0.0448 0.0293  371 ARG A NE  
582  C CZ  . ARG A 126 ? 0.8331 0.5640 0.8865 0.1119  -0.0561 0.0429  371 ARG A CZ  
583  N NH1 . ARG A 126 ? 0.7884 0.4877 0.8613 0.1249  -0.0601 0.0398  371 ARG A NH1 
584  N NH2 . ARG A 126 ? 0.7860 0.5112 0.8112 0.0942  -0.0625 0.0591  371 ARG A NH2 
585  N N   . ASP A 127 ? 0.6903 0.5956 0.8602 0.1582  0.0330  -0.0662 372 ASP A N   
586  C CA  . ASP A 127 ? 0.7453 0.6570 0.9524 0.1748  0.0499  -0.0901 372 ASP A CA  
587  C C   . ASP A 127 ? 0.6863 0.6383 0.8977 0.1686  0.0736  -0.1096 372 ASP A C   
588  O O   . ASP A 127 ? 0.7230 0.6905 0.9752 0.1837  0.0896  -0.1298 372 ASP A O   
589  C CB  . ASP A 127 ? 0.8334 0.7020 1.0269 0.1765  0.0574  -0.1079 372 ASP A CB  
590  C CG  . ASP A 127 ? 0.9074 0.7338 1.1066 0.1850  0.0362  -0.0908 372 ASP A CG  
591  O OD1 . ASP A 127 ? 0.8767 0.7026 1.1186 0.2046  0.0236  -0.0804 372 ASP A OD1 
592  O OD2 . ASP A 127 ? 0.9544 0.7490 1.1155 0.1706  0.0308  -0.0864 372 ASP A OD2 
593  N N   . TYR A 128 ? 0.7125 0.6815 0.8854 0.1468  0.0769  -0.1045 373 TYR A N   
594  C CA  . TYR A 128 ? 0.7062 0.7077 0.8724 0.1354  0.1000  -0.1220 373 TYR A CA  
595  C C   . TYR A 128 ? 0.7119 0.7454 0.8714 0.1224  0.0931  -0.1037 373 TYR A C   
596  O O   . TYR A 128 ? 0.7741 0.7969 0.8939 0.1061  0.0817  -0.0885 373 TYR A O   
597  C CB  . TYR A 128 ? 0.7066 0.6874 0.8217 0.1169  0.1129  -0.1379 373 TYR A CB  
598  C CG  . TYR A 128 ? 0.7545 0.6981 0.8718 0.1270  0.1181  -0.1564 373 TYR A CG  
599  C CD1 . TYR A 128 ? 0.7377 0.6857 0.8794 0.1374  0.1424  -0.1869 373 TYR A CD1 
600  C CD2 . TYR A 128 ? 0.8122 0.7159 0.9094 0.1256  0.1000  -0.1448 373 TYR A CD2 
601  C CE1 . TYR A 128 ? 0.7805 0.6896 0.9247 0.1468  0.1472  -0.2056 373 TYR A CE1 
602  C CE2 . TYR A 128 ? 0.7919 0.6581 0.8906 0.1329  0.1038  -0.1612 373 TYR A CE2 
603  C CZ  . TYR A 128 ? 0.8256 0.6923 0.9472 0.1439  0.1268  -0.1917 373 TYR A CZ  
604  O OH  . TYR A 128 ? 0.8305 0.6552 0.9534 0.1509  0.1307  -0.2099 373 TYR A OH  
605  N N   . GLN A 129 ? 0.7018 0.7746 0.9040 0.1299  0.0996  -0.1060 374 GLN A N   
606  C CA  . GLN A 129 ? 0.6601 0.7649 0.8608 0.1165  0.0946  -0.0911 374 GLN A CA  
607  C C   . GLN A 129 ? 0.6423 0.7892 0.8625 0.1100  0.1206  -0.1095 374 GLN A C   
608  O O   . GLN A 129 ? 0.7484 0.9109 1.0109 0.1256  0.1374  -0.1303 374 GLN A O   
609  C CB  . GLN A 129 ? 0.6722 0.7868 0.9081 0.1288  0.0712  -0.0703 374 GLN A CB  
610  C CG  . GLN A 129 ? 0.7839 0.8589 0.9980 0.1322  0.0471  -0.0515 374 GLN A CG  
611  C CD  . GLN A 129 ? 0.8529 0.9030 1.0949 0.1542  0.0404  -0.0545 374 GLN A CD  
612  O OE1 . GLN A 129 ? 0.8984 0.9648 1.1890 0.1721  0.0482  -0.0669 374 GLN A OE1 
613  N NE2 . GLN A 129 ? 0.8039 0.8142 1.0177 0.1528  0.0261  -0.0430 374 GLN A NE2 
614  N N   . HIS A 130 ? 0.5760 0.7407 0.7670 0.0863  0.1248  -0.1025 375 HIS A N   
615  C CA  . HIS A 130 ? 0.5551 0.7572 0.7521 0.0728  0.1523  -0.1198 375 HIS A CA  
616  C C   . HIS A 130 ? 0.5969 0.8160 0.7694 0.0480  0.1469  -0.1022 375 HIS A C   
617  O O   . HIS A 130 ? 0.6311 0.8239 0.7677 0.0388  0.1260  -0.0817 375 HIS A O   
618  C CB  . HIS A 130 ? 0.5972 0.7823 0.7544 0.0620  0.1751  -0.1425 375 HIS A CB  
619  C CG  . HIS A 130 ? 0.5996 0.8219 0.7561 0.0449  0.2072  -0.1628 375 HIS A CG  
620  N ND1 . HIS A 130 ? 0.5912 0.8213 0.6995 0.0132  0.2127  -0.1544 375 HIS A ND1 
621  C CD2 . HIS A 130 ? 0.5944 0.8472 0.7917 0.0538  0.2369  -0.1919 375 HIS A CD2 
622  C CE1 . HIS A 130 ? 0.6230 0.8881 0.7382 0.0006  0.2450  -0.1763 375 HIS A CE1 
623  N NE2 . HIS A 130 ? 0.6250 0.9065 0.7959 0.0255  0.2618  -0.2011 375 HIS A NE2 
624  N N   . GLU A 131 ? 0.5764 0.8397 0.7714 0.0371  0.1671  -0.1116 376 GLU A N   
625  C CA  . GLU A 131 ? 0.5980 0.8787 0.7736 0.0115  0.1639  -0.0959 376 GLU A CA  
626  C C   . GLU A 131 ? 0.6076 0.8530 0.7104 -0.0132 0.1584  -0.0847 376 GLU A C   
627  O O   . GLU A 131 ? 0.6128 0.8482 0.6938 -0.0274 0.1410  -0.0635 376 GLU A O   
628  C CB  . GLU A 131 ? 0.6655 0.9988 0.8709 -0.0007 0.1930  -0.1123 376 GLU A CB  
629  C CG  . GLU A 131 ? 0.7830 1.1602 1.0468 0.0032  0.1857  -0.1039 376 GLU A CG  
630  C CD  . GLU A 131 ? 0.8806 1.3129 1.2095 0.0124  0.2138  -0.1286 376 GLU A CD  
631  O OE1 . GLU A 131 ? 0.9152 1.3445 1.2712 0.0356  0.2261  -0.1496 376 GLU A OE1 
632  O OE2 . GLU A 131 ? 0.9070 1.3858 1.2627 -0.0038 0.2242  -0.1283 376 GLU A OE2 
633  N N   . ASN A 132 ? 0.6005 0.8258 0.6662 -0.0191 0.1720  -0.0991 377 ASN A N   
634  C CA  . ASN A 132 ? 0.5716 0.7673 0.5694 -0.0444 0.1667  -0.0892 377 ASN A CA  
635  C C   . ASN A 132 ? 0.5579 0.7082 0.5290 -0.0344 0.1459  -0.0822 377 ASN A C   
636  O O   . ASN A 132 ? 0.5806 0.7066 0.5005 -0.0510 0.1440  -0.0812 377 ASN A O   
637  C CB  . ASN A 132 ? 0.5881 0.7973 0.5547 -0.0663 0.1968  -0.1094 377 ASN A CB  
638  C CG  . ASN A 132 ? 0.6427 0.8993 0.6312 -0.0823 0.2191  -0.1148 377 ASN A CG  
639  O OD1 . ASN A 132 ? 0.5948 0.8847 0.6129 -0.0787 0.2489  -0.1407 377 ASN A OD1 
640  N ND2 . ASN A 132 ? 0.6910 0.9511 0.6682 -0.1002 0.2054  -0.0913 377 ASN A ND2 
641  N N   . VAL A 133 ? 0.5354 0.6753 0.5401 -0.0096 0.1295  -0.0767 378 VAL A N   
642  C CA  . VAL A 133 ? 0.5793 0.6804 0.5659 -0.0003 0.1099  -0.0690 378 VAL A CA  
643  C C   . VAL A 133 ? 0.5663 0.6608 0.5662 0.0060  0.0862  -0.0470 378 VAL A C   
644  O O   . VAL A 133 ? 0.5578 0.6742 0.5962 0.0160  0.0840  -0.0436 378 VAL A O   
645  C CB  . VAL A 133 ? 0.5320 0.6225 0.5430 0.0219  0.1160  -0.0863 378 VAL A CB  
646  C CG1 . VAL A 133 ? 0.5639 0.6168 0.5588 0.0290  0.0956  -0.0767 378 VAL A CG1 
647  C CG2 . VAL A 133 ? 0.5773 0.6732 0.5736 0.0144  0.1426  -0.1127 378 VAL A CG2 
648  N N   . VAL A 134 ? 0.5222 0.5885 0.4911 -0.0010 0.0686  -0.0329 379 VAL A N   
649  C CA  . VAL A 134 ? 0.5391 0.5975 0.5176 0.0036  0.0492  -0.0155 379 VAL A CA  
650  C C   . VAL A 134 ? 0.5510 0.6072 0.5618 0.0253  0.0432  -0.0170 379 VAL A C   
651  O O   . VAL A 134 ? 0.5366 0.5785 0.5499 0.0363  0.0456  -0.0258 379 VAL A O   
652  C CB  . VAL A 134 ? 0.5351 0.5643 0.4818 -0.0049 0.0332  -0.0036 379 VAL A CB  
653  C CG1 . VAL A 134 ? 0.5560 0.5771 0.5154 0.0013  0.0174  0.0090  379 VAL A CG1 
654  C CG2 . VAL A 134 ? 0.5736 0.6022 0.4879 -0.0277 0.0343  0.0027  379 VAL A CG2 
655  N N   . GLU A 135 ? 0.5303 0.5990 0.5639 0.0297  0.0343  -0.0076 380 GLU A N   
656  C CA  . GLU A 135 ? 0.5155 0.5819 0.5762 0.0476  0.0260  -0.0057 380 GLU A CA  
657  C C   . GLU A 135 ? 0.5175 0.5543 0.5595 0.0489  0.0112  0.0041  380 GLU A C   
658  O O   . GLU A 135 ? 0.4729 0.5011 0.4962 0.0384  0.0038  0.0124  380 GLU A O   
659  C CB  . GLU A 135 ? 0.5881 0.6824 0.6799 0.0497  0.0207  0.0004  380 GLU A CB  
660  C CG  . GLU A 135 ? 0.7414 0.8390 0.8671 0.0689  0.0129  0.0014  380 GLU A CG  
661  C CD  . GLU A 135 ? 0.7836 0.9135 0.9438 0.0701  0.0053  0.0077  380 GLU A CD  
662  O OE1 . GLU A 135 ? 0.7929 0.9457 0.9533 0.0556  0.0105  0.0080  380 GLU A OE1 
663  O OE2 . GLU A 135 ? 0.7915 0.9231 0.9781 0.0841  -0.0075 0.0136  380 GLU A OE2 
664  N N   . MET A 136 ? 0.4783 0.4988 0.5270 0.0614  0.0080  0.0022  381 MET A N   
665  C CA  A MET A 136 ? 0.5168 0.5119 0.5502 0.0616  -0.0030 0.0099  381 MET A CA  
666  C CA  C MET A 136 ? 0.5122 0.5074 0.5456 0.0616  -0.0030 0.0099  381 MET A CA  
667  C C   . MET A 136 ? 0.5189 0.5137 0.5684 0.0699  -0.0141 0.0191  381 MET A C   
668  O O   . MET A 136 ? 0.5250 0.5242 0.5985 0.0822  -0.0145 0.0173  381 MET A O   
669  C CB  A MET A 136 ? 0.5651 0.5382 0.5869 0.0642  0.0011  0.0021  381 MET A CB  
670  C CB  C MET A 136 ? 0.5377 0.5107 0.5590 0.0639  0.0011  0.0021  381 MET A CB  
671  C CG  A MET A 136 ? 0.6590 0.6353 0.6659 0.0564  0.0124  -0.0092 381 MET A CG  
672  C CG  C MET A 136 ? 0.6624 0.6313 0.6589 0.0515  0.0054  -0.0025 381 MET A CG  
673  S SD  A MET A 136 ? 0.7040 0.6554 0.6978 0.0578  0.0172  -0.0217 381 MET A SD  
674  S SD  C MET A 136 ? 0.7721 0.7252 0.7552 0.0508  0.0143  -0.0177 381 MET A SD  
675  C CE  A MET A 136 ? 0.7070 0.6404 0.6816 0.0489  0.0037  -0.0111 381 MET A CE  
676  C CE  C MET A 136 ? 0.6660 0.6395 0.6688 0.0580  0.0314  -0.0325 381 MET A CE  
677  N N   . TYR A 137 ? 0.4631 0.4517 0.4993 0.0626  -0.0235 0.0287  382 TYR A N   
678  C CA  . TYR A 137 ? 0.4594 0.4489 0.5028 0.0652  -0.0358 0.0391  382 TYR A CA  
679  C C   . TYR A 137 ? 0.4618 0.4254 0.4931 0.0674  -0.0416 0.0447  382 TYR A C   
680  O O   . TYR A 137 ? 0.5008 0.4593 0.5444 0.0756  -0.0502 0.0515  382 TYR A O   
681  C CB  . TYR A 137 ? 0.4848 0.4821 0.5167 0.0529  -0.0417 0.0445  382 TYR A CB  
682  C CG  . TYR A 137 ? 0.4956 0.5158 0.5371 0.0471  -0.0368 0.0410  382 TYR A CG  
683  C CD1 . TYR A 137 ? 0.4978 0.5436 0.5680 0.0534  -0.0338 0.0384  382 TYR A CD1 
684  C CD2 . TYR A 137 ? 0.4651 0.4807 0.4892 0.0349  -0.0346 0.0399  382 TYR A CD2 
685  C CE1 . TYR A 137 ? 0.5004 0.5691 0.5783 0.0445  -0.0271 0.0352  382 TYR A CE1 
686  C CE2 . TYR A 137 ? 0.4708 0.5036 0.5002 0.0265  -0.0307 0.0386  382 TYR A CE2 
687  C CZ  . TYR A 137 ? 0.4903 0.5507 0.5449 0.0299  -0.0262 0.0364  382 TYR A CZ  
688  O OH  . TYR A 137 ? 0.5416 0.6212 0.6005 0.0182  -0.0203 0.0353  382 TYR A OH  
689  N N   . ASN A 138 ? 0.4554 0.4028 0.4645 0.0593  -0.0380 0.0429  383 ASN A N   
690  C CA  . ASN A 138 ? 0.4537 0.3791 0.4495 0.0569  -0.0414 0.0483  383 ASN A CA  
691  C C   . ASN A 138 ? 0.4531 0.3673 0.4382 0.0518  -0.0329 0.0407  383 ASN A C   
692  O O   . ASN A 138 ? 0.4389 0.3613 0.4233 0.0488  -0.0280 0.0342  383 ASN A O   
693  C CB  . ASN A 138 ? 0.4727 0.3960 0.4515 0.0467  -0.0489 0.0574  383 ASN A CB  
694  C CG  . ASN A 138 ? 0.5307 0.4647 0.5192 0.0498  -0.0623 0.0677  383 ASN A CG  
695  O OD1 . ASN A 138 ? 0.5334 0.4867 0.5278 0.0467  -0.0650 0.0671  383 ASN A OD1 
696  N ND2 . ASN A 138 ? 0.5033 0.4243 0.4953 0.0551  -0.0727 0.0782  383 ASN A ND2 
697  N N   . SER A 139 ? 0.4779 0.3731 0.4558 0.0498  -0.0331 0.0431  384 SER A N   
698  C CA  . SER A 139 ? 0.4652 0.3524 0.4368 0.0433  -0.0267 0.0367  384 SER A CA  
699  C C   . SER A 139 ? 0.4657 0.3424 0.4234 0.0325  -0.0261 0.0424  384 SER A C   
700  O O   . SER A 139 ? 0.4902 0.3561 0.4389 0.0306  -0.0321 0.0526  384 SER A O   
701  C CB  . SER A 139 ? 0.4762 0.3510 0.4534 0.0482  -0.0245 0.0305  384 SER A CB  
702  O OG  . SER A 139 ? 0.5332 0.3885 0.5115 0.0522  -0.0290 0.0366  384 SER A OG  
703  N N   . TYR A 140 ? 0.4631 0.3441 0.4199 0.0246  -0.0191 0.0360  385 TYR A N   
704  C CA  . TYR A 140 ? 0.4916 0.3686 0.4370 0.0120  -0.0136 0.0376  385 TYR A CA  
705  C C   . TYR A 140 ? 0.5240 0.4036 0.4800 0.0065  -0.0066 0.0297  385 TYR A C   
706  O O   . TYR A 140 ? 0.5269 0.4156 0.4980 0.0116  -0.0076 0.0228  385 TYR A O   
707  C CB  . TYR A 140 ? 0.4664 0.3548 0.4047 0.0067  -0.0099 0.0350  385 TYR A CB  
708  C CG  . TYR A 140 ? 0.5141 0.4047 0.4442 0.0102  -0.0187 0.0420  385 TYR A CG  
709  C CD1 . TYR A 140 ? 0.5190 0.4004 0.4287 0.0028  -0.0248 0.0528  385 TYR A CD1 
710  C CD2 . TYR A 140 ? 0.4866 0.3890 0.4292 0.0187  -0.0223 0.0390  385 TYR A CD2 
711  C CE1 . TYR A 140 ? 0.5390 0.4256 0.4450 0.0052  -0.0359 0.0601  385 TYR A CE1 
712  C CE2 . TYR A 140 ? 0.4642 0.3726 0.4038 0.0203  -0.0306 0.0450  385 TYR A CE2 
713  C CZ  . TYR A 140 ? 0.5047 0.4066 0.4282 0.0143  -0.0380 0.0552  385 TYR A CZ  
714  O OH  . TYR A 140 ? 0.5250 0.4361 0.4492 0.0152  -0.0491 0.0619  385 TYR A OH  
715  N N   . LEU A 141 ? 0.5203 0.3929 0.4679 -0.0061 -0.0005 0.0318  386 LEU A N   
716  C CA  . LEU A 141 ? 0.4943 0.3763 0.4564 -0.0145 0.0079  0.0236  386 LEU A CA  
717  C C   . LEU A 141 ? 0.5282 0.4263 0.4926 -0.0216 0.0197  0.0164  386 LEU A C   
718  O O   . LEU A 141 ? 0.5562 0.4489 0.4985 -0.0331 0.0261  0.0200  386 LEU A O   
719  C CB  . LEU A 141 ? 0.5202 0.3859 0.4738 -0.0267 0.0098  0.0288  386 LEU A CB  
720  C CG  . LEU A 141 ? 0.5445 0.4242 0.5162 -0.0388 0.0193  0.0205  386 LEU A CG  
721  C CD1 . LEU A 141 ? 0.5406 0.4315 0.5379 -0.0307 0.0126  0.0127  386 LEU A CD1 
722  C CD2 . LEU A 141 ? 0.6277 0.4884 0.5848 -0.0557 0.0223  0.0278  386 LEU A CD2 
723  N N   . VAL A 142 ? 0.5244 0.4406 0.5146 -0.0155 0.0221  0.0059  387 VAL A N   
724  C CA  . VAL A 142 ? 0.5178 0.4490 0.5181 -0.0192 0.0347  -0.0051 387 VAL A CA  
725  C C   . VAL A 142 ? 0.5539 0.5038 0.5891 -0.0219 0.0417  -0.0150 387 VAL A C   
726  O O   . VAL A 142 ? 0.5617 0.5207 0.6246 -0.0117 0.0324  -0.0175 387 VAL A O   
727  C CB  . VAL A 142 ? 0.5281 0.4622 0.5341 -0.0077 0.0296  -0.0088 387 VAL A CB  
728  C CG1 . VAL A 142 ? 0.5171 0.4614 0.5318 -0.0116 0.0442  -0.0228 387 VAL A CG1 
729  C CG2 . VAL A 142 ? 0.5303 0.4506 0.5080 -0.0050 0.0200  0.0019  387 VAL A CG2 
730  N N   . GLY A 143 ? 0.5391 0.4963 0.5735 -0.0371 0.0572  -0.0198 388 GLY A N   
731  C CA  . GLY A 143 ? 0.5234 0.5031 0.5962 -0.0415 0.0644  -0.0291 388 GLY A CA  
732  C C   . GLY A 143 ? 0.5311 0.5066 0.6140 -0.0394 0.0487  -0.0216 388 GLY A C   
733  O O   . GLY A 143 ? 0.5718 0.5269 0.6287 -0.0467 0.0438  -0.0116 388 GLY A O   
734  N N   . ASP A 144 ? 0.5270 0.5197 0.6477 -0.0299 0.0394  -0.0266 389 ASP A N   
735  C CA  . ASP A 144 ? 0.5288 0.5191 0.6576 -0.0302 0.0234  -0.0214 389 ASP A CA  
736  C C   . ASP A 144 ? 0.5257 0.4989 0.6365 -0.0176 0.0058  -0.0140 389 ASP A C   
737  O O   . ASP A 144 ? 0.5158 0.4883 0.6320 -0.0174 -0.0084 -0.0118 389 ASP A O   
738  C CB  . ASP A 144 ? 0.5673 0.5882 0.7473 -0.0302 0.0202  -0.0293 389 ASP A CB  
739  C CG  . ASP A 144 ? 0.6284 0.6725 0.8323 -0.0443 0.0409  -0.0390 389 ASP A CG  
740  O OD1 . ASP A 144 ? 0.6309 0.6648 0.8117 -0.0615 0.0493  -0.0354 389 ASP A OD1 
741  O OD2 . ASP A 144 ? 0.6173 0.6889 0.8636 -0.0388 0.0495  -0.0507 389 ASP A OD2 
742  N N   . GLU A 145 ? 0.4781 0.4390 0.5662 -0.0095 0.0069  -0.0108 390 GLU A N   
743  C CA  . GLU A 145 ? 0.4851 0.4358 0.5609 0.0012  -0.0066 -0.0054 390 GLU A CA  
744  C C   . GLU A 145 ? 0.5055 0.4355 0.5465 0.0024  -0.0059 0.0011  390 GLU A C   
745  O O   . GLU A 145 ? 0.5134 0.4372 0.5393 -0.0011 0.0028  0.0031  390 GLU A O   
746  C CB  . GLU A 145 ? 0.4528 0.4115 0.5432 0.0109  -0.0082 -0.0080 390 GLU A CB  
747  C CG  . GLU A 145 ? 0.4720 0.4507 0.6051 0.0137  -0.0116 -0.0142 390 GLU A CG  
748  C CD  . GLU A 145 ? 0.5288 0.5094 0.6787 0.0244  -0.0138 -0.0171 390 GLU A CD  
749  O OE1 . GLU A 145 ? 0.4791 0.4467 0.6050 0.0269  -0.0101 -0.0157 390 GLU A OE1 
750  O OE2 . GLU A 145 ? 0.5117 0.5063 0.7014 0.0302  -0.0204 -0.0207 390 GLU A OE2 
751  N N   . LEU A 146 ? 0.4548 0.3751 0.4842 0.0068  -0.0156 0.0043  391 LEU A N   
752  C CA  . LEU A 146 ? 0.4624 0.3687 0.4693 0.0122  -0.0160 0.0088  391 LEU A CA  
753  C C   . LEU A 146 ? 0.4816 0.3947 0.4878 0.0196  -0.0190 0.0103  391 LEU A C   
754  O O   . LEU A 146 ? 0.4730 0.3924 0.4867 0.0214  -0.0261 0.0097  391 LEU A O   
755  C CB  . LEU A 146 ? 0.4687 0.3625 0.4655 0.0125  -0.0211 0.0074  391 LEU A CB  
756  C CG  . LEU A 146 ? 0.4998 0.3835 0.4825 0.0207  -0.0206 0.0092  391 LEU A CG  
757  C CD1 . LEU A 146 ? 0.5013 0.3724 0.4778 0.0216  -0.0171 0.0150  391 LEU A CD1 
758  C CD2 . LEU A 146 ? 0.5101 0.3839 0.4848 0.0208  -0.0226 0.0026  391 LEU A CD2 
759  N N   . TRP A 147 ? 0.4501 0.3609 0.4462 0.0218  -0.0151 0.0135  392 TRP A N   
760  C CA  . TRP A 147 ? 0.4375 0.3534 0.4314 0.0264  -0.0177 0.0152  392 TRP A CA  
761  C C   . TRP A 147 ? 0.5004 0.4126 0.4828 0.0309  -0.0196 0.0195  392 TRP A C   
762  O O   . TRP A 147 ? 0.5084 0.4137 0.4842 0.0312  -0.0185 0.0232  392 TRP A O   
763  C CB  . TRP A 147 ? 0.4284 0.3476 0.4221 0.0236  -0.0123 0.0134  392 TRP A CB  
764  C CG  . TRP A 147 ? 0.4431 0.3691 0.4554 0.0217  -0.0079 0.0059  392 TRP A CG  
765  C CD1 . TRP A 147 ? 0.4448 0.3769 0.4770 0.0216  -0.0096 0.0026  392 TRP A CD1 
766  C CD2 . TRP A 147 ? 0.4810 0.4100 0.4982 0.0201  -0.0009 -0.0011 392 TRP A CD2 
767  N NE1 . TRP A 147 ? 0.4445 0.3858 0.4995 0.0220  -0.0041 -0.0056 392 TRP A NE1 
768  C CE2 . TRP A 147 ? 0.4587 0.3966 0.5039 0.0213  0.0028  -0.0093 392 TRP A CE2 
769  C CE3 . TRP A 147 ? 0.5214 0.4464 0.5228 0.0170  0.0024  -0.0024 392 TRP A CE3 
770  C CZ2 . TRP A 147 ? 0.4755 0.4177 0.5361 0.0216  0.0121  -0.0209 392 TRP A CZ2 
771  C CZ3 . TRP A 147 ? 0.4816 0.4081 0.4915 0.0148  0.0114  -0.0140 392 TRP A CZ3 
772  C CH2 . TRP A 147 ? 0.4694 0.4040 0.5098 0.0181  0.0173  -0.0240 392 TRP A CH2 
773  N N   . VAL A 148 ? 0.4057 0.3234 0.3876 0.0336  -0.0228 0.0196  393 VAL A N   
774  C CA  . VAL A 148 ? 0.4143 0.3354 0.3930 0.0381  -0.0223 0.0213  393 VAL A CA  
775  C C   . VAL A 148 ? 0.4286 0.3599 0.4076 0.0365  -0.0241 0.0243  393 VAL A C   
776  O O   . VAL A 148 ? 0.4408 0.3743 0.4191 0.0329  -0.0264 0.0243  393 VAL A O   
777  C CB  . VAL A 148 ? 0.4475 0.3681 0.4233 0.0394  -0.0207 0.0163  393 VAL A CB  
778  C CG1 . VAL A 148 ? 0.4342 0.3644 0.4139 0.0447  -0.0169 0.0153  393 VAL A CG1 
779  C CG2 . VAL A 148 ? 0.4586 0.3653 0.4331 0.0397  -0.0195 0.0121  393 VAL A CG2 
780  N N   . VAL A 149 ? 0.4166 0.3522 0.3960 0.0377  -0.0251 0.0281  394 VAL A N   
781  C CA  . VAL A 149 ? 0.4529 0.3986 0.4326 0.0341  -0.0275 0.0306  394 VAL A CA  
782  C C   . VAL A 149 ? 0.3931 0.3530 0.3808 0.0372  -0.0262 0.0308  394 VAL A C   
783  O O   . VAL A 149 ? 0.3984 0.3623 0.3953 0.0445  -0.0257 0.0310  394 VAL A O   
784  C CB  . VAL A 149 ? 0.4667 0.4118 0.4411 0.0309  -0.0310 0.0343  394 VAL A CB  
785  C CG1 . VAL A 149 ? 0.4332 0.3879 0.4072 0.0246  -0.0346 0.0356  394 VAL A CG1 
786  C CG2 . VAL A 149 ? 0.4414 0.3743 0.4071 0.0264  -0.0275 0.0310  394 VAL A CG2 
787  N N   . MET A 150 ? 0.4251 0.3919 0.4109 0.0313  -0.0250 0.0304  395 MET A N   
788  C CA  . MET A 150 ? 0.4449 0.4276 0.4367 0.0312  -0.0194 0.0281  395 MET A CA  
789  C C   . MET A 150 ? 0.4605 0.4547 0.4516 0.0209  -0.0204 0.0318  395 MET A C   
790  O O   . MET A 150 ? 0.4502 0.4350 0.4346 0.0144  -0.0263 0.0356  395 MET A O   
791  C CB  . MET A 150 ? 0.4957 0.4721 0.4774 0.0300  -0.0141 0.0226  395 MET A CB  
792  C CG  . MET A 150 ? 0.5127 0.4776 0.4792 0.0208  -0.0194 0.0264  395 MET A CG  
793  S SD  . MET A 150 ? 0.5736 0.5277 0.5245 0.0178  -0.0191 0.0218  395 MET A SD  
794  C CE  . MET A 150 ? 0.6348 0.6023 0.5716 0.0075  -0.0093 0.0181  395 MET A CE  
795  N N   . GLU A 151 ? 0.6802 0.4863 0.3271 -0.0970 0.0029  0.0176  396 GLU A N   
796  C CA  . GLU A 151 ? 0.6968 0.5159 0.3651 -0.0983 -0.0077 0.0103  396 GLU A CA  
797  C C   . GLU A 151 ? 0.6898 0.5125 0.3894 -0.0932 0.0194  -0.0028 396 GLU A C   
798  O O   . GLU A 151 ? 0.6640 0.5014 0.4010 -0.0802 0.0343  -0.0002 396 GLU A O   
799  C CB  . GLU A 151 ? 0.6776 0.5309 0.3921 -0.0861 -0.0332 0.0229  396 GLU A CB  
800  C CG  . GLU A 151 ? 0.7231 0.5912 0.4586 -0.0900 -0.0485 0.0181  396 GLU A CG  
801  C CD  . GLU A 151 ? 0.6873 0.5904 0.4753 -0.0768 -0.0660 0.0293  396 GLU A CD  
802  O OE1 . GLU A 151 ? 0.6303 0.5433 0.4340 -0.0647 -0.0676 0.0405  396 GLU A OE1 
803  O OE2 . GLU A 151 ? 0.7383 0.6573 0.5518 -0.0794 -0.0759 0.0260  396 GLU A OE2 
804  N N   . PHE A 152 ? 0.6842 0.4926 0.3696 -0.1037 0.0240  -0.0165 397 PHE A N   
805  C CA  . PHE A 152 ? 0.6713 0.4809 0.3893 -0.0980 0.0469  -0.0278 397 PHE A CA  
806  C C   . PHE A 152 ? 0.6571 0.4941 0.4215 -0.0901 0.0313  -0.0232 397 PHE A C   
807  O O   . PHE A 152 ? 0.6937 0.5327 0.4499 -0.0995 0.0114  -0.0243 397 PHE A O   
808  C CB  . PHE A 152 ? 0.7193 0.4931 0.3962 -0.1138 0.0645  -0.0465 397 PHE A CB  
809  C CG  . PHE A 152 ? 0.7792 0.5505 0.4907 -0.1075 0.0866  -0.0577 397 PHE A CG  
810  C CD1 . PHE A 152 ? 0.7501 0.5382 0.5111 -0.0899 0.1038  -0.0536 397 PHE A CD1 
811  C CD2 . PHE A 152 ? 0.8445 0.5945 0.5384 -0.1200 0.0891  -0.0721 397 PHE A CD2 
812  C CE1 . PHE A 152 ? 0.7767 0.5605 0.5706 -0.0829 0.1218  -0.0617 397 PHE A CE1 
813  C CE2 . PHE A 152 ? 0.8440 0.5873 0.5696 -0.1134 0.1098  -0.0814 397 PHE A CE2 
814  C CZ  . PHE A 152 ? 0.7847 0.5452 0.5613 -0.0939 0.1256  -0.0752 397 PHE A CZ  
815  N N   . LEU A 153 ? 0.6180 0.4754 0.4299 -0.0742 0.0401  -0.0178 398 LEU A N   
816  C CA  . LEU A 153 ? 0.5845 0.4646 0.4375 -0.0667 0.0298  -0.0127 398 LEU A CA  
817  C C   . LEU A 153 ? 0.6151 0.4816 0.4809 -0.0672 0.0477  -0.0234 398 LEU A C   
818  O O   . LEU A 153 ? 0.6006 0.4698 0.4943 -0.0555 0.0634  -0.0222 398 LEU A O   
819  C CB  . LEU A 153 ? 0.5708 0.4761 0.4593 -0.0510 0.0272  0.0001  398 LEU A CB  
820  C CG  . LEU A 153 ? 0.5897 0.5123 0.4789 -0.0484 0.0064  0.0117  398 LEU A CG  
821  C CD1 . LEU A 153 ? 0.5795 0.5192 0.4889 -0.0500 -0.0106 0.0147  398 LEU A CD1 
822  C CD2 . LEU A 153 ? 0.5581 0.4647 0.4049 -0.0578 -0.0013 0.0123  398 LEU A CD2 
823  N N   . GLU A 154 ? 0.6330 0.4835 0.4790 -0.0812 0.0439  -0.0336 399 GLU A N   
824  C CA  . GLU A 154 ? 0.6535 0.4799 0.5003 -0.0846 0.0640  -0.0469 399 GLU A CA  
825  C C   . GLU A 154 ? 0.6380 0.4761 0.5304 -0.0730 0.0679  -0.0412 399 GLU A C   
826  O O   . GLU A 154 ? 0.6604 0.4791 0.5626 -0.0704 0.0869  -0.0488 399 GLU A O   
827  C CB  . GLU A 154 ? 0.7010 0.5046 0.5106 -0.1054 0.0572  -0.0602 399 GLU A CB  
828  C CG  . GLU A 154 ? 0.7268 0.5503 0.5492 -0.1129 0.0307  -0.0547 399 GLU A CG  
829  C CD  . GLU A 154 ? 0.7564 0.5992 0.5656 -0.1162 0.0042  -0.0446 399 GLU A CD  
830  O OE1 . GLU A 154 ? 0.7652 0.5972 0.5410 -0.1175 0.0053  -0.0437 399 GLU A OE1 
831  O OE2 . GLU A 154 ? 0.7370 0.6050 0.5716 -0.1172 -0.0165 -0.0370 399 GLU A OE2 
832  N N   . GLY A 155 ? 0.5873 0.4535 0.5059 -0.0662 0.0517  -0.0278 400 GLY A N   
833  C CA  . GLY A 155 ? 0.5822 0.4576 0.5368 -0.0562 0.0545  -0.0200 400 GLY A CA  
834  C C   . GLY A 155 ? 0.5846 0.4658 0.5628 -0.0395 0.0651  -0.0122 400 GLY A C   
835  O O   . GLY A 155 ? 0.5824 0.4670 0.5859 -0.0313 0.0666  -0.0045 400 GLY A O   
836  N N   . GLY A 156 ? 0.5670 0.4486 0.5371 -0.0355 0.0717  -0.0134 401 GLY A N   
837  C CA  . GLY A 156 ? 0.5710 0.4605 0.5679 -0.0213 0.0805  -0.0068 401 GLY A CA  
838  C C   . GLY A 156 ? 0.5401 0.4554 0.5527 -0.0133 0.0658  0.0073  401 GLY A C   
839  O O   . GLY A 156 ? 0.5169 0.4443 0.5194 -0.0175 0.0517  0.0113  401 GLY A O   
840  N N   . ALA A 157 ? 0.5055 0.4287 0.5450 -0.0017 0.0690  0.0146  402 ALA A N   
841  C CA  . ALA A 157 ? 0.4741 0.4178 0.5241 0.0045  0.0565  0.0262  402 ALA A CA  
842  C C   . ALA A 157 ? 0.4526 0.3991 0.5149 0.0083  0.0486  0.0354  402 ALA A C   
843  O O   . ALA A 157 ? 0.4552 0.3883 0.5267 0.0099  0.0538  0.0356  402 ALA A O   
844  C CB  . ALA A 157 ? 0.4618 0.4141 0.5307 0.0122  0.0613  0.0291  402 ALA A CB  
845  N N   . LEU A 158 ? 0.4278 0.3886 0.4877 0.0094  0.0375  0.0431  403 LEU A N   
846  C CA  . LEU A 158 ? 0.4231 0.3844 0.4873 0.0113  0.0317  0.0522  403 LEU A CA  
847  C C   . LEU A 158 ? 0.4346 0.3911 0.5159 0.0199  0.0309  0.0604  403 LEU A C   
848  O O   . LEU A 158 ? 0.4364 0.3832 0.5188 0.0208  0.0286  0.0680  403 LEU A O   
849  C CB  . LEU A 158 ? 0.3822 0.3572 0.4382 0.0105  0.0235  0.0566  403 LEU A CB  
850  C CG  . LEU A 158 ? 0.4312 0.4052 0.4834 0.0100  0.0201  0.0649  403 LEU A CG  
851  C CD1 . LEU A 158 ? 0.4466 0.4135 0.4972 0.0029  0.0249  0.0632  403 LEU A CD1 
852  C CD2 . LEU A 158 ? 0.4586 0.4438 0.5027 0.0100  0.0157  0.0663  403 LEU A CD2 
853  N N   . THR A 159 ? 0.4149 0.3777 0.5115 0.0258  0.0322  0.0600  404 THR A N   
854  C CA  . THR A 159 ? 0.4076 0.3697 0.5286 0.0348  0.0283  0.0689  404 THR A CA  
855  C C   . THR A 159 ? 0.4897 0.4325 0.6216 0.0382  0.0353  0.0699  404 THR A C   
856  O O   . THR A 159 ? 0.4494 0.3854 0.5906 0.0439  0.0271  0.0821  404 THR A O   
857  C CB  . THR A 159 ? 0.4055 0.3792 0.5499 0.0396  0.0324  0.0656  404 THR A CB  
858  O OG1 . THR A 159 ? 0.4192 0.4069 0.5514 0.0352  0.0267  0.0646  404 THR A OG1 
859  C CG2 . THR A 159 ? 0.3790 0.3576 0.5558 0.0494  0.0239  0.0765  404 THR A CG2 
860  N N   . ASP A 160 ? 0.4285 0.3590 0.5562 0.0340  0.0497  0.0576  405 ASP A N   
861  C CA  . ASP A 160 ? 0.4548 0.3627 0.5933 0.0369  0.0587  0.0567  405 ASP A CA  
862  C C   . ASP A 160 ? 0.5238 0.4198 0.6474 0.0322  0.0522  0.0649  405 ASP A C   
863  O O   . ASP A 160 ? 0.5561 0.4334 0.6909 0.0370  0.0538  0.0719  405 ASP A O   
864  C CB  . ASP A 160 ? 0.5075 0.4009 0.6370 0.0301  0.0764  0.0394  405 ASP A CB  
865  C CG  . ASP A 160 ? 0.6098 0.4755 0.7508 0.0328  0.0886  0.0361  405 ASP A CG  
866  O OD1 . ASP A 160 ? 0.6057 0.4663 0.7788 0.0452  0.0953  0.0392  405 ASP A OD1 
867  O OD2 . ASP A 160 ? 0.6216 0.4707 0.7430 0.0225  0.0914  0.0305  405 ASP A OD2 
868  N N   . ILE A 161 ? 0.4990 0.4047 0.5998 0.0230  0.0459  0.0648  406 ILE A N   
869  C CA  . ILE A 161 ? 0.4958 0.3917 0.5837 0.0168  0.0431  0.0718  406 ILE A CA  
870  C C   . ILE A 161 ? 0.5342 0.4297 0.6209 0.0228  0.0318  0.0887  406 ILE A C   
871  O O   . ILE A 161 ? 0.5389 0.4148 0.6236 0.0235  0.0311  0.0990  406 ILE A O   
872  C CB  . ILE A 161 ? 0.4712 0.3801 0.5423 0.0055  0.0422  0.0650  406 ILE A CB  
873  C CG1 . ILE A 161 ? 0.4564 0.3594 0.5240 -0.0033 0.0498  0.0502  406 ILE A CG1 
874  C CG2 . ILE A 161 ? 0.4765 0.3809 0.5374 -0.0005 0.0407  0.0737  406 ILE A CG2 
875  C CD1 . ILE A 161 ? 0.4966 0.4176 0.5540 -0.0121 0.0446  0.0438  406 ILE A CD1 
876  N N   . VAL A 162 ? 0.4534 0.3677 0.5376 0.0257  0.0222  0.0920  407 VAL A N   
877  C CA  A VAL A 162 ? 0.4788 0.3924 0.5534 0.0283  0.0092  0.1066  407 VAL A CA  
878  C CA  B VAL A 162 ? 0.4818 0.3943 0.5558 0.0280  0.0095  0.1068  407 VAL A CA  
879  C C   . VAL A 162 ? 0.5124 0.4146 0.6066 0.0387  0.0012  0.1190  407 VAL A C   
880  O O   . VAL A 162 ? 0.5249 0.4143 0.6065 0.0395  -0.0097 0.1342  407 VAL A O   
881  C CB  A VAL A 162 ? 0.4592 0.3940 0.5286 0.0281  0.0015  0.1041  407 VAL A CB  
882  C CB  B VAL A 162 ? 0.4538 0.3862 0.5188 0.0270  0.0013  0.1055  407 VAL A CB  
883  C CG1 A VAL A 162 ? 0.4461 0.3825 0.5172 0.0332  -0.0149 0.1169  407 VAL A CG1 
884  C CG1 B VAL A 162 ? 0.4674 0.4100 0.5196 0.0190  0.0093  0.0942  407 VAL A CG1 
885  C CG2 A VAL A 162 ? 0.4610 0.4007 0.5064 0.0189  0.0053  0.0995  407 VAL A CG2 
886  C CG2 B VAL A 162 ? 0.4380 0.3850 0.5281 0.0347  -0.0033 0.1031  407 VAL A CG2 
887  N N   . THR A 163 ? 0.4925 0.3981 0.6178 0.0470  0.0066  0.1133  408 THR A N   
888  C CA  . THR A 163 ? 0.4788 0.3769 0.6328 0.0593  -0.0014 0.1255  408 THR A CA  
889  C C   . THR A 163 ? 0.5218 0.3905 0.6805 0.0620  0.0069  0.1297  408 THR A C   
890  O O   . THR A 163 ? 0.5580 0.4155 0.7396 0.0731  -0.0013 0.1433  408 THR A O   
891  C CB  . THR A 163 ? 0.4881 0.4040 0.6815 0.0683  0.0030  0.1181  408 THR A CB  
892  O OG1 . THR A 163 ? 0.5327 0.4433 0.7294 0.0653  0.0249  0.1003  408 THR A OG1 
893  C CG2 . THR A 163 ? 0.4321 0.3746 0.6232 0.0653  -0.0069 0.1164  408 THR A CG2 
894  N N   . HIS A 164 ? 0.4892 0.3443 0.6287 0.0518  0.0216  0.1193  409 HIS A N   
895  C CA  . HIS A 164 ? 0.5530 0.3774 0.6975 0.0525  0.0316  0.1209  409 HIS A CA  
896  C C   . HIS A 164 ? 0.6067 0.4122 0.7198 0.0398  0.0343  0.1255  409 HIS A C   
897  O O   . HIS A 164 ? 0.5847 0.3607 0.7004 0.0401  0.0405  0.1306  409 HIS A O   
898  C CB  . HIS A 164 ? 0.5106 0.3291 0.6689 0.0512  0.0514  0.1009  409 HIS A CB  
899  C CG  . HIS A 164 ? 0.5332 0.3600 0.7285 0.0648  0.0561  0.0969  409 HIS A CG  
900  N ND1 . HIS A 164 ? 0.5717 0.4227 0.7722 0.0639  0.0604  0.0847  409 HIS A ND1 
901  C CD2 . HIS A 164 ? 0.5490 0.3633 0.7815 0.0798  0.0583  0.1039  409 HIS A CD2 
902  C CE1 . HIS A 164 ? 0.5503 0.4044 0.7896 0.0765  0.0671  0.0832  409 HIS A CE1 
903  N NE2 . HIS A 164 ? 0.5691 0.4026 0.8314 0.0872  0.0657  0.0946  409 HIS A NE2 
904  N N   . THR A 165 ? 0.5880 0.4079 0.6746 0.0285  0.0319  0.1234  410 THR A N   
905  C CA  A THR A 165 ? 0.6169 0.4213 0.6791 0.0152  0.0381  0.1263  410 THR A CA  
906  C CA  B THR A 165 ? 0.6210 0.4248 0.6833 0.0155  0.0379  0.1268  410 THR A CA  
907  C C   . THR A 165 ? 0.6028 0.4203 0.6390 0.0092  0.0308  0.1331  410 THR A C   
908  O O   . THR A 165 ? 0.6205 0.4587 0.6564 0.0144  0.0205  0.1335  410 THR A O   
909  C CB  A THR A 165 ? 0.6214 0.4281 0.6848 0.0030  0.0524  0.1078  410 THR A CB  
910  C CB  B THR A 165 ? 0.6300 0.4337 0.6938 0.0033  0.0527  0.1087  410 THR A CB  
911  O OG1 A THR A 165 ? 0.5736 0.4055 0.6457 0.0045  0.0522  0.0932  410 THR A OG1 
912  O OG1 B THR A 165 ? 0.6555 0.4380 0.7054 -0.0087 0.0605  0.1134  410 THR A OG1 
913  C CG2 A THR A 165 ? 0.6361 0.4127 0.7107 0.0025  0.0632  0.1043  410 THR A CG2 
914  C CG2 B THR A 165 ? 0.5842 0.4194 0.6432 -0.0030 0.0518  0.0962  410 THR A CG2 
915  N N   . ARG A 166 ? 0.5983 0.4021 0.6127 -0.0028 0.0384  0.1372  411 ARG A N   
916  C CA  . ARG A 166 ? 0.6384 0.4503 0.6259 -0.0104 0.0374  0.1414  411 ARG A CA  
917  C C   . ARG A 166 ? 0.6311 0.4636 0.6232 -0.0214 0.0500  0.1255  411 ARG A C   
918  O O   . ARG A 166 ? 0.6641 0.4903 0.6651 -0.0306 0.0614  0.1190  411 ARG A O   
919  C CB  . ARG A 166 ? 0.7203 0.5007 0.6776 -0.0171 0.0392  0.1587  411 ARG A CB  
920  C CG  . ARG A 166 ? 0.8110 0.5730 0.7562 -0.0069 0.0206  0.1785  411 ARG A CG  
921  C CD  . ARG A 166 ? 0.9106 0.6399 0.8127 -0.0167 0.0218  0.1963  411 ARG A CD  
922  N NE  . ARG A 166 ? 0.9336 0.6396 0.8255 -0.0070 0.0009  0.2183  411 ARG A NE  
923  C CZ  . ARG A 166 ? 0.9822 0.6597 0.8852 -0.0010 -0.0013 0.2309  411 ARG A CZ  
924  N NH1 . ARG A 166 ? 0.9322 0.5986 0.8527 -0.0055 0.0177  0.2220  411 ARG A NH1 
925  N NH2 . ARG A 166 ? 1.0298 0.6888 0.9272 0.0094  -0.0237 0.2524  411 ARG A NH2 
926  N N   . MET A 167 ? 0.5643 0.4207 0.5526 -0.0207 0.0471  0.1198  412 MET A N   
927  C CA  . MET A 167 ? 0.5268 0.4040 0.5230 -0.0293 0.0571  0.1074  412 MET A CA  
928  C C   . MET A 167 ? 0.5518 0.4209 0.5271 -0.0396 0.0689  0.1126  412 MET A C   
929  O O   . MET A 167 ? 0.6129 0.4669 0.5588 -0.0390 0.0660  0.1235  412 MET A O   
930  C CB  . MET A 167 ? 0.5110 0.4148 0.5152 -0.0225 0.0497  0.0990  412 MET A CB  
931  C CG  . MET A 167 ? 0.5714 0.4816 0.5928 -0.0139 0.0413  0.0935  412 MET A CG  
932  S SD  . MET A 167 ? 0.4937 0.4297 0.5203 -0.0070 0.0334  0.0860  412 MET A SD  
933  C CE  . MET A 167 ? 0.4549 0.4097 0.4899 -0.0154 0.0407  0.0760  412 MET A CE  
934  N N   . ASN A 168 ? 0.5690 0.4474 0.5590 -0.0504 0.0827  0.1045  413 ASN A N   
935  C CA  . ASN A 168 ? 0.5104 0.3870 0.4874 -0.0605 0.0987  0.1059  413 ASN A CA  
936  C C   . ASN A 168 ? 0.5184 0.4235 0.5064 -0.0570 0.1003  0.0961  413 ASN A C   
937  O O   . ASN A 168 ? 0.4866 0.4117 0.4916 -0.0481 0.0882  0.0892  413 ASN A O   
938  C CB  . ASN A 168 ? 0.5520 0.4245 0.5450 -0.0750 0.1149  0.1031  413 ASN A CB  
939  C CG  . ASN A 168 ? 0.5235 0.4247 0.5579 -0.0778 0.1126  0.0887  413 ASN A CG  
940  O OD1 . ASN A 168 ? 0.5053 0.4338 0.5566 -0.0712 0.1050  0.0805  413 ASN A OD1 
941  N ND2 . ASN A 168 ? 0.5489 0.4416 0.5979 -0.0892 0.1185  0.0862  413 ASN A ND2 
942  N N   . GLU A 169 ? 0.5310 0.4349 0.5079 -0.0643 0.1173  0.0955  414 GLU A N   
943  C CA  . GLU A 169 ? 0.5265 0.4505 0.5092 -0.0589 0.1197  0.0875  414 GLU A CA  
944  C C   . GLU A 169 ? 0.4599 0.4180 0.4907 -0.0573 0.1202  0.0756  414 GLU A C   
945  O O   . GLU A 169 ? 0.5216 0.4978 0.5642 -0.0484 0.1134  0.0698  414 GLU A O   
946  C CB  . GLU A 169 ? 0.5862 0.4947 0.5396 -0.0669 0.1403  0.0891  414 GLU A CB  
947  C CG  . GLU A 169 ? 0.6124 0.4869 0.5109 -0.0676 0.1327  0.1016  414 GLU A CG  
948  C CD  . GLU A 169 ? 0.6755 0.5335 0.5353 -0.0747 0.1498  0.1005  414 GLU A CD  
949  O OE1 . GLU A 169 ? 0.6333 0.5068 0.5137 -0.0778 0.1711  0.0891  414 GLU A OE1 
950  O OE2 . GLU A 169 ? 0.6802 0.5091 0.4894 -0.0774 0.1418  0.1107  414 GLU A OE2 
951  N N   . GLU A 170 ? 0.4752 0.4413 0.5339 -0.0665 0.1263  0.0727  415 GLU A N   
952  C CA  . GLU A 170 ? 0.4720 0.4703 0.5762 -0.0659 0.1197  0.0631  415 GLU A CA  
953  C C   . GLU A 170 ? 0.4542 0.4588 0.5590 -0.0559 0.0965  0.0612  415 GLU A C   
954  O O   . GLU A 170 ? 0.4405 0.4685 0.5677 -0.0500 0.0872  0.0556  415 GLU A O   
955  C CB  . GLU A 170 ? 0.5150 0.5165 0.6444 -0.0804 0.1270  0.0608  415 GLU A CB  
956  C CG  . GLU A 170 ? 0.5248 0.5554 0.6954 -0.0821 0.1128  0.0522  415 GLU A CG  
957  C CD  . GLU A 170 ? 0.6325 0.6665 0.8290 -0.0990 0.1187  0.0487  415 GLU A CD  
958  O OE1 . GLU A 170 ? 0.6637 0.6689 0.8380 -0.1070 0.1253  0.0532  415 GLU A OE1 
959  O OE2 . GLU A 170 ? 0.6160 0.6812 0.8570 -0.1044 0.1157  0.0418  415 GLU A OE2 
960  N N   . GLN A 171 ? 0.4404 0.4231 0.5216 -0.0538 0.0880  0.0663  416 GLN A N   
961  C CA  . GLN A 171 ? 0.4455 0.4316 0.5257 -0.0451 0.0706  0.0637  416 GLN A CA  
962  C C   . GLN A 171 ? 0.4640 0.4529 0.5294 -0.0335 0.0643  0.0658  416 GLN A C   
963  O O   . GLN A 171 ? 0.4362 0.4386 0.5098 -0.0272 0.0537  0.0613  416 GLN A O   
964  C CB  . GLN A 171 ? 0.4348 0.3968 0.5014 -0.0459 0.0670  0.0675  416 GLN A CB  
965  C CG  . GLN A 171 ? 0.4703 0.4263 0.5509 -0.0586 0.0725  0.0634  416 GLN A CG  
966  C CD  . GLN A 171 ? 0.5447 0.4686 0.6096 -0.0598 0.0754  0.0698  416 GLN A CD  
967  O OE1 . GLN A 171 ? 0.5377 0.4435 0.5818 -0.0536 0.0763  0.0808  416 GLN A OE1 
968  N NE2 . GLN A 171 ? 0.5102 0.4253 0.5849 -0.0680 0.0758  0.0630  416 GLN A NE2 
969  N N   . ILE A 172 ? 0.4756 0.4494 0.5159 -0.0321 0.0700  0.0726  417 ILE A N   
970  C CA  . ILE A 172 ? 0.4648 0.4399 0.4902 -0.0237 0.0641  0.0734  417 ILE A CA  
971  C C   . ILE A 172 ? 0.4499 0.4453 0.4932 -0.0212 0.0685  0.0659  417 ILE A C   
972  O O   . ILE A 172 ? 0.4373 0.4420 0.4848 -0.0136 0.0591  0.0631  417 ILE A O   
973  C CB  . ILE A 172 ? 0.4754 0.4278 0.4658 -0.0258 0.0680  0.0820  417 ILE A CB  
974  C CG1 . ILE A 172 ? 0.4724 0.4052 0.4502 -0.0251 0.0590  0.0918  417 ILE A CG1 
975  C CG2 . ILE A 172 ? 0.4451 0.3988 0.4195 -0.0201 0.0624  0.0806  417 ILE A CG2 
976  C CD1 . ILE A 172 ? 0.5212 0.4280 0.4621 -0.0290 0.0596  0.1034  417 ILE A CD1 
977  N N   . ALA A 173 ? 0.4253 0.4273 0.4824 -0.0274 0.0841  0.0630  418 ALA A N   
978  C CA  . ALA A 173 ? 0.4132 0.4357 0.4962 -0.0232 0.0894  0.0562  418 ALA A CA  
979  C C   . ALA A 173 ? 0.4335 0.4774 0.5463 -0.0185 0.0734  0.0529  418 ALA A C   
980  O O   . ALA A 173 ? 0.4400 0.4945 0.5634 -0.0102 0.0677  0.0506  418 ALA A O   
981  C CB  . ALA A 173 ? 0.3894 0.4181 0.4912 -0.0311 0.1112  0.0532  418 ALA A CB  
982  N N   . ALA A 174 ? 0.3976 0.4440 0.5197 -0.0245 0.0654  0.0529  419 ALA A N   
983  C CA  . ALA A 174 ? 0.3846 0.4471 0.5261 -0.0227 0.0488  0.0497  419 ALA A CA  
984  C C   . ALA A 174 ? 0.4096 0.4644 0.5298 -0.0142 0.0362  0.0510  419 ALA A C   
985  O O   . ALA A 174 ? 0.4045 0.4707 0.5347 -0.0091 0.0256  0.0499  419 ALA A O   
986  C CB  . ALA A 174 ? 0.3872 0.4485 0.5358 -0.0335 0.0442  0.0475  419 ALA A CB  
987  N N   . VAL A 175 ? 0.4094 0.4450 0.5022 -0.0128 0.0368  0.0542  420 VAL A N   
988  C CA  . VAL A 175 ? 0.3839 0.4141 0.4613 -0.0057 0.0276  0.0550  420 VAL A CA  
989  C C   . VAL A 175 ? 0.4351 0.4694 0.5109 0.0013  0.0288  0.0553  420 VAL A C   
990  O O   . VAL A 175 ? 0.4076 0.4468 0.4855 0.0062  0.0207  0.0545  420 VAL A O   
991  C CB  . VAL A 175 ? 0.3855 0.3979 0.4435 -0.0050 0.0280  0.0589  420 VAL A CB  
992  C CG1 . VAL A 175 ? 0.4352 0.4453 0.4834 0.0017  0.0211  0.0596  420 VAL A CG1 
993  C CG2 . VAL A 175 ? 0.4189 0.4237 0.4798 -0.0104 0.0273  0.0571  420 VAL A CG2 
994  N N   . CYS A 176 ? 0.4251 0.4543 0.4944 0.0008  0.0402  0.0562  421 CYS A N   
995  C CA  . CYS A 176 ? 0.4274 0.4549 0.4909 0.0063  0.0437  0.0546  421 CYS A CA  
996  C C   . CYS A 176 ? 0.4379 0.4817 0.5296 0.0114  0.0434  0.0515  421 CYS A C   
997  O O   . CYS A 176 ? 0.4398 0.4823 0.5305 0.0180  0.0392  0.0510  421 CYS A O   
998  C CB  . CYS A 176 ? 0.4505 0.4651 0.4955 0.0023  0.0581  0.0547  421 CYS A CB  
999  S SG  . CYS A 176 ? 0.4825 0.4752 0.4901 -0.0017 0.0523  0.0615  421 CYS A SG  
1000 N N   . LEU A 177 ? 0.3863 0.4452 0.5063 0.0083  0.0472  0.0501  422 LEU A N   
1001 C CA  . LEU A 177 ? 0.3805 0.4580 0.5351 0.0142  0.0435  0.0488  422 LEU A CA  
1002 C C   . LEU A 177 ? 0.3618 0.4421 0.5149 0.0181  0.0231  0.0519  422 LEU A C   
1003 O O   . LEU A 177 ? 0.3817 0.4645 0.5440 0.0264  0.0176  0.0535  422 LEU A O   
1004 C CB  . LEU A 177 ? 0.3737 0.4704 0.5640 0.0082  0.0487  0.0471  422 LEU A CB  
1005 C CG  . LEU A 177 ? 0.3398 0.4614 0.5761 0.0138  0.0403  0.0473  422 LEU A CG  
1006 C CD1 . LEU A 177 ? 0.3623 0.4850 0.6154 0.0249  0.0531  0.0455  422 LEU A CD1 
1007 C CD2 . LEU A 177 ? 0.3789 0.5217 0.6527 0.0045  0.0430  0.0454  422 LEU A CD2 
1008 N N   . ALA A 178 ? 0.3954 0.4720 0.5345 0.0116  0.0131  0.0526  423 ALA A N   
1009 C CA  . ALA A 178 ? 0.4113 0.4861 0.5409 0.0126  -0.0037 0.0548  423 ALA A CA  
1010 C C   . ALA A 178 ? 0.3921 0.4521 0.4978 0.0186  -0.0040 0.0567  423 ALA A C   
1011 O O   . ALA A 178 ? 0.3949 0.4539 0.4998 0.0232  -0.0136 0.0599  423 ALA A O   
1012 C CB  . ALA A 178 ? 0.4194 0.4882 0.5346 0.0031  -0.0091 0.0526  423 ALA A CB  
1013 N N   . VAL A 179 ? 0.3767 0.4245 0.4634 0.0179  0.0052  0.0556  424 VAL A N   
1014 C CA  . VAL A 179 ? 0.3890 0.4250 0.4575 0.0217  0.0047  0.0567  424 VAL A CA  
1015 C C   . VAL A 179 ? 0.4144 0.4499 0.4914 0.0286  0.0081  0.0568  424 VAL A C   
1016 O O   . VAL A 179 ? 0.4080 0.4371 0.4798 0.0325  0.0027  0.0590  424 VAL A O   
1017 C CB  . VAL A 179 ? 0.3794 0.4054 0.4309 0.0189  0.0105  0.0563  424 VAL A CB  
1018 C CG1 . VAL A 179 ? 0.3541 0.3708 0.3927 0.0214  0.0101  0.0565  424 VAL A CG1 
1019 C CG2 . VAL A 179 ? 0.3715 0.3947 0.4175 0.0146  0.0074  0.0565  424 VAL A CG2 
1020 N N   . LEU A 180 ? 0.3862 0.4261 0.4764 0.0299  0.0193  0.0541  425 LEU A N   
1021 C CA  . LEU A 180 ? 0.3762 0.4128 0.4762 0.0370  0.0267  0.0521  425 LEU A CA  
1022 C C   . LEU A 180 ? 0.4078 0.4546 0.5348 0.0447  0.0171  0.0560  425 LEU A C   
1023 O O   . LEU A 180 ? 0.3833 0.4214 0.5134 0.0521  0.0181  0.0568  425 LEU A O   
1024 C CB  . LEU A 180 ? 0.3735 0.4106 0.4804 0.0354  0.0449  0.0470  425 LEU A CB  
1025 C CG  . LEU A 180 ? 0.4375 0.4563 0.5085 0.0289  0.0527  0.0444  425 LEU A CG  
1026 C CD1 . LEU A 180 ? 0.4449 0.4609 0.5139 0.0239  0.0708  0.0405  425 LEU A CD1 
1027 C CD2 . LEU A 180 ? 0.4190 0.4208 0.4716 0.0314  0.0536  0.0415  425 LEU A CD2 
1028 N N   . GLN A 181 ? 0.3742 0.4376 0.5207 0.0428  0.0064  0.0590  426 GLN A N   
1029 C CA  . GLN A 181 ? 0.3665 0.4389 0.5362 0.0496  -0.0084 0.0651  426 GLN A CA  
1030 C C   . GLN A 181 ? 0.3728 0.4284 0.5142 0.0506  -0.0209 0.0707  426 GLN A C   
1031 O O   . GLN A 181 ? 0.3964 0.4461 0.5457 0.0590  -0.0267 0.0762  426 GLN A O   
1032 C CB  . GLN A 181 ? 0.3933 0.4867 0.5864 0.0444  -0.0209 0.0669  426 GLN A CB  
1033 C CG  . GLN A 181 ? 0.3850 0.4993 0.6204 0.0450  -0.0089 0.0629  426 GLN A CG  
1034 C CD  . GLN A 181 ? 0.4284 0.5626 0.6845 0.0356  -0.0201 0.0629  426 GLN A CD  
1035 O OE1 . GLN A 181 ? 0.4479 0.5765 0.6794 0.0273  -0.0345 0.0641  426 GLN A OE1 
1036 N NE2 . GLN A 181 ? 0.4137 0.5703 0.7157 0.0358  -0.0118 0.0605  426 GLN A NE2 
1037 N N   . ALA A 182 ? 0.3910 0.4372 0.5007 0.0420  -0.0230 0.0696  427 ALA A N   
1038 C CA  . ALA A 182 ? 0.4323 0.4612 0.5136 0.0407  -0.0297 0.0737  427 ALA A CA  
1039 C C   . ALA A 182 ? 0.4218 0.4355 0.4952 0.0456  -0.0202 0.0730  427 ALA A C   
1040 O O   . ALA A 182 ? 0.4260 0.4270 0.4929 0.0496  -0.0257 0.0787  427 ALA A O   
1041 C CB  . ALA A 182 ? 0.3764 0.3998 0.4323 0.0309  -0.0283 0.0703  427 ALA A CB  
1042 N N   . LEU A 183 ? 0.4231 0.4350 0.4937 0.0440  -0.0066 0.0663  428 LEU A N   
1043 C CA  . LEU A 183 ? 0.4081 0.4039 0.4678 0.0457  0.0015  0.0639  428 LEU A CA  
1044 C C   . LEU A 183 ? 0.4355 0.4266 0.5146 0.0557  0.0052  0.0646  428 LEU A C   
1045 O O   . LEU A 183 ? 0.4586 0.4318 0.5288 0.0581  0.0070  0.0655  428 LEU A O   
1046 C CB  . LEU A 183 ? 0.3916 0.3851 0.4399 0.0402  0.0119  0.0570  428 LEU A CB  
1047 C CG  . LEU A 183 ? 0.3937 0.3884 0.4262 0.0322  0.0089  0.0568  428 LEU A CG  
1048 C CD1 . LEU A 183 ? 0.4229 0.4145 0.4453 0.0278  0.0155  0.0525  428 LEU A CD1 
1049 C CD2 . LEU A 183 ? 0.4063 0.3915 0.4263 0.0292  0.0048  0.0590  428 LEU A CD2 
1050 N N   . SER A 184 ? 0.4576 0.4638 0.5665 0.0615  0.0077  0.0640  429 SER A N   
1051 C CA  . SER A 184 ? 0.4261 0.4283 0.5606 0.0730  0.0133  0.0644  429 SER A CA  
1052 C C   . SER A 184 ? 0.4407 0.4347 0.5788 0.0799  -0.0027 0.0754  429 SER A C   
1053 O O   . SER A 184 ? 0.4328 0.4097 0.5762 0.0879  0.0017  0.0767  429 SER A O   
1054 C CB  . SER A 184 ? 0.4455 0.4696 0.6200 0.0781  0.0198  0.0620  429 SER A CB  
1055 O OG  . SER A 184 ? 0.4869 0.5316 0.6817 0.0782  0.0015  0.0697  429 SER A OG  
1056 N N   . VAL A 185 ? 0.4275 0.4292 0.5581 0.0758  -0.0208 0.0834  430 VAL A N   
1057 C CA  . VAL A 185 ? 0.4584 0.4491 0.5846 0.0804  -0.0382 0.0958  430 VAL A CA  
1058 C C   . VAL A 185 ? 0.4214 0.3849 0.5087 0.0747  -0.0354 0.0974  430 VAL A C   
1059 O O   . VAL A 185 ? 0.4460 0.3894 0.5299 0.0807  -0.0388 0.1049  430 VAL A O   
1060 C CB  . VAL A 185 ? 0.4524 0.4582 0.5783 0.0755  -0.0589 0.1028  430 VAL A CB  
1061 C CG1 . VAL A 185 ? 0.4994 0.4875 0.6044 0.0763  -0.0781 0.1165  430 VAL A CG1 
1062 C CG2 . VAL A 185 ? 0.4501 0.4841 0.6242 0.0818  -0.0639 0.1027  430 VAL A CG2 
1063 N N   . LEU A 186 ? 0.4294 0.3917 0.4903 0.0630  -0.0286 0.0908  431 LEU A N   
1064 C CA  . LEU A 186 ? 0.4612 0.4018 0.4922 0.0560  -0.0237 0.0910  431 LEU A CA  
1065 C C   . LEU A 186 ? 0.4711 0.3953 0.5054 0.0596  -0.0113 0.0861  431 LEU A C   
1066 O O   . LEU A 186 ? 0.4841 0.3855 0.5073 0.0605  -0.0115 0.0914  431 LEU A O   
1067 C CB  . LEU A 186 ? 0.4430 0.3907 0.4569 0.0445  -0.0182 0.0841  431 LEU A CB  
1068 C CG  . LEU A 186 ? 0.4650 0.4201 0.4668 0.0384  -0.0273 0.0872  431 LEU A CG  
1069 C CD1 . LEU A 186 ? 0.4695 0.4346 0.4666 0.0306  -0.0193 0.0790  431 LEU A CD1 
1070 C CD2 . LEU A 186 ? 0.4822 0.4170 0.4561 0.0337  -0.0329 0.0955  431 LEU A CD2 
1071 N N   . HIS A 187 ? 0.4373 0.3694 0.4836 0.0607  0.0004  0.0758  432 HIS A N   
1072 C CA  . HIS A 187 ? 0.4965 0.4100 0.5402 0.0616  0.0133  0.0685  432 HIS A CA  
1073 C C   . HIS A 187 ? 0.5190 0.4169 0.5807 0.0743  0.0142  0.0734  432 HIS A C   
1074 O O   . HIS A 187 ? 0.5165 0.3887 0.5681 0.0739  0.0206  0.0718  432 HIS A O   
1075 C CB  . HIS A 187 ? 0.4555 0.3777 0.5027 0.0593  0.0255  0.0569  432 HIS A CB  
1076 C CG  . HIS A 187 ? 0.4317 0.3631 0.4602 0.0475  0.0242  0.0531  432 HIS A CG  
1077 N ND1 . HIS A 187 ? 0.4339 0.3716 0.4578 0.0432  0.0317  0.0455  432 HIS A ND1 
1078 C CD2 . HIS A 187 ? 0.4177 0.3518 0.4322 0.0394  0.0167  0.0564  432 HIS A CD2 
1079 C CE1 . HIS A 187 ? 0.4166 0.3609 0.4264 0.0342  0.0260  0.0458  432 HIS A CE1 
1080 N NE2 . HIS A 187 ? 0.4394 0.3830 0.4466 0.0323  0.0180  0.0515  432 HIS A NE2 
1081 N N   . ALA A 188 ? 0.4858 0.3989 0.5777 0.0856  0.0072  0.0797  433 ALA A N   
1082 C CA  . ALA A 188 ? 0.5312 0.4315 0.6478 0.1001  0.0056  0.0867  433 ALA A CA  
1083 C C   . ALA A 188 ? 0.5431 0.4191 0.6392 0.0998  -0.0067 0.0998  433 ALA A C   
1084 O O   . ALA A 188 ? 0.5276 0.3805 0.6338 0.1097  -0.0045 0.1047  433 ALA A O   
1085 C CB  . ALA A 188 ? 0.4861 0.4131 0.6451 0.1114  -0.0038 0.0927  433 ALA A CB  
1086 N N   . GLN A 189 ? 0.5423 0.4195 0.6085 0.0885  -0.0175 0.1056  434 GLN A N   
1087 C CA  . GLN A 189 ? 0.6050 0.4555 0.6443 0.0850  -0.0256 0.1176  434 GLN A CA  
1088 C C   . GLN A 189 ? 0.5987 0.4301 0.6085 0.0713  -0.0123 0.1102  434 GLN A C   
1089 O O   . GLN A 189 ? 0.6218 0.4319 0.6058 0.0645  -0.0154 0.1187  434 GLN A O   
1090 C CB  . GLN A 189 ? 0.6168 0.4757 0.6383 0.0797  -0.0442 0.1288  434 GLN A CB  
1091 C CG  . GLN A 189 ? 0.6881 0.5686 0.7397 0.0905  -0.0617 0.1366  434 GLN A CG  
1092 C CD  . GLN A 189 ? 0.8288 0.7037 0.8553 0.0859  -0.0845 0.1516  434 GLN A CD  
1093 O OE1 . GLN A 189 ? 0.8929 0.7854 0.9085 0.0770  -0.0921 0.1491  434 GLN A OE1 
1094 N NE2 . GLN A 189 ? 0.8675 0.7145 0.8814 0.0910  -0.0955 0.1674  434 GLN A NE2 
1095 N N   . GLY A 190 ? 0.5785 0.4169 0.5914 0.0661  0.0017  0.0950  435 GLY A N   
1096 C CA  . GLY A 190 ? 0.5517 0.3754 0.5432 0.0525  0.0116  0.0875  435 GLY A CA  
1097 C C   . GLY A 190 ? 0.5822 0.4215 0.5579 0.0388  0.0104  0.0851  435 GLY A C   
1098 O O   . GLY A 190 ? 0.5886 0.4187 0.5521 0.0270  0.0170  0.0803  435 GLY A O   
1099 N N   . VAL A 191 ? 0.4822 0.3447 0.4608 0.0397  0.0028  0.0875  436 VAL A N   
1100 C CA  . VAL A 191 ? 0.4721 0.3470 0.4386 0.0282  0.0036  0.0851  436 VAL A CA  
1101 C C   . VAL A 191 ? 0.4805 0.3762 0.4578 0.0254  0.0079  0.0741  436 VAL A C   
1102 O O   . VAL A 191 ? 0.4582 0.3680 0.4486 0.0321  0.0062  0.0715  436 VAL A O   
1103 C CB  . VAL A 191 ? 0.4997 0.3822 0.4576 0.0288  -0.0061 0.0931  436 VAL A CB  
1104 C CG1 . VAL A 191 ? 0.5108 0.4050 0.4598 0.0181  -0.0011 0.0881  436 VAL A CG1 
1105 C CG2 . VAL A 191 ? 0.5458 0.4033 0.4842 0.0292  -0.0122 0.1060  436 VAL A CG2 
1106 N N   . ILE A 192 ? 0.4447 0.3416 0.4176 0.0148  0.0129  0.0685  437 ILE A N   
1107 C CA  . ILE A 192 ? 0.4269 0.3415 0.4070 0.0108  0.0135  0.0607  437 ILE A CA  
1108 C C   . ILE A 192 ? 0.4281 0.3581 0.4104 0.0061  0.0126  0.0622  437 ILE A C   
1109 O O   . ILE A 192 ? 0.4589 0.3832 0.4364 -0.0007 0.0166  0.0643  437 ILE A O   
1110 C CB  . ILE A 192 ? 0.4530 0.3593 0.4306 0.0020  0.0166  0.0536  437 ILE A CB  
1111 C CG1 . ILE A 192 ? 0.5059 0.3882 0.4775 0.0051  0.0211  0.0513  437 ILE A CG1 
1112 C CG2 . ILE A 192 ? 0.4620 0.3831 0.4427 -0.0009 0.0134  0.0474  437 ILE A CG2 
1113 C CD1 . ILE A 192 ? 0.5061 0.3753 0.4710 -0.0068 0.0237  0.0435  437 ILE A CD1 
1114 N N   . HIS A 193 ? 0.4074 0.3544 0.3970 0.0091  0.0097  0.0606  438 HIS A N   
1115 C CA  . HIS A 193 ? 0.3831 0.3416 0.3762 0.0059  0.0108  0.0610  438 HIS A CA  
1116 C C   . HIS A 193 ? 0.4024 0.3685 0.4069 -0.0013 0.0133  0.0576  438 HIS A C   
1117 O O   . HIS A 193 ? 0.4042 0.3721 0.4131 -0.0063 0.0194  0.0577  438 HIS A O   
1118 C CB  . HIS A 193 ? 0.3837 0.3551 0.3824 0.0109  0.0073  0.0604  438 HIS A CB  
1119 C CG  . HIS A 193 ? 0.3878 0.3664 0.3890 0.0084  0.0098  0.0599  438 HIS A CG  
1120 N ND1 . HIS A 193 ? 0.3903 0.3778 0.4046 0.0056  0.0126  0.0574  438 HIS A ND1 
1121 C CD2 . HIS A 193 ? 0.4204 0.3967 0.4128 0.0079  0.0101  0.0609  438 HIS A CD2 
1122 C CE1 . HIS A 193 ? 0.4271 0.4167 0.4428 0.0048  0.0175  0.0562  438 HIS A CE1 
1123 N NE2 . HIS A 193 ? 0.4062 0.3878 0.4052 0.0050  0.0163  0.0575  438 HIS A NE2 
1124 N N   . ARG A 194 ? 0.3936 0.3648 0.4038 -0.0024 0.0085  0.0545  439 ARG A N   
1125 C CA  . ARG A 194 ? 0.3880 0.3678 0.4116 -0.0095 0.0051  0.0522  439 ARG A CA  
1126 C C   . ARG A 194 ? 0.3966 0.3940 0.4394 -0.0082 0.0034  0.0536  439 ARG A C   
1127 O O   . ARG A 194 ? 0.3875 0.3958 0.4490 -0.0130 -0.0015 0.0532  439 ARG A O   
1128 C CB  . ARG A 194 ? 0.4023 0.3759 0.4307 -0.0182 0.0101  0.0511  439 ARG A CB  
1129 C CG  . ARG A 194 ? 0.4157 0.3678 0.4265 -0.0197 0.0122  0.0501  439 ARG A CG  
1130 C CD  . ARG A 194 ? 0.4483 0.3938 0.4649 -0.0314 0.0147  0.0474  439 ARG A CD  
1131 N NE  . ARG A 194 ? 0.4457 0.3895 0.4679 -0.0361 0.0252  0.0505  439 ARG A NE  
1132 C CZ  . ARG A 194 ? 0.4949 0.4292 0.5208 -0.0471 0.0316  0.0495  439 ARG A CZ  
1133 N NH1 . ARG A 194 ? 0.4574 0.3832 0.4828 -0.0546 0.0266  0.0447  439 ARG A NH1 
1134 N NH2 . ARG A 194 ? 0.4810 0.4115 0.5083 -0.0522 0.0444  0.0525  439 ARG A NH2 
1135 N N   . ASP A 195 ? 0.4012 0.4016 0.4429 -0.0022 0.0065  0.0551  440 ASP A N   
1136 C CA  . ASP A 195 ? 0.3808 0.3938 0.4414 0.0002  0.0058  0.0561  440 ASP A CA  
1137 C C   . ASP A 195 ? 0.3881 0.4003 0.4404 0.0062  0.0041  0.0576  440 ASP A C   
1138 O O   . ASP A 195 ? 0.3942 0.4083 0.4528 0.0087  0.0092  0.0571  440 ASP A O   
1139 C CB  . ASP A 195 ? 0.3781 0.3941 0.4528 -0.0019 0.0178  0.0543  440 ASP A CB  
1140 C CG  . ASP A 195 ? 0.4256 0.4568 0.5331 0.0002  0.0177  0.0548  440 ASP A CG  
1141 O OD1 . ASP A 195 ? 0.4296 0.4697 0.5493 0.0014  0.0045  0.0582  440 ASP A OD1 
1142 O OD2 . ASP A 195 ? 0.4233 0.4560 0.5438 0.0007  0.0309  0.0520  440 ASP A OD2 
1143 N N   . ILE A 196 ? 0.3817 0.3893 0.4199 0.0075  -0.0013 0.0582  441 ILE A N   
1144 C CA  . ILE A 196 ? 0.3723 0.3796 0.4050 0.0113  -0.0018 0.0596  441 ILE A CA  
1145 C C   . ILE A 196 ? 0.3905 0.4027 0.4335 0.0121  -0.0072 0.0634  441 ILE A C   
1146 O O   . ILE A 196 ? 0.3958 0.4091 0.4389 0.0096  -0.0158 0.0659  441 ILE A O   
1147 C CB  . ILE A 196 ? 0.3712 0.3718 0.3886 0.0117  -0.0021 0.0586  441 ILE A CB  
1148 C CG1 . ILE A 196 ? 0.3874 0.3826 0.4004 0.0132  0.0019  0.0566  441 ILE A CG1 
1149 C CG2 . ILE A 196 ? 0.3777 0.3790 0.3921 0.0136  -0.0004 0.0600  441 ILE A CG2 
1150 C CD1 . ILE A 196 ? 0.3977 0.3956 0.4136 0.0159  0.0035  0.0576  441 ILE A CD1 
1151 N N   . LYS A 197 ? 0.3854 0.3987 0.4360 0.0151  -0.0034 0.0643  442 LYS A N   
1152 C CA  . LYS A 197 ? 0.3564 0.3706 0.4183 0.0178  -0.0075 0.0692  442 LYS A CA  
1153 C C   . LYS A 197 ? 0.4153 0.4253 0.4798 0.0198  0.0008  0.0670  442 LYS A C   
1154 O O   . LYS A 197 ? 0.3732 0.3817 0.4320 0.0181  0.0077  0.0616  442 LYS A O   
1155 C CB  . LYS A 197 ? 0.3639 0.3870 0.4513 0.0191  -0.0116 0.0715  442 LYS A CB  
1156 C CG  . LYS A 197 ? 0.3720 0.3991 0.4750 0.0192  0.0005  0.0656  442 LYS A CG  
1157 C CD  . LYS A 197 ? 0.3690 0.4083 0.5062 0.0205  -0.0010 0.0673  442 LYS A CD  
1158 C CE  . LYS A 197 ? 0.4301 0.4710 0.5788 0.0185  0.0159  0.0601  442 LYS A CE  
1159 N NZ  . LYS A 197 ? 0.4302 0.4867 0.6190 0.0186  0.0170  0.0607  442 LYS A NZ  
1160 N N   . SER A 198 ? 0.3775 0.3829 0.4478 0.0223  -0.0010 0.0718  443 SER A N   
1161 C CA  . SER A 198 ? 0.3800 0.3780 0.4509 0.0224  0.0072  0.0686  443 SER A CA  
1162 C C   . SER A 198 ? 0.4038 0.4012 0.4842 0.0225  0.0173  0.0610  443 SER A C   
1163 O O   . SER A 198 ? 0.4045 0.3953 0.4748 0.0188  0.0237  0.0549  443 SER A O   
1164 C CB  . SER A 198 ? 0.3560 0.3452 0.4336 0.0254  0.0047  0.0758  443 SER A CB  
1165 O OG  . SER A 198 ? 0.3774 0.3693 0.4794 0.0315  0.0017  0.0799  443 SER A OG  
1166 N N   . ASP A 199 ? 0.3989 0.4027 0.4981 0.0253  0.0192  0.0609  444 ASP A N   
1167 C CA  . ASP A 199 ? 0.3700 0.3707 0.4761 0.0242  0.0333  0.0527  444 ASP A CA  
1168 C C   . ASP A 199 ? 0.3988 0.3957 0.4790 0.0174  0.0372  0.0469  444 ASP A C   
1169 O O   . ASP A 199 ? 0.4204 0.4076 0.4911 0.0136  0.0488  0.0394  444 ASP A O   
1170 C CB  . ASP A 199 ? 0.3824 0.3941 0.5190 0.0276  0.0363  0.0537  444 ASP A CB  
1171 C CG  . ASP A 199 ? 0.4172 0.4367 0.5808 0.0346  0.0241  0.0634  444 ASP A CG  
1172 O OD1 . ASP A 199 ? 0.4189 0.4398 0.5696 0.0338  0.0087  0.0709  444 ASP A OD1 
1173 O OD2 . ASP A 199 ? 0.4257 0.4490 0.6235 0.0407  0.0299  0.0637  444 ASP A OD2 
1174 N N   . SER A 200 ? 0.4012 0.4029 0.4682 0.0157  0.0279  0.0503  445 SER A N   
1175 C CA  . SER A 200 ? 0.4093 0.4067 0.4545 0.0109  0.0284  0.0478  445 SER A CA  
1176 C C   . SER A 200 ? 0.4270 0.4203 0.4560 0.0087  0.0234  0.0469  445 SER A C   
1177 O O   . SER A 200 ? 0.4058 0.3957 0.4183 0.0055  0.0203  0.0465  445 SER A O   
1178 C CB  . SER A 200 ? 0.3938 0.3965 0.4372 0.0110  0.0219  0.0517  445 SER A CB  
1179 O OG  . SER A 200 ? 0.4257 0.4336 0.4859 0.0106  0.0255  0.0518  445 SER A OG  
1180 N N   . ILE A 201 ? 0.3830 0.3766 0.4182 0.0098  0.0217  0.0475  446 ILE A N   
1181 C CA  . ILE A 201 ? 0.3925 0.3860 0.4199 0.0064  0.0170  0.0465  446 ILE A CA  
1182 C C   . ILE A 201 ? 0.4362 0.4188 0.4586 0.0013  0.0228  0.0400  446 ILE A C   
1183 O O   . ILE A 201 ? 0.4436 0.4203 0.4768 0.0033  0.0291  0.0391  446 ILE A O   
1184 C CB  . ILE A 201 ? 0.3980 0.3972 0.4337 0.0087  0.0134  0.0513  446 ILE A CB  
1185 C CG1 . ILE A 201 ? 0.4218 0.4269 0.4575 0.0123  0.0098  0.0557  446 ILE A CG1 
1186 C CG2 . ILE A 201 ? 0.4054 0.4077 0.4406 0.0042  0.0106  0.0496  446 ILE A CG2 
1187 C CD1 . ILE A 201 ? 0.3985 0.4063 0.4278 0.0126  0.0067  0.0550  446 ILE A CD1 
1188 N N   . LEU A 202 ? 0.4541 0.4317 0.4590 -0.0055 0.0197  0.0355  447 LEU A N   
1189 C CA  . LEU A 202 ? 0.4512 0.4143 0.4437 -0.0133 0.0252  0.0270  447 LEU A CA  
1190 C C   . LEU A 202 ? 0.5004 0.4668 0.4914 -0.0203 0.0152  0.0257  447 LEU A C   
1191 O O   . LEU A 202 ? 0.4664 0.4475 0.4651 -0.0191 0.0042  0.0310  447 LEU A O   
1192 C CB  . LEU A 202 ? 0.4722 0.4224 0.4384 -0.0192 0.0296  0.0218  447 LEU A CB  
1193 C CG  . LEU A 202 ? 0.4938 0.4421 0.4640 -0.0145 0.0416  0.0224  447 LEU A CG  
1194 C CD1 . LEU A 202 ? 0.5220 0.4526 0.4599 -0.0233 0.0495  0.0165  447 LEU A CD1 
1195 C CD2 . LEU A 202 ? 0.4855 0.4328 0.4814 -0.0084 0.0546  0.0199  447 LEU A CD2 
1196 N N   . LEU A 203 ? 0.4895 0.4420 0.4738 -0.0280 0.0202  0.0176  448 LEU A N   
1197 C CA  A LEU A 203 ? 0.5053 0.4611 0.4934 -0.0366 0.0119  0.0153  448 LEU A CA  
1198 C CA  B LEU A 203 ? 0.5097 0.4651 0.4980 -0.0367 0.0122  0.0151  448 LEU A CA  
1199 C C   . LEU A 203 ? 0.5612 0.5007 0.5223 -0.0505 0.0088  0.0048  448 LEU A C   
1200 O O   . LEU A 203 ? 0.5565 0.4749 0.4968 -0.0536 0.0207  -0.0033 448 LEU A O   
1201 C CB  A LEU A 203 ? 0.5221 0.4738 0.5292 -0.0351 0.0204  0.0159  448 LEU A CB  
1202 C CB  B LEU A 203 ? 0.5241 0.4739 0.5303 -0.0354 0.0213  0.0152  448 LEU A CB  
1203 C CG  A LEU A 203 ? 0.5446 0.5099 0.5727 -0.0261 0.0205  0.0264  448 LEU A CG  
1204 C CG  B LEU A 203 ? 0.5515 0.5119 0.5784 -0.0253 0.0234  0.0256  448 LEU A CG  
1205 C CD1 A LEU A 203 ? 0.5245 0.4926 0.5554 -0.0145 0.0238  0.0326  448 LEU A CD1 
1206 C CD1 B LEU A 203 ? 0.5132 0.4948 0.5491 -0.0243 0.0136  0.0315  448 LEU A CD1 
1207 C CD2 A LEU A 203 ? 0.5383 0.4924 0.5762 -0.0284 0.0280  0.0272  448 LEU A CD2 
1208 C CD2 B LEU A 203 ? 0.5610 0.5191 0.5912 -0.0142 0.0296  0.0300  448 LEU A CD2 
1209 N N   . THR A 204 ? 0.5561 0.5054 0.5180 -0.0598 -0.0072 0.0046  449 THR A N   
1210 C CA  . THR A 204 ? 0.6225 0.5560 0.5585 -0.0763 -0.0139 -0.0059 449 THR A CA  
1211 C C   . THR A 204 ? 0.6051 0.5283 0.5522 -0.0841 -0.0056 -0.0137 449 THR A C   
1212 O O   . THR A 204 ? 0.5807 0.5121 0.5566 -0.0770 0.0019  -0.0085 449 THR A O   
1213 C CB  . THR A 204 ? 0.6328 0.5832 0.5682 -0.0839 -0.0392 -0.0017 449 THR A CB  
1214 O OG1 . THR A 204 ? 0.5473 0.5220 0.5228 -0.0831 -0.0455 0.0026  449 THR A OG1 
1215 C CG2 . THR A 204 ? 0.6078 0.5672 0.5359 -0.0747 -0.0485 0.0085  449 THR A CG2 
1216 N N   . HIS A 205 ? 0.6145 0.5165 0.5349 -0.1004 -0.0074 -0.0262 450 HIS A N   
1217 C CA  . HIS A 205 ? 0.6659 0.5532 0.5943 -0.1099 0.0012  -0.0350 450 HIS A CA  
1218 C C   . HIS A 205 ? 0.6679 0.5803 0.6322 -0.1134 -0.0101 -0.0288 450 HIS A C   
1219 O O   . HIS A 205 ? 0.6218 0.5270 0.6041 -0.1153 0.0010  -0.0300 450 HIS A O   
1220 C CB  . HIS A 205 ? 0.6851 0.5435 0.5739 -0.1298 -0.0007 -0.0514 450 HIS A CB  
1221 C CG  . HIS A 205 ? 0.7384 0.6107 0.6200 -0.1466 -0.0283 -0.0525 450 HIS A CG  
1222 N ND1 . HIS A 205 ? 0.7446 0.6242 0.6016 -0.1495 -0.0480 -0.0481 450 HIS A ND1 
1223 C CD2 . HIS A 205 ? 0.7414 0.6220 0.6399 -0.1618 -0.0410 -0.0565 450 HIS A CD2 
1224 C CE1 . HIS A 205 ? 0.7498 0.6431 0.6104 -0.1646 -0.0740 -0.0486 450 HIS A CE1 
1225 N NE2 . HIS A 205 ? 0.7706 0.6665 0.6583 -0.1729 -0.0699 -0.0545 450 HIS A NE2 
1226 N N   . ASP A 206 ? 0.5808 0.5216 0.5576 -0.1144 -0.0307 -0.0217 451 ASP A N   
1227 C CA  . ASP A 206 ? 0.5705 0.5384 0.5870 -0.1184 -0.0395 -0.0168 451 ASP A CA  
1228 C C   . ASP A 206 ? 0.5456 0.5368 0.5933 -0.1010 -0.0331 -0.0037 451 ASP A C   
1229 O O   . ASP A 206 ? 0.5277 0.5454 0.6098 -0.1020 -0.0396 0.0013  451 ASP A O   
1230 C CB  . ASP A 206 ? 0.6128 0.5992 0.6324 -0.1315 -0.0670 -0.0179 451 ASP A CB  
1231 C CG  . ASP A 206 ? 0.7292 0.7230 0.7308 -0.1236 -0.0827 -0.0105 451 ASP A CG  
1232 O OD1 . ASP A 206 ? 0.6874 0.6687 0.6688 -0.1107 -0.0705 -0.0073 451 ASP A OD1 
1233 O OD2 . ASP A 206 ? 0.7344 0.7463 0.7437 -0.1308 -0.1083 -0.0073 451 ASP A OD2 
1234 N N   . GLY A 207 ? 0.5201 0.5013 0.5575 -0.0861 -0.0195 0.0010  452 GLY A N   
1235 C CA  . GLY A 207 ? 0.5048 0.5004 0.5646 -0.0724 -0.0111 0.0114  452 GLY A CA  
1236 C C   . GLY A 207 ? 0.4841 0.5007 0.5517 -0.0615 -0.0201 0.0194  452 GLY A C   
1237 O O   . GLY A 207 ? 0.4640 0.4915 0.5484 -0.0519 -0.0129 0.0264  452 GLY A O   
1238 N N   . ARG A 208 ? 0.4876 0.5067 0.5404 -0.0634 -0.0352 0.0186  453 ARG A N   
1239 C CA  A ARG A 208 ? 0.4802 0.5136 0.5382 -0.0520 -0.0430 0.0270  453 ARG A CA  
1240 C CA  B ARG A 208 ? 0.4857 0.5192 0.5439 -0.0520 -0.0429 0.0270  453 ARG A CA  
1241 C C   . ARG A 208 ? 0.5438 0.5644 0.5848 -0.0405 -0.0303 0.0299  453 ARG A C   
1242 O O   . ARG A 208 ? 0.5211 0.5212 0.5386 -0.0423 -0.0219 0.0250  453 ARG A O   
1243 C CB  A ARG A 208 ? 0.5122 0.5468 0.5542 -0.0580 -0.0643 0.0274  453 ARG A CB  
1244 C CB  B ARG A 208 ? 0.5118 0.5474 0.5553 -0.0580 -0.0645 0.0275  453 ARG A CB  
1245 C CG  A ARG A 208 ? 0.5228 0.5805 0.5938 -0.0662 -0.0835 0.0284  453 ARG A CG  
1246 C CG  B ARG A 208 ? 0.5225 0.5760 0.5898 -0.0699 -0.0818 0.0257  453 ARG A CG  
1247 C CD  A ARG A 208 ? 0.5718 0.6236 0.6163 -0.0751 -0.1079 0.0290  453 ARG A CD  
1248 C CD  B ARG A 208 ? 0.5732 0.6272 0.6224 -0.0770 -0.1082 0.0279  453 ARG A CD  
1249 N NE  A ARG A 208 ? 0.6485 0.6748 0.6551 -0.0918 -0.1073 0.0174  453 ARG A NE  
1250 N NE  B ARG A 208 ? 0.6179 0.6900 0.6920 -0.0907 -0.1273 0.0254  453 ARG A NE  
1251 C CZ  A ARG A 208 ? 0.6991 0.7028 0.6579 -0.1005 -0.1176 0.0147  453 ARG A CZ  
1252 C CZ  B ARG A 208 ? 0.6231 0.6979 0.6850 -0.1007 -0.1558 0.0273  453 ARG A CZ  
1253 N NH1 A ARG A 208 ? 0.6909 0.6941 0.6335 -0.0940 -0.1307 0.0246  453 ARG A NH1 
1254 N NH1 B ARG A 208 ? 0.6431 0.6999 0.6629 -0.0986 -0.1667 0.0324  453 ARG A NH1 
1255 N NH2 A ARG A 208 ? 0.5974 0.5751 0.5214 -0.1166 -0.1130 0.0016  453 ARG A NH2 
1256 N NH2 B ARG A 208 ? 0.5964 0.6911 0.6873 -0.1142 -0.1742 0.0247  453 ARG A NH2 
1257 N N   . VAL A 209 ? 0.4357 0.4683 0.4912 -0.0291 -0.0281 0.0371  454 VAL A N   
1258 C CA  . VAL A 209 ? 0.4268 0.4509 0.4726 -0.0193 -0.0174 0.0402  454 VAL A CA  
1259 C C   . VAL A 209 ? 0.4191 0.4429 0.4533 -0.0139 -0.0248 0.0443  454 VAL A C   
1260 O O   . VAL A 209 ? 0.4465 0.4830 0.4939 -0.0107 -0.0349 0.0488  454 VAL A O   
1261 C CB  . VAL A 209 ? 0.4768 0.5091 0.5412 -0.0130 -0.0081 0.0442  454 VAL A CB  
1262 C CG1 . VAL A 209 ? 0.4581 0.4834 0.5125 -0.0046 -0.0017 0.0476  454 VAL A CG1 
1263 C CG2 . VAL A 209 ? 0.4523 0.4800 0.5236 -0.0193 0.0001  0.0420  454 VAL A CG2 
1264 N N   . LYS A 210 ? 0.4582 0.4673 0.4710 -0.0126 -0.0187 0.0431  455 LYS A N   
1265 C CA  . LYS A 210 ? 0.4417 0.4464 0.4398 -0.0095 -0.0240 0.0474  455 LYS A CA  
1266 C C   . LYS A 210 ? 0.4434 0.4412 0.4370 -0.0041 -0.0123 0.0482  455 LYS A C   
1267 O O   . LYS A 210 ? 0.4480 0.4392 0.4407 -0.0051 -0.0016 0.0441  455 LYS A O   
1268 C CB  . LYS A 210 ? 0.4726 0.4634 0.4410 -0.0189 -0.0317 0.0449  455 LYS A CB  
1269 C CG  . LYS A 210 ? 0.5068 0.5040 0.4776 -0.0274 -0.0476 0.0435  455 LYS A CG  
1270 C CD  . LYS A 210 ? 0.5497 0.5321 0.4850 -0.0366 -0.0612 0.0443  455 LYS A CD  
1271 C CE  . LYS A 210 ? 0.5680 0.5595 0.5087 -0.0465 -0.0814 0.0431  455 LYS A CE  
1272 N NZ  . LYS A 210 ? 0.6196 0.5955 0.5210 -0.0567 -0.1000 0.0458  455 LYS A NZ  
1273 N N   . LEU A 211 ? 0.4164 0.4155 0.4102 0.0014  -0.0150 0.0536  456 LEU A N   
1274 C CA  . LEU A 211 ? 0.4147 0.4084 0.4059 0.0046  -0.0062 0.0544  456 LEU A CA  
1275 C C   . LEU A 211 ? 0.4422 0.4209 0.4099 -0.0009 -0.0017 0.0530  456 LEU A C   
1276 O O   . LEU A 211 ? 0.4623 0.4322 0.4096 -0.0052 -0.0093 0.0553  456 LEU A O   
1277 C CB  . LEU A 211 ? 0.4240 0.4217 0.4235 0.0111  -0.0097 0.0595  456 LEU A CB  
1278 C CG  . LEU A 211 ? 0.4539 0.4469 0.4530 0.0133  -0.0035 0.0603  456 LEU A CG  
1279 C CD1 . LEU A 211 ? 0.4374 0.4356 0.4469 0.0133  0.0028  0.0574  456 LEU A CD1 
1280 C CD2 . LEU A 211 ? 0.3957 0.3893 0.4017 0.0192  -0.0070 0.0636  456 LEU A CD2 
1281 N N   . SER A 212 ? 0.4466 0.4221 0.4176 -0.0015 0.0108  0.0497  457 SER A N   
1282 C CA  A SER A 212 ? 0.4774 0.4384 0.4292 -0.0077 0.0211  0.0468  457 SER A CA  
1283 C CA  B SER A 212 ? 0.4726 0.4336 0.4244 -0.0077 0.0211  0.0468  457 SER A CA  
1284 C C   . SER A 212 ? 0.4300 0.3942 0.3961 -0.0057 0.0301  0.0478  457 SER A C   
1285 O O   . SER A 212 ? 0.4310 0.4063 0.4159 -0.0003 0.0253  0.0509  457 SER A O   
1286 C CB  A SER A 212 ? 0.5045 0.4578 0.4508 -0.0127 0.0313  0.0383  457 SER A CB  
1287 C CB  B SER A 212 ? 0.5011 0.4546 0.4478 -0.0126 0.0314  0.0383  457 SER A CB  
1288 O OG  A SER A 212 ? 0.5645 0.5010 0.4883 -0.0201 0.0448  0.0339  457 SER A OG  
1289 O OG  B SER A 212 ? 0.4251 0.3877 0.4006 -0.0073 0.0398  0.0360  457 SER A OG  
1290 N N   . ASP A 213 ? 0.4495 0.4032 0.4059 -0.0115 0.0442  0.0443  458 ASP A N   
1291 C CA  . ASP A 213 ? 0.4729 0.4314 0.4483 -0.0120 0.0552  0.0439  458 ASP A CA  
1292 C C   . ASP A 213 ? 0.4433 0.4026 0.4186 -0.0112 0.0473  0.0504  458 ASP A C   
1293 O O   . ASP A 213 ? 0.4256 0.3974 0.4238 -0.0074 0.0423  0.0517  458 ASP A O   
1294 C CB  . ASP A 213 ? 0.5265 0.5019 0.5391 -0.0062 0.0576  0.0414  458 ASP A CB  
1295 C CG  . ASP A 213 ? 0.6970 0.6680 0.7169 -0.0072 0.0731  0.0338  458 ASP A CG  
1296 O OD1 . ASP A 213 ? 0.7220 0.6762 0.7170 -0.0147 0.0863  0.0286  458 ASP A OD1 
1297 O OD2 . ASP A 213 ? 0.7058 0.6875 0.7548 -0.0009 0.0726  0.0332  458 ASP A OD2 
1298 N N   . PHE A 214 ? 0.4483 0.3902 0.3939 -0.0158 0.0462  0.0545  459 PHE A N   
1299 C CA  . PHE A 214 ? 0.4894 0.4250 0.4309 -0.0155 0.0409  0.0608  459 PHE A CA  
1300 C C   . PHE A 214 ? 0.5167 0.4455 0.4606 -0.0234 0.0555  0.0600  459 PHE A C   
1301 O O   . PHE A 214 ? 0.5037 0.4202 0.4379 -0.0257 0.0539  0.0653  459 PHE A O   
1302 C CB  . PHE A 214 ? 0.5050 0.4240 0.4162 -0.0152 0.0298  0.0683  459 PHE A CB  
1303 C CG  . PHE A 214 ? 0.5076 0.4378 0.4276 -0.0069 0.0140  0.0700  459 PHE A CG  
1304 C CD1 . PHE A 214 ? 0.5288 0.4651 0.4464 -0.0076 0.0106  0.0662  459 PHE A CD1 
1305 C CD2 . PHE A 214 ? 0.5033 0.4373 0.4365 0.0008  0.0050  0.0744  459 PHE A CD2 
1306 C CE1 . PHE A 214 ? 0.5289 0.4775 0.4595 -0.0016 -0.0023 0.0675  459 PHE A CE1 
1307 C CE2 . PHE A 214 ? 0.5240 0.4700 0.4706 0.0079  -0.0058 0.0751  459 PHE A CE2 
1308 C CZ  . PHE A 214 ? 0.5066 0.4612 0.4532 0.0064  -0.0097 0.0721  459 PHE A CZ  
1309 N N   . GLY A 215 ? 0.4573 0.3935 0.4178 -0.0274 0.0708  0.0534  460 GLY A N   
1310 C CA  . GLY A 215 ? 0.4863 0.4184 0.4544 -0.0364 0.0874  0.0520  460 GLY A CA  
1311 C C   . GLY A 215 ? 0.4790 0.4209 0.4722 -0.0371 0.0819  0.0538  460 GLY A C   
1312 O O   . GLY A 215 ? 0.5093 0.4444 0.5052 -0.0463 0.0937  0.0540  460 GLY A O   
1313 N N   . PHE A 216 ? 0.4452 0.4005 0.4535 -0.0293 0.0652  0.0546  461 PHE A N   
1314 C CA  . PHE A 216 ? 0.4522 0.4155 0.4812 -0.0318 0.0589  0.0543  461 PHE A CA  
1315 C C   . PHE A 216 ? 0.4878 0.4369 0.4972 -0.0288 0.0475  0.0581  461 PHE A C   
1316 O O   . PHE A 216 ? 0.4569 0.4089 0.4774 -0.0312 0.0413  0.0562  461 PHE A O   
1317 C CB  . PHE A 216 ? 0.4347 0.4228 0.4966 -0.0273 0.0501  0.0513  461 PHE A CB  
1318 C CG  . PHE A 216 ? 0.5318 0.5346 0.6215 -0.0275 0.0613  0.0480  461 PHE A CG  
1319 C CD1 . PHE A 216 ? 0.5205 0.5254 0.6080 -0.0203 0.0631  0.0467  461 PHE A CD1 
1320 C CD2 . PHE A 216 ? 0.5344 0.5481 0.6553 -0.0352 0.0719  0.0453  461 PHE A CD2 
1321 C CE1 . PHE A 216 ? 0.5519 0.5671 0.6667 -0.0194 0.0760  0.0426  461 PHE A CE1 
1322 C CE2 . PHE A 216 ? 0.5314 0.5593 0.6846 -0.0339 0.0851  0.0416  461 PHE A CE2 
1323 C CZ  . PHE A 216 ? 0.4945 0.5217 0.6438 -0.0253 0.0876  0.0401  461 PHE A CZ  
1324 N N   . CYS A 217 ? 0.4487 0.3818 0.4305 -0.0241 0.0443  0.0630  462 CYS A N   
1325 C CA  A CYS A 217 ? 0.4626 0.3845 0.4343 -0.0183 0.0344  0.0663  462 CYS A CA  
1326 C CA  B CYS A 217 ? 0.4564 0.3770 0.4264 -0.0184 0.0346  0.0668  462 CYS A CA  
1327 C C   . CYS A 217 ? 0.4777 0.3797 0.4426 -0.0252 0.0391  0.0684  462 CYS A C   
1328 O O   . CYS A 217 ? 0.4958 0.3915 0.4602 -0.0356 0.0503  0.0685  462 CYS A O   
1329 C CB  A CYS A 217 ? 0.4548 0.3679 0.4068 -0.0108 0.0275  0.0724  462 CYS A CB  
1330 C CB  B CYS A 217 ? 0.4736 0.3821 0.4208 -0.0123 0.0289  0.0736  462 CYS A CB  
1331 S SG  A CYS A 217 ? 0.5371 0.4255 0.4557 -0.0174 0.0330  0.0802  462 CYS A SG  
1332 S SG  B CYS A 217 ? 0.5089 0.4357 0.4617 -0.0044 0.0206  0.0716  462 CYS A SG  
1333 N N   . ALA A 218 ? 0.4586 0.3497 0.4199 -0.0199 0.0325  0.0692  463 ALA A N   
1334 C CA  . ALA A 218 ? 0.5239 0.3906 0.4769 -0.0251 0.0365  0.0711  463 ALA A CA  
1335 C C   . ALA A 218 ? 0.5183 0.3682 0.4624 -0.0136 0.0299  0.0756  463 ALA A C   
1336 O O   . ALA A 218 ? 0.5244 0.3866 0.4754 -0.0032 0.0231  0.0744  463 ALA A O   
1337 C CB  . ALA A 218 ? 0.5351 0.4073 0.5043 -0.0346 0.0380  0.0623  463 ALA A CB  
1338 N N   . GLN A 219 ? 0.5329 0.3542 0.4649 -0.0153 0.0333  0.0810  464 GLN A N   
1339 C CA  . GLN A 219 ? 0.5871 0.3898 0.5157 -0.0027 0.0279  0.0868  464 GLN A CA  
1340 C C   . GLN A 219 ? 0.6154 0.3993 0.5487 -0.0046 0.0335  0.0796  464 GLN A C   
1341 O O   . GLN A 219 ? 0.6002 0.3708 0.5290 -0.0178 0.0408  0.0763  464 GLN A O   
1342 C CB  . GLN A 219 ? 0.6720 0.4504 0.5795 -0.0008 0.0249  0.1019  464 GLN A CB  
1343 C CG  . GLN A 219 ? 0.7565 0.5483 0.6516 -0.0010 0.0190  0.1079  464 GLN A CG  
1344 C CD  . GLN A 219 ? 0.8834 0.6485 0.7509 0.0009  0.0116  0.1241  464 GLN A CD  
1345 O OE1 . GLN A 219 ? 0.9377 0.7060 0.8058 0.0120  -0.0033 0.1321  464 GLN A OE1 
1346 N NE2 . GLN A 219 ? 0.9350 0.6735 0.7782 -0.0110 0.0212  0.1299  464 GLN A NE2 
1347 N N   . VAL A 220 ? 0.5503 0.3326 0.4935 0.0075  0.0316  0.0761  465 VAL A N   
1348 C CA  . VAL A 220 ? 0.6064 0.3635 0.5502 0.0076  0.0390  0.0687  465 VAL A CA  
1349 C C   . VAL A 220 ? 0.6120 0.3456 0.5602 0.0234  0.0379  0.0785  465 VAL A C   
1350 O O   . VAL A 220 ? 0.6270 0.3713 0.5822 0.0353  0.0285  0.0893  465 VAL A O   
1351 C CB  . VAL A 220 ? 0.5895 0.3592 0.5397 0.0069  0.0420  0.0536  465 VAL A CB  
1352 C CG1 . VAL A 220 ? 0.5677 0.3570 0.5149 -0.0091 0.0396  0.0458  465 VAL A CG1 
1353 C CG2 . VAL A 220 ? 0.6014 0.3924 0.5653 0.0214  0.0384  0.0550  465 VAL A CG2 
1354 N N   . SER A 221 ? 0.6054 0.3062 0.5514 0.0233  0.0465  0.0746  466 SER A N   
1355 C CA  . SER A 221 ? 0.6372 0.3098 0.5906 0.0388  0.0464  0.0849  466 SER A CA  
1356 C C   . SER A 221 ? 0.6882 0.3267 0.6407 0.0365  0.0606  0.0731  466 SER A C   
1357 O O   . SER A 221 ? 0.7060 0.3440 0.6486 0.0214  0.0681  0.0574  466 SER A O   
1358 C CB  . SER A 221 ? 0.6939 0.3478 0.6312 0.0374  0.0388  0.1042  466 SER A CB  
1359 O OG  . SER A 221 ? 0.7580 0.3888 0.6757 0.0192  0.0477  0.1018  466 SER A OG  
1360 N N   . LYS A 222 ? 0.7320 0.3399 0.6950 0.0515  0.0633  0.0810  467 LYS A N   
1361 C CA  . LYS A 222 ? 0.7666 0.3356 0.7283 0.0502  0.0792  0.0690  467 LYS A CA  
1362 C C   . LYS A 222 ? 0.8170 0.3612 0.7529 0.0274  0.0846  0.0645  467 LYS A C   
1363 O O   . LYS A 222 ? 0.8111 0.3373 0.7382 0.0153  0.0963  0.0465  467 LYS A O   
1364 C CB  . LYS A 222 ? 0.8887 0.4271 0.8703 0.0720  0.0804  0.0814  467 LYS A CB  
1365 C CG  . LYS A 222 ? 0.9880 0.4891 0.9780 0.0773  0.1007  0.0657  467 LYS A CG  
1366 C CD  . LYS A 222 ? 1.0892 0.5407 1.0561 0.0632  0.1097  0.0640  467 LYS A CD  
1367 C CE  . LYS A 222 ? 1.1250 0.5458 1.0969 0.0651  0.1286  0.0442  467 LYS A CE  
1368 N NZ  . LYS A 222 ? 1.1353 0.5478 1.0822 0.0432  0.1426  0.0187  467 LYS A NZ  
1369 N N   . GLU A 223 ? 0.7584 0.3010 0.6808 0.0192  0.0769  0.0799  468 GLU A N   
1370 C CA  . GLU A 223 ? 0.7905 0.3115 0.6937 -0.0035 0.0837  0.0767  468 GLU A CA  
1371 C C   . GLU A 223 ? 0.7628 0.3195 0.6630 -0.0234 0.0822  0.0642  468 GLU A C   
1372 O O   . GLU A 223 ? 0.8054 0.3500 0.6982 -0.0439 0.0885  0.0547  468 GLU A O   
1373 C CB  . GLU A 223 ? 0.8784 0.3779 0.7663 -0.0051 0.0798  0.0988  468 GLU A CB  
1374 C CG  . GLU A 223 ? 0.9748 0.4359 0.8650 0.0148  0.0770  0.1161  468 GLU A CG  
1375 C CD  . GLU A 223 ? 1.0631 0.5497 0.9720 0.0388  0.0621  0.1272  468 GLU A CD  
1376 O OE1 . GLU A 223 ? 1.0286 0.5572 0.9382 0.0373  0.0526  0.1275  468 GLU A OE1 
1377 O OE2 . GLU A 223 ? 1.0641 0.5300 0.9908 0.0588  0.0595  0.1352  468 GLU A OE2 
1378 N N   . VAL A 224 ? 0.6914 0.2914 0.5999 -0.0181 0.0731  0.0644  469 VAL A N   
1379 C CA  . VAL A 224 ? 0.6778 0.3134 0.5888 -0.0333 0.0698  0.0538  469 VAL A CA  
1380 C C   . VAL A 224 ? 0.6250 0.2871 0.5450 -0.0238 0.0657  0.0438  469 VAL A C   
1381 O O   . VAL A 224 ? 0.6101 0.3042 0.5376 -0.0158 0.0580  0.0494  469 VAL A O   
1382 C CB  . VAL A 224 ? 0.6953 0.3555 0.6057 -0.0382 0.0648  0.0652  469 VAL A CB  
1383 C CG1 . VAL A 224 ? 0.7161 0.4074 0.6355 -0.0556 0.0636  0.0546  469 VAL A CG1 
1384 C CG2 . VAL A 224 ? 0.7618 0.3905 0.6573 -0.0431 0.0702  0.0795  469 VAL A CG2 
1385 N N   . PRO A 225 ? 0.7103 0.3575 0.6266 -0.0255 0.0721  0.0285  470 PRO A N   
1386 C CA  . PRO A 225 ? 0.6982 0.3641 0.6194 -0.0148 0.0719  0.0207  470 PRO A CA  
1387 C C   . PRO A 225 ? 0.6977 0.4020 0.6183 -0.0236 0.0625  0.0159  470 PRO A C   
1388 O O   . PRO A 225 ? 0.6408 0.3656 0.5667 -0.0136 0.0609  0.0150  470 PRO A O   
1389 C CB  . PRO A 225 ? 0.7518 0.3830 0.6615 -0.0180 0.0848  0.0042  470 PRO A CB  
1390 C CG  . PRO A 225 ? 0.7764 0.3815 0.6736 -0.0373 0.0868  -0.0001 470 PRO A CG  
1391 C CD  . PRO A 225 ? 0.7647 0.3712 0.6695 -0.0363 0.0823  0.0181  470 PRO A CD  
1392 N N   . ARG A 226 ? 0.6556 0.3700 0.5731 -0.0419 0.0565  0.0135  471 ARG A N   
1393 C CA  . ARG A 226 ? 0.6320 0.3802 0.5521 -0.0501 0.0459  0.0095  471 ARG A CA  
1394 C C   . ARG A 226 ? 0.6247 0.3938 0.5586 -0.0603 0.0401  0.0168  471 ARG A C   
1395 O O   . ARG A 226 ? 0.6267 0.3794 0.5620 -0.0686 0.0453  0.0200  471 ARG A O   
1396 C CB  . ARG A 226 ? 0.7062 0.4450 0.6095 -0.0653 0.0433  -0.0064 471 ARG A CB  
1397 C CG  . ARG A 226 ? 0.7908 0.4975 0.6745 -0.0607 0.0551  -0.0182 471 ARG A CG  
1398 C CD  . ARG A 226 ? 0.8044 0.5229 0.6915 -0.0422 0.0602  -0.0159 471 ARG A CD  
1399 N NE  . ARG A 226 ? 0.8680 0.6026 0.7404 -0.0479 0.0543  -0.0226 471 ARG A NE  
1400 C CZ  . ARG A 226 ? 0.8859 0.6345 0.7608 -0.0357 0.0583  -0.0208 471 ARG A CZ  
1401 N NH1 . ARG A 226 ? 0.8337 0.5862 0.7300 -0.0170 0.0664  -0.0131 471 ARG A NH1 
1402 N NH2 . ARG A 226 ? 0.9073 0.6657 0.7635 -0.0431 0.0530  -0.0258 471 ARG A NH2 
1403 N N   . ARG A 227 ? 0.5880 0.3918 0.5332 -0.0600 0.0311  0.0191  472 ARG A N   
1404 C CA  . ARG A 227 ? 0.5591 0.3860 0.5231 -0.0697 0.0275  0.0235  472 ARG A CA  
1405 C C   . ARG A 227 ? 0.6011 0.4427 0.5735 -0.0858 0.0164  0.0147  472 ARG A C   
1406 O O   . ARG A 227 ? 0.6002 0.4381 0.5579 -0.0879 0.0090  0.0068  472 ARG A O   
1407 C CB  . ARG A 227 ? 0.5362 0.3905 0.5114 -0.0583 0.0253  0.0322  472 ARG A CB  
1408 C CG  . ARG A 227 ? 0.5192 0.3626 0.4852 -0.0430 0.0311  0.0415  472 ARG A CG  
1409 C CD  . ARG A 227 ? 0.5431 0.3603 0.5008 -0.0462 0.0398  0.0484  472 ARG A CD  
1410 N NE  . ARG A 227 ? 0.5850 0.4100 0.5522 -0.0597 0.0452  0.0504  472 ARG A NE  
1411 C CZ  . ARG A 227 ? 0.6383 0.4431 0.5952 -0.0641 0.0548  0.0584  472 ARG A CZ  
1412 N NH1 . ARG A 227 ? 0.6084 0.3842 0.5453 -0.0549 0.0560  0.0668  472 ARG A NH1 
1413 N NH2 . ARG A 227 ? 0.5844 0.3972 0.5520 -0.0777 0.0635  0.0586  472 ARG A NH2 
1414 N N   . LYS A 228 ? 0.5426 0.4003 0.5385 -0.0982 0.0152  0.0162  473 LYS A N   
1415 C CA  . LYS A 228 ? 0.5590 0.4345 0.5706 -0.1143 0.0010  0.0093  473 LYS A CA  
1416 C C   . LYS A 228 ? 0.6224 0.5378 0.6714 -0.1150 -0.0053 0.0149  473 LYS A C   
1417 O O   . LYS A 228 ? 0.6438 0.5800 0.7136 -0.1262 -0.0206 0.0116  473 LYS A O   
1418 C CB  . LYS A 228 ? 0.5642 0.4199 0.5774 -0.1339 0.0044  0.0023  473 LYS A CB  
1419 C CG  . LYS A 228 ? 0.6912 0.5044 0.6691 -0.1347 0.0105  -0.0055 473 LYS A CG  
1420 C CD  . LYS A 228 ? 0.7824 0.5678 0.7603 -0.1502 0.0205  -0.0093 473 LYS A CD  
1421 C CE  . LYS A 228 ? 0.8359 0.5753 0.7799 -0.1471 0.0292  -0.0167 473 LYS A CE  
1422 N NZ  . LYS A 228 ? 0.7817 0.4870 0.7233 -0.1586 0.0420  -0.0177 473 LYS A NZ  
1423 N N   . SEP A 229 ? 0.5077 0.4328 0.5659 -0.1031 0.0058  0.0231  474 SEP A N   
1424 C CA  . SEP A 229 ? 0.5329 0.4914 0.6293 -0.1036 0.0060  0.0270  474 SEP A CA  
1425 C CB  . SEP A 229 ? 0.4841 0.4387 0.5785 -0.0952 0.0250  0.0336  474 SEP A CB  
1426 O OG  . SEP A 229 ? 0.4875 0.4174 0.5711 -0.1044 0.0396  0.0343  474 SEP A OG  
1427 C C   . SEP A 229 ? 0.4850 0.4692 0.5932 -0.0954 -0.0103 0.0288  474 SEP A C   
1428 O O   . SEP A 229 ? 0.4866 0.4633 0.5695 -0.0839 -0.0144 0.0302  474 SEP A O   
1429 P P   . SEP A 229 ? 0.5261 0.4257 0.5703 -0.0918 0.0484  0.0411  474 SEP A P   
1430 O O1P . SEP A 229 ? 0.5389 0.4278 0.5606 -0.0802 0.0360  0.0389  474 SEP A O1P 
1431 O O2P . SEP A 229 ? 0.5321 0.3981 0.5610 -0.1028 0.0620  0.0436  474 SEP A O2P 
1432 O O3P . SEP A 229 ? 0.4959 0.4071 0.5396 -0.0816 0.0565  0.0475  474 SEP A O3P 
1433 N N   . LEU A 230 ? 0.4537 0.4682 0.6035 -0.1014 -0.0191 0.0295  475 LEU A N   
1434 C CA  . LEU A 230 ? 0.4256 0.4643 0.5923 -0.0922 -0.0338 0.0341  475 LEU A CA  
1435 C C   . LEU A 230 ? 0.4236 0.4712 0.6013 -0.0775 -0.0184 0.0393  475 LEU A C   
1436 O O   . LEU A 230 ? 0.3990 0.4637 0.6132 -0.0788 -0.0066 0.0401  475 LEU A O   
1437 C CB  . LEU A 230 ? 0.4380 0.5068 0.6515 -0.1029 -0.0514 0.0343  475 LEU A CB  
1438 C CG  . LEU A 230 ? 0.4850 0.5768 0.7174 -0.0937 -0.0715 0.0412  475 LEU A CG  
1439 C CD1 . LEU A 230 ? 0.4725 0.5451 0.6562 -0.0919 -0.0886 0.0417  475 LEU A CD1 
1440 C CD2 . LEU A 230 ? 0.5302 0.6551 0.8195 -0.1034 -0.0894 0.0431  475 LEU A CD2 
1441 N N   . VAL A 231 ? 0.4223 0.4568 0.5678 -0.0650 -0.0170 0.0417  476 VAL A N   
1442 C CA  . VAL A 231 ? 0.3901 0.4263 0.5356 -0.0529 -0.0032 0.0451  476 VAL A CA  
1443 C C   . VAL A 231 ? 0.3927 0.4299 0.5232 -0.0416 -0.0138 0.0485  476 VAL A C   
1444 O O   . VAL A 231 ? 0.4359 0.4580 0.5350 -0.0405 -0.0206 0.0474  476 VAL A O   
1445 C CB  . VAL A 231 ? 0.4385 0.4501 0.5536 -0.0517 0.0136  0.0449  476 VAL A CB  
1446 C CG1 . VAL A 231 ? 0.4482 0.4585 0.5537 -0.0405 0.0228  0.0478  476 VAL A CG1 
1447 C CG2 . VAL A 231 ? 0.4250 0.4320 0.5523 -0.0636 0.0278  0.0431  476 VAL A CG2 
1448 N N   . GLY A 232 ? 0.3986 0.4510 0.5511 -0.0334 -0.0121 0.0518  477 GLY A N   
1449 C CA  . GLY A 232 ? 0.3860 0.4367 0.5244 -0.0234 -0.0191 0.0556  477 GLY A CA  
1450 C C   . GLY A 232 ? 0.3800 0.4509 0.5550 -0.0180 -0.0260 0.0602  477 GLY A C   
1451 O O   . GLY A 232 ? 0.3876 0.4757 0.6029 -0.0203 -0.0223 0.0598  477 GLY A O   
1452 N N   . THR A 233 ? 0.3914 0.4593 0.5546 -0.0106 -0.0349 0.0651  478 THR A N   
1453 C CA  . THR A 233 ? 0.3795 0.4621 0.5753 -0.0038 -0.0437 0.0716  478 THR A CA  
1454 C C   . THR A 233 ? 0.3880 0.4710 0.5740 -0.0072 -0.0691 0.0784  478 THR A C   
1455 O O   . THR A 233 ? 0.3935 0.4590 0.5372 -0.0085 -0.0736 0.0790  478 THR A O   
1456 C CB  . THR A 233 ? 0.3983 0.4732 0.5877 0.0065  -0.0333 0.0731  478 THR A CB  
1457 O OG1 . THR A 233 ? 0.3769 0.4459 0.5622 0.0068  -0.0113 0.0659  478 THR A OG1 
1458 C CG2 . THR A 233 ? 0.3907 0.4787 0.6209 0.0149  -0.0389 0.0797  478 THR A CG2 
1459 N N   . PRO A 234 ? 0.3757 0.4780 0.5995 -0.0096 -0.0860 0.0835  479 PRO A N   
1460 C CA  . PRO A 234 ? 0.4485 0.5497 0.6573 -0.0175 -0.1140 0.0892  479 PRO A CA  
1461 C C   . PRO A 234 ? 0.4576 0.5367 0.6167 -0.0160 -0.1232 0.0947  479 PRO A C   
1462 O O   . PRO A 234 ? 0.4412 0.5034 0.5567 -0.0260 -0.1295 0.0910  479 PRO A O   
1463 C CB  . PRO A 234 ? 0.4477 0.5757 0.7154 -0.0136 -0.1308 0.0980  479 PRO A CB  
1464 C CG  . PRO A 234 ? 0.3772 0.5229 0.6918 -0.0121 -0.1082 0.0906  479 PRO A CG  
1465 C CD  . PRO A 234 ? 0.3818 0.5085 0.6657 -0.0069 -0.0794 0.0832  479 PRO A CD  
1466 N N   . TYR A 235 ? 0.4329 0.5090 0.5966 -0.0047 -0.1213 0.1025  480 TYR A N   
1467 C CA  . TYR A 235 ? 0.4179 0.4722 0.5362 -0.0046 -0.1293 0.1092  480 TYR A CA  
1468 C C   . TYR A 235 ? 0.4665 0.5000 0.5374 -0.0082 -0.1112 0.1000  480 TYR A C   
1469 O O   . TYR A 235 ? 0.4541 0.4683 0.4819 -0.0129 -0.1161 0.1026  480 TYR A O   
1470 C CB  . TYR A 235 ? 0.3973 0.4509 0.5341 0.0081  -0.1283 0.1193  480 TYR A CB  
1471 C CG  . TYR A 235 ? 0.4186 0.4939 0.6116 0.0145  -0.1446 0.1288  480 TYR A CG  
1472 C CD1 . TYR A 235 ? 0.4333 0.5093 0.6258 0.0121  -0.1758 0.1427  480 TYR A CD1 
1473 C CD2 . TYR A 235 ? 0.3639 0.4585 0.6108 0.0225  -0.1288 0.1238  480 TYR A CD2 
1474 C CE1 . TYR A 235 ? 0.4761 0.5753 0.7285 0.0193  -0.1932 0.1526  480 TYR A CE1 
1475 C CE2 . TYR A 235 ? 0.3556 0.4725 0.6623 0.0294  -0.1414 0.1317  480 TYR A CE2 
1476 C CZ  . TYR A 235 ? 0.4533 0.5742 0.7664 0.0286  -0.1746 0.1467  480 TYR A CZ  
1477 O OH  . TYR A 235 ? 0.4569 0.6030 0.8376 0.0370  -0.1897 0.1561  480 TYR A OH  
1478 N N   . TRP A 236 ? 0.3993 0.4357 0.4777 -0.0065 -0.0903 0.0899  481 TRP A N   
1479 C CA  . TRP A 236 ? 0.4683 0.4884 0.5120 -0.0076 -0.0742 0.0823  481 TRP A CA  
1480 C C   . TRP A 236 ? 0.4683 0.4812 0.4941 -0.0167 -0.0719 0.0733  481 TRP A C   
1481 O O   . TRP A 236 ? 0.4636 0.4635 0.4664 -0.0163 -0.0584 0.0671  481 TRP A O   
1482 C CB  . TRP A 236 ? 0.3948 0.4185 0.4533 0.0005  -0.0547 0.0785  481 TRP A CB  
1483 C CG  . TRP A 236 ? 0.4360 0.4589 0.5024 0.0084  -0.0519 0.0844  481 TRP A CG  
1484 C CD1 . TRP A 236 ? 0.3941 0.4053 0.4392 0.0105  -0.0439 0.0847  481 TRP A CD1 
1485 C CD2 . TRP A 236 ? 0.3898 0.4230 0.4909 0.0150  -0.0553 0.0902  481 TRP A CD2 
1486 N NE1 . TRP A 236 ? 0.3945 0.4057 0.4550 0.0166  -0.0429 0.0902  481 TRP A NE1 
1487 C CE2 . TRP A 236 ? 0.3723 0.3958 0.4670 0.0204  -0.0494 0.0936  481 TRP A CE2 
1488 C CE3 . TRP A 236 ? 0.3755 0.4255 0.5167 0.0169  -0.0616 0.0924  481 TRP A CE3 
1489 C CZ2 . TRP A 236 ? 0.3858 0.4120 0.5095 0.0283  -0.0493 0.0990  481 TRP A CZ2 
1490 C CZ3 . TRP A 236 ? 0.4020 0.4578 0.5764 0.0259  -0.0609 0.0978  481 TRP A CZ3 
1491 C CH2 . TRP A 236 ? 0.4004 0.4425 0.5644 0.0319  -0.0547 0.1011  481 TRP A CH2 
1492 N N   . MET A 237 ? 0.4489 0.4697 0.4877 -0.0249 -0.0846 0.0723  482 MET A N   
1493 C CA  . MET A 237 ? 0.4455 0.4573 0.4711 -0.0340 -0.0800 0.0628  482 MET A CA  
1494 C C   . MET A 237 ? 0.5055 0.4937 0.4836 -0.0424 -0.0840 0.0582  482 MET A C   
1495 O O   . MET A 237 ? 0.5223 0.5046 0.4799 -0.0474 -0.0999 0.0633  482 MET A O   
1496 C CB  . MET A 237 ? 0.4685 0.4966 0.5260 -0.0425 -0.0916 0.0623  482 MET A CB  
1497 C CG  . MET A 237 ? 0.4553 0.5042 0.5598 -0.0366 -0.0814 0.0636  482 MET A CG  
1498 S SD  . MET A 237 ? 0.4660 0.5367 0.6130 -0.0491 -0.0962 0.0628  482 MET A SD  
1499 C CE  . MET A 237 ? 0.5097 0.5991 0.7056 -0.0415 -0.0736 0.0623  482 MET A CE  
1500 N N   . ALA A 238 ? 0.5133 0.4851 0.4723 -0.0442 -0.0688 0.0488  483 ALA A N   
1501 C CA  . ALA A 238 ? 0.5395 0.4857 0.4545 -0.0527 -0.0673 0.0413  483 ALA A CA  
1502 C C   . ALA A 238 ? 0.5781 0.5195 0.4815 -0.0688 -0.0867 0.0382  483 ALA A C   
1503 O O   . ALA A 238 ? 0.5609 0.5182 0.4960 -0.0734 -0.0952 0.0385  483 ALA A O   
1504 C CB  . ALA A 238 ? 0.5283 0.4588 0.4352 -0.0493 -0.0464 0.0321  483 ALA A CB  
1505 N N   . PRO A 239 ? 0.6273 0.5465 0.4848 -0.0792 -0.0939 0.0347  484 PRO A N   
1506 C CA  . PRO A 239 ? 0.6283 0.5417 0.4708 -0.0972 -0.1161 0.0313  484 PRO A CA  
1507 C C   . PRO A 239 ? 0.6424 0.5464 0.4889 -0.1065 -0.1091 0.0188  484 PRO A C   
1508 O O   . PRO A 239 ? 0.6207 0.5368 0.4873 -0.1181 -0.1271 0.0185  484 PRO A O   
1509 C CB  . PRO A 239 ? 0.7046 0.5881 0.4848 -0.1068 -0.1201 0.0289  484 PRO A CB  
1510 C CG  . PRO A 239 ? 0.7305 0.6005 0.4955 -0.0950 -0.0911 0.0254  484 PRO A CG  
1511 C CD  . PRO A 239 ? 0.6341 0.5329 0.4506 -0.0771 -0.0839 0.0345  484 PRO A CD  
1512 N N   . GLU A 240 ? 0.6600 0.5431 0.4922 -0.1016 -0.0837 0.0090  485 GLU A N   
1513 C CA  . GLU A 240 ? 0.6585 0.5282 0.4941 -0.1101 -0.0764 -0.0018 485 GLU A CA  
1514 C C   . GLU A 240 ? 0.6658 0.5621 0.5541 -0.1063 -0.0773 0.0040  485 GLU A C   
1515 O O   . GLU A 240 ? 0.6734 0.5655 0.5717 -0.1182 -0.0795 -0.0020 485 GLU A O   
1516 C CB  . GLU A 240 ? 0.6763 0.5174 0.4909 -0.1027 -0.0489 -0.0116 485 GLU A CB  
1517 C CG  . GLU A 240 ? 0.6642 0.5184 0.5093 -0.0824 -0.0314 -0.0046 485 GLU A CG  
1518 C CD  . GLU A 240 ? 0.6860 0.5454 0.5228 -0.0704 -0.0246 0.0008  485 GLU A CD  
1519 O OE1 . GLU A 240 ? 0.6934 0.5544 0.5094 -0.0762 -0.0365 0.0040  485 GLU A OE1 
1520 O OE2 . GLU A 240 ? 0.6293 0.4905 0.4806 -0.0561 -0.0080 0.0025  485 GLU A OE2 
1521 N N   . LEU A 241 ? 0.6004 0.5215 0.5204 -0.0914 -0.0739 0.0149  486 LEU A N   
1522 C CA  . LEU A 241 ? 0.5425 0.4868 0.5087 -0.0887 -0.0716 0.0198  486 LEU A CA  
1523 C C   . LEU A 241 ? 0.5157 0.4854 0.5126 -0.0990 -0.0941 0.0241  486 LEU A C   
1524 O O   . LEU A 241 ? 0.5411 0.5211 0.5678 -0.1079 -0.0947 0.0219  486 LEU A O   
1525 C CB  . LEU A 241 ? 0.5319 0.4902 0.5167 -0.0707 -0.0592 0.0280  486 LEU A CB  
1526 C CG  . LEU A 241 ? 0.5328 0.5091 0.5562 -0.0661 -0.0502 0.0325  486 LEU A CG  
1527 C CD1 . LEU A 241 ? 0.4970 0.4710 0.5170 -0.0510 -0.0347 0.0363  486 LEU A CD1 
1528 C CD2 . LEU A 241 ? 0.5375 0.5440 0.6001 -0.0673 -0.0631 0.0388  486 LEU A CD2 
1529 N N   . ILE A 242 ? 0.5221 0.5021 0.5145 -0.0982 -0.1132 0.0310  487 ILE A N   
1530 C CA  . ILE A 242 ? 0.5137 0.5178 0.5366 -0.1078 -0.1397 0.0364  487 ILE A CA  
1531 C C   . ILE A 242 ? 0.5684 0.5593 0.5728 -0.1296 -0.1542 0.0268  487 ILE A C   
1532 O O   . ILE A 242 ? 0.5395 0.5522 0.5826 -0.1408 -0.1698 0.0274  487 ILE A O   
1533 C CB  . ILE A 242 ? 0.5317 0.5429 0.5462 -0.1018 -0.1591 0.0479  487 ILE A CB  
1534 C CG1 . ILE A 242 ? 0.4830 0.5062 0.5191 -0.0817 -0.1441 0.0563  487 ILE A CG1 
1535 C CG2 . ILE A 242 ? 0.5619 0.5984 0.6106 -0.1111 -0.1913 0.0554  487 ILE A CG2 
1536 C CD1 . ILE A 242 ? 0.4980 0.5202 0.5188 -0.0753 -0.1591 0.0677  487 ILE A CD1 
1537 N N   . SER A 243 ? 0.5853 0.5401 0.5326 -0.1369 -0.1483 0.0168  488 SER A N   
1538 C CA  . SER A 243 ? 0.6167 0.5529 0.5405 -0.1594 -0.1598 0.0051  488 SER A CA  
1539 C C   . SER A 243 ? 0.6325 0.5659 0.5814 -0.1658 -0.1439 -0.0033 488 SER A C   
1540 O O   . SER A 243 ? 0.6416 0.5592 0.5762 -0.1859 -0.1519 -0.0141 488 SER A O   
1541 C CB  . SER A 243 ? 0.6957 0.5892 0.5485 -0.1655 -0.1531 -0.0054 488 SER A CB  
1542 O OG  . SER A 243 ? 0.7579 0.6497 0.5803 -0.1645 -0.1696 0.0025  488 SER A OG  
1543 N N   . ARG A 244 ? 0.5639 0.5091 0.5457 -0.1508 -0.1219 0.0013  489 ARG A N   
1544 C CA  . ARG A 244 ? 0.5585 0.4977 0.5611 -0.1561 -0.1046 -0.0040 489 ARG A CA  
1545 C C   . ARG A 244 ? 0.6596 0.5544 0.6170 -0.1611 -0.0885 -0.0164 489 ARG A C   
1546 O O   . ARG A 244 ? 0.6496 0.5297 0.6121 -0.1735 -0.0812 -0.0236 489 ARG A O   
1547 C CB  . ARG A 244 ? 0.5553 0.5179 0.6004 -0.1747 -0.1205 -0.0052 489 ARG A CB  
1548 C CG  . ARG A 244 ? 0.5257 0.5335 0.6225 -0.1709 -0.1400 0.0062  489 ARG A CG  
1549 C CD  . ARG A 244 ? 0.4888 0.5146 0.6111 -0.1482 -0.1226 0.0164  489 ARG A CD  
1550 N NE  . ARG A 244 ? 0.5760 0.5870 0.6976 -0.1424 -0.0924 0.0140  489 ARG A NE  
1551 C CZ  . ARG A 244 ? 0.5668 0.5896 0.7266 -0.1490 -0.0797 0.0135  489 ARG A CZ  
1552 N NH1 . ARG A 244 ? 0.6236 0.6773 0.8333 -0.1611 -0.0933 0.0142  489 ARG A NH1 
1553 N NH2 . ARG A 244 ? 0.5499 0.5533 0.6989 -0.1441 -0.0536 0.0131  489 ARG A NH2 
1554 N N   . LEU A 245 ? 0.6811 0.5536 0.5971 -0.1516 -0.0810 -0.0190 490 LEU A N   
1555 C CA  . LEU A 245 ? 0.7421 0.5733 0.6231 -0.1512 -0.0608 -0.0300 490 LEU A CA  
1556 C C   . LEU A 245 ? 0.7020 0.5312 0.5997 -0.1314 -0.0376 -0.0234 490 LEU A C   
1557 O O   . LEU A 245 ? 0.6862 0.5414 0.6069 -0.1168 -0.0366 -0.0120 490 LEU A O   
1558 C CB  . LEU A 245 ? 0.7392 0.5467 0.5703 -0.1503 -0.0599 -0.0370 490 LEU A CB  
1559 C CG  . LEU A 245 ? 0.7909 0.5942 0.5920 -0.1709 -0.0851 -0.0426 490 LEU A CG  
1560 C CD1 . LEU A 245 ? 0.8142 0.5929 0.5616 -0.1693 -0.0805 -0.0477 490 LEU A CD1 
1561 C CD2 . LEU A 245 ? 0.8437 0.6245 0.6334 -0.1940 -0.0900 -0.0563 490 LEU A CD2 
1562 N N   . PRO A 246 ? 0.6987 0.4957 0.5848 -0.1310 -0.0198 -0.0299 491 PRO A N   
1563 C CA  . PRO A 246 ? 0.6431 0.4355 0.5409 -0.1116 -0.0015 -0.0218 491 PRO A CA  
1564 C C   . PRO A 246 ? 0.6270 0.4236 0.5136 -0.0936 0.0038  -0.0186 491 PRO A C   
1565 O O   . PRO A 246 ? 0.7064 0.4878 0.5640 -0.0956 0.0049  -0.0273 491 PRO A O   
1566 C CB  . PRO A 246 ? 0.6501 0.4007 0.5325 -0.1158 0.0135  -0.0303 491 PRO A CB  
1567 C CG  . PRO A 246 ? 0.7212 0.4613 0.5943 -0.1408 0.0030  -0.0418 491 PRO A CG  
1568 C CD  . PRO A 246 ? 0.6918 0.4526 0.5532 -0.1482 -0.0167 -0.0444 491 PRO A CD  
1569 N N   . TYR A 247 ? 0.5903 0.4070 0.4985 -0.0777 0.0076  -0.0066 492 TYR A N   
1570 C CA  . TYR A 247 ? 0.5861 0.4135 0.4905 -0.0627 0.0103  -0.0026 492 TYR A CA  
1571 C C   . TYR A 247 ? 0.5906 0.4161 0.5085 -0.0454 0.0220  0.0054  492 TYR A C   
1572 O O   . TYR A 247 ? 0.5893 0.4085 0.5181 -0.0446 0.0257  0.0107  492 TYR A O   
1573 C CB  . TYR A 247 ? 0.5665 0.4273 0.4839 -0.0629 -0.0040 0.0046  492 TYR A CB  
1574 C CG  . TYR A 247 ? 0.5442 0.4289 0.4934 -0.0615 -0.0072 0.0139  492 TYR A CG  
1575 C CD1 . TYR A 247 ? 0.5503 0.4470 0.5169 -0.0754 -0.0167 0.0134  492 TYR A CD1 
1576 C CD2 . TYR A 247 ? 0.5108 0.4057 0.4729 -0.0477 -0.0000 0.0225  492 TYR A CD2 
1577 C CE1 . TYR A 247 ? 0.5299 0.4476 0.5274 -0.0746 -0.0148 0.0205  492 TYR A CE1 
1578 C CE2 . TYR A 247 ? 0.5167 0.4288 0.5017 -0.0479 0.0004  0.0293  492 TYR A CE2 
1579 C CZ  . TYR A 247 ? 0.5150 0.4380 0.5182 -0.0609 -0.0049 0.0280  492 TYR A CZ  
1580 O OH  . TYR A 247 ? 0.4906 0.4296 0.5179 -0.0613 0.0003  0.0333  492 TYR A OH  
1581 N N   . GLY A 248 ? 0.5735 0.4044 0.4900 -0.0325 0.0269  0.0069  493 GLY A N   
1582 C CA  . GLY A 248 ? 0.5417 0.3742 0.4733 -0.0163 0.0338  0.0150  493 GLY A CA  
1583 C C   . GLY A 248 ? 0.5157 0.3753 0.4584 -0.0074 0.0297  0.0217  493 GLY A C   
1584 O O   . GLY A 248 ? 0.5486 0.4274 0.4917 -0.0129 0.0210  0.0232  493 GLY A O   
1585 N N   . PRO A 249 ? 0.5176 0.3788 0.4723 0.0066  0.0353  0.0263  494 PRO A N   
1586 C CA  . PRO A 249 ? 0.5207 0.4066 0.4875 0.0138  0.0316  0.0322  494 PRO A CA  
1587 C C   . PRO A 249 ? 0.5314 0.4258 0.4880 0.0094  0.0321  0.0269  494 PRO A C   
1588 O O   . PRO A 249 ? 0.5008 0.4149 0.4650 0.0118  0.0276  0.0318  494 PRO A O   
1589 C CB  . PRO A 249 ? 0.5237 0.4066 0.5070 0.0281  0.0375  0.0356  494 PRO A CB  
1590 C CG  . PRO A 249 ? 0.5774 0.4347 0.5592 0.0300  0.0413  0.0360  494 PRO A CG  
1591 C CD  . PRO A 249 ? 0.5321 0.3720 0.4929 0.0164  0.0446  0.0260  494 PRO A CD  
1592 N N   . GLU A 250 ? 0.5316 0.4083 0.4671 0.0018  0.0375  0.0171  495 GLU A N   
1593 C CA  . GLU A 250 ? 0.5508 0.4296 0.4675 -0.0043 0.0378  0.0131  495 GLU A CA  
1594 C C   . GLU A 250 ? 0.5383 0.4360 0.4548 -0.0108 0.0219  0.0198  495 GLU A C   
1595 O O   . GLU A 250 ? 0.5393 0.4433 0.4466 -0.0121 0.0202  0.0217  495 GLU A O   
1596 C CB  . GLU A 250 ? 0.6097 0.4606 0.4951 -0.0149 0.0444  0.0008  495 GLU A CB  
1597 C CG  . GLU A 250 ? 0.6333 0.4606 0.5196 -0.0080 0.0636  -0.0080 495 GLU A CG  
1598 C CD  . GLU A 250 ? 0.6959 0.5075 0.5898 -0.0080 0.0630  -0.0089 495 GLU A CD  
1599 O OE1 . GLU A 250 ? 0.6747 0.4947 0.5726 -0.0147 0.0491  -0.0033 495 GLU A OE1 
1600 O OE2 . GLU A 250 ? 0.7813 0.5711 0.6791 -0.0012 0.0781  -0.0151 495 GLU A OE2 
1601 N N   . VAL A 251 ? 0.5210 0.4267 0.4491 -0.0148 0.0116  0.0238  496 VAL A N   
1602 C CA  . VAL A 251 ? 0.4907 0.4150 0.4257 -0.0196 -0.0022 0.0297  496 VAL A CA  
1603 C C   . VAL A 251 ? 0.4896 0.4324 0.4413 -0.0102 -0.0017 0.0373  496 VAL A C   
1604 O O   . VAL A 251 ? 0.4888 0.4423 0.4422 -0.0117 -0.0099 0.0418  496 VAL A O   
1605 C CB  . VAL A 251 ? 0.4899 0.4205 0.4400 -0.0266 -0.0100 0.0310  496 VAL A CB  
1606 C CG1 . VAL A 251 ? 0.5085 0.4201 0.4418 -0.0388 -0.0121 0.0225  496 VAL A CG1 
1607 C CG2 . VAL A 251 ? 0.4594 0.3939 0.4278 -0.0196 -0.0026 0.0352  496 VAL A CG2 
1608 N N   . ASP A 252 ? 0.4715 0.4166 0.4353 -0.0010 0.0062  0.0392  497 ASP A N   
1609 C CA  . ASP A 252 ? 0.4340 0.3943 0.4105 0.0055  0.0062  0.0447  497 ASP A CA  
1610 C C   . ASP A 252 ? 0.4300 0.3896 0.3970 0.0063  0.0102  0.0437  497 ASP A C   
1611 O O   . ASP A 252 ? 0.4327 0.4027 0.4053 0.0074  0.0076  0.0482  497 ASP A O   
1612 C CB  . ASP A 252 ? 0.3970 0.3593 0.3858 0.0133  0.0103  0.0473  497 ASP A CB  
1613 C CG  . ASP A 252 ? 0.4339 0.3950 0.4272 0.0114  0.0077  0.0503  497 ASP A CG  
1614 O OD1 . ASP A 252 ? 0.4215 0.3885 0.4182 0.0054  0.0042  0.0508  497 ASP A OD1 
1615 O OD2 . ASP A 252 ? 0.4410 0.3951 0.4355 0.0158  0.0096  0.0529  497 ASP A OD2 
1616 N N   . ILE A 253 ? 0.4512 0.3963 0.4034 0.0052  0.0191  0.0375  498 ILE A N   
1617 C CA  . ILE A 253 ? 0.4321 0.3739 0.3728 0.0044  0.0273  0.0358  498 ILE A CA  
1618 C C   . ILE A 253 ? 0.4567 0.3944 0.3747 -0.0046 0.0180  0.0388  498 ILE A C   
1619 O O   . ILE A 253 ? 0.4858 0.4264 0.3995 -0.0051 0.0192  0.0432  498 ILE A O   
1620 C CB  . ILE A 253 ? 0.4915 0.4159 0.4217 0.0051  0.0433  0.0266  498 ILE A CB  
1621 C CG1 . ILE A 253 ? 0.5331 0.4614 0.4911 0.0160  0.0496  0.0261  498 ILE A CG1 
1622 C CG2 . ILE A 253 ? 0.5453 0.4650 0.4622 0.0025  0.0560  0.0243  498 ILE A CG2 
1623 C CD1 . ILE A 253 ? 0.4830 0.4328 0.4702 0.0240  0.0481  0.0327  498 ILE A CD1 
1624 N N   . TRP A 254 ? 0.5229 0.4527 0.4264 -0.0124 0.0075  0.0371  499 TRP A N   
1625 C CA  . TRP A 254 ? 0.5432 0.4716 0.4295 -0.0204 -0.0072 0.0425  499 TRP A CA  
1626 C C   . TRP A 254 ? 0.4891 0.4371 0.4012 -0.0149 -0.0166 0.0526  499 TRP A C   
1627 O O   . TRP A 254 ? 0.4692 0.4161 0.3726 -0.0157 -0.0210 0.0594  499 TRP A O   
1628 C CB  . TRP A 254 ? 0.5184 0.4399 0.3936 -0.0305 -0.0204 0.0392  499 TRP A CB  
1629 C CG  . TRP A 254 ? 0.5559 0.4796 0.4198 -0.0380 -0.0410 0.0470  499 TRP A CG  
1630 C CD1 . TRP A 254 ? 0.5012 0.4455 0.3949 -0.0346 -0.0560 0.0567  499 TRP A CD1 
1631 C CD2 . TRP A 254 ? 0.6043 0.5076 0.4243 -0.0499 -0.0495 0.0466  499 TRP A CD2 
1632 N NE1 . TRP A 254 ? 0.5367 0.4769 0.4130 -0.0422 -0.0758 0.0638  499 TRP A NE1 
1633 C CE2 . TRP A 254 ? 0.5571 0.4712 0.3842 -0.0526 -0.0735 0.0584  499 TRP A CE2 
1634 C CE3 . TRP A 254 ? 0.6111 0.4861 0.3851 -0.0589 -0.0385 0.0373  499 TRP A CE3 
1635 C CZ2 . TRP A 254 ? 0.5873 0.4846 0.3741 -0.0644 -0.0908 0.0630  499 TRP A CZ2 
1636 C CZ3 . TRP A 254 ? 0.6760 0.5320 0.4048 -0.0723 -0.0525 0.0399  499 TRP A CZ3 
1637 C CH2 . TRP A 254 ? 0.6976 0.5648 0.4316 -0.0752 -0.0805 0.0537  499 TRP A CH2 
1638 N N   . SER A 255 ? 0.4520 0.4146 0.3937 -0.0097 -0.0181 0.0535  500 SER A N   
1639 C CA  . SER A 255 ? 0.4555 0.4339 0.4221 -0.0047 -0.0233 0.0606  500 SER A CA  
1640 C C   . SER A 255 ? 0.4049 0.3845 0.3729 0.0006  -0.0151 0.0632  500 SER A C   
1641 O O   . SER A 255 ? 0.4173 0.4013 0.3937 0.0026  -0.0197 0.0696  500 SER A O   
1642 C CB  . SER A 255 ? 0.4309 0.4196 0.4217 -0.0017 -0.0207 0.0588  500 SER A CB  
1643 O OG  . SER A 255 ? 0.4296 0.4189 0.4243 -0.0082 -0.0279 0.0568  500 SER A OG  
1644 N N   . LEU A 256 ? 0.4136 0.3896 0.3778 0.0031  -0.0027 0.0584  501 LEU A N   
1645 C CA  . LEU A 256 ? 0.4435 0.4218 0.4115 0.0057  0.0052  0.0602  501 LEU A CA  
1646 C C   . LEU A 256 ? 0.4336 0.4006 0.3793 0.0005  0.0050  0.0643  501 LEU A C   
1647 O O   . LEU A 256 ? 0.4603 0.4285 0.4104 0.0011  0.0053  0.0698  501 LEU A O   
1648 C CB  . LEU A 256 ? 0.3997 0.3788 0.3737 0.0091  0.0172  0.0544  501 LEU A CB  
1649 C CG  . LEU A 256 ? 0.4433 0.4268 0.4252 0.0099  0.0265  0.0549  501 LEU A CG  
1650 C CD1 . LEU A 256 ? 0.4160 0.4104 0.4152 0.0115  0.0211  0.0589  501 LEU A CD1 
1651 C CD2 . LEU A 256 ? 0.4423 0.4298 0.4386 0.0143  0.0369  0.0495  501 LEU A CD2 
1652 N N   . GLY A 257 ? 0.4874 0.4398 0.4050 -0.0059 0.0048  0.0618  502 GLY A N   
1653 C CA  . GLY A 257 ? 0.4624 0.3991 0.3494 -0.0129 0.0027  0.0671  502 GLY A CA  
1654 C C   . GLY A 257 ? 0.5007 0.4404 0.3926 -0.0125 -0.0150 0.0784  502 GLY A C   
1655 O O   . GLY A 257 ? 0.5054 0.4372 0.3878 -0.0137 -0.0150 0.0864  502 GLY A O   
1656 N N   . ILE A 258 ? 0.4796 0.4303 0.3896 -0.0106 -0.0295 0.0798  503 ILE A N   
1657 C CA  . ILE A 258 ? 0.4624 0.4195 0.3887 -0.0078 -0.0457 0.0905  503 ILE A CA  
1658 C C   . ILE A 258 ? 0.4412 0.4053 0.3923 -0.0000 -0.0377 0.0936  503 ILE A C   
1659 O O   . ILE A 258 ? 0.4557 0.4146 0.4094 0.0020  -0.0444 0.1035  503 ILE A O   
1660 C CB  . ILE A 258 ? 0.4792 0.4511 0.4304 -0.0072 -0.0585 0.0895  503 ILE A CB  
1661 C CG1 . ILE A 258 ? 0.4674 0.4303 0.3924 -0.0176 -0.0686 0.0858  503 ILE A CG1 
1662 C CG2 . ILE A 258 ? 0.4460 0.4276 0.4247 -0.0021 -0.0735 0.1006  503 ILE A CG2 
1663 C CD1 . ILE A 258 ? 0.5181 0.4640 0.4072 -0.0256 -0.0846 0.0945  503 ILE A CD1 
1664 N N   . MET A 259 ? 0.4126 0.3862 0.3809 0.0039  -0.0244 0.0855  504 MET A N   
1665 C CA  . MET A 259 ? 0.4214 0.3986 0.4076 0.0084  -0.0168 0.0863  504 MET A CA  
1666 C C   . MET A 259 ? 0.4593 0.4240 0.4283 0.0050  -0.0090 0.0898  504 MET A C   
1667 O O   . MET A 259 ? 0.4456 0.4067 0.4239 0.0067  -0.0074 0.0943  504 MET A O   
1668 C CB  . MET A 259 ? 0.4104 0.3984 0.4121 0.0110  -0.0074 0.0775  504 MET A CB  
1669 C CG  . MET A 259 ? 0.4260 0.4175 0.4463 0.0142  -0.0029 0.0768  504 MET A CG  
1670 S SD  . MET A 259 ? 0.4259 0.4264 0.4556 0.0149  0.0035  0.0680  504 MET A SD  
1671 C CE  . MET A 259 ? 0.4284 0.4297 0.4511 0.0123  0.0097  0.0655  504 MET A CE  
1672 N N   . VAL A 260 ? 0.4567 0.4129 0.4012 -0.0006 -0.0017 0.0869  505 VAL A N   
1673 C CA  . VAL A 260 ? 0.4539 0.3964 0.3807 -0.0059 0.0080  0.0907  505 VAL A CA  
1674 C C   . VAL A 260 ? 0.4925 0.4186 0.4009 -0.0080 -0.0041 0.1038  505 VAL A C   
1675 O O   . VAL A 260 ? 0.5386 0.4549 0.4462 -0.0091 -0.0000 0.1105  505 VAL A O   
1676 C CB  . VAL A 260 ? 0.5130 0.4476 0.4166 -0.0119 0.0220  0.0839  505 VAL A CB  
1677 C CG1 . VAL A 260 ? 0.5554 0.4731 0.4370 -0.0195 0.0348  0.0884  505 VAL A CG1 
1678 C CG2 . VAL A 260 ? 0.4695 0.4209 0.3994 -0.0075 0.0330  0.0733  505 VAL A CG2 
1679 N N   . ILE A 261 ? 0.5102 0.4330 0.4061 -0.0088 -0.0210 0.1085  506 ILE A N   
1680 C CA  . ILE A 261 ? 0.5405 0.4492 0.4230 -0.0095 -0.0379 0.1234  506 ILE A CA  
1681 C C   . ILE A 261 ? 0.5387 0.4556 0.4593 0.0002  -0.0428 0.1295  506 ILE A C   
1682 O O   . ILE A 261 ? 0.5335 0.4349 0.4488 0.0012  -0.0471 0.1415  506 ILE A O   
1683 C CB  . ILE A 261 ? 0.5652 0.4726 0.4318 -0.0133 -0.0586 0.1266  506 ILE A CB  
1684 C CG1 . ILE A 261 ? 0.6096 0.4987 0.4271 -0.0252 -0.0515 0.1207  506 ILE A CG1 
1685 C CG2 . ILE A 261 ? 0.5813 0.4798 0.4462 -0.0114 -0.0823 0.1443  506 ILE A CG2 
1686 C CD1 . ILE A 261 ? 0.6209 0.5057 0.4166 -0.0323 -0.0711 0.1209  506 ILE A CD1 
1687 N N   . GLU A 262 ? 0.4973 0.4350 0.4545 0.0071  -0.0401 0.1210  507 GLU A N   
1688 C CA  . GLU A 262 ? 0.4532 0.3956 0.4445 0.0153  -0.0383 0.1229  507 GLU A CA  
1689 C C   . GLU A 262 ? 0.4950 0.4241 0.4807 0.0132  -0.0243 0.1233  507 GLU A C   
1690 O O   . GLU A 262 ? 0.5021 0.4192 0.4972 0.0170  -0.0262 0.1317  507 GLU A O   
1691 C CB  . GLU A 262 ? 0.4349 0.3970 0.4551 0.0196  -0.0313 0.1108  507 GLU A CB  
1692 C CG  . GLU A 262 ? 0.4437 0.4206 0.4855 0.0232  -0.0423 0.1107  507 GLU A CG  
1693 C CD  . GLU A 262 ? 0.4413 0.4311 0.5082 0.0265  -0.0304 0.0998  507 GLU A CD  
1694 O OE1 . GLU A 262 ? 0.4028 0.3990 0.4613 0.0228  -0.0245 0.0911  507 GLU A OE1 
1695 O OE2 . GLU A 262 ? 0.4052 0.3956 0.4976 0.0325  -0.0258 0.0999  507 GLU A OE2 
1696 N N   . MET A 263 ? 0.4754 0.4070 0.4501 0.0071  -0.0100 0.1141  508 MET A N   
1697 C CA  . MET A 263 ? 0.4862 0.4098 0.4627 0.0033  0.0036  0.1124  508 MET A CA  
1698 C C   . MET A 263 ? 0.5527 0.4519 0.5029 -0.0024 0.0046  0.1245  508 MET A C   
1699 O O   . MET A 263 ? 0.5669 0.4543 0.5226 -0.0046 0.0125  0.1271  508 MET A O   
1700 C CB  . MET A 263 ? 0.4842 0.4206 0.4628 -0.0016 0.0165  0.1005  508 MET A CB  
1701 C CG  . MET A 263 ? 0.4644 0.4196 0.4668 0.0030  0.0159  0.0903  508 MET A CG  
1702 S SD  . MET A 263 ? 0.4577 0.4285 0.4693 -0.0011 0.0260  0.0792  508 MET A SD  
1703 C CE  . MET A 263 ? 0.4398 0.4146 0.4363 -0.0000 0.0256  0.0775  508 MET A CE  
1704 N N   . VAL A 264 ? 0.5554 0.4436 0.4737 -0.0063 -0.0030 0.1321  509 VAL A N   
1705 C CA  . VAL A 264 ? 0.5889 0.4488 0.4729 -0.0133 -0.0029 0.1455  509 VAL A CA  
1706 C C   . VAL A 264 ? 0.6358 0.4819 0.5207 -0.0066 -0.0238 0.1623  509 VAL A C   
1707 O O   . VAL A 264 ? 0.6763 0.4996 0.5534 -0.0076 -0.0230 0.1742  509 VAL A O   
1708 C CB  . VAL A 264 ? 0.6035 0.4531 0.4440 -0.0234 0.0015  0.1443  509 VAL A CB  
1709 C CG1 . VAL A 264 ? 0.6596 0.4744 0.4548 -0.0327 0.0018  0.1596  509 VAL A CG1 
1710 C CG2 . VAL A 264 ? 0.5535 0.4167 0.4011 -0.0280 0.0238  0.1286  509 VAL A CG2 
1711 N N   . ASP A 265 ? 0.6231 0.4825 0.5205 0.0001  -0.0431 0.1643  510 ASP A N   
1712 C CA  . ASP A 265 ? 0.6394 0.4895 0.5424 0.0069  -0.0666 0.1816  510 ASP A CA  
1713 C C   . ASP A 265 ? 0.6258 0.4905 0.5835 0.0208  -0.0698 0.1809  510 ASP A C   
1714 O O   . ASP A 265 ? 0.5771 0.4329 0.5496 0.0289  -0.0862 0.1962  510 ASP A O   
1715 C CB  . ASP A 265 ? 0.6806 0.5367 0.5663 0.0039  -0.0885 0.1853  510 ASP A CB  
1716 C CG  . ASP A 265 ? 0.7860 0.6179 0.6084 -0.0106 -0.0887 0.1892  510 ASP A CG  
1717 O OD1 . ASP A 265 ? 0.8664 0.6756 0.6594 -0.0178 -0.0724 0.1921  510 ASP A OD1 
1718 O OD2 . ASP A 265 ? 0.7365 0.5705 0.5372 -0.0163 -0.1040 0.1886  510 ASP A OD2 
1719 N N   . GLY A 266 ? 0.5629 0.4482 0.5501 0.0239  -0.0546 0.1640  511 GLY A N   
1720 C CA  . GLY A 266 ? 0.5650 0.4620 0.5995 0.0354  -0.0531 0.1604  511 GLY A CA  
1721 C C   . GLY A 266 ? 0.5698 0.4920 0.6335 0.0413  -0.0643 0.1570  511 GLY A C   
1722 O O   . GLY A 266 ? 0.5053 0.4399 0.6079 0.0491  -0.0567 0.1495  511 GLY A O   
1723 N N   . GLU A 267 ? 0.5132 0.4415 0.5583 0.0363  -0.0806 0.1613  512 GLU A N   
1724 C CA  . GLU A 267 ? 0.4964 0.4487 0.5706 0.0396  -0.0926 0.1585  512 GLU A CA  
1725 C C   . GLU A 267 ? 0.5374 0.4923 0.5758 0.0283  -0.1007 0.1550  512 GLU A C   
1726 O O   . GLU A 267 ? 0.5382 0.4734 0.5302 0.0197  -0.1023 0.1594  512 GLU A O   
1727 C CB  . GLU A 267 ? 0.5217 0.4771 0.6294 0.0492  -0.1147 0.1746  512 GLU A CB  
1728 C CG  . GLU A 267 ? 0.6816 0.6172 0.7538 0.0447  -0.1391 0.1935  512 GLU A CG  
1729 C CD  . GLU A 267 ? 0.7497 0.6895 0.8603 0.0557  -0.1625 0.2099  512 GLU A CD  
1730 O OE1 . GLU A 267 ? 0.6976 0.6418 0.8544 0.0684  -0.1520 0.2085  512 GLU A OE1 
1731 O OE2 . GLU A 267 ? 0.7949 0.7346 0.8863 0.0501  -0.1858 0.2170  512 GLU A OE2 
1732 N N   . PRO A 268 ? 0.5208 0.4968 0.5780 0.0270  -0.1033 0.1462  513 PRO A N   
1733 C CA  . PRO A 268 ? 0.4768 0.4519 0.5004 0.0157  -0.1105 0.1416  513 PRO A CA  
1734 C C   . PRO A 268 ? 0.4934 0.4617 0.5009 0.0110  -0.1394 0.1557  513 PRO A C   
1735 O O   . PRO A 268 ? 0.5142 0.4851 0.5485 0.0187  -0.1560 0.1696  513 PRO A O   
1736 C CB  . PRO A 268 ? 0.4614 0.4597 0.5168 0.0164  -0.1045 0.1293  513 PRO A CB  
1737 C CG  . PRO A 268 ? 0.4496 0.4638 0.5589 0.0273  -0.1062 0.1334  513 PRO A CG  
1738 C CD  . PRO A 268 ? 0.4721 0.4709 0.5809 0.0347  -0.0975 0.1394  513 PRO A CD  
1739 N N   . PRO A 269 ? 0.5351 0.4927 0.4981 -0.0018 -0.1470 0.1527  514 PRO A N   
1740 C CA  . PRO A 269 ? 0.5821 0.5310 0.5228 -0.0092 -0.1780 0.1658  514 PRO A CA  
1741 C C   . PRO A 269 ? 0.5818 0.5589 0.5771 -0.0047 -0.2004 0.1703  514 PRO A C   
1742 O O   . PRO A 269 ? 0.5465 0.5475 0.5839 -0.0011 -0.1892 0.1588  514 PRO A O   
1743 C CB  . PRO A 269 ? 0.6197 0.5526 0.5044 -0.0251 -0.1749 0.1551  514 PRO A CB  
1744 C CG  . PRO A 269 ? 0.6075 0.5353 0.4818 -0.0238 -0.1409 0.1406  514 PRO A CG  
1745 C CD  . PRO A 269 ? 0.5836 0.5347 0.5148 -0.0102 -0.1279 0.1370  514 PRO A CD  
1746 N N   . TYR A 270 ? 0.5535 0.5276 0.5488 -0.0054 -0.2325 0.1880  515 TYR A N   
1747 C CA  . TYR A 270 ? 0.5687 0.5709 0.6166 -0.0033 -0.2550 0.1909  515 TYR A CA  
1748 C C   . TYR A 270 ? 0.5493 0.5795 0.6754 0.0135  -0.2430 0.1898  515 TYR A C   
1749 O O   . TYR A 270 ? 0.5237 0.5825 0.7025 0.0148  -0.2510 0.1865  515 TYR A O   
1750 C CB  . TYR A 270 ? 0.5781 0.5916 0.6177 -0.0181 -0.2657 0.1806  515 TYR A CB  
1751 C CG  . TYR A 270 ? 0.6482 0.6304 0.6061 -0.0362 -0.2705 0.1766  515 TYR A CG  
1752 C CD1 . TYR A 270 ? 0.7291 0.6853 0.6383 -0.0427 -0.2836 0.1850  515 TYR A CD1 
1753 C CD2 . TYR A 270 ? 0.6599 0.6362 0.5911 -0.0458 -0.2486 0.1568  515 TYR A CD2 
1754 C CE1 . TYR A 270 ? 0.7931 0.7180 0.6259 -0.0601 -0.2830 0.1789  515 TYR A CE1 
1755 C CE2 . TYR A 270 ? 0.6911 0.6363 0.5491 -0.0619 -0.2480 0.1505  515 TYR A CE2 
1756 C CZ  . TYR A 270 ? 0.8025 0.7207 0.6069 -0.0704 -0.2690 0.1639  515 TYR A CZ  
1757 O OH  . TYR A 270 ? 0.8908 0.7750 0.6192 -0.0875 -0.2634 0.1552  515 TYR A OH  
1758 N N   . PHE A 271 ? 0.5326 0.5534 0.6661 0.0251  -0.2213 0.1910  516 PHE A N   
1759 C CA  . PHE A 271 ? 0.5122 0.5538 0.7128 0.0399  -0.2044 0.1871  516 PHE A CA  
1760 C C   . PHE A 271 ? 0.5467 0.6018 0.7966 0.0489  -0.2176 0.1942  516 PHE A C   
1761 O O   . PHE A 271 ? 0.5123 0.5903 0.8241 0.0582  -0.2058 0.1884  516 PHE A O   
1762 C CB  . PHE A 271 ? 0.4979 0.5197 0.6834 0.0467  -0.1758 0.1824  516 PHE A CB  
1763 C CG  . PHE A 271 ? 0.4855 0.5226 0.7173 0.0556  -0.1482 0.1690  516 PHE A CG  
1764 C CD1 . PHE A 271 ? 0.4706 0.5248 0.7112 0.0497  -0.1334 0.1527  516 PHE A CD1 
1765 C CD2 . PHE A 271 ? 0.4970 0.5268 0.7586 0.0686  -0.1359 0.1723  516 PHE A CD2 
1766 C CE1 . PHE A 271 ? 0.4490 0.5127 0.7234 0.0558  -0.1074 0.1406  516 PHE A CE1 
1767 C CE2 . PHE A 271 ? 0.4772 0.5164 0.7736 0.0747  -0.1088 0.1582  516 PHE A CE2 
1768 C CZ  . PHE A 271 ? 0.4844 0.5404 0.7849 0.0678  -0.0948 0.1426  516 PHE A CZ  
1769 N N   . ASN A 272 ? 0.5675 0.6080 0.7905 0.0459  -0.2405 0.2065  517 ASN A N   
1770 C CA  A ASN A 272 ? 0.5818 0.6350 0.8504 0.0540  -0.2574 0.2157  517 ASN A CA  
1771 C CA  B ASN A 272 ? 0.5801 0.6336 0.8499 0.0543  -0.2569 0.2154  517 ASN A CA  
1772 C C   . ASN A 272 ? 0.6208 0.7043 0.9268 0.0474  -0.2750 0.2122  517 ASN A C   
1773 O O   . ASN A 272 ? 0.6554 0.7575 1.0162 0.0553  -0.2847 0.2174  517 ASN A O   
1774 C CB  A ASN A 272 ? 0.6445 0.6703 0.8674 0.0518  -0.2781 0.2313  517 ASN A CB  
1775 C CB  B ASN A 272 ? 0.6421 0.6684 0.8688 0.0531  -0.2769 0.2314  517 ASN A CB  
1776 C CG  A ASN A 272 ? 0.6770 0.6897 0.8359 0.0332  -0.2983 0.2327  517 ASN A CG  
1777 C CG  B ASN A 272 ? 0.6664 0.6604 0.8537 0.0574  -0.2589 0.2350  517 ASN A CG  
1778 O OD1 A ASN A 272 ? 0.7469 0.7372 0.8462 0.0237  -0.2876 0.2283  517 ASN A OD1 
1779 O OD1 B ASN A 272 ? 0.6424 0.6367 0.8566 0.0675  -0.2342 0.2290  517 ASN A OD1 
1780 N ND2 A ASN A 272 ? 0.6632 0.6889 0.8343 0.0271  -0.3263 0.2379  517 ASN A ND2 
1781 N ND2 B ASN A 272 ? 0.7353 0.6995 0.8572 0.0483  -0.2700 0.2444  517 ASN A ND2 
1782 N N   . GLU A 273 ? 0.5887 0.6769 0.8668 0.0324  -0.2791 0.2036  518 GLU A N   
1783 C CA  . GLU A 273 ? 0.5628 0.6760 0.8670 0.0221  -0.2962 0.1992  518 GLU A CA  
1784 C C   . GLU A 273 ? 0.5452 0.6880 0.9085 0.0254  -0.2744 0.1860  518 GLU A C   
1785 O O   . GLU A 273 ? 0.5362 0.6756 0.8991 0.0307  -0.2474 0.1781  518 GLU A O   
1786 C CB  . GLU A 273 ? 0.5585 0.6552 0.7949 0.0023  -0.3108 0.1956  518 GLU A CB  
1787 C CG  . GLU A 273 ? 0.6511 0.7150 0.8203 -0.0044 -0.3293 0.2068  518 GLU A CG  
1788 C CD  . GLU A 273 ? 0.7871 0.8581 0.9751 -0.0052 -0.3603 0.2190  518 GLU A CD  
1789 O OE1 . GLU A 273 ? 0.7771 0.8801 1.0350 0.0006  -0.3670 0.2190  518 GLU A OE1 
1790 O OE2 . GLU A 273 ? 0.9089 0.9528 1.0411 -0.0121 -0.3775 0.2288  518 GLU A OE2 
1791 N N   . PRO A 274 ? 0.5590 0.7303 0.9733 0.0217  -0.2846 0.1834  519 PRO A N   
1792 C CA  . PRO A 274 ? 0.4812 0.6784 0.9456 0.0213  -0.2619 0.1698  519 PRO A CA  
1793 C C   . PRO A 274 ? 0.5036 0.6938 0.9266 0.0084  -0.2530 0.1593  519 PRO A C   
1794 O O   . PRO A 274 ? 0.4949 0.6668 0.8579 -0.0051 -0.2715 0.1607  519 PRO A O   
1795 C CB  . PRO A 274 ? 0.4335 0.6584 0.9471 0.0152  -0.2811 0.1706  519 PRO A CB  
1796 C CG  . PRO A 274 ? 0.5268 0.7442 1.0388 0.0213  -0.3079 0.1866  519 PRO A CG  
1797 C CD  . PRO A 274 ? 0.5533 0.7343 0.9854 0.0182  -0.3161 0.1934  519 PRO A CD  
1798 N N   . PRO A 275 ? 0.5118 0.7136 0.9622 0.0112  -0.2234 0.1480  520 PRO A N   
1799 C CA  . PRO A 275 ? 0.5149 0.7023 0.9161 -0.0001 -0.2086 0.1363  520 PRO A CA  
1800 C C   . PRO A 275 ? 0.4692 0.6574 0.8455 -0.0203 -0.2276 0.1311  520 PRO A C   
1801 O O   . PRO A 275 ? 0.4907 0.6508 0.7976 -0.0301 -0.2253 0.1251  520 PRO A O   
1802 C CB  . PRO A 275 ? 0.4871 0.6852 0.9243 0.0051  -0.1705 0.1233  520 PRO A CB  
1803 C CG  . PRO A 275 ? 0.4856 0.6960 0.9784 0.0232  -0.1638 0.1307  520 PRO A CG  
1804 C CD  . PRO A 275 ? 0.5185 0.7374 1.0314 0.0242  -0.1951 0.1425  520 PRO A CD  
1805 N N   . LEU A 276 ? 0.4679 0.6863 0.8996 -0.0275 -0.2447 0.1321  521 LEU A N   
1806 C CA  . LEU A 276 ? 0.5144 0.7321 0.9226 -0.0490 -0.2646 0.1263  521 LEU A CA  
1807 C C   . LEU A 276 ? 0.5805 0.7731 0.9257 -0.0565 -0.2956 0.1344  521 LEU A C   
1808 O O   . LEU A 276 ? 0.5742 0.7481 0.8655 -0.0745 -0.3064 0.1279  521 LEU A O   
1809 C CB  . LEU A 276 ? 0.4867 0.7354 0.9599 -0.0544 -0.2671 0.1221  521 LEU A CB  
1810 C CG  . LEU A 276 ? 0.5310 0.7971 1.0460 -0.0590 -0.2361 0.1092  521 LEU A CG  
1811 C CD1 . LEU A 276 ? 0.5432 0.8406 1.1299 -0.0588 -0.2326 0.1069  521 LEU A CD1 
1812 C CD2 . LEU A 276 ? 0.5431 0.7894 1.0070 -0.0791 -0.2325 0.0971  521 LEU A CD2 
1813 N N   . LYS A 277 ? 0.5378 0.7260 0.8858 -0.0443 -0.3080 0.1476  522 LYS A N   
1814 C CA  . LYS A 277 ? 0.5643 0.7241 0.8465 -0.0515 -0.3333 0.1561  522 LYS A CA  
1815 C C   . LYS A 277 ? 0.5482 0.6730 0.7552 -0.0541 -0.3223 0.1541  522 LYS A C   
1816 O O   . LYS A 277 ? 0.6229 0.7210 0.7620 -0.0699 -0.3345 0.1512  522 LYS A O   
1817 C CB  . LYS A 277 ? 0.5855 0.7472 0.8908 -0.0371 -0.3463 0.1717  522 LYS A CB  
1818 C CG  . LYS A 277 ? 0.6635 0.7937 0.9006 -0.0439 -0.3701 0.1822  522 LYS A CG  
1819 C CD  . LYS A 277 ? 0.7676 0.9110 1.0354 -0.0436 -0.4002 0.1940  522 LYS A CD  
1820 C CE  . LYS A 277 ? 0.8419 0.9547 1.0563 -0.0423 -0.4178 0.2089  522 LYS A CE  
1821 N NZ  . LYS A 277 ? 0.9227 0.9972 1.0431 -0.0588 -0.4186 0.2042  522 LYS A NZ  
1822 N N   . ALA A 278 ? 0.4872 0.6104 0.7043 -0.0394 -0.2973 0.1547  523 ALA A N   
1823 C CA  . ALA A 278 ? 0.5175 0.6064 0.6650 -0.0402 -0.2787 0.1504  523 ALA A CA  
1824 C C   . ALA A 278 ? 0.5485 0.6236 0.6557 -0.0547 -0.2614 0.1316  523 ALA A C   
1825 O O   . ALA A 278 ? 0.5890 0.6323 0.6276 -0.0629 -0.2561 0.1268  523 ALA A O   
1826 C CB  . ALA A 278 ? 0.4863 0.5751 0.6551 -0.0217 -0.2474 0.1498  523 ALA A CB  
1827 N N   . MET A 279 ? 0.5148 0.6117 0.6650 -0.0581 -0.2505 0.1207  524 MET A N   
1828 C CA  . MET A 279 ? 0.5632 0.6450 0.6794 -0.0713 -0.2347 0.1039  524 MET A CA  
1829 C C   . MET A 279 ? 0.6011 0.6656 0.6699 -0.0917 -0.2609 0.1013  524 MET A C   
1830 O O   . MET A 279 ? 0.6627 0.6961 0.6709 -0.1009 -0.2489 0.0904  524 MET A O   
1831 C CB  . MET A 279 ? 0.5199 0.6269 0.6930 -0.0719 -0.2194 0.0952  524 MET A CB  
1832 C CG  . MET A 279 ? 0.5090 0.6209 0.7062 -0.0556 -0.1862 0.0928  524 MET A CG  
1833 S SD  . MET A 279 ? 0.4969 0.6390 0.7641 -0.0572 -0.1697 0.0858  524 MET A SD  
1834 C CE  . MET A 279 ? 0.5372 0.6614 0.7677 -0.0780 -0.1672 0.0720  524 MET A CE  
1835 N N   . LYS A 280 ? 0.5973 0.6809 0.6935 -0.0994 -0.2969 0.1110  525 LYS A N   
1836 C CA  . LYS A 280 ? 0.6765 0.7413 0.7216 -0.1212 -0.3264 0.1092  525 LYS A CA  
1837 C C   . LYS A 280 ? 0.7292 0.7537 0.6917 -0.1233 -0.3287 0.1137  525 LYS A C   
1838 O O   . LYS A 280 ? 0.7901 0.7821 0.6850 -0.1406 -0.3295 0.1031  525 LYS A O   
1839 C CB  . LYS A 280 ? 0.6659 0.7572 0.7580 -0.1238 -0.3575 0.1189  525 LYS A CB  
1840 C CG  . LYS A 280 ? 0.8167 0.8899 0.8628 -0.1456 -0.3805 0.1134  525 LYS A CG  
1841 C CD  . LYS A 280 ? 0.8513 0.9573 0.9587 -0.1467 -0.4045 0.1199  525 LYS A CD  
1842 C CE  . LYS A 280 ? 0.8524 0.9400 0.9122 -0.1681 -0.4311 0.1164  525 LYS A CE  
1843 N NZ  . LYS A 280 ? 0.8778 1.0005 1.0015 -0.1693 -0.4562 0.1231  525 LYS A NZ  
1844 N N   . MET A 281 ? 0.7410 0.7642 0.7067 -0.1066 -0.3265 0.1282  526 MET A N   
1845 C CA  . MET A 281 ? 0.7444 0.7286 0.6335 -0.1094 -0.3253 0.1331  526 MET A CA  
1846 C C   . MET A 281 ? 0.7557 0.7130 0.5995 -0.1087 -0.2858 0.1176  526 MET A C   
1847 O O   . MET A 281 ? 0.8347 0.7555 0.6049 -0.1210 -0.2814 0.1119  526 MET A O   
1848 C CB  . MET A 281 ? 0.7841 0.7725 0.6950 -0.0911 -0.3269 0.1507  526 MET A CB  
1849 C CG  . MET A 281 ? 0.8317 0.8443 0.7947 -0.0866 -0.3526 0.1620  526 MET A CG  
1850 S SD  . MET A 281 ? 0.8460 0.8587 0.8335 -0.0650 -0.3520 0.1811  526 MET A SD  
1851 C CE  . MET A 281 ? 0.9475 0.9101 0.8348 -0.0767 -0.3553 0.1862  526 MET A CE  
1852 N N   . ILE A 282 ? 0.6857 0.6601 0.5735 -0.0944 -0.2552 0.1101  527 ILE A N   
1853 C CA  . ILE A 282 ? 0.6347 0.5888 0.4918 -0.0926 -0.2189 0.0951  527 ILE A CA  
1854 C C   . ILE A 282 ? 0.6832 0.6177 0.5027 -0.1105 -0.2163 0.0785  527 ILE A C   
1855 O O   . ILE A 282 ? 0.7750 0.6777 0.5393 -0.1162 -0.1977 0.0683  527 ILE A O   
1856 C CB  . ILE A 282 ? 0.6147 0.5924 0.5283 -0.0762 -0.1934 0.0913  527 ILE A CB  
1857 C CG1 . ILE A 282 ? 0.6213 0.6096 0.5612 -0.0594 -0.1905 0.1048  527 ILE A CG1 
1858 C CG2 . ILE A 282 ? 0.6319 0.5922 0.5215 -0.0755 -0.1613 0.0760  527 ILE A CG2 
1859 C CD1 . ILE A 282 ? 0.6544 0.6711 0.6588 -0.0461 -0.1766 0.1039  527 ILE A CD1 
1860 N N   . ARG A 283 ? 0.6835 0.6360 0.5352 -0.1199 -0.2328 0.0747  528 ARG A N   
1861 C CA  . ARG A 283 ? 0.7241 0.6572 0.5454 -0.1376 -0.2292 0.0577  528 ARG A CA  
1862 C C   . ARG A 283 ? 0.7750 0.6746 0.5233 -0.1576 -0.2491 0.0553  528 ARG A C   
1863 O O   . ARG A 283 ? 0.8322 0.6975 0.5272 -0.1684 -0.2319 0.0395  528 ARG A O   
1864 C CB  . ARG A 283 ? 0.7580 0.7203 0.6364 -0.1443 -0.2423 0.0551  528 ARG A CB  
1865 C CG  . ARG A 283 ? 0.7501 0.6917 0.6012 -0.1644 -0.2403 0.0377  528 ARG A CG  
1866 C CD  . ARG A 283 ? 0.7387 0.7115 0.6472 -0.1744 -0.2601 0.0380  528 ARG A CD  
1867 N NE  . ARG A 283 ? 0.7577 0.7494 0.6788 -0.1823 -0.3020 0.0513  528 ARG A NE  
1868 C CZ  . ARG A 283 ? 0.7984 0.8277 0.7850 -0.1876 -0.3248 0.0567  528 ARG A CZ  
1869 N NH1 . ARG A 283 ? 0.7545 0.8041 0.7952 -0.1871 -0.3063 0.0491  528 ARG A NH1 
1870 N NH2 . ARG A 283 ? 0.8082 0.8533 0.8076 -0.1905 -0.3601 0.0697  528 ARG A NH2 
1871 N N   . ASP A 284 ? 0.7827 0.6892 0.5258 -0.1630 -0.2852 0.0707  529 ASP A N   
1872 C CA  . ASP A 284 ? 0.8715 0.7470 0.5442 -0.1862 -0.3115 0.0693  529 ASP A CA  
1873 C C   . ASP A 284 ? 0.9357 0.7758 0.5414 -0.1845 -0.3009 0.0748  529 ASP A C   
1874 O O   . ASP A 284 ? 1.0182 0.8239 0.5610 -0.2004 -0.3010 0.0670  529 ASP A O   
1875 C CB  . ASP A 284 ? 0.8869 0.7904 0.6038 -0.1886 -0.3462 0.0816  529 ASP A CB  
1876 C CG  . ASP A 284 ? 0.9120 0.8467 0.6898 -0.1954 -0.3552 0.0737  529 ASP A CG  
1877 O OD1 . ASP A 284 ? 0.9134 0.8372 0.6810 -0.2046 -0.3374 0.0562  529 ASP A OD1 
1878 O OD2 . ASP A 284 ? 0.9055 0.8744 0.7426 -0.1917 -0.3781 0.0845  529 ASP A OD2 
1879 N N   . ASN A 285 ? 0.8939 0.7403 0.5121 -0.1666 -0.2895 0.0874  530 ASN A N   
1880 C CA  . ASN A 285 ? 0.9573 0.7735 0.5213 -0.1653 -0.2798 0.0945  530 ASN A CA  
1881 C C   . ASN A 285 ? 0.9834 0.7730 0.5064 -0.1626 -0.2399 0.0827  530 ASN A C   
1882 O O   . ASN A 285 ? 0.8990 0.7034 0.4627 -0.1516 -0.2117 0.0704  530 ASN A O   
1883 C CB  . ASN A 285 ? 0.9082 0.7459 0.5143 -0.1477 -0.2925 0.1169  530 ASN A CB  
1884 C CG  . ASN A 285 ? 0.8994 0.7587 0.5423 -0.1493 -0.3288 0.1290  530 ASN A CG  
1885 O OD1 . ASN A 285 ? 1.0007 0.8527 0.6231 -0.1660 -0.3462 0.1225  530 ASN A OD1 
1886 N ND2 . ASN A 285 ? 0.8993 0.7840 0.5973 -0.1317 -0.3392 0.1461  530 ASN A ND2 
1887 N N   . LEU A 286 ? 0.9861 0.7418 0.4495 -0.1678 -0.2269 0.0839  531 LEU A N   
1888 C CA  . LEU A 286 ? 0.9753 0.7077 0.4053 -0.1640 -0.1870 0.0750  531 LEU A CA  
1889 C C   . LEU A 286 ? 0.8804 0.6459 0.3798 -0.1396 -0.1705 0.0831  531 LEU A C   
1890 O O   . LEU A 286 ? 0.8593 0.6540 0.4090 -0.1289 -0.1931 0.0989  531 LEU A O   
1891 C CB  . LEU A 286 ? 1.0220 0.7201 0.3940 -0.1719 -0.1762 0.0776  531 LEU A CB  
1892 C CG  . LEU A 286 ? 1.1052 0.7738 0.4229 -0.1931 -0.1874 0.0685  531 LEU A CG  
1893 C CD1 . LEU A 286 ? 1.1561 0.8353 0.4831 -0.1967 -0.2298 0.0868  531 LEU A CD1 
1894 C CD2 . LEU A 286 ? 1.1699 0.7963 0.4229 -0.2023 -0.1545 0.0585  531 LEU A CD2 
1895 N N   . PRO A 287 ? 0.9229 0.6846 0.4290 -0.1307 -0.1312 0.0716  532 PRO A N   
1896 C CA  . PRO A 287 ? 0.8187 0.6107 0.3884 -0.1096 -0.1160 0.0773  532 PRO A CA  
1897 C C   . PRO A 287 ? 0.8102 0.6080 0.3881 -0.1030 -0.1323 0.0987  532 PRO A C   
1898 O O   . PRO A 287 ? 0.8245 0.5936 0.3465 -0.1133 -0.1399 0.1082  532 PRO A O   
1899 C CB  . PRO A 287 ? 0.8472 0.6238 0.4016 -0.1067 -0.0750 0.0639  532 PRO A CB  
1900 C CG  . PRO A 287 ? 0.9229 0.6737 0.4356 -0.1206 -0.0655 0.0457  532 PRO A CG  
1901 C CD  . PRO A 287 ? 0.9823 0.7135 0.4441 -0.1394 -0.0987 0.0514  532 PRO A CD  
1902 N N   . PRO A 288 ? 0.7296 0.5603 0.3734 -0.0866 -0.1370 0.1069  533 PRO A N   
1903 C CA  . PRO A 288 ? 0.7755 0.6102 0.4324 -0.0791 -0.1526 0.1272  533 PRO A CA  
1904 C C   . PRO A 288 ? 0.7844 0.5971 0.4112 -0.0782 -0.1288 0.1308  533 PRO A C   
1905 O O   . PRO A 288 ? 0.7543 0.5649 0.3812 -0.0762 -0.0968 0.1177  533 PRO A O   
1906 C CB  . PRO A 288 ? 0.6758 0.5486 0.4112 -0.0619 -0.1531 0.1287  533 PRO A CB  
1907 C CG  . PRO A 288 ? 0.6732 0.5556 0.4261 -0.0587 -0.1254 0.1099  533 PRO A CG  
1908 C CD  . PRO A 288 ? 0.6702 0.5314 0.3754 -0.0742 -0.1239 0.0973  533 PRO A CD  
1909 N N   . ARG A 289 ? 0.7701 0.5667 0.3742 -0.0797 -0.1454 0.1499  534 ARG A N   
1910 C CA  . ARG A 289 ? 0.8182 0.5892 0.3879 -0.0820 -0.1251 0.1561  534 ARG A CA  
1911 C C   . ARG A 289 ? 0.8286 0.6166 0.4512 -0.0660 -0.1210 0.1665  534 ARG A C   
1912 O O   . ARG A 289 ? 0.7705 0.5798 0.4406 -0.0548 -0.1428 0.1763  534 ARG A O   
1913 C CB  . ARG A 289 ? 0.8981 0.6406 0.4146 -0.0934 -0.1390 0.1648  534 ARG A CB  
1914 C CG  . ARG A 289 ? 0.9907 0.7139 0.4546 -0.1105 -0.1427 0.1522  534 ARG A CG  
1915 C CD  . ARG A 289 ? 1.1154 0.8225 0.5491 -0.1183 -0.1697 0.1639  534 ARG A CD  
1916 N NE  . ARG A 289 ? 1.2083 0.9428 0.6919 -0.1091 -0.2062 0.1764  534 ARG A NE  
1917 C CZ  . ARG A 289 ? 1.2701 1.0022 0.7582 -0.1059 -0.2308 0.1936  534 ARG A CZ  
1918 N NH1 . ARG A 289 ? 1.3279 1.0292 0.7687 -0.1120 -0.2245 0.2017  534 ARG A NH1 
1919 N NH2 . ARG A 289 ? 1.2410 1.0016 0.7835 -0.0965 -0.2606 0.2029  534 ARG A NH2 
1920 N N   . LEU A 290 ? 0.7991 0.5768 0.4148 -0.0657 -0.0912 0.1633  535 LEU A N   
1921 C CA  . LEU A 290 ? 0.7335 0.5150 0.3818 -0.0552 -0.0877 0.1749  535 LEU A CA  
1922 C C   . LEU A 290 ? 0.7702 0.5309 0.3959 -0.0563 -0.1130 0.1965  535 LEU A C   
1923 O O   . LEU A 290 ? 0.8442 0.5830 0.4199 -0.0674 -0.1171 0.1977  535 LEU A O   
1924 C CB  . LEU A 290 ? 0.7352 0.5062 0.3738 -0.0590 -0.0522 0.1676  535 LEU A CB  
1925 C CG  . LEU A 290 ? 0.7074 0.5042 0.3822 -0.0545 -0.0272 0.1465  535 LEU A CG  
1926 C CD1 . LEU A 290 ? 0.7516 0.5335 0.4016 -0.0638 0.0063  0.1378  535 LEU A CD1 
1927 C CD2 . LEU A 290 ? 0.6498 0.4748 0.3887 -0.0401 -0.0275 0.1457  535 LEU A CD2 
1928 N N   . LYS A 291 ? 0.7455 0.5194 0.4198 -0.0422 -0.1256 0.2081  536 LYS A N   
1929 C CA  . LYS A 291 ? 0.8384 0.5980 0.5053 -0.0390 -0.1419 0.2237  536 LYS A CA  
1930 C C   . LYS A 291 ? 0.8425 0.5734 0.4780 -0.0444 -0.1192 0.2291  536 LYS A C   
1931 O O   . LYS A 291 ? 0.8991 0.6078 0.5022 -0.0484 -0.1275 0.2405  536 LYS A O   
1932 C CB  . LYS A 291 ? 0.8691 0.6506 0.6013 -0.0211 -0.1603 0.2328  536 LYS A CB  
1933 C CG  . LYS A 291 ? 0.9351 0.7185 0.7064 -0.0106 -0.1419 0.2341  536 LYS A CG  
1934 C CD  . LYS A 291 ? 0.9649 0.7638 0.7958 0.0070  -0.1576 0.2424  536 LYS A CD  
1935 C CE  . LYS A 291 ? 0.9776 0.7686 0.8386 0.0157  -0.1383 0.2439  536 LYS A CE  
1936 N NZ  . LYS A 291 ? 0.9810 0.7786 0.8924 0.0324  -0.1503 0.2517  536 LYS A NZ  
1937 N N   . ASN A 292 ? 0.8927 0.6238 0.5371 -0.0460 -0.0905 0.2209  537 ASN A N   
1938 C CA  . ASN A 292 ? 0.9875 0.6949 0.6096 -0.0529 -0.0652 0.2237  537 ASN A CA  
1939 C C   . ASN A 292 ? 0.8936 0.5937 0.4807 -0.0674 -0.0353 0.2083  537 ASN A C   
1940 O O   . ASN A 292 ? 0.8638 0.5675 0.4678 -0.0695 -0.0088 0.2005  537 ASN A O   
1941 C CB  . ASN A 292 ? 1.0189 0.7323 0.6887 -0.0436 -0.0549 0.2266  537 ASN A CB  
1942 C CG  . ASN A 292 ? 0.9995 0.7179 0.7087 -0.0277 -0.0787 0.2399  537 ASN A CG  
1943 O OD1 . ASN A 292 ? 0.9950 0.7326 0.7560 -0.0164 -0.0815 0.2373  537 ASN A OD1 
1944 N ND2 . ASN A 292 ? 1.0446 0.7456 0.7311 -0.0267 -0.0946 0.2539  537 ASN A ND2 
1945 N N   . LEU A 293 ? 0.8936 0.5836 0.4349 -0.0777 -0.0382 0.2023  538 LEU A N   
1946 C CA  . LEU A 293 ? 0.9247 0.6073 0.4366 -0.0902 -0.0068 0.1854  538 LEU A CA  
1947 C C   . LEU A 293 ? 0.9453 0.6113 0.4461 -0.0978 0.0229  0.1861  538 LEU A C   
1948 O O   . LEU A 293 ? 0.9078 0.5794 0.4167 -0.1029 0.0548  0.1720  538 LEU A O   
1949 C CB  . LEU A 293 ? 0.9926 0.6602 0.4529 -0.1010 -0.0153 0.1790  538 LEU A CB  
1950 C CG  . LEU A 293 ? 0.9986 0.6554 0.4274 -0.1133 0.0178  0.1594  538 LEU A CG  
1951 C CD1 . LEU A 293 ? 0.9410 0.6219 0.4094 -0.1073 0.0380  0.1450  538 LEU A CD1 
1952 C CD2 . LEU A 293 ? 1.0184 0.6581 0.3976 -0.1238 0.0039  0.1528  538 LEU A CD2 
1953 N N   . HIS A 294 ? 0.9197 0.5669 0.4074 -0.0982 0.0134  0.2024  539 HIS A N   
1954 C CA  . HIS A 294 ? 0.9417 0.5728 0.4215 -0.1063 0.0404  0.2043  539 HIS A CA  
1955 C C   . HIS A 294 ? 0.9061 0.5544 0.4390 -0.1010 0.0579  0.2011  539 HIS A C   
1956 O O   . HIS A 294 ? 1.0562 0.6959 0.5908 -0.1091 0.0826  0.1998  539 HIS A O   
1957 C CB  . HIS A 294 ? 1.0790 0.6836 0.5316 -0.1074 0.0237  0.2245  539 HIS A CB  
1958 C CG  . HIS A 294 ? 1.0388 0.6509 0.5259 -0.0915 -0.0073 0.2410  539 HIS A CG  
1959 N ND1 . HIS A 294 ? 1.0451 0.6729 0.5448 -0.0817 -0.0382 0.2431  539 HIS A ND1 
1960 C CD2 . HIS A 294 ? 1.0196 0.6255 0.5348 -0.0835 -0.0105 0.2549  539 HIS A CD2 
1961 C CE1 . HIS A 294 ? 1.0484 0.6814 0.5859 -0.0672 -0.0581 0.2572  539 HIS A CE1 
1962 N NE2 . HIS A 294 ? 1.0166 0.6344 0.5622 -0.0676 -0.0415 0.2646  539 HIS A NE2 
1963 N N   . LYS A 295 ? 0.8275 0.4989 0.4035 -0.0892 0.0462  0.1989  540 LYS A N   
1964 C CA  . LYS A 295 ? 0.8514 0.5363 0.4755 -0.0851 0.0604  0.1952  540 LYS A CA  
1965 C C   . LYS A 295 ? 0.9175 0.6376 0.5789 -0.0831 0.0788  0.1724  540 LYS A C   
1966 O O   . LYS A 295 ? 0.9149 0.6624 0.6317 -0.0753 0.0823  0.1638  540 LYS A O   
1967 C CB  . LYS A 295 ? 0.8377 0.5321 0.5011 -0.0694 0.0338  0.2048  540 LYS A CB  
1968 C CG  . LYS A 295 ? 0.9018 0.5701 0.5539 -0.0665 0.0187  0.2254  540 LYS A CG  
1969 C CD  . LYS A 295 ? 0.9575 0.6336 0.6536 -0.0497 -0.0041 0.2338  540 LYS A CD  
1970 C CE  . LYS A 295 ? 0.9856 0.6646 0.7248 -0.0467 0.0121  0.2286  540 LYS A CE  
1971 N NZ  . LYS A 295 ? 0.9738 0.6867 0.7482 -0.0489 0.0334  0.2043  540 LYS A NZ  
1972 N N   . VAL A 296 ? 0.8455 0.5662 0.4800 -0.0892 0.0892  0.1617  541 VAL A N   
1973 C CA  . VAL A 296 ? 0.7469 0.5008 0.4206 -0.0856 0.1064  0.1407  541 VAL A CA  
1974 C C   . VAL A 296 ? 0.7499 0.4899 0.3967 -0.0997 0.1411  0.1320  541 VAL A C   
1975 O O   . VAL A 296 ? 0.7831 0.4915 0.3721 -0.1107 0.1455  0.1369  541 VAL A O   
1976 C CB  . VAL A 296 ? 0.8039 0.5765 0.4850 -0.0762 0.0878  0.1325  541 VAL A CB  
1977 C CG1 . VAL A 296 ? 0.7680 0.5521 0.4742 -0.0637 0.0562  0.1419  541 VAL A CG1 
1978 C CG2 . VAL A 296 ? 0.7922 0.5380 0.4105 -0.0864 0.0874  0.1322  541 VAL A CG2 
1979 N N   . SER A 297 ? 0.7317 0.4996 0.4276 -0.0982 0.1637  0.1176  542 SER A N   
1980 C CA  . SER A 297 ? 0.7585 0.5198 0.4442 -0.1098 0.2003  0.1071  542 SER A CA  
1981 C C   . SER A 297 ? 0.7694 0.5250 0.4263 -0.1098 0.2061  0.0956  542 SER A C   
1982 O O   . SER A 297 ? 0.7272 0.4973 0.3945 -0.0988 0.1835  0.0920  542 SER A O   
1983 C CB  . SER A 297 ? 0.6832 0.4822 0.4408 -0.1063 0.2178  0.0952  542 SER A CB  
1984 O OG  . SER A 297 ? 0.6867 0.5205 0.4895 -0.0912 0.2036  0.0848  542 SER A OG  
1985 N N   . PRO A 298 ? 0.7969 0.5373 0.4282 -0.1194 0.2315  0.0858  543 PRO A N   
1986 C CA  . PRO A 298 ? 0.8091 0.5435 0.4188 -0.1190 0.2402  0.0712  543 PRO A CA  
1987 C C   . PRO A 298 ? 0.7947 0.5623 0.4598 -0.1069 0.2477  0.0592  543 PRO A C   
1988 O O   . PRO A 298 ? 0.8050 0.5713 0.4585 -0.1017 0.2393  0.0509  543 PRO A O   
1989 C CB  . PRO A 298 ? 0.8344 0.5520 0.4261 -0.1299 0.2711  0.0606  543 PRO A CB  
1990 C CG  . PRO A 298 ? 0.8648 0.5645 0.4341 -0.1386 0.2658  0.0755  543 PRO A CG  
1991 C CD  . PRO A 298 ? 0.8155 0.5401 0.4333 -0.1308 0.2509  0.0868  543 PRO A CD  
1992 N N   . SER A 299 ? 0.7294 0.5328 0.4650 -0.0997 0.2542  0.0566  544 SER A N   
1993 C CA  . SER A 299 ? 0.6842 0.5266 0.4848 -0.0839 0.2485  0.0458  544 SER A CA  
1994 C C   . SER A 299 ? 0.6562 0.5094 0.4615 -0.0720 0.2098  0.0515  544 SER A C   
1995 O O   . SER A 299 ? 0.6427 0.5059 0.4603 -0.0627 0.2028  0.0433  544 SER A O   
1996 C CB  . SER A 299 ? 0.7123 0.5889 0.5826 -0.0813 0.2588  0.0439  544 SER A CB  
1997 O OG  . SER A 299 ? 0.6891 0.6016 0.6197 -0.0666 0.2514  0.0353  544 SER A OG  
1998 N N   . LEU A 300 ? 0.6477 0.4982 0.4463 -0.0721 0.1862  0.0654  545 LEU A N   
1999 C CA  A LEU A 300 ? 0.6070 0.4674 0.4121 -0.0616 0.1528  0.0704  545 LEU A CA  
2000 C CA  B LEU A 300 ? 0.6035 0.4638 0.4085 -0.0616 0.1528  0.0705  545 LEU A CA  
2001 C C   . LEU A 300 ? 0.6352 0.4725 0.3892 -0.0642 0.1410  0.0707  545 LEU A C   
2002 O O   . LEU A 300 ? 0.6320 0.4817 0.3991 -0.0558 0.1257  0.0659  545 LEU A O   
2003 C CB  A LEU A 300 ? 0.6149 0.4738 0.4246 -0.0610 0.1340  0.0845  545 LEU A CB  
2004 C CB  B LEU A 300 ? 0.6163 0.4747 0.4255 -0.0613 0.1343  0.0845  545 LEU A CB  
2005 C CG  A LEU A 300 ? 0.5732 0.4482 0.4051 -0.0491 0.1044  0.0883  545 LEU A CG  
2006 C CG  B LEU A 300 ? 0.5861 0.4545 0.4066 -0.0507 0.1031  0.0903  545 LEU A CG  
2007 C CD1 A LEU A 300 ? 0.5439 0.4275 0.4056 -0.0467 0.0973  0.0948  545 LEU A CD1 
2008 C CD1 B LEU A 300 ? 0.5502 0.4481 0.4120 -0.0397 0.0978  0.0794  545 LEU A CD1 
2009 C CD2 A LEU A 300 ? 0.6286 0.4841 0.4195 -0.0497 0.0827  0.0970  545 LEU A CD2 
2010 C CD2 B LEU A 300 ? 0.5728 0.4415 0.4101 -0.0492 0.0929  0.1008  545 LEU A CD2 
2011 N N   . LYS A 301 ? 0.6918 0.4938 0.3849 -0.0775 0.1474  0.0764  546 LYS A N   
2012 C CA  . LYS A 301 ? 0.7297 0.5072 0.3686 -0.0832 0.1345  0.0760  546 LYS A CA  
2013 C C   . LYS A 301 ? 0.7609 0.5412 0.4034 -0.0814 0.1507  0.0576  546 LYS A C   
2014 O O   . LYS A 301 ? 0.7401 0.5205 0.3744 -0.0785 0.1327  0.0539  546 LYS A O   
2015 C CB  . LYS A 301 ? 0.8129 0.5476 0.3788 -0.1002 0.1406  0.0852  546 LYS A CB  
2016 C CG  . LYS A 301 ? 0.8788 0.5850 0.3810 -0.1092 0.1227  0.0858  546 LYS A CG  
2017 C CD  . LYS A 301 ? 0.8654 0.5894 0.3882 -0.0995 0.0816  0.0945  546 LYS A CD  
2018 C CE  . LYS A 301 ? 0.8948 0.5898 0.3534 -0.1112 0.0570  0.1000  546 LYS A CE  
2019 N NZ  . LYS A 301 ? 0.9661 0.6420 0.3858 -0.1213 0.0743  0.0816  546 LYS A NZ  
2020 N N   . GLY A 302 ? 0.7232 0.5053 0.3811 -0.0833 0.1858  0.0457  547 GLY A N   
2021 C CA  . GLY A 302 ? 0.7484 0.5328 0.4178 -0.0791 0.2035  0.0282  547 GLY A CA  
2022 C C   . GLY A 302 ? 0.6935 0.5120 0.4220 -0.0622 0.1859  0.0251  547 GLY A C   
2023 O O   . GLY A 302 ? 0.6912 0.5051 0.4147 -0.0588 0.1824  0.0160  547 GLY A O   
2024 N N   . PHE A 303 ? 0.6732 0.5231 0.4547 -0.0529 0.1750  0.0324  548 PHE A N   
2025 C CA  . PHE A 303 ? 0.6244 0.5030 0.4536 -0.0387 0.1552  0.0322  548 PHE A CA  
2026 C C   . PHE A 303 ? 0.6723 0.5433 0.4760 -0.0384 0.1264  0.0372  548 PHE A C   
2027 O O   . PHE A 303 ? 0.6224 0.4957 0.4327 -0.0332 0.1205  0.0304  548 PHE A O   
2028 C CB  . PHE A 303 ? 0.5873 0.4937 0.4635 -0.0331 0.1477  0.0397  548 PHE A CB  
2029 C CG  . PHE A 303 ? 0.5377 0.4714 0.4587 -0.0204 0.1290  0.0398  548 PHE A CG  
2030 C CD1 . PHE A 303 ? 0.5259 0.4775 0.4876 -0.0113 0.1376  0.0318  548 PHE A CD1 
2031 C CD2 . PHE A 303 ? 0.5478 0.4879 0.4708 -0.0176 0.1042  0.0486  548 PHE A CD2 
2032 C CE1 . PHE A 303 ? 0.4888 0.4611 0.4842 -0.0011 0.1195  0.0337  548 PHE A CE1 
2033 C CE2 . PHE A 303 ? 0.4768 0.4381 0.4342 -0.0081 0.0899  0.0483  548 PHE A CE2 
2034 C CZ  . PHE A 303 ? 0.4637 0.4396 0.4536 -0.0005 0.0968  0.0414  548 PHE A CZ  
2035 N N   . LEU A 304 ? 0.6618 0.5231 0.4388 -0.0442 0.1083  0.0497  549 LEU A N   
2036 C CA  . LEU A 304 ? 0.6660 0.5236 0.4261 -0.0443 0.0799  0.0556  549 LEU A CA  
2037 C C   . LEU A 304 ? 0.6677 0.5023 0.3855 -0.0523 0.0806  0.0468  549 LEU A C   
2038 O O   . LEU A 304 ? 0.6890 0.5282 0.4102 -0.0504 0.0619  0.0455  549 LEU A O   
2039 C CB  . LEU A 304 ? 0.6689 0.5158 0.4062 -0.0493 0.0626  0.0713  549 LEU A CB  
2040 C CG  . LEU A 304 ? 0.6615 0.5125 0.3979 -0.0471 0.0309  0.0797  549 LEU A CG  
2041 C CD1 . LEU A 304 ? 0.6103 0.4922 0.4019 -0.0344 0.0229  0.0773  549 LEU A CD1 
2042 C CD2 . LEU A 304 ? 0.6695 0.5082 0.3873 -0.0503 0.0144  0.0969  549 LEU A CD2 
2043 N N   . ASP A 305 ? 0.6990 0.5069 0.3754 -0.0628 0.1033  0.0398  550 ASP A N   
2044 C CA  . ASP A 305 ? 0.7613 0.5413 0.3898 -0.0730 0.1066  0.0291  550 ASP A CA  
2045 C C   . ASP A 305 ? 0.7747 0.5642 0.4344 -0.0644 0.1155  0.0147  550 ASP A C   
2046 O O   . ASP A 305 ? 0.7798 0.5507 0.4094 -0.0713 0.1098  0.0066  550 ASP A O   
2047 C CB  . ASP A 305 ? 0.8000 0.5460 0.3749 -0.0869 0.1347  0.0232  550 ASP A CB  
2048 C CG  . ASP A 305 ? 0.9031 0.6237 0.4196 -0.1007 0.1192  0.0379  550 ASP A CG  
2049 O OD1 . ASP A 305 ? 0.8562 0.5865 0.3773 -0.0984 0.0848  0.0521  550 ASP A OD1 
2050 O OD2 . ASP A 305 ? 0.9565 0.6460 0.4227 -0.1139 0.1419  0.0357  550 ASP A OD2 
2051 N N   . ARG A 306 ? 0.7067 0.5230 0.4249 -0.0504 0.1279  0.0121  551 ARG A N   
2052 C CA  . ARG A 306 ? 0.6688 0.4935 0.4197 -0.0405 0.1334  0.0017  551 ARG A CA  
2053 C C   . ARG A 306 ? 0.6593 0.5046 0.4388 -0.0329 0.1054  0.0085  551 ARG A C   
2054 O O   . ARG A 306 ? 0.6440 0.4896 0.4397 -0.0274 0.1056  0.0016  551 ARG A O   
2055 C CB  . ARG A 306 ? 0.6313 0.4747 0.4332 -0.0289 0.1574  -0.0030 551 ARG A CB  
2056 C CG  . ARG A 306 ? 0.6905 0.5158 0.4743 -0.0356 0.1923  -0.0124 551 ARG A CG  
2057 C CD  . ARG A 306 ? 0.7865 0.5782 0.5333 -0.0417 0.2123  -0.0287 551 ARG A CD  
2058 N NE  . ARG A 306 ? 0.8097 0.6096 0.5985 -0.0280 0.2168  -0.0369 551 ARG A NE  
2059 C CZ  . ARG A 306 ? 0.8333 0.6176 0.6047 -0.0290 0.2048  -0.0422 551 ARG A CZ  
2060 N NH1 . ARG A 306 ? 0.8322 0.5951 0.5474 -0.0438 0.1865  -0.0411 551 ARG A NH1 
2061 N NH2 . ARG A 306 ? 0.8125 0.6020 0.6239 -0.0158 0.2102  -0.0479 551 ARG A NH2 
2062 N N   . LEU A 307 ? 0.6175 0.4774 0.4034 -0.0328 0.0835  0.0218  552 LEU A N   
2063 C CA  . LEU A 307 ? 0.6167 0.4957 0.4294 -0.0269 0.0600  0.0280  552 LEU A CA  
2064 C C   . LEU A 307 ? 0.6193 0.4860 0.4009 -0.0368 0.0391  0.0298  552 LEU A C   
2065 O O   . LEU A 307 ? 0.6164 0.4863 0.4087 -0.0361 0.0298  0.0262  552 LEU A O   
2066 C CB  . LEU A 307 ? 0.5545 0.4555 0.3953 -0.0210 0.0500  0.0398  552 LEU A CB  
2067 C CG  . LEU A 307 ? 0.6229 0.5383 0.4943 -0.0143 0.0656  0.0400  552 LEU A CG  
2068 C CD1 . LEU A 307 ? 0.5486 0.4789 0.4384 -0.0118 0.0536  0.0505  552 LEU A CD1 
2069 C CD2 . LEU A 307 ? 0.5956 0.5249 0.5031 -0.0043 0.0715  0.0340  552 LEU A CD2 
2070 N N   . LEU A 308 ? 0.6360 0.4885 0.3802 -0.0468 0.0299  0.0364  553 LEU A N   
2071 C CA  . LEU A 308 ? 0.6772 0.5217 0.3962 -0.0566 0.0044  0.0407  553 LEU A CA  
2072 C C   . LEU A 308 ? 0.7174 0.5303 0.3849 -0.0708 0.0101  0.0286  553 LEU A C   
2073 O O   . LEU A 308 ? 0.7506 0.5395 0.3663 -0.0842 0.0029  0.0311  553 LEU A O   
2074 C CB  . LEU A 308 ? 0.6837 0.5277 0.3892 -0.0597 -0.0132 0.0564  553 LEU A CB  
2075 C CG  . LEU A 308 ? 0.6531 0.5243 0.4079 -0.0466 -0.0182 0.0670  553 LEU A CG  
2076 C CD1 . LEU A 308 ? 0.6149 0.4792 0.3542 -0.0490 -0.0326 0.0826  553 LEU A CD1 
2077 C CD2 . LEU A 308 ? 0.6295 0.5255 0.4283 -0.0394 -0.0323 0.0670  553 LEU A CD2 
2078 N N   . VAL A 309 ? 0.6805 0.4900 0.3598 -0.0682 0.0237  0.0152  554 VAL A N   
2079 C CA  . VAL A 309 ? 0.7307 0.5081 0.3652 -0.0813 0.0312  0.0007  554 VAL A CA  
2080 C C   . VAL A 309 ? 0.7670 0.5497 0.4117 -0.0863 0.0091  -0.0013 554 VAL A C   
2081 O O   . VAL A 309 ? 0.7180 0.5224 0.4103 -0.0756 0.0077  -0.0002 554 VAL A O   
2082 C CB  . VAL A 309 ? 0.7290 0.4941 0.3708 -0.0747 0.0659  -0.0141 554 VAL A CB  
2083 C CG1 . VAL A 309 ? 0.8159 0.5431 0.4096 -0.0886 0.0765  -0.0311 554 VAL A CG1 
2084 C CG2 . VAL A 309 ? 0.7421 0.5065 0.3817 -0.0708 0.0889  -0.0120 554 VAL A CG2 
2085 N N   . ARG A 310 ? 0.7769 0.5391 0.3755 -0.1042 -0.0090 -0.0037 555 ARG A N   
2086 C CA  . ARG A 310 ? 0.8228 0.5923 0.4340 -0.1118 -0.0323 -0.0052 555 ARG A CA  
2087 C C   . ARG A 310 ? 0.8064 0.5642 0.4292 -0.1105 -0.0142 -0.0209 555 ARG A C   
2088 O O   . ARG A 310 ? 0.7913 0.5684 0.4564 -0.1055 -0.0218 -0.0191 555 ARG A O   
2089 C CB  . ARG A 310 ? 0.8762 0.6248 0.4333 -0.1332 -0.0576 -0.0049 555 ARG A CB  
2090 C CG  . ARG A 310 ? 0.8942 0.6590 0.4519 -0.1331 -0.0847 0.0148  555 ARG A CG  
2091 C CD  . ARG A 310 ? 0.9267 0.6719 0.4327 -0.1548 -0.1156 0.0170  555 ARG A CD  
2092 N NE  . ARG A 310 ? 1.0245 0.7751 0.5450 -0.1655 -0.1325 0.0085  555 ARG A NE  
2093 C CZ  . ARG A 310 ? 1.0338 0.8202 0.6109 -0.1619 -0.1572 0.0177  555 ARG A CZ  
2094 N NH1 . ARG A 310 ? 0.9708 0.7895 0.5947 -0.1465 -0.1673 0.0352  555 ARG A NH1 
2095 N NH2 . ARG A 310 ? 1.0797 0.8684 0.6679 -0.1743 -0.1697 0.0085  555 ARG A NH2 
2096 N N   . ASP A 311 ? 0.8246 0.5486 0.4102 -0.1151 0.0113  -0.0362 556 ASP A N   
2097 C CA  . ASP A 311 ? 0.8254 0.5331 0.4219 -0.1125 0.0309  -0.0510 556 ASP A CA  
2098 C C   . ASP A 311 ? 0.7941 0.5250 0.4486 -0.0894 0.0481  -0.0460 556 ASP A C   
2099 O O   . ASP A 311 ? 0.8166 0.5478 0.4760 -0.0792 0.0695  -0.0462 556 ASP A O   
2100 C CB  . ASP A 311 ? 0.9058 0.5681 0.4463 -0.1233 0.0562  -0.0698 556 ASP A CB  
2101 C CG  . ASP A 311 ? 0.9520 0.5906 0.5003 -0.1217 0.0763  -0.0864 556 ASP A CG  
2102 O OD1 . ASP A 311 ? 0.9495 0.6070 0.5480 -0.1100 0.0729  -0.0816 556 ASP A OD1 
2103 O OD2 . ASP A 311 ? 1.0631 0.6603 0.5641 -0.1328 0.0967  -0.1044 556 ASP A OD2 
2104 N N   . PRO A 312 ? 0.7977 0.5473 0.4954 -0.0819 0.0397  -0.0412 557 PRO A N   
2105 C CA  . PRO A 312 ? 0.7833 0.5541 0.5307 -0.0612 0.0516  -0.0341 557 PRO A CA  
2106 C C   . PRO A 312 ? 0.7901 0.5404 0.5422 -0.0512 0.0810  -0.0448 557 PRO A C   
2107 O O   . PRO A 312 ? 0.7481 0.5158 0.5360 -0.0346 0.0915  -0.0387 557 PRO A O   
2108 C CB  . PRO A 312 ? 0.7668 0.5522 0.5457 -0.0605 0.0365  -0.0283 557 PRO A CB  
2109 C CG  . PRO A 312 ? 0.7788 0.5416 0.5277 -0.0795 0.0271  -0.0384 557 PRO A CG  
2110 C CD  . PRO A 312 ? 0.8352 0.5860 0.5373 -0.0935 0.0193  -0.0419 557 PRO A CD  
2111 N N   . ALA A 313 ? 0.7957 0.5091 0.5143 -0.0611 0.0946  -0.0611 558 ALA A N   
2112 C CA  . ALA A 313 ? 0.8516 0.5435 0.5769 -0.0506 0.1260  -0.0725 558 ALA A CA  
2113 C C   . ALA A 313 ? 0.9003 0.5956 0.6187 -0.0462 0.1450  -0.0738 558 ALA A C   
2114 O O   . ALA A 313 ? 0.8656 0.5620 0.6149 -0.0312 0.1688  -0.0770 558 ALA A O   
2115 C CB  . ALA A 313 ? 0.8717 0.5183 0.5577 -0.0642 0.1385  -0.0918 558 ALA A CB  
2116 N N   . GLN A 314 ? 0.8780 0.5752 0.5592 -0.0592 0.1348  -0.0703 559 GLN A N   
2117 C CA  . GLN A 314 ? 0.8300 0.5261 0.4972 -0.0587 0.1539  -0.0712 559 GLN A CA  
2118 C C   . GLN A 314 ? 0.7640 0.4998 0.4690 -0.0478 0.1433  -0.0536 559 GLN A C   
2119 O O   . GLN A 314 ? 0.8001 0.5393 0.5065 -0.0452 0.1614  -0.0533 559 GLN A O   
2120 C CB  . GLN A 314 ? 0.9310 0.5969 0.5246 -0.0813 0.1508  -0.0774 559 GLN A CB  
2121 C CG  . GLN A 314 ? 1.0175 0.6378 0.5634 -0.0954 0.1650  -0.0980 559 GLN A CG  
2122 C CD  . GLN A 314 ? 1.1176 0.7193 0.6820 -0.0840 0.2062  -0.1136 559 GLN A CD  
2123 O OE1 . GLN A 314 ? 1.1052 0.7133 0.6835 -0.0760 0.2310  -0.1139 559 GLN A OE1 
2124 N NE2 . GLN A 314 ? 1.1297 0.7086 0.6991 -0.0829 0.2143  -0.1263 559 GLN A NE2 
2125 N N   . ARG A 315 ? 0.7258 0.4892 0.4597 -0.0430 0.1162  -0.0401 560 ARG A N   
2126 C CA  . ARG A 315 ? 0.7016 0.5001 0.4731 -0.0325 0.1068  -0.0252 560 ARG A CA  
2127 C C   . ARG A 315 ? 0.6720 0.4854 0.4922 -0.0153 0.1255  -0.0256 560 ARG A C   
2128 O O   . ARG A 315 ? 0.6963 0.5024 0.5371 -0.0071 0.1344  -0.0316 560 ARG A O   
2129 C CB  . ARG A 315 ? 0.6512 0.4710 0.4434 -0.0312 0.0785  -0.0141 560 ARG A CB  
2130 C CG  . ARG A 315 ? 0.6341 0.4814 0.4429 -0.0282 0.0625  0.0005  560 ARG A CG  
2131 C CD  . ARG A 315 ? 0.5967 0.4588 0.4200 -0.0299 0.0379  0.0080  560 ARG A CD  
2132 N NE  . ARG A 315 ? 0.6259 0.4721 0.4153 -0.0451 0.0237  0.0045  560 ARG A NE  
2133 C CZ  . ARG A 315 ? 0.6931 0.5448 0.4935 -0.0498 0.0079  0.0053  560 ARG A CZ  
2134 N NH1 . ARG A 315 ? 0.5983 0.4676 0.4376 -0.0405 0.0069  0.0095  560 ARG A NH1 
2135 N NH2 . ARG A 315 ? 0.6730 0.5117 0.4445 -0.0652 -0.0070 0.0017  560 ARG A NH2 
2136 N N   . ALA A 316 ? 0.6572 0.4915 0.4980 -0.0101 0.1300  -0.0185 561 ALA A N   
2137 C CA  . ALA A 316 ? 0.6556 0.5099 0.5491 0.0055  0.1424  -0.0171 561 ALA A CA  
2138 C C   . ALA A 316 ? 0.5882 0.4637 0.5188 0.0162  0.1220  -0.0073 561 ALA A C   
2139 O O   . ALA A 316 ? 0.5854 0.4683 0.5072 0.0118  0.1002  0.0004  561 ALA A O   
2140 C CB  . ALA A 316 ? 0.6024 0.4747 0.5094 0.0056  0.1503  -0.0120 561 ALA A CB  
2141 N N   . THR A 317 ? 0.5694 0.4532 0.5416 0.0301  0.1297  -0.0075 562 THR A N   
2142 C CA  . THR A 317 ? 0.5440 0.4456 0.5476 0.0397  0.1108  0.0033  562 THR A CA  
2143 C C   . THR A 317 ? 0.5344 0.4670 0.5691 0.0444  0.1030  0.0127  562 THR A C   
2144 O O   . THR A 317 ? 0.5082 0.4498 0.5509 0.0428  0.1155  0.0104  562 THR A O   
2145 C CB  . THR A 317 ? 0.5612 0.4535 0.5925 0.0525  0.1181  0.0012  562 THR A CB  
2146 O OG1 . THR A 317 ? 0.5691 0.4729 0.6386 0.0628  0.1354  -0.0015 562 THR A OG1 
2147 C CG2 . THR A 317 ? 0.6007 0.4579 0.6012 0.0468  0.1294  -0.0105 562 THR A CG2 
2148 N N   . ALA A 318 ? 0.4851 0.4320 0.5355 0.0488  0.0833  0.0228  563 ALA A N   
2149 C CA  . ALA A 318 ? 0.4877 0.4613 0.5647 0.0517  0.0740  0.0305  563 ALA A CA  
2150 C C   . ALA A 318 ? 0.4947 0.4825 0.6148 0.0615  0.0849  0.0294  563 ALA A C   
2151 O O   . ALA A 318 ? 0.4496 0.4562 0.5883 0.0594  0.0882  0.0302  563 ALA A O   
2152 C CB  . ALA A 318 ? 0.4342 0.4148 0.5144 0.0536  0.0528  0.0401  563 ALA A CB  
2153 N N   . ALA A 319 ? 0.4910 0.4700 0.6315 0.0723  0.0911  0.0276  564 ALA A N   
2154 C CA  . ALA A 319 ? 0.4765 0.4716 0.6681 0.0837  0.1011  0.0271  564 ALA A CA  
2155 C C   . ALA A 319 ? 0.5119 0.5062 0.7064 0.0793  0.1294  0.0157  564 ALA A C   
2156 O O   . ALA A 319 ? 0.4832 0.5010 0.7200 0.0828  0.1372  0.0157  564 ALA A O   
2157 C CB  . ALA A 319 ? 0.4644 0.4458 0.6776 0.0977  0.1025  0.0282  564 ALA A CB  
2158 N N   . GLU A 320 ? 0.5072 0.4737 0.6561 0.0702  0.1451  0.0057  565 GLU A N   
2159 C CA  . GLU A 320 ? 0.5190 0.4782 0.6576 0.0630  0.1733  -0.0051 565 GLU A CA  
2160 C C   . GLU A 320 ? 0.4921 0.4670 0.6202 0.0518  0.1690  -0.0004 565 GLU A C   
2161 O O   . GLU A 320 ? 0.5316 0.5174 0.6806 0.0495  0.1883  -0.0040 565 GLU A O   
2162 C CB  . GLU A 320 ? 0.5819 0.5030 0.6646 0.0535  0.1874  -0.0165 565 GLU A CB  
2163 C CG  . GLU A 320 ? 0.6580 0.5567 0.7484 0.0628  0.1985  -0.0245 565 GLU A CG  
2164 C CD  . GLU A 320 ? 0.7651 0.6255 0.7938 0.0503  0.2022  -0.0343 565 GLU A CD  
2165 O OE1 . GLU A 320 ? 0.7304 0.5849 0.7128 0.0353  0.1919  -0.0328 565 GLU A OE1 
2166 O OE2 . GLU A 320 ? 0.7764 0.6121 0.8046 0.0554  0.2143  -0.0433 565 GLU A OE2 
2167 N N   . LEU A 321 ? 0.5146 0.4895 0.6125 0.0446  0.1455  0.0076  566 LEU A N   
2168 C CA  . LEU A 321 ? 0.5171 0.5009 0.6012 0.0342  0.1412  0.0125  566 LEU A CA  
2169 C C   . LEU A 321 ? 0.5115 0.5269 0.6450 0.0381  0.1363  0.0181  566 LEU A C   
2170 O O   . LEU A 321 ? 0.5223 0.5445 0.6556 0.0296  0.1435  0.0190  566 LEU A O   
2171 C CB  . LEU A 321 ? 0.4983 0.4752 0.5468 0.0281  0.1177  0.0195  566 LEU A CB  
2172 C CG  . LEU A 321 ? 0.5157 0.4639 0.5136 0.0201  0.1186  0.0151  566 LEU A CG  
2173 C CD1 . LEU A 321 ? 0.5281 0.4764 0.5113 0.0185  0.0938  0.0219  566 LEU A CD1 
2174 C CD2 . LEU A 321 ? 0.5156 0.4481 0.4761 0.0077  0.1312  0.0130  566 LEU A CD2 
2175 N N   . LEU A 322 ? 0.4434 0.4769 0.6176 0.0495  0.1227  0.0224  567 LEU A N   
2176 C CA  . LEU A 322 ? 0.4697 0.5341 0.6924 0.0518  0.1151  0.0273  567 LEU A CA  
2177 C C   . LEU A 322 ? 0.4698 0.5463 0.7284 0.0511  0.1416  0.0205  567 LEU A C   
2178 O O   . LEU A 322 ? 0.4553 0.5565 0.7484 0.0472  0.1392  0.0230  567 LEU A O   
2179 C CB  . LEU A 322 ? 0.4146 0.4926 0.6716 0.0642  0.0944  0.0341  567 LEU A CB  
2180 C CG  . LEU A 322 ? 0.4242 0.4951 0.6499 0.0620  0.0679  0.0420  567 LEU A CG  
2181 C CD1 . LEU A 322 ? 0.4472 0.5237 0.6968 0.0734  0.0492  0.0498  567 LEU A CD1 
2182 C CD2 . LEU A 322 ? 0.4128 0.4956 0.6308 0.0514  0.0563  0.0454  567 LEU A CD2 
2183 N N   . LYS A 323 ? 0.4676 0.5258 0.7178 0.0531  0.1683  0.0109  568 LYS A N   
2184 C CA  . LYS A 323 ? 0.4707 0.5364 0.7519 0.0516  0.2002  0.0025  568 LYS A CA  
2185 C C   . LYS A 323 ? 0.4769 0.5212 0.7083 0.0349  0.2216  -0.0025 568 LYS A C   
2186 O O   . LYS A 323 ? 0.4705 0.5152 0.7176 0.0307  0.2529  -0.0104 568 LYS A O   
2187 C CB  . LYS A 323 ? 0.4771 0.5327 0.7818 0.0644  0.2215  -0.0066 568 LYS A CB  
2188 C CG  . LYS A 323 ? 0.5593 0.6448 0.9402 0.0820  0.2104  -0.0015 568 LYS A CG  
2189 C CD  . LYS A 323 ? 0.6606 0.7559 1.0411 0.0874  0.1690  0.0123  568 LYS A CD  
2190 C CE  . LYS A 323 ? 0.6858 0.8162 1.1408 0.1006  0.1513  0.0209  568 LYS A CE  
2191 N NZ  . LYS A 323 ? 0.6503 0.7868 1.0931 0.1013  0.1112  0.0344  568 LYS A NZ  
2192 N N   . HIS A 324 ? 0.5166 0.5418 0.6896 0.0253  0.2058  0.0027  569 HIS A N   
2193 C CA  . HIS A 324 ? 0.5252 0.5256 0.6460 0.0099  0.2230  0.0004  569 HIS A CA  
2194 C C   . HIS A 324 ? 0.5116 0.5293 0.6543 0.0008  0.2298  0.0045  569 HIS A C   
2195 O O   . HIS A 324 ? 0.4849 0.5269 0.6581 0.0025  0.2080  0.0121  569 HIS A O   
2196 C CB  . HIS A 324 ? 0.5671 0.5439 0.6260 0.0034  0.2012  0.0064  569 HIS A CB  
2197 C CG  . HIS A 324 ? 0.6147 0.5595 0.6122 -0.0114 0.2160  0.0048  569 HIS A CG  
2198 N ND1 . HIS A 324 ? 0.6065 0.5479 0.5867 -0.0227 0.2178  0.0120  569 HIS A ND1 
2199 C CD2 . HIS A 324 ? 0.6275 0.5390 0.5736 -0.0180 0.2297  -0.0030 569 HIS A CD2 
2200 C CE1 . HIS A 324 ? 0.6748 0.5820 0.5940 -0.0350 0.2303  0.0106  569 HIS A CE1 
2201 N NE2 . HIS A 324 ? 0.6587 0.5476 0.5548 -0.0331 0.2372  0.0009  569 HIS A NE2 
2202 N N   . PRO A 325 ? 0.5396 0.5424 0.6641 -0.0107 0.2608  -0.0008 570 PRO A N   
2203 C CA  . PRO A 325 ? 0.5416 0.5596 0.6901 -0.0209 0.2710  0.0027  570 PRO A CA  
2204 C C   . PRO A 325 ? 0.5158 0.5294 0.6366 -0.0290 0.2462  0.0145  570 PRO A C   
2205 O O   . PRO A 325 ? 0.4967 0.5299 0.6512 -0.0346 0.2450  0.0181  570 PRO A O   
2206 C CB  . PRO A 325 ? 0.5919 0.5830 0.7074 -0.0334 0.3113  -0.0052 570 PRO A CB  
2207 C CG  . PRO A 325 ? 0.5854 0.5599 0.6885 -0.0256 0.3266  -0.0166 570 PRO A CG  
2208 C CD  . PRO A 325 ? 0.5764 0.5471 0.6608 -0.0156 0.2915  -0.0117 570 PRO A CD  
2209 N N   . PHE A 326 ? 0.5060 0.4943 0.5696 -0.0303 0.2276  0.0203  571 PHE A N   
2210 C CA  . PHE A 326 ? 0.5368 0.5213 0.5813 -0.0354 0.2046  0.0315  571 PHE A CA  
2211 C C   . PHE A 326 ? 0.5276 0.5443 0.6230 -0.0285 0.1824  0.0343  571 PHE A C   
2212 O O   . PHE A 326 ? 0.4921 0.5122 0.5923 -0.0352 0.1745  0.0401  571 PHE A O   
2213 C CB  . PHE A 326 ? 0.5369 0.4963 0.5262 -0.0346 0.1844  0.0371  571 PHE A CB  
2214 C CG  . PHE A 326 ? 0.5359 0.4948 0.5169 -0.0357 0.1596  0.0481  571 PHE A CG  
2215 C CD1 . PHE A 326 ? 0.5274 0.4716 0.4892 -0.0464 0.1646  0.0558  571 PHE A CD1 
2216 C CD2 . PHE A 326 ? 0.5071 0.4783 0.5007 -0.0261 0.1339  0.0504  571 PHE A CD2 
2217 C CE1 . PHE A 326 ? 0.5248 0.4662 0.4828 -0.0462 0.1441  0.0653  571 PHE A CE1 
2218 C CE2 . PHE A 326 ? 0.5582 0.5278 0.5473 -0.0267 0.1153  0.0588  571 PHE A CE2 
2219 C CZ  . PHE A 326 ? 0.5322 0.4869 0.5053 -0.0360 0.1203  0.0659  571 PHE A CZ  
2220 N N   . LEU A 327 ? 0.4746 0.5118 0.6054 -0.0160 0.1723  0.0305  572 LEU A N   
2221 C CA  . LEU A 327 ? 0.4290 0.4928 0.5993 -0.0109 0.1488  0.0338  572 LEU A CA  
2222 C C   . LEU A 327 ? 0.4535 0.5448 0.6781 -0.0159 0.1567  0.0317  572 LEU A C   
2223 O O   . LEU A 327 ? 0.4247 0.5348 0.6753 -0.0164 0.1363  0.0345  572 LEU A O   
2224 C CB  . LEU A 327 ? 0.3944 0.4679 0.5813 0.0031  0.1342  0.0325  572 LEU A CB  
2225 C CG  . LEU A 327 ? 0.4112 0.4623 0.5526 0.0073  0.1215  0.0346  572 LEU A CG  
2226 C CD1 . LEU A 327 ? 0.4639 0.5245 0.6267 0.0199  0.1091  0.0340  572 LEU A CD1 
2227 C CD2 . LEU A 327 ? 0.4066 0.4497 0.5205 0.0022  0.1027  0.0414  572 LEU A CD2 
2228 N N   . ALA A 328 ? 0.4192 0.5127 0.6613 -0.0210 0.1864  0.0262  573 ALA A N   
2229 C CA  . ALA A 328 ? 0.4621 0.5814 0.7564 -0.0293 0.1966  0.0245  573 ALA A CA  
2230 C C   . ALA A 328 ? 0.4905 0.6009 0.7657 -0.0436 0.1900  0.0299  573 ALA A C   
2231 O O   . ALA A 328 ? 0.4274 0.5604 0.7464 -0.0520 0.1901  0.0289  573 ALA A O   
2232 C CB  . ALA A 328 ? 0.4463 0.5645 0.7569 -0.0340 0.2359  0.0169  573 ALA A CB  
2233 N N   . LYS A 329 ? 0.4539 0.5315 0.6676 -0.0469 0.1842  0.0356  574 LYS A N   
2234 C CA  . LYS A 329 ? 0.4868 0.5509 0.6812 -0.0584 0.1774  0.0417  574 LYS A CA  
2235 C C   . LYS A 329 ? 0.4645 0.5402 0.6707 -0.0548 0.1469  0.0436  574 LYS A C   
2236 O O   . LYS A 329 ? 0.4640 0.5302 0.6621 -0.0640 0.1413  0.0467  574 LYS A O   
2237 C CB  . LYS A 329 ? 0.4999 0.5240 0.6275 -0.0618 0.1811  0.0488  574 LYS A CB  
2238 C CG  . LYS A 329 ? 0.5373 0.5395 0.6366 -0.0709 0.2120  0.0483  574 LYS A CG  
2239 C CD  . LYS A 329 ? 0.6203 0.5824 0.6494 -0.0734 0.2069  0.0575  574 LYS A CD  
2240 C CE  . LYS A 329 ? 0.7120 0.6459 0.6992 -0.0840 0.2362  0.0572  574 LYS A CE  
2241 N NZ  . LYS A 329 ? 0.8046 0.7299 0.7958 -0.1000 0.2599  0.0600  574 LYS A NZ  
2242 N N   . ALA A 330 ? 0.4107 0.5028 0.6325 -0.0424 0.1287  0.0417  575 ALA A N   
2243 C CA  . ALA A 330 ? 0.4057 0.5008 0.6239 -0.0395 0.1014  0.0435  575 ALA A CA  
2244 C C   . ALA A 330 ? 0.4336 0.5449 0.6840 -0.0509 0.0938  0.0413  575 ALA A C   
2245 O O   . ALA A 330 ? 0.4023 0.5405 0.7007 -0.0546 0.0979  0.0377  575 ALA A O   
2246 C CB  . ALA A 330 ? 0.4114 0.5206 0.6419 -0.0261 0.0858  0.0426  575 ALA A CB  
2247 N N   . GLY A 331 ? 0.4253 0.5195 0.6516 -0.0570 0.0835  0.0428  576 GLY A N   
2248 C CA  . GLY A 331 ? 0.4386 0.5433 0.6885 -0.0693 0.0741  0.0390  576 GLY A CA  
2249 C C   . GLY A 331 ? 0.4339 0.5535 0.6933 -0.0653 0.0478  0.0364  576 GLY A C   
2250 O O   . GLY A 331 ? 0.3742 0.4926 0.6185 -0.0527 0.0380  0.0386  576 GLY A O   
2251 N N   . PRO A 332 ? 0.4007 0.5320 0.6819 -0.0778 0.0356  0.0319  577 PRO A N   
2252 C CA  . PRO A 332 ? 0.3876 0.5264 0.6663 -0.0773 0.0088  0.0297  577 PRO A CA  
2253 C C   . PRO A 332 ? 0.4015 0.5087 0.6299 -0.0758 0.0039  0.0288  577 PRO A C   
2254 O O   . PRO A 332 ? 0.4368 0.5193 0.6412 -0.0768 0.0187  0.0298  577 PRO A O   
2255 C CB  . PRO A 332 ? 0.4156 0.5721 0.7283 -0.0950 -0.0011 0.0241  577 PRO A CB  
2256 C CG  . PRO A 332 ? 0.4759 0.6166 0.7865 -0.1065 0.0216  0.0224  577 PRO A CG  
2257 C CD  . PRO A 332 ? 0.4540 0.5878 0.7573 -0.0953 0.0455  0.0283  577 PRO A CD  
2258 N N   . PRO A 333 ? 0.4153 0.5213 0.6272 -0.0735 -0.0159 0.0274  578 PRO A N   
2259 C CA  . PRO A 333 ? 0.4611 0.5371 0.6287 -0.0734 -0.0166 0.0247  578 PRO A CA  
2260 C C   . PRO A 333 ? 0.4563 0.5111 0.6137 -0.0868 -0.0083 0.0185  578 PRO A C   
2261 O O   . PRO A 333 ? 0.5015 0.5295 0.6312 -0.0832 0.0016  0.0181  578 PRO A O   
2262 C CB  . PRO A 333 ? 0.4780 0.5580 0.6333 -0.0750 -0.0393 0.0228  578 PRO A CB  
2263 C CG  . PRO A 333 ? 0.4790 0.5883 0.6670 -0.0666 -0.0493 0.0293  578 PRO A CG  
2264 C CD  . PRO A 333 ? 0.4320 0.5616 0.6638 -0.0708 -0.0377 0.0292  578 PRO A CD  
2265 N N   . ALA A 334 ? 0.4716 0.5379 0.6545 -0.1021 -0.0117 0.0138  579 ALA A N   
2266 C CA  . ALA A 334 ? 0.4868 0.5299 0.6606 -0.1166 -0.0032 0.0072  579 ALA A CA  
2267 C C   . ALA A 334 ? 0.5006 0.5215 0.6642 -0.1107 0.0195  0.0130  579 ALA A C   
2268 O O   . ALA A 334 ? 0.5146 0.5052 0.6576 -0.1151 0.0273  0.0099  579 ALA A O   
2269 C CB  . ALA A 334 ? 0.4927 0.5559 0.7030 -0.1350 -0.0093 0.0021  579 ALA A CB  
2270 N N   . SER A 335 ? 0.4586 0.4912 0.6336 -0.1007 0.0299  0.0217  580 SER A N   
2271 C CA  . SER A 335 ? 0.5014 0.5115 0.6620 -0.0969 0.0486  0.0291  580 SER A CA  
2272 C C   . SER A 335 ? 0.4877 0.4736 0.6152 -0.0838 0.0484  0.0330  580 SER A C   
2273 O O   . SER A 335 ? 0.4867 0.4483 0.5995 -0.0815 0.0593  0.0395  580 SER A O   
2274 C CB  . SER A 335 ? 0.4607 0.4872 0.6365 -0.0921 0.0604  0.0358  580 SER A CB  
2275 O OG  . SER A 335 ? 0.4851 0.5228 0.6541 -0.0769 0.0538  0.0387  580 SER A OG  
2276 N N   . ILE A 336 ? 0.4741 0.4665 0.5919 -0.0754 0.0362  0.0302  581 ILE A N   
2277 C CA  A ILE A 336 ? 0.4836 0.4572 0.5772 -0.0639 0.0366  0.0325  581 ILE A CA  
2278 C CA  B ILE A 336 ? 0.4768 0.4503 0.5704 -0.0639 0.0366  0.0325  581 ILE A CA  
2279 C C   . ILE A 336 ? 0.5247 0.4739 0.6052 -0.0697 0.0376  0.0244  581 ILE A C   
2280 O O   . ILE A 336 ? 0.5721 0.5002 0.6409 -0.0617 0.0441  0.0270  581 ILE A O   
2281 C CB  A ILE A 336 ? 0.4855 0.4752 0.5744 -0.0536 0.0264  0.0329  581 ILE A CB  
2282 C CB  B ILE A 336 ? 0.4829 0.4729 0.5721 -0.0535 0.0266  0.0331  581 ILE A CB  
2283 C CG1 A ILE A 336 ? 0.4718 0.4822 0.5744 -0.0478 0.0276  0.0391  581 ILE A CG1 
2284 C CG1 B ILE A 336 ? 0.4712 0.4756 0.5681 -0.0453 0.0302  0.0411  581 ILE A CG1 
2285 C CG2 A ILE A 336 ? 0.5084 0.4827 0.5789 -0.0425 0.0285  0.0354  581 ILE A CG2 
2286 C CG2 B ILE A 336 ? 0.5091 0.4831 0.5782 -0.0449 0.0264  0.0323  581 ILE A CG2 
2287 C CD1 A ILE A 336 ? 0.4460 0.4451 0.5380 -0.0408 0.0381  0.0476  581 ILE A CD1 
2288 C CD1 B ILE A 336 ? 0.4575 0.4783 0.5551 -0.0368 0.0209  0.0414  581 ILE A CD1 
2289 N N   . VAL A 337 ? 0.5575 0.5085 0.6413 -0.0841 0.0313  0.0142  582 VAL A N   
2290 C CA  . VAL A 337 ? 0.5776 0.5017 0.6441 -0.0919 0.0337  0.0034  582 VAL A CA  
2291 C C   . VAL A 337 ? 0.6085 0.5012 0.6711 -0.0889 0.0494  0.0059  582 VAL A C   
2292 O O   . VAL A 337 ? 0.6125 0.4834 0.6614 -0.0829 0.0553  0.0016  582 VAL A O   
2293 C CB  . VAL A 337 ? 0.5948 0.5243 0.6657 -0.1119 0.0236  -0.0076 582 VAL A CB  
2294 C CG1 . VAL A 337 ? 0.5973 0.4923 0.6462 -0.1229 0.0294  -0.0209 582 VAL A CG1 
2295 C CG2 . VAL A 337 ? 0.6141 0.5699 0.6848 -0.1126 0.0044  -0.0088 582 VAL A CG2 
2296 N N   . PRO A 338 ? 0.5977 0.4845 0.6722 -0.0929 0.0574  0.0132  583 PRO A N   
2297 C CA  . PRO A 338 ? 0.6230 0.4749 0.6923 -0.0901 0.0704  0.0171  583 PRO A CA  
2298 C C   . PRO A 338 ? 0.5647 0.4080 0.6285 -0.0703 0.0729  0.0279  583 PRO A C   
2299 O O   . PRO A 338 ? 0.5828 0.3969 0.6453 -0.0650 0.0812  0.0307  583 PRO A O   
2300 C CB  . PRO A 338 ? 0.6116 0.4613 0.6918 -0.0998 0.0776  0.0251  583 PRO A CB  
2301 C CG  . PRO A 338 ? 0.6373 0.5238 0.7306 -0.1014 0.0712  0.0278  583 PRO A CG  
2302 C CD  . PRO A 338 ? 0.5793 0.4880 0.6736 -0.1018 0.0569  0.0174  583 PRO A CD  
2303 N N   . LEU A 339 ? 0.5165 0.3837 0.5800 -0.0593 0.0653  0.0338  584 LEU A N   
2304 C CA  . LEU A 339 ? 0.5391 0.4016 0.6009 -0.0423 0.0650  0.0436  584 LEU A CA  
2305 C C   . LEU A 339 ? 0.5835 0.4361 0.6444 -0.0351 0.0677  0.0351  584 LEU A C   
2306 O O   . LEU A 339 ? 0.5473 0.3906 0.6153 -0.0219 0.0699  0.0423  584 LEU A O   
2307 C CB  . LEU A 339 ? 0.5287 0.4181 0.5893 -0.0353 0.0566  0.0508  584 LEU A CB  
2308 C CG  . LEU A 339 ? 0.5688 0.4677 0.6289 -0.0403 0.0577  0.0591  584 LEU A CG  
2309 C CD1 . LEU A 339 ? 0.5573 0.4817 0.6161 -0.0345 0.0511  0.0609  584 LEU A CD1 
2310 C CD2 . LEU A 339 ? 0.5978 0.4734 0.6496 -0.0370 0.0623  0.0731  584 LEU A CD2 
2311 N N   . MET A 340 ? 0.5460 0.4001 0.5987 -0.0441 0.0677  0.0202  585 MET A N   
2312 C CA  . MET A 340 ? 0.5662 0.4121 0.6131 -0.0386 0.0731  0.0110  585 MET A CA  
2313 C C   . MET A 340 ? 0.5781 0.3899 0.6290 -0.0371 0.0881  0.0050  585 MET A C   
2314 O O   . MET A 340 ? 0.5928 0.3844 0.6440 -0.0457 0.0929  0.0032  585 MET A O   
2315 C CB  . MET A 340 ? 0.5693 0.4238 0.5976 -0.0504 0.0674  -0.0019 585 MET A CB  
2316 C CG  . MET A 340 ? 0.6093 0.4952 0.6373 -0.0471 0.0538  0.0049  585 MET A CG  
2317 S SD  . MET A 340 ? 0.6391 0.5333 0.6438 -0.0597 0.0427  -0.0061 585 MET A SD  
2318 C CE  . MET A 340 ? 0.6037 0.5052 0.6164 -0.0766 0.0326  -0.0090 585 MET A CE  
2319 N N   . ARG A 341 ? 0.5690 0.3737 0.6256 -0.0262 0.0972  0.0013  586 ARG A N   
2320 C CA  . ARG A 341 ? 0.5846 0.3582 0.6543 -0.0194 0.1134  -0.0025 586 ARG A CA  
2321 C C   . ARG A 341 ? 0.6829 0.4258 0.7355 -0.0356 0.1241  -0.0191 586 ARG A C   
2322 O O   . ARG A 341 ? 0.7250 0.4405 0.7872 -0.0352 0.1324  -0.0175 586 ARG A O   
2323 C CB  . ARG A 341 ? 0.5959 0.3711 0.6774 -0.0072 0.1243  -0.0073 586 ARG A CB  
2324 C CG  . ARG A 341 ? 0.6459 0.3892 0.7467 0.0011  0.1445  -0.0137 586 ARG A CG  
2325 C CD  . ARG A 341 ? 0.6786 0.4290 0.8026 0.0151  0.1569  -0.0166 586 ARG A CD  
2326 N NE  . ARG A 341 ? 0.7059 0.4859 0.8579 0.0300  0.1421  0.0025  586 ARG A NE  
2327 C CZ  . ARG A 341 ? 0.7269 0.5046 0.9117 0.0448  0.1359  0.0190  586 ARG A CZ  
2328 N NH1 . ARG A 341 ? 0.6784 0.4244 0.8740 0.0482  0.1449  0.0196  586 ARG A NH1 
2329 N NH2 . ARG A 341 ? 0.6493 0.4541 0.8541 0.0555  0.1196  0.0354  586 ARG A NH2 
2330 N N   . GLN A 342 ? 0.7058 0.4503 0.7308 -0.0510 0.1226  -0.0347 587 GLN A N   
2331 C CA  . GLN A 342 ? 0.6829 0.3972 0.6866 -0.0694 0.1305  -0.0526 587 GLN A CA  
2332 C C   . GLN A 342 ? 0.6756 0.3857 0.6837 -0.0817 0.1231  -0.0484 587 GLN A C   
2333 O O   . GLN A 342 ? 0.6974 0.3784 0.6929 -0.0973 0.1305  -0.0623 587 GLN A O   
2334 C CB  . GLN A 342 ? 0.7449 0.4646 0.7132 -0.0855 0.1239  -0.0673 587 GLN A CB  
2335 C CG  . GLN A 342 ? 0.7426 0.4985 0.7069 -0.0932 0.0992  -0.0590 587 GLN A CG  
2336 C CD  . GLN A 342 ? 0.6845 0.4720 0.6564 -0.0787 0.0909  -0.0466 587 GLN A CD  
2337 O OE1 . GLN A 342 ? 0.6673 0.4544 0.6533 -0.0624 0.1015  -0.0412 587 GLN A OE1 
2338 N NE2 . GLN A 342 ? 0.7078 0.5228 0.6735 -0.0848 0.0717  -0.0420 587 GLN A NE2 
2339 N N   . ASN A 343 ? 0.6355 0.3716 0.6599 -0.0769 0.1105  -0.0308 588 ASN A N   
2340 C CA  . ASN A 343 ? 0.6695 0.4033 0.6990 -0.0904 0.1063  -0.0270 588 ASN A CA  
2341 C C   . ASN A 343 ? 0.6835 0.4061 0.7313 -0.0799 0.1113  -0.0091 588 ASN A C   
2342 O O   . ASN A 343 ? 0.7120 0.4215 0.7625 -0.0921 0.1139  -0.0070 588 ASN A O   
2343 C CB  . ASN A 343 ? 0.6659 0.4384 0.6957 -0.0997 0.0885  -0.0238 588 ASN A CB  
2344 C CG  . ASN A 343 ? 0.6585 0.4407 0.6680 -0.1121 0.0787  -0.0389 588 ASN A CG  
2345 O OD1 . ASN A 343 ? 0.6909 0.4472 0.6815 -0.1259 0.0837  -0.0553 588 ASN A OD1 
2346 N ND2 . ASN A 343 ? 0.6192 0.4351 0.6289 -0.1075 0.0645  -0.0332 588 ASN A ND2 
2347 N N   . ARG A 344 ? 0.7198 0.4461 0.7792 -0.0592 0.1118  0.0045  589 ARG A N   
2348 C CA  . ARG A 344 ? 0.8170 0.5322 0.8873 -0.0510 0.1120  0.0240  589 ARG A CA  
2349 C C   . ARG A 344 ? 0.9244 0.5973 1.0045 -0.0433 0.1256  0.0250  589 ARG A C   
2350 O O   . ARG A 344 ? 0.9142 0.5686 0.9956 -0.0418 0.1371  0.0098  589 ARG A O   
2351 C CB  . ARG A 344 ? 0.7298 0.4715 0.8062 -0.0349 0.1007  0.0408  589 ARG A CB  
2352 C CG  . ARG A 344 ? 0.7101 0.4630 0.7957 -0.0195 0.0999  0.0380  589 ARG A CG  
2353 C CD  . ARG A 344 ? 0.6254 0.4003 0.7182 -0.0056 0.0874  0.0556  589 ARG A CD  
2354 N NE  . ARG A 344 ? 0.5856 0.3627 0.6981 0.0108  0.0891  0.0562  589 ARG A NE  
2355 C CZ  . ARG A 344 ? 0.5716 0.3739 0.6870 0.0153  0.0858  0.0511  589 ARG A CZ  
2356 N NH1 . ARG A 344 ? 0.5817 0.3851 0.7211 0.0292  0.0902  0.0514  589 ARG A NH1 
2357 N NH2 . ARG A 344 ? 0.5437 0.3700 0.6415 0.0063  0.0787  0.0464  589 ARG A NH2 
2358 N N   . THR A 345 ? 0.9943 0.6488 1.0796 -0.0390 0.1254  0.0432  590 THR A N   
2359 C CA  . THR A 345 ? 1.0333 0.6445 1.1305 -0.0303 0.1366  0.0482  590 THR A CA  
2360 C C   . THR A 345 ? 1.0159 0.6240 1.1269 -0.0094 0.1274  0.0738  590 THR A C   
2361 O O   . THR A 345 ? 0.9675 0.5920 1.0959 0.0082  0.1220  0.0772  590 THR A O   
2362 C CB  . THR A 345 ? 1.0134 0.5912 1.1009 -0.0487 0.1458  0.0466  590 THR A CB  
2363 O OG1 . THR A 345 ? 1.0510 0.5849 1.1502 -0.0379 0.1555  0.0545  590 THR A OG1 
2364 C CG2 . THR A 345 ? 0.9524 0.5442 1.0284 -0.0587 0.1376  0.0625  590 THR A CG2 
2365 N N   . LYS B 2   ? 0.7394 0.8738 1.4898 0.2093  0.2478  0.1085  504 LYS B N   
2366 C CA  . LYS B 2   ? 0.6880 0.8151 1.3405 0.1616  0.2268  0.0844  504 LYS B CA  
2367 C C   . LYS B 2   ? 0.6014 0.7439 1.2159 0.1370  0.1347  0.0924  504 LYS B C   
2368 O O   . LYS B 2   ? 0.5574 0.7147 1.1411 0.1031  0.1082  0.0895  504 LYS B O   
2369 C CB  . LYS B 2   ? 0.7045 0.8971 1.4349 0.1490  0.2574  0.0973  504 LYS B CB  
2370 C CG  . LYS B 2   ? 0.7478 0.9271 1.5100 0.1705  0.3558  0.0848  504 LYS B CG  
2371 C CD  . LYS B 2   ? 0.7516 0.9717 1.5153 0.1385  0.3890  0.0786  504 LYS B CD  
2372 C CE  . LYS B 2   ? 0.7005 1.0212 1.6001 0.1427  0.3665  0.1227  504 LYS B CE  
2373 N NZ  . LYS B 2   ? 0.6958 1.0489 1.5843 0.1116  0.3947  0.1166  504 LYS B NZ  
2374 N N   . LYS B 3   ? 0.5607 0.6946 1.1759 0.1538  0.0911  0.1021  505 LYS B N   
2375 C CA  . LYS B 3   ? 0.5361 0.6839 1.1122 0.1301  0.0071  0.1061  505 LYS B CA  
2376 C C   . LYS B 3   ? 0.5254 0.6097 0.9495 0.1038  -0.0059 0.0744  505 LYS B C   
2377 O O   . LYS B 3   ? 0.5344 0.6251 0.9233 0.0804  -0.0611 0.0737  505 LYS B O   
2378 C CB  . LYS B 3   ? 0.5740 0.7296 1.1777 0.1534  -0.0303 0.1241  505 LYS B CB  
2379 C CG  . LYS B 3   ? 0.5861 0.8138 1.2378 0.1298  -0.1124 0.1496  505 LYS B CG  
2380 C CD  . LYS B 3   ? 0.5249 0.7775 1.2046 0.1420  -0.1251 0.1736  505 LYS B CD  
2381 C CE  . LYS B 3   ? 0.5370 0.7151 1.1345 0.1670  -0.1155 0.1540  505 LYS B CE  
2382 N NZ  . LYS B 3   ? 0.5694 0.7728 1.1762 0.1686  -0.1373 0.1737  505 LYS B NZ  
2383 N N   . ARG B 4   ? 0.5592 0.5856 0.8910 0.1042  0.0470  0.0518  506 ARG B N   
2384 C CA  . ARG B 4   ? 0.5671 0.5522 0.7603 0.0790  0.0392  0.0371  506 ARG B CA  
2385 C C   . ARG B 4   ? 0.6513 0.6514 0.8342 0.0530  0.0732  0.0387  506 ARG B C   
2386 O O   . ARG B 4   ? 0.6062 0.5859 0.6865 0.0323  0.0783  0.0388  506 ARG B O   
2387 C CB  . ARG B 4   ? 0.6094 0.5346 0.6915 0.0800  0.0707  0.0198  506 ARG B CB  
2388 C CG  . ARG B 4   ? 0.6047 0.5054 0.6969 0.1069  0.0461  0.0202  506 ARG B CG  
2389 C CD  . ARG B 4   ? 0.6082 0.4387 0.5605 0.0947  0.0717  0.0012  506 ARG B CD  
2390 N NE  . ARG B 4   ? 0.5830 0.4125 0.4089 0.0671  0.0323  0.0054  506 ARG B NE  
2391 C CZ  . ARG B 4   ? 0.5783 0.4065 0.3527 0.0716  -0.0321 0.0138  506 ARG B CZ  
2392 N NH1 . ARG B 4   ? 0.5356 0.3695 0.2028 0.0512  -0.0587 0.0240  506 ARG B NH1 
2393 N NH2 . ARG B 4   ? 0.5618 0.3915 0.3976 0.0972  -0.0682 0.0181  506 ARG B NH2 
2394 N N   . TYR B 5   ? 0.6329 0.6788 0.9246 0.0528  0.0953  0.0480  507 TYR B N   
2395 C CA  . TYR B 5   ? 0.6112 0.6776 0.9027 0.0274  0.1320  0.0524  507 TYR B CA  
2396 C C   . TYR B 5   ? 0.6064 0.6827 0.9044 0.0071  0.0892  0.0663  507 TYR B C   
2397 O O   . TYR B 5   ? 0.5903 0.6788 0.9400 0.0074  0.0402  0.0711  507 TYR B O   
2398 C CB  . TYR B 5   ? 0.6047 0.7177 1.0058 0.0350  0.1803  0.0571  507 TYR B CB  
2399 C CG  . TYR B 5   ? 0.6957 0.7846 1.0624 0.0405  0.2549  0.0367  507 TYR B CG  
2400 C CD1 . TYR B 5   ? 0.7758 0.8010 1.0304 0.0401  0.2676  0.0159  507 TYR B CD1 
2401 C CD2 . TYR B 5   ? 0.7197 0.8467 1.1577 0.0402  0.3157  0.0365  507 TYR B CD2 
2402 C CE1 . TYR B 5   ? 0.8466 0.8355 1.0537 0.0338  0.3425  -0.0094 507 TYR B CE1 
2403 C CE2 . TYR B 5   ? 0.7710 0.8656 1.1676 0.0392  0.3932  0.0103  507 TYR B CE2 
2404 C CZ  . TYR B 5   ? 0.8552 0.8748 1.1322 0.0332  0.4082  -0.0150 507 TYR B CZ  
2405 O OH  . TYR B 5   ? 0.9679 0.9398 1.1847 0.0209  0.4834  -0.0465 507 TYR B OH  
2406 N N   . THR B 6   ? 0.5933 0.6645 0.8367 -0.0152 0.1124  0.0751  508 THR B N   
2407 C CA  . THR B 6   ? 0.5768 0.6420 0.8261 -0.0328 0.0892  0.0903  508 THR B CA  
2408 C C   . THR B 6   ? 0.5714 0.6762 0.9329 -0.0463 0.0861  0.0975  508 THR B C   
2409 O O   . THR B 6   ? 0.5615 0.7137 0.9883 -0.0469 0.1215  0.1013  508 THR B O   
2410 C CB  . THR B 6   ? 0.5735 0.6402 0.7604 -0.0509 0.1252  0.1122  508 THR B CB  
2411 O OG1 . THR B 6   ? 0.5848 0.6372 0.6672 -0.0480 0.1368  0.1121  508 THR B OG1 
2412 C CG2 . THR B 6   ? 0.5624 0.5990 0.7401 -0.0588 0.1061  0.1316  508 THR B CG2 
2413 N N   . VAL B 7   ? 0.5785 0.6630 0.9554 -0.0621 0.0473  0.0994  509 VAL B N   
2414 C CA  . VAL B 7   ? 0.5780 0.6985 1.0460 -0.0879 0.0405  0.1096  509 VAL B CA  
2415 C C   . VAL B 7   ? 0.5887 0.6686 1.0328 -0.1141 0.0492  0.1202  509 VAL B C   
2416 O O   . VAL B 7   ? 0.6010 0.6172 0.9690 -0.1101 0.0446  0.1179  509 VAL B O   
2417 C CB  . VAL B 7   ? 0.5882 0.7290 1.1061 -0.0992 -0.0110 0.1053  509 VAL B CB  
2418 C CG1 . VAL B 7   ? 0.5749 0.7493 1.1171 -0.0655 -0.0189 0.1037  509 VAL B CG1 
2419 C CG2 . VAL B 7   ? 0.6338 0.7088 1.0851 -0.1205 -0.0493 0.0896  509 VAL B CG2 
2420 N N   . VAL B 8   ? 0.5822 0.7009 1.0966 -0.1383 0.0661  0.1367  510 VAL B N   
2421 C CA  . VAL B 8   ? 0.6603 0.7426 1.1697 -0.1647 0.0801  0.1529  510 VAL B CA  
2422 C C   . VAL B 8   ? 0.6262 0.7178 1.1979 -0.2055 0.0532  0.1526  510 VAL B C   
2423 O O   . VAL B 8   ? 0.6182 0.7909 1.2704 -0.2153 0.0516  0.1641  510 VAL B O   
2424 C CB  . VAL B 8   ? 0.6015 0.7306 1.1292 -0.1656 0.1288  0.1808  510 VAL B CB  
2425 C CG1 . VAL B 8   ? 0.6314 0.7213 1.1606 -0.1883 0.1435  0.2062  510 VAL B CG1 
2426 C CG2 . VAL B 8   ? 0.5384 0.6712 0.9938 -0.1395 0.1534  0.1825  510 VAL B CG2 
2427 N N   . GLY B 9   ? 0.7177 0.7265 1.2474 -0.2322 0.0354  0.1405  511 GLY B N   
2428 C CA  . GLY B 9   ? 0.7674 0.7762 1.3301 -0.2849 0.0032  0.1335  511 GLY B CA  
2429 C C   . GLY B 9   ? 0.8522 0.9122 1.4893 -0.3185 0.0173  0.1605  511 GLY B C   
2430 O O   . GLY B 9   ? 0.8843 0.9537 1.5388 -0.3069 0.0551  0.1828  511 GLY B O   
2431 N N   . ASN B 10  ? 0.9239 1.0287 1.6054 -0.3670 -0.0167 0.1639  512 ASN B N   
2432 C CA  . ASN B 10  ? 0.9088 1.0805 1.6523 -0.3980 -0.0117 0.1898  512 ASN B CA  
2433 C C   . ASN B 10  ? 0.9653 1.0462 1.6616 -0.4350 0.0065  0.1854  512 ASN B C   
2434 O O   . ASN B 10  ? 0.9767 0.9583 1.6074 -0.4748 -0.0032 0.1596  512 ASN B O   
2435 C CB  . ASN B 10  ? 0.9563 1.2155 1.7392 -0.4310 -0.0529 0.1983  512 ASN B CB  
2436 C CG  . ASN B 10  ? 1.0392 1.2323 1.7521 -0.4871 -0.0876 0.1705  512 ASN B CG  
2437 O OD1 . ASN B 10  ? 1.0579 1.1521 1.7001 -0.4853 -0.0889 0.1397  512 ASN B OD1 
2438 N ND2 . ASN B 10  ? 1.0442 1.2937 1.7693 -0.5370 -0.1122 0.1805  512 ASN B ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   246 ?   ?   ?   A . n 
A 1 2   GLY 2   247 ?   ?   ?   A . n 
A 1 3   SER 3   248 ?   ?   ?   A . n 
A 1 4   SER 4   249 ?   ?   ?   A . n 
A 1 5   HIS 5   250 ?   ?   ?   A . n 
A 1 6   HIS 6   251 ?   ?   ?   A . n 
A 1 7   HIS 7   252 ?   ?   ?   A . n 
A 1 8   HIS 8   253 ?   ?   ?   A . n 
A 1 9   HIS 9   254 ?   ?   ?   A . n 
A 1 10  HIS 10  255 ?   ?   ?   A . n 
A 1 11  SER 11  256 ?   ?   ?   A . n 
A 1 12  SER 12  257 ?   ?   ?   A . n 
A 1 13  GLY 13  258 ?   ?   ?   A . n 
A 1 14  LEU 14  259 ?   ?   ?   A . n 
A 1 15  VAL 15  260 ?   ?   ?   A . n 
A 1 16  PRO 16  261 ?   ?   ?   A . n 
A 1 17  ARG 17  262 ?   ?   ?   A . n 
A 1 18  GLY 18  263 ?   ?   ?   A . n 
A 1 19  SER 19  264 ?   ?   ?   A . n 
A 1 20  HIS 20  265 ?   ?   ?   A . n 
A 1 21  MET 21  266 ?   ?   ?   A . n 
A 1 22  GLU 22  267 ?   ?   ?   A . n 
A 1 23  ASN 23  268 ?   ?   ?   A . n 
A 1 24  LEU 24  269 ?   ?   ?   A . n 
A 1 25  TYR 25  270 ?   ?   ?   A . n 
A 1 26  PHE 26  271 ?   ?   ?   A . n 
A 1 27  GLN 27  272 ?   ?   ?   A . n 
A 1 28  GLY 28  273 ?   ?   ?   A . n 
A 1 29  ALA 29  274 ?   ?   ?   A . n 
A 1 30  ARG 30  275 ?   ?   ?   A . n 
A 1 31  ALA 31  276 ?   ?   ?   A . n 
A 1 32  ARG 32  277 ?   ?   ?   A . n 
A 1 33  GLN 33  278 ?   ?   ?   A . n 
A 1 34  GLU 34  279 ?   ?   ?   A . n 
A 1 35  ASN 35  280 ?   ?   ?   A . n 
A 1 36  GLY 36  281 ?   ?   ?   A . n 
A 1 37  MET 37  282 ?   ?   ?   A . n 
A 1 38  PRO 38  283 ?   ?   ?   A . n 
A 1 39  GLU 39  284 ?   ?   ?   A . n 
A 1 40  LYS 40  285 ?   ?   ?   A . n 
A 1 41  PRO 41  286 ?   ?   ?   A . n 
A 1 42  PRO 42  287 ?   ?   ?   A . n 
A 1 43  GLY 43  288 ?   ?   ?   A . n 
A 1 44  PRO 44  289 ?   ?   ?   A . n 
A 1 45  ARG 45  290 ?   ?   ?   A . n 
A 1 46  SER 46  291 ?   ?   ?   A . n 
A 1 47  PRO 47  292 ?   ?   ?   A . n 
A 1 48  GLN 48  293 ?   ?   ?   A . n 
A 1 49  ARG 49  294 ?   ?   ?   A . n 
A 1 50  GLU 50  295 ?   ?   ?   A . n 
A 1 51  PRO 51  296 ?   ?   ?   A . n 
A 1 52  GLN 52  297 ?   ?   ?   A . n 
A 1 53  ARG 53  298 ?   ?   ?   A . n 
A 1 54  VAL 54  299 299 VAL VAL A . n 
A 1 55  SER 55  300 300 SER SER A . n 
A 1 56  HIS 56  301 301 HIS HIS A . n 
A 1 57  GLU 57  302 302 GLU GLU A . n 
A 1 58  GLN 58  303 303 GLN GLN A . n 
A 1 59  PHE 59  304 304 PHE PHE A . n 
A 1 60  ARG 60  305 305 ARG ARG A . n 
A 1 61  ALA 61  306 306 ALA ALA A . n 
A 1 62  ALA 62  307 307 ALA ALA A . n 
A 1 63  LEU 63  308 308 LEU LEU A . n 
A 1 64  GLN 64  309 309 GLN GLN A . n 
A 1 65  LEU 65  310 310 LEU LEU A . n 
A 1 66  VAL 66  311 311 VAL VAL A . n 
A 1 67  VAL 67  312 312 VAL VAL A . n 
A 1 68  ASP 68  313 313 ASP ASP A . n 
A 1 69  PRO 69  314 314 PRO PRO A . n 
A 1 70  GLY 70  315 315 GLY GLY A . n 
A 1 71  ASP 71  316 316 ASP ASP A . n 
A 1 72  PRO 72  317 317 PRO PRO A . n 
A 1 73  ARG 73  318 318 ARG ARG A . n 
A 1 74  SER 74  319 319 SER SER A . n 
A 1 75  TYR 75  320 320 TYR TYR A . n 
A 1 76  LEU 76  321 321 LEU LEU A . n 
A 1 77  ASP 77  322 322 ASP ASP A . n 
A 1 78  ASN 78  323 323 ASN ASN A . n 
A 1 79  PHE 79  324 324 PHE PHE A . n 
A 1 80  ILE 80  325 325 ILE ILE A . n 
A 1 81  LYS 81  326 326 LYS LYS A . n 
A 1 82  ILE 82  327 327 ILE ILE A . n 
A 1 83  GLY 83  328 328 GLY GLY A . n 
A 1 84  GLU 84  329 329 GLU GLU A . n 
A 1 85  GLY 85  330 330 GLY GLY A . n 
A 1 86  SER 86  331 331 SER SER A . n 
A 1 87  THR 87  332 332 THR THR A . n 
A 1 88  GLY 88  333 333 GLY GLY A . n 
A 1 89  ILE 89  334 334 ILE ILE A . n 
A 1 90  VAL 90  335 335 VAL VAL A . n 
A 1 91  CYS 91  336 336 CYS CYS A . n 
A 1 92  ILE 92  337 337 ILE ILE A . n 
A 1 93  ALA 93  338 338 ALA ALA A . n 
A 1 94  THR 94  339 339 THR THR A . n 
A 1 95  VAL 95  340 340 VAL VAL A . n 
A 1 96  ARG 96  341 341 ARG ARG A . n 
A 1 97  SER 97  342 342 SER SER A . n 
A 1 98  SER 98  343 343 SER SER A . n 
A 1 99  GLY 99  344 344 GLY GLY A . n 
A 1 100 LYS 100 345 345 LYS LYS A . n 
A 1 101 LEU 101 346 346 LEU LEU A . n 
A 1 102 VAL 102 347 347 VAL VAL A . n 
A 1 103 ALA 103 348 348 ALA ALA A . n 
A 1 104 VAL 104 349 349 VAL VAL A . n 
A 1 105 LYS 105 350 350 LYS LYS A . n 
A 1 106 LYS 106 351 351 LYS LYS A . n 
A 1 107 MET 107 352 352 MET MET A . n 
A 1 108 ASP 108 353 353 ASP ASP A . n 
A 1 109 LEU 109 354 354 LEU LEU A . n 
A 1 110 ARG 110 355 355 ARG ARG A . n 
A 1 111 LYS 111 356 356 LYS LYS A . n 
A 1 112 GLN 112 357 357 GLN GLN A . n 
A 1 113 GLN 113 358 358 GLN GLN A . n 
A 1 114 ARG 114 359 359 ARG ARG A . n 
A 1 115 ARG 115 360 360 ARG ARG A . n 
A 1 116 GLU 116 361 361 GLU GLU A . n 
A 1 117 LEU 117 362 362 LEU LEU A . n 
A 1 118 LEU 118 363 363 LEU LEU A . n 
A 1 119 PHE 119 364 364 PHE PHE A . n 
A 1 120 ASN 120 365 365 ASN ASN A . n 
A 1 121 GLU 121 366 366 GLU GLU A . n 
A 1 122 VAL 122 367 367 VAL VAL A . n 
A 1 123 VAL 123 368 368 VAL VAL A . n 
A 1 124 ILE 124 369 369 ILE ILE A . n 
A 1 125 MET 125 370 370 MET MET A . n 
A 1 126 ARG 126 371 371 ARG ARG A . n 
A 1 127 ASP 127 372 372 ASP ASP A . n 
A 1 128 TYR 128 373 373 TYR TYR A . n 
A 1 129 GLN 129 374 374 GLN GLN A . n 
A 1 130 HIS 130 375 375 HIS HIS A . n 
A 1 131 GLU 131 376 376 GLU GLU A . n 
A 1 132 ASN 132 377 377 ASN ASN A . n 
A 1 133 VAL 133 378 378 VAL VAL A . n 
A 1 134 VAL 134 379 379 VAL VAL A . n 
A 1 135 GLU 135 380 380 GLU GLU A . n 
A 1 136 MET 136 381 381 MET MET A . n 
A 1 137 TYR 137 382 382 TYR TYR A . n 
A 1 138 ASN 138 383 383 ASN ASN A . n 
A 1 139 SER 139 384 384 SER SER A . n 
A 1 140 TYR 140 385 385 TYR TYR A . n 
A 1 141 LEU 141 386 386 LEU LEU A . n 
A 1 142 VAL 142 387 387 VAL VAL A . n 
A 1 143 GLY 143 388 388 GLY GLY A . n 
A 1 144 ASP 144 389 389 ASP ASP A . n 
A 1 145 GLU 145 390 390 GLU GLU A . n 
A 1 146 LEU 146 391 391 LEU LEU A . n 
A 1 147 TRP 147 392 392 TRP TRP A . n 
A 1 148 VAL 148 393 393 VAL VAL A . n 
A 1 149 VAL 149 394 394 VAL VAL A . n 
A 1 150 MET 150 395 395 MET MET A . n 
A 1 151 GLU 151 396 396 GLU GLU A . n 
A 1 152 PHE 152 397 397 PHE PHE A . n 
A 1 153 LEU 153 398 398 LEU LEU A . n 
A 1 154 GLU 154 399 399 GLU GLU A . n 
A 1 155 GLY 155 400 400 GLY GLY A . n 
A 1 156 GLY 156 401 401 GLY GLY A . n 
A 1 157 ALA 157 402 402 ALA ALA A . n 
A 1 158 LEU 158 403 403 LEU LEU A . n 
A 1 159 THR 159 404 404 THR THR A . n 
A 1 160 ASP 160 405 405 ASP ASP A . n 
A 1 161 ILE 161 406 406 ILE ILE A . n 
A 1 162 VAL 162 407 407 VAL VAL A . n 
A 1 163 THR 163 408 408 THR THR A . n 
A 1 164 HIS 164 409 409 HIS HIS A . n 
A 1 165 THR 165 410 410 THR THR A . n 
A 1 166 ARG 166 411 411 ARG ARG A . n 
A 1 167 MET 167 412 412 MET MET A . n 
A 1 168 ASN 168 413 413 ASN ASN A . n 
A 1 169 GLU 169 414 414 GLU GLU A . n 
A 1 170 GLU 170 415 415 GLU GLU A . n 
A 1 171 GLN 171 416 416 GLN GLN A . n 
A 1 172 ILE 172 417 417 ILE ILE A . n 
A 1 173 ALA 173 418 418 ALA ALA A . n 
A 1 174 ALA 174 419 419 ALA ALA A . n 
A 1 175 VAL 175 420 420 VAL VAL A . n 
A 1 176 CYS 176 421 421 CYS CYS A . n 
A 1 177 LEU 177 422 422 LEU LEU A . n 
A 1 178 ALA 178 423 423 ALA ALA A . n 
A 1 179 VAL 179 424 424 VAL VAL A . n 
A 1 180 LEU 180 425 425 LEU LEU A . n 
A 1 181 GLN 181 426 426 GLN GLN A . n 
A 1 182 ALA 182 427 427 ALA ALA A . n 
A 1 183 LEU 183 428 428 LEU LEU A . n 
A 1 184 SER 184 429 429 SER SER A . n 
A 1 185 VAL 185 430 430 VAL VAL A . n 
A 1 186 LEU 186 431 431 LEU LEU A . n 
A 1 187 HIS 187 432 432 HIS HIS A . n 
A 1 188 ALA 188 433 433 ALA ALA A . n 
A 1 189 GLN 189 434 434 GLN GLN A . n 
A 1 190 GLY 190 435 435 GLY GLY A . n 
A 1 191 VAL 191 436 436 VAL VAL A . n 
A 1 192 ILE 192 437 437 ILE ILE A . n 
A 1 193 HIS 193 438 438 HIS HIS A . n 
A 1 194 ARG 194 439 439 ARG ARG A . n 
A 1 195 ASP 195 440 440 ASP ASP A . n 
A 1 196 ILE 196 441 441 ILE ILE A . n 
A 1 197 LYS 197 442 442 LYS LYS A . n 
A 1 198 SER 198 443 443 SER SER A . n 
A 1 199 ASP 199 444 444 ASP ASP A . n 
A 1 200 SER 200 445 445 SER SER A . n 
A 1 201 ILE 201 446 446 ILE ILE A . n 
A 1 202 LEU 202 447 447 LEU LEU A . n 
A 1 203 LEU 203 448 448 LEU LEU A . n 
A 1 204 THR 204 449 449 THR THR A . n 
A 1 205 HIS 205 450 450 HIS HIS A . n 
A 1 206 ASP 206 451 451 ASP ASP A . n 
A 1 207 GLY 207 452 452 GLY GLY A . n 
A 1 208 ARG 208 453 453 ARG ARG A . n 
A 1 209 VAL 209 454 454 VAL VAL A . n 
A 1 210 LYS 210 455 455 LYS LYS A . n 
A 1 211 LEU 211 456 456 LEU LEU A . n 
A 1 212 SER 212 457 457 SER SER A . n 
A 1 213 ASP 213 458 458 ASP ASP A . n 
A 1 214 PHE 214 459 459 PHE PHE A . n 
A 1 215 GLY 215 460 460 GLY GLY A . n 
A 1 216 PHE 216 461 461 PHE PHE A . n 
A 1 217 CYS 217 462 462 CYS CYS A . n 
A 1 218 ALA 218 463 463 ALA ALA A . n 
A 1 219 GLN 219 464 464 GLN GLN A . n 
A 1 220 VAL 220 465 465 VAL VAL A . n 
A 1 221 SER 221 466 466 SER SER A . n 
A 1 222 LYS 222 467 467 LYS LYS A . n 
A 1 223 GLU 223 468 468 GLU GLU A . n 
A 1 224 VAL 224 469 469 VAL VAL A . n 
A 1 225 PRO 225 470 470 PRO PRO A . n 
A 1 226 ARG 226 471 471 ARG ARG A . n 
A 1 227 ARG 227 472 472 ARG ARG A . n 
A 1 228 LYS 228 473 473 LYS LYS A . n 
A 1 229 SEP 229 474 474 SEP SEP A . n 
A 1 230 LEU 230 475 475 LEU LEU A . n 
A 1 231 VAL 231 476 476 VAL VAL A . n 
A 1 232 GLY 232 477 477 GLY GLY A . n 
A 1 233 THR 233 478 478 THR THR A . n 
A 1 234 PRO 234 479 479 PRO PRO A . n 
A 1 235 TYR 235 480 480 TYR TYR A . n 
A 1 236 TRP 236 481 481 TRP TRP A . n 
A 1 237 MET 237 482 482 MET MET A . n 
A 1 238 ALA 238 483 483 ALA ALA A . n 
A 1 239 PRO 239 484 484 PRO PRO A . n 
A 1 240 GLU 240 485 485 GLU GLU A . n 
A 1 241 LEU 241 486 486 LEU LEU A . n 
A 1 242 ILE 242 487 487 ILE ILE A . n 
A 1 243 SER 243 488 488 SER SER A . n 
A 1 244 ARG 244 489 489 ARG ARG A . n 
A 1 245 LEU 245 490 490 LEU LEU A . n 
A 1 246 PRO 246 491 491 PRO PRO A . n 
A 1 247 TYR 247 492 492 TYR TYR A . n 
A 1 248 GLY 248 493 493 GLY GLY A . n 
A 1 249 PRO 249 494 494 PRO PRO A . n 
A 1 250 GLU 250 495 495 GLU GLU A . n 
A 1 251 VAL 251 496 496 VAL VAL A . n 
A 1 252 ASP 252 497 497 ASP ASP A . n 
A 1 253 ILE 253 498 498 ILE ILE A . n 
A 1 254 TRP 254 499 499 TRP TRP A . n 
A 1 255 SER 255 500 500 SER SER A . n 
A 1 256 LEU 256 501 501 LEU LEU A . n 
A 1 257 GLY 257 502 502 GLY GLY A . n 
A 1 258 ILE 258 503 503 ILE ILE A . n 
A 1 259 MET 259 504 504 MET MET A . n 
A 1 260 VAL 260 505 505 VAL VAL A . n 
A 1 261 ILE 261 506 506 ILE ILE A . n 
A 1 262 GLU 262 507 507 GLU GLU A . n 
A 1 263 MET 263 508 508 MET MET A . n 
A 1 264 VAL 264 509 509 VAL VAL A . n 
A 1 265 ASP 265 510 510 ASP ASP A . n 
A 1 266 GLY 266 511 511 GLY GLY A . n 
A 1 267 GLU 267 512 512 GLU GLU A . n 
A 1 268 PRO 268 513 513 PRO PRO A . n 
A 1 269 PRO 269 514 514 PRO PRO A . n 
A 1 270 TYR 270 515 515 TYR TYR A . n 
A 1 271 PHE 271 516 516 PHE PHE A . n 
A 1 272 ASN 272 517 517 ASN ASN A . n 
A 1 273 GLU 273 518 518 GLU GLU A . n 
A 1 274 PRO 274 519 519 PRO PRO A . n 
A 1 275 PRO 275 520 520 PRO PRO A . n 
A 1 276 LEU 276 521 521 LEU LEU A . n 
A 1 277 LYS 277 522 522 LYS LYS A . n 
A 1 278 ALA 278 523 523 ALA ALA A . n 
A 1 279 MET 279 524 524 MET MET A . n 
A 1 280 LYS 280 525 525 LYS LYS A . n 
A 1 281 MET 281 526 526 MET MET A . n 
A 1 282 ILE 282 527 527 ILE ILE A . n 
A 1 283 ARG 283 528 528 ARG ARG A . n 
A 1 284 ASP 284 529 529 ASP ASP A . n 
A 1 285 ASN 285 530 530 ASN ASN A . n 
A 1 286 LEU 286 531 531 LEU LEU A . n 
A 1 287 PRO 287 532 532 PRO PRO A . n 
A 1 288 PRO 288 533 533 PRO PRO A . n 
A 1 289 ARG 289 534 534 ARG ARG A . n 
A 1 290 LEU 290 535 535 LEU LEU A . n 
A 1 291 LYS 291 536 536 LYS LYS A . n 
A 1 292 ASN 292 537 537 ASN ASN A . n 
A 1 293 LEU 293 538 538 LEU LEU A . n 
A 1 294 HIS 294 539 539 HIS HIS A . n 
A 1 295 LYS 295 540 540 LYS LYS A . n 
A 1 296 VAL 296 541 541 VAL VAL A . n 
A 1 297 SER 297 542 542 SER SER A . n 
A 1 298 PRO 298 543 543 PRO PRO A . n 
A 1 299 SER 299 544 544 SER SER A . n 
A 1 300 LEU 300 545 545 LEU LEU A . n 
A 1 301 LYS 301 546 546 LYS LYS A . n 
A 1 302 GLY 302 547 547 GLY GLY A . n 
A 1 303 PHE 303 548 548 PHE PHE A . n 
A 1 304 LEU 304 549 549 LEU LEU A . n 
A 1 305 ASP 305 550 550 ASP ASP A . n 
A 1 306 ARG 306 551 551 ARG ARG A . n 
A 1 307 LEU 307 552 552 LEU LEU A . n 
A 1 308 LEU 308 553 553 LEU LEU A . n 
A 1 309 VAL 309 554 554 VAL VAL A . n 
A 1 310 ARG 310 555 555 ARG ARG A . n 
A 1 311 ASP 311 556 556 ASP ASP A . n 
A 1 312 PRO 312 557 557 PRO PRO A . n 
A 1 313 ALA 313 558 558 ALA ALA A . n 
A 1 314 GLN 314 559 559 GLN GLN A . n 
A 1 315 ARG 315 560 560 ARG ARG A . n 
A 1 316 ALA 316 561 561 ALA ALA A . n 
A 1 317 THR 317 562 562 THR THR A . n 
A 1 318 ALA 318 563 563 ALA ALA A . n 
A 1 319 ALA 319 564 564 ALA ALA A . n 
A 1 320 GLU 320 565 565 GLU GLU A . n 
A 1 321 LEU 321 566 566 LEU LEU A . n 
A 1 322 LEU 322 567 567 LEU LEU A . n 
A 1 323 LYS 323 568 568 LYS LYS A . n 
A 1 324 HIS 324 569 569 HIS HIS A . n 
A 1 325 PRO 325 570 570 PRO PRO A . n 
A 1 326 PHE 326 571 571 PHE PHE A . n 
A 1 327 LEU 327 572 572 LEU LEU A . n 
A 1 328 ALA 328 573 573 ALA ALA A . n 
A 1 329 LYS 329 574 574 LYS LYS A . n 
A 1 330 ALA 330 575 575 ALA ALA A . n 
A 1 331 GLY 331 576 576 GLY GLY A . n 
A 1 332 PRO 332 577 577 PRO PRO A . n 
A 1 333 PRO 333 578 578 PRO PRO A . n 
A 1 334 ALA 334 579 579 ALA ALA A . n 
A 1 335 SER 335 580 580 SER SER A . n 
A 1 336 ILE 336 581 581 ILE ILE A . n 
A 1 337 VAL 337 582 582 VAL VAL A . n 
A 1 338 PRO 338 583 583 PRO PRO A . n 
A 1 339 LEU 339 584 584 LEU LEU A . n 
A 1 340 MET 340 585 585 MET MET A . n 
A 1 341 ARG 341 586 586 ARG ARG A . n 
A 1 342 GLN 342 587 587 GLN GLN A . n 
A 1 343 ASN 343 588 588 ASN ASN A . n 
A 1 344 ARG 344 589 589 ARG ARG A . n 
A 1 345 THR 345 590 590 THR THR A . n 
A 1 346 ARG 346 591 ?   ?   ?   A . n 
B 2 1   ARG 1   503 ?   ?   ?   B . n 
B 2 2   LYS 2   504 504 LYS LYS B . n 
B 2 3   LYS 3   505 505 LYS LYS B . n 
B 2 4   ARG 4   506 506 ARG ARG B . n 
B 2 5   TYR 5   507 507 TYR TYR B . n 
B 2 6   THR 6   508 508 THR THR B . n 
B 2 7   VAL 7   509 509 VAL VAL B . n 
B 2 8   VAL 8   510 510 VAL VAL B . n 
B 2 9   GLY 9   511 511 GLY GLY B . n 
B 2 10  ASN 10  512 512 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   601 136 HOH HOH A . 
C 3 HOH 2   602 15  HOH HOH A . 
C 3 HOH 3   603 99  HOH HOH A . 
C 3 HOH 4   604 41  HOH HOH A . 
C 3 HOH 5   605 94  HOH HOH A . 
C 3 HOH 6   606 64  HOH HOH A . 
C 3 HOH 7   607 116 HOH HOH A . 
C 3 HOH 8   608 82  HOH HOH A . 
C 3 HOH 9   609 16  HOH HOH A . 
C 3 HOH 10  610 57  HOH HOH A . 
C 3 HOH 11  611 96  HOH HOH A . 
C 3 HOH 12  612 37  HOH HOH A . 
C 3 HOH 13  613 44  HOH HOH A . 
C 3 HOH 14  614 70  HOH HOH A . 
C 3 HOH 15  615 21  HOH HOH A . 
C 3 HOH 16  616 23  HOH HOH A . 
C 3 HOH 17  617 8   HOH HOH A . 
C 3 HOH 18  618 7   HOH HOH A . 
C 3 HOH 19  619 122 HOH HOH A . 
C 3 HOH 20  620 43  HOH HOH A . 
C 3 HOH 21  621 19  HOH HOH A . 
C 3 HOH 22  622 55  HOH HOH A . 
C 3 HOH 23  623 26  HOH HOH A . 
C 3 HOH 24  624 115 HOH HOH A . 
C 3 HOH 25  625 133 HOH HOH A . 
C 3 HOH 26  626 91  HOH HOH A . 
C 3 HOH 27  627 39  HOH HOH A . 
C 3 HOH 28  628 111 HOH HOH A . 
C 3 HOH 29  629 14  HOH HOH A . 
C 3 HOH 30  630 65  HOH HOH A . 
C 3 HOH 31  631 69  HOH HOH A . 
C 3 HOH 32  632 134 HOH HOH A . 
C 3 HOH 33  633 22  HOH HOH A . 
C 3 HOH 34  634 119 HOH HOH A . 
C 3 HOH 35  635 100 HOH HOH A . 
C 3 HOH 36  636 121 HOH HOH A . 
C 3 HOH 37  637 10  HOH HOH A . 
C 3 HOH 38  638 31  HOH HOH A . 
C 3 HOH 39  639 40  HOH HOH A . 
C 3 HOH 40  640 61  HOH HOH A . 
C 3 HOH 41  641 112 HOH HOH A . 
C 3 HOH 42  642 32  HOH HOH A . 
C 3 HOH 43  643 120 HOH HOH A . 
C 3 HOH 44  644 3   HOH HOH A . 
C 3 HOH 45  645 53  HOH HOH A . 
C 3 HOH 46  646 45  HOH HOH A . 
C 3 HOH 47  647 13  HOH HOH A . 
C 3 HOH 48  648 12  HOH HOH A . 
C 3 HOH 49  649 101 HOH HOH A . 
C 3 HOH 50  650 28  HOH HOH A . 
C 3 HOH 51  651 73  HOH HOH A . 
C 3 HOH 52  652 18  HOH HOH A . 
C 3 HOH 53  653 80  HOH HOH A . 
C 3 HOH 54  654 75  HOH HOH A . 
C 3 HOH 55  655 11  HOH HOH A . 
C 3 HOH 56  656 2   HOH HOH A . 
C 3 HOH 57  657 52  HOH HOH A . 
C 3 HOH 58  658 66  HOH HOH A . 
C 3 HOH 59  659 76  HOH HOH A . 
C 3 HOH 60  660 9   HOH HOH A . 
C 3 HOH 61  661 4   HOH HOH A . 
C 3 HOH 62  662 1   HOH HOH A . 
C 3 HOH 63  663 17  HOH HOH A . 
C 3 HOH 64  664 142 HOH HOH A . 
C 3 HOH 65  665 24  HOH HOH A . 
C 3 HOH 66  666 50  HOH HOH A . 
C 3 HOH 67  667 123 HOH HOH A . 
C 3 HOH 68  668 20  HOH HOH A . 
C 3 HOH 69  669 58  HOH HOH A . 
C 3 HOH 70  670 97  HOH HOH A . 
C 3 HOH 71  671 71  HOH HOH A . 
C 3 HOH 72  672 25  HOH HOH A . 
C 3 HOH 73  673 56  HOH HOH A . 
C 3 HOH 74  674 90  HOH HOH A . 
C 3 HOH 75  675 93  HOH HOH A . 
C 3 HOH 76  676 81  HOH HOH A . 
C 3 HOH 77  677 85  HOH HOH A . 
C 3 HOH 78  678 46  HOH HOH A . 
C 3 HOH 79  679 47  HOH HOH A . 
C 3 HOH 80  680 68  HOH HOH A . 
C 3 HOH 81  681 113 HOH HOH A . 
C 3 HOH 82  682 51  HOH HOH A . 
C 3 HOH 83  683 5   HOH HOH A . 
C 3 HOH 84  684 92  HOH HOH A . 
C 3 HOH 85  685 42  HOH HOH A . 
C 3 HOH 86  686 132 HOH HOH A . 
C 3 HOH 87  687 72  HOH HOH A . 
C 3 HOH 88  688 6   HOH HOH A . 
C 3 HOH 89  689 86  HOH HOH A . 
C 3 HOH 90  690 49  HOH HOH A . 
C 3 HOH 91  691 109 HOH HOH A . 
C 3 HOH 92  692 89  HOH HOH A . 
C 3 HOH 93  693 114 HOH HOH A . 
C 3 HOH 94  694 108 HOH HOH A . 
C 3 HOH 95  695 48  HOH HOH A . 
C 3 HOH 96  696 74  HOH HOH A . 
C 3 HOH 97  697 34  HOH HOH A . 
C 3 HOH 98  698 127 HOH HOH A . 
C 3 HOH 99  699 87  HOH HOH A . 
C 3 HOH 100 700 98  HOH HOH A . 
C 3 HOH 101 701 54  HOH HOH A . 
C 3 HOH 102 702 30  HOH HOH A . 
C 3 HOH 103 703 33  HOH HOH A . 
C 3 HOH 104 704 117 HOH HOH A . 
C 3 HOH 105 705 106 HOH HOH A . 
C 3 HOH 106 706 62  HOH HOH A . 
C 3 HOH 107 707 107 HOH HOH A . 
C 3 HOH 108 708 38  HOH HOH A . 
C 3 HOH 109 709 78  HOH HOH A . 
C 3 HOH 110 710 83  HOH HOH A . 
C 3 HOH 111 711 36  HOH HOH A . 
C 3 HOH 112 712 63  HOH HOH A . 
C 3 HOH 113 713 124 HOH HOH A . 
C 3 HOH 114 714 84  HOH HOH A . 
C 3 HOH 115 715 95  HOH HOH A . 
C 3 HOH 116 716 128 HOH HOH A . 
C 3 HOH 117 717 102 HOH HOH A . 
C 3 HOH 118 718 140 HOH HOH A . 
C 3 HOH 119 719 138 HOH HOH A . 
C 3 HOH 120 720 141 HOH HOH A . 
C 3 HOH 121 721 135 HOH HOH A . 
C 3 HOH 122 722 139 HOH HOH A . 
C 3 HOH 123 723 137 HOH HOH A . 
C 3 HOH 124 724 29  HOH HOH A . 
C 3 HOH 125 725 104 HOH HOH A . 
C 3 HOH 126 726 130 HOH HOH A . 
C 3 HOH 127 727 131 HOH HOH A . 
C 3 HOH 128 728 67  HOH HOH A . 
C 3 HOH 129 729 77  HOH HOH A . 
C 3 HOH 130 730 125 HOH HOH A . 
D 3 HOH 1   601 59  HOH HOH B . 
D 3 HOH 2   602 88  HOH HOH B . 
D 3 HOH 3   603 35  HOH HOH B . 
D 3 HOH 4   604 129 HOH HOH B . 
D 3 HOH 5   605 110 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     229 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      474 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1290  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  13980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-06-24 
2 'Structure model' 1 1 2020-07-08 
3 'Structure model' 1 2 2020-08-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.page_first'              
2 2 'Structure model' '_citation.page_last'               
3 2 'Structure model' '_citation.pdbx_database_id_DOI'    
4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
5 2 'Structure model' '_citation.title'                   
6 2 'Structure model' '_citation_author.name'             
7 3 'Structure model' '_citation.journal_volume'          
8 3 'Structure model' '_citation_author.name'             
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 14.3959 -11.3082 22.8016 0.2872 ? 0.0332  ? -0.0224 ? 0.1988 ? 0.0171 ? 0.2688 ? 3.3148 ? 1.9549 ? 
0.4983  ? 3.8838 ? 0.3395  ? 2.8740 ? -0.0277 ? 0.0523  ? -0.1241 ? -0.0277 ? -0.0345 ? 0.1123 ? 0.1943  ? 0.0451  ? 0.0469  ? 
2 'X-RAY DIFFRACTION' ? refined 21.7098 -8.8224  -0.7617 0.2632 ? 0.0096  ? -0.0021 ? 0.2541 ? 0.0665 ? 0.2558 ? 2.1684 ? 1.1260 ? 
-0.5317 ? 4.5957 ? -0.0137 ? 2.1279 ? -0.0703 ? 0.2054  ? 0.0911  ? -0.4074 ? 0.0963  ? 0.0796 ? 0.0234  ? -0.0332 ? -0.0271 ? 
3 'X-RAY DIFFRACTION' ? refined 6.3727  -9.3937  4.3537  0.4129 ? -0.0079 ? 0.0599  ? 0.5655 ? 0.0884 ? 0.8870 ? 7.9005 ? 5.2934 ? 
-3.7822 ? 2.0020 ? -5.8268 ? 8.2329 ? 0.2363  ? -0.3129 ? 0.0151  ? 0.1865  ? 0.1867  ? 2.4534 ? -0.0058 ? -1.2738 ? -0.4120 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 299 ? ? ? A 395 ? ? 
;chain 'A' and (resid 299 through 395 )
;
2 'X-RAY DIFFRACTION' 2 ? ? A 396 ? ? ? A 590 ? ? 
;chain 'A' and (resid 396 through 590 )
;
3 'X-RAY DIFFRACTION' 3 ? ? B 504 ? ? ? B 512 ? ? 
;chain 'B' and (resid 504 through 512 )
;
# 
_pdbx_phasing_MR.entry_id                     6WLY 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          5.570 
_pdbx_phasing_MR.d_res_low_rotation           43.580 
_pdbx_phasing_MR.d_res_high_translation       5.570 
_pdbx_phasing_MR.d_res_low_translation        43.580 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.17.1_3660 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.8.1       3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25        4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .           5 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           6 
# 
_pdbx_entry_details.entry_id                 6WLY 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 440 ? ? -142.65 46.72 
2 1 ASN A 537 ? ? -115.95 59.00 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 246 ? A MET 1   
2  1 Y 1 A GLY 247 ? A GLY 2   
3  1 Y 1 A SER 248 ? A SER 3   
4  1 Y 1 A SER 249 ? A SER 4   
5  1 Y 1 A HIS 250 ? A HIS 5   
6  1 Y 1 A HIS 251 ? A HIS 6   
7  1 Y 1 A HIS 252 ? A HIS 7   
8  1 Y 1 A HIS 253 ? A HIS 8   
9  1 Y 1 A HIS 254 ? A HIS 9   
10 1 Y 1 A HIS 255 ? A HIS 10  
11 1 Y 1 A SER 256 ? A SER 11  
12 1 Y 1 A SER 257 ? A SER 12  
13 1 Y 1 A GLY 258 ? A GLY 13  
14 1 Y 1 A LEU 259 ? A LEU 14  
15 1 Y 1 A VAL 260 ? A VAL 15  
16 1 Y 1 A PRO 261 ? A PRO 16  
17 1 Y 1 A ARG 262 ? A ARG 17  
18 1 Y 1 A GLY 263 ? A GLY 18  
19 1 Y 1 A SER 264 ? A SER 19  
20 1 Y 1 A HIS 265 ? A HIS 20  
21 1 Y 1 A MET 266 ? A MET 21  
22 1 Y 1 A GLU 267 ? A GLU 22  
23 1 Y 1 A ASN 268 ? A ASN 23  
24 1 Y 1 A LEU 269 ? A LEU 24  
25 1 Y 1 A TYR 270 ? A TYR 25  
26 1 Y 1 A PHE 271 ? A PHE 26  
27 1 Y 1 A GLN 272 ? A GLN 27  
28 1 Y 1 A GLY 273 ? A GLY 28  
29 1 Y 1 A ALA 274 ? A ALA 29  
30 1 Y 1 A ARG 275 ? A ARG 30  
31 1 Y 1 A ALA 276 ? A ALA 31  
32 1 Y 1 A ARG 277 ? A ARG 32  
33 1 Y 1 A GLN 278 ? A GLN 33  
34 1 Y 1 A GLU 279 ? A GLU 34  
35 1 Y 1 A ASN 280 ? A ASN 35  
36 1 Y 1 A GLY 281 ? A GLY 36  
37 1 Y 1 A MET 282 ? A MET 37  
38 1 Y 1 A PRO 283 ? A PRO 38  
39 1 Y 1 A GLU 284 ? A GLU 39  
40 1 Y 1 A LYS 285 ? A LYS 40  
41 1 Y 1 A PRO 286 ? A PRO 41  
42 1 Y 1 A PRO 287 ? A PRO 42  
43 1 Y 1 A GLY 288 ? A GLY 43  
44 1 Y 1 A PRO 289 ? A PRO 44  
45 1 Y 1 A ARG 290 ? A ARG 45  
46 1 Y 1 A SER 291 ? A SER 46  
47 1 Y 1 A PRO 292 ? A PRO 47  
48 1 Y 1 A GLN 293 ? A GLN 48  
49 1 Y 1 A ARG 294 ? A ARG 49  
50 1 Y 1 A GLU 295 ? A GLU 50  
51 1 Y 1 A PRO 296 ? A PRO 51  
52 1 Y 1 A GLN 297 ? A GLN 52  
53 1 Y 1 A ARG 298 ? A ARG 53  
54 1 Y 1 A ARG 591 ? A ARG 346 
55 1 Y 1 B ARG 503 ? B ARG 1   
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM102262     1 
'American Heart Association'                                                               'United States' 19IPLOI34740007 2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_related_exp_data_set.data_reference       . 
_pdbx_related_exp_data_set.data_set_type        'diffraction image data' 
_pdbx_related_exp_data_set.details              ? 
_pdbx_related_exp_data_set.metadata_reference   10.15785/SBGRID/782 
_pdbx_related_exp_data_set.ordinal              1 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#