data_6WPF
# 
_entry.id   6WPF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WPF         
WWPDB D_1000248728 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WPF 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bertoletti, N.' 1 0000-0001-5167-402X 
'Anderson, K.S.' 2 0000-0003-3433-0780 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Molecules 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1420-3049 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Post-Catalytic Complexes with Emtricitabine or Stavudine and HIV-1 Reverse Transcriptase Reveal New Mechanistic Insights for Nucleotide Incorporation and Drug Resistance.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/molecules25204868 
_citation.pdbx_database_id_PubMed   33096918 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bertoletti, N.' 1 0000-0001-5167-402X 
primary 'Chan, A.H.'     2 ?                   
primary 'Schinazi, R.F.' 3 ?                   
primary 'Anderson, K.S.' 4 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WPF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     165.569 
_cell.length_a_esd                 ? 
_cell.length_b                     170.468 
_cell.length_b_esd                 ? 
_cell.length_c                     103.343 
_cell.length_c_esd                 ? 
_cell.volume                       2916775.184 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WPF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn 'DNA Primer 21-mer'                                                                                            
6476.240  1   ?                              ?              ? ? 
2  polymer     syn 'DNA template 27-mer'                                                                                          
8392.398  1   ?                              ?              ? ? 
3  polymer     man 'Reverse transcriptase/ribonuclease H'                                                                         
64653.090 1   '2.7.7.49, 2.7.7.7, 3.1.26.13' 'C280S, Q258C' ? ? 
4  polymer     man 'p51 RT'                                                                                                       
52748.418 1   2.7.7.-,3.1.-.-                C280S          ? ? 
5  non-polymer syn '[(5R)-5-(5-METHYL-2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-2,5-DIHYDROFURAN-2-YL]METHYL DIHYDROGEN PHOSPHATE' 
304.193   1   ?                              ?              ? ? 
6  non-polymer syn 'SULFATE ION'                                                                                                  
96.063    4   ?                              ?              ? ? 
7  non-polymer syn 'MAGNESIUM ION'                                                                                                
24.305    3   ?                              ?              ? ? 
8  non-polymer syn 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
464.153   1   ?                              ?              ? ? 
9  non-polymer syn GLYCEROL                                                                                                       
92.094    1   ?                              ?              ? ? 
10 water       nat water                                                                                                          
18.015    139 ?                              ?              ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(G47)(DC)(DG)(DC)
(DC)(DG)
;
ACAGTCCCTGTTCGGGCGCCG P ? 
2 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DA)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGACGGCGCCCGAACAGGGACTGTG T ? 
3 'polypeptide(L)'        no no  
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
A ? 
4 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DC  n 
1 3   DA  n 
1 4   DG  n 
1 5   DT  n 
1 6   DC  n 
1 7   DC  n 
1 8   DC  n 
1 9   DT  n 
1 10  DG  n 
1 11  DT  n 
1 12  DT  n 
1 13  DC  n 
1 14  DG  n 
1 15  DG  n 
1 16  G47 n 
1 17  DC  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DG  n 
2 1   DA  n 
2 2   DT  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DC  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DC  n 
2 13  DC  n 
2 14  DG  n 
2 15  DA  n 
2 16  DA  n 
2 17  DC  n 
2 18  DA  n 
2 19  DG  n 
2 20  DG  n 
2 21  DG  n 
2 22  DA  n 
2 23  DC  n 
2 24  DT  n 
2 25  DG  n 
2 26  DT  n 
2 27  DG  n 
3 1   MET n 
3 2   PRO n 
3 3   ILE n 
3 4   SER n 
3 5   PRO n 
3 6   ILE n 
3 7   GLU n 
3 8   THR n 
3 9   VAL n 
3 10  PRO n 
3 11  VAL n 
3 12  LYS n 
3 13  LEU n 
3 14  LYS n 
3 15  PRO n 
3 16  GLY n 
3 17  MET n 
3 18  ASP n 
3 19  GLY n 
3 20  PRO n 
3 21  LYS n 
3 22  VAL n 
3 23  LYS n 
3 24  GLN n 
3 25  TRP n 
3 26  PRO n 
3 27  LEU n 
3 28  THR n 
3 29  GLU n 
3 30  GLU n 
3 31  LYS n 
3 32  ILE n 
3 33  LYS n 
3 34  ALA n 
3 35  LEU n 
3 36  VAL n 
3 37  GLU n 
3 38  ILE n 
3 39  CYS n 
3 40  THR n 
3 41  GLU n 
3 42  MET n 
3 43  GLU n 
3 44  LYS n 
3 45  GLU n 
3 46  GLY n 
3 47  LYS n 
3 48  ILE n 
3 49  SER n 
3 50  LYS n 
3 51  ILE n 
3 52  GLY n 
3 53  PRO n 
3 54  GLU n 
3 55  ASN n 
3 56  PRO n 
3 57  TYR n 
3 58  ASN n 
3 59  THR n 
3 60  PRO n 
3 61  VAL n 
3 62  PHE n 
3 63  ALA n 
3 64  ILE n 
3 65  LYS n 
3 66  LYS n 
3 67  LYS n 
3 68  ASP n 
3 69  SER n 
3 70  THR n 
3 71  LYS n 
3 72  TRP n 
3 73  ARG n 
3 74  LYS n 
3 75  LEU n 
3 76  VAL n 
3 77  ASP n 
3 78  PHE n 
3 79  ARG n 
3 80  GLU n 
3 81  LEU n 
3 82  ASN n 
3 83  LYS n 
3 84  ARG n 
3 85  THR n 
3 86  GLN n 
3 87  ASP n 
3 88  PHE n 
3 89  TRP n 
3 90  GLU n 
3 91  VAL n 
3 92  GLN n 
3 93  LEU n 
3 94  GLY n 
3 95  ILE n 
3 96  PRO n 
3 97  HIS n 
3 98  PRO n 
3 99  ALA n 
3 100 GLY n 
3 101 LEU n 
3 102 LYS n 
3 103 LYS n 
3 104 LYS n 
3 105 LYS n 
3 106 SER n 
3 107 VAL n 
3 108 THR n 
3 109 VAL n 
3 110 LEU n 
3 111 ASP n 
3 112 VAL n 
3 113 GLY n 
3 114 ASP n 
3 115 ALA n 
3 116 TYR n 
3 117 PHE n 
3 118 SER n 
3 119 VAL n 
3 120 PRO n 
3 121 LEU n 
3 122 ASP n 
3 123 GLU n 
3 124 ASP n 
3 125 PHE n 
3 126 ARG n 
3 127 LYS n 
3 128 TYR n 
3 129 THR n 
3 130 ALA n 
3 131 PHE n 
3 132 THR n 
3 133 ILE n 
3 134 PRO n 
3 135 SER n 
3 136 ILE n 
3 137 ASN n 
3 138 ASN n 
3 139 GLU n 
3 140 THR n 
3 141 PRO n 
3 142 GLY n 
3 143 ILE n 
3 144 ARG n 
3 145 TYR n 
3 146 GLN n 
3 147 TYR n 
3 148 ASN n 
3 149 VAL n 
3 150 LEU n 
3 151 PRO n 
3 152 GLN n 
3 153 GLY n 
3 154 TRP n 
3 155 LYS n 
3 156 GLY n 
3 157 SER n 
3 158 PRO n 
3 159 ALA n 
3 160 ILE n 
3 161 PHE n 
3 162 GLN n 
3 163 SER n 
3 164 SER n 
3 165 MET n 
3 166 THR n 
3 167 LYS n 
3 168 ILE n 
3 169 LEU n 
3 170 GLU n 
3 171 PRO n 
3 172 PHE n 
3 173 ARG n 
3 174 LYS n 
3 175 GLN n 
3 176 ASN n 
3 177 PRO n 
3 178 ASP n 
3 179 ILE n 
3 180 VAL n 
3 181 ILE n 
3 182 TYR n 
3 183 GLN n 
3 184 TYR n 
3 185 MET n 
3 186 ASP n 
3 187 ASP n 
3 188 LEU n 
3 189 TYR n 
3 190 VAL n 
3 191 GLY n 
3 192 SER n 
3 193 ASP n 
3 194 LEU n 
3 195 GLU n 
3 196 ILE n 
3 197 GLY n 
3 198 GLN n 
3 199 HIS n 
3 200 ARG n 
3 201 THR n 
3 202 LYS n 
3 203 ILE n 
3 204 GLU n 
3 205 GLU n 
3 206 LEU n 
3 207 ARG n 
3 208 GLN n 
3 209 HIS n 
3 210 LEU n 
3 211 LEU n 
3 212 ARG n 
3 213 TRP n 
3 214 GLY n 
3 215 LEU n 
3 216 THR n 
3 217 THR n 
3 218 PRO n 
3 219 ASP n 
3 220 LYS n 
3 221 LYS n 
3 222 HIS n 
3 223 GLN n 
3 224 LYS n 
3 225 GLU n 
3 226 PRO n 
3 227 PRO n 
3 228 PHE n 
3 229 LEU n 
3 230 TRP n 
3 231 MET n 
3 232 GLY n 
3 233 TYR n 
3 234 GLU n 
3 235 LEU n 
3 236 HIS n 
3 237 PRO n 
3 238 ASP n 
3 239 LYS n 
3 240 TRP n 
3 241 THR n 
3 242 VAL n 
3 243 GLN n 
3 244 PRO n 
3 245 ILE n 
3 246 VAL n 
3 247 LEU n 
3 248 PRO n 
3 249 GLU n 
3 250 LYS n 
3 251 ASP n 
3 252 SER n 
3 253 TRP n 
3 254 THR n 
3 255 VAL n 
3 256 ASN n 
3 257 ASP n 
3 258 ILE n 
3 259 CYS n 
3 260 LYS n 
3 261 LEU n 
3 262 VAL n 
3 263 GLY n 
3 264 LYS n 
3 265 LEU n 
3 266 ASN n 
3 267 TRP n 
3 268 ALA n 
3 269 SER n 
3 270 GLN n 
3 271 ILE n 
3 272 TYR n 
3 273 PRO n 
3 274 GLY n 
3 275 ILE n 
3 276 LYS n 
3 277 VAL n 
3 278 ARG n 
3 279 GLN n 
3 280 LEU n 
3 281 SER n 
3 282 LYS n 
3 283 LEU n 
3 284 LEU n 
3 285 ARG n 
3 286 GLY n 
3 287 THR n 
3 288 LYS n 
3 289 ALA n 
3 290 LEU n 
3 291 THR n 
3 292 GLU n 
3 293 VAL n 
3 294 ILE n 
3 295 PRO n 
3 296 LEU n 
3 297 THR n 
3 298 GLU n 
3 299 GLU n 
3 300 ALA n 
3 301 GLU n 
3 302 LEU n 
3 303 GLU n 
3 304 LEU n 
3 305 ALA n 
3 306 GLU n 
3 307 ASN n 
3 308 ARG n 
3 309 GLU n 
3 310 ILE n 
3 311 LEU n 
3 312 LYS n 
3 313 GLU n 
3 314 PRO n 
3 315 VAL n 
3 316 HIS n 
3 317 GLY n 
3 318 VAL n 
3 319 TYR n 
3 320 TYR n 
3 321 ASP n 
3 322 PRO n 
3 323 SER n 
3 324 LYS n 
3 325 ASP n 
3 326 LEU n 
3 327 ILE n 
3 328 ALA n 
3 329 GLU n 
3 330 ILE n 
3 331 GLN n 
3 332 LYS n 
3 333 GLN n 
3 334 GLY n 
3 335 GLN n 
3 336 GLY n 
3 337 GLN n 
3 338 TRP n 
3 339 THR n 
3 340 TYR n 
3 341 GLN n 
3 342 ILE n 
3 343 TYR n 
3 344 GLN n 
3 345 GLU n 
3 346 PRO n 
3 347 PHE n 
3 348 LYS n 
3 349 ASN n 
3 350 LEU n 
3 351 LYS n 
3 352 THR n 
3 353 GLY n 
3 354 LYS n 
3 355 TYR n 
3 356 ALA n 
3 357 ARG n 
3 358 MET n 
3 359 ARG n 
3 360 GLY n 
3 361 ALA n 
3 362 HIS n 
3 363 THR n 
3 364 ASN n 
3 365 ASP n 
3 366 VAL n 
3 367 LYS n 
3 368 GLN n 
3 369 LEU n 
3 370 THR n 
3 371 GLU n 
3 372 ALA n 
3 373 VAL n 
3 374 GLN n 
3 375 LYS n 
3 376 ILE n 
3 377 THR n 
3 378 THR n 
3 379 GLU n 
3 380 SER n 
3 381 ILE n 
3 382 VAL n 
3 383 ILE n 
3 384 TRP n 
3 385 GLY n 
3 386 LYS n 
3 387 THR n 
3 388 PRO n 
3 389 LYS n 
3 390 PHE n 
3 391 LYS n 
3 392 LEU n 
3 393 PRO n 
3 394 ILE n 
3 395 GLN n 
3 396 LYS n 
3 397 GLU n 
3 398 THR n 
3 399 TRP n 
3 400 GLU n 
3 401 THR n 
3 402 TRP n 
3 403 TRP n 
3 404 THR n 
3 405 GLU n 
3 406 TYR n 
3 407 TRP n 
3 408 GLN n 
3 409 ALA n 
3 410 THR n 
3 411 TRP n 
3 412 ILE n 
3 413 PRO n 
3 414 GLU n 
3 415 TRP n 
3 416 GLU n 
3 417 PHE n 
3 418 VAL n 
3 419 ASN n 
3 420 THR n 
3 421 PRO n 
3 422 PRO n 
3 423 LEU n 
3 424 VAL n 
3 425 LYS n 
3 426 LEU n 
3 427 TRP n 
3 428 TYR n 
3 429 GLN n 
3 430 LEU n 
3 431 GLU n 
3 432 LYS n 
3 433 GLU n 
3 434 PRO n 
3 435 ILE n 
3 436 VAL n 
3 437 GLY n 
3 438 ALA n 
3 439 GLU n 
3 440 THR n 
3 441 PHE n 
3 442 TYR n 
3 443 VAL n 
3 444 ASP n 
3 445 GLY n 
3 446 ALA n 
3 447 ALA n 
3 448 ASN n 
3 449 ARG n 
3 450 GLU n 
3 451 THR n 
3 452 LYS n 
3 453 LEU n 
3 454 GLY n 
3 455 LYS n 
3 456 ALA n 
3 457 GLY n 
3 458 TYR n 
3 459 VAL n 
3 460 THR n 
3 461 ASN n 
3 462 ARG n 
3 463 GLY n 
3 464 ARG n 
3 465 GLN n 
3 466 LYS n 
3 467 VAL n 
3 468 VAL n 
3 469 THR n 
3 470 LEU n 
3 471 THR n 
3 472 ASP n 
3 473 THR n 
3 474 THR n 
3 475 ASN n 
3 476 GLN n 
3 477 LYS n 
3 478 THR n 
3 479 GLU n 
3 480 LEU n 
3 481 GLN n 
3 482 ALA n 
3 483 ILE n 
3 484 TYR n 
3 485 LEU n 
3 486 ALA n 
3 487 LEU n 
3 488 GLN n 
3 489 ASP n 
3 490 SER n 
3 491 GLY n 
3 492 LEU n 
3 493 GLU n 
3 494 VAL n 
3 495 ASN n 
3 496 ILE n 
3 497 VAL n 
3 498 THR n 
3 499 ASP n 
3 500 SER n 
3 501 GLN n 
3 502 TYR n 
3 503 ALA n 
3 504 LEU n 
3 505 GLY n 
3 506 ILE n 
3 507 ILE n 
3 508 GLN n 
3 509 ALA n 
3 510 GLN n 
3 511 PRO n 
3 512 ASP n 
3 513 GLN n 
3 514 SER n 
3 515 GLU n 
3 516 SER n 
3 517 GLU n 
3 518 LEU n 
3 519 VAL n 
3 520 ASN n 
3 521 GLN n 
3 522 ILE n 
3 523 ILE n 
3 524 GLU n 
3 525 GLN n 
3 526 LEU n 
3 527 ILE n 
3 528 LYS n 
3 529 LYS n 
3 530 GLU n 
3 531 LYS n 
3 532 VAL n 
3 533 TYR n 
3 534 LEU n 
3 535 ALA n 
3 536 TRP n 
3 537 VAL n 
3 538 PRO n 
3 539 ALA n 
3 540 HIS n 
3 541 LYS n 
3 542 GLY n 
3 543 ILE n 
3 544 GLY n 
3 545 GLY n 
3 546 ASN n 
3 547 GLU n 
3 548 GLN n 
3 549 VAL n 
3 550 ASP n 
3 551 LYS n 
3 552 LEU n 
3 553 VAL n 
3 554 SER n 
3 555 ALA n 
3 556 GLY n 
3 557 ILE n 
3 558 ARG n 
3 559 LYS n 
3 560 VAL n 
3 561 LEU n 
4 1   MET n 
4 2   GLY n 
4 3   SER n 
4 4   SER n 
4 5   HIS n 
4 6   HIS n 
4 7   HIS n 
4 8   HIS n 
4 9   HIS n 
4 10  HIS n 
4 11  SER n 
4 12  SER n 
4 13  PRO n 
4 14  ILE n 
4 15  SER n 
4 16  PRO n 
4 17  ILE n 
4 18  GLU n 
4 19  THR n 
4 20  VAL n 
4 21  PRO n 
4 22  VAL n 
4 23  LYS n 
4 24  LEU n 
4 25  LYS n 
4 26  PRO n 
4 27  GLY n 
4 28  MET n 
4 29  ASP n 
4 30  GLY n 
4 31  PRO n 
4 32  LYS n 
4 33  VAL n 
4 34  LYS n 
4 35  GLN n 
4 36  TRP n 
4 37  PRO n 
4 38  LEU n 
4 39  THR n 
4 40  GLU n 
4 41  GLU n 
4 42  LYS n 
4 43  ILE n 
4 44  LYS n 
4 45  ALA n 
4 46  LEU n 
4 47  VAL n 
4 48  GLU n 
4 49  ILE n 
4 50  CYS n 
4 51  THR n 
4 52  GLU n 
4 53  MET n 
4 54  GLU n 
4 55  LYS n 
4 56  GLU n 
4 57  GLY n 
4 58  LYS n 
4 59  ILE n 
4 60  SER n 
4 61  LYS n 
4 62  ILE n 
4 63  GLY n 
4 64  PRO n 
4 65  GLU n 
4 66  ASN n 
4 67  PRO n 
4 68  TYR n 
4 69  ASN n 
4 70  THR n 
4 71  PRO n 
4 72  VAL n 
4 73  PHE n 
4 74  ALA n 
4 75  ILE n 
4 76  LYS n 
4 77  LYS n 
4 78  LYS n 
4 79  ASP n 
4 80  SER n 
4 81  THR n 
4 82  LYS n 
4 83  TRP n 
4 84  ARG n 
4 85  LYS n 
4 86  LEU n 
4 87  VAL n 
4 88  ASP n 
4 89  PHE n 
4 90  ARG n 
4 91  GLU n 
4 92  LEU n 
4 93  ASN n 
4 94  LYS n 
4 95  ARG n 
4 96  THR n 
4 97  GLN n 
4 98  ASP n 
4 99  PHE n 
4 100 TRP n 
4 101 GLU n 
4 102 VAL n 
4 103 GLN n 
4 104 LEU n 
4 105 GLY n 
4 106 ILE n 
4 107 PRO n 
4 108 HIS n 
4 109 PRO n 
4 110 ALA n 
4 111 GLY n 
4 112 LEU n 
4 113 LYS n 
4 114 LYS n 
4 115 LYS n 
4 116 LYS n 
4 117 SER n 
4 118 VAL n 
4 119 THR n 
4 120 VAL n 
4 121 LEU n 
4 122 ASP n 
4 123 VAL n 
4 124 GLY n 
4 125 ASP n 
4 126 ALA n 
4 127 TYR n 
4 128 PHE n 
4 129 SER n 
4 130 VAL n 
4 131 PRO n 
4 132 LEU n 
4 133 ASP n 
4 134 GLU n 
4 135 ASP n 
4 136 PHE n 
4 137 ARG n 
4 138 LYS n 
4 139 TYR n 
4 140 THR n 
4 141 ALA n 
4 142 PHE n 
4 143 THR n 
4 144 ILE n 
4 145 PRO n 
4 146 SER n 
4 147 ILE n 
4 148 ASN n 
4 149 ASN n 
4 150 GLU n 
4 151 THR n 
4 152 PRO n 
4 153 GLY n 
4 154 ILE n 
4 155 ARG n 
4 156 TYR n 
4 157 GLN n 
4 158 TYR n 
4 159 ASN n 
4 160 VAL n 
4 161 LEU n 
4 162 PRO n 
4 163 GLN n 
4 164 GLY n 
4 165 TRP n 
4 166 LYS n 
4 167 GLY n 
4 168 SER n 
4 169 PRO n 
4 170 ALA n 
4 171 ILE n 
4 172 PHE n 
4 173 GLN n 
4 174 SER n 
4 175 SER n 
4 176 MET n 
4 177 THR n 
4 178 LYS n 
4 179 ILE n 
4 180 LEU n 
4 181 GLU n 
4 182 PRO n 
4 183 PHE n 
4 184 ARG n 
4 185 LYS n 
4 186 GLN n 
4 187 ASN n 
4 188 PRO n 
4 189 ASP n 
4 190 ILE n 
4 191 VAL n 
4 192 ILE n 
4 193 TYR n 
4 194 GLN n 
4 195 TYR n 
4 196 MET n 
4 197 ASP n 
4 198 ASP n 
4 199 LEU n 
4 200 TYR n 
4 201 VAL n 
4 202 GLY n 
4 203 SER n 
4 204 ASP n 
4 205 LEU n 
4 206 GLU n 
4 207 ILE n 
4 208 GLY n 
4 209 GLN n 
4 210 HIS n 
4 211 ARG n 
4 212 THR n 
4 213 LYS n 
4 214 ILE n 
4 215 GLU n 
4 216 GLU n 
4 217 LEU n 
4 218 ARG n 
4 219 GLN n 
4 220 HIS n 
4 221 LEU n 
4 222 LEU n 
4 223 ARG n 
4 224 TRP n 
4 225 GLY n 
4 226 LEU n 
4 227 THR n 
4 228 THR n 
4 229 PRO n 
4 230 ASP n 
4 231 LYS n 
4 232 LYS n 
4 233 HIS n 
4 234 GLN n 
4 235 LYS n 
4 236 GLU n 
4 237 PRO n 
4 238 PRO n 
4 239 PHE n 
4 240 LEU n 
4 241 TRP n 
4 242 MET n 
4 243 GLY n 
4 244 TYR n 
4 245 GLU n 
4 246 LEU n 
4 247 HIS n 
4 248 PRO n 
4 249 ASP n 
4 250 LYS n 
4 251 TRP n 
4 252 THR n 
4 253 VAL n 
4 254 GLN n 
4 255 PRO n 
4 256 ILE n 
4 257 VAL n 
4 258 LEU n 
4 259 PRO n 
4 260 GLU n 
4 261 LYS n 
4 262 ASP n 
4 263 SER n 
4 264 TRP n 
4 265 THR n 
4 266 VAL n 
4 267 ASN n 
4 268 ASP n 
4 269 ILE n 
4 270 GLN n 
4 271 LYS n 
4 272 LEU n 
4 273 VAL n 
4 274 GLY n 
4 275 LYS n 
4 276 LEU n 
4 277 ASN n 
4 278 TRP n 
4 279 ALA n 
4 280 SER n 
4 281 GLN n 
4 282 ILE n 
4 283 TYR n 
4 284 PRO n 
4 285 GLY n 
4 286 ILE n 
4 287 LYS n 
4 288 VAL n 
4 289 ARG n 
4 290 GLN n 
4 291 LEU n 
4 292 SER n 
4 293 LYS n 
4 294 LEU n 
4 295 LEU n 
4 296 ARG n 
4 297 GLY n 
4 298 THR n 
4 299 LYS n 
4 300 ALA n 
4 301 LEU n 
4 302 THR n 
4 303 GLU n 
4 304 VAL n 
4 305 ILE n 
4 306 PRO n 
4 307 LEU n 
4 308 THR n 
4 309 GLU n 
4 310 GLU n 
4 311 ALA n 
4 312 GLU n 
4 313 LEU n 
4 314 GLU n 
4 315 LEU n 
4 316 ALA n 
4 317 GLU n 
4 318 ASN n 
4 319 ARG n 
4 320 GLU n 
4 321 ILE n 
4 322 LEU n 
4 323 LYS n 
4 324 GLU n 
4 325 PRO n 
4 326 VAL n 
4 327 HIS n 
4 328 GLY n 
4 329 VAL n 
4 330 TYR n 
4 331 TYR n 
4 332 ASP n 
4 333 PRO n 
4 334 SER n 
4 335 LYS n 
4 336 ASP n 
4 337 LEU n 
4 338 ILE n 
4 339 ALA n 
4 340 GLU n 
4 341 ILE n 
4 342 GLN n 
4 343 LYS n 
4 344 GLN n 
4 345 GLY n 
4 346 GLN n 
4 347 GLY n 
4 348 GLN n 
4 349 TRP n 
4 350 THR n 
4 351 TYR n 
4 352 GLN n 
4 353 ILE n 
4 354 TYR n 
4 355 GLN n 
4 356 GLU n 
4 357 PRO n 
4 358 PHE n 
4 359 LYS n 
4 360 ASN n 
4 361 LEU n 
4 362 LYS n 
4 363 THR n 
4 364 GLY n 
4 365 LYS n 
4 366 TYR n 
4 367 ALA n 
4 368 ARG n 
4 369 MET n 
4 370 ARG n 
4 371 GLY n 
4 372 ALA n 
4 373 HIS n 
4 374 THR n 
4 375 ASN n 
4 376 ASP n 
4 377 VAL n 
4 378 LYS n 
4 379 GLN n 
4 380 LEU n 
4 381 THR n 
4 382 GLU n 
4 383 ALA n 
4 384 VAL n 
4 385 GLN n 
4 386 LYS n 
4 387 ILE n 
4 388 THR n 
4 389 THR n 
4 390 GLU n 
4 391 SER n 
4 392 ILE n 
4 393 VAL n 
4 394 ILE n 
4 395 TRP n 
4 396 GLY n 
4 397 LYS n 
4 398 THR n 
4 399 PRO n 
4 400 LYS n 
4 401 PHE n 
4 402 LYS n 
4 403 LEU n 
4 404 PRO n 
4 405 ILE n 
4 406 GLN n 
4 407 LYS n 
4 408 GLU n 
4 409 THR n 
4 410 TRP n 
4 411 GLU n 
4 412 THR n 
4 413 TRP n 
4 414 TRP n 
4 415 THR n 
4 416 GLU n 
4 417 TYR n 
4 418 TRP n 
4 419 GLN n 
4 420 ALA n 
4 421 THR n 
4 422 TRP n 
4 423 ILE n 
4 424 PRO n 
4 425 GLU n 
4 426 TRP n 
4 427 GLU n 
4 428 PHE n 
4 429 VAL n 
4 430 ASN n 
4 431 THR n 
4 432 PRO n 
4 433 PRO n 
4 434 LEU n 
4 435 VAL n 
4 436 LYS n 
4 437 LEU n 
4 438 TRP n 
4 439 TYR n 
4 440 GLN n 
4 441 LEU n 
4 442 GLU n 
4 443 LYS n 
4 444 GLU n 
4 445 PRO n 
4 446 ILE n 
4 447 VAL n 
4 448 GLY n 
4 449 ALA n 
4 450 GLU n 
4 451 THR n 
4 452 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample 'Biological sequence' 1 561 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 452 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 21 'synthetic construct' ? 32630 ? 
2 1 sample 1 27 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6WPF      6WPF   ? 1 ? 1   
2 PDB 6WPF      6WPF   ? 2 ? 1   
3 UNP POL_HV1H2 P04585 ? 3 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
4 UNP POL_HV1H2 P04585 ? 4 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WPF P 1  ? 21  ? 6WPF   802 ? 822  ? 802 822 
2 2 6WPF T 1  ? 27  ? 6WPF   701 ? 727  ? 701 727 
3 3 6WPF A 2  ? 561 ? P04585 588 ? 1147 ? 1   560 
4 4 6WPF B 13 ? 452 ? P04585 588 ? 1027 ? 1   440 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 6WPF MET A 1   ? UNP P04585 ?   ?   'expression tag'      0   1  
3 6WPF CYS A 259 ? UNP P04585 GLN 845 'engineered mutation' 258 2  
3 6WPF SER A 281 ? UNP P04585 CYS 867 'engineered mutation' 280 3  
4 6WPF MET B 1   ? UNP P04585 ?   ?   'expression tag'      -11 4  
4 6WPF GLY B 2   ? UNP P04585 ?   ?   'expression tag'      -10 5  
4 6WPF SER B 3   ? UNP P04585 ?   ?   'expression tag'      -9  6  
4 6WPF SER B 4   ? UNP P04585 ?   ?   'expression tag'      -8  7  
4 6WPF HIS B 5   ? UNP P04585 ?   ?   'expression tag'      -7  8  
4 6WPF HIS B 6   ? UNP P04585 ?   ?   'expression tag'      -6  9  
4 6WPF HIS B 7   ? UNP P04585 ?   ?   'expression tag'      -5  10 
4 6WPF HIS B 8   ? UNP P04585 ?   ?   'expression tag'      -4  11 
4 6WPF HIS B 9   ? UNP P04585 ?   ?   'expression tag'      -3  12 
4 6WPF HIS B 10  ? UNP P04585 ?   ?   'expression tag'      -2  13 
4 6WPF SER B 11  ? UNP P04585 ?   ?   'expression tag'      -1  14 
4 6WPF SER B 12  ? UNP P04585 ?   ?   'expression tag'      0   15 
4 6WPF SER B 292 ? UNP P04585 CYS 867 'engineered mutation' 280 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
D4M 'DNA linking'       n 
'[(5R)-5-(5-METHYL-2,4-DIOXO-3,4-DIHYDROPYRIMIDIN-1(2H)-YL)-2,5-DIHYDROFURAN-2-YL]METHYL DIHYDROGEN PHOSPHATE' 
;2',3'-DIDEOXY-2',3-DIDEHYDROTHYMIDINE 5'-MONOPHOSPHATE; 2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-MONOPHOSPHATE
;
'C10 H13 N2 O7 P'   304.193 
D4T non-polymer         . 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
?                                                                                                              'C10 H15 N2 O13 P3' 
464.153 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'   322.208 
G47 'DNA linking'       n "N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C12 H18 N5 O7 P S' 407.339 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WPF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.74 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.16 
_exptl_crystal.description                 'thin plate' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '6-10% (w/v) PEG 8000, 15 mM magnesium sulfate, and 50 mM MES adjusted at pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            46.19 
_reflns.entry_id                         6WPF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.53 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47964 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.23 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.147 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.44 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_CC_star                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.53 
_reflns_shell.d_res_low                   2.68 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.13 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6782 
_reflns_shell.percent_possible_all        87.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.78 
_reflns_shell.pdbx_Rsym_value             0.989 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.768 
_reflns_shell.pdbx_CC_star                0.768 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               54.28 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WPF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.53 
_refine.ls_d_res_low                             47.68 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     47959 
_refine.ls_number_reflns_R_free                  2398 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.92 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1844 
_refine.ls_R_factor_R_free                       0.2312 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1820 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6OR7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.4341 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3688 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.53 
_refine_hist.d_res_low                        47.68 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               8601 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7541 
_refine_hist.pdbx_number_atoms_nucleic_acid   845 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0068  ? 8762  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9073  ? 12117 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0493  ? 1336  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0053  ? 1378  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 18.1673 ? 5057  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.53 2.58  . . 93  1756 64.70  . . . 0.3580 . 0.3059 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.58 2.64  . . 141 2683 99.89  . . . 0.3561 . 0.2884 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.64 2.70  . . 143 2705 100.00 . . . 0.3196 . 0.2670 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.70 2.77  . . 143 2726 100.00 . . . 0.3889 . 0.2538 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.77 2.84  . . 141 2688 100.00 . . . 0.2902 . 0.2416 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.84 2.93  . . 143 2704 100.00 . . . 0.3092 . 0.2395 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.93 3.02  . . 144 2730 100.00 . . . 0.3110 . 0.2222 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.02 3.13  . . 143 2725 100.00 . . . 0.2708 . 0.2289 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.13 3.25  . . 142 2693 100.00 . . . 0.2431 . 0.2146 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.25 3.40  . . 144 2743 100.00 . . . 0.2825 . 0.1931 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.40 3.58  . . 143 2720 100.00 . . . 0.2342 . 0.1775 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.58 3.81  . . 144 2728 100.00 . . . 0.2148 . 0.1709 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.81 4.10  . . 144 2747 99.97  . . . 0.1976 . 0.1512 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.10 4.51  . . 145 2754 100.00 . . . 0.1869 . 0.1417 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.51 5.16  . . 146 2766 99.97  . . . 0.1725 . 0.1380 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.16 6.50  . . 147 2791 100.00 . . . 0.2087 . 0.1640 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.50 47.68 . . 152 2902 99.90  . . . 0.1848 . 0.1567 . . . . . . . . . . . 
# 
_struct.entry_id                     6WPF 
_struct.title                        'Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and d4T' 
_struct.pdbx_descriptor              'Reverse transcriptase/ribonuclease H, p51 RT/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WPF 
_struct_keywords.text            
'Reverse Transcriptase, ternary complex, d4T, chain terminator, stereochemistry, TRANSFERASE, TRANSFERASE-DNA complex, Stavudine' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 6  ? 
I N N 7  ? 
J N N 7  ? 
K N N 8  ? 
L N N 6  ? 
M N N 6  ? 
N N N 9  ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
R N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR C 28  ? GLU C 45  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE C 78  ? THR C 85  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS C 97  ? LEU C 101 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA C 115 ? VAL C 119 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP C 122 ? LYS C 127 ? ASP A 121 LYS A 126 1 ? 6  
HELX_P HELX_P6  AA6 TYR C 128 ? ALA C 130 ? TYR A 127 ALA A 129 5 ? 3  
HELX_P HELX_P7  AA7 GLY C 156 ? ASN C 176 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P8  AA8 GLU C 195 ? TRP C 213 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P9  AA9 PRO C 218 ? HIS C 222 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P10 AB1 VAL C 255 ? SER C 269 ? VAL A 254 SER A 268 1 ? 15 
HELX_P HELX_P11 AB2 VAL C 277 ? LEU C 283 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P12 AB3 THR C 297 ? LYS C 312 ? THR A 296 LYS A 311 1 ? 16 
HELX_P HELX_P13 AB4 ASN C 364 ? GLY C 385 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P14 AB5 GLN C 395 ? TYR C 406 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P15 AB6 THR C 474 ? ASP C 489 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P16 AB7 SER C 500 ? ALA C 509 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P17 AB8 SER C 516 ? LYS C 529 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P18 AB9 GLY C 545 ? ALA C 555 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P19 AC1 THR D 39  ? GLU D 56  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P20 AC2 PHE D 89  ? THR D 96  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P21 AC3 GLY D 111 ? LYS D 115 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P22 AC4 GLY D 124 ? VAL D 130 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P23 AC5 ASP D 133 ? ALA D 141 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P24 AC6 SER D 146 ? GLU D 150 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS D 166 ? ASN D 187 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P26 AC8 GLU D 206 ? LEU D 221 ? GLU B 194 LEU B 209 1 ? 16 
HELX_P HELX_P27 AC9 HIS D 247 ? TRP D 251 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 VAL D 266 ? SER D 280 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P29 AD2 VAL D 288 ? LEU D 294 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P30 AD3 THR D 308 ? LEU D 322 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P31 AD4 ASN D 375 ? GLY D 396 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN D 406 ? TRP D 414 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P33 AD6 THR D 415 ? TYR D 417 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P34 AD7 PRO D 432 ? GLN D 440 ? PRO B 420 GLN B 428 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DG  15  "O3'" ? ? ? 1_555 A G47 16  P   ? ? P DG  816 P G47 817 1_555 ? ? ? ? ? ? ?            1.603 ? ? 
covale2  covale one  ? A G47 16  "O3'" ? ? ? 1_555 A DC  17  P   ? ? P G47 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.603 ? ? 
covale3  covale none ? A G47 16  SG    ? ? ? 1_555 C CYS 259 SG  ? ? P G47 817 A CYS 258 1_555 ? ? ? ? ? ? ?            2.027 ? ? 
covale4  covale both ? A DG  21  "O3'" ? ? ? 1_555 E D4M .   P   ? ? P DG  822 P D4M 901 1_555 ? ? ? ? ? ? ?            1.562 ? ? 
metalc1  metalc ?    ? A DG  21  "O3'" ? ? ? 1_555 G MG  .   MG  ? ? P DG  822 P MG  903 1_555 ? ? ? ? ? ? ?            2.484 ? ? 
metalc2  metalc ?    ? E D4M .   OP1   ? ? ? 1_555 G MG  .   MG  ? ? P D4M 901 P MG  903 1_555 ? ? ? ? ? ? ?            2.186 ? ? 
metalc3  metalc ?    ? G MG  .   MG    ? ? ? 1_555 C ASP 111 OD1 ? ? P MG  903 A ASP 110 1_555 ? ? ? ? ? ? ?            2.343 ? ? 
metalc4  metalc ?    ? G MG  .   MG    ? ? ? 1_555 C ASP 111 OD2 ? ? P MG  903 A ASP 110 1_555 ? ? ? ? ? ? ?            2.759 ? ? 
metalc5  metalc ?    ? G MG  .   MG    ? ? ? 1_555 C ASP 186 OD1 ? ? P MG  903 A ASP 185 1_555 ? ? ? ? ? ? ?            2.617 ? ? 
metalc6  metalc ?    ? G MG  .   MG    ? ? ? 1_555 K D4T .   O2A ? ? P MG  903 A D4T 603 1_555 ? ? ? ? ? ? ?            2.360 ? ? 
metalc7  metalc ?    ? C ASP 111 OD2   ? ? ? 1_555 J MG  .   MG  ? ? A ASP 110 A MG  602 1_555 ? ? ? ? ? ? ?            2.097 ? ? 
metalc8  metalc ?    ? C VAL 112 O     ? ? ? 1_555 J MG  .   MG  ? ? A VAL 111 A MG  602 1_555 ? ? ? ? ? ? ?            1.986 ? ? 
metalc9  metalc ?    ? C ASP 186 OD2   ? ? ? 1_555 J MG  .   MG  ? ? A ASP 185 A MG  602 1_555 ? ? ? ? ? ? ?            2.466 ? ? 
metalc10 metalc ?    ? C ASP 444 OD1   ? ? ? 1_555 I MG  .   MG  ? ? A ASP 443 A MG  601 1_555 ? ? ? ? ? ? ?            2.042 ? ? 
metalc11 metalc ?    ? C GLU 479 OE2   ? ? ? 1_555 I MG  .   MG  ? ? A GLU 478 A MG  601 1_555 ? ? ? ? ? ? ?            2.129 ? ? 
metalc12 metalc ?    ? C ASP 499 OD1   ? ? ? 1_555 I MG  .   MG  ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?            2.100 ? ? 
metalc13 metalc ?    ? C ASP 499 OD2   ? ? ? 1_555 I MG  .   MG  ? ? A ASP 498 A MG  601 1_555 ? ? ? ? ? ? ?            2.538 ? ? 
metalc14 metalc ?    ? I MG  .   MG    ? ? ? 1_555 Q HOH .   O   ? ? A MG  601 A HOH 709 1_555 ? ? ? ? ? ? ?            2.807 ? ? 
metalc15 metalc ?    ? J MG  .   MG    ? ? ? 1_555 K D4T .   O2C ? ? A MG  602 A D4T 603 1_555 ? ? ? ? ? ? ?            2.203 ? ? 
metalc16 metalc ?    ? J MG  .   MG    ? ? ? 1_555 K D4T .   O2A ? ? A MG  602 A D4T 603 1_555 ? ? ? ? ? ? ?            2.263 ? ? 
metalc17 metalc ?    ? J MG  .   MG    ? ? ? 1_555 K D4T .   O2B ? ? A MG  602 A D4T 603 1_555 ? ? ? ? ? ? ?            2.380 ? ? 
hydrog1  hydrog ?    ? A DG  4   N1    ? ? ? 1_555 B DC  23  N3  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? A DG  4   N2    ? ? ? 1_555 B DC  23  O2  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? A DG  4   O6    ? ? ? 1_555 B DC  23  N4  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? A DT  5   N3    ? ? ? 1_555 B DA  22  N1  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? A DT  5   O4    ? ? ? 1_555 B DA  22  N6  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? A DC  6   N3    ? ? ? 1_555 B DG  21  N1  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? A DC  6   N4    ? ? ? 1_555 B DG  21  O6  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? A DC  6   O2    ? ? ? 1_555 B DG  21  N2  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? A DC  7   N3    ? ? ? 1_555 B DG  20  N1  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? A DC  7   N4    ? ? ? 1_555 B DG  20  O6  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? A DC  7   O2    ? ? ? 1_555 B DG  20  N2  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? A DC  8   N3    ? ? ? 1_555 B DG  19  N1  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? A DC  8   N4    ? ? ? 1_555 B DG  19  O6  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? A DC  8   O2    ? ? ? 1_555 B DG  19  N2  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? A DT  9   N3    ? ? ? 1_555 B DA  18  N1  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? A DT  9   O4    ? ? ? 1_555 B DA  18  N6  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? A DG  10  N1    ? ? ? 1_555 B DC  17  N3  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? A DG  10  N2    ? ? ? 1_555 B DC  17  O2  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? A DG  10  O6    ? ? ? 1_555 B DC  17  N4  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? A DT  11  N3    ? ? ? 1_555 B DA  16  N1  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? A DT  11  O4    ? ? ? 1_555 B DA  16  N6  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? A DT  12  N3    ? ? ? 1_555 B DA  15  N1  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? A DT  12  O4    ? ? ? 1_555 B DA  15  N6  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? A DC  13  N3    ? ? ? 1_555 B DG  14  N1  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? A DC  13  N4    ? ? ? 1_555 B DG  14  O6  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? A DC  13  O2    ? ? ? 1_555 B DG  14  N2  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? A DG  14  N1    ? ? ? 1_555 B DC  13  N3  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? A DG  14  N2    ? ? ? 1_555 B DC  13  O2  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? A DG  14  O6    ? ? ? 1_555 B DC  13  N4  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? A DG  15  N1    ? ? ? 1_555 B DC  12  N3  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ?    ? A DG  15  N2    ? ? ? 1_555 B DC  12  O2  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ?    ? A DG  15  O6    ? ? ? 1_555 B DC  12  N4  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ?    ? A G47 16  N1    ? ? ? 1_555 B DC  11  N3  ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ?    ? A G47 16  N2    ? ? ? 1_555 B DC  11  O2  ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ?    ? A G47 16  O6    ? ? ? 1_555 B DC  11  N4  ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ?    ? A DC  17  N3    ? ? ? 1_555 B DG  10  N1  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ?    ? A DC  17  N4    ? ? ? 1_555 B DG  10  O6  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ?    ? A DC  17  O2    ? ? ? 1_555 B DG  10  N2  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ?    ? A DG  18  N1    ? ? ? 1_555 B DC  9   N3  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ?    ? A DG  18  N2    ? ? ? 1_555 B DC  9   O2  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ?    ? A DG  18  O6    ? ? ? 1_555 B DC  9   N4  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ?    ? A DC  19  N3    ? ? ? 1_555 B DG  8   N1  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ?    ? A DC  19  N4    ? ? ? 1_555 B DG  8   O6  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ?    ? A DC  19  O2    ? ? ? 1_555 B DG  8   N2  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ?    ? A DC  20  N3    ? ? ? 1_555 B DG  7   N1  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ?    ? A DC  20  N4    ? ? ? 1_555 B DG  7   O6  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ?    ? A DC  20  O2    ? ? ? 1_555 B DG  7   N2  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ?    ? A DG  21  N1    ? ? ? 1_555 B DC  6   N3  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ?    ? A DG  21  N2    ? ? ? 1_555 B DC  6   O2  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ?    ? A DG  21  O6    ? ? ? 1_555 B DC  6   N4  ? ? P DG  822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 226 C . ? PRO 225 A PRO 227 C ? PRO 226 A 1 4.38  
2 PRO 421 C . ? PRO 420 A PRO 422 C ? PRO 421 A 1 -0.78 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE C 48  ? LYS C 50  ? ILE A 47  LYS A 49  
AA1 2 ILE C 143 ? TYR C 147 ? ILE A 142 TYR A 146 
AA1 3 PHE C 131 ? ILE C 133 ? PHE A 130 ILE A 132 
AA2 1 VAL C 61  ? LYS C 65  ? VAL A 60  LYS A 64  
AA2 2 TRP C 72  ? VAL C 76  ? TRP A 71  VAL A 75  
AA3 1 SER C 106 ? ASP C 111 ? SER A 105 ASP A 110 
AA3 2 ASP C 187 ? SER C 192 ? ASP A 186 SER A 191 
AA3 3 VAL C 180 ? TYR C 184 ? VAL A 179 TYR A 183 
AA4 1 PHE C 228 ? TRP C 230 ? PHE A 227 TRP A 229 
AA4 2 TYR C 233 ? LEU C 235 ? TYR A 232 LEU A 234 
AA4 3 TRP C 240 ? VAL C 242 ? TRP A 239 VAL A 241 
AA5 1 TRP C 253 ? THR C 254 ? TRP A 252 THR A 253 
AA5 2 VAL C 293 ? ILE C 294 ? VAL A 292 ILE A 293 
AA6 1 ASN C 349 ? TYR C 355 ? ASN A 348 TYR A 354 
AA6 2 GLN C 337 ? TYR C 343 ? GLN A 336 TYR A 342 
AA6 3 ILE C 327 ? GLN C 333 ? ILE A 326 GLN A 332 
AA6 4 LYS C 389 ? LEU C 392 ? LYS A 388 LEU A 391 
AA6 5 TRP C 415 ? PHE C 417 ? TRP A 414 PHE A 416 
AA7 1 HIS C 362 ? THR C 363 ? HIS A 361 THR A 362 
AA7 2 GLN C 513 ? SER C 514 ? GLN A 512 SER A 513 
AA8 1 GLN C 465 ? LEU C 470 ? GLN A 464 LEU A 469 
AA8 2 GLY C 454 ? THR C 460 ? GLY A 453 THR A 459 
AA8 3 GLU C 439 ? ALA C 447 ? GLU A 438 ALA A 446 
AA8 4 GLU C 493 ? THR C 498 ? GLU A 492 THR A 497 
AA8 5 LYS C 531 ? TRP C 536 ? LYS A 530 TRP A 535 
AA9 1 ILE D 59  ? ILE D 62  ? ILE B 47  ILE B 50  
AA9 2 ILE D 154 ? TYR D 158 ? ILE B 142 TYR B 146 
AA9 3 PHE D 142 ? ILE D 144 ? PHE B 130 ILE B 132 
AB1 1 VAL D 72  ? LYS D 76  ? VAL B 60  LYS B 64  
AB1 2 TRP D 83  ? VAL D 87  ? TRP B 71  VAL B 75  
AB2 1 SER D 117 ? ASP D 122 ? SER B 105 ASP B 110 
AB2 2 ASP D 198 ? SER D 203 ? ASP B 186 SER B 191 
AB2 3 VAL D 191 ? TYR D 195 ? VAL B 179 TYR B 183 
AB3 1 TRP D 264 ? THR D 265 ? TRP B 252 THR B 253 
AB3 2 VAL D 304 ? ILE D 305 ? VAL B 292 ILE B 293 
AB4 1 ASN D 360 ? ALA D 367 ? ASN B 348 ALA B 355 
AB4 2 GLN D 348 ? TYR D 354 ? GLN B 336 TYR B 342 
AB4 3 ILE D 338 ? GLY D 345 ? ILE B 326 GLY B 333 
AB4 4 LYS D 400 ? LEU D 403 ? LYS B 388 LEU B 391 
AB4 5 TRP D 426 ? PHE D 428 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER C 49  ? N SER A 48  O GLN C 146 ? O GLN A 145 
AA1 2 3 O ILE C 143 ? O ILE A 142 N ILE C 133 ? N ILE A 132 
AA2 1 2 N PHE C 62  ? N PHE A 61  O LEU C 75  ? O LEU A 74  
AA3 1 2 N THR C 108 ? N THR A 107 O VAL C 190 ? O VAL A 189 
AA3 2 3 O ASP C 187 ? O ASP A 186 N TYR C 184 ? N TYR A 183 
AA4 1 2 N PHE C 228 ? N PHE A 227 O LEU C 235 ? O LEU A 234 
AA4 2 3 N GLU C 234 ? N GLU A 233 O THR C 241 ? O THR A 240 
AA5 1 2 N TRP C 253 ? N TRP A 252 O ILE C 294 ? O ILE A 293 
AA6 1 2 O LEU C 350 ? O LEU A 349 N ILE C 342 ? N ILE A 341 
AA6 2 3 O TYR C 343 ? O TYR A 342 N ILE C 327 ? N ILE A 326 
AA6 3 4 N ALA C 328 ? N ALA A 327 O LYS C 391 ? O LYS A 390 
AA6 4 5 N PHE C 390 ? N PHE A 389 O GLU C 416 ? O GLU A 415 
AA7 1 2 N THR C 363 ? N THR A 362 O GLN C 513 ? O GLN A 512 
AA8 1 2 O VAL C 468 ? O VAL A 467 N ALA C 456 ? N ALA A 455 
AA8 2 3 O VAL C 459 ? O VAL A 458 N TYR C 442 ? N TYR A 441 
AA8 3 4 N PHE C 441 ? N PHE A 440 O ASN C 495 ? O ASN A 494 
AA8 4 5 N ILE C 496 ? N ILE A 495 O TYR C 533 ? O TYR A 532 
AA9 1 2 N SER D 60  ? N SER B 48  O GLN D 157 ? O GLN B 145 
AA9 2 3 O ILE D 154 ? O ILE B 142 N ILE D 144 ? N ILE B 132 
AB1 1 2 N PHE D 73  ? N PHE B 61  O LEU D 86  ? O LEU B 74  
AB2 1 2 N THR D 119 ? N THR B 107 O VAL D 201 ? O VAL B 189 
AB2 2 3 O ASP D 198 ? O ASP B 186 N TYR D 195 ? N TYR B 183 
AB3 1 2 N TRP D 264 ? N TRP B 252 O ILE D 305 ? O ILE B 293 
AB4 1 2 O LEU D 361 ? O LEU B 349 N ILE D 353 ? N ILE B 341 
AB4 2 3 O TYR D 354 ? O TYR B 342 N ILE D 338 ? N ILE B 326 
AB4 3 4 N ALA D 339 ? N ALA B 327 O LYS D 402 ? O LYS B 390 
AB4 4 5 N LEU D 403 ? N LEU B 391 O GLU D 427 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software P D4M 901 ? 10 'binding site for residue D4M P 901' 
AC2 Software P SO4 902 ? 4  'binding site for residue SO4 P 902' 
AC3 Software P MG  903 ? 6  'binding site for residue MG P 903'  
AC4 Software T SO4 801 ? 3  'binding site for residue SO4 T 801' 
AC5 Software A MG  601 ? 4  'binding site for residue MG A 601'  
AC6 Software A MG  602 ? 6  'binding site for residue MG A 602'  
AC7 Software A D4T 603 ? 20 'binding site for residue D4T A 603' 
AC8 Software A SO4 604 ? 5  'binding site for residue SO4 A 604' 
AC9 Software A SO4 605 ? 7  'binding site for residue SO4 A 605' 
AD1 Software B GOL 501 ? 8  'binding site for residue GOL B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 LYS C 67  ? LYS A 66   . ? 1_555 ? 
2  AC1 10 ASP C 111 ? ASP A 110  . ? 1_555 ? 
3  AC1 10 LYS C 221 ? LYS A 220  . ? 1_555 ? 
4  AC1 10 GLN C 223 ? GLN A 222  . ? 1_555 ? 
5  AC1 10 LEU C 229 ? LEU A 228  . ? 1_555 ? 
6  AC1 10 D4T K .   ? D4T A 603  . ? 1_555 ? 
7  AC1 10 HOH Q .   ? HOH A 708  . ? 1_555 ? 
8  AC1 10 DG  A 21  ? DG  P 822  . ? 1_555 ? 
9  AC1 10 MG  G .   ? MG  P 903  . ? 1_555 ? 
10 AC1 10 HOH O .   ? HOH P 1006 . ? 1_555 ? 
11 AC2 4  DG  A 15  ? DG  P 816  . ? 1_555 ? 
12 AC2 4  G47 A 16  ? G47 P 817  . ? 1_555 ? 
13 AC2 4  DG  B 10  ? DG  T 710  . ? 1_555 ? 
14 AC2 4  DC  B 11  ? DC  T 711  . ? 1_555 ? 
15 AC3 6  ASP C 111 ? ASP A 110  . ? 1_555 ? 
16 AC3 6  ASP C 186 ? ASP A 185  . ? 1_555 ? 
17 AC3 6  MG  J .   ? MG  A 602  . ? 1_555 ? 
18 AC3 6  D4T K .   ? D4T A 603  . ? 1_555 ? 
19 AC3 6  DG  A 21  ? DG  P 822  . ? 1_555 ? 
20 AC3 6  D4M E .   ? D4M P 901  . ? 1_555 ? 
21 AC4 3  HOH O .   ? HOH P 1001 . ? 1_555 ? 
22 AC4 3  DG  B 7   ? DG  T 707  . ? 1_555 ? 
23 AC4 3  DG  B 8   ? DG  T 708  . ? 1_555 ? 
24 AC5 4  ASP C 444 ? ASP A 443  . ? 1_555 ? 
25 AC5 4  GLU C 479 ? GLU A 478  . ? 1_555 ? 
26 AC5 4  ASP C 499 ? ASP A 498  . ? 1_555 ? 
27 AC5 4  HOH Q .   ? HOH A 709  . ? 1_555 ? 
28 AC6 6  ASP C 111 ? ASP A 110  . ? 1_555 ? 
29 AC6 6  VAL C 112 ? VAL A 111  . ? 1_555 ? 
30 AC6 6  ASP C 186 ? ASP A 185  . ? 1_555 ? 
31 AC6 6  LYS C 221 ? LYS A 220  . ? 1_555 ? 
32 AC6 6  D4T K .   ? D4T A 603  . ? 1_555 ? 
33 AC6 6  MG  G .   ? MG  P 903  . ? 1_555 ? 
34 AC7 20 LYS C 66  ? LYS A 65   . ? 1_555 ? 
35 AC7 20 LYS C 71  ? LYS A 70   . ? 1_555 ? 
36 AC7 20 ARG C 73  ? ARG A 72   . ? 1_555 ? 
37 AC7 20 ASP C 111 ? ASP A 110  . ? 1_555 ? 
38 AC7 20 VAL C 112 ? VAL A 111  . ? 1_555 ? 
39 AC7 20 GLY C 113 ? GLY A 112  . ? 1_555 ? 
40 AC7 20 ASP C 114 ? ASP A 113  . ? 1_555 ? 
41 AC7 20 ALA C 115 ? ALA A 114  . ? 1_555 ? 
42 AC7 20 TYR C 116 ? TYR A 115  . ? 1_555 ? 
43 AC7 20 GLN C 152 ? GLN A 151  . ? 1_555 ? 
44 AC7 20 ASP C 186 ? ASP A 185  . ? 1_555 ? 
45 AC7 20 LYS C 221 ? LYS A 220  . ? 1_555 ? 
46 AC7 20 MG  J .   ? MG  A 602  . ? 1_555 ? 
47 AC7 20 HOH Q .   ? HOH A 708  . ? 1_555 ? 
48 AC7 20 HOH Q .   ? HOH A 734  . ? 1_555 ? 
49 AC7 20 DG  A 21  ? DG  P 822  . ? 1_555 ? 
50 AC7 20 D4M E .   ? D4M P 901  . ? 1_555 ? 
51 AC7 20 MG  G .   ? MG  P 903  . ? 1_555 ? 
52 AC7 20 DA  B 5   ? DA  T 705  . ? 1_555 ? 
53 AC7 20 HOH P .   ? HOH T 901  . ? 1_555 ? 
54 AC8 5  ARG C 207 ? ARG A 206  . ? 7_554 ? 
55 AC8 5  ASN C 461 ? ASN A 460  . ? 1_555 ? 
56 AC8 5  ARG C 462 ? ARG A 461  . ? 1_555 ? 
57 AC8 5  HOH Q .   ? HOH A 704  . ? 1_555 ? 
58 AC8 5  ALA D 300 ? ALA B 288  . ? 1_555 ? 
59 AC9 7  LYS C 102 ? LYS A 101  . ? 1_555 ? 
60 AC9 7  LYS C 104 ? LYS A 103  . ? 1_555 ? 
61 AC9 7  VAL C 107 ? VAL A 106  . ? 1_555 ? 
62 AC9 7  TYR C 189 ? TYR A 188  . ? 1_555 ? 
63 AC9 7  HIS C 236 ? HIS A 235  . ? 1_555 ? 
64 AC9 7  PRO C 237 ? PRO A 236  . ? 1_555 ? 
65 AC9 7  TYR C 319 ? TYR A 318  . ? 1_555 ? 
66 AD1 8  LEU C 93  ? LEU A 92   . ? 1_555 ? 
67 AD1 8  VAL C 382 ? VAL A 381  . ? 1_555 ? 
68 AD1 8  GLN D 35  ? GLN B 23   . ? 1_555 ? 
69 AD1 8  TRP D 36  ? TRP B 24   . ? 1_555 ? 
70 AD1 8  PRO D 37  ? PRO B 25   . ? 1_555 ? 
71 AD1 8  PRO D 145 ? PRO B 133  . ? 1_555 ? 
72 AD1 8  SER D 146 ? SER B 134  . ? 1_555 ? 
73 AD1 8  ASN D 149 ? ASN B 137  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6WPF 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.006040 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005866 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009677 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153 2.53737 ? ? 2.59044  63.03566 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882 3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1  4   ? 4.00258  38.00018  -36.43840 1.000 62.03727  ? 805  DG  P "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1  4   ? 3.20573  37.07193  -37.21538 1.000 69.87262  ? 805  DG  P "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1  4   ? 2.63774  37.71879  -38.49303 1.000 77.95325  ? 805  DG  P "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1  4   ? 2.09013  39.02873  -38.19387 1.000 78.55066  ? 805  DG  P "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1  4   ? 3.63776  37.90104  -39.63692 1.000 79.29569  ? 805  DG  P "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1  4   ? 3.42201  36.91419  -40.65559 1.000 82.14508  ? 805  DG  P "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1  4   ? 3.40579  39.31987  -40.17655 1.000 78.96616  ? 805  DG  P "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1  4   ? 2.53863  40.00324  -39.12378 1.000 79.66492  ? 805  DG  P "C1'" 1 
ATOM   9    N  N9    . DG  A 1  4   ? 3.20265  41.07612  -38.37580 1.000 76.15037  ? 805  DG  P N9    1 
ATOM   10   C  C8    . DG  A 1  4   ? 3.21502  41.20812  -37.01106 1.000 74.77193  ? 805  DG  P C8    1 
ATOM   11   N  N7    . DG  A 1  4   ? 3.84982  42.25966  -36.59098 1.000 70.99749  ? 805  DG  P N7    1 
ATOM   12   C  C5    . DG  A 1  4   ? 4.29493  42.87928  -37.74834 1.000 71.24776  ? 805  DG  P C5    1 
ATOM   13   C  C6    . DG  A 1  4   ? 5.04361  44.07184  -37.89846 1.000 68.19937  ? 805  DG  P C6    1 
ATOM   14   O  O6    . DG  A 1  4   ? 5.47246  44.81775  -37.00532 1.000 60.28446  ? 805  DG  P O6    1 
ATOM   15   N  N1    . DG  A 1  4   ? 5.28807  44.36552  -39.23425 1.000 71.25807  ? 805  DG  P N1    1 
ATOM   16   C  C2    . DG  A 1  4   ? 4.85766  43.61002  -40.30251 1.000 72.50382  ? 805  DG  P C2    1 
ATOM   17   N  N2    . DG  A 1  4   ? 5.19745  44.06786  -41.52366 1.000 71.94204  ? 805  DG  P N2    1 
ATOM   18   N  N3    . DG  A 1  4   ? 4.14322  42.47955  -40.17670 1.000 72.90438  ? 805  DG  P N3    1 
ATOM   19   C  C4    . DG  A 1  4   ? 3.90327  42.17507  -38.86815 1.000 72.11632  ? 805  DG  P C4    1 
ATOM   20   P  P     . DT  A 1  5   ? 4.66847  36.39772  -41.53026 1.000 80.18018  ? 806  DT  P P     1 
ATOM   21   O  OP1   . DT  A 1  5   ? 4.21463  35.47056  -42.59439 1.000 83.77277  ? 806  DT  P OP1   1 
ATOM   22   O  OP2   . DT  A 1  5   ? 5.70511  35.97051  -40.56669 1.000 75.86791  ? 806  DT  P OP2   1 
ATOM   23   O  "O5'" . DT  A 1  5   ? 5.22884  37.72752  -42.20775 1.000 79.96306  ? 806  DT  P "O5'" 1 
ATOM   24   C  "C5'" . DT  A 1  5   ? 4.58129  38.29882  -43.33346 1.000 81.77601  ? 806  DT  P "C5'" 1 
ATOM   25   C  "C4'" . DT  A 1  5   ? 5.56517  39.13454  -44.13216 1.000 78.23748  ? 806  DT  P "C4'" 1 
ATOM   26   O  "O4'" . DT  A 1  5   ? 5.89838  40.33641  -43.38804 1.000 72.16857  ? 806  DT  P "O4'" 1 
ATOM   27   C  "C3'" . DT  A 1  5   ? 6.89014  38.44279  -44.42826 1.000 76.19722  ? 806  DT  P "C3'" 1 
ATOM   28   O  "O3'" . DT  A 1  5   ? 7.38357  38.84565  -45.69105 1.000 80.37464  ? 806  DT  P "O3'" 1 
ATOM   29   C  "C2'" . DT  A 1  5   ? 7.79107  38.92454  -43.29893 1.000 70.56904  ? 806  DT  P "C2'" 1 
ATOM   30   C  "C1'" . DT  A 1  5   ? 7.26494  40.33196  -43.03477 1.000 68.98059  ? 806  DT  P "C1'" 1 
ATOM   31   N  N1    . DT  A 1  5   ? 7.37825  40.73385  -41.60577 1.000 63.38523  ? 806  DT  P N1    1 
ATOM   32   C  C2    . DT  A 1  5   ? 7.91523  41.95311  -41.29683 1.000 59.99164  ? 806  DT  P C2    1 
ATOM   33   O  O2    . DT  A 1  5   ? 8.29547  42.74015  -42.13615 1.000 59.70226  ? 806  DT  P O2    1 
ATOM   34   N  N3    . DT  A 1  5   ? 7.99053  42.22164  -39.95909 1.000 59.75552  ? 806  DT  P N3    1 
ATOM   35   C  C4    . DT  A 1  5   ? 7.58536  41.40979  -38.91927 1.000 60.68945  ? 806  DT  P C4    1 
ATOM   36   O  O4    . DT  A 1  5   ? 7.68503  41.74593  -37.74261 1.000 63.11517  ? 806  DT  P O4    1 
ATOM   37   C  C5    . DT  A 1  5   ? 7.03035  40.14015  -39.31182 1.000 58.78853  ? 806  DT  P C5    1 
ATOM   38   C  C7    . DT  A 1  5   ? 6.55648  39.17716  -38.26826 1.000 54.18640  ? 806  DT  P C7    1 
ATOM   39   C  C6    . DT  A 1  5   ? 6.95420  39.86491  -40.62122 1.000 61.27480  ? 806  DT  P C6    1 
ATOM   40   P  P     . DC  A 1  6   ? 8.66211  38.10756  -46.32703 1.000 80.79849  ? 807  DC  P P     1 
ATOM   41   O  OP1   . DC  A 1  6   ? 8.37904  37.97517  -47.77263 1.000 86.20390  ? 807  DC  P OP1   1 
ATOM   42   O  OP2   . DC  A 1  6   ? 9.00399  36.92905  -45.49292 1.000 76.49675  ? 807  DC  P OP2   1 
ATOM   43   O  "O5'" . DC  A 1  6   ? 9.84542  39.16172  -46.14059 1.000 75.02523  ? 807  DC  P "O5'" 1 
ATOM   44   C  "C5'" . DC  A 1  6   ? 9.61491  40.51180  -46.45087 1.000 74.74404  ? 807  DC  P "C5'" 1 
ATOM   45   C  "C4'" . DC  A 1  6   ? 10.81598 41.35858  -46.10154 1.000 70.10236  ? 807  DC  P "C4'" 1 
ATOM   46   O  "O4'" . DC  A 1  6   ? 10.74624 41.77055  -44.71122 1.000 66.89180  ? 807  DC  P "O4'" 1 
ATOM   47   C  "C3'" . DC  A 1  6   ? 12.16868 40.68215  -46.28310 1.000 67.13499  ? 807  DC  P "C3'" 1 
ATOM   48   O  "O3'" . DC  A 1  6   ? 13.07967 41.62881  -46.82244 1.000 62.39255  ? 807  DC  P "O3'" 1 
ATOM   49   C  "C2'" . DC  A 1  6   ? 12.54375 40.27572  -44.85584 1.000 65.48884  ? 807  DC  P "C2'" 1 
ATOM   50   C  "C1'" . DC  A 1  6   ? 11.94432 41.41888  -44.04937 1.000 65.06068  ? 807  DC  P "C1'" 1 
ATOM   51   N  N1    . DC  A 1  6   ? 11.58450 41.05459  -42.65315 1.000 65.51365  ? 807  DC  P N1    1 
ATOM   52   C  C2    . DC  A 1  6   ? 11.86738 41.94552  -41.61671 1.000 63.20661  ? 807  DC  P C2    1 
ATOM   53   O  O2    . DC  A 1  6   ? 12.43478 43.01010  -41.88372 1.000 63.75482  ? 807  DC  P O2    1 
ATOM   54   N  N3    . DC  A 1  6   ? 11.51426 41.60799  -40.34690 1.000 59.74898  ? 807  DC  P N3    1 
ATOM   55   C  C4    . DC  A 1  6   ? 10.89951 40.44597  -40.11036 1.000 55.89508  ? 807  DC  P C4    1 
ATOM   56   N  N4    . DC  A 1  6   ? 10.56053 40.15663  -38.84698 1.000 53.17031  ? 807  DC  P N4    1 
ATOM   57   C  C5    . DC  A 1  6   ? 10.59504 39.53190  -41.16010 1.000 55.63946  ? 807  DC  P C5    1 
ATOM   58   C  C6    . DC  A 1  6   ? 10.95155 39.87072  -42.40056 1.000 61.41375  ? 807  DC  P C6    1 
ATOM   59   P  P     . DC  A 1  7   ? 14.55250 41.19477  -47.28651 1.000 61.34549  ? 808  DC  P P     1 
ATOM   60   O  OP1   . DC  A 1  7   ? 14.88129 41.95982  -48.51701 1.000 65.50829  ? 808  DC  P OP1   1 
ATOM   61   O  OP2   . DC  A 1  7   ? 14.64550 39.71485  -47.24689 1.000 61.95528  ? 808  DC  P OP2   1 
ATOM   62   O  "O5'" . DC  A 1  7   ? 15.48486 41.77813  -46.13356 1.000 55.13232  ? 808  DC  P "O5'" 1 
ATOM   63   C  "C5'" . DC  A 1  7   ? 15.30665 43.09562  -45.71070 1.000 51.13841  ? 808  DC  P "C5'" 1 
ATOM   64   C  "C4'" . DC  A 1  7   ? 16.16483 43.38609  -44.50356 1.000 50.21129  ? 808  DC  P "C4'" 1 
ATOM   65   O  "O4'" . DC  A 1  7   ? 15.52335 42.89914  -43.30576 1.000 49.31814  ? 808  DC  P "O4'" 1 
ATOM   66   C  "C3'" . DC  A 1  7   ? 17.57076 42.78754  -44.52772 1.000 48.66627  ? 808  DC  P "C3'" 1 
ATOM   67   O  "O3'" . DC  A 1  7   ? 18.49646 43.83774  -44.25655 1.000 47.27862  ? 808  DC  P "O3'" 1 
ATOM   68   C  "C2'" . DC  A 1  7   ? 17.54427 41.72580  -43.40924 1.000 42.03727  ? 808  DC  P "C2'" 1 
ATOM   69   C  "C1'" . DC  A 1  7   ? 16.47055 42.27105  -42.47767 1.000 45.24932  ? 808  DC  P "C1'" 1 
ATOM   70   N  N1    . DC  A 1  7   ? 15.71929 41.25067  -41.67590 1.000 47.59018  ? 808  DC  P N1    1 
ATOM   71   C  C2    . DC  A 1  7   ? 15.48088 41.49836  -40.31856 1.000 50.18462  ? 808  DC  P C2    1 
ATOM   72   O  O2    . DC  A 1  7   ? 15.94945 42.52905  -39.81336 1.000 54.16062  ? 808  DC  P O2    1 
ATOM   73   N  N3    . DC  A 1  7   ? 14.75208 40.60527  -39.60087 1.000 45.64630  ? 808  DC  P N3    1 
ATOM   74   C  C4    . DC  A 1  7   ? 14.25895 39.51271  -40.19920 1.000 47.47455  ? 808  DC  P C4    1 
ATOM   75   N  N4    . DC  A 1  7   ? 13.55868 38.65470  -39.45239 1.000 46.55933  ? 808  DC  P N4    1 
ATOM   76   C  C5    . DC  A 1  7   ? 14.47283 39.25154  -41.59074 1.000 47.61141  ? 808  DC  P C5    1 
ATOM   77   C  C6    . DC  A 1  7   ? 15.19160 40.14491  -42.28656 1.000 48.07762  ? 808  DC  P C6    1 
ATOM   78   P  P     . DC  A 1  8   ? 20.05329 43.66845  -44.56393 1.000 48.25107  ? 809  DC  P P     1 
ATOM   79   O  OP1   . DC  A 1  8   ? 20.52754 44.98143  -45.05244 1.000 55.81432  ? 809  DC  P OP1   1 
ATOM   80   O  OP2   . DC  A 1  8   ? 20.29260 42.43541  -45.35948 1.000 44.66493  ? 809  DC  P OP2   1 
ATOM   81   O  "O5'" . DC  A 1  8   ? 20.66869 43.47192  -43.13305 1.000 43.89822  ? 809  DC  P "O5'" 1 
ATOM   82   C  "C5'" . DC  A 1  8   ? 20.33554 44.36649  -42.12029 1.000 44.32333  ? 809  DC  P "C5'" 1 
ATOM   83   C  "C4'" . DC  A 1  8   ? 20.63757 43.74981  -40.77863 1.000 51.58314  ? 809  DC  P "C4'" 1 
ATOM   84   O  "O4'" . DC  A 1  8   ? 19.61020 42.78496  -40.42654 1.000 47.97480  ? 809  DC  P "O4'" 1 
ATOM   85   C  "C3'" . DC  A 1  8   ? 21.97728 42.99410  -40.68643 1.000 48.72957  ? 809  DC  P "C3'" 1 
ATOM   86   O  "O3'" . DC  A 1  8   ? 22.72514 43.57155  -39.64391 1.000 50.62853  ? 809  DC  P "O3'" 1 
ATOM   87   C  "C2'" . DC  A 1  8   ? 21.55715 41.55219  -40.34422 1.000 46.32390  ? 809  DC  P "C2'" 1 
ATOM   88   C  "C1'" . DC  A 1  8   ? 20.22201 41.79408  -39.65628 1.000 48.59569  ? 809  DC  P "C1'" 1 
ATOM   89   N  N1    . DC  A 1  8   ? 19.31498 40.61293  -39.58822 1.000 53.51055  ? 809  DC  P N1    1 
ATOM   90   C  C2    . DC  A 1  8   ? 18.71785 40.29065  -38.37235 1.000 51.37436  ? 809  DC  P C2    1 
ATOM   91   O  O2    . DC  A 1  8   ? 18.97569 40.98210  -37.38642 1.000 49.54931  ? 809  DC  P O2    1 
ATOM   92   N  N3    . DC  A 1  8   ? 17.88727 39.22255  -38.31064 1.000 55.95699  ? 809  DC  P N3    1 
ATOM   93   C  C4    . DC  A 1  8   ? 17.63500 38.50623  -39.41044 1.000 55.92833  ? 809  DC  P C4    1 
ATOM   94   N  N4    . DC  A 1  8   ? 16.80104 37.46286  -39.30322 1.000 52.79618  ? 809  DC  P N4    1 
ATOM   95   C  C5    . DC  A 1  8   ? 18.22312 38.83312  -40.67151 1.000 53.87961  ? 809  DC  P C5    1 
ATOM   96   C  C6    . DC  A 1  8   ? 19.04699 39.88238  -40.71409 1.000 55.35491  ? 809  DC  P C6    1 
ATOM   97   P  P     . DT  A 1  9   ? 24.31362 43.41982  -39.56239 1.000 47.96797  ? 810  DT  P P     1 
ATOM   98   O  OP1   . DT  A 1  9   ? 24.85505 44.78780  -39.36488 1.000 46.38104  ? 810  DT  P OP1   1 
ATOM   99   O  OP2   . DT  A 1  9   ? 24.78426 42.59008  -40.68627 1.000 43.38622  ? 810  DT  P OP2   1 
ATOM   100  O  "O5'" . DT  A 1  9   ? 24.51273 42.64903  -38.17828 1.000 51.68043  ? 810  DT  P "O5'" 1 
ATOM   101  C  "C5'" . DT  A 1  9   ? 23.91454 43.18257  -37.00457 1.000 51.85409  ? 810  DT  P "C5'" 1 
ATOM   102  C  "C4'" . DT  A 1  9   ? 23.56342 42.08611  -36.01377 1.000 50.75839  ? 810  DT  P "C4'" 1 
ATOM   103  O  "O4'" . DT  A 1  9   ? 22.45995 41.29647  -36.50909 1.000 51.91712  ? 810  DT  P "O4'" 1 
ATOM   104  C  "C3'" . DT  A 1  9   ? 24.68878 41.09400  -35.74052 1.000 53.56978  ? 810  DT  P "C3'" 1 
ATOM   105  O  "O3'" . DT  A 1  9   ? 25.26339 41.33024  -34.48601 1.000 57.08152  ? 810  DT  P "O3'" 1 
ATOM   106  C  "C2'" . DT  A 1  9   ? 24.02095 39.72171  -35.77152 1.000 55.43035  ? 810  DT  P "C2'" 1 
ATOM   107  C  "C1'" . DT  A 1  9   ? 22.54010 40.03970  -35.88817 1.000 58.28682  ? 810  DT  P "C1'" 1 
ATOM   108  N  N1    . DT  A 1  9   ? 21.82344 39.02498  -36.68981 1.000 60.10944  ? 810  DT  P N1    1 
ATOM   109  C  C2    . DT  A 1  9   ? 20.95395 38.19412  -36.05000 1.000 60.93988  ? 810  DT  P C2    1 
ATOM   110  O  O2    . DT  A 1  9   ? 20.70330 38.28475  -34.85991 1.000 65.99095  ? 810  DT  P O2    1 
ATOM   111  N  N3    . DT  A 1  9   ? 20.35418 37.26789  -36.84858 1.000 59.44738  ? 810  DT  P N3    1 
ATOM   112  C  C4    . DT  A 1  9   ? 20.54948 37.07673  -38.20728 1.000 60.10562  ? 810  DT  P C4    1 
ATOM   113  O  O4    . DT  A 1  9   ? 19.95304 36.21048  -38.84204 1.000 61.05892  ? 810  DT  P O4    1 
ATOM   114  C  C5    . DT  A 1  9   ? 21.49443 37.97051  -38.82385 1.000 56.23486  ? 810  DT  P C5    1 
ATOM   115  C  C7    . DT  A 1  9   ? 21.78223 37.85719  -40.28970 1.000 43.46651  ? 810  DT  P C7    1 
ATOM   116  C  C6    . DT  A 1  9   ? 22.09035 38.89203  -38.04215 1.000 60.26166  ? 810  DT  P C6    1 
ATOM   117  P  P     . DG  A 1  10  ? 26.62701 40.57465  -34.10512 1.000 60.36013  ? 811  DG  P P     1 
ATOM   118  O  OP1   . DG  A 1  10  ? 27.52181 41.58209  -33.49496 1.000 65.79305  ? 811  DG  P OP1   1 
ATOM   119  O  OP2   . DG  A 1  10  ? 27.08800 39.86127  -35.31112 1.000 61.01786  ? 811  DG  P OP2   1 
ATOM   120  O  "O5'" . DG  A 1  10  ? 26.16925 39.45412  -33.04977 1.000 55.77835  ? 811  DG  P "O5'" 1 
ATOM   121  C  "C5'" . DG  A 1  10  ? 25.28175 39.79334  -31.97756 1.000 54.01681  ? 811  DG  P "C5'" 1 
ATOM   122  C  "C4'" . DG  A 1  10  ? 24.64379 38.54508  -31.39050 1.000 53.99930  ? 811  DG  P "C4'" 1 
ATOM   123  O  "O4'" . DG  A 1  10  ? 23.65789 38.02746  -32.32456 1.000 55.45055  ? 811  DG  P "O4'" 1 
ATOM   124  C  "C3'" . DG  A 1  10  ? 25.62690 37.39895  -31.10309 1.000 55.92025  ? 811  DG  P "C3'" 1 
ATOM   125  O  "O3'" . DG  A 1  10  ? 25.56825 37.00797  -29.74656 1.000 60.24401  ? 811  DG  P "O3'" 1 
ATOM   126  C  "C2'" . DG  A 1  10  ? 25.17674 36.26401  -32.01737 1.000 58.86678  ? 811  DG  P "C2'" 1 
ATOM   127  C  "C1'" . DG  A 1  10  ? 23.73567 36.62191  -32.35609 1.000 59.31172  ? 811  DG  P "C1'" 1 
ATOM   128  N  N9    . DG  A 1  10  ? 23.35873 36.16147  -33.68850 1.000 60.82482  ? 811  DG  P N9    1 
ATOM   129  C  C8    . DG  A 1  10  ? 23.85606 36.61545  -34.88312 1.000 61.17509  ? 811  DG  P C8    1 
ATOM   130  N  N7    . DG  A 1  10  ? 23.35673 36.01158  -35.92203 1.000 58.84105  ? 811  DG  P N7    1 
ATOM   131  C  C5    . DG  A 1  10  ? 22.48755 35.07716  -35.38146 1.000 60.57276  ? 811  DG  P C5    1 
ATOM   132  C  C6    . DG  A 1  10  ? 21.66416 34.13034  -36.02365 1.000 61.21523  ? 811  DG  P C6    1 
ATOM   133  O  O6    . DG  A 1  10  ? 21.53237 33.93019  -37.23339 1.000 62.31018  ? 811  DG  P O6    1 
ATOM   134  N  N1    . DG  A 1  10  ? 20.93710 33.37686  -35.11279 1.000 61.80051  ? 811  DG  P N1    1 
ATOM   135  C  C2    . DG  A 1  10  ? 20.99313 33.52084  -33.74843 1.000 63.45932  ? 811  DG  P C2    1 
ATOM   136  N  N2    . DG  A 1  10  ? 20.22033 32.69277  -33.02897 1.000 64.38415  ? 811  DG  P N2    1 
ATOM   137  N  N3    . DG  A 1  10  ? 21.76426 34.40619  -33.13092 1.000 63.96098  ? 811  DG  P N3    1 
ATOM   138  C  C4    . DG  A 1  10  ? 22.47925 35.14985  -34.00727 1.000 61.44722  ? 811  DG  P C4    1 
ATOM   139  P  P     . DT  A 1  11  ? 26.54281 35.84847  -29.18437 1.000 65.36566  ? 812  DT  P P     1 
ATOM   140  O  OP1   . DT  A 1  11  ? 26.67996 36.10454  -27.73033 1.000 71.22172  ? 812  DT  P OP1   1 
ATOM   141  O  OP2   . DT  A 1  11  ? 27.74557 35.71801  -30.03093 1.000 63.52551  ? 812  DT  P OP2   1 
ATOM   142  O  "O5'" . DT  A 1  11  ? 25.68520 34.52206  -29.35738 1.000 64.70514  ? 812  DT  P "O5'" 1 
ATOM   143  C  "C5'" . DT  A 1  11  ? 24.37858 34.48158  -28.82545 1.000 66.52197  ? 812  DT  P "C5'" 1 
ATOM   144  C  "C4'" . DT  A 1  11  ? 23.89575 33.05926  -28.71257 1.000 63.42878  ? 812  DT  P "C4'" 1 
ATOM   145  O  "O4'" . DT  A 1  11  ? 23.31013 32.65034  -29.97267 1.000 61.86023  ? 812  DT  P "O4'" 1 
ATOM   146  C  "C3'" . DT  A 1  11  ? 24.98273 32.04549  -28.39389 1.000 61.54119  ? 812  DT  P "C3'" 1 
ATOM   147  O  "O3'" . DT  A 1  11  ? 24.46385 31.06080  -27.51325 1.000 62.34613  ? 812  DT  P "O3'" 1 
ATOM   148  C  "C2'" . DT  A 1  11  ? 25.32579 31.47271  -29.76398 1.000 61.08438  ? 812  DT  P "C2'" 1 
ATOM   149  C  "C1'" . DT  A 1  11  ? 23.99061 31.52766  -30.48238 1.000 63.35266  ? 812  DT  P "C1'" 1 
ATOM   150  N  N1    . DT  A 1  11  ? 24.11019 31.69917  -31.96550 1.000 65.81960  ? 812  DT  P N1    1 
ATOM   151  C  C2    . DT  A 1  11  ? 23.29949 30.95623  -32.79506 1.000 64.33939  ? 812  DT  P C2    1 
ATOM   152  O  O2    . DT  A 1  11  ? 22.48773 30.14292  -32.38696 1.000 64.04299  ? 812  DT  P O2    1 
ATOM   153  N  N3    . DT  A 1  11  ? 23.48087 31.19140  -34.12848 1.000 63.53981  ? 812  DT  P N3    1 
ATOM   154  C  C4    . DT  A 1  11  ? 24.36645 32.07858  -34.71330 1.000 62.49275  ? 812  DT  P C4    1 
ATOM   155  O  O4    . DT  A 1  11  ? 24.44883 32.21639  -35.93753 1.000 60.13053  ? 812  DT  P O4    1 
ATOM   156  C  C5    . DT  A 1  11  ? 25.18267 32.83717  -33.78527 1.000 59.02512  ? 812  DT  P C5    1 
ATOM   157  C  C7    . DT  A 1  11  ? 26.18153 33.83348  -34.29706 1.000 50.63740  ? 812  DT  P C7    1 
ATOM   158  C  C6    . DT  A 1  11  ? 25.01647 32.61189  -32.47239 1.000 63.58369  ? 812  DT  P C6    1 
ATOM   159  P  P     . DT  A 1  12  ? 25.35487 29.81078  -27.02797 1.000 78.30401  ? 813  DT  P P     1 
ATOM   160  O  OP1   . DT  A 1  12  ? 25.04916 29.63348  -25.58837 1.000 85.09019  ? 813  DT  P OP1   1 
ATOM   161  O  OP2   . DT  A 1  12  ? 26.76355 29.96087  -27.46552 1.000 79.83542  ? 813  DT  P OP2   1 
ATOM   162  O  "O5'" . DT  A 1  12  ? 24.74424 28.59151  -27.85174 1.000 69.90854  ? 813  DT  P "O5'" 1 
ATOM   163  C  "C5'" . DT  A 1  12  ? 23.33898 28.42944  -27.93121 1.000 69.08755  ? 813  DT  P "C5'" 1 
ATOM   164  C  "C4'" . DT  A 1  12  ? 22.97876 27.18989  -28.72613 1.000 71.53261  ? 813  DT  P "C4'" 1 
ATOM   165  O  "O4'" . DT  A 1  12  ? 23.10624 27.46701  -30.14090 1.000 67.56208  ? 813  DT  P "O4'" 1 
ATOM   166  C  "C3'" . DT  A 1  12  ? 23.85170 25.96824  -28.46330 1.000 76.89334  ? 813  DT  P "C3'" 1 
ATOM   167  O  "O3'" . DT  A 1  12  ? 23.05485 24.79918  -28.58665 1.000 81.41751  ? 813  DT  P "O3'" 1 
ATOM   168  C  "C2'" . DT  A 1  12  ? 24.89692 26.06832  -29.58133 1.000 72.77194  ? 813  DT  P "C2'" 1 
ATOM   169  C  "C1'" . DT  A 1  12  ? 24.04326 26.58711  -30.72340 1.000 68.26114  ? 813  DT  P "C1'" 1 
ATOM   170  N  N1    . DT  A 1  12  ? 24.77762 27.34434  -31.78486 1.000 68.69420  ? 813  DT  P N1    1 
ATOM   171  C  C2    . DT  A 1  12  ? 24.43386 27.12506  -33.09681 1.000 70.49204  ? 813  DT  P C2    1 
ATOM   172  O  O2    . DT  A 1  12  ? 23.58960 26.31532  -33.43571 1.000 74.22815  ? 813  DT  P O2    1 
ATOM   173  N  N3    . DT  A 1  12  ? 25.12331 27.87291  -34.00815 1.000 69.05016  ? 813  DT  P N3    1 
ATOM   174  C  C4    . DT  A 1  12  ? 26.10008 28.81520  -33.74841 1.000 70.91909  ? 813  DT  P C4    1 
ATOM   175  O  O4    . DT  A 1  12  ? 26.65938 29.44334  -34.64487 1.000 72.96485  ? 813  DT  P O4    1 
ATOM   176  C  C5    . DT  A 1  12  ? 26.41108 29.01568  -32.35157 1.000 67.42671  ? 813  DT  P C5    1 
ATOM   177  C  C7    . DT  A 1  12  ? 27.46054 30.01103  -31.96006 1.000 59.80020  ? 813  DT  P C7    1 
ATOM   178  C  C6    . DT  A 1  12  ? 25.73780 28.28124  -31.43983 1.000 69.67304  ? 813  DT  P C6    1 
ATOM   179  P  P     . DC  A 1  13  ? 23.57138 23.37725  -28.04050 1.000 86.90764  ? 814  DC  P P     1 
ATOM   180  O  OP1   . DC  A 1  13  ? 22.64696 22.96060  -26.96727 1.000 91.55986  ? 814  DC  P OP1   1 
ATOM   181  O  OP2   . DC  A 1  13  ? 25.03507 23.43740  -27.78795 1.000 86.78721  ? 814  DC  P OP2   1 
ATOM   182  O  "O5'" . DC  A 1  13  ? 23.31967 22.39531  -29.26956 1.000 82.49582  ? 814  DC  P "O5'" 1 
ATOM   183  C  "C5'" . DC  A 1  13  ? 22.61896 22.85015  -30.41097 1.000 76.86814  ? 814  DC  P "C5'" 1 
ATOM   184  C  "C4'" . DC  A 1  13  ? 23.09473 22.10862  -31.64263 1.000 77.66703  ? 814  DC  P "C4'" 1 
ATOM   185  O  "O4'" . DC  A 1  13  ? 23.82789 23.01347  -32.51147 1.000 76.46306  ? 814  DC  P "O4'" 1 
ATOM   186  C  "C3'" . DC  A 1  13  ? 24.04685 20.94754  -31.36803 1.000 82.34829  ? 814  DC  P "C3'" 1 
ATOM   187  O  "O3'" . DC  A 1  13  ? 23.80591 19.92770  -32.30895 1.000 85.59106  ? 814  DC  P "O3'" 1 
ATOM   188  C  "C2'" . DC  A 1  13  ? 25.41578 21.58687  -31.59106 1.000 81.01569  ? 814  DC  P "C2'" 1 
ATOM   189  C  "C1'" . DC  A 1  13  ? 25.10444 22.47198  -32.78280 1.000 77.12803  ? 814  DC  P "C1'" 1 
ATOM   190  N  N1    . DC  A 1  13  ? 26.05977 23.60577  -32.99093 1.000 75.88155  ? 814  DC  P N1    1 
ATOM   191  C  C2    . DC  A 1  13  ? 26.33945 24.03605  -34.29850 1.000 77.16140  ? 814  DC  P C2    1 
ATOM   192  O  O2    . DC  A 1  13  ? 25.80037 23.44802  -35.25039 1.000 77.16020  ? 814  DC  P O2    1 
ATOM   193  N  N3    . DC  A 1  13  ? 27.19401 25.07704  -34.47889 1.000 75.56423  ? 814  DC  P N3    1 
ATOM   194  C  C4    . DC  A 1  13  ? 27.74970 25.67583  -33.41683 1.000 75.64940  ? 814  DC  P C4    1 
ATOM   195  N  N4    . DC  A 1  13  ? 28.58352 26.70235  -33.63634 1.000 75.16516  ? 814  DC  P N4    1 
ATOM   196  C  C5    . DC  A 1  13  ? 27.46850 25.25205  -32.08209 1.000 73.11605  ? 814  DC  P C5    1 
ATOM   197  C  C6    . DC  A 1  13  ? 26.62635 24.22667  -31.91787 1.000 72.93418  ? 814  DC  P C6    1 
ATOM   198  P  P     . DG  A 1  14  ? 24.02535 18.38163  -31.93242 1.000 93.24817  ? 815  DG  P P     1 
ATOM   199  O  OP1   . DG  A 1  14  ? 22.73876 17.86467  -31.41406 1.000 97.31678  ? 815  DG  P OP1   1 
ATOM   200  O  OP2   . DG  A 1  14  ? 25.25261 18.24755  -31.11178 1.000 94.54134  ? 815  DG  P OP2   1 
ATOM   201  O  "O5'" . DG  A 1  14  ? 24.30050 17.71979  -33.35641 1.000 92.84103  ? 815  DG  P "O5'" 1 
ATOM   202  C  "C5'" . DG  A 1  14  ? 23.62842 18.23025  -34.49641 1.000 88.78211  ? 815  DG  P "C5'" 1 
ATOM   203  C  "C4'" . DG  A 1  14  ? 24.52829 18.19311  -35.71305 1.000 88.22883  ? 815  DG  P "C4'" 1 
ATOM   204  O  "O4'" . DG  A 1  14  ? 25.31391 19.41293  -35.79584 1.000 85.43595  ? 815  DG  P "O4'" 1 
ATOM   205  C  "C3'" . DG  A 1  14  ? 25.52715 17.04342  -35.73655 1.000 91.73948  ? 815  DG  P "C3'" 1 
ATOM   206  O  "O3'" . DG  A 1  14  ? 25.57193 16.50622  -37.03257 1.000 96.55945  ? 815  DG  P "O3'" 1 
ATOM   207  C  "C2'" . DG  A 1  14  ? 26.84801 17.71704  -35.36252 1.000 89.06445  ? 815  DG  P "C2'" 1 
ATOM   208  C  "C1'" . DG  A 1  14  ? 26.67073 19.08348  -36.00093 1.000 86.34242  ? 815  DG  P "C1'" 1 
ATOM   209  N  N9    . DG  A 1  14  ? 27.47928 20.13077  -35.39018 1.000 84.91918  ? 815  DG  P N9    1 
ATOM   210  C  C8    . DG  A 1  14  ? 27.60785 20.38686  -34.04805 1.000 86.27549  ? 815  DG  P C8    1 
ATOM   211  N  N7    . DG  A 1  14  ? 28.38246 21.39707  -33.78438 1.000 85.54507  ? 815  DG  P N7    1 
ATOM   212  C  C5    . DG  A 1  14  ? 28.79146 21.84893  -35.03399 1.000 81.56869  ? 815  DG  P C5    1 
ATOM   213  C  C6    . DG  A 1  14  ? 29.63686 22.93134  -35.37541 1.000 78.98119  ? 815  DG  P C6    1 
ATOM   214  O  O6    . DG  A 1  14  ? 30.21395 23.72059  -34.61456 1.000 78.73862  ? 815  DG  P O6    1 
ATOM   215  N  N1    . DG  A 1  14  ? 29.79518 23.04457  -36.74772 1.000 76.95654  ? 815  DG  P N1    1 
ATOM   216  C  C2    . DG  A 1  14  ? 29.20429 22.22236  -37.67886 1.000 76.54967  ? 815  DG  P C2    1 
ATOM   217  N  N2    . DG  A 1  14  ? 29.47470 22.48997  -38.95929 1.000 73.50734  ? 815  DG  P N2    1 
ATOM   218  N  N3    . DG  A 1  14  ? 28.40609 21.20602  -37.37309 1.000 77.70853  ? 815  DG  P N3    1 
ATOM   219  C  C4    . DG  A 1  14  ? 28.24191 21.08241  -36.03503 1.000 80.54368  ? 815  DG  P C4    1 
ATOM   220  P  P     . DG  A 1  15  ? 26.12034 15.01970  -37.27373 1.000 107.95584 ? 816  DG  P P     1 
ATOM   221  O  OP1   . DG  A 1  15  ? 25.04378 14.28008  -37.97229 1.000 115.91792 ? 816  DG  P OP1   1 
ATOM   222  O  OP2   . DG  A 1  15  ? 26.67531 14.49340  -36.00221 1.000 110.18394 ? 816  DG  P OP2   1 
ATOM   223  O  "O5'" . DG  A 1  15  ? 27.33044 15.24108  -38.28551 1.000 105.01041 ? 816  DG  P "O5'" 1 
ATOM   224  C  "C5'" . DG  A 1  15  ? 27.11313 15.93122  -39.49694 1.000 102.03907 ? 816  DG  P "C5'" 1 
ATOM   225  C  "C4'" . DG  A 1  15  ? 28.42424 16.44143  -40.02510 1.000 103.57341 ? 816  DG  P "C4'" 1 
ATOM   226  O  "O4'" . DG  A 1  15  ? 28.74410 17.66580  -39.35227 1.000 97.64407  ? 816  DG  P "O4'" 1 
ATOM   227  C  "C3'" . DG  A 1  15  ? 29.58605 15.50899  -39.74776 1.000 115.91136 ? 816  DG  P "C3'" 1 
ATOM   228  O  "O3'" . DG  A 1  15  ? 29.86297 14.75441  -40.88491 1.000 137.90765 ? 816  DG  P "O3'" 1 
ATOM   229  C  "C2'" . DG  A 1  15  ? 30.75641 16.42665  -39.40935 1.000 108.89616 ? 816  DG  P "C2'" 1 
ATOM   230  C  "C1'" . DG  A 1  15  ? 30.13890 17.81334  -39.29013 1.000 99.11070  ? 816  DG  P "C1'" 1 
ATOM   231  N  N9    . DG  A 1  15  ? 30.46951 18.47936  -38.04062 1.000 94.49049  ? 816  DG  P N9    1 
ATOM   232  C  C8    . DG  A 1  15  ? 30.02897 18.15113  -36.78051 1.000 95.14210  ? 816  DG  P C8    1 
ATOM   233  N  N7    . DG  A 1  15  ? 30.48702 18.94167  -35.85075 1.000 94.51764  ? 816  DG  P N7    1 
ATOM   234  C  C5    . DG  A 1  15  ? 31.27666 19.85454  -36.54269 1.000 88.65097  ? 816  DG  P C5    1 
ATOM   235  C  C6    . DG  A 1  15  ? 32.03414 20.94728  -36.06957 1.000 74.90511  ? 816  DG  P C6    1 
ATOM   236  O  O6    . DG  A 1  15  ? 32.16507 21.33913  -34.90553 1.000 68.21290  ? 816  DG  P O6    1 
ATOM   237  N  N1    . DG  A 1  15  ? 32.69353 21.60535  -37.11045 1.000 73.64937  ? 816  DG  P N1    1 
ATOM   238  C  C2    . DG  A 1  15  ? 32.62092 21.24406  -38.43846 1.000 77.03035  ? 816  DG  P C2    1 
ATOM   239  N  N2    . DG  A 1  15  ? 33.32082 21.98073  -39.30869 1.000 72.92760  ? 816  DG  P N2    1 
ATOM   240  N  N3    . DG  A 1  15  ? 31.91683 20.22269  -38.88734 1.000 87.10161  ? 816  DG  P N3    1 
ATOM   241  C  C4    . DG  A 1  15  ? 31.27669 19.57497  -37.88990 1.000 91.11260  ? 816  DG  P C4    1 
HETATM 242  P  P     . G47 A 1  16  ? 31.17329 13.83209  -40.92298 1.000 68.78819  ? 817  G47 P P     1 
HETATM 243  O  O1P   . G47 A 1  16  ? 31.52105 13.40263  -39.50497 1.000 68.84490  ? 817  G47 P O1P   1 
HETATM 244  O  O2P   . G47 A 1  16  ? 30.92229 12.79579  -41.99441 1.000 74.43594  ? 817  G47 P O2P   1 
HETATM 245  O  "O5'" . G47 A 1  16  ? 32.32250 14.81586  -41.46457 1.000 62.68191  ? 817  G47 P "O5'" 1 
HETATM 246  C  "C5'" . G47 A 1  16  ? 33.62011 14.32809  -41.76013 1.000 55.42305  ? 817  G47 P "C5'" 1 
HETATM 247  C  "C4'" . G47 A 1  16  ? 34.40904 15.53279  -42.22440 1.000 55.98815  ? 817  G47 P "C4'" 1 
HETATM 248  O  "O4'" . G47 A 1  16  ? 33.85433 16.75637  -41.71737 1.000 57.51850  ? 817  G47 P "O4'" 1 
HETATM 249  C  "C3'" . G47 A 1  16  ? 35.78938 15.48496  -41.62693 1.000 53.70513  ? 817  G47 P "C3'" 1 
HETATM 250  O  "O3'" . G47 A 1  16  ? 36.66137 14.64229  -42.38056 1.000 44.62580  ? 817  G47 P "O3'" 1 
HETATM 251  C  "C2'" . G47 A 1  16  ? 36.21802 16.93961  -41.52465 1.000 51.73922  ? 817  G47 P "C2'" 1 
HETATM 252  C  "C1'" . G47 A 1  16  ? 34.88842 17.61486  -41.20613 1.000 54.18941  ? 817  G47 P "C1'" 1 
HETATM 253  N  N9    . G47 A 1  16  ? 34.66501 17.80053  -39.73748 1.000 58.13606  ? 817  G47 P N9    1 
HETATM 254  C  C8    . G47 A 1  16  ? 33.85455 17.04234  -38.97939 1.000 60.61236  ? 817  G47 P C8    1 
HETATM 255  N  N7    . G47 A 1  16  ? 33.82779 17.45166  -37.68202 1.000 62.06915  ? 817  G47 P N7    1 
HETATM 256  C  C5    . G47 A 1  16  ? 34.65199 18.50971  -37.58157 1.000 60.37037  ? 817  G47 P C5    1 
HETATM 257  C  C6    . G47 A 1  16  ? 35.10041 19.42460  -36.49475 1.000 55.74929  ? 817  G47 P C6    1 
HETATM 258  O  O6    . G47 A 1  16  ? 34.68267 19.28405  -35.32295 1.000 51.43096  ? 817  G47 P O6    1 
HETATM 259  N  N1    . G47 A 1  16  ? 35.96701 20.39870  -36.81147 1.000 53.08633  ? 817  G47 P N1    1 
HETATM 260  C  C2    . G47 A 1  16  ? 36.42825 20.56465  -38.06775 1.000 55.02736  ? 817  G47 P C2    1 
HETATM 261  N  N2    . G47 A 1  16  ? 37.29490 21.56990  -38.32015 1.000 54.25119  ? 817  G47 P N2    1 
HETATM 262  N  N3    . G47 A 1  16  ? 36.05180 19.75768  -39.09293 1.000 58.59860  ? 817  G47 P N3    1 
HETATM 263  C  C4    . G47 A 1  16  ? 35.19065 18.73430  -38.93293 1.000 59.25789  ? 817  G47 P C4    1 
HETATM 264  C  C6A   . G47 A 1  16  ? 38.18584 21.54089  -39.46642 1.000 60.67625  ? 817  G47 P C6A   1 
HETATM 265  C  C7A   . G47 A 1  16  ? 37.50128 21.70087  -40.82734 1.000 64.31671  ? 817  G47 P C7A   1 
HETATM 266  S  SG    . G47 A 1  16  ? 38.73542 22.00192  -42.11920 1.000 65.13116  ? 817  G47 P SG    1 
ATOM   267  P  P     . DC  A 1  17  ? 37.52432 13.54194  -41.59778 1.000 79.69819  ? 818  DC  P P     1 
ATOM   268  O  OP1   . DC  A 1  17  ? 37.90475 12.47648  -42.54689 1.000 88.86353  ? 818  DC  P OP1   1 
ATOM   269  O  OP2   . DC  A 1  17  ? 36.74579 13.24194  -40.37947 1.000 71.66528  ? 818  DC  P OP2   1 
ATOM   270  O  "O5'" . DC  A 1  17  ? 38.83724 14.31936  -41.15644 1.000 66.38222  ? 818  DC  P "O5'" 1 
ATOM   271  C  "C5'" . DC  A 1  17  ? 39.50849 15.14836  -42.08181 1.000 68.94624  ? 818  DC  P "C5'" 1 
ATOM   272  C  "C4'" . DC  A 1  17  ? 40.25907 16.24564  -41.35402 1.000 66.75130  ? 818  DC  P "C4'" 1 
ATOM   273  O  "O4'" . DC  A 1  17  ? 39.31241 17.18684  -40.78038 1.000 67.62475  ? 818  DC  P "O4'" 1 
ATOM   274  C  "C3'" . DC  A 1  17  ? 41.06727 15.79229  -40.15246 1.000 60.44931  ? 818  DC  P "C3'" 1 
ATOM   275  O  "O3'" . DC  A 1  17  ? 42.31327 15.21534  -40.55246 1.000 61.23800  ? 818  DC  P "O3'" 1 
ATOM   276  C  "C2'" . DC  A 1  17  ? 41.25613 17.12053  -39.43342 1.000 56.63799  ? 818  DC  P "C2'" 1 
ATOM   277  C  "C1'" . DC  A 1  17  ? 39.86465 17.72981  -39.58044 1.000 62.18788  ? 818  DC  P "C1'" 1 
ATOM   278  N  N1    . DC  A 1  17  ? 38.96948 17.41142  -38.40613 1.000 61.28037  ? 818  DC  P N1    1 
ATOM   279  C  C2    . DC  A 1  17  ? 39.10009 18.15589  -37.21388 1.000 56.92981  ? 818  DC  P C2    1 
ATOM   280  O  O2    . DC  A 1  17  ? 39.92773 19.08044  -37.16068 1.000 56.84551  ? 818  DC  P O2    1 
ATOM   281  N  N3    . DC  A 1  17  ? 38.30883 17.84387  -36.15574 1.000 51.18734  ? 818  DC  P N3    1 
ATOM   282  C  C4    . DC  A 1  17  ? 37.42394 16.85782  -36.25064 1.000 51.34843  ? 818  DC  P C4    1 
ATOM   283  N  N4    . DC  A 1  17  ? 36.66591 16.60110  -35.18332 1.000 53.03664  ? 818  DC  P N4    1 
ATOM   284  C  C5    . DC  A 1  17  ? 37.27501 16.08546  -37.44632 1.000 53.01366  ? 818  DC  P C5    1 
ATOM   285  C  C6    . DC  A 1  17  ? 38.06476 16.38561  -38.48686 1.000 57.80598  ? 818  DC  P C6    1 
ATOM   286  P  P     . DG  A 1  18  ? 43.17073 14.33764  -39.50462 1.000 58.49874  ? 819  DG  P P     1 
ATOM   287  O  OP1   . DG  A 1  18  ? 44.36273 13.80711  -40.20998 1.000 61.61544  ? 819  DG  P OP1   1 
ATOM   288  O  OP2   . DG  A 1  18  ? 42.26100 13.37430  -38.83617 1.000 54.97444  ? 819  DG  P OP2   1 
ATOM   289  O  "O5'" . DG  A 1  18  ? 43.63004 15.40777  -38.39467 1.000 56.50253  ? 819  DG  P "O5'" 1 
ATOM   290  C  "C5'" . DG  A 1  18  ? 44.57466 16.43393  -38.71747 1.000 57.04004  ? 819  DG  P "C5'" 1 
ATOM   291  C  "C4'" . DG  A 1  18  ? 45.00152 17.18104  -37.46740 1.000 53.61950  ? 819  DG  P "C4'" 1 
ATOM   292  O  "O4'" . DG  A 1  18  ? 43.86877 17.88912  -36.93055 1.000 55.89976  ? 819  DG  P "O4'" 1 
ATOM   293  C  "C3'" . DG  A 1  18  ? 45.48148 16.29636  -36.33238 1.000 49.02659  ? 819  DG  P "C3'" 1 
ATOM   294  O  "O3'" . DG  A 1  18  ? 46.85309 16.08330  -36.45013 1.000 52.57374  ? 819  DG  P "O3'" 1 
ATOM   295  C  "C2'" . DG  A 1  18  ? 45.17110 17.13266  -35.10687 1.000 47.64154  ? 819  DG  P "C2'" 1 
ATOM   296  C  "C1'" . DG  A 1  18  ? 43.87476 17.80649  -35.51749 1.000 54.86281  ? 819  DG  P "C1'" 1 
ATOM   297  N  N9    . DG  A 1  18  ? 42.65796 17.11590  -35.08762 1.000 58.90809  ? 819  DG  P N9    1 
ATOM   298  C  C8    . DG  A 1  18  ? 41.85139 16.30671  -35.85243 1.000 60.60848  ? 819  DG  P C8    1 
ATOM   299  N  N7    . DG  A 1  18  ? 40.81145 15.85480  -35.20854 1.000 62.23528  ? 819  DG  P N7    1 
ATOM   300  C  C5    . DG  A 1  18  ? 40.92956 16.40412  -33.93584 1.000 58.32490  ? 819  DG  P C5    1 
ATOM   301  C  C6    . DG  A 1  18  ? 40.09177 16.26960  -32.79997 1.000 52.22423  ? 819  DG  P C6    1 
ATOM   302  O  O6    . DG  A 1  18  ? 39.04286 15.61934  -32.69240 1.000 47.12239  ? 819  DG  P O6    1 
ATOM   303  N  N1    . DG  A 1  18  ? 40.58025 16.99321  -31.71169 1.000 53.57754  ? 819  DG  P N1    1 
ATOM   304  C  C2    . DG  A 1  18  ? 41.73298 17.75931  -31.72064 1.000 52.78393  ? 819  DG  P C2    1 
ATOM   305  N  N2    . DG  A 1  18  ? 42.04915 18.39743  -30.57654 1.000 43.25500  ? 819  DG  P N2    1 
ATOM   306  N  N3    . DG  A 1  18  ? 42.51994 17.89070  -32.77978 1.000 58.62217  ? 819  DG  P N3    1 
ATOM   307  C  C4    . DG  A 1  18  ? 42.05917 17.18799  -33.84713 1.000 58.79558  ? 819  DG  P C4    1 
ATOM   308  P  P     . DC  A 1  19  ? 47.49149 14.71102  -35.92780 1.000 51.19989  ? 820  DC  P P     1 
ATOM   309  O  OP1   . DC  A 1  19  ? 48.93906 14.78332  -36.25288 1.000 49.70465  ? 820  DC  P OP1   1 
ATOM   310  O  OP2   . DC  A 1  19  ? 46.65417 13.60447  -36.44460 1.000 52.90247  ? 820  DC  P OP2   1 
ATOM   311  O  "O5'" . DC  A 1  19  ? 47.26213 14.75640  -34.33986 1.000 46.86853  ? 820  DC  P "O5'" 1 
ATOM   312  C  "C5'" . DC  A 1  19  ? 48.00353 15.66898  -33.54605 1.000 43.49133  ? 820  DC  P "C5'" 1 
ATOM   313  C  "C4'" . DC  A 1  19  ? 47.53529 15.66112  -32.10170 1.000 42.44841  ? 820  DC  P "C4'" 1 
ATOM   314  O  "O4'" . DC  A 1  19  ? 46.19240 16.18693  -32.01676 1.000 43.72238  ? 820  DC  P "O4'" 1 
ATOM   315  C  "C3'" . DC  A 1  19  ? 47.42950 14.29689  -31.42923 1.000 39.48842  ? 820  DC  P "C3'" 1 
ATOM   316  O  "O3'" . DC  A 1  19  ? 48.69129 13.85613  -30.98952 1.000 40.00298  ? 820  DC  P "O3'" 1 
ATOM   317  C  "C2'" . DC  A 1  19  ? 46.54106 14.64236  -30.24628 1.000 41.63185  ? 820  DC  P "C2'" 1 
ATOM   318  C  "C1'" . DC  A 1  19  ? 45.54578 15.58983  -30.89354 1.000 47.04718  ? 820  DC  P "C1'" 1 
ATOM   319  N  N1    . DC  A 1  19  ? 44.32089 14.91141  -31.34757 1.000 51.63788  ? 820  DC  P N1    1 
ATOM   320  C  C2    . DC  A 1  19  ? 43.30906 14.67892  -30.42400 1.000 49.51244  ? 820  DC  P C2    1 
ATOM   321  O  O2    . DC  A 1  19  ? 43.47603 15.04402  -29.25160 1.000 44.71096  ? 820  DC  P O2    1 
ATOM   322  N  N3    . DC  A 1  19  ? 42.17329 14.06372  -30.83931 1.000 46.53435  ? 820  DC  P N3    1 
ATOM   323  C  C4    . DC  A 1  19  ? 42.04742 13.67870  -32.11123 1.000 43.84943  ? 820  DC  P C4    1 
ATOM   324  N  N4    . DC  A 1  19  ? 40.91198 13.08142  -32.46943 1.000 34.93670  ? 820  DC  P N4    1 
ATOM   325  C  C5    . DC  A 1  19  ? 43.07811 13.90088  -33.07169 1.000 43.32857  ? 820  DC  P C5    1 
ATOM   326  C  C6    . DC  A 1  19  ? 44.19054 14.51001  -32.65145 1.000 48.74305  ? 820  DC  P C6    1 
ATOM   327  P  P     . DC  A 1  20  ? 48.94445 12.30095  -30.67535 1.000 39.21017  ? 821  DC  P P     1 
ATOM   328  O  OP1   . DC  A 1  20  ? 50.37998 12.17522  -30.35759 1.000 42.05512  ? 821  DC  P OP1   1 
ATOM   329  O  OP2   . DC  A 1  20  ? 48.36047 11.51603  -31.77630 1.000 41.74953  ? 821  DC  P OP2   1 
ATOM   330  O  "O5'" . DC  A 1  20  ? 48.06742 12.01190  -29.36610 1.000 38.00939  ? 821  DC  P "O5'" 1 
ATOM   331  C  "C5'" . DC  A 1  20  ? 48.34304 12.70802  -28.13306 1.000 35.87675  ? 821  DC  P "C5'" 1 
ATOM   332  C  "C4'" . DC  A 1  20  ? 47.40941 12.23876  -27.03568 1.000 37.61283  ? 821  DC  P "C4'" 1 
ATOM   333  O  "O4'" . DC  A 1  20  ? 46.06037 12.66543  -27.31638 1.000 38.60318  ? 821  DC  P "O4'" 1 
ATOM   334  C  "C3'" . DC  A 1  20  ? 47.31149 10.73584  -26.91518 1.000 42.27712  ? 821  DC  P "C3'" 1 
ATOM   335  O  "O3'" . DC  A 1  20  ? 48.32083 10.27243  -26.10825 1.000 49.58864  ? 821  DC  P "O3'" 1 
ATOM   336  C  "C2'" . DC  A 1  20  ? 45.94775 10.52175  -26.27511 1.000 42.19939  ? 821  DC  P "C2'" 1 
ATOM   337  C  "C1'" . DC  A 1  20  ? 45.14298 11.68569  -26.83081 1.000 41.94610  ? 821  DC  P "C1'" 1 
ATOM   338  N  N1    . DC  A 1  20  ? 44.21497 11.31682  -27.92105 1.000 44.06613  ? 821  DC  P N1    1 
ATOM   339  C  C2    . DC  A 1  20  ? 42.93047 10.90884  -27.60146 1.000 46.75873  ? 821  DC  P C2    1 
ATOM   340  O  O2    . DC  A 1  20  ? 42.61400 10.83802  -26.41479 1.000 51.83277  ? 821  DC  P O2    1 
ATOM   341  N  N3    . DC  A 1  20  ? 42.07159 10.59551  -28.60166 1.000 47.22094  ? 821  DC  P N3    1 
ATOM   342  C  C4    . DC  A 1  20  ? 42.46933 10.68510  -29.87058 1.000 45.09584  ? 821  DC  P C4    1 
ATOM   343  N  N4    . DC  A 1  20  ? 41.59525 10.36905  -30.82429 1.000 46.30638  ? 821  DC  P N4    1 
ATOM   344  C  C5    . DC  A 1  20  ? 43.78632 11.09824  -30.21774 1.000 41.49487  ? 821  DC  P C5    1 
ATOM   345  C  C6    . DC  A 1  20  ? 44.61828 11.40602  -29.22225 1.000 42.78428  ? 821  DC  P C6    1 
ATOM   346  P  P     . DG  A 1  21  ? 48.81953 8.76767   -26.29753 1.000 37.41483  ? 822  DG  P P     1 
ATOM   347  O  OP1   . DG  A 1  21  ? 50.01097 8.63548   -25.42609 1.000 41.48753  ? 822  DG  P OP1   1 
ATOM   348  O  OP2   . DG  A 1  21  ? 48.90494 8.45593   -27.74637 1.000 41.84442  ? 822  DG  P OP2   1 
ATOM   349  O  "O5'" . DG  A 1  21  ? 47.60215 7.90618   -25.74317 1.000 38.35083  ? 822  DG  P "O5'" 1 
ATOM   350  C  "C5'" . DG  A 1  21  ? 47.28237 7.90573   -24.36154 1.000 33.68687  ? 822  DG  P "C5'" 1 
ATOM   351  C  "C4'" . DG  A 1  21  ? 46.09607 7.00750   -24.13421 1.000 39.05426  ? 822  DG  P "C4'" 1 
ATOM   352  O  "O4'" . DG  A 1  21  ? 44.89149 7.67930   -24.58700 1.000 43.09949  ? 822  DG  P "O4'" 1 
ATOM   353  C  "C3'" . DG  A 1  21  ? 46.09513 5.72645   -24.95713 1.000 41.89856  ? 822  DG  P "C3'" 1 
ATOM   354  O  "O3'" . DG  A 1  21  ? 46.98568 4.75533   -24.41902 1.000 45.20203  ? 822  DG  P "O3'" 1 
ATOM   355  C  "C2'" . DG  A 1  21  ? 44.63417 5.32159   -24.82086 1.000 44.72177  ? 822  DG  P "C2'" 1 
ATOM   356  C  "C1'" . DG  A 1  21  ? 43.95525 6.68690   -25.03448 1.000 45.35288  ? 822  DG  P "C1'" 1 
ATOM   357  N  N9    . DG  A 1  21  ? 43.57515 6.91253   -26.44215 1.000 38.77604  ? 822  DG  P N9    1 
ATOM   358  C  C8    . DG  A 1  21  ? 44.38600 7.31336   -27.48034 1.000 37.09271  ? 822  DG  P C8    1 
ATOM   359  N  N7    . DG  A 1  21  ? 43.75988 7.39392   -28.63222 1.000 36.64613  ? 822  DG  P N7    1 
ATOM   360  C  C5    . DG  A 1  21  ? 42.45536 7.00209   -28.34080 1.000 37.31101  ? 822  DG  P C5    1 
ATOM   361  C  C6    . DG  A 1  21  ? 41.31787 6.87749   -29.18597 1.000 39.09272  ? 822  DG  P C6    1 
ATOM   362  O  O6    . DG  A 1  21  ? 41.23058 7.10131   -30.40101 1.000 43.58708  ? 822  DG  P O6    1 
ATOM   363  N  N1    . DG  A 1  21  ? 40.19034 6.44912   -28.48212 1.000 36.48370  ? 822  DG  P N1    1 
ATOM   364  C  C2    . DG  A 1  21  ? 40.16074 6.17184   -27.14184 1.000 36.11171  ? 822  DG  P C2    1 
ATOM   365  N  N2    . DG  A 1  21  ? 38.98260 5.77309   -26.63756 1.000 35.89437  ? 822  DG  P N2    1 
ATOM   366  N  N3    . DG  A 1  21  ? 41.21753 6.27615   -26.33789 1.000 38.10009  ? 822  DG  P N3    1 
ATOM   367  C  C4    . DG  A 1  21  ? 42.32784 6.69562   -27.00187 1.000 38.16886  ? 822  DG  P C4    1 
ATOM   368  P  P     . DG  B 2  3   ? 44.77339 -0.38780  -44.95568 1.000 124.97201 ? 703  DG  T P     1 
ATOM   369  O  OP1   . DG  B 2  3   ? 45.61374 -0.92393  -43.85485 1.000 125.81087 ? 703  DG  T OP1   1 
ATOM   370  O  OP2   . DG  B 2  3   ? 43.81606 -1.27259  -45.66383 1.000 125.32968 ? 703  DG  T OP2   1 
ATOM   371  O  "O5'" . DG  B 2  3   ? 43.97637 0.91581   -44.45461 1.000 118.60143 ? 703  DG  T "O5'" 1 
ATOM   372  C  "C5'" . DG  B 2  3   ? 42.86499 0.78365   -43.56792 1.000 111.62462 ? 703  DG  T "C5'" 1 
ATOM   373  C  "C4'" . DG  B 2  3   ? 41.85582 1.90036   -43.78702 1.000 105.48471 ? 703  DG  T "C4'" 1 
ATOM   374  O  "O4'" . DG  B 2  3   ? 40.84873 1.46207   -44.73036 1.000 106.01506 ? 703  DG  T "O4'" 1 
ATOM   375  C  "C3'" . DG  B 2  3   ? 41.06789 2.30116   -42.55494 1.000 100.01039 ? 703  DG  T "C3'" 1 
ATOM   376  O  "O3'" . DG  B 2  3   ? 40.56200 3.63338   -42.71058 1.000 90.21827  ? 703  DG  T "O3'" 1 
ATOM   377  C  "C2'" . DG  B 2  3   ? 39.94321 1.26545   -42.54767 1.000 103.22594 ? 703  DG  T "C2'" 1 
ATOM   378  C  "C1'" . DG  B 2  3   ? 39.66416 1.08329   -44.03951 1.000 105.23142 ? 703  DG  T "C1'" 1 
ATOM   379  N  N9    . DG  B 2  3   ? 39.33323 -0.29310  -44.42675 1.000 106.36751 ? 703  DG  T N9    1 
ATOM   380  C  C8    . DG  B 2  3   ? 40.14540 -1.39854  -44.32048 1.000 106.01602 ? 703  DG  T C8    1 
ATOM   381  N  N7    . DG  B 2  3   ? 39.59508 -2.49442  -44.76526 1.000 106.06369 ? 703  DG  T N7    1 
ATOM   382  C  C5    . DG  B 2  3   ? 38.33792 -2.09413  -45.20516 1.000 107.19971 ? 703  DG  T C5    1 
ATOM   383  C  C6    . DG  B 2  3   ? 37.28911 -2.85236  -45.78913 1.000 109.14799 ? 703  DG  T C6    1 
ATOM   384  O  O6    . DG  B 2  3   ? 37.26462 -4.06694  -46.04009 1.000 109.57431 ? 703  DG  T O6    1 
ATOM   385  N  N1    . DG  B 2  3   ? 36.18337 -2.05889  -46.08894 1.000 109.43527 ? 703  DG  T N1    1 
ATOM   386  C  C2    . DG  B 2  3   ? 36.09824 -0.70721  -45.85397 1.000 107.79728 ? 703  DG  T C2    1 
ATOM   387  N  N2    . DG  B 2  3   ? 34.94903 -0.11856  -46.21008 1.000 107.02133 ? 703  DG  T N2    1 
ATOM   388  N  N3    . DG  B 2  3   ? 37.07164 0.01761   -45.30784 1.000 106.83590 ? 703  DG  T N3    1 
ATOM   389  C  C4    . DG  B 2  3   ? 38.15972 -0.74024  -45.00918 1.000 106.96323 ? 703  DG  T C4    1 
ATOM   390  P  P     . DG  B 2  4   ? 40.33240 4.58103   -41.42659 1.000 163.14621 ? 704  DG  T P     1 
ATOM   391  O  OP1   . DG  B 2  4   ? 40.15276 5.96240   -41.92583 1.000 164.94670 ? 704  DG  T OP1   1 
ATOM   392  O  OP2   . DG  B 2  4   ? 41.39642 4.29573   -40.43633 1.000 158.51883 ? 704  DG  T OP2   1 
ATOM   393  O  "O5'" . DG  B 2  4   ? 38.93966 4.07353   -40.81620 1.000 146.52402 ? 704  DG  T "O5'" 1 
ATOM   394  C  "C5'" . DG  B 2  4   ? 37.72447 4.26002   -41.54916 1.000 134.69134 ? 704  DG  T "C5'" 1 
ATOM   395  C  "C4'" . DG  B 2  4   ? 36.62813 3.33505   -41.03841 1.000 116.34518 ? 704  DG  T "C4'" 1 
ATOM   396  O  "O4'" . DG  B 2  4   ? 36.78575 2.02903   -41.61726 1.000 113.20448 ? 704  DG  T "O4'" 1 
ATOM   397  C  "C3'" . DG  B 2  4   ? 36.64424 3.09229   -39.54186 1.000 101.03628 ? 704  DG  T "C3'" 1 
ATOM   398  O  "O3'" . DG  B 2  4   ? 35.90422 4.13345   -38.86268 1.000 91.21554  ? 704  DG  T "O3'" 1 
ATOM   399  C  "C2'" . DG  B 2  4   ? 36.00979 1.70187   -39.39275 1.000 99.73852  ? 704  DG  T "C2'" 1 
ATOM   400  C  "C1'" . DG  B 2  4   ? 36.13904 1.08603   -40.79439 1.000 106.70776 ? 704  DG  T "C1'" 1 
ATOM   401  N  N9    . DG  B 2  4   ? 36.91150 -0.14846  -40.81828 1.000 106.76170 ? 704  DG  T N9    1 
ATOM   402  C  C8    . DG  B 2  4   ? 38.16067 -0.35428  -40.28307 1.000 105.77701 ? 704  DG  T C8    1 
ATOM   403  N  N7    . DG  B 2  4   ? 38.60853 -1.56558  -40.46381 1.000 108.60586 ? 704  DG  T N7    1 
ATOM   404  C  C5    . DG  B 2  4   ? 37.58885 -2.20356  -41.15742 1.000 110.06587 ? 704  DG  T C5    1 
ATOM   405  C  C6    . DG  B 2  4   ? 37.50707 -3.52692  -41.62650 1.000 114.69463 ? 704  DG  T C6    1 
ATOM   406  O  O6    . DG  B 2  4   ? 38.34929 -4.42771  -41.51449 1.000 118.74667 ? 704  DG  T O6    1 
ATOM   407  N  N1    . DG  B 2  4   ? 36.30020 -3.76728  -42.29047 1.000 115.15528 ? 704  DG  T N1    1 
ATOM   408  C  C2    . DG  B 2  4   ? 35.30200 -2.83640  -42.47129 1.000 110.12601 ? 704  DG  T C2    1 
ATOM   409  N  N2    . DG  B 2  4   ? 34.21353 -3.24626  -43.14191 1.000 110.70206 ? 704  DG  T N2    1 
ATOM   410  N  N3    . DG  B 2  4   ? 35.36879 -1.59072  -42.03054 1.000 106.76033 ? 704  DG  T N3    1 
ATOM   411  C  C4    . DG  B 2  4   ? 36.53770 -1.34540  -41.38612 1.000 107.79911 ? 704  DG  T C4    1 
ATOM   412  P  P     . DA  B 2  5   ? 34.32788 4.01241   -38.54490 1.000 85.41832  ? 705  DA  T P     1 
ATOM   413  O  OP1   . DA  B 2  5   ? 33.60709 3.39403   -39.67897 1.000 92.35774  ? 705  DA  T OP1   1 
ATOM   414  O  OP2   . DA  B 2  5   ? 33.91588 5.37773   -38.14276 1.000 84.56321  ? 705  DA  T OP2   1 
ATOM   415  O  "O5'" . DA  B 2  5   ? 34.26769 3.07523   -37.23446 1.000 72.52130  ? 705  DA  T "O5'" 1 
ATOM   416  C  "C5'" . DA  B 2  5   ? 33.20658 2.15229   -37.05152 1.000 69.68144  ? 705  DA  T "C5'" 1 
ATOM   417  C  "C4'" . DA  B 2  5   ? 33.01160 1.83857   -35.57531 1.000 67.44266  ? 705  DA  T "C4'" 1 
ATOM   418  O  "O4'" . DA  B 2  5   ? 34.01326 0.87910   -35.11839 1.000 65.83464  ? 705  DA  T "O4'" 1 
ATOM   419  C  "C3'" . DA  B 2  5   ? 33.17561 3.02513   -34.64018 1.000 62.91657  ? 705  DA  T "C3'" 1 
ATOM   420  O  "O3'" . DA  B 2  5   ? 31.97221 3.75818   -34.56042 1.000 59.41792  ? 705  DA  T "O3'" 1 
ATOM   421  C  "C2'" . DA  B 2  5   ? 33.50260 2.31972   -33.32702 1.000 57.06175  ? 705  DA  T "C2'" 1 
ATOM   422  C  "C1'" . DA  B 2  5   ? 34.47096 1.25317   -33.81837 1.000 60.49579  ? 705  DA  T "C1'" 1 
ATOM   423  N  N9    . DA  B 2  5   ? 35.84631 1.75740   -33.91750 1.000 64.30410  ? 705  DA  T N9    1 
ATOM   424  C  C8    . DA  B 2  5   ? 36.54105 2.05607   -35.06297 1.000 66.62145  ? 705  DA  T C8    1 
ATOM   425  N  N7    . DA  B 2  5   ? 37.75517 2.51223   -34.84647 1.000 66.71794  ? 705  DA  T N7    1 
ATOM   426  C  C5    . DA  B 2  5   ? 37.86814 2.52698   -33.45901 1.000 64.90519  ? 705  DA  T C5    1 
ATOM   427  C  C6    . DA  B 2  5   ? 38.91869 2.91011   -32.58476 1.000 64.64538  ? 705  DA  T C6    1 
ATOM   428  N  N6    . DA  B 2  5   ? 40.10816 3.36943   -33.00558 1.000 53.31074  ? 705  DA  T N6    1 
ATOM   429  N  N1    . DA  B 2  5   ? 38.69365 2.80095   -31.25512 1.000 56.09887  ? 705  DA  T N1    1 
ATOM   430  C  C2    . DA  B 2  5   ? 37.50641 2.34272   -30.82886 1.000 52.86917  ? 705  DA  T C2    1 
ATOM   431  N  N3    . DA  B 2  5   ? 36.45086 1.95589   -31.54334 1.000 58.75191  ? 705  DA  T N3    1 
ATOM   432  C  C4    . DA  B 2  5   ? 36.69710 2.07165   -32.86844 1.000 64.25670  ? 705  DA  T C4    1 
ATOM   433  P  P     . DC  B 2  6   ? 31.98811 5.25111   -33.97201 1.000 56.22892  ? 706  DC  T P     1 
ATOM   434  O  OP1   . DC  B 2  6   ? 30.60916 5.76847   -33.98609 1.000 52.73185  ? 706  DC  T OP1   1 
ATOM   435  O  OP2   . DC  B 2  6   ? 33.05593 5.97904   -34.69300 1.000 61.93921  ? 706  DC  T OP2   1 
ATOM   436  O  "O5'" . DC  B 2  6   ? 32.44287 5.07410   -32.43902 1.000 53.35544  ? 706  DC  T "O5'" 1 
ATOM   437  C  "C5'" . DC  B 2  6   ? 31.53764 4.60174   -31.47350 1.000 44.19812  ? 706  DC  T "C5'" 1 
ATOM   438  C  "C4'" . DC  B 2  6   ? 32.19430 4.57104   -30.11347 1.000 58.04710  ? 706  DC  T "C4'" 1 
ATOM   439  O  "O4'" . DC  B 2  6   ? 33.49798 3.94454   -30.20713 1.000 57.65664  ? 706  DC  T "O4'" 1 
ATOM   440  C  "C3'" . DC  B 2  6   ? 32.48247 5.92838   -29.51458 1.000 49.28392  ? 706  DC  T "C3'" 1 
ATOM   441  O  "O3'" . DC  B 2  6   ? 31.31314 6.44294   -28.89648 1.000 42.50984  ? 706  DC  T "O3'" 1 
ATOM   442  C  "C2'" . DC  B 2  6   ? 33.56688 5.58854   -28.49647 1.000 47.70315  ? 706  DC  T "C2'" 1 
ATOM   443  C  "C1'" . DC  B 2  6   ? 34.37910 4.54483   -29.26451 1.000 51.40575  ? 706  DC  T "C1'" 1 
ATOM   444  N  N1    . DC  B 2  6   ? 35.55790 5.10835   -30.00314 1.000 50.88795  ? 706  DC  T N1    1 
ATOM   445  C  C2    . DC  B 2  6   ? 36.71403 5.45695   -29.29146 1.000 45.22159  ? 706  DC  T C2    1 
ATOM   446  O  O2    . DC  B 2  6   ? 36.72741 5.31647   -28.07051 1.000 39.87011  ? 706  DC  T O2    1 
ATOM   447  N  N3    . DC  B 2  6   ? 37.78509 5.94419   -29.96969 1.000 48.24470  ? 706  DC  T N3    1 
ATOM   448  C  C4    . DC  B 2  6   ? 37.73326 6.08687   -31.29610 1.000 51.03027  ? 706  DC  T C4    1 
ATOM   449  N  N4    . DC  B 2  6   ? 38.81456 6.58664   -31.91559 1.000 45.12906  ? 706  DC  T N4    1 
ATOM   450  C  C5    . DC  B 2  6   ? 36.56518 5.72323   -32.04653 1.000 47.63931  ? 706  DC  T C5    1 
ATOM   451  C  C6    . DC  B 2  6   ? 35.50944 5.24991   -31.36540 1.000 43.03067  ? 706  DC  T C6    1 
ATOM   452  P  P     . DG  B 2  7   ? 30.92296 7.97357   -29.13923 1.000 42.17532  ? 707  DG  T P     1 
ATOM   453  O  OP1   . DG  B 2  7   ? 29.48490 8.15835   -28.87634 1.000 39.64116  ? 707  DG  T OP1   1 
ATOM   454  O  OP2   . DG  B 2  7   ? 31.48028 8.33712   -30.45970 1.000 52.84263  ? 707  DG  T OP2   1 
ATOM   455  O  "O5'" . DG  B 2  7   ? 31.73953 8.73756   -28.01479 1.000 34.85125  ? 707  DG  T "O5'" 1 
ATOM   456  C  "C5'" . DG  B 2  7   ? 31.44998 8.43756   -26.67937 1.000 34.73295  ? 707  DG  T "C5'" 1 
ATOM   457  C  "C4'" . DG  B 2  7   ? 32.55700 8.89198   -25.78257 1.000 34.09358  ? 707  DG  T "C4'" 1 
ATOM   458  O  "O4'" . DG  B 2  7   ? 33.73307 8.08097   -25.99082 1.000 36.04501  ? 707  DG  T "O4'" 1 
ATOM   459  C  "C3'" . DG  B 2  7   ? 33.03942 10.31740  -26.01577 1.000 39.04218  ? 707  DG  T "C3'" 1 
ATOM   460  O  "O3'" . DG  B 2  7   ? 32.12901 11.23359  -25.41511 1.000 29.89789  ? 707  DG  T "O3'" 1 
ATOM   461  C  "C2'" . DG  B 2  7   ? 34.38928 10.26814  -25.29644 1.000 33.05017  ? 707  DG  T "C2'" 1 
ATOM   462  C  "C1'" . DG  B 2  7   ? 34.89113 8.88301   -25.74340 1.000 34.96391  ? 707  DG  T "C1'" 1 
ATOM   463  N  N9    . DG  B 2  7   ? 35.65013 8.94793   -26.96932 1.000 36.67746  ? 707  DG  T N9    1 
ATOM   464  C  C8    . DG  B 2  7   ? 35.16518 8.81251   -28.24978 1.000 39.77193  ? 707  DG  T C8    1 
ATOM   465  N  N7    . DG  B 2  7   ? 36.08270 8.93400   -29.16092 1.000 39.72349  ? 707  DG  T N7    1 
ATOM   466  C  C5    . DG  B 2  7   ? 37.24317 9.17862   -28.44137 1.000 39.99581  ? 707  DG  T C5    1 
ATOM   467  C  C6    . DG  B 2  7   ? 38.55879 9.40421   -28.89054 1.000 43.67294  ? 707  DG  T C6    1 
ATOM   468  O  O6    . DG  B 2  7   ? 38.97482 9.42401   -30.05014 1.000 44.12191  ? 707  DG  T O6    1 
ATOM   469  N  N1    . DG  B 2  7   ? 39.43817 9.61465   -27.82783 1.000 46.23627  ? 707  DG  T N1    1 
ATOM   470  C  C2    . DG  B 2  7   ? 39.08713 9.60859   -26.49834 1.000 40.34907  ? 707  DG  T C2    1 
ATOM   471  N  N2    . DG  B 2  7   ? 40.07049 9.82739   -25.62598 1.000 42.18773  ? 707  DG  T N2    1 
ATOM   472  N  N3    . DG  B 2  7   ? 37.85738 9.39872   -26.06115 1.000 35.99737  ? 707  DG  T N3    1 
ATOM   473  C  C4    . DG  B 2  7   ? 36.98936 9.19003   -27.08776 1.000 37.33175  ? 707  DG  T C4    1 
ATOM   474  P  P     . DG  B 2  8   ? 32.14214 12.78992  -25.81394 1.000 38.26718  ? 708  DG  T P     1 
ATOM   475  O  OP1   . DG  B 2  8   ? 31.09633 13.45266  -24.99111 1.000 36.08285  ? 708  DG  T OP1   1 
ATOM   476  O  OP2   . DG  B 2  8   ? 32.08663 12.87112  -27.28343 1.000 36.57703  ? 708  DG  T OP2   1 
ATOM   477  O  "O5'" . DG  B 2  8   ? 33.58834 13.29919  -25.31632 1.000 36.94819  ? 708  DG  T "O5'" 1 
ATOM   478  C  "C5'" . DG  B 2  8   ? 33.87108 13.37180  -23.92724 1.000 38.23783  ? 708  DG  T "C5'" 1 
ATOM   479  C  "C4'" . DG  B 2  8   ? 35.28160 13.87128  -23.65675 1.000 38.84908  ? 708  DG  T "C4'" 1 
ATOM   480  O  "O4'" . DG  B 2  8   ? 36.25345 12.91166  -24.13277 1.000 36.41208  ? 708  DG  T "O4'" 1 
ATOM   481  C  "C3'" . DG  B 2  8   ? 35.65826 15.17782  -24.33536 1.000 39.27060  ? 708  DG  T "C3'" 1 
ATOM   482  O  "O3'" . DG  B 2  8   ? 35.21431 16.25182  -23.55103 1.000 40.43158  ? 708  DG  T "O3'" 1 
ATOM   483  C  "C2'" . DG  B 2  8   ? 37.17575 15.07390  -24.31683 1.000 39.55216  ? 708  DG  T "C2'" 1 
ATOM   484  C  "C1'" . DG  B 2  8   ? 37.37523 13.59621  -24.65279 1.000 38.83490  ? 708  DG  T "C1'" 1 
ATOM   485  N  N9    . DG  B 2  8   ? 37.42943 13.33965  -26.08593 1.000 43.15280  ? 708  DG  T N9    1 
ATOM   486  C  C8    . DG  B 2  8   ? 36.38854 12.95803  -26.89923 1.000 44.33203  ? 708  DG  T C8    1 
ATOM   487  N  N7    . DG  B 2  8   ? 36.72796 12.80766  -28.14851 1.000 40.77450  ? 708  DG  T N7    1 
ATOM   488  C  C5    . DG  B 2  8   ? 38.08005 13.10435  -28.16534 1.000 44.76262  ? 708  DG  T C5    1 
ATOM   489  C  C6    . DG  B 2  8   ? 38.99576 13.11211  -29.24079 1.000 43.72306  ? 708  DG  T C6    1 
ATOM   490  O  O6    . DG  B 2  8   ? 38.78416 12.85092  -30.42570 1.000 41.69419  ? 708  DG  T O6    1 
ATOM   491  N  N1    . DG  B 2  8   ? 40.27364 13.48136  -28.82644 1.000 43.31677  ? 708  DG  T N1    1 
ATOM   492  C  C2    . DG  B 2  8   ? 40.61914 13.79244  -27.53355 1.000 45.57320  ? 708  DG  T C2    1 
ATOM   493  N  N2    . DG  B 2  8   ? 41.89628 14.11098  -27.32499 1.000 52.05258  ? 708  DG  T N2    1 
ATOM   494  N  N3    . DG  B 2  8   ? 39.77305 13.78178  -26.51206 1.000 42.62340  ? 708  DG  T N3    1 
ATOM   495  C  C4    . DG  B 2  8   ? 38.52659 13.43661  -26.90056 1.000 44.26134  ? 708  DG  T C4    1 
ATOM   496  P  P     . DC  B 2  9   ? 34.43676 17.49724  -24.20483 1.000 42.45326  ? 709  DC  T P     1 
ATOM   497  O  OP1   . DC  B 2  9   ? 33.66527 18.07421  -23.07900 1.000 40.19397  ? 709  DC  T OP1   1 
ATOM   498  O  OP2   . DC  B 2  9   ? 33.78827 17.11683  -25.46864 1.000 34.87558  ? 709  DC  T OP2   1 
ATOM   499  O  "O5'" . DC  B 2  9   ? 35.60500 18.52370  -24.54858 1.000 37.26887  ? 709  DC  T "O5'" 1 
ATOM   500  C  "C5'" . DC  B 2  9   ? 36.56303 18.83491  -23.54365 1.000 35.22317  ? 709  DC  T "C5'" 1 
ATOM   501  C  "C4'" . DC  B 2  9   ? 37.89853 19.16831  -24.16705 1.000 37.67270  ? 709  DC  T "C4'" 1 
ATOM   502  O  "O4'" . DC  B 2  9   ? 38.45370 17.98485  -24.78574 1.000 36.04069  ? 709  DC  T "O4'" 1 
ATOM   503  C  "C3'" . DC  B 2  9   ? 37.84214 20.16897  -25.29887 1.000 41.19572  ? 709  DC  T "C3'" 1 
ATOM   504  O  "O3'" . DC  B 2  9   ? 37.79952 21.46246  -24.78824 1.000 38.20655  ? 709  DC  T "O3'" 1 
ATOM   505  C  "C2'" . DC  B 2  9   ? 39.16096 19.88237  -26.00533 1.000 41.59278  ? 709  DC  T "C2'" 1 
ATOM   506  C  "C1'" . DC  B 2  9   ? 39.22438 18.35892  -25.91245 1.000 38.22674  ? 709  DC  T "C1'" 1 
ATOM   507  N  N1    . DC  B 2  9   ? 38.66560 17.69203  -27.09648 1.000 42.32575  ? 709  DC  T N1    1 
ATOM   508  C  C2    . DC  B 2  9   ? 39.46391 17.53863  -28.23925 1.000 46.67178  ? 709  DC  T C2    1 
ATOM   509  O  O2    . DC  B 2  9   ? 40.62942 17.96111  -28.21848 1.000 46.95076  ? 709  DC  T O2    1 
ATOM   510  N  N3    . DC  B 2  9   ? 38.93572 16.92841  -29.33222 1.000 49.17960  ? 709  DC  T N3    1 
ATOM   511  C  C4    . DC  B 2  9   ? 37.66810 16.48757  -29.30363 1.000 49.50949  ? 709  DC  T C4    1 
ATOM   512  N  N4    . DC  B 2  9   ? 37.18183 15.89222  -30.40100 1.000 48.52312  ? 709  DC  T N4    1 
ATOM   513  C  C5    . DC  B 2  9   ? 36.84080 16.65197  -28.14972 1.000 48.28362  ? 709  DC  T C5    1 
ATOM   514  C  C6    . DC  B 2  9   ? 37.37421 17.25161  -27.08024 1.000 41.99538  ? 709  DC  T C6    1 
ATOM   515  P  P     . DG  B 2  10  ? 37.21590 22.66353  -25.68155 1.000 42.27700  ? 710  DG  T P     1 
ATOM   516  O  OP1   . DG  B 2  10  ? 37.35467 23.88095  -24.83769 1.000 43.46469  ? 710  DG  T OP1   1 
ATOM   517  O  OP2   . DG  B 2  10  ? 35.89977 22.28037  -26.22423 1.000 36.05090  ? 710  DG  T OP2   1 
ATOM   518  O  "O5'" . DG  B 2  10  ? 38.26682 22.78509  -26.87041 1.000 40.44623  ? 710  DG  T "O5'" 1 
ATOM   519  C  "C5'" . DG  B 2  10  ? 39.59726 23.21481  -26.58863 1.000 37.24239  ? 710  DG  T "C5'" 1 
ATOM   520  C  "C4'" . DG  B 2  10  ? 40.42325 23.23978  -27.85304 1.000 34.36514  ? 710  DG  T "C4'" 1 
ATOM   521  O  "O4'" . DG  B 2  10  ? 40.53868 21.90508  -28.36428 1.000 36.05260  ? 710  DG  T "O4'" 1 
ATOM   522  C  "C3'" . DG  B 2  10  ? 39.82140 24.05027  -28.98490 1.000 34.52509  ? 710  DG  T "C3'" 1 
ATOM   523  O  "O3'" . DG  B 2  10  ? 40.27178 25.35710  -28.87526 1.000 38.39656  ? 710  DG  T "O3'" 1 
ATOM   524  C  "C2'" . DG  B 2  10  ? 40.40578 23.38014  -30.21632 1.000 33.46186  ? 710  DG  T "C2'" 1 
ATOM   525  C  "C1'" . DG  B 2  10  ? 40.54944 21.93311  -29.77068 1.000 35.66430  ? 710  DG  T "C1'" 1 
ATOM   526  N  N9    . DG  B 2  10  ? 39.50004 21.05478  -30.24028 1.000 42.59067  ? 710  DG  T N9    1 
ATOM   527  C  C8    . DG  B 2  10  ? 38.46024 20.53453  -29.50802 1.000 44.47918  ? 710  DG  T C8    1 
ATOM   528  N  N7    . DG  B 2  10  ? 37.69400 19.73670  -30.20037 1.000 47.06016  ? 710  DG  T N7    1 
ATOM   529  C  C5    . DG  B 2  10  ? 38.27024 19.72633  -31.46550 1.000 46.30034  ? 710  DG  T C5    1 
ATOM   530  C  C6    . DG  B 2  10  ? 37.88625 19.04570  -32.63423 1.000 48.85513  ? 710  DG  T C6    1 
ATOM   531  O  O6    . DG  B 2  10  ? 36.92859 18.28805  -32.79625 1.000 52.63322  ? 710  DG  T O6    1 
ATOM   532  N  N1    . DG  B 2  10  ? 38.74671 19.31140  -33.69171 1.000 48.62509  ? 710  DG  T N1    1 
ATOM   533  C  C2    . DG  B 2  10  ? 39.83996 20.13588  -33.62917 1.000 50.83845  ? 710  DG  T C2    1 
ATOM   534  N  N2    . DG  B 2  10  ? 40.55649 20.27968  -34.75348 1.000 56.21990  ? 710  DG  T N2    1 
ATOM   535  N  N3    . DG  B 2  10  ? 40.20874 20.78190  -32.54262 1.000 48.60336  ? 710  DG  T N3    1 
ATOM   536  C  C4    . DG  B 2  10  ? 39.38072 20.53057  -31.50219 1.000 45.99040  ? 710  DG  T C4    1 
ATOM   537  P  P     . DC  B 2  11  ? 39.47352 26.56602  -29.55036 1.000 49.12982  ? 711  DC  T P     1 
ATOM   538  O  OP1   . DC  B 2  11  ? 40.21942 27.79057  -29.16423 1.000 49.70858  ? 711  DC  T OP1   1 
ATOM   539  O  OP2   . DC  B 2  11  ? 38.02875 26.45468  -29.23854 1.000 47.64888  ? 711  DC  T OP2   1 
ATOM   540  O  "O5'" . DC  B 2  11  ? 39.67571 26.32233  -31.11382 1.000 47.03516  ? 711  DC  T "O5'" 1 
ATOM   541  C  "C5'" . DC  B 2  11  ? 40.96516 26.41002  -31.68331 1.000 41.63114  ? 711  DC  T "C5'" 1 
ATOM   542  C  "C4'" . DC  B 2  11  ? 40.86738 26.17121  -33.16100 1.000 45.52857  ? 711  DC  T "C4'" 1 
ATOM   543  O  "O4'" . DC  B 2  11  ? 40.41154 24.82492  -33.38250 1.000 49.49200  ? 711  DC  T "O4'" 1 
ATOM   544  C  "C3'" . DC  B 2  11  ? 39.88038 27.09061  -33.86038 1.000 44.93653  ? 711  DC  T "C3'" 1 
ATOM   545  O  "O3'" . DC  B 2  11  ? 40.59145 27.98004  -34.65547 1.000 51.19941  ? 711  DC  T "O3'" 1 
ATOM   546  C  "C2'" . DC  B 2  11  ? 38.99006 26.17922  -34.71345 1.000 44.35806  ? 711  DC  T "C2'" 1 
ATOM   547  C  "C1'" . DC  B 2  11  ? 39.49795 24.77410  -34.45414 1.000 47.82649  ? 711  DC  T "C1'" 1 
ATOM   548  N  N1    . DC  B 2  11  ? 38.42913 23.82815  -34.07409 1.000 48.19001  ? 711  DC  T N1    1 
ATOM   549  C  C2    . DC  B 2  11  ? 37.88756 22.98308  -35.03485 1.000 50.10919  ? 711  DC  T C2    1 
ATOM   550  O  O2    . DC  B 2  11  ? 38.30531 23.05328  -36.19014 1.000 52.52648  ? 711  DC  T O2    1 
ATOM   551  N  N3    . DC  B 2  11  ? 36.91631 22.10941  -34.66932 1.000 53.36683  ? 711  DC  T N3    1 
ATOM   552  C  C4    . DC  B 2  11  ? 36.50082 22.06796  -33.39815 1.000 51.53538  ? 711  DC  T C4    1 
ATOM   553  N  N4    . DC  B 2  11  ? 35.54006 21.19353  -33.07492 1.000 48.48844  ? 711  DC  T N4    1 
ATOM   554  C  C5    . DC  B 2  11  ? 37.04776 22.93222  -32.40499 1.000 47.97475  ? 711  DC  T C5    1 
ATOM   555  C  C6    . DC  B 2  11  ? 38.00061 23.78366  -32.78260 1.000 44.52513  ? 711  DC  T C6    1 
ATOM   556  P  P     . DC  B 2  12  ? 39.88029 29.26997  -35.28886 1.000 63.84067  ? 712  DC  T P     1 
ATOM   557  O  OP1   . DC  B 2  12  ? 41.04847 30.01046  -35.81365 1.000 68.85411  ? 712  DC  T OP1   1 
ATOM   558  O  OP2   . DC  B 2  12  ? 38.90012 29.87295  -34.35849 1.000 55.27901  ? 712  DC  T OP2   1 
ATOM   559  O  "O5'" . DC  B 2  12  ? 38.95178 28.70620  -36.46680 1.000 63.14411  ? 712  DC  T "O5'" 1 
ATOM   560  C  "C5'" . DC  B 2  12  ? 39.51229 28.20414  -37.66737 1.000 66.26367  ? 712  DC  T "C5'" 1 
ATOM   561  C  "C4'" . DC  B 2  12  ? 38.40607 27.70349  -38.58290 1.000 68.34209  ? 712  DC  T "C4'" 1 
ATOM   562  O  "O4'" . DC  B 2  12  ? 37.81842 26.49708  -38.03620 1.000 71.42778  ? 712  DC  T "O4'" 1 
ATOM   563  C  "C3'" . DC  B 2  12  ? 37.26118 28.69047  -38.78734 1.000 65.11582  ? 712  DC  T "C3'" 1 
ATOM   564  O  "O3'" . DC  B 2  12  ? 37.25386 29.10998  -40.12335 1.000 72.62083  ? 712  DC  T "O3'" 1 
ATOM   565  C  "C2'" . DC  B 2  12  ? 35.98243 27.91224  -38.44054 1.000 64.43316  ? 712  DC  T "C2'" 1 
ATOM   566  C  "C1'" . DC  B 2  12  ? 36.43976 26.46191  -38.32884 1.000 67.12992  ? 712  DC  T "C1'" 1 
ATOM   567  N  N1    . DC  B 2  12  ? 35.75768 25.71354  -37.22228 1.000 61.06911  ? 712  DC  T N1    1 
ATOM   568  C  C2    . DC  B 2  12  ? 35.00043 24.55614  -37.50239 1.000 57.11839  ? 712  DC  T C2    1 
ATOM   569  O  O2    . DC  B 2  12  ? 34.90244 24.16773  -38.66607 1.000 56.41913  ? 712  DC  T O2    1 
ATOM   570  N  N3    . DC  B 2  12  ? 34.40132 23.89647  -36.47376 1.000 55.22491  ? 712  DC  T N3    1 
ATOM   571  C  C4    . DC  B 2  12  ? 34.54027 24.34511  -35.22600 1.000 56.06031  ? 712  DC  T C4    1 
ATOM   572  N  N4    . DC  B 2  12  ? 33.93139 23.67512  -34.24454 1.000 57.95783  ? 712  DC  T N4    1 
ATOM   573  C  C5    . DC  B 2  12  ? 35.30485 25.51559  -34.92568 1.000 53.79911  ? 712  DC  T C5    1 
ATOM   574  C  C6    . DC  B 2  12  ? 35.88729 26.15987  -35.94214 1.000 54.37219  ? 712  DC  T C6    1 
ATOM   575  P  P     . DC  B 2  13  ? 36.24595 30.25680  -40.61672 1.000 72.63724  ? 713  DC  T P     1 
ATOM   576  O  OP1   . DC  B 2  13  ? 36.97275 30.95194  -41.70354 1.000 73.64808  ? 713  DC  T OP1   1 
ATOM   577  O  OP2   . DC  B 2  13  ? 35.71496 30.98303  -39.44315 1.000 68.20163  ? 713  DC  T OP2   1 
ATOM   578  O  "O5'" . DC  B 2  13  ? 35.00240 29.45034  -41.21658 1.000 75.84758  ? 713  DC  T "O5'" 1 
ATOM   579  C  "C5'" . DC  B 2  13  ? 35.21573 28.30214  -42.04761 1.000 78.57080  ? 713  DC  T "C5'" 1 
ATOM   580  C  "C4'" . DC  B 2  13  ? 33.89771 27.60629  -42.32601 1.000 78.47843  ? 713  DC  T "C4'" 1 
ATOM   581  O  "O4'" . DC  B 2  13  ? 33.54477 26.75248  -41.20033 1.000 78.56415  ? 713  DC  T "O4'" 1 
ATOM   582  C  "C3'" . DC  B 2  13  ? 32.72609 28.56037  -42.51905 1.000 78.82086  ? 713  DC  T "C3'" 1 
ATOM   583  O  "O3'" . DC  B 2  13  ? 31.99066 28.21566  -43.66653 1.000 84.29501  ? 713  DC  T "O3'" 1 
ATOM   584  C  "C2'" . DC  B 2  13  ? 31.89512 28.39394  -41.24604 1.000 76.05224  ? 713  DC  T "C2'" 1 
ATOM   585  C  "C1'" . DC  B 2  13  ? 32.19290 26.96093  -40.85516 1.000 75.96844  ? 713  DC  T "C1'" 1 
ATOM   586  N  N1    . DC  B 2  13  ? 32.04434 26.72357  -39.40125 1.000 70.55812  ? 713  DC  T N1    1 
ATOM   587  C  C2    . DC  B 2  13  ? 31.35110 25.60196  -38.94055 1.000 73.03151  ? 713  DC  T C2    1 
ATOM   588  O  O2    . DC  B 2  13  ? 30.87572 24.80932  -39.76229 1.000 74.40910  ? 713  DC  T O2    1 
ATOM   589  N  N3    . DC  B 2  13  ? 31.23230 25.41232  -37.60015 1.000 75.61377  ? 713  DC  T N3    1 
ATOM   590  C  C4    . DC  B 2  13  ? 31.77067 26.29485  -36.75104 1.000 71.01819  ? 713  DC  T C4    1 
ATOM   591  N  N4    . DC  B 2  13  ? 31.63121 26.07775  -35.44124 1.000 67.00587  ? 713  DC  T N4    1 
ATOM   592  C  C5    . DC  B 2  13  ? 32.47559 27.44093  -37.21043 1.000 70.21349  ? 713  DC  T C5    1 
ATOM   593  C  C6    . DC  B 2  13  ? 32.58154 27.61406  -38.52761 1.000 70.11773  ? 713  DC  T C6    1 
ATOM   594  P  P     . DG  B 2  14  ? 30.93943 29.27060  -44.26061 1.000 82.86278  ? 714  DG  T P     1 
ATOM   595  O  OP1   . DG  B 2  14  ? 31.35317 29.53095  -45.65262 1.000 91.94017  ? 714  DG  T OP1   1 
ATOM   596  O  OP2   . DG  B 2  14  ? 30.76067 30.38060  -43.28899 1.000 74.98888  ? 714  DG  T OP2   1 
ATOM   597  O  "O5'" . DG  B 2  14  ? 29.55745 28.49103  -44.25194 1.000 80.32447  ? 714  DG  T "O5'" 1 
ATOM   598  C  "C5'" . DG  B 2  14  ? 29.43932 27.23672  -44.87561 1.000 83.26361  ? 714  DG  T "C5'" 1 
ATOM   599  C  "C4'" . DG  B 2  14  ? 28.22948 26.52121  -44.32670 1.000 86.50237  ? 714  DG  T "C4'" 1 
ATOM   600  O  "O4'" . DG  B 2  14  ? 28.43921 26.28167  -42.90827 1.000 88.36230  ? 714  DG  T "O4'" 1 
ATOM   601  C  "C3'" . DG  B 2  14  ? 26.91816 27.31037  -44.42873 1.000 85.05503  ? 714  DG  T "C3'" 1 
ATOM   602  O  "O3'" . DG  B 2  14  ? 25.84047 26.42354  -44.68002 1.000 91.26892  ? 714  DG  T "O3'" 1 
ATOM   603  C  "C2'" . DG  B 2  14  ? 26.79930 27.94816  -43.04829 1.000 80.20322  ? 714  DG  T "C2'" 1 
ATOM   604  C  "C1'" . DG  B 2  14  ? 27.37480 26.84705  -42.17272 1.000 84.00592  ? 714  DG  T "C1'" 1 
ATOM   605  N  N9    . DG  B 2  14  ? 27.87245 27.31220  -40.87611 1.000 77.66264  ? 714  DG  T N9    1 
ATOM   606  C  C8    . DG  B 2  14  ? 28.62057 28.43776  -40.62151 1.000 73.96562  ? 714  DG  T C8    1 
ATOM   607  N  N7    . DG  B 2  14  ? 28.90565 28.59832  -39.35597 1.000 71.38386  ? 714  DG  T N7    1 
ATOM   608  C  C5    . DG  B 2  14  ? 28.30722 27.50506  -38.73311 1.000 73.57566  ? 714  DG  T C5    1 
ATOM   609  C  C6    . DG  B 2  14  ? 28.27641 27.12964  -37.36361 1.000 72.01413  ? 714  DG  T C6    1 
ATOM   610  O  O6    . DG  B 2  14  ? 28.79000 27.71122  -36.39144 1.000 71.95117  ? 714  DG  T O6    1 
ATOM   611  N  N1    . DG  B 2  14  ? 27.55372 25.95129  -37.16983 1.000 72.18388  ? 714  DG  T N1    1 
ATOM   612  C  C2    . DG  B 2  14  ? 26.94242 25.22843  -38.16943 1.000 76.35719  ? 714  DG  T C2    1 
ATOM   613  N  N2    . DG  B 2  14  ? 26.29610 24.11836  -37.80014 1.000 80.41812  ? 714  DG  T N2    1 
ATOM   614  N  N3    . DG  B 2  14  ? 26.96709 25.56634  -39.44887 1.000 77.35431  ? 714  DG  T N3    1 
ATOM   615  C  C4    . DG  B 2  14  ? 27.66348 26.71105  -39.65729 1.000 76.22073  ? 714  DG  T C4    1 
ATOM   616  P  P     . DA  B 2  15  ? 24.44885 26.96977  -45.27089 1.000 92.62125  ? 715  DA  T P     1 
ATOM   617  O  OP1   . DA  B 2  15  ? 24.48181 26.79282  -46.74075 1.000 96.00289  ? 715  DA  T OP1   1 
ATOM   618  O  OP2   . DA  B 2  15  ? 24.18162 28.29339  -44.67647 1.000 88.78573  ? 715  DA  T OP2   1 
ATOM   619  O  "O5'" . DA  B 2  15  ? 23.36042 25.96969  -44.65993 1.000 94.51368  ? 715  DA  T "O5'" 1 
ATOM   620  C  "C5'" . DA  B 2  15  ? 23.75875 24.68385  -44.17303 1.000 90.63905  ? 715  DA  T "C5'" 1 
ATOM   621  C  "C4'" . DA  B 2  15  ? 22.84736 24.22763  -43.04158 1.000 89.41163  ? 715  DA  T "C4'" 1 
ATOM   622  O  "O4'" . DA  B 2  15  ? 23.41328 24.61156  -41.76032 1.000 83.49055  ? 715  DA  T "O4'" 1 
ATOM   623  C  "C3'" . DA  B 2  15  ? 21.43815 24.80371  -43.06898 1.000 91.74952  ? 715  DA  T "C3'" 1 
ATOM   624  O  "O3'" . DA  B 2  15  ? 20.50952 23.80564  -42.68931 1.000 98.52980  ? 715  DA  T "O3'" 1 
ATOM   625  C  "C2'" . DA  B 2  15  ? 21.49614 25.94516  -42.04766 1.000 82.95887  ? 715  DA  T "C2'" 1 
ATOM   626  C  "C1'" . DA  B 2  15  ? 22.51000 25.42740  -41.03827 1.000 78.65584  ? 715  DA  T "C1'" 1 
ATOM   627  N  N9    . DA  B 2  15  ? 23.29720 26.48208  -40.40754 1.000 73.92215  ? 715  DA  T N9    1 
ATOM   628  C  C8    . DA  B 2  15  ? 23.93268 27.51291  -41.03906 1.000 71.08930  ? 715  DA  T C8    1 
ATOM   629  N  N7    . DA  B 2  15  ? 24.59699 28.30072  -40.23108 1.000 67.47543  ? 715  DA  T N7    1 
ATOM   630  C  C5    . DA  B 2  15  ? 24.39255 27.74847  -38.98048 1.000 67.60203  ? 715  DA  T C5    1 
ATOM   631  C  C6    . DA  B 2  15  ? 24.83776 28.12344  -37.69861 1.000 68.30314  ? 715  DA  T C6    1 
ATOM   632  N  N6    . DA  B 2  15  ? 25.60910 29.19891  -37.47456 1.000 64.92535  ? 715  DA  T N6    1 
ATOM   633  N  N1    . DA  B 2  15  ? 24.45712 27.34945  -36.65029 1.000 69.06618  ? 715  DA  T N1    1 
ATOM   634  C  C2    . DA  B 2  15  ? 23.68157 26.27732  -36.88056 1.000 67.52869  ? 715  DA  T C2    1 
ATOM   635  N  N3    . DA  B 2  15  ? 23.20037 25.82920  -38.04097 1.000 70.50934  ? 715  DA  T N3    1 
ATOM   636  C  C4    . DA  B 2  15  ? 23.59754 26.61999  -39.06426 1.000 70.95027  ? 715  DA  T C4    1 
ATOM   637  P  P     . DA  B 2  16  ? 18.93337 24.08843  -42.80218 1.000 104.95717 ? 716  DA  T P     1 
ATOM   638  O  OP1   . DA  B 2  16  ? 18.31104 22.78360  -43.12301 1.000 114.11292 ? 716  DA  T OP1   1 
ATOM   639  O  OP2   . DA  B 2  16  ? 18.70896 25.26381  -43.67935 1.000 100.29358 ? 716  DA  T OP2   1 
ATOM   640  O  "O5'" . DA  B 2  16  ? 18.51567 24.51627  -41.31735 1.000 101.95009 ? 716  DA  T "O5'" 1 
ATOM   641  C  "C5'" . DA  B 2  16  ? 18.44600 23.53351  -40.28584 1.000 101.32187 ? 716  DA  T "C5'" 1 
ATOM   642  C  "C4'" . DA  B 2  16  ? 18.18927 24.18773  -38.94494 1.000 96.41431  ? 716  DA  T "C4'" 1 
ATOM   643  O  "O4'" . DA  B 2  16  ? 19.27595 25.10230  -38.65393 1.000 85.81674  ? 716  DA  T "O4'" 1 
ATOM   644  C  "C3'" . DA  B 2  16  ? 16.90156 25.02509  -38.86849 1.000 100.87569 ? 716  DA  T "C3'" 1 
ATOM   645  O  "O3'" . DA  B 2  16  ? 16.15805 24.70752  -37.68555 1.000 116.12990 ? 716  DA  T "O3'" 1 
ATOM   646  C  "C2'" . DA  B 2  16  ? 17.42134 26.45559  -38.82472 1.000 88.09336  ? 716  DA  T "C2'" 1 
ATOM   647  C  "C1'" . DA  B 2  16  ? 18.73541 26.26542  -38.10109 1.000 79.82427  ? 716  DA  T "C1'" 1 
ATOM   648  N  N9    . DA  B 2  16  ? 19.66305 27.36991  -38.30400 1.000 69.38483  ? 716  DA  T N9    1 
ATOM   649  C  C8    . DA  B 2  16  ? 19.95104 27.99588  -39.48442 1.000 64.76320  ? 716  DA  T C8    1 
ATOM   650  N  N7    . DA  B 2  16  ? 20.81705 28.96665  -39.36702 1.000 59.05648  ? 716  DA  T N7    1 
ATOM   651  C  C5    . DA  B 2  16  ? 21.10974 28.99295  -38.01295 1.000 58.36873  ? 716  DA  T C5    1 
ATOM   652  C  C6    . DA  B 2  16  ? 21.96059 29.80707  -37.24070 1.000 51.96782  ? 716  DA  T C6    1 
ATOM   653  N  N6    . DA  B 2  16  ? 22.70069 30.78868  -37.75257 1.000 46.95359  ? 716  DA  T N6    1 
ATOM   654  N  N1    . DA  B 2  16  ? 22.01754 29.57036  -35.91433 1.000 53.89808  ? 716  DA  T N1    1 
ATOM   655  C  C2    . DA  B 2  16  ? 21.27766 28.58055  -35.39717 1.000 57.04757  ? 716  DA  T C2    1 
ATOM   656  N  N3    . DA  B 2  16  ? 20.44010 27.75198  -36.01969 1.000 63.38110  ? 716  DA  T N3    1 
ATOM   657  C  C4    . DA  B 2  16  ? 20.40267 28.01672  -37.34080 1.000 63.71506  ? 716  DA  T C4    1 
ATOM   658  P  P     . DC  B 2  17  ? 14.59115 25.08288  -37.57437 1.000 130.45296 ? 717  DC  T P     1 
ATOM   659  O  OP1   . DC  B 2  17  ? 14.10515 24.59844  -36.25931 1.000 137.55590 ? 717  DC  T OP1   1 
ATOM   660  O  OP2   . DC  B 2  17  ? 13.93165 24.55313  -38.79263 1.000 139.07863 ? 717  DC  T OP2   1 
ATOM   661  O  "O5'" . DC  B 2  17  ? 14.55729 26.69888  -37.64353 1.000 118.78436 ? 717  DC  T "O5'" 1 
ATOM   662  C  "C5'" . DC  B 2  17  ? 14.05758 27.48514  -36.54285 1.000 109.84105 ? 717  DC  T "C5'" 1 
ATOM   663  C  "C4'" . DC  B 2  17  ? 15.06100 27.53740  -35.39567 1.000 99.35852  ? 717  DC  T "C4'" 1 
ATOM   664  O  "O4'" . DC  B 2  17  ? 16.40051 27.63804  -35.92381 1.000 93.44072  ? 717  DC  T "O4'" 1 
ATOM   665  C  "C3'" . DC  B 2  17  ? 14.90040 28.71908  -34.45547 1.000 92.16259  ? 717  DC  T "C3'" 1 
ATOM   666  O  "O3'" . DC  B 2  17  ? 14.06759 28.35634  -33.38812 1.000 95.36741  ? 717  DC  T "O3'" 1 
ATOM   667  C  "C2'" . DC  B 2  17  ? 16.31747 28.96856  -33.95876 1.000 87.47666  ? 717  DC  T "C2'" 1 
ATOM   668  C  "C1'" . DC  B 2  17  ? 17.18750 28.48685  -35.11240 1.000 87.04148  ? 717  DC  T "C1'" 1 
ATOM   669  N  N1    . DC  B 2  17  ? 17.74752 29.57788  -35.97915 1.000 80.78657  ? 717  DC  T N1    1 
ATOM   670  C  C2    . DC  B 2  17  ? 18.57043 30.57786  -35.42876 1.000 75.33833  ? 717  DC  T C2    1 
ATOM   671  O  O2    . DC  B 2  17  ? 18.81249 30.57543  -34.21197 1.000 81.04406  ? 717  DC  T O2    1 
ATOM   672  N  N3    . DC  B 2  17  ? 19.07601 31.52651  -36.25160 1.000 63.64112  ? 717  DC  T N3    1 
ATOM   673  C  C4    . DC  B 2  17  ? 18.80138 31.49911  -37.55315 1.000 61.57581  ? 717  DC  T C4    1 
ATOM   674  N  N4    . DC  B 2  17  ? 19.32796 32.45214  -38.32089 1.000 56.37161  ? 717  DC  T N4    1 
ATOM   675  C  C5    . DC  B 2  17  ? 17.97818 30.49288  -38.12773 1.000 68.26682  ? 717  DC  T C5    1 
ATOM   676  C  C6    . DC  B 2  17  ? 17.48028 29.56347  -37.31553 1.000 76.70332  ? 717  DC  T C6    1 
ATOM   677  P  P     . DA  B 2  18  ? 13.17010 29.46271  -32.65249 1.000 99.08755  ? 718  DA  T P     1 
ATOM   678  O  OP1   . DA  B 2  18  ? 12.50292 28.80585  -31.49900 1.000 105.37608 ? 718  DA  T OP1   1 
ATOM   679  O  OP2   . DA  B 2  18  ? 12.37497 30.13497  -33.70317 1.000 100.83886 ? 718  DA  T OP2   1 
ATOM   680  O  "O5'" . DA  B 2  18  ? 14.22799 30.54294  -32.12910 1.000 90.35339  ? 718  DA  T "O5'" 1 
ATOM   681  C  "C5'" . DA  B 2  18  ? 15.09653 30.24689  -31.04111 1.000 88.20521  ? 718  DA  T "C5'" 1 
ATOM   682  C  "C4'" . DA  B 2  18  ? 15.60979 31.52833  -30.41263 1.000 84.19559  ? 718  DA  T "C4'" 1 
ATOM   683  O  "O4'" . DA  B 2  18  ? 16.53441 32.18289  -31.31567 1.000 77.89933  ? 718  DA  T "O4'" 1 
ATOM   684  C  "C3'" . DA  B 2  18  ? 14.53129 32.55106  -30.10873 1.000 86.02858  ? 718  DA  T "C3'" 1 
ATOM   685  O  "O3'" . DA  B 2  18  ? 14.83376 33.23432  -28.92794 1.000 89.24576  ? 718  DA  T "O3'" 1 
ATOM   686  C  "C2'" . DA  B 2  18  ? 14.56267 33.48223  -31.31808 1.000 80.31772  ? 718  DA  T "C2'" 1 
ATOM   687  C  "C1'" . DA  B 2  18  ? 16.02747 33.44124  -31.72211 1.000 75.41072  ? 718  DA  T "C1'" 1 
ATOM   688  N  N9    . DA  B 2  18  ? 16.23533 33.55011  -33.15955 1.000 72.01280  ? 718  DA  T N9    1 
ATOM   689  C  C8    . DA  B 2  18  ? 15.66679 32.77780  -34.13417 1.000 73.92238  ? 718  DA  T C8    1 
ATOM   690  N  N7    . DA  B 2  18  ? 16.05032 33.09010  -35.34774 1.000 71.94272  ? 718  DA  T N7    1 
ATOM   691  C  C5    . DA  B 2  18  ? 16.93700 34.13073  -35.15263 1.000 65.48748  ? 718  DA  T C5    1 
ATOM   692  C  C6    . DA  B 2  18  ? 17.70012 34.89740  -36.04375 1.000 57.50533  ? 718  DA  T C6    1 
ATOM   693  N  N6    . DA  B 2  18  ? 17.67855 34.72592  -37.37125 1.000 55.63823  ? 718  DA  T N6    1 
ATOM   694  N  N1    . DA  B 2  18  ? 18.48774 35.85223  -35.51984 1.000 55.34061  ? 718  DA  T N1    1 
ATOM   695  C  C2    . DA  B 2  18  ? 18.50989 36.02061  -34.19671 1.000 58.34258  ? 718  DA  T C2    1 
ATOM   696  N  N3    . DA  B 2  18  ? 17.84060 35.36058  -33.25937 1.000 62.53883  ? 718  DA  T N3    1 
ATOM   697  C  C4    . DA  B 2  18  ? 17.06551 34.42213  -33.80896 1.000 65.42641  ? 718  DA  T C4    1 
ATOM   698  P  P     . DG  B 2  19  ? 13.66692 34.04078  -28.18218 1.000 97.29052  ? 719  DG  T P     1 
ATOM   699  O  OP1   . DG  B 2  19  ? 14.03473 34.19837  -26.75509 1.000 103.38803 ? 719  DG  T OP1   1 
ATOM   700  O  OP2   . DG  B 2  19  ? 12.37875 33.43414  -28.58516 1.000 106.66026 ? 719  DG  T OP2   1 
ATOM   701  O  "O5'" . DG  B 2  19  ? 13.72084 35.47814  -28.82912 1.000 84.84550  ? 719  DG  T "O5'" 1 
ATOM   702  C  "C5'" . DG  B 2  19  ? 13.99833 36.55646  -28.00337 1.000 84.00929  ? 719  DG  T "C5'" 1 
ATOM   703  C  "C4'" . DG  B 2  19  ? 14.87233 37.55583  -28.70825 1.000 76.52582  ? 719  DG  T "C4'" 1 
ATOM   704  O  "O4'" . DG  B 2  19  ? 15.24081 37.04742  -30.00183 1.000 73.45289  ? 719  DG  T "O4'" 1 
ATOM   705  C  "C3'" . DG  B 2  19  ? 14.18299 38.88282  -28.95513 1.000 76.95963  ? 719  DG  T "C3'" 1 
ATOM   706  O  "O3'" . DG  B 2  19  ? 14.76044 39.85793  -28.15637 1.000 79.53026  ? 719  DG  T "O3'" 1 
ATOM   707  C  "C2'" . DG  B 2  19  ? 14.37831 39.17341  -30.44844 1.000 71.85462  ? 719  DG  T "C2'" 1 
ATOM   708  C  "C1'" . DG  B 2  19  ? 15.38034 38.12706  -30.88735 1.000 69.12853  ? 719  DG  T "C1'" 1 
ATOM   709  N  N9    . DG  B 2  19  ? 15.19024 37.64089  -32.25582 1.000 66.45906  ? 719  DG  T N9    1 
ATOM   710  C  C8    . DG  B 2  19  ? 14.43143 36.56842  -32.66736 1.000 69.47405  ? 719  DG  T C8    1 
ATOM   711  N  N7    . DG  B 2  19  ? 14.49064 36.34619  -33.95175 1.000 66.87459  ? 719  DG  T N7    1 
ATOM   712  C  C5    . DG  B 2  19  ? 15.34773 37.33397  -34.41806 1.000 63.30794  ? 719  DG  T C5    1 
ATOM   713  C  C6    . DG  B 2  19  ? 15.79633 37.60406  -35.72840 1.000 59.63695  ? 719  DG  T C6    1 
ATOM   714  O  O6    . DG  B 2  19  ? 15.51230 37.00780  -36.77830 1.000 60.06606  ? 719  DG  T O6    1 
ATOM   715  N  N1    . DG  B 2  19  ? 16.66094 38.68494  -35.75516 1.000 56.59478  ? 719  DG  T N1    1 
ATOM   716  C  C2    . DG  B 2  19  ? 17.04241 39.41828  -34.65828 1.000 57.30506  ? 719  DG  T C2    1 
ATOM   717  N  N2    . DG  B 2  19  ? 17.87899 40.43881  -34.88127 1.000 57.22203  ? 719  DG  T N2    1 
ATOM   718  N  N3    . DG  B 2  19  ? 16.63086 39.17517  -33.42879 1.000 57.17068  ? 719  DG  T N3    1 
ATOM   719  C  C4    . DG  B 2  19  ? 15.79091 38.12762  -33.38326 1.000 61.29130  ? 719  DG  T C4    1 
ATOM   720  P  P     . DG  B 2  20  ? 13.83544 41.01962  -27.56878 1.000 85.80116  ? 720  DG  T P     1 
ATOM   721  O  OP1   . DG  B 2  20  ? 14.31635 41.32574  -26.19917 1.000 93.38846  ? 720  DG  T OP1   1 
ATOM   722  O  OP2   . DG  B 2  20  ? 12.42565 40.62381  -27.81505 1.000 85.75746  ? 720  DG  T OP2   1 
ATOM   723  O  "O5'" . DG  B 2  20  ? 14.16236 42.25312  -28.51696 1.000 78.69173  ? 720  DG  T "O5'" 1 
ATOM   724  C  "C5'" . DG  B 2  20  ? 15.50331 42.54678  -28.84804 1.000 71.90677  ? 720  DG  T "C5'" 1 
ATOM   725  C  "C4'" . DG  B 2  20  ? 15.55132 43.44153  -30.06348 1.000 68.96167  ? 720  DG  T "C4'" 1 
ATOM   726  O  "O4'" . DG  B 2  20  ? 15.47983 42.62906  -31.26123 1.000 66.57080  ? 720  DG  T "O4'" 1 
ATOM   727  C  "C3'" . DG  B 2  20  ? 14.38987 44.43053  -30.17817 1.000 72.67324  ? 720  DG  T "C3'" 1 
ATOM   728  O  "O3'" . DG  B 2  20  ? 14.85653 45.62931  -30.75552 1.000 75.91050  ? 720  DG  T "O3'" 1 
ATOM   729  C  "C2'" . DG  B 2  20  ? 13.44582 43.71036  -31.13239 1.000 71.09767  ? 720  DG  T "C2'" 1 
ATOM   730  C  "C1'" . DG  B 2  20  ? 14.46735 43.14778  -32.09114 1.000 66.81003  ? 720  DG  T "C1'" 1 
ATOM   731  N  N9    . DG  B 2  20  ? 13.98014 42.08447  -32.95473 1.000 64.55681  ? 720  DG  T N9    1 
ATOM   732  C  C8    . DG  B 2  20  ? 13.14704 41.05753  -32.61835 1.000 67.13389  ? 720  DG  T C8    1 
ATOM   733  N  N7    . DG  B 2  20  ? 12.90330 40.24282  -33.60378 1.000 68.29646  ? 720  DG  T N7    1 
ATOM   734  C  C5    . DG  B 2  20  ? 13.61533 40.77500  -34.66665 1.000 63.36288  ? 720  DG  T C5    1 
ATOM   735  C  C6    . DG  B 2  20  ? 13.72979 40.33136  -36.00375 1.000 58.15040  ? 720  DG  T C6    1 
ATOM   736  O  O6    . DG  B 2  20  ? 13.20798 39.33833  -36.53480 1.000 62.91058  ? 720  DG  T O6    1 
ATOM   737  N  N1    . DG  B 2  20  ? 14.54501 41.17210  -36.74994 1.000 52.24987  ? 720  DG  T N1    1 
ATOM   738  C  C2    . DG  B 2  20  ? 15.17847 42.29174  -36.26105 1.000 51.68285  ? 720  DG  T C2    1 
ATOM   739  N  N2    . DG  B 2  20  ? 15.92862 42.97713  -37.11823 1.000 50.15802  ? 720  DG  T N2    1 
ATOM   740  N  N3    . DG  B 2  20  ? 15.08143 42.71201  -35.01763 1.000 56.97474  ? 720  DG  T N3    1 
ATOM   741  C  C4    . DG  B 2  20  ? 14.28567 41.90817  -34.27885 1.000 62.34865  ? 720  DG  T C4    1 
ATOM   742  P  P     . DG  B 2  21  ? 14.17147 47.02326  -30.36686 1.000 80.63626  ? 721  DG  T P     1 
ATOM   743  O  OP1   . DG  B 2  21  ? 14.98283 47.57911  -29.26210 1.000 84.48695  ? 721  DG  T OP1   1 
ATOM   744  O  OP2   . DG  B 2  21  ? 12.70570 46.82000  -30.25214 1.000 80.83972  ? 721  DG  T OP2   1 
ATOM   745  O  "O5'" . DG  B 2  21  ? 14.39613 47.92796  -31.64210 1.000 75.62924  ? 721  DG  T "O5'" 1 
ATOM   746  C  "C5'" . DG  B 2  21  ? 15.59322 47.84626  -32.36109 1.000 70.95971  ? 721  DG  T "C5'" 1 
ATOM   747  C  "C4'" . DG  B 2  21  ? 15.33744 48.26979  -33.78401 1.000 72.24629  ? 721  DG  T "C4'" 1 
ATOM   748  O  "O4'" . DG  B 2  21  ? 15.01996 47.09261  -34.56912 1.000 71.75649  ? 721  DG  T "O4'" 1 
ATOM   749  C  "C3'" . DG  B 2  21  ? 14.14991 49.22494  -33.95053 1.000 73.88090  ? 721  DG  T "C3'" 1 
ATOM   750  O  "O3'" . DG  B 2  21  ? 14.43104 50.17637  -34.95528 1.000 74.12967  ? 721  DG  T "O3'" 1 
ATOM   751  C  "C2'" . DG  B 2  21  ? 13.01848 48.29037  -34.37068 1.000 75.97413  ? 721  DG  T "C2'" 1 
ATOM   752  C  "C1'" . DG  B 2  21  ? 13.77247 47.26512  -35.20310 1.000 72.11644  ? 721  DG  T "C1'" 1 
ATOM   753  N  N9    . DG  B 2  21  ? 13.10219 45.96902  -35.27795 1.000 66.60135  ? 721  DG  T N9    1 
ATOM   754  C  C8    . DG  B 2  21  ? 12.53187 45.27172  -34.24159 1.000 64.17610  ? 721  DG  T C8    1 
ATOM   755  N  N7    . DG  B 2  21  ? 12.00390 44.13753  -34.60747 1.000 62.35979  ? 721  DG  T N7    1 
ATOM   756  C  C5    . DG  B 2  21  ? 12.23994 44.07537  -35.97515 1.000 65.19155  ? 721  DG  T C5    1 
ATOM   757  C  C6    . DG  B 2  21  ? 11.89436 43.07617  -36.91558 1.000 64.31685  ? 721  DG  T C6    1 
ATOM   758  O  O6    . DG  B 2  21  ? 11.28734 42.01433  -36.71097 1.000 69.63390  ? 721  DG  T O6    1 
ATOM   759  N  N1    . DG  B 2  21  ? 12.32469 43.40493  -38.20797 1.000 59.02698  ? 721  DG  T N1    1 
ATOM   760  C  C2    . DG  B 2  21  ? 13.00412 44.55759  -38.54461 1.000 60.10996  ? 721  DG  T C2    1 
ATOM   761  N  N2    . DG  B 2  21  ? 13.34009 44.71153  -39.84062 1.000 57.71179  ? 721  DG  T N2    1 
ATOM   762  N  N3    . DG  B 2  21  ? 13.33454 45.49981  -37.66646 1.000 65.23302  ? 721  DG  T N3    1 
ATOM   763  C  C4    . DG  B 2  21  ? 12.91796 45.19418  -36.40570 1.000 66.23760  ? 721  DG  T C4    1 
ATOM   764  P  P     . DA  B 2  22  ? 13.47394 51.45388  -35.16546 1.000 98.86172  ? 722  DA  T P     1 
ATOM   765  O  OP1   . DA  B 2  22  ? 14.32706 52.65499  -34.99938 1.000 108.36434 ? 722  DA  T OP1   1 
ATOM   766  O  OP2   . DA  B 2  22  ? 12.23808 51.27868  -34.36533 1.000 94.87509  ? 722  DA  T OP2   1 
ATOM   767  O  "O5'" . DA  B 2  22  ? 13.04341 51.37593  -36.69849 1.000 88.83009  ? 722  DA  T "O5'" 1 
ATOM   768  C  "C5'" . DA  B 2  22  ? 14.02577 51.22591  -37.69710 1.000 83.66381  ? 722  DA  T "C5'" 1 
ATOM   769  C  "C4'" . DA  B 2  22  ? 13.38764 50.74816  -38.97725 1.000 80.14346  ? 722  DA  T "C4'" 1 
ATOM   770  O  "O4'" . DA  B 2  22  ? 12.99208 49.35646  -38.82775 1.000 77.82911  ? 722  DA  T "O4'" 1 
ATOM   771  C  "C3'" . DA  B 2  22  ? 12.13432 51.52510  -39.38411 1.000 78.30886  ? 722  DA  T "C3'" 1 
ATOM   772  O  "O3'" . DA  B 2  22  ? 12.23644 51.93166  -40.74363 1.000 81.11824  ? 722  DA  T "O3'" 1 
ATOM   773  C  "C2'" . DA  B 2  22  ? 10.98510 50.53581  -39.16684 1.000 72.76840  ? 722  DA  T "C2'" 1 
ATOM   774  C  "C1'" . DA  B 2  22  ? 11.67183 49.17738  -39.28690 1.000 73.05187  ? 722  DA  T "C1'" 1 
ATOM   775  N  N9    . DA  B 2  22  ? 11.02725 48.14195  -38.47355 1.000 72.78041  ? 722  DA  T N9    1 
ATOM   776  C  C8    . DA  B 2  22  ? 10.82384 48.16809  -37.12333 1.000 74.23985  ? 722  DA  T C8    1 
ATOM   777  N  N7    . DA  B 2  22  ? 10.19797 47.11338  -36.66032 1.000 71.74203  ? 722  DA  T N7    1 
ATOM   778  C  C5    . DA  B 2  22  ? 9.96574  46.34222  -37.78517 1.000 70.06856  ? 722  DA  T C5    1 
ATOM   779  C  C6    . DA  B 2  22  ? 9.33685  45.08931  -37.96806 1.000 68.98062  ? 722  DA  T C6    1 
ATOM   780  N  N6    . DA  B 2  22  ? 8.80752  44.37778  -36.96953 1.000 64.33993  ? 722  DA  T N6    1 
ATOM   781  N  N1    . DA  B 2  22  ? 9.27791  44.59638  -39.22409 1.000 71.85590  ? 722  DA  T N1    1 
ATOM   782  C  C2    . DA  B 2  22  ? 9.81066  45.31362  -40.22437 1.000 75.26863  ? 722  DA  T C2    1 
ATOM   783  N  N3    . DA  B 2  22  ? 10.42595 46.49707  -40.17415 1.000 76.40345  ? 722  DA  T N3    1 
ATOM   784  C  C4    . DA  B 2  22  ? 10.46977 46.96135  -38.91383 1.000 72.43025  ? 722  DA  T C4    1 
ATOM   785  P  P     . DC  B 2  23  ? 11.14331 52.91762  -41.38688 1.000 81.67870  ? 723  DC  T P     1 
ATOM   786  O  OP1   . DC  B 2  23  ? 11.83259 53.71557  -42.42601 1.000 86.51406  ? 723  DC  T OP1   1 
ATOM   787  O  OP2   . DC  B 2  23  ? 10.39823 53.56640  -40.28318 1.000 82.10065  ? 723  DC  T OP2   1 
ATOM   788  O  "O5'" . DC  B 2  23  ? 10.13158 51.93748  -42.13656 1.000 76.76828  ? 723  DC  T "O5'" 1 
ATOM   789  C  "C5'" . DC  B 2  23  ? 10.59655 51.15867  -43.21086 1.000 78.39279  ? 723  DC  T "C5'" 1 
ATOM   790  C  "C4'" . DC  B 2  23  ? 9.56800  50.12539  -43.59987 1.000 78.27852  ? 723  DC  T "C4'" 1 
ATOM   791  O  "O4'" . DC  B 2  23  ? 9.32903  49.22772  -42.49129 1.000 76.17673  ? 723  DC  T "O4'" 1 
ATOM   792  C  "C3'" . DC  B 2  23  ? 8.20500  50.69497  -43.98260 1.000 83.08053  ? 723  DC  T "C3'" 1 
ATOM   793  O  "O3'" . DC  B 2  23  ? 7.81968  50.16691  -45.21617 1.000 90.71759  ? 723  DC  T "O3'" 1 
ATOM   794  C  "C2'" . DC  B 2  23  ? 7.28072  50.21245  -42.86835 1.000 78.65804  ? 723  DC  T "C2'" 1 
ATOM   795  C  "C1'" . DC  B 2  23  ? 7.96296  48.92218  -42.45953 1.000 76.42804  ? 723  DC  T "C1'" 1 
ATOM   796  N  N1    . DC  B 2  23  ? 7.60792  48.48437  -41.09125 1.000 78.03537  ? 723  DC  T N1    1 
ATOM   797  C  C2    . DC  B 2  23  ? 6.98994  47.23679  -40.88314 1.000 75.78347  ? 723  DC  T C2    1 
ATOM   798  O  O2    . DC  B 2  23  ? 6.75365  46.49740  -41.85367 1.000 74.80698  ? 723  DC  T O2    1 
ATOM   799  N  N3    . DC  B 2  23  ? 6.66854  46.87844  -39.61527 1.000 73.67567  ? 723  DC  T N3    1 
ATOM   800  C  C4    . DC  B 2  23  ? 6.93632  47.70218  -38.60099 1.000 72.63787  ? 723  DC  T C4    1 
ATOM   801  N  N4    . DC  B 2  23  ? 6.60493  47.31382  -37.37337 1.000 68.59089  ? 723  DC  T N4    1 
ATOM   802  C  C5    . DC  B 2  23  ? 7.55908  48.96590  -38.79827 1.000 77.57029  ? 723  DC  T C5    1 
ATOM   803  C  C6    . DC  B 2  23  ? 7.86838  49.31461  -40.04443 1.000 79.86356  ? 723  DC  T C6    1 
ATOM   804  P  P     . DT  B 2  24  ? 7.01991  51.08560  -46.25360 1.000 96.66846  ? 724  DT  T P     1 
ATOM   805  O  OP1   . DT  B 2  24  ? 7.84432  51.16916  -47.48662 1.000 103.51215 ? 724  DT  T OP1   1 
ATOM   806  O  OP2   . DT  B 2  24  ? 6.60218  52.31004  -45.53097 1.000 92.58576  ? 724  DT  T OP2   1 
ATOM   807  O  "O5'" . DT  B 2  24  ? 5.70628  50.23787  -46.55829 1.000 93.53014  ? 724  DT  T "O5'" 1 
ATOM   808  C  "C5'" . DT  B 2  24  ? 5.67879  48.83985  -46.30638 1.000 89.37611  ? 724  DT  T "C5'" 1 
ATOM   809  C  "C4'" . DT  B 2  24  ? 4.25408  48.35015  -46.38721 1.000 89.40612  ? 724  DT  T "C4'" 1 
ATOM   810  O  "O4'" . DT  B 2  24  ? 3.67195  48.36660  -45.05933 1.000 88.52486  ? 724  DT  T "O4'" 1 
ATOM   811  C  "C3'" . DT  B 2  24  ? 3.35369  49.22518  -47.26328 1.000 96.18118  ? 724  DT  T "C3'" 1 
ATOM   812  O  "O3'" . DT  B 2  24  ? 2.54089  48.42039  -48.11838 1.000 98.82909  ? 724  DT  T "O3'" 1 
ATOM   813  C  "C2'" . DT  B 2  24  ? 2.52219  50.02295  -46.25394 1.000 96.08904  ? 724  DT  T "C2'" 1 
ATOM   814  C  "C1'" . DT  B 2  24  ? 2.44589  49.06757  -45.07731 1.000 90.46400  ? 724  DT  T "C1'" 1 
ATOM   815  N  N1    . DT  B 2  24  ? 2.27004  49.74834  -43.75401 1.000 88.91775  ? 724  DT  T N1    1 
ATOM   816  C  C2    . DT  B 2  24  ? 1.21180  49.38966  -42.95236 1.000 88.80522  ? 724  DT  T C2    1 
ATOM   817  O  O2    . DT  B 2  24  ? 0.39790  48.54148  -43.26357 1.000 88.21701  ? 724  DT  T O2    1 
ATOM   818  N  N3    . DT  B 2  24  ? 1.13835  50.06279  -41.76119 1.000 89.77099  ? 724  DT  T N3    1 
ATOM   819  C  C4    . DT  B 2  24  ? 1.99970  51.03880  -41.29628 1.000 89.28001  ? 724  DT  T C4    1 
ATOM   820  O  O4    . DT  B 2  24  ? 1.84756  51.58079  -40.20539 1.000 89.23403  ? 724  DT  T O4    1 
ATOM   821  C  C5    . DT  B 2  24  ? 3.09188  51.37109  -42.18436 1.000 89.14817  ? 724  DT  T C5    1 
ATOM   822  C  C7    . DT  B 2  24  ? 4.09200  52.41518  -41.78926 1.000 90.73871  ? 724  DT  T C7    1 
ATOM   823  C  C6    . DT  B 2  24  ? 3.17487  50.71587  -43.35709 1.000 88.79864  ? 724  DT  T C6    1 
ATOM   824  P  P     . DG  B 2  25  ? 1.76331  49.08228  -49.36647 1.000 103.25302 ? 725  DG  T P     1 
ATOM   825  O  OP1   . DG  B 2  25  ? 2.16068  48.32460  -50.57621 1.000 104.77191 ? 725  DG  T OP1   1 
ATOM   826  O  OP2   . DG  B 2  25  ? 1.98457  50.55082  -49.35616 1.000 106.31960 ? 725  DG  T OP2   1 
ATOM   827  O  "O5'" . DG  B 2  25  ? 0.22367  48.77121  -49.03610 1.000 99.27273  ? 725  DG  T "O5'" 1 
ATOM   828  C  "C5'" . DG  B 2  25  ? -0.79131 49.73587  -49.31083 1.000 99.51395  ? 725  DG  T "C5'" 1 
ATOM   829  C  "C4'" . DG  B 2  25  ? -1.76967 49.82339  -48.15008 1.000 96.38991  ? 725  DG  T "C4'" 1 
ATOM   830  O  "O4'" . DG  B 2  25  ? -1.02829 50.10991  -46.94159 1.000 97.27890  ? 725  DG  T "O4'" 1 
ATOM   831  C  "C3'" . DG  B 2  25  ? -2.84072 50.90931  -48.29347 1.000 93.32223  ? 725  DG  T "C3'" 1 
ATOM   832  O  "O3'" . DG  B 2  25  ? -4.13103 50.31542  -48.57318 1.000 81.53620  ? 725  DG  T "O3'" 1 
ATOM   833  C  "C2'" . DG  B 2  25  ? -2.82852 51.67238  -46.95306 1.000 99.36293  ? 725  DG  T "C2'" 1 
ATOM   834  C  "C1'" . DG  B 2  25  ? -1.76675 50.95921  -46.09469 1.000 100.75099 ? 725  DG  T "C1'" 1 
ATOM   835  N  N9    . DG  B 2  25  ? -0.82441 51.88050  -45.43351 1.000 103.64853 ? 725  DG  T N9    1 
ATOM   836  C  C8    . DG  B 2  25  ? 0.28450  52.46572  -45.99881 1.000 103.27481 ? 725  DG  T C8    1 
ATOM   837  N  N7    . DG  B 2  25  ? 0.94296  53.24165  -45.18001 1.000 104.09768 ? 725  DG  T N7    1 
ATOM   838  C  C5    . DG  B 2  25  ? 0.22725  53.17615  -43.99050 1.000 103.97323 ? 725  DG  T C5    1 
ATOM   839  C  C6    . DG  B 2  25  ? 0.46585  53.81415  -42.74221 1.000 104.38438 ? 725  DG  T C6    1 
ATOM   840  O  O6    . DG  B 2  25  ? 1.38443  54.58751  -42.43465 1.000 105.12272 ? 725  DG  T O6    1 
ATOM   841  N  N1    . DG  B 2  25  ? -0.49712 53.47612  -41.79680 1.000 104.39769 ? 725  DG  T N1    1 
ATOM   842  C  C2    . DG  B 2  25  ? -1.55829 52.63286  -42.02419 1.000 103.58779 ? 725  DG  T C2    1 
ATOM   843  N  N2    . DG  B 2  25  ? -2.38155 52.42898  -40.98694 1.000 103.46515 ? 725  DG  T N2    1 
ATOM   844  N  N3    . DG  B 2  25  ? -1.79751 52.02809  -43.18745 1.000 103.44216 ? 725  DG  T N3    1 
ATOM   845  C  C4    . DG  B 2  25  ? -0.86566 52.34301  -44.12373 1.000 103.65229 ? 725  DG  T C4    1 
ATOM   846  N  N     . PRO C 3  2   ? 43.68487 -10.44804 -15.93294 1.000 51.95061  ? 1    PRO A N     1 
ATOM   847  C  CA    . PRO C 3  2   ? 42.47241 -10.99968 -15.32423 1.000 51.03961  ? 1    PRO A CA    1 
ATOM   848  C  C     . PRO C 3  2   ? 41.31179 -9.99561  -15.35180 1.000 46.62866  ? 1    PRO A C     1 
ATOM   849  O  O     . PRO C 3  2   ? 41.44217 -8.95383  -16.00729 1.000 45.91686  ? 1    PRO A O     1 
ATOM   850  C  CB    . PRO C 3  2   ? 42.91605 -11.30849 -13.88188 1.000 49.86056  ? 1    PRO A CB    1 
ATOM   851  C  CG    . PRO C 3  2   ? 44.28047 -10.62253 -13.70835 1.000 51.39222  ? 1    PRO A CG    1 
ATOM   852  C  CD    . PRO C 3  2   ? 44.50716 -9.77187  -14.92027 1.000 52.66883  ? 1    PRO A CD    1 
ATOM   853  N  N     . ILE C 3  3   ? 40.20613 -10.29243 -14.66442 1.000 40.95233  ? 2    ILE A N     1 
ATOM   854  C  CA    . ILE C 3  3   ? 39.01232 -9.45144  -14.69697 1.000 38.59533  ? 2    ILE A CA    1 
ATOM   855  C  C     . ILE C 3  3   ? 38.84355 -8.77491  -13.34020 1.000 36.70020  ? 2    ILE A C     1 
ATOM   856  O  O     . ILE C 3  3   ? 38.88501 -9.43408  -12.29517 1.000 37.31019  ? 2    ILE A O     1 
ATOM   857  C  CB    . ILE C 3  3   ? 37.75729 -10.25525 -15.08450 1.000 35.01585  ? 2    ILE A CB    1 
ATOM   858  C  CG1   . ILE C 3  3   ? 37.99049 -10.98503 -16.41176 1.000 32.80092  ? 2    ILE A CG1   1 
ATOM   859  C  CG2   . ILE C 3  3   ? 36.54466 -9.32605  -15.24077 1.000 34.58178  ? 2    ILE A CG2   1 
ATOM   860  C  CD1   . ILE C 3  3   ? 36.74621 -11.65708 -16.97580 1.000 33.31498  ? 2    ILE A CD1   1 
ATOM   861  N  N     . SER C 3  4   ? 38.66406 -7.45889  -13.35823 1.000 34.91167  ? 3    SER A N     1 
ATOM   862  C  CA    . SER C 3  4   ? 38.47990 -6.72340  -12.11737 1.000 35.20919  ? 3    SER A CA    1 
ATOM   863  C  C     . SER C 3  4   ? 37.26867 -7.23960  -11.34225 1.000 39.92659  ? 3    SER A C     1 
ATOM   864  O  O     . SER C 3  4   ? 36.21745 -7.51425  -11.93949 1.000 38.93622  ? 3    SER A O     1 
ATOM   865  C  CB    . SER C 3  4   ? 38.28398 -5.23884  -12.38758 1.000 31.92941  ? 3    SER A CB    1 
ATOM   866  O  OG    . SER C 3  4   ? 38.18826 -4.57189  -11.15279 1.000 33.63173  ? 3    SER A OG    1 
ATOM   867  N  N     . PRO C 3  5   ? 37.37027 -7.35798  -10.01741 1.000 38.08129  ? 4    PRO A N     1 
ATOM   868  C  CA    . PRO C 3  5   ? 36.19480 -7.64512  -9.18347  1.000 37.70242  ? 4    PRO A CA    1 
ATOM   869  C  C     . PRO C 3  5   ? 35.39279 -6.41740  -8.78198  1.000 35.86160  ? 4    PRO A C     1 
ATOM   870  O  O     . PRO C 3  5   ? 34.50960 -6.54177  -7.92876  1.000 37.41202  ? 4    PRO A O     1 
ATOM   871  C  CB    . PRO C 3  5   ? 36.82466 -8.29970  -7.94897  1.000 28.93234  ? 4    PRO A CB    1 
ATOM   872  C  CG    . PRO C 3  5   ? 38.16028 -7.62787  -7.83063  1.000 28.21992  ? 4    PRO A CG    1 
ATOM   873  C  CD    . PRO C 3  5   ? 38.61298 -7.29814  -9.22273  1.000 37.92820  ? 4    PRO A CD    1 
ATOM   874  N  N     . ILE C 3  6   ? 35.69868 -5.25340  -9.36738  1.000 38.37713  ? 5    ILE A N     1 
ATOM   875  C  CA    . ILE C 3  6   ? 34.89373 -4.05521  -9.16392  1.000 34.47235  ? 5    ILE A CA    1 
ATOM   876  C  C     . ILE C 3  6   ? 33.43623 -4.34882  -9.52278  1.000 37.24759  ? 5    ILE A C     1 
ATOM   877  O  O     . ILE C 3  6   ? 33.13686 -5.22958  -10.33810 1.000 40.03907  ? 5    ILE A O     1 
ATOM   878  C  CB    . ILE C 3  6   ? 35.46265 -2.89329  -9.99663  1.000 34.44936  ? 5    ILE A CB    1 
ATOM   879  C  CG1   . ILE C 3  6   ? 34.85657 -1.55734  -9.56573  1.000 43.32910  ? 5    ILE A CG1   1 
ATOM   880  C  CG2   . ILE C 3  6   ? 35.25010 -3.14320  -11.49062 1.000 27.91674  ? 5    ILE A CG2   1 
ATOM   881  C  CD1   . ILE C 3  6   ? 35.32992 -0.34522  -10.37100 1.000 43.45627  ? 5    ILE A CD1   1 
ATOM   882  N  N     . GLU C 3  7   ? 32.51773 -3.65739  -8.85759  1.000 36.40684  ? 6    GLU A N     1 
ATOM   883  C  CA    . GLU C 3  7   ? 31.11329 -3.81181  -9.20175  1.000 35.92822  ? 6    GLU A CA    1 
ATOM   884  C  C     . GLU C 3  7   ? 30.88222 -3.28000  -10.61652 1.000 40.13917  ? 6    GLU A C     1 
ATOM   885  O  O     . GLU C 3  7   ? 31.55814 -2.34622  -11.06332 1.000 37.21603  ? 6    GLU A O     1 
ATOM   886  C  CB    . GLU C 3  7   ? 30.22781 -3.08352  -8.17556  1.000 31.11671  ? 6    GLU A CB    1 
ATOM   887  N  N     . THR C 3  8   ? 29.94046 -3.89679  -11.33534 1.000 29.76578  ? 7    THR A N     1 
ATOM   888  C  CA    . THR C 3  8   ? 29.62339 -3.44612  -12.68437 1.000 32.62028  ? 7    THR A CA    1 
ATOM   889  C  C     . THR C 3  8   ? 28.72739 -2.21370  -12.66340 1.000 35.86733  ? 7    THR A C     1 
ATOM   890  O  O     . THR C 3  8   ? 27.94984 -1.99072  -11.73274 1.000 39.81990  ? 7    THR A O     1 
ATOM   891  C  CB    . THR C 3  8   ? 28.93664 -4.54228  -13.51015 1.000 36.16670  ? 7    THR A CB    1 
ATOM   892  O  OG1   . THR C 3  8   ? 27.85849 -5.12089  -12.77238 1.000 38.87324  ? 7    THR A OG1   1 
ATOM   893  C  CG2   . THR C 3  8   ? 29.92247 -5.61798  -13.92115 1.000 30.95283  ? 7    THR A CG2   1 
ATOM   894  N  N     . VAL C 3  9   ? 28.83447 -1.41781  -13.71882 1.000 36.37597  ? 8    VAL A N     1 
ATOM   895  C  CA    . VAL C 3  9   ? 28.01229 -0.22578  -13.89183 1.000 37.83409  ? 8    VAL A CA    1 
ATOM   896  C  C     . VAL C 3  9   ? 26.73659 -0.63686  -14.62216 1.000 41.73869  ? 8    VAL A C     1 
ATOM   897  O  O     . VAL C 3  9   ? 26.82087 -1.14045  -15.75619 1.000 39.39776  ? 8    VAL A O     1 
ATOM   898  C  CB    . VAL C 3  9   ? 28.77076 0.85590   -14.66924 1.000 37.93123  ? 8    VAL A CB    1 
ATOM   899  C  CG1   . VAL C 3  9   ? 27.88564 2.05762   -14.93345 1.000 34.13946  ? 8    VAL A CG1   1 
ATOM   900  C  CG2   . VAL C 3  9   ? 30.03797 1.25451   -13.90688 1.000 39.80295  ? 8    VAL A CG2   1 
ATOM   901  N  N     . PRO C 3  10  ? 25.55795 -0.43536  -14.03695 1.000 44.73802  ? 9    PRO A N     1 
ATOM   902  C  CA    . PRO C 3  10  ? 24.32581 -0.88690  -14.70002 1.000 50.10401  ? 9    PRO A CA    1 
ATOM   903  C  C     . PRO C 3  10  ? 23.98358 0.04259   -15.85928 1.000 48.28404  ? 9    PRO A C     1 
ATOM   904  O  O     . PRO C 3  10  ? 24.03029 1.26842   -15.72377 1.000 48.07841  ? 9    PRO A O     1 
ATOM   905  C  CB    . PRO C 3  10  ? 23.27753 -0.81423  -13.58322 1.000 37.14368  ? 9    PRO A CB    1 
ATOM   906  C  CG    . PRO C 3  10  ? 23.76909 0.35397   -12.71876 1.000 41.49911  ? 9    PRO A CG    1 
ATOM   907  C  CD    . PRO C 3  10  ? 25.28473 0.40495   -12.85355 1.000 39.66935  ? 9    PRO A CD    1 
ATOM   908  N  N     . VAL C 3  11  ? 23.65332 -0.54957  -17.00714 1.000 48.47992  ? 10   VAL A N     1 
ATOM   909  C  CA    . VAL C 3  11  ? 23.30104 0.18753   -18.21195 1.000 48.94713  ? 10   VAL A CA    1 
ATOM   910  C  C     . VAL C 3  11  ? 22.06990 -0.43863  -18.83989 1.000 53.95955  ? 10   VAL A C     1 
ATOM   911  O  O     . VAL C 3  11  ? 21.86964 -1.65521  -18.78456 1.000 59.61945  ? 10   VAL A O     1 
ATOM   912  C  CB    . VAL C 3  11  ? 24.45634 0.21908   -19.23227 1.000 54.24937  ? 10   VAL A CB    1 
ATOM   913  C  CG1   . VAL C 3  11  ? 25.59014 1.08513   -18.71445 1.000 56.07327  ? 10   VAL A CG1   1 
ATOM   914  C  CG2   . VAL C 3  11  ? 24.94096 -1.18765  -19.52596 1.000 53.54421  ? 10   VAL A CG2   1 
ATOM   915  N  N     . LYS C 3  12  ? 21.24098 0.39997   -19.44984 1.000 55.47299  ? 11   LYS A N     1 
ATOM   916  C  CA    . LYS C 3  12  ? 20.03093 -0.06664  -20.10337 1.000 57.07095  ? 11   LYS A CA    1 
ATOM   917  C  C     . LYS C 3  12  ? 20.00504 0.48193   -21.52137 1.000 53.11568  ? 11   LYS A C     1 
ATOM   918  O  O     . LYS C 3  12  ? 20.78139 1.36785   -21.87905 1.000 51.81665  ? 11   LYS A O     1 
ATOM   919  C  CB    . LYS C 3  12  ? 18.77021 0.34907   -19.32260 1.000 47.13026  ? 11   LYS A CB    1 
ATOM   920  N  N     . LEU C 3  13  ? 19.12926 -0.08339  -22.34533 1.000 55.12259  ? 12   LEU A N     1 
ATOM   921  C  CA    . LEU C 3  13  ? 18.84122 0.51626   -23.63753 1.000 60.46451  ? 12   LEU A CA    1 
ATOM   922  C  C     . LEU C 3  13  ? 17.85194 1.66706   -23.45547 1.000 62.70286  ? 12   LEU A C     1 
ATOM   923  O  O     . LEU C 3  13  ? 17.20334 1.79855   -22.41459 1.000 67.64600  ? 12   LEU A O     1 
ATOM   924  C  CB    . LEU C 3  13  ? 18.27948 -0.52642  -24.61002 1.000 64.37341  ? 12   LEU A CB    1 
ATOM   925  C  CG    . LEU C 3  13  ? 19.15380 -1.73291  -24.98892 1.000 63.89363  ? 12   LEU A CG    1 
ATOM   926  C  CD1   . LEU C 3  13  ? 18.41378 -2.67930  -25.92935 1.000 64.02223  ? 12   LEU A CD1   1 
ATOM   927  C  CD2   . LEU C 3  13  ? 20.46663 -1.28429  -25.62066 1.000 64.38502  ? 12   LEU A CD2   1 
ATOM   928  N  N     . LYS C 3  14  ? 17.74872 2.51859   -24.47086 1.000 59.58303  ? 13   LYS A N     1 
ATOM   929  C  CA    . LYS C 3  14  ? 16.71131 3.53884   -24.44018 1.000 61.45231  ? 13   LYS A CA    1 
ATOM   930  C  C     . LYS C 3  14  ? 15.33034 2.87756   -24.52317 1.000 65.87438  ? 13   LYS A C     1 
ATOM   931  O  O     . LYS C 3  14  ? 15.19042 1.78786   -25.08683 1.000 68.59653  ? 13   LYS A O     1 
ATOM   932  C  CB    . LYS C 3  14  ? 16.90030 4.52856   -25.58436 1.000 61.43934  ? 13   LYS A CB    1 
ATOM   933  C  CG    . LYS C 3  14  ? 18.20615 5.28443   -25.51853 1.000 61.60010  ? 13   LYS A CG    1 
ATOM   934  C  CD    . LYS C 3  14  ? 18.30439 6.34481   -26.60975 1.000 66.18799  ? 13   LYS A CD    1 
ATOM   935  C  CE    . LYS C 3  14  ? 19.58979 7.15472   -26.45674 1.000 68.29616  ? 13   LYS A CE    1 
ATOM   936  N  NZ    . LYS C 3  14  ? 19.71556 8.26327   -27.43732 1.000 72.97051  ? 13   LYS A NZ    1 
ATOM   937  N  N     . PRO C 3  15  ? 14.29777 3.51010   -23.96196 1.000 66.03572  ? 14   PRO A N     1 
ATOM   938  C  CA    . PRO C 3  15  ? 12.98948 2.85201   -23.86942 1.000 70.34470  ? 14   PRO A CA    1 
ATOM   939  C  C     . PRO C 3  15  ? 12.48690 2.36062   -25.21853 1.000 72.80420  ? 14   PRO A C     1 
ATOM   940  O  O     . PRO C 3  15  ? 12.67359 3.01092   -26.24940 1.000 70.04811  ? 14   PRO A O     1 
ATOM   941  C  CB    . PRO C 3  15  ? 12.08056 3.94878   -23.30042 1.000 65.60711  ? 14   PRO A CB    1 
ATOM   942  C  CG    . PRO C 3  15  ? 12.80404 5.22865   -23.55684 1.000 71.33722  ? 14   PRO A CG    1 
ATOM   943  C  CD    . PRO C 3  15  ? 14.24991 4.87369   -23.41260 1.000 68.16231  ? 14   PRO A CD    1 
ATOM   944  N  N     . GLY C 3  16  ? 11.86148 1.18377   -25.19834 1.000 75.24360  ? 15   GLY A N     1 
ATOM   945  C  CA    . GLY C 3  16  ? 11.22147 0.63702   -26.37959 1.000 80.65632  ? 15   GLY A CA    1 
ATOM   946  C  C     . GLY C 3  16  ? 12.15536 0.30129   -27.51944 1.000 82.02954  ? 15   GLY A C     1 
ATOM   947  O  O     . GLY C 3  16  ? 11.73633 0.33963   -28.68164 1.000 85.50333  ? 15   GLY A O     1 
ATOM   948  N  N     . MET C 3  17  ? 13.41351 -0.02387  -27.22418 1.000 78.85208  ? 16   MET A N     1 
ATOM   949  C  CA    . MET C 3  17  ? 14.37887 -0.39038  -28.24830 1.000 76.35021  ? 16   MET A CA    1 
ATOM   950  C  C     . MET C 3  17  ? 15.01242 -1.72666  -27.89394 1.000 71.01532  ? 16   MET A C     1 
ATOM   951  O  O     . MET C 3  17  ? 14.95923 -2.17502  -26.74720 1.000 67.36098  ? 16   MET A O     1 
ATOM   952  C  CB    . MET C 3  17  ? 15.46274 0.67706   -28.41303 1.000 78.29872  ? 16   MET A CB    1 
ATOM   953  C  CG    . MET C 3  17  ? 14.92874 2.05136   -28.75326 1.000 88.45944  ? 16   MET A CG    1 
ATOM   954  S  SD    . MET C 3  17  ? 16.00413 2.90126   -29.92226 1.000 96.18885  ? 16   MET A SD    1 
ATOM   955  C  CE    . MET C 3  17  ? 15.84927 4.60782   -29.36845 1.000 94.97927  ? 16   MET A CE    1 
ATOM   956  N  N     . ASP C 3  18  ? 15.63095 -2.35314  -28.89394 1.000 71.99996  ? 17   ASP A N     1 
ATOM   957  C  CA    . ASP C 3  18  ? 16.16267 -3.70643  -28.77757 1.000 73.43786  ? 17   ASP A CA    1 
ATOM   958  C  C     . ASP C 3  18  ? 17.59557 -3.73547  -29.30842 1.000 70.00693  ? 17   ASP A C     1 
ATOM   959  O  O     . ASP C 3  18  ? 18.13132 -2.72279  -29.77195 1.000 71.84418  ? 17   ASP A O     1 
ATOM   960  C  CB    . ASP C 3  18  ? 15.25911 -4.70561  -29.52174 1.000 81.59189  ? 17   ASP A CB    1 
ATOM   961  C  CG    . ASP C 3  18  ? 15.56480 -6.16247  -29.18011 1.000 81.15835  ? 17   ASP A CG    1 
ATOM   962  O  OD1   . ASP C 3  18  ? 16.11669 -6.43218  -28.08204 1.000 73.78579  ? 17   ASP A OD1   1 
ATOM   963  O  OD2   . ASP C 3  18  ? 15.26378 -7.03209  -30.03346 1.000 85.63596  ? 17   ASP A OD2   1 
ATOM   964  N  N     . GLY C 3  19  ? 18.21854 -4.91314  -29.23444 1.000 70.99236  ? 18   GLY A N     1 
ATOM   965  C  CA    . GLY C 3  19  ? 19.60653 -5.08413  -29.59269 1.000 68.61580  ? 18   GLY A CA    1 
ATOM   966  C  C     . GLY C 3  19  ? 19.83781 -5.22010  -31.08431 1.000 68.45494  ? 18   GLY A C     1 
ATOM   967  O  O     . GLY C 3  19  ? 18.92073 -5.50636  -31.85982 1.000 63.54045  ? 18   GLY A O     1 
ATOM   968  N  N     . PRO C 3  20  ? 21.08689 -5.02441  -31.50903 1.000 64.90165  ? 19   PRO A N     1 
ATOM   969  C  CA    . PRO C 3  20  ? 21.39020 -5.01770  -32.94503 1.000 64.03911  ? 19   PRO A CA    1 
ATOM   970  C  C     . PRO C 3  20  ? 21.29319 -6.40471  -33.56059 1.000 68.02586  ? 19   PRO A C     1 
ATOM   971  O  O     . PRO C 3  20  ? 21.59843 -7.42094  -32.92651 1.000 66.66310  ? 19   PRO A O     1 
ATOM   972  C  CB    . PRO C 3  20  ? 22.82880 -4.49633  -32.99140 1.000 65.71310  ? 19   PRO A CB    1 
ATOM   973  C  CG    . PRO C 3  20  ? 23.42203 -4.96099  -31.67801 1.000 55.20866  ? 19   PRO A CG    1 
ATOM   974  C  CD    . PRO C 3  20  ? 22.29889 -4.86973  -30.68006 1.000 55.25375  ? 19   PRO A CD    1 
ATOM   975  N  N     . LYS C 3  21  ? 20.84871 -6.43706  -34.81818 1.000 70.27027  ? 20   LYS A N     1 
ATOM   976  C  CA    . LYS C 3  21  ? 20.82048 -7.65705  -35.62737 1.000 71.47117  ? 20   LYS A CA    1 
ATOM   977  C  C     . LYS C 3  21  ? 21.44955 -7.30382  -36.97308 1.000 76.84606  ? 20   LYS A C     1 
ATOM   978  O  O     . LYS C 3  21  ? 20.73508 -6.95072  -37.91570 1.000 83.14519  ? 20   LYS A O     1 
ATOM   979  C  CB    . LYS C 3  21  ? 19.40210 -8.19130  -35.79695 1.000 72.94913  ? 20   LYS A CB    1 
ATOM   980  C  CG    . LYS C 3  21  ? 18.59941 -8.39066  -34.51504 1.000 71.93806  ? 20   LYS A CG    1 
ATOM   981  C  CD    . LYS C 3  21  ? 17.32453 -9.18858  -34.81799 1.000 75.04763  ? 20   LYS A CD    1 
ATOM   982  C  CE    . LYS C 3  21  ? 16.17227 -8.84627  -33.87829 1.000 75.39740  ? 20   LYS A CE    1 
ATOM   983  N  NZ    . LYS C 3  21  ? 16.34205 -9.39194  -32.50596 1.000 74.80666  ? 20   LYS A NZ    1 
ATOM   984  N  N     . VAL C 3  22  ? 22.77748 -7.41157  -37.06819 1.000 75.07591  ? 21   VAL A N     1 
ATOM   985  C  CA    . VAL C 3  22  ? 23.53679 -6.90123  -38.20968 1.000 77.28632  ? 21   VAL A CA    1 
ATOM   986  C  C     . VAL C 3  22  ? 24.53613 -7.95731  -38.67468 1.000 81.70336  ? 21   VAL A C     1 
ATOM   987  O  O     . VAL C 3  22  ? 25.35910 -8.43145  -37.88116 1.000 80.43109  ? 21   VAL A O     1 
ATOM   988  C  CB    . VAL C 3  22  ? 24.26717 -5.58863  -37.86202 1.000 72.32225  ? 21   VAL A CB    1 
ATOM   989  C  CG1   . VAL C 3  22  ? 25.07213 -5.09891  -39.05009 1.000 71.23634  ? 21   VAL A CG1   1 
ATOM   990  C  CG2   . VAL C 3  22  ? 23.26853 -4.52312  -37.41729 1.000 71.52379  ? 21   VAL A CG2   1 
ATOM   991  N  N     . LYS C 3  23  ? 24.48588 -8.29245  -39.96890 1.000 84.72200  ? 22   LYS A N     1 
ATOM   992  C  CA    . LYS C 3  23  ? 25.29063 -9.37918  -40.51989 1.000 81.30768  ? 22   LYS A CA    1 
ATOM   993  C  C     . LYS C 3  23  ? 26.78248 -9.06200  -40.47139 1.000 78.79654  ? 22   LYS A C     1 
ATOM   994  O  O     . LYS C 3  23  ? 27.20497 -7.92553  -40.69369 1.000 78.32315  ? 22   LYS A O     1 
ATOM   995  C  CB    . LYS C 3  23  ? 24.87408 -9.66924  -41.96249 1.000 83.57668  ? 22   LYS A CB    1 
ATOM   996  N  N     . GLN C 3  24  ? 27.58221 -10.08586 -40.18593 1.000 79.33513  ? 23   GLN A N     1 
ATOM   997  C  CA    . GLN C 3  24  ? 29.03003 -9.93918  -40.18941 1.000 75.49018  ? 23   GLN A CA    1 
ATOM   998  C  C     . GLN C 3  24  ? 29.53600 -9.79496  -41.61663 1.000 80.17761  ? 23   GLN A C     1 
ATOM   999  O  O     . GLN C 3  24  ? 29.10599 -10.52225 -42.51774 1.000 85.33929  ? 23   GLN A O     1 
ATOM   1000 C  CB    . GLN C 3  24  ? 29.68483 -11.14864 -39.52680 1.000 69.17677  ? 23   GLN A CB    1 
ATOM   1001 C  CG    . GLN C 3  24  ? 31.19426 -11.06263 -39.43794 1.000 67.97890  ? 23   GLN A CG    1 
ATOM   1002 C  CD    . GLN C 3  24  ? 31.66888 -9.94128  -38.51130 1.000 68.86784  ? 23   GLN A CD    1 
ATOM   1003 O  OE1   . GLN C 3  24  ? 31.45944 -9.98271  -37.28268 1.000 68.27843  ? 23   GLN A OE1   1 
ATOM   1004 N  NE2   . GLN C 3  24  ? 32.30846 -8.93258  -39.09813 1.000 63.95608  ? 23   GLN A NE2   1 
ATOM   1005 N  N     . TRP C 3  25  ? 30.45758 -8.84282  -41.82460 1.000 80.24314  ? 24   TRP A N     1 
ATOM   1006 C  CA    . TRP C 3  25  ? 30.98665 -8.61599  -43.16201 1.000 86.27430  ? 24   TRP A CA    1 
ATOM   1007 C  C     . TRP C 3  25  ? 32.25750 -9.42665  -43.38932 1.000 85.81201  ? 24   TRP A C     1 
ATOM   1008 O  O     . TRP C 3  25  ? 32.87445 -9.91883  -42.43955 1.000 79.02751  ? 24   TRP A O     1 
ATOM   1009 C  CB    . TRP C 3  25  ? 31.24422 -7.11926  -43.39236 1.000 90.32251  ? 24   TRP A CB    1 
ATOM   1010 C  CG    . TRP C 3  25  ? 32.09700 -6.38949  -42.37041 1.000 88.07291  ? 24   TRP A CG    1 
ATOM   1011 C  CD1   . TRP C 3  25  ? 33.32563 -6.76066  -41.89743 1.000 90.37937  ? 24   TRP A CD1   1 
ATOM   1012 C  CD2   . TRP C 3  25  ? 31.79540 -5.13172  -41.75253 1.000 84.92018  ? 24   TRP A CD2   1 
ATOM   1013 N  NE1   . TRP C 3  25  ? 33.79316 -5.82511  -41.00024 1.000 89.95513  ? 24   TRP A NE1   1 
ATOM   1014 C  CE2   . TRP C 3  25  ? 32.87236 -4.81603  -40.89342 1.000 86.29352  ? 24   TRP A CE2   1 
ATOM   1015 C  CE3   . TRP C 3  25  ? 30.71298 -4.25018  -41.82871 1.000 83.71189  ? 24   TRP A CE3   1 
ATOM   1016 C  CZ2   . TRP C 3  25  ? 32.89789 -3.65403  -40.12084 1.000 80.66790  ? 24   TRP A CZ2   1 
ATOM   1017 C  CZ3   . TRP C 3  25  ? 30.74066 -3.09491  -41.05917 1.000 82.34431  ? 24   TRP A CZ3   1 
ATOM   1018 C  CH2   . TRP C 3  25  ? 31.82644 -2.80769  -40.21946 1.000 79.35466  ? 24   TRP A CH2   1 
ATOM   1019 N  N     . PRO C 3  26  ? 32.65801 -9.62446  -44.64825 1.000 92.03236  ? 25   PRO A N     1 
ATOM   1020 C  CA    . PRO C 3  26  ? 33.87007 -10.41681 -44.91956 1.000 91.99534  ? 25   PRO A CA    1 
ATOM   1021 C  C     . PRO C 3  26  ? 35.12486 -9.71874  -44.41010 1.000 86.47822  ? 25   PRO A C     1 
ATOM   1022 O  O     . PRO C 3  26  ? 35.43889 -8.59381  -44.81000 1.000 80.38563  ? 25   PRO A O     1 
ATOM   1023 C  CB    . PRO C 3  26  ? 33.87293 -10.55411 -46.44813 1.000 93.83776  ? 25   PRO A CB    1 
ATOM   1024 C  CG    . PRO C 3  26  ? 32.97002 -9.47317  -46.93707 1.000 94.06060  ? 25   PRO A CG    1 
ATOM   1025 C  CD    . PRO C 3  26  ? 31.92337 -9.31916  -45.88901 1.000 93.08847  ? 25   PRO A CD    1 
ATOM   1026 N  N     . LEU C 3  27  ? 35.83076 -10.39507 -43.50687 1.000 84.52516  ? 26   LEU A N     1 
ATOM   1027 C  CA    . LEU C 3  27  ? 37.16193 -9.99377  -43.08230 1.000 79.81843  ? 26   LEU A CA    1 
ATOM   1028 C  C     . LEU C 3  27  ? 38.20946 -10.75085 -43.89455 1.000 78.39174  ? 26   LEU A C     1 
ATOM   1029 O  O     . LEU C 3  27  ? 37.96639 -11.85868 -44.38223 1.000 82.22095  ? 26   LEU A O     1 
ATOM   1030 C  CB    . LEU C 3  27  ? 37.35994 -10.25201 -41.58134 1.000 76.45723  ? 26   LEU A CB    1 
ATOM   1031 N  N     . THR C 3  28  ? 39.37113 -10.12687 -44.06196 1.000 77.60062  ? 27   THR A N     1 
ATOM   1032 C  CA    . THR C 3  28  ? 40.49418 -10.80550 -44.68393 1.000 83.22031  ? 27   THR A CA    1 
ATOM   1033 C  C     . THR C 3  28  ? 40.98372 -11.92597 -43.77647 1.000 89.01685  ? 27   THR A C     1 
ATOM   1034 O  O     . THR C 3  28  ? 40.71284 -11.94679 -42.57106 1.000 89.50561  ? 27   THR A O     1 
ATOM   1035 C  CB    . THR C 3  28  ? 41.64174 -9.83175  -44.95328 1.000 83.61666  ? 27   THR A CB    1 
ATOM   1036 O  OG1   . THR C 3  28  ? 42.15957 -9.35645  -43.70375 1.000 81.48749  ? 27   THR A OG1   1 
ATOM   1037 C  CG2   . THR C 3  28  ? 41.16970 -8.63996  -45.79542 1.000 79.93218  ? 27   THR A CG2   1 
ATOM   1038 N  N     . GLU C 3  29  ? 41.73706 -12.85669 -44.36823 1.000 92.03355  ? 28   GLU A N     1 
ATOM   1039 C  CA    . GLU C 3  29  ? 42.19428 -14.02595 -43.62189 1.000 94.49186  ? 28   GLU A CA    1 
ATOM   1040 C  C     . GLU C 3  29  ? 43.17440 -13.64889 -42.51131 1.000 95.22977  ? 28   GLU A C     1 
ATOM   1041 O  O     . GLU C 3  29  ? 43.17408 -14.27834 -41.44328 1.000 94.00111  ? 28   GLU A O     1 
ATOM   1042 C  CB    . GLU C 3  29  ? 42.81912 -15.03157 -44.58404 1.000 101.03904 ? 28   GLU A CB    1 
ATOM   1043 C  CG    . GLU C 3  29  ? 43.19315 -16.36247 -43.97301 1.000 105.04489 ? 28   GLU A CG    1 
ATOM   1044 C  CD    . GLU C 3  29  ? 44.68195 -16.60577 -44.04348 1.000 109.39662 ? 28   GLU A CD    1 
ATOM   1045 O  OE1   . GLU C 3  29  ? 45.44495 -15.63697 -43.82643 1.000 105.67744 ? 28   GLU A OE1   1 
ATOM   1046 O  OE2   . GLU C 3  29  ? 45.08747 -17.75438 -44.33210 1.000 114.27937 ? 28   GLU A OE2   1 
ATOM   1047 N  N     . GLU C 3  30  ? 44.00790 -12.62830 -42.73623 1.000 94.48328  ? 29   GLU A N     1 
ATOM   1048 C  CA    . GLU C 3  30  ? 44.93492 -12.18663 -41.69792 1.000 91.76463  ? 29   GLU A CA    1 
ATOM   1049 C  C     . GLU C 3  30  ? 44.18276 -11.71065 -40.45997 1.000 85.33092  ? 29   GLU A C     1 
ATOM   1050 O  O     . GLU C 3  30  ? 44.54814 -12.04485 -39.32106 1.000 80.14177  ? 29   GLU A O     1 
ATOM   1051 C  CB    . GLU C 3  30  ? 45.83192 -11.07593 -42.24594 1.000 95.52085  ? 29   GLU A CB    1 
ATOM   1052 C  CG    . GLU C 3  30  ? 46.90135 -10.59951 -41.27615 1.000 95.82076  ? 29   GLU A CG    1 
ATOM   1053 C  CD    . GLU C 3  30  ? 47.58294 -9.32444  -41.73666 1.000 95.49066  ? 29   GLU A CD    1 
ATOM   1054 O  OE1   . GLU C 3  30  ? 47.10037 -8.71196  -42.71404 1.000 92.91998  ? 29   GLU A OE1   1 
ATOM   1055 O  OE2   . GLU C 3  30  ? 48.59606 -8.93432  -41.11286 1.000 97.23085  ? 29   GLU A OE2   1 
ATOM   1056 N  N     . LYS C 3  31  ? 43.10219 -10.95600 -40.66827 1.000 84.71164  ? 30   LYS A N     1 
ATOM   1057 C  CA    . LYS C 3  31  ? 42.29169 -10.49214 -39.55185 1.000 81.49185  ? 30   LYS A CA    1 
ATOM   1058 C  C     . LYS C 3  31  ? 41.43228 -11.61059 -38.96584 1.000 82.01904  ? 30   LYS A C     1 
ATOM   1059 O  O     . LYS C 3  31  ? 41.14369 -11.58581 -37.76521 1.000 72.76422  ? 30   LYS A O     1 
ATOM   1060 C  CB    . LYS C 3  31  ? 41.43883 -9.29759  -39.99178 1.000 77.45045  ? 30   LYS A CB    1 
ATOM   1061 C  CG    . LYS C 3  31  ? 42.27598 -8.05083  -40.31511 1.000 74.46615  ? 30   LYS A CG    1 
ATOM   1062 C  CD    . LYS C 3  31  ? 41.40751 -6.82650  -40.54454 1.000 74.87544  ? 30   LYS A CD    1 
ATOM   1063 C  CE    . LYS C 3  31  ? 42.21286 -5.65470  -41.09353 1.000 78.93599  ? 30   LYS A CE    1 
ATOM   1064 N  NZ    . LYS C 3  31  ? 41.36175 -4.44308  -41.34141 1.000 79.79639  ? 30   LYS A NZ    1 
ATOM   1065 N  N     . ILE C 3  32  ? 41.05323 -12.61377 -39.77263 1.000 86.27296  ? 31   ILE A N     1 
ATOM   1066 C  CA    . ILE C 3  32  ? 40.33498 -13.77146 -39.23626 1.000 83.07606  ? 31   ILE A CA    1 
ATOM   1067 C  C     . ILE C 3  32  ? 41.22611 -14.55848 -38.28233 1.000 81.03331  ? 31   ILE A C     1 
ATOM   1068 O  O     . ILE C 3  32  ? 40.79568 -14.95869 -37.19688 1.000 78.94970  ? 31   ILE A O     1 
ATOM   1069 C  CB    . ILE C 3  32  ? 39.80743 -14.66824 -40.36937 1.000 86.62227  ? 31   ILE A CB    1 
ATOM   1070 C  CG1   . ILE C 3  32  ? 38.67263 -13.97486 -41.11748 1.000 86.52546  ? 31   ILE A CG1   1 
ATOM   1071 C  CG2   . ILE C 3  32  ? 39.33080 -16.00194 -39.80640 1.000 86.45067  ? 31   ILE A CG2   1 
ATOM   1072 C  CD1   . ILE C 3  32  ? 37.97337 -14.86736 -42.10068 1.000 87.91288  ? 31   ILE A CD1   1 
ATOM   1073 N  N     . LYS C 3  33  ? 42.47863 -14.80014 -38.67662 1.000 79.89524  ? 32   LYS A N     1 
ATOM   1074 C  CA    . LYS C 3  33  ? 43.41623 -15.46679 -37.77949 1.000 73.85536  ? 32   LYS A CA    1 
ATOM   1075 C  C     . LYS C 3  33  ? 43.66955 -14.63159 -36.52442 1.000 70.68063  ? 32   LYS A C     1 
ATOM   1076 O  O     . LYS C 3  33  ? 43.69202 -15.16987 -35.40342 1.000 69.61979  ? 32   LYS A O     1 
ATOM   1077 C  CB    . LYS C 3  33  ? 44.72431 -15.76425 -38.51812 1.000 71.82369  ? 32   LYS A CB    1 
ATOM   1078 N  N     . ALA C 3  34  ? 43.85121 -13.31177 -36.68454 1.000 66.37933  ? 33   ALA A N     1 
ATOM   1079 C  CA    . ALA C 3  34  ? 44.04548 -12.45738 -35.51205 1.000 64.55230  ? 33   ALA A CA    1 
ATOM   1080 C  C     . ALA C 3  34  ? 42.87036 -12.57078 -34.54491 1.000 62.81692  ? 33   ALA A C     1 
ATOM   1081 O  O     . ALA C 3  34  ? 43.05234 -12.83297 -33.34618 1.000 59.38453  ? 33   ALA A O     1 
ATOM   1082 C  CB    . ALA C 3  34  ? 44.24237 -11.00366 -35.94002 1.000 64.20432  ? 33   ALA A CB    1 
ATOM   1083 N  N     . LEU C 3  35  ? 41.65357 -12.37398 -35.05863 1.000 63.43897  ? 34   LEU A N     1 
ATOM   1084 C  CA    . LEU C 3  35  ? 40.45781 -12.44267 -34.23209 1.000 58.26744  ? 34   LEU A CA    1 
ATOM   1085 C  C     . LEU C 3  35  ? 40.28554 -13.82195 -33.60378 1.000 56.12501  ? 34   LEU A C     1 
ATOM   1086 O  O     . LEU C 3  35  ? 39.90996 -13.91722 -32.43408 1.000 54.00417  ? 34   LEU A O     1 
ATOM   1087 C  CB    . LEU C 3  35  ? 39.23476 -12.05563 -35.06690 1.000 59.71202  ? 34   LEU A CB    1 
ATOM   1088 C  CG    . LEU C 3  35  ? 39.23367 -10.59069 -35.53208 1.000 64.60056  ? 34   LEU A CG    1 
ATOM   1089 C  CD1   . LEU C 3  35  ? 38.22689 -10.34942 -36.65064 1.000 58.04561  ? 34   LEU A CD1   1 
ATOM   1090 C  CD2   . LEU C 3  35  ? 38.99717 -9.62524  -34.34780 1.000 61.05726  ? 34   LEU A CD2   1 
ATOM   1091 N  N     . VAL C 3  36  ? 40.56259 -14.89949 -34.35721 1.000 59.12828  ? 35   VAL A N     1 
ATOM   1092 C  CA    . VAL C 3  36  ? 40.41410 -16.25981 -33.83435 1.000 60.06982  ? 35   VAL A CA    1 
ATOM   1093 C  C     . VAL C 3  36  ? 41.33494 -16.47765 -32.63897 1.000 62.58403  ? 35   VAL A C     1 
ATOM   1094 O  O     . VAL C 3  36  ? 40.92068 -17.00925 -31.60071 1.000 65.69197  ? 35   VAL A O     1 
ATOM   1095 C  CB    . VAL C 3  36  ? 40.68346 -17.29790 -34.94164 1.000 63.96544  ? 35   VAL A CB    1 
ATOM   1096 C  CG1   . VAL C 3  36  ? 41.23654 -18.58813 -34.35138 1.000 65.04741  ? 35   VAL A CG1   1 
ATOM   1097 C  CG2   . VAL C 3  36  ? 39.42092 -17.58471 -35.71967 1.000 66.13674  ? 35   VAL A CG2   1 
ATOM   1098 N  N     . GLU C 3  37  ? 42.60329 -16.08701 -32.77169 1.000 58.41280  ? 36   GLU A N     1 
ATOM   1099 C  CA    . GLU C 3  37  ? 43.53875 -16.24435 -31.66251 1.000 60.29165  ? 36   GLU A CA    1 
ATOM   1100 C  C     . GLU C 3  37  ? 43.11890 -15.39469 -30.45511 1.000 62.41401  ? 36   GLU A C     1 
ATOM   1101 O  O     . GLU C 3  37  ? 43.04150 -15.89544 -29.31290 1.000 63.47537  ? 36   GLU A O     1 
ATOM   1102 C  CB    . GLU C 3  37  ? 44.93951 -15.88182 -32.14236 1.000 61.32963  ? 36   GLU A CB    1 
ATOM   1103 C  CG    . GLU C 3  37  ? 46.03455 -16.16532 -31.15698 1.000 71.14396  ? 36   GLU A CG    1 
ATOM   1104 C  CD    . GLU C 3  37  ? 47.32954 -15.48380 -31.54726 1.000 84.34744  ? 36   GLU A CD    1 
ATOM   1105 O  OE1   . GLU C 3  37  ? 47.51969 -15.20766 -32.75668 1.000 88.80973  ? 36   GLU A OE1   1 
ATOM   1106 O  OE2   . GLU C 3  37  ? 48.14989 -15.20807 -30.64278 1.000 88.88093  ? 36   GLU A OE2   1 
ATOM   1107 N  N     . ILE C 3  38  ? 42.82634 -14.10315 -30.69715 1.000 59.49521  ? 37   ILE A N     1 
ATOM   1108 C  CA    . ILE C 3  38  ? 42.31119 -13.22503 -29.64416 1.000 53.63065  ? 37   ILE A CA    1 
ATOM   1109 C  C     . ILE C 3  38  ? 41.11514 -13.86249 -28.94763 1.000 50.81501  ? 37   ILE A C     1 
ATOM   1110 O  O     . ILE C 3  38  ? 41.01766 -13.85423 -27.71745 1.000 48.78327  ? 37   ILE A O     1 
ATOM   1111 C  CB    . ILE C 3  38  ? 41.94638 -11.84189 -30.22372 1.000 52.48169  ? 37   ILE A CB    1 
ATOM   1112 C  CG1   . ILE C 3  38  ? 43.20174 -11.06356 -30.61445 1.000 53.05197  ? 37   ILE A CG1   1 
ATOM   1113 C  CG2   . ILE C 3  38  ? 41.10653 -11.03487 -29.23562 1.000 45.34715  ? 37   ILE A CG2   1 
ATOM   1114 C  CD1   . ILE C 3  38  ? 42.94266 -9.97989  -31.63924 1.000 54.17625  ? 37   ILE A CD1   1 
ATOM   1115 N  N     . CYS C 3  39  ? 40.20334 -14.45380 -29.71740 1.000 53.42837  ? 38   CYS A N     1 
ATOM   1116 C  CA    . CYS C 3  39  ? 38.93617 -14.88595 -29.14621 1.000 57.84446  ? 38   CYS A CA    1 
ATOM   1117 C  C     . CYS C 3  39  ? 39.06375 -16.19621 -28.38655 1.000 58.17028  ? 38   CYS A C     1 
ATOM   1118 O  O     . CYS C 3  39  ? 38.43958 -16.36037 -27.33636 1.000 55.35204  ? 38   CYS A O     1 
ATOM   1119 C  CB    . CYS C 3  39  ? 37.87561 -14.99579 -30.23654 1.000 59.65961  ? 38   CYS A CB    1 
ATOM   1120 S  SG    . CYS C 3  39  ? 37.09876 -13.39827 -30.54306 1.000 61.44156  ? 38   CYS A SG    1 
ATOM   1121 N  N     . THR C 3  40  ? 39.85894 -17.13993 -28.88121 1.000 59.57022  ? 39   THR A N     1 
ATOM   1122 C  CA    . THR C 3  40  ? 40.05746 -18.35383 -28.10344 1.000 63.39609  ? 39   THR A CA    1 
ATOM   1123 C  C     . THR C 3  40  ? 40.72916 -18.02888 -26.77211 1.000 59.44664  ? 39   THR A C     1 
ATOM   1124 O  O     . THR C 3  40  ? 40.36016 -18.58988 -25.72541 1.000 57.74615  ? 39   THR A O     1 
ATOM   1125 C  CB    . THR C 3  40  ? 40.85075 -19.38558 -28.91236 1.000 72.18884  ? 39   THR A CB    1 
ATOM   1126 O  OG1   . THR C 3  40  ? 42.08915 -18.81765 -29.35184 1.000 78.54595  ? 39   THR A OG1   1 
ATOM   1127 C  CG2   . THR C 3  40  ? 40.04725 -19.82232 -30.13598 1.000 70.50258  ? 39   THR A CG2   1 
ATOM   1128 N  N     . GLU C 3  41  ? 41.66150 -17.06508 -26.76911 1.000 54.69572  ? 40   GLU A N     1 
ATOM   1129 C  CA    . GLU C 3  41  ? 42.28303 -16.70763 -25.49522 1.000 52.07639  ? 40   GLU A CA    1 
ATOM   1130 C  C     . GLU C 3  41  ? 41.31089 -15.96260 -24.57578 1.000 50.28858  ? 40   GLU A C     1 
ATOM   1131 O  O     . GLU C 3  41  ? 41.26234 -16.24194 -23.37108 1.000 47.49673  ? 40   GLU A O     1 
ATOM   1132 C  CB    . GLU C 3  41  ? 43.55657 -15.89151 -25.72620 1.000 57.72433  ? 40   GLU A CB    1 
ATOM   1133 C  CG    . GLU C 3  41  ? 44.44693 -15.74292 -24.48068 1.000 66.52451  ? 40   GLU A CG    1 
ATOM   1134 C  CD    . GLU C 3  41  ? 44.68536 -17.06571 -23.71413 1.000 79.28087  ? 40   GLU A CD    1 
ATOM   1135 O  OE1   . GLU C 3  41  ? 44.67995 -17.01345 -22.45575 1.000 83.30384  ? 40   GLU A OE1   1 
ATOM   1136 O  OE2   . GLU C 3  41  ? 44.88347 -18.13959 -24.35401 1.000 76.20418  ? 40   GLU A OE2   1 
ATOM   1137 N  N     . MET C 3  42  ? 40.52657 -15.01832 -25.11336 1.000 44.45352  ? 41   MET A N     1 
ATOM   1138 C  CA    . MET C 3  42  ? 39.55410 -14.31009 -24.28147 1.000 49.10323  ? 41   MET A CA    1 
ATOM   1139 C  C     . MET C 3  42  ? 38.51521 -15.26915 -23.71861 1.000 47.75590  ? 41   MET A C     1 
ATOM   1140 O  O     . MET C 3  42  ? 38.07019 -15.12133 -22.57273 1.000 43.91013  ? 41   MET A O     1 
ATOM   1141 C  CB    . MET C 3  42  ? 38.85560 -13.20173 -25.07353 1.000 41.86414  ? 41   MET A CB    1 
ATOM   1142 C  CG    . MET C 3  42  ? 39.70815 -11.98319 -25.38482 1.000 50.07153  ? 41   MET A CG    1 
ATOM   1143 S  SD    . MET C 3  42  ? 38.77646 -10.72281 -26.31152 1.000 55.34808  ? 41   MET A SD    1 
ATOM   1144 C  CE    . MET C 3  42  ? 37.79746 -9.95317  -25.02527 1.000 47.14778  ? 41   MET A CE    1 
ATOM   1145 N  N     . GLU C 3  43  ? 38.11235 -16.25570 -24.51380 1.000 48.11713  ? 42   GLU A N     1 
ATOM   1146 C  CA    . GLU C 3  43  ? 37.13080 -17.22225 -24.05207 1.000 48.66656  ? 42   GLU A CA    1 
ATOM   1147 C  C     . GLU C 3  43  ? 37.70651 -18.11093 -22.95552 1.000 50.24107  ? 42   GLU A C     1 
ATOM   1148 O  O     . GLU C 3  43  ? 37.00129 -18.44258 -21.99870 1.000 50.73715  ? 42   GLU A O     1 
ATOM   1149 C  CB    . GLU C 3  43  ? 36.62899 -18.04436 -25.23790 1.000 51.38006  ? 42   GLU A CB    1 
ATOM   1150 C  CG    . GLU C 3  43  ? 35.28988 -18.66181 -25.00690 1.000 57.19965  ? 42   GLU A CG    1 
ATOM   1151 C  CD    . GLU C 3  43  ? 35.39700 -19.98600 -24.28584 1.000 66.70859  ? 42   GLU A CD    1 
ATOM   1152 O  OE1   . GLU C 3  43  ? 36.48818 -20.59529 -24.33791 1.000 69.25752  ? 42   GLU A OE1   1 
ATOM   1153 O  OE2   . GLU C 3  43  ? 34.39597 -20.41641 -23.66951 1.000 69.86332  ? 42   GLU A OE2   1 
ATOM   1154 N  N     . LYS C 3  44  ? 38.98678 -18.49510 -23.05813 1.000 51.23116  ? 43   LYS A N     1 
ATOM   1155 C  CA    . LYS C 3  44  ? 39.59091 -19.25077 -21.95818 1.000 53.30401  ? 43   LYS A CA    1 
ATOM   1156 C  C     . LYS C 3  44  ? 39.59241 -18.44480 -20.66482 1.000 50.79350  ? 43   LYS A C     1 
ATOM   1157 O  O     . LYS C 3  44  ? 39.53286 -19.02108 -19.57163 1.000 50.64737  ? 43   LYS A O     1 
ATOM   1158 C  CB    . LYS C 3  44  ? 41.02457 -19.68296 -22.29906 1.000 56.48031  ? 43   LYS A CB    1 
ATOM   1159 C  CG    . LYS C 3  44  ? 41.14508 -20.87404 -23.25474 1.000 64.83118  ? 43   LYS A CG    1 
ATOM   1160 C  CD    . LYS C 3  44  ? 42.60864 -21.24515 -23.48611 1.000 72.75932  ? 43   LYS A CD    1 
ATOM   1161 C  CE    . LYS C 3  44  ? 42.76942 -22.43315 -24.44226 1.000 85.67702  ? 43   LYS A CE    1 
ATOM   1162 N  NZ    . LYS C 3  44  ? 42.25447 -23.74403 -23.91165 1.000 93.04718  ? 43   LYS A NZ    1 
ATOM   1163 N  N     . GLU C 3  45  ? 39.64666 -17.12026 -20.76961 1.000 46.27488  ? 44   GLU A N     1 
ATOM   1164 C  CA    . GLU C 3  45  ? 39.75917 -16.22498 -19.62483 1.000 47.03445  ? 44   GLU A CA    1 
ATOM   1165 C  C     . GLU C 3  45  ? 38.41623 -15.73436 -19.10399 1.000 47.13762  ? 44   GLU A C     1 
ATOM   1166 O  O     . GLU C 3  45  ? 38.39425 -14.87342 -18.21205 1.000 51.43477  ? 44   GLU A O     1 
ATOM   1167 C  CB    . GLU C 3  45  ? 40.61603 -15.00223 -19.99178 1.000 45.12636  ? 44   GLU A CB    1 
ATOM   1168 C  CG    . GLU C 3  45  ? 42.07139 -15.32486 -20.19382 1.000 52.24569  ? 44   GLU A CG    1 
ATOM   1169 C  CD    . GLU C 3  45  ? 42.78797 -14.26151 -20.98422 1.000 57.38597  ? 44   GLU A CD    1 
ATOM   1170 O  OE1   . GLU C 3  45  ? 44.02648 -14.34851 -21.09700 1.000 61.93121  ? 44   GLU A OE1   1 
ATOM   1171 O  OE2   . GLU C 3  45  ? 42.11635 -13.35159 -21.51132 1.000 58.54056  ? 44   GLU A OE2   1 
ATOM   1172 N  N     . GLY C 3  46  ? 37.30539 -16.21860 -19.65572 1.000 43.27978  ? 45   GLY A N     1 
ATOM   1173 C  CA    . GLY C 3  46  ? 36.00646 -15.71387 -19.25187 1.000 43.39624  ? 45   GLY A CA    1 
ATOM   1174 C  C     . GLY C 3  46  ? 35.67203 -14.29509 -19.67199 1.000 38.47959  ? 45   GLY A C     1 
ATOM   1175 O  O     . GLY C 3  46  ? 34.64221 -13.76874 -19.24160 1.000 45.20290  ? 45   GLY A O     1 
ATOM   1176 N  N     . LYS C 3  47  ? 36.48816 -13.65823 -20.50931 1.000 38.08985  ? 46   LYS A N     1 
ATOM   1177 C  CA    . LYS C 3  47  ? 36.15249 -12.31192 -20.95861 1.000 43.58897  ? 46   LYS A CA    1 
ATOM   1178 C  C     . LYS C 3  47  ? 35.06453 -12.31937 -22.02405 1.000 43.40787  ? 46   LYS A C     1 
ATOM   1179 O  O     . LYS C 3  47  ? 34.32513 -11.33810 -22.15672 1.000 42.67864  ? 46   LYS A O     1 
ATOM   1180 C  CB    . LYS C 3  47  ? 37.40945 -11.60100 -21.46621 1.000 41.45277  ? 46   LYS A CB    1 
ATOM   1181 C  CG    . LYS C 3  47  ? 38.37663 -11.27214 -20.33820 1.000 40.58119  ? 46   LYS A CG    1 
ATOM   1182 C  CD    . LYS C 3  47  ? 39.79168 -10.99967 -20.82550 1.000 40.17130  ? 46   LYS A CD    1 
ATOM   1183 C  CE    . LYS C 3  47  ? 40.67348 -10.55595 -19.65183 1.000 37.89129  ? 46   LYS A CE    1 
ATOM   1184 N  NZ    . LYS C 3  47  ? 42.11396 -10.59938 -20.00945 1.000 43.29560  ? 46   LYS A NZ    1 
ATOM   1185 N  N     . ILE C 3  48  ? 34.94872 -13.40249 -22.78399 1.000 47.14290  ? 47   ILE A N     1 
ATOM   1186 C  CA    . ILE C 3  48  ? 33.83681 -13.59605 -23.70260 1.000 49.98940  ? 47   ILE A CA    1 
ATOM   1187 C  C     . ILE C 3  48  ? 33.27426 -14.98467 -23.46126 1.000 53.21447  ? 47   ILE A C     1 
ATOM   1188 O  O     . ILE C 3  48  ? 33.97027 -15.88806 -22.98477 1.000 52.79856  ? 47   ILE A O     1 
ATOM   1189 C  CB    . ILE C 3  48  ? 34.23201 -13.42695 -25.19441 1.000 49.90640  ? 47   ILE A CB    1 
ATOM   1190 C  CG1   . ILE C 3  48  ? 35.21487 -14.51453 -25.62773 1.000 44.86811  ? 47   ILE A CG1   1 
ATOM   1191 C  CG2   . ILE C 3  48  ? 34.80892 -12.03504 -25.45433 1.000 47.58681  ? 47   ILE A CG2   1 
ATOM   1192 C  CD1   . ILE C 3  48  ? 35.65997 -14.38598 -27.04562 1.000 46.40142  ? 47   ILE A CD1   1 
ATOM   1193 N  N     . SER C 3  49  ? 32.00265 -15.15073 -23.80034 1.000 54.32158  ? 48   SER A N     1 
ATOM   1194 C  CA    . SER C 3  49  ? 31.31345 -16.42280 -23.63629 1.000 52.54391  ? 48   SER A CA    1 
ATOM   1195 C  C     . SER C 3  49  ? 30.72979 -16.86191 -24.96994 1.000 57.16966  ? 48   SER A C     1 
ATOM   1196 O  O     . SER C 3  49  ? 30.19867 -16.04076 -25.72335 1.000 57.30524  ? 48   SER A O     1 
ATOM   1197 C  CB    . SER C 3  49  ? 30.19515 -16.31859 -22.59125 1.000 50.80065  ? 48   SER A CB    1 
ATOM   1198 O  OG    . SER C 3  49  ? 30.68845 -15.91811 -21.32274 1.000 44.85929  ? 48   SER A OG    1 
ATOM   1199 N  N     . LYS C 3  50  ? 30.83295 -18.15590 -25.26597 1.000 59.14668  ? 49   LYS A N     1 
ATOM   1200 C  CA    . LYS C 3  50  ? 30.13615 -18.70492 -26.42206 1.000 57.99532  ? 49   LYS A CA    1 
ATOM   1201 C  C     . LYS C 3  50  ? 28.63579 -18.64992 -26.17466 1.000 58.83744  ? 49   LYS A C     1 
ATOM   1202 O  O     . LYS C 3  50  ? 28.15796 -19.02875 -25.09850 1.000 56.02733  ? 49   LYS A O     1 
ATOM   1203 C  CB    . LYS C 3  50  ? 30.56967 -20.14447 -26.69387 1.000 62.12535  ? 49   LYS A CB    1 
ATOM   1204 C  CG    . LYS C 3  50  ? 31.95950 -20.30066 -27.27674 1.000 62.65543  ? 49   LYS A CG    1 
ATOM   1205 C  CD    . LYS C 3  50  ? 32.28654 -21.78262 -27.48877 1.000 64.00140  ? 49   LYS A CD    1 
ATOM   1206 C  CE    . LYS C 3  50  ? 33.66220 -21.95105 -28.12562 1.000 68.65620  ? 49   LYS A CE    1 
ATOM   1207 N  NZ    . LYS C 3  50  ? 34.07897 -23.37368 -28.28486 1.000 72.06270  ? 49   LYS A NZ    1 
ATOM   1208 N  N     . ILE C 3  51  ? 27.89897 -18.15779 -27.16556 1.000 62.68521  ? 50   ILE A N     1 
ATOM   1209 C  CA    . ILE C 3  51  ? 26.44997 -18.05854 -27.09880 1.000 58.87288  ? 50   ILE A CA    1 
ATOM   1210 C  C     . ILE C 3  51  ? 25.85280 -19.06744 -28.06574 1.000 62.65759  ? 50   ILE A C     1 
ATOM   1211 O  O     . ILE C 3  51  ? 26.50836 -19.53213 -29.00425 1.000 64.05754  ? 50   ILE A O     1 
ATOM   1212 C  CB    . ILE C 3  51  ? 25.96281 -16.63956 -27.42837 1.000 58.04121  ? 50   ILE A CB    1 
ATOM   1213 C  CG1   . ILE C 3  51  ? 26.41239 -16.27131 -28.84263 1.000 63.69161  ? 50   ILE A CG1   1 
ATOM   1214 C  CG2   . ILE C 3  51  ? 26.51155 -15.65556 -26.42554 1.000 55.42334  ? 50   ILE A CG2   1 
ATOM   1215 C  CD1   . ILE C 3  51  ? 26.10337 -14.85021 -29.25692 1.000 66.16901  ? 50   ILE A CD1   1 
ATOM   1216 N  N     . GLY C 3  52  ? 24.58222 -19.39707 -27.83498 1.000 65.15469  ? 51   GLY A N     1 
ATOM   1217 C  CA    . GLY C 3  52  ? 23.86200 -20.32239 -28.67980 1.000 71.87092  ? 51   GLY A CA    1 
ATOM   1218 C  C     . GLY C 3  52  ? 22.81328 -19.64997 -29.54688 1.000 77.30949  ? 51   GLY A C     1 
ATOM   1219 O  O     . GLY C 3  52  ? 22.93284 -18.47223 -29.91142 1.000 75.94009  ? 51   GLY A O     1 
ATOM   1220 N  N     . PRO C 3  53  ? 21.75648 -20.39353 -29.89752 1.000 80.67302  ? 52   PRO A N     1 
ATOM   1221 C  CA    . PRO C 3  53  ? 20.68877 -19.82340 -30.73256 1.000 81.18177  ? 52   PRO A CA    1 
ATOM   1222 C  C     . PRO C 3  53  ? 19.68867 -18.97579 -29.96451 1.000 78.85694  ? 52   PRO A C     1 
ATOM   1223 O  O     . PRO C 3  53  ? 18.90306 -18.25343 -30.59461 1.000 78.96921  ? 52   PRO A O     1 
ATOM   1224 C  CB    . PRO C 3  53  ? 20.00417 -21.06373 -31.32244 1.000 85.74794  ? 52   PRO A CB    1 
ATOM   1225 C  CG    . PRO C 3  53  ? 20.57375 -22.26323 -30.56337 1.000 87.53961  ? 52   PRO A CG    1 
ATOM   1226 C  CD    . PRO C 3  53  ? 21.42377 -21.75066 -29.44724 1.000 83.86172  ? 52   PRO A CD    1 
ATOM   1227 N  N     . GLU C 3  54  ? 19.68450 -19.04992 -28.63145 1.000 76.43008  ? 53   GLU A N     1 
ATOM   1228 C  CA    . GLU C 3  54  ? 18.83291 -18.17754 -27.83503 1.000 78.05432  ? 53   GLU A CA    1 
ATOM   1229 C  C     . GLU C 3  54  ? 19.21418 -16.71248 -27.99606 1.000 80.87351  ? 53   GLU A C     1 
ATOM   1230 O  O     . GLU C 3  54  ? 18.40141 -15.83381 -27.69195 1.000 84.82623  ? 53   GLU A O     1 
ATOM   1231 C  CB    . GLU C 3  54  ? 18.90399 -18.58171 -26.35894 1.000 77.03585  ? 53   GLU A CB    1 
ATOM   1232 C  CG    . GLU C 3  54  ? 20.20174 -18.18556 -25.63530 1.000 76.59197  ? 53   GLU A CG    1 
ATOM   1233 C  CD    . GLU C 3  54  ? 21.42373 -18.99141 -26.07489 1.000 77.03473  ? 53   GLU A CD    1 
ATOM   1234 O  OE1   . GLU C 3  54  ? 21.25474 -19.94985 -26.86471 1.000 76.46529  ? 53   GLU A OE1   1 
ATOM   1235 O  OE2   . GLU C 3  54  ? 22.55141 -18.65850 -25.62755 1.000 74.84568  ? 53   GLU A OE2   1 
ATOM   1236 N  N     . ASN C 3  55  ? 20.43069 -16.43193 -28.46076 1.000 78.83372  ? 54   ASN A N     1 
ATOM   1237 C  CA    . ASN C 3  55  ? 20.90104 -15.07352 -28.68862 1.000 78.45099  ? 54   ASN A CA    1 
ATOM   1238 C  C     . ASN C 3  55  ? 20.57464 -14.65620 -30.11914 1.000 78.72741  ? 54   ASN A C     1 
ATOM   1239 O  O     . ASN C 3  55  ? 21.23243 -15.10862 -31.06549 1.000 77.95595  ? 54   ASN A O     1 
ATOM   1240 C  CB    . ASN C 3  55  ? 22.40406 -14.98018 -28.41239 1.000 76.32061  ? 54   ASN A CB    1 
ATOM   1241 C  CG    . ASN C 3  55  ? 22.86160 -13.56206 -28.15090 1.000 73.61780  ? 54   ASN A CG    1 
ATOM   1242 O  OD1   . ASN C 3  55  ? 22.52825 -12.65273 -28.90446 1.000 78.31242  ? 54   ASN A OD1   1 
ATOM   1243 N  ND2   . ASN C 3  55  ? 23.62335 -13.36371 -27.07133 1.000 67.55640  ? 54   ASN A ND2   1 
ATOM   1244 N  N     . PRO C 3  56  ? 19.56451 -13.80554 -30.31763 1.000 77.20013  ? 55   PRO A N     1 
ATOM   1245 C  CA    . PRO C 3  56  ? 19.16401 -13.42029 -31.67699 1.000 82.02695  ? 55   PRO A CA    1 
ATOM   1246 C  C     . PRO C 3  56  ? 20.01393 -12.32212 -32.29731 1.000 82.47104  ? 55   PRO A C     1 
ATOM   1247 O  O     . PRO C 3  56  ? 19.80614 -11.99290 -33.47246 1.000 81.84273  ? 55   PRO A O     1 
ATOM   1248 C  CB    . PRO C 3  56  ? 17.73130 -12.92741 -31.46727 1.000 80.73677  ? 55   PRO A CB    1 
ATOM   1249 C  CG    . PRO C 3  56  ? 17.78081 -12.30010 -30.09067 1.000 74.80914  ? 55   PRO A CG    1 
ATOM   1250 C  CD    . PRO C 3  56  ? 18.71751 -13.17271 -29.28909 1.000 71.84923  ? 55   PRO A CD    1 
ATOM   1251 N  N     . TYR C 3  57  ? 20.94932 -11.75141 -31.54594 1.000 77.63227  ? 56   TYR A N     1 
ATOM   1252 C  CA    . TYR C 3  57  ? 21.63365 -10.52381 -31.91828 1.000 73.84399  ? 56   TYR A CA    1 
ATOM   1253 C  C     . TYR C 3  57  ? 22.96239 -10.80139 -32.60864 1.000 73.10719  ? 56   TYR A C     1 
ATOM   1254 O  O     . TYR C 3  57  ? 23.50481 -11.90869 -32.55590 1.000 78.96053  ? 56   TYR A O     1 
ATOM   1255 C  CB    . TYR C 3  57  ? 21.87538 -9.66567  -30.68150 1.000 70.28766  ? 56   TYR A CB    1 
ATOM   1256 C  CG    . TYR C 3  57  ? 20.61403 -9.33371  -29.92832 1.000 73.50075  ? 56   TYR A CG    1 
ATOM   1257 C  CD1   . TYR C 3  57  ? 19.59970 -8.59967  -30.52710 1.000 78.03996  ? 56   TYR A CD1   1 
ATOM   1258 C  CD2   . TYR C 3  57  ? 20.43935 -9.74015  -28.61324 1.000 70.28446  ? 56   TYR A CD2   1 
ATOM   1259 C  CE1   . TYR C 3  57  ? 18.44297 -8.28681  -29.83579 1.000 77.35665  ? 56   TYR A CE1   1 
ATOM   1260 C  CE2   . TYR C 3  57  ? 19.28896 -9.43004  -27.91684 1.000 69.65641  ? 56   TYR A CE2   1 
ATOM   1261 C  CZ    . TYR C 3  57  ? 18.29786 -8.70216  -28.53112 1.000 72.63055  ? 56   TYR A CZ    1 
ATOM   1262 O  OH    . TYR C 3  57  ? 17.15753 -8.38695  -27.83777 1.000 73.11710  ? 56   TYR A OH    1 
ATOM   1263 N  N     . ASN C 3  58  ? 23.48233 -9.76628  -33.26104 1.000 67.13069  ? 57   ASN A N     1 
ATOM   1264 C  CA    . ASN C 3  58  ? 24.82716 -9.79883  -33.81560 1.000 65.33285  ? 57   ASN A CA    1 
ATOM   1265 C  C     . ASN C 3  58  ? 25.21491 -8.38921  -34.22787 1.000 62.16692  ? 57   ASN A C     1 
ATOM   1266 O  O     . ASN C 3  58  ? 24.35307 -7.55770  -34.52140 1.000 62.73065  ? 57   ASN A O     1 
ATOM   1267 C  CB    . ASN C 3  58  ? 24.93338 -10.74413 -35.01846 1.000 64.07639  ? 57   ASN A CB    1 
ATOM   1268 C  CG    . ASN C 3  58  ? 26.36883 -11.05901 -35.38181 1.000 66.81455  ? 57   ASN A CG    1 
ATOM   1269 O  OD1   . ASN C 3  58  ? 27.00240 -11.89815 -34.75047 1.000 71.18523  ? 57   ASN A OD1   1 
ATOM   1270 N  ND2   . ASN C 3  58  ? 26.89180 -10.38310 -36.39533 1.000 64.09453  ? 57   ASN A ND2   1 
ATOM   1271 N  N     . THR C 3  59  ? 26.51837 -8.12734  -34.23421 1.000 58.00968  ? 58   THR A N     1 
ATOM   1272 C  CA    . THR C 3  59  ? 27.03538 -6.88385  -34.77870 1.000 57.44971  ? 58   THR A CA    1 
ATOM   1273 C  C     . THR C 3  59  ? 28.43539 -7.14680  -35.32964 1.000 57.26990  ? 58   THR A C     1 
ATOM   1274 O  O     . THR C 3  59  ? 29.13387 -8.03350  -34.82962 1.000 56.34491  ? 58   THR A O     1 
ATOM   1275 C  CB    . THR C 3  59  ? 27.00769 -5.75468  -33.71864 1.000 54.63948  ? 58   THR A CB    1 
ATOM   1276 O  OG1   . THR C 3  59  ? 28.23817 -5.02633  -33.71791 1.000 61.08987  ? 58   THR A OG1   1 
ATOM   1277 C  CG2   . THR C 3  59  ? 26.68983 -6.28872  -32.32296 1.000 52.85415  ? 58   THR A CG2   1 
ATOM   1278 N  N     . PRO C 3  60  ? 28.84847 -6.43764  -36.38733 1.000 62.30426  ? 59   PRO A N     1 
ATOM   1279 C  CA    . PRO C 3  60  ? 30.09909 -6.79052  -37.08623 1.000 62.46828  ? 59   PRO A CA    1 
ATOM   1280 C  C     . PRO C 3  60  ? 31.36802 -6.52347  -36.27863 1.000 65.17664  ? 59   PRO A C     1 
ATOM   1281 O  O     . PRO C 3  60  ? 31.45414 -5.56954  -35.49605 1.000 67.81161  ? 59   PRO A O     1 
ATOM   1282 C  CB    . PRO C 3  60  ? 30.06470 -5.90371  -38.33986 1.000 61.85847  ? 59   PRO A CB    1 
ATOM   1283 C  CG    . PRO C 3  60  ? 28.62370 -5.54156  -38.52507 1.000 62.73706  ? 59   PRO A CG    1 
ATOM   1284 C  CD    . PRO C 3  60  ? 28.05445 -5.45011  -37.14093 1.000 60.18035  ? 59   PRO A CD    1 
ATOM   1285 N  N     . VAL C 3  61  ? 32.38624 -7.36163  -36.52809 1.000 61.44034  ? 60   VAL A N     1 
ATOM   1286 C  CA    . VAL C 3  61  ? 33.67074 -7.31697  -35.83278 1.000 58.93187  ? 60   VAL A CA    1 
ATOM   1287 C  C     . VAL C 3  61  ? 34.80717 -7.17419  -36.84497 1.000 60.06378  ? 60   VAL A C     1 
ATOM   1288 O  O     . VAL C 3  61  ? 34.69628 -7.60606  -37.99658 1.000 60.51958  ? 60   VAL A O     1 
ATOM   1289 C  CB    . VAL C 3  61  ? 33.84260 -8.57713  -34.94690 1.000 59.62380  ? 60   VAL A CB    1 
ATOM   1290 C  CG1   . VAL C 3  61  ? 35.30799 -8.89682  -34.66428 1.000 59.71336  ? 60   VAL A CG1   1 
ATOM   1291 C  CG2   . VAL C 3  61  ? 33.10118 -8.38411  -33.64206 1.000 55.69055  ? 60   VAL A CG2   1 
ATOM   1292 N  N     . PHE C 3  62  ? 35.89454 -6.52592  -36.42002 1.000 60.86001  ? 61   PHE A N     1 
ATOM   1293 C  CA    . PHE C 3  62  ? 37.11814 -6.43497  -37.21710 1.000 65.30274  ? 61   PHE A CA    1 
ATOM   1294 C  C     . PHE C 3  62  ? 38.29559 -6.20392  -36.26955 1.000 63.17979  ? 61   PHE A C     1 
ATOM   1295 O  O     . PHE C 3  62  ? 38.15007 -6.24588  -35.04661 1.000 51.05327  ? 61   PHE A O     1 
ATOM   1296 C  CB    . PHE C 3  62  ? 37.01665 -5.34258  -38.29367 1.000 69.34652  ? 61   PHE A CB    1 
ATOM   1297 C  CG    . PHE C 3  62  ? 36.75967 -3.96066  -37.75092 1.000 70.99211  ? 61   PHE A CG    1 
ATOM   1298 C  CD1   . PHE C 3  62  ? 35.51991 -3.62276  -37.20970 1.000 69.32227  ? 61   PHE A CD1   1 
ATOM   1299 C  CD2   . PHE C 3  62  ? 37.75070 -2.99067  -37.80406 1.000 71.26277  ? 61   PHE A CD2   1 
ATOM   1300 C  CE1   . PHE C 3  62  ? 35.27975 -2.35154  -36.71582 1.000 67.14000  ? 61   PHE A CE1   1 
ATOM   1301 C  CE2   . PHE C 3  62  ? 37.51828 -1.71266  -37.31491 1.000 68.88781  ? 61   PHE A CE2   1 
ATOM   1302 C  CZ    . PHE C 3  62  ? 36.27839 -1.39385  -36.76846 1.000 68.04484  ? 61   PHE A CZ    1 
ATOM   1303 N  N     . ALA C 3  63  ? 39.47997 -5.99485  -36.84223 1.000 61.76797  ? 62   ALA A N     1 
ATOM   1304 C  CA    . ALA C 3  63  ? 40.66576 -5.74782  -36.02883 1.000 58.93097  ? 62   ALA A CA    1 
ATOM   1305 C  C     . ALA C 3  63  ? 41.63835 -4.87675  -36.81383 1.000 61.07478  ? 62   ALA A C     1 
ATOM   1306 O  O     . ALA C 3  63  ? 41.65165 -4.89057  -38.04794 1.000 63.73984  ? 62   ALA A O     1 
ATOM   1307 C  CB    . ALA C 3  63  ? 41.35025 -7.05238  -35.58229 1.000 54.01427  ? 62   ALA A CB    1 
ATOM   1308 N  N     . ILE C 3  64  ? 42.43561 -4.09621  -36.08139 1.000 58.56329  ? 63   ILE A N     1 
ATOM   1309 C  CA    . ILE C 3  64  ? 43.42414 -3.20373  -36.68093 1.000 60.12430  ? 63   ILE A CA    1 
ATOM   1310 C  C     . ILE C 3  64  ? 44.72945 -3.32059  -35.90431 1.000 62.13067  ? 63   ILE A C     1 
ATOM   1311 O  O     . ILE C 3  64  ? 44.78905 -3.90777  -34.82799 1.000 61.33786  ? 63   ILE A O     1 
ATOM   1312 C  CB    . ILE C 3  64  ? 42.95450 -1.73143  -36.71592 1.000 56.36894  ? 63   ILE A CB    1 
ATOM   1313 C  CG1   . ILE C 3  64  ? 43.04950 -1.11312  -35.31825 1.000 53.74254  ? 63   ILE A CG1   1 
ATOM   1314 C  CG2   . ILE C 3  64  ? 41.53583 -1.62124  -37.27710 1.000 52.73428  ? 63   ILE A CG2   1 
ATOM   1315 C  CD1   . ILE C 3  64  ? 42.37366 0.20760   -35.17995 1.000 48.20849  ? 63   ILE A CD1   1 
ATOM   1316 N  N     . LYS C 3  65  ? 45.78843 -2.74961  -36.46141 1.000 65.32966  ? 64   LYS A N     1 
ATOM   1317 C  CA    . LYS C 3  65  ? 47.04324 -2.73172  -35.72937 1.000 67.08403  ? 64   LYS A CA    1 
ATOM   1318 C  C     . LYS C 3  65  ? 46.99322 -1.71098  -34.59016 1.000 67.52776  ? 64   LYS A C     1 
ATOM   1319 O  O     . LYS C 3  65  ? 46.22860 -0.74272  -34.61654 1.000 67.03119  ? 64   LYS A O     1 
ATOM   1320 C  CB    . LYS C 3  65  ? 48.20373 -2.40323  -36.66427 1.000 71.73190  ? 64   LYS A CB    1 
ATOM   1321 C  CG    . LYS C 3  65  ? 49.32949 -3.41029  -36.62639 1.000 74.96838  ? 64   LYS A CG    1 
ATOM   1322 C  CD    . LYS C 3  65  ? 48.93671 -4.67188  -37.36446 1.000 75.03427  ? 64   LYS A CD    1 
ATOM   1323 C  CE    . LYS C 3  65  ? 50.05266 -5.68849  -37.32970 1.000 76.44602  ? 64   LYS A CE    1 
ATOM   1324 N  NZ    . LYS C 3  65  ? 49.67819 -6.92551  -38.06364 1.000 81.49394  ? 64   LYS A NZ    1 
ATOM   1325 N  N     . LYS C 3  66  ? 47.83068 -1.93702  -33.58307 1.000 67.72034  ? 65   LYS A N     1 
ATOM   1326 C  CA    . LYS C 3  66  ? 48.02042 -0.99357  -32.49200 1.000 66.81308  ? 65   LYS A CA    1 
ATOM   1327 C  C     . LYS C 3  66  ? 49.23232 -0.10322  -32.76540 1.000 67.70092  ? 65   LYS A C     1 
ATOM   1328 O  O     . LYS C 3  66  ? 49.97698 -0.30534  -33.73136 1.000 65.50193  ? 65   LYS A O     1 
ATOM   1329 C  CB    . LYS C 3  66  ? 48.19793 -1.72899  -31.15683 1.000 69.79103  ? 65   LYS A CB    1 
ATOM   1330 C  CG    . LYS C 3  66  ? 46.93759 -2.38875  -30.59158 1.000 68.69924  ? 65   LYS A CG    1 
ATOM   1331 C  CD    . LYS C 3  66  ? 47.18067 -2.90361  -29.17091 1.000 66.11192  ? 65   LYS A CD    1 
ATOM   1332 C  CE    . LYS C 3  66  ? 45.95968 -3.62040  -28.61560 1.000 63.34170  ? 65   LYS A CE    1 
ATOM   1333 N  NZ    . LYS C 3  66  ? 46.19565 -4.16577  -27.25136 1.000 61.65078  ? 65   LYS A NZ    1 
ATOM   1334 N  N     . LYS C 3  67  ? 49.40480 0.90822   -31.89685 1.000 67.68274  ? 66   LYS A N     1 
ATOM   1335 C  CA    . LYS C 3  67  ? 50.60364 1.74754   -31.90922 1.000 66.40125  ? 66   LYS A CA    1 
ATOM   1336 C  C     . LYS C 3  67  ? 51.86190 0.88703   -31.89139 1.000 73.47275  ? 66   LYS A C     1 
ATOM   1337 O  O     . LYS C 3  67  ? 52.76505 1.05518   -32.72029 1.000 75.98028  ? 66   LYS A O     1 
ATOM   1338 C  CB    . LYS C 3  67  ? 50.57794 2.69491   -30.70605 1.000 62.93342  ? 66   LYS A CB    1 
ATOM   1339 C  CG    . LYS C 3  67  ? 51.55670 3.86480   -30.75589 1.000 68.11787  ? 66   LYS A CG    1 
ATOM   1340 C  CD    . LYS C 3  67  ? 50.89625 5.11107   -31.35497 1.000 70.20883  ? 66   LYS A CD    1 
ATOM   1341 C  CE    . LYS C 3  67  ? 51.18995 6.37116   -30.53854 1.000 67.21330  ? 66   LYS A CE    1 
ATOM   1342 N  NZ    . LYS C 3  67  ? 50.59297 6.27867   -29.17207 1.000 63.01796  ? 66   LYS A NZ    1 
ATOM   1343 N  N     . ASP C 3  68  ? 51.92924 -0.05096  -30.95033 1.000 76.21856  ? 67   ASP A N     1 
ATOM   1344 C  CA    . ASP C 3  68  ? 52.88571 -1.14751  -31.02370 1.000 81.64749  ? 67   ASP A CA    1 
ATOM   1345 C  C     . ASP C 3  68  ? 52.44191 -2.03377  -32.17985 1.000 83.70647  ? 67   ASP A C     1 
ATOM   1346 O  O     . ASP C 3  68  ? 51.52743 -2.84627  -32.03527 1.000 83.44188  ? 67   ASP A O     1 
ATOM   1347 C  CB    . ASP C 3  68  ? 52.91680 -1.90822  -29.69965 1.000 85.25541  ? 67   ASP A CB    1 
ATOM   1348 C  CG    . ASP C 3  68  ? 53.85750 -3.11867  -29.72007 1.000 92.11474  ? 67   ASP A CG    1 
ATOM   1349 O  OD1   . ASP C 3  68  ? 54.62890 -3.28033  -30.68554 1.000 97.17246  ? 67   ASP A OD1   1 
ATOM   1350 O  OD2   . ASP C 3  68  ? 53.82964 -3.91620  -28.75880 1.000 92.66100  ? 67   ASP A OD2   1 
ATOM   1351 N  N     . SER C 3  69  ? 53.07867 -1.86622  -33.34617 1.000 86.16201  ? 68   SER A N     1 
ATOM   1352 C  CA    . SER C 3  69  ? 52.69403 -2.59920  -34.55333 1.000 80.75146  ? 68   SER A CA    1 
ATOM   1353 C  C     . SER C 3  69  ? 52.77301 -4.11387  -34.38322 1.000 82.55356  ? 68   SER A C     1 
ATOM   1354 O  O     . SER C 3  69  ? 52.28176 -4.84372  -35.25270 1.000 83.28724  ? 68   SER A O     1 
ATOM   1355 C  CB    . SER C 3  69  ? 53.57009 -2.16375  -35.73791 1.000 74.73221  ? 68   SER A CB    1 
ATOM   1356 N  N     . THR C 3  70  ? 53.36797 -4.60163  -33.29027 1.000 80.90686  ? 69   THR A N     1 
ATOM   1357 C  CA    . THR C 3  70  ? 53.46591 -6.03800  -33.05107 1.000 81.21529  ? 69   THR A CA    1 
ATOM   1358 C  C     . THR C 3  70  ? 52.14489 -6.65472  -32.59960 1.000 78.96225  ? 69   THR A C     1 
ATOM   1359 O  O     . THR C 3  70  ? 52.02439 -7.88594  -32.60492 1.000 79.24429  ? 69   THR A O     1 
ATOM   1360 C  CB    . THR C 3  70  ? 54.54745 -6.33040  -32.00557 1.000 79.63467  ? 69   THR A CB    1 
ATOM   1361 N  N     . LYS C 3  71  ? 51.15561 -5.84041  -32.21767 1.000 72.55429  ? 70   LYS A N     1 
ATOM   1362 C  CA    . LYS C 3  71  ? 49.92686 -6.32915  -31.60693 1.000 66.98326  ? 70   LYS A CA    1 
ATOM   1363 C  C     . LYS C 3  71  ? 48.69717 -5.91109  -32.41123 1.000 63.73180  ? 70   LYS A C     1 
ATOM   1364 O  O     . LYS C 3  71  ? 48.69144 -4.86916  -33.07410 1.000 65.19818  ? 70   LYS A O     1 
ATOM   1365 C  CB    . LYS C 3  71  ? 49.81002 -5.82028  -30.16145 1.000 65.89703  ? 70   LYS A CB    1 
ATOM   1366 C  CG    . LYS C 3  71  ? 51.04398 -6.10358  -29.29511 1.000 66.14516  ? 70   LYS A CG    1 
ATOM   1367 C  CD    . LYS C 3  71  ? 51.09534 -5.17605  -28.07717 1.000 62.97937  ? 70   LYS A CD    1 
ATOM   1368 C  CE    . LYS C 3  71  ? 50.07997 -5.55159  -27.00730 1.000 60.05061  ? 70   LYS A CE    1 
ATOM   1369 N  NZ    . LYS C 3  71  ? 50.49743 -6.79008  -26.29472 1.000 62.54017  ? 70   LYS A NZ    1 
ATOM   1370 N  N     . TRP C 3  72  ? 47.65478 -6.74379  -32.34809 1.000 61.44668  ? 71   TRP A N     1 
ATOM   1371 C  CA    . TRP C 3  72  ? 46.34777 -6.47089  -32.93487 1.000 61.96841  ? 71   TRP A CA    1 
ATOM   1372 C  C     . TRP C 3  72  ? 45.37646 -5.92003  -31.88935 1.000 60.06150  ? 71   TRP A C     1 
ATOM   1373 O  O     . TRP C 3  72  ? 45.54553 -6.10548  -30.67916 1.000 64.23089  ? 71   TRP A O     1 
ATOM   1374 C  CB    . TRP C 3  72  ? 45.74789 -7.73601  -33.55992 1.000 67.22900  ? 71   TRP A CB    1 
ATOM   1375 C  CG    . TRP C 3  72  ? 46.31312 -8.11109  -34.90206 1.000 74.74311  ? 71   TRP A CG    1 
ATOM   1376 C  CD1   . TRP C 3  72  ? 47.29246 -9.02458  -35.14876 1.000 75.73249  ? 71   TRP A CD1   1 
ATOM   1377 C  CD2   . TRP C 3  72  ? 45.91834 -7.59167  -36.18430 1.000 81.06620  ? 71   TRP A CD2   1 
ATOM   1378 N  NE1   . TRP C 3  72  ? 47.53695 -9.10664  -36.49793 1.000 79.84358  ? 71   TRP A NE1   1 
ATOM   1379 C  CE2   . TRP C 3  72  ? 46.70778 -8.23756  -37.15679 1.000 81.90792  ? 71   TRP A CE2   1 
ATOM   1380 C  CE3   . TRP C 3  72  ? 44.97576 -6.64361  -36.60222 1.000 82.95479  ? 71   TRP A CE3   1 
ATOM   1381 C  CZ2   . TRP C 3  72  ? 46.58791 -7.96564  -38.52084 1.000 84.27269  ? 71   TRP A CZ2   1 
ATOM   1382 C  CZ3   . TRP C 3  72  ? 44.85726 -6.37574  -37.96098 1.000 84.94311  ? 71   TRP A CZ3   1 
ATOM   1383 C  CH2   . TRP C 3  72  ? 45.65968 -7.03601  -38.90180 1.000 85.33302  ? 71   TRP A CH2   1 
ATOM   1384 N  N     . ARG C 3  73  ? 44.34003 -5.24160  -32.37974 1.000 52.43515  ? 72   ARG A N     1 
ATOM   1385 C  CA    . ARG C 3  73  ? 43.27311 -4.70238  -31.54937 1.000 43.92077  ? 72   ARG A CA    1 
ATOM   1386 C  C     . ARG C 3  73  ? 41.94737 -5.14470  -32.14199 1.000 45.52388  ? 72   ARG A C     1 
ATOM   1387 O  O     . ARG C 3  73  ? 41.66922 -4.87145  -33.31677 1.000 47.19674  ? 72   ARG A O     1 
ATOM   1388 C  CB    . ARG C 3  73  ? 43.32899 -3.17252  -31.46927 1.000 44.88037  ? 72   ARG A CB    1 
ATOM   1389 C  CG    . ARG C 3  73  ? 42.22126 -2.57586  -30.61884 1.000 40.91043  ? 72   ARG A CG    1 
ATOM   1390 C  CD    . ARG C 3  73  ? 42.19898 -1.04507  -30.68511 1.000 49.35100  ? 72   ARG A CD    1 
ATOM   1391 N  NE    . ARG C 3  73  ? 43.46691 -0.42166  -30.31825 1.000 47.59465  ? 72   ARG A NE    1 
ATOM   1392 C  CZ    . ARG C 3  73  ? 43.88877 -0.22996  -29.06975 1.000 44.73033  ? 72   ARG A CZ    1 
ATOM   1393 N  NH1   . ARG C 3  73  ? 45.06418 0.34806   -28.85522 1.000 41.75553  ? 72   ARG A NH1   1 
ATOM   1394 N  NH2   . ARG C 3  73  ? 43.15172 -0.62977  -28.03834 1.000 43.72790  ? 72   ARG A NH2   1 
ATOM   1395 N  N     . LYS C 3  74  ? 41.14144 -5.82158  -31.32984 1.000 43.26261  ? 73   LYS A N     1 
ATOM   1396 C  CA    . LYS C 3  74  ? 39.80484 -6.24176  -31.71955 1.000 46.81069  ? 73   LYS A CA    1 
ATOM   1397 C  C     . LYS C 3  74  ? 38.83521 -5.07532  -31.55357 1.000 46.52320  ? 73   LYS A C     1 
ATOM   1398 O  O     . LYS C 3  74  ? 38.80330 -4.42670  -30.50357 1.000 50.62518  ? 73   LYS A O     1 
ATOM   1399 C  CB    . LYS C 3  74  ? 39.37953 -7.45165  -30.87248 1.000 44.45125  ? 73   LYS A CB    1 
ATOM   1400 C  CG    . LYS C 3  74  ? 37.93822 -7.92200  -31.03943 1.000 44.43331  ? 73   LYS A CG    1 
ATOM   1401 C  CD    . LYS C 3  74  ? 37.79042 -9.32525  -30.44547 1.000 59.99960  ? 73   LYS A CD    1 
ATOM   1402 C  CE    . LYS C 3  74  ? 36.37617 -9.90545  -30.56638 1.000 55.30495  ? 73   LYS A CE    1 
ATOM   1403 N  NZ    . LYS C 3  74  ? 35.37559 -9.00810  -31.20431 1.000 52.78043  ? 73   LYS A NZ    1 
ATOM   1404 N  N     . LEU C 3  75  ? 38.05407 -4.80367  -32.59427 1.000 48.84307  ? 74   LEU A N     1 
ATOM   1405 C  CA    . LEU C 3  75  ? 37.07119 -3.73182  -32.61907 1.000 51.01836  ? 74   LEU A CA    1 
ATOM   1406 C  C     . LEU C 3  75  ? 35.72754 -4.28274  -33.08324 1.000 57.52111  ? 74   LEU A C     1 
ATOM   1407 O  O     . LEU C 3  75  ? 35.64811 -5.29019  -33.79676 1.000 59.58009  ? 74   LEU A O     1 
ATOM   1408 C  CB    . LEU C 3  75  ? 37.49007 -2.59283  -33.56214 1.000 52.09747  ? 74   LEU A CB    1 
ATOM   1409 C  CG    . LEU C 3  75  ? 38.83004 -1.88795  -33.35142 1.000 48.18821  ? 74   LEU A CG    1 
ATOM   1410 C  CD1   . LEU C 3  75  ? 38.99139 -0.72292  -34.34392 1.000 45.39886  ? 74   LEU A CD1   1 
ATOM   1411 C  CD2   . LEU C 3  75  ? 38.92653 -1.40257  -31.93703 1.000 43.42157  ? 74   LEU A CD2   1 
ATOM   1412 N  N     . VAL C 3  76  ? 34.66585 -3.58935  -32.68555 1.000 56.68286  ? 75   VAL A N     1 
ATOM   1413 C  CA    . VAL C 3  76  ? 33.30203 -3.94347  -33.05162 1.000 53.01945  ? 75   VAL A CA    1 
ATOM   1414 C  C     . VAL C 3  76  ? 32.62067 -2.68741  -33.57058 1.000 55.78842  ? 75   VAL A C     1 
ATOM   1415 O  O     . VAL C 3  76  ? 32.72158 -1.62320  -32.94650 1.000 62.47923  ? 75   VAL A O     1 
ATOM   1416 C  CB    . VAL C 3  76  ? 32.52339 -4.52039  -31.85288 1.000 50.90678  ? 75   VAL A CB    1 
ATOM   1417 C  CG1   . VAL C 3  76  ? 31.15459 -4.99353  -32.29047 1.000 53.94591  ? 75   VAL A CG1   1 
ATOM   1418 C  CG2   . VAL C 3  76  ? 33.31516 -5.63297  -31.16513 1.000 44.41661  ? 75   VAL A CG2   1 
ATOM   1419 N  N     . ASP C 3  77  ? 31.93671 -2.80237  -34.71025 1.000 53.35821  ? 76   ASP A N     1 
ATOM   1420 C  CA    . ASP C 3  77  ? 31.16717 -1.68269  -35.24790 1.000 53.83288  ? 76   ASP A CA    1 
ATOM   1421 C  C     . ASP C 3  77  ? 29.80922 -1.66950  -34.55718 1.000 56.32604  ? 76   ASP A C     1 
ATOM   1422 O  O     . ASP C 3  77  ? 28.78132 -2.07814  -35.10954 1.000 58.45659  ? 76   ASP A O     1 
ATOM   1423 C  CB    . ASP C 3  77  ? 31.01965 -1.77599  -36.75909 1.000 59.60845  ? 76   ASP A CB    1 
ATOM   1424 C  CG    . ASP C 3  77  ? 30.32188 -0.55057  -37.35197 1.000 64.14746  ? 76   ASP A CG    1 
ATOM   1425 O  OD1   . ASP C 3  77  ? 30.07152 0.42382   -36.59264 1.000 56.25478  ? 76   ASP A OD1   1 
ATOM   1426 O  OD2   . ASP C 3  77  ? 30.02619 -0.56368  -38.57422 1.000 70.71667  ? 76   ASP A OD2   1 
ATOM   1427 N  N     . PHE C 3  78  ? 29.81649 -1.15326  -33.32687 1.000 48.91104  ? 77   PHE A N     1 
ATOM   1428 C  CA    . PHE C 3  78  ? 28.64718 -1.08535  -32.46276 1.000 50.09840  ? 77   PHE A CA    1 
ATOM   1429 C  C     . PHE C 3  78  ? 27.77461 0.12293   -32.74814 1.000 50.45410  ? 77   PHE A C     1 
ATOM   1430 O  O     . PHE C 3  78  ? 27.00683 0.53359   -31.87235 1.000 50.68651  ? 77   PHE A O     1 
ATOM   1431 C  CB    . PHE C 3  78  ? 29.07811 -1.06740  -30.99132 1.000 48.51373  ? 77   PHE A CB    1 
ATOM   1432 C  CG    . PHE C 3  78  ? 29.24142 -2.43246  -30.37888 1.000 51.37593  ? 77   PHE A CG    1 
ATOM   1433 C  CD1   . PHE C 3  78  ? 28.28260 -3.41239  -30.55920 1.000 47.65897  ? 77   PHE A CD1   1 
ATOM   1434 C  CD2   . PHE C 3  78  ? 30.35228 -2.72679  -29.60304 1.000 51.17559  ? 77   PHE A CD2   1 
ATOM   1435 C  CE1   . PHE C 3  78  ? 28.42912 -4.66279  -29.97607 1.000 48.45773  ? 77   PHE A CE1   1 
ATOM   1436 C  CE2   . PHE C 3  78  ? 30.50495 -3.98566  -29.02201 1.000 51.75081  ? 77   PHE A CE2   1 
ATOM   1437 C  CZ    . PHE C 3  78  ? 29.54439 -4.95520  -29.21743 1.000 48.91209  ? 77   PHE A CZ    1 
ATOM   1438 N  N     . ARG C 3  79  ? 27.88189 0.70522   -33.94062 1.000 52.44851  ? 78   ARG A N     1 
ATOM   1439 C  CA    . ARG C 3  79  ? 27.15876 1.93874   -34.22244 1.000 54.16913  ? 78   ARG A CA    1 
ATOM   1440 C  C     . ARG C 3  79  ? 25.66783 1.77816   -33.97565 1.000 56.25247  ? 78   ARG A C     1 
ATOM   1441 O  O     . ARG C 3  79  ? 25.02438 2.68918   -33.44486 1.000 59.60828  ? 78   ARG A O     1 
ATOM   1442 C  CB    . ARG C 3  79  ? 27.43388 2.39753   -35.65246 1.000 56.87688  ? 78   ARG A CB    1 
ATOM   1443 C  CG    . ARG C 3  79  ? 28.58252 3.40353   -35.73511 1.000 57.67737  ? 78   ARG A CG    1 
ATOM   1444 C  CD    . ARG C 3  79  ? 28.93444 3.76200   -37.17020 1.000 61.87559  ? 78   ARG A CD    1 
ATOM   1445 N  NE    . ARG C 3  79  ? 29.49564 2.62361   -37.89438 1.000 66.27485  ? 78   ARG A NE    1 
ATOM   1446 C  CZ    . ARG C 3  79  ? 29.82118 2.63854   -39.18327 1.000 69.23225  ? 78   ARG A CZ    1 
ATOM   1447 N  NH1   . ARG C 3  79  ? 29.64165 3.74306   -39.89912 1.000 72.39619  ? 78   ARG A NH1   1 
ATOM   1448 N  NH2   . ARG C 3  79  ? 30.31892 1.54640   -39.75700 1.000 68.34408  ? 78   ARG A NH2   1 
ATOM   1449 N  N     . GLU C 3  80  ? 25.10673 0.61480   -34.30932 1.000 58.02043  ? 79   GLU A N     1 
ATOM   1450 C  CA    . GLU C 3  80  ? 23.67477 0.41565   -34.11881 1.000 60.59218  ? 79   GLU A CA    1 
ATOM   1451 C  C     . GLU C 3  80  ? 23.33157 0.25714   -32.64043 1.000 58.56645  ? 79   GLU A C     1 
ATOM   1452 O  O     . GLU C 3  80  ? 22.43024 0.93151   -32.11788 1.000 59.61042  ? 79   GLU A O     1 
ATOM   1453 C  CB    . GLU C 3  80  ? 23.21279 -0.79316  -34.92678 1.000 67.47759  ? 79   GLU A CB    1 
ATOM   1454 C  CG    . GLU C 3  80  ? 21.72132 -0.96840  -34.92718 1.000 74.67570  ? 79   GLU A CG    1 
ATOM   1455 C  CD    . GLU C 3  80  ? 21.00143 0.25259   -35.46542 1.000 78.45505  ? 79   GLU A CD    1 
ATOM   1456 O  OE1   . GLU C 3  80  ? 21.54560 0.90478   -36.38627 1.000 80.85093  ? 79   GLU A OE1   1 
ATOM   1457 O  OE2   . GLU C 3  80  ? 19.89635 0.55856   -34.96399 1.000 77.81521  ? 79   GLU A OE2   1 
ATOM   1458 N  N     . LEU C 3  81  ? 24.04303 -0.62823  -31.94352 1.000 45.16673  ? 80   LEU A N     1 
ATOM   1459 C  CA    . LEU C 3  81  ? 23.86025 -0.72230  -30.49818 1.000 49.19818  ? 80   LEU A CA    1 
ATOM   1460 C  C     . LEU C 3  81  ? 24.13905 0.61610   -29.81788 1.000 51.00751  ? 80   LEU A C     1 
ATOM   1461 O  O     . LEU C 3  81  ? 23.43372 0.99252   -28.87288 1.000 54.40476  ? 80   LEU A O     1 
ATOM   1462 C  CB    . LEU C 3  81  ? 24.75001 -1.81903  -29.91117 1.000 45.44272  ? 80   LEU A CB    1 
ATOM   1463 C  CG    . LEU C 3  81  ? 24.82352 -1.82394  -28.38051 1.000 44.48132  ? 80   LEU A CG    1 
ATOM   1464 C  CD1   . LEU C 3  81  ? 23.47411 -2.20396  -27.75349 1.000 43.28473  ? 80   LEU A CD1   1 
ATOM   1465 C  CD2   . LEU C 3  81  ? 25.95100 -2.73217  -27.86770 1.000 44.45344  ? 80   LEU A CD2   1 
ATOM   1466 N  N     . ASN C 3  82  ? 25.15275 1.35688   -30.29036 1.000 48.85976  ? 81   ASN A N     1 
ATOM   1467 C  CA    . ASN C 3  82  ? 25.42965 2.68159   -29.72272 1.000 49.84196  ? 81   ASN A CA    1 
ATOM   1468 C  C     . ASN C 3  82  ? 24.24069 3.62374   -29.88733 1.000 50.83748  ? 81   ASN A C     1 
ATOM   1469 O  O     . ASN C 3  82  ? 23.89126 4.35485   -28.95293 1.000 50.51249  ? 81   ASN A O     1 
ATOM   1470 C  CB    . ASN C 3  82  ? 26.67379 3.30040   -30.35795 1.000 50.13061  ? 81   ASN A CB    1 
ATOM   1471 C  CG    . ASN C 3  82  ? 27.95380 2.59307   -29.95068 1.000 53.54213  ? 81   ASN A CG    1 
ATOM   1472 O  OD1   . ASN C 3  82  ? 28.03835 2.00146   -28.86708 1.000 57.92973  ? 81   ASN A OD1   1 
ATOM   1473 N  ND2   . ASN C 3  82  ? 28.96189 2.65113   -30.81915 1.000 47.76005  ? 81   ASN A ND2   1 
ATOM   1474 N  N     . LYS C 3  83  ? 23.61684 3.62948   -31.07170 1.000 50.72790  ? 82   LYS A N     1 
ATOM   1475 C  CA    . LYS C 3  83  ? 22.38363 4.38761   -31.26216 1.000 52.66299  ? 82   LYS A CA    1 
ATOM   1476 C  C     . LYS C 3  83  ? 21.35233 4.01359   -30.21328 1.000 55.17740  ? 82   LYS A C     1 
ATOM   1477 O  O     . LYS C 3  83  ? 20.71427 4.88736   -29.61605 1.000 54.67202  ? 82   LYS A O     1 
ATOM   1478 C  CB    . LYS C 3  83  ? 21.80063 4.15006   -32.65974 1.000 56.15782  ? 82   LYS A CB    1 
ATOM   1479 C  CG    . LYS C 3  83  ? 22.51330 4.83661   -33.80502 1.000 60.67405  ? 82   LYS A CG    1 
ATOM   1480 C  CD    . LYS C 3  83  ? 21.73054 4.68515   -35.10915 1.000 65.13161  ? 82   LYS A CD    1 
ATOM   1481 C  CE    . LYS C 3  83  ? 22.58448 5.02900   -36.32782 1.000 66.68632  ? 82   LYS A CE    1 
ATOM   1482 N  NZ    . LYS C 3  83  ? 23.17525 3.79898   -36.95164 1.000 70.30156  ? 82   LYS A NZ    1 
ATOM   1483 N  N     . ARG C 3  84  ? 21.17250 2.71161   -29.97670 1.000 59.66157  ? 83   ARG A N     1 
ATOM   1484 C  CA    . ARG C 3  84  ? 20.07934 2.25688   -29.12257 1.000 64.30324  ? 83   ARG A CA    1 
ATOM   1485 C  C     . ARG C 3  84  ? 20.41914 2.25254   -27.63147 1.000 63.06894  ? 83   ARG A C     1 
ATOM   1486 O  O     . ARG C 3  84  ? 19.55657 1.88484   -26.82164 1.000 62.42055  ? 83   ARG A O     1 
ATOM   1487 C  CB    . ARG C 3  84  ? 19.62569 0.85759   -29.55237 1.000 70.61263  ? 83   ARG A CB    1 
ATOM   1488 C  CG    . ARG C 3  84  ? 19.47766 0.68714   -31.05679 1.000 77.31254  ? 83   ARG A CG    1 
ATOM   1489 C  CD    . ARG C 3  84  ? 18.11143 0.16482   -31.41818 1.000 87.02261  ? 83   ARG A CD    1 
ATOM   1490 N  NE    . ARG C 3  84  ? 18.04360 -0.30839  -32.79847 1.000 96.27749  ? 83   ARG A NE    1 
ATOM   1491 C  CZ    . ARG C 3  84  ? 18.33259 -1.55183  -33.17061 1.000 101.21032 ? 83   ARG A CZ    1 
ATOM   1492 N  NH1   . ARG C 3  84  ? 18.24016 -1.91133  -34.44508 1.000 103.05332 ? 83   ARG A NH1   1 
ATOM   1493 N  NH2   . ARG C 3  84  ? 18.72262 -2.43678  -32.26368 1.000 101.91327 ? 83   ARG A NH2   1 
ATOM   1494 N  N     . THR C 3  85  ? 21.63049 2.66431   -27.24504 1.000 60.92241  ? 84   THR A N     1 
ATOM   1495 C  CA    . THR C 3  85  ? 22.06090 2.63846   -25.84742 1.000 56.87359  ? 84   THR A CA    1 
ATOM   1496 C  C     . THR C 3  85  ? 21.72395 3.95050   -25.14636 1.000 55.21189  ? 84   THR A C     1 
ATOM   1497 O  O     . THR C 3  85  ? 21.76037 5.02585   -25.75197 1.000 55.45914  ? 84   THR A O     1 
ATOM   1498 C  CB    . THR C 3  85  ? 23.56671 2.36299   -25.75166 1.000 50.86676  ? 84   THR A CB    1 
ATOM   1499 O  OG1   . THR C 3  85  ? 23.83205 1.07101   -26.29815 1.000 53.07933  ? 84   THR A OG1   1 
ATOM   1500 C  CG2   . THR C 3  85  ? 24.06844 2.38266   -24.30533 1.000 46.26697  ? 84   THR A CG2   1 
ATOM   1501 N  N     . GLN C 3  86  ? 21.39953 3.84410   -23.85072 1.000 52.94976  ? 85   GLN A N     1 
ATOM   1502 C  CA    . GLN C 3  86  ? 21.12886 4.98576   -22.97615 1.000 50.97329  ? 85   GLN A CA    1 
ATOM   1503 C  C     . GLN C 3  86  ? 22.21676 6.06217   -23.03242 1.000 49.63481  ? 85   GLN A C     1 
ATOM   1504 O  O     . GLN C 3  86  ? 23.35622 5.80736   -23.44017 1.000 50.08568  ? 85   GLN A O     1 
ATOM   1505 C  CB    . GLN C 3  86  ? 20.99892 4.52145   -21.52451 1.000 42.41328  ? 85   GLN A CB    1 
ATOM   1506 C  CG    . GLN C 3  86  ? 22.34913 4.14305   -20.97411 1.000 41.95171  ? 85   GLN A CG    1 
ATOM   1507 C  CD    . GLN C 3  86  ? 22.40769 4.10659   -19.47698 1.000 43.01294  ? 85   GLN A CD    1 
ATOM   1508 O  OE1   . GLN C 3  86  ? 22.11218 3.07235   -18.86024 1.000 46.07839  ? 85   GLN A OE1   1 
ATOM   1509 N  NE2   . GLN C 3  86  ? 22.81630 5.23014   -18.86724 1.000 35.65418  ? 85   GLN A NE2   1 
ATOM   1510 N  N     . ASP C 3  87  ? 21.88315 7.26995   -22.61002 1.000 48.86014  ? 86   ASP A N     1 
ATOM   1511 C  CA    . ASP C 3  87  ? 22.89761 8.30769   -22.59053 1.000 51.93626  ? 86   ASP A CA    1 
ATOM   1512 C  C     . ASP C 3  87  ? 23.76904 8.18144   -21.35117 1.000 49.21688  ? 86   ASP A C     1 
ATOM   1513 O  O     . ASP C 3  87  ? 23.38184 7.60199   -20.33397 1.000 48.05153  ? 86   ASP A O     1 
ATOM   1514 C  CB    . ASP C 3  87  ? 22.26609 9.69858   -22.64032 1.000 52.93072  ? 86   ASP A CB    1 
ATOM   1515 C  CG    . ASP C 3  87  ? 21.71714 10.02776  -24.00551 1.000 59.82053  ? 86   ASP A CG    1 
ATOM   1516 O  OD1   . ASP C 3  87  ? 22.37470 9.64187   -25.00020 1.000 61.43668  ? 86   ASP A OD1   1 
ATOM   1517 O  OD2   . ASP C 3  87  ? 20.63742 10.65841  -24.08553 1.000 62.36509  ? 86   ASP A OD2   1 
ATOM   1518 N  N     . PHE C 3  88  ? 24.96370 8.73840   -21.45655 1.000 49.05796  ? 87   PHE A N     1 
ATOM   1519 C  CA    . PHE C 3  88  ? 25.89803 8.82239   -20.35172 1.000 46.31371  ? 87   PHE A CA    1 
ATOM   1520 C  C     . PHE C 3  88  ? 26.27399 10.27952  -20.13941 1.000 45.22119  ? 87   PHE A C     1 
ATOM   1521 O  O     . PHE C 3  88  ? 26.16619 11.10724  -21.04896 1.000 47.70479  ? 87   PHE A O     1 
ATOM   1522 C  CB    . PHE C 3  88  ? 27.15720 7.98220   -20.62522 1.000 41.86969  ? 87   PHE A CB    1 
ATOM   1523 C  CG    . PHE C 3  88  ? 26.87369 6.51846   -20.79175 1.000 44.84812  ? 87   PHE A CG    1 
ATOM   1524 C  CD1   . PHE C 3  88  ? 26.54366 5.99956   -22.03784 1.000 46.76056  ? 87   PHE A CD1   1 
ATOM   1525 C  CD2   . PHE C 3  88  ? 26.91414 5.66350   -19.70256 1.000 40.47950  ? 87   PHE A CD2   1 
ATOM   1526 C  CE1   . PHE C 3  88  ? 26.26514 4.66465   -22.19308 1.000 45.71655  ? 87   PHE A CE1   1 
ATOM   1527 C  CE2   . PHE C 3  88  ? 26.63470 4.32203   -19.85551 1.000 44.00203  ? 87   PHE A CE2   1 
ATOM   1528 C  CZ    . PHE C 3  88  ? 26.31289 3.82024   -21.09457 1.000 45.52664  ? 87   PHE A CZ    1 
ATOM   1529 N  N     . TRP C 3  89  ? 26.70132 10.59248  -18.92401 1.000 40.72919  ? 88   TRP A N     1 
ATOM   1530 C  CA    . TRP C 3  89  ? 27.43849 11.81644  -18.66659 1.000 38.34620  ? 88   TRP A CA    1 
ATOM   1531 C  C     . TRP C 3  89  ? 28.91691 11.46378  -18.72195 1.000 35.19297  ? 88   TRP A C     1 
ATOM   1532 O  O     . TRP C 3  89  ? 29.40270 10.68872  -17.89932 1.000 37.31738  ? 88   TRP A O     1 
ATOM   1533 C  CB    . TRP C 3  89  ? 27.07024 12.44219  -17.32581 1.000 39.81483  ? 88   TRP A CB    1 
ATOM   1534 C  CG    . TRP C 3  89  ? 27.62801 13.83030  -17.22956 1.000 37.75623  ? 88   TRP A CG    1 
ATOM   1535 C  CD1   . TRP C 3  89  ? 28.76549 14.21624  -16.58325 1.000 34.54505  ? 88   TRP A CD1   1 
ATOM   1536 C  CD2   . TRP C 3  89  ? 27.10735 15.00266  -17.86280 1.000 39.31066  ? 88   TRP A CD2   1 
ATOM   1537 N  NE1   . TRP C 3  89  ? 28.97084 15.55599  -16.74999 1.000 36.39601  ? 88   TRP A NE1   1 
ATOM   1538 C  CE2   . TRP C 3  89  ? 27.97345 16.06826  -17.53852 1.000 39.28691  ? 88   TRP A CE2   1 
ATOM   1539 C  CE3   . TRP C 3  89  ? 25.98315 15.25953  -18.66319 1.000 37.47367  ? 88   TRP A CE3   1 
ATOM   1540 C  CZ2   . TRP C 3  89  ? 27.74754 17.38436  -17.98180 1.000 36.42427  ? 88   TRP A CZ2   1 
ATOM   1541 C  CZ3   . TRP C 3  89  ? 25.75573 16.55624  -19.10071 1.000 33.41098  ? 88   TRP A CZ3   1 
ATOM   1542 C  CH2   . TRP C 3  89  ? 26.63813 17.60540  -18.75813 1.000 34.61568  ? 88   TRP A CH2   1 
ATOM   1543 N  N     . GLU C 3  90  ? 29.62204 12.00739  -19.70620 1.000 37.66015  ? 89   GLU A N     1 
ATOM   1544 C  CA    . GLU C 3  90  ? 31.04375 11.73017  -19.83791 1.000 35.43668  ? 89   GLU A CA    1 
ATOM   1545 C  C     . GLU C 3  90  ? 31.78602 12.36321  -18.67172 1.000 41.11528  ? 89   GLU A C     1 
ATOM   1546 O  O     . GLU C 3  90  ? 31.39540 13.42913  -18.18649 1.000 43.32990  ? 89   GLU A O     1 
ATOM   1547 C  CB    . GLU C 3  90  ? 31.56798 12.26216  -21.17508 1.000 27.03986  ? 89   GLU A CB    1 
ATOM   1548 C  CG    . GLU C 3  90  ? 30.85919 11.68824  -22.40792 1.000 31.34268  ? 89   GLU A CG    1 
ATOM   1549 C  CD    . GLU C 3  90  ? 30.99735 10.14567  -22.59047 1.000 40.64508  ? 89   GLU A CD    1 
ATOM   1550 O  OE1   . GLU C 3  90  ? 32.09750 9.56746   -22.35589 1.000 37.96645  ? 89   GLU A OE1   1 
ATOM   1551 O  OE2   . GLU C 3  90  ? 29.98575 9.51604   -23.00190 1.000 43.00014  ? 89   GLU A OE2   1 
ATOM   1552 N  N     . VAL C 3  91  ? 32.83524 11.69114  -18.18477 1.000 37.73706  ? 90   VAL A N     1 
ATOM   1553 C  CA    . VAL C 3  91  ? 33.58820 12.21555  -17.04902 1.000 35.93193  ? 90   VAL A CA    1 
ATOM   1554 C  C     . VAL C 3  91  ? 34.95872 12.74357  -17.42571 1.000 32.43710  ? 90   VAL A C     1 
ATOM   1555 O  O     . VAL C 3  91  ? 35.59111 13.40536  -16.58160 1.000 30.37522  ? 90   VAL A O     1 
ATOM   1556 C  CB    . VAL C 3  91  ? 33.71769 11.18242  -15.91309 1.000 33.71962  ? 90   VAL A CB    1 
ATOM   1557 C  CG1   . VAL C 3  91  ? 32.36892 10.97549  -15.29944 1.000 28.66552  ? 90   VAL A CG1   1 
ATOM   1558 C  CG2   . VAL C 3  91  ? 34.29848 9.86709   -16.43331 1.000 34.52031  ? 90   VAL A CG2   1 
ATOM   1559 N  N     . GLN C 3  92  ? 35.43917 12.49419  -18.65344 1.000 26.32786  ? 91   GLN A N     1 
ATOM   1560 C  CA    . GLN C 3  92  ? 36.64344 13.15284  -19.17124 1.000 24.24753  ? 91   GLN A CA    1 
ATOM   1561 C  C     . GLN C 3  92  ? 36.29481 14.59448  -19.53924 1.000 29.62334  ? 91   GLN A C     1 
ATOM   1562 O  O     . GLN C 3  92  ? 35.63828 14.84371  -20.55526 1.000 30.79192  ? 91   GLN A O     1 
ATOM   1563 C  CB    . GLN C 3  92  ? 37.20273 12.40794  -20.38139 1.000 22.63584  ? 91   GLN A CB    1 
ATOM   1564 C  CG    . GLN C 3  92  ? 38.64161 12.79883  -20.72751 1.000 23.24630  ? 91   GLN A CG    1 
ATOM   1565 C  CD    . GLN C 3  92  ? 39.62233 12.39992  -19.61378 1.000 36.01372  ? 91   GLN A CD    1 
ATOM   1566 O  OE1   . GLN C 3  92  ? 39.51565 11.31087  -19.02340 1.000 40.18145  ? 91   GLN A OE1   1 
ATOM   1567 N  NE2   . GLN C 3  92  ? 40.56885 13.28469  -19.31689 1.000 35.28779  ? 91   GLN A NE2   1 
ATOM   1568 N  N     . LEU C 3  93  ? 36.73269 15.54557  -18.71719 1.000 33.42516  ? 92   LEU A N     1 
ATOM   1569 C  CA    . LEU C 3  93  ? 36.34812 16.94570  -18.87888 1.000 34.98796  ? 92   LEU A CA    1 
ATOM   1570 C  C     . LEU C 3  93  ? 37.30857 17.73352  -19.76499 1.000 36.49395  ? 92   LEU A C     1 
ATOM   1571 O  O     . LEU C 3  93  ? 36.95441 18.82070  -20.24272 1.000 39.25259  ? 92   LEU A O     1 
ATOM   1572 C  CB    . LEU C 3  93  ? 36.24370 17.62121  -17.50184 1.000 31.42464  ? 92   LEU A CB    1 
ATOM   1573 C  CG    . LEU C 3  93  ? 35.34238 16.91433  -16.47757 1.000 34.00362  ? 92   LEU A CG    1 
ATOM   1574 C  CD1   . LEU C 3  93  ? 34.97555 17.85004  -15.30202 1.000 26.44779  ? 92   LEU A CD1   1 
ATOM   1575 C  CD2   . LEU C 3  93  ? 34.09519 16.34813  -17.14162 1.000 23.05746  ? 92   LEU A CD2   1 
ATOM   1576 N  N     . GLY C 3  94  ? 38.50593 17.21405  -19.98690 1.000 32.19337  ? 93   GLY A N     1 
ATOM   1577 C  CA    . GLY C 3  94  ? 39.46977 17.88080  -20.83420 1.000 31.10205  ? 93   GLY A CA    1 
ATOM   1578 C  C     . GLY C 3  94  ? 40.71551 17.02960  -20.95128 1.000 35.60416  ? 93   GLY A C     1 
ATOM   1579 O  O     . GLY C 3  94  ? 40.76227 15.88498  -20.48388 1.000 36.26821  ? 93   GLY A O     1 
ATOM   1580 N  N     . ILE C 3  95  ? 41.73038 17.61062  -21.57461 1.000 35.24582  ? 94   ILE A N     1 
ATOM   1581 C  CA    . ILE C 3  95  ? 42.98388 16.93297  -21.88803 1.000 28.82255  ? 94   ILE A CA    1 
ATOM   1582 C  C     . ILE C 3  95  ? 44.06737 17.54686  -21.00900 1.000 32.57375  ? 94   ILE A C     1 
ATOM   1583 O  O     . ILE C 3  95  ? 44.25294 18.77281  -21.02959 1.000 32.76916  ? 94   ILE A O     1 
ATOM   1584 C  CB    . ILE C 3  95  ? 43.33341 17.07289  -23.38023 1.000 29.71660  ? 94   ILE A CB    1 
ATOM   1585 C  CG1   . ILE C 3  95  ? 42.16492 16.59342  -24.26593 1.000 31.43212  ? 94   ILE A CG1   1 
ATOM   1586 C  CG2   . ILE C 3  95  ? 44.63954 16.38192  -23.70182 1.000 25.51497  ? 94   ILE A CG2   1 
ATOM   1587 C  CD1   . ILE C 3  95  ? 41.46448 15.27449  -23.78227 1.000 24.22970  ? 94   ILE A CD1   1 
ATOM   1588 N  N     . PRO C 3  96  ? 44.78057 16.76014  -20.21125 1.000 29.16596  ? 95   PRO A N     1 
ATOM   1589 C  CA    . PRO C 3  96  ? 45.84901 17.33759  -19.39095 1.000 26.60204  ? 95   PRO A CA    1 
ATOM   1590 C  C     . PRO C 3  96  ? 46.96413 17.86398  -20.27277 1.000 29.11385  ? 95   PRO A C     1 
ATOM   1591 O  O     . PRO C 3  96  ? 47.18326 17.37999  -21.38283 1.000 30.37052  ? 95   PRO A O     1 
ATOM   1592 C  CB    . PRO C 3  96  ? 46.31585 16.16380  -18.51956 1.000 23.51026  ? 95   PRO A CB    1 
ATOM   1593 C  CG    . PRO C 3  96  ? 45.84439 14.94952  -19.21674 1.000 21.12900  ? 95   PRO A CG    1 
ATOM   1594 C  CD    . PRO C 3  96  ? 44.62457 15.31337  -20.00243 1.000 23.27376  ? 95   PRO A CD    1 
ATOM   1595 N  N     . HIS C 3  97  ? 47.64837 18.89790  -19.78629 1.000 31.00097  ? 96   HIS A N     1 
ATOM   1596 C  CA    . HIS C 3  97  ? 48.64460 19.56727  -20.60991 1.000 28.97033  ? 96   HIS A CA    1 
ATOM   1597 C  C     . HIS C 3  97  ? 49.96789 19.66059  -19.86189 1.000 29.90908  ? 96   HIS A C     1 
ATOM   1598 O  O     . HIS C 3  97  ? 49.97795 19.97472  -18.66589 1.000 30.96160  ? 96   HIS A O     1 
ATOM   1599 C  CB    . HIS C 3  97  ? 48.17185 20.97129  -21.00403 1.000 30.27640  ? 96   HIS A CB    1 
ATOM   1600 C  CG    . HIS C 3  97  ? 49.02094 21.60983  -22.05360 1.000 29.41935  ? 96   HIS A CG    1 
ATOM   1601 N  ND1   . HIS C 3  97  ? 50.26400 22.14077  -21.78171 1.000 28.24110  ? 96   HIS A ND1   1 
ATOM   1602 C  CD2   . HIS C 3  97  ? 48.82482 21.76394  -23.38488 1.000 27.48016  ? 96   HIS A CD2   1 
ATOM   1603 C  CE1   . HIS C 3  97  ? 50.79252 22.60661  -22.89855 1.000 28.52118  ? 96   HIS A CE1   1 
ATOM   1604 N  NE2   . HIS C 3  97  ? 49.93766 22.39266  -23.88469 1.000 30.96732  ? 96   HIS A NE2   1 
ATOM   1605 N  N     . PRO C 3  98  ? 51.09765 19.39732  -20.53680 1.000 29.49126  ? 97   PRO A N     1 
ATOM   1606 C  CA    . PRO C 3  98  ? 52.39415 19.34723  -19.82472 1.000 26.42105  ? 97   PRO A CA    1 
ATOM   1607 C  C     . PRO C 3  98  ? 52.78133 20.65284  -19.13530 1.000 32.38377  ? 97   PRO A C     1 
ATOM   1608 O  O     . PRO C 3  98  ? 53.46041 20.61115  -18.09399 1.000 30.56306  ? 97   PRO A O     1 
ATOM   1609 C  CB    . PRO C 3  98  ? 53.39865 18.97445  -20.93288 1.000 24.29444  ? 97   PRO A CB    1 
ATOM   1610 C  CG    . PRO C 3  98  ? 52.69505 19.21990  -22.24404 1.000 23.04461  ? 97   PRO A CG    1 
ATOM   1611 C  CD    . PRO C 3  98  ? 51.22337 19.04471  -21.96224 1.000 26.14826  ? 97   PRO A CD    1 
ATOM   1612 N  N     . ALA C 3  99  ? 52.36547 21.80846  -19.67467 1.000 29.56950  ? 98   ALA A N     1 
ATOM   1613 C  CA    . ALA C 3  99  ? 52.70514 23.07686  -19.04316 1.000 30.46513  ? 98   ALA A CA    1 
ATOM   1614 C  C     . ALA C 3  99  ? 52.09137 23.20328  -17.65364 1.000 29.15581  ? 98   ALA A C     1 
ATOM   1615 O  O     . ALA C 3  99  ? 52.50423 24.08019  -16.87878 1.000 29.53791  ? 98   ALA A O     1 
ATOM   1616 C  CB    . ALA C 3  99  ? 52.25868 24.24780  -19.92999 1.000 35.80150  ? 98   ALA A CB    1 
ATOM   1617 N  N     . GLY C 3  100 ? 51.10000 22.36374  -17.33187 1.000 24.61450  ? 99   GLY A N     1 
ATOM   1618 C  CA    . GLY C 3  100 ? 50.50022 22.31154  -16.01118 1.000 23.57198  ? 99   GLY A CA    1 
ATOM   1619 C  C     . GLY C 3  100 ? 51.16619 21.33951  -15.04329 1.000 29.15737  ? 99   GLY A C     1 
ATOM   1620 O  O     . GLY C 3  100 ? 50.81475 21.30469  -13.85936 1.000 29.27260  ? 99   GLY A O     1 
ATOM   1621 N  N     . LEU C 3  101 ? 52.14403 20.56358  -15.50331 1.000 26.92120  ? 100  LEU A N     1 
ATOM   1622 C  CA    . LEU C 3  101 ? 52.90542 19.71146  -14.59972 1.000 25.60626  ? 100  LEU A CA    1 
ATOM   1623 C  C     . LEU C 3  101 ? 53.90854 20.51674  -13.77443 1.000 26.65918  ? 100  LEU A C     1 
ATOM   1624 O  O     . LEU C 3  101 ? 54.55569 21.44408  -14.26940 1.000 30.29637  ? 100  LEU A O     1 
ATOM   1625 C  CB    . LEU C 3  101 ? 53.63374 18.62480  -15.39465 1.000 22.80125  ? 100  LEU A CB    1 
ATOM   1626 C  CG    . LEU C 3  101 ? 52.63030 17.75674  -16.13954 1.000 28.42245  ? 100  LEU A CG    1 
ATOM   1627 C  CD1   . LEU C 3  101 ? 53.27842 17.00365  -17.30054 1.000 29.75181  ? 100  LEU A CD1   1 
ATOM   1628 C  CD2   . LEU C 3  101 ? 51.96803 16.80423  -15.14491 1.000 29.28467  ? 100  LEU A CD2   1 
ATOM   1629 N  N     . LYS C 3  102 ? 54.05670 20.13788  -12.51831 1.000 24.45751  ? 101  LYS A N     1 
ATOM   1630 C  CA    . LYS C 3  102 ? 55.07411 20.72727  -11.66543 1.000 28.81178  ? 101  LYS A CA    1 
ATOM   1631 C  C     . LYS C 3  102 ? 56.34492 19.88064  -11.68716 1.000 36.43098  ? 101  LYS A C     1 
ATOM   1632 O  O     . LYS C 3  102 ? 56.34639 18.73786  -12.14673 1.000 43.79146  ? 101  LYS A O     1 
ATOM   1633 C  CB    . LYS C 3  102 ? 54.52458 20.86472  -10.25111 1.000 29.43634  ? 101  LYS A CB    1 
ATOM   1634 C  CG    . LYS C 3  102 ? 53.17832 21.58567  -10.24970 1.000 35.06440  ? 101  LYS A CG    1 
ATOM   1635 C  CD    . LYS C 3  102 ? 52.60260 21.72844  -8.85934  1.000 39.79280  ? 101  LYS A CD    1 
ATOM   1636 C  CE    . LYS C 3  102 ? 51.29926 22.48047  -8.89948  1.000 43.50229  ? 101  LYS A CE    1 
ATOM   1637 N  NZ    . LYS C 3  102 ? 50.91918 22.92306  -7.54404  1.000 49.04451  ? 101  LYS A NZ    1 
ATOM   1638 N  N     . LYS C 3  103 ? 57.44189 20.46765  -11.21829 1.000 35.71123  ? 102  LYS A N     1 
ATOM   1639 C  CA    . LYS C 3  103 ? 58.68355 19.71656  -11.08547 1.000 44.67831  ? 102  LYS A CA    1 
ATOM   1640 C  C     . LYS C 3  103 ? 58.53326 18.67672  -9.97975  1.000 41.43837  ? 102  LYS A C     1 
ATOM   1641 O  O     . LYS C 3  103 ? 58.21486 19.01893  -8.83714  1.000 38.78216  ? 102  LYS A O     1 
ATOM   1642 C  CB    . LYS C 3  103 ? 59.85906 20.64691  -10.79120 1.000 26.69342  ? 102  LYS A CB    1 
ATOM   1643 N  N     . LYS C 3  104 ? 58.75063 17.40856  -10.32831 1.000 46.67873  ? 103  LYS A N     1 
ATOM   1644 C  CA    . LYS C 3  104 ? 58.71091 16.29082  -9.39101  1.000 43.30952  ? 103  LYS A CA    1 
ATOM   1645 C  C     . LYS C 3  104 ? 60.09450 15.67140  -9.29409  1.000 46.31736  ? 103  LYS A C     1 
ATOM   1646 O  O     . LYS C 3  104 ? 60.82945 15.61317  -10.28411 1.000 47.21488  ? 103  LYS A O     1 
ATOM   1647 C  CB    . LYS C 3  104 ? 57.70043 15.21984  -9.83032  1.000 34.85560  ? 103  LYS A CB    1 
ATOM   1648 C  CG    . LYS C 3  104 ? 56.24995 15.67723  -9.78694  1.000 33.49372  ? 103  LYS A CG    1 
ATOM   1649 C  CD    . LYS C 3  104 ? 55.76619 15.81794  -8.36367  1.000 40.17065  ? 103  LYS A CD    1 
ATOM   1650 C  CE    . LYS C 3  104 ? 54.58719 16.77018  -8.26810  1.000 42.75380  ? 103  LYS A CE    1 
ATOM   1651 N  NZ    . LYS C 3  104 ? 54.10189 16.93241  -6.86498  1.000 43.86648  ? 103  LYS A NZ    1 
ATOM   1652 N  N     . LYS C 3  105 ? 60.44765 15.20517  -8.09857  1.000 48.09649  ? 104  LYS A N     1 
ATOM   1653 C  CA    . LYS C 3  105 ? 61.73542 14.54020  -7.93126  1.000 42.81181  ? 104  LYS A CA    1 
ATOM   1654 C  C     . LYS C 3  105 ? 61.78764 13.21982  -8.70003  1.000 40.45758  ? 104  LYS A C     1 
ATOM   1655 O  O     . LYS C 3  105 ? 62.81362 12.88593  -9.30129  1.000 38.30957  ? 104  LYS A O     1 
ATOM   1656 C  CB    . LYS C 3  105 ? 62.01149 14.32096  -6.45390  1.000 41.97270  ? 104  LYS A CB    1 
ATOM   1657 C  CG    . LYS C 3  105 ? 63.45544 14.04859  -6.15645  1.000 50.63828  ? 104  LYS A CG    1 
ATOM   1658 C  CD    . LYS C 3  105 ? 63.66660 13.92754  -4.66297  1.000 57.84953  ? 104  LYS A CD    1 
ATOM   1659 C  CE    . LYS C 3  105 ? 65.10636 13.61528  -4.31928  1.000 61.36966  ? 104  LYS A CE    1 
ATOM   1660 N  NZ    . LYS C 3  105 ? 66.04630 14.71231  -4.69978  1.000 66.35286  ? 104  LYS A NZ    1 
ATOM   1661 N  N     . SER C 3  106 ? 60.69198 12.46446  -8.71640  1.000 40.04040  ? 105  SER A N     1 
ATOM   1662 C  CA    . SER C 3  106 ? 60.69266 11.15978  -9.36436  1.000 31.71209  ? 105  SER A CA    1 
ATOM   1663 C  C     . SER C 3  106 ? 59.40574 10.96869  -10.15600 1.000 33.23435  ? 105  SER A C     1 
ATOM   1664 O  O     . SER C 3  106 ? 58.33875 11.45444  -9.76597  1.000 36.56904  ? 105  SER A O     1 
ATOM   1665 C  CB    . SER C 3  106 ? 60.86840 10.03773  -8.34841  1.000 29.67858  ? 105  SER A CB    1 
ATOM   1666 O  OG    . SER C 3  106 ? 62.10605 10.12476  -7.64426  1.000 26.92059  ? 105  SER A OG    1 
ATOM   1667 N  N     . VAL C 3  107 ? 59.52666 10.26818  -11.28596 1.000 30.74816  ? 106  VAL A N     1 
ATOM   1668 C  CA    . VAL C 3  107 ? 58.47495 10.18377  -12.29658 1.000 29.75223  ? 106  VAL A CA    1 
ATOM   1669 C  C     . VAL C 3  107 ? 58.43013 8.77539   -12.88305 1.000 29.71044  ? 106  VAL A C     1 
ATOM   1670 O  O     . VAL C 3  107 ? 59.46660 8.15850   -13.15487 1.000 32.97885  ? 106  VAL A O     1 
ATOM   1671 C  CB    . VAL C 3  107 ? 58.69047 11.21711  -13.42242 1.000 32.10708  ? 106  VAL A CB    1 
ATOM   1672 C  CG1   . VAL C 3  107 ? 57.76655 10.93036  -14.59824 1.000 34.95679  ? 106  VAL A CG1   1 
ATOM   1673 C  CG2   . VAL C 3  107 ? 58.45221 12.63167  -12.92074 1.000 25.94130  ? 106  VAL A CG2   1 
ATOM   1674 N  N     . THR C 3  108 ? 57.22212 8.27047   -13.08437 1.000 28.86965  ? 107  THR A N     1 
ATOM   1675 C  CA    . THR C 3  108 ? 56.99960 6.98459   -13.72311 1.000 28.26553  ? 107  THR A CA    1 
ATOM   1676 C  C     . THR C 3  108 ? 55.79263 7.13081   -14.62364 1.000 35.43686  ? 107  THR A C     1 
ATOM   1677 O  O     . THR C 3  108 ? 54.85049 7.83986   -14.27589 1.000 37.06260  ? 107  THR A O     1 
ATOM   1678 C  CB    . THR C 3  108 ? 56.75744 5.88109   -12.69506 1.000 24.71028  ? 107  THR A CB    1 
ATOM   1679 O  OG1   . THR C 3  108 ? 57.98785 5.57372   -12.04414 1.000 25.18155  ? 107  THR A OG1   1 
ATOM   1680 C  CG2   . THR C 3  108 ? 56.22949 4.63248   -13.35420 1.000 19.82908  ? 107  THR A CG2   1 
ATOM   1681 N  N     . VAL C 3  109 ? 55.83078 6.50851   -15.79682 1.000 35.02416  ? 108  VAL A N     1 
ATOM   1682 C  CA    . VAL C 3  109 ? 54.65971 6.44038   -16.65858 1.000 33.36504  ? 108  VAL A CA    1 
ATOM   1683 C  C     . VAL C 3  109 ? 54.39800 4.97222   -16.92997 1.000 39.83814  ? 108  VAL A C     1 
ATOM   1684 O  O     . VAL C 3  109 ? 55.28549 4.25644   -17.40980 1.000 49.31640  ? 108  VAL A O     1 
ATOM   1685 C  CB    . VAL C 3  109 ? 54.84940 7.23386   -17.96060 1.000 31.97801  ? 108  VAL A CB    1 
ATOM   1686 C  CG1   . VAL C 3  109 ? 53.64832 7.05805   -18.86864 1.000 26.05098  ? 108  VAL A CG1   1 
ATOM   1687 C  CG2   . VAL C 3  109 ? 55.07099 8.71383   -17.64039 1.000 27.63710  ? 108  VAL A CG2   1 
ATOM   1688 N  N     . LEU C 3  110 ? 53.20290 4.50959   -16.58957 1.000 36.34882  ? 109  LEU A N     1 
ATOM   1689 C  CA    . LEU C 3  110 ? 52.89031 3.11645   -16.82290 1.000 39.84694  ? 109  LEU A CA    1 
ATOM   1690 C  C     . LEU C 3  110 ? 51.49453 2.99090   -17.40147 1.000 37.15697  ? 109  LEU A C     1 
ATOM   1691 O  O     . LEU C 3  110 ? 50.69105 3.92538   -17.36517 1.000 34.74826  ? 109  LEU A O     1 
ATOM   1692 C  CB    . LEU C 3  110 ? 53.05101 2.26623   -15.55740 1.000 44.00770  ? 109  LEU A CB    1 
ATOM   1693 C  CG    . LEU C 3  110 ? 52.75300 2.80224   -14.17111 1.000 44.49947  ? 109  LEU A CG    1 
ATOM   1694 C  CD1   . LEU C 3  110 ? 51.26341 2.89000   -13.96791 1.000 51.08365  ? 109  LEU A CD1   1 
ATOM   1695 C  CD2   . LEU C 3  110 ? 53.36671 1.84720   -13.18952 1.000 43.64997  ? 109  LEU A CD2   1 
ATOM   1696 N  N     . ASP C 3  111 ? 51.24566 1.82201   -17.98888 1.000 33.33189  ? 110  ASP A N     1 
ATOM   1697 C  CA    . ASP C 3  111 ? 50.04657 1.56318   -18.76135 1.000 36.17188  ? 110  ASP A CA    1 
ATOM   1698 C  C     . ASP C 3  111 ? 49.41465 0.26718   -18.28024 1.000 36.73314  ? 110  ASP A C     1 
ATOM   1699 O  O     . ASP C 3  111 ? 50.10838 -0.64519  -17.81437 1.000 32.91428  ? 110  ASP A O     1 
ATOM   1700 C  CB    . ASP C 3  111 ? 50.36984 1.47139   -20.25477 1.000 42.34833  ? 110  ASP A CB    1 
ATOM   1701 C  CG    . ASP C 3  111 ? 49.18663 1.79117   -21.13001 1.000 48.14670  ? 110  ASP A CG    1 
ATOM   1702 O  OD1   . ASP C 3  111 ? 48.87430 2.99101   -21.29679 1.000 50.56355  ? 110  ASP A OD1   1 
ATOM   1703 O  OD2   . ASP C 3  111 ? 48.57351 0.84028   -21.65515 1.000 52.57216  ? 110  ASP A OD2   1 
ATOM   1704 N  N     . VAL C 3  112 ? 48.08643 0.20760   -18.37387 1.000 34.60685  ? 111  VAL A N     1 
ATOM   1705 C  CA    . VAL C 3  112 ? 47.32533 -0.97979  -18.00973 1.000 33.57299  ? 111  VAL A CA    1 
ATOM   1706 C  C     . VAL C 3  112 ? 47.23419 -1.90977  -19.21984 1.000 39.68049  ? 111  VAL A C     1 
ATOM   1707 O  O     . VAL C 3  112 ? 47.00394 -1.46173  -20.35109 1.000 43.36582  ? 111  VAL A O     1 
ATOM   1708 C  CB    . VAL C 3  112 ? 45.93561 -0.58030  -17.48805 1.000 31.29524  ? 111  VAL A CB    1 
ATOM   1709 C  CG1   . VAL C 3  112 ? 45.10383 -1.82108  -17.15955 1.000 33.53934  ? 111  VAL A CG1   1 
ATOM   1710 C  CG2   . VAL C 3  112 ? 46.07903 0.32246   -16.27226 1.000 29.87396  ? 111  VAL A CG2   1 
ATOM   1711 N  N     . GLY C 3  113 ? 47.43875 -3.20636  -18.99372 1.000 37.81295  ? 112  GLY A N     1 
ATOM   1712 C  CA    . GLY C 3  113 ? 47.37247 -4.18182  -20.06879 1.000 34.94865  ? 112  GLY A CA    1 
ATOM   1713 C  C     . GLY C 3  113 ? 45.93085 -4.58443  -20.30295 1.000 38.04216  ? 112  GLY A C     1 
ATOM   1714 O  O     . GLY C 3  113 ? 45.20503 -4.89544  -19.35305 1.000 42.44189  ? 112  GLY A O     1 
ATOM   1715 N  N     . ASP C 3  114 ? 45.51481 -4.55456  -21.56982 1.000 35.86182  ? 113  ASP A N     1 
ATOM   1716 C  CA    . ASP C 3  114 ? 44.15097 -4.89534  -21.99686 1.000 39.20205  ? 113  ASP A CA    1 
ATOM   1717 C  C     . ASP C 3  114 ? 43.11094 -4.31660  -21.04310 1.000 38.70279  ? 113  ASP A C     1 
ATOM   1718 O  O     . ASP C 3  114 ? 42.25396 -5.01356  -20.49658 1.000 43.44846  ? 113  ASP A O     1 
ATOM   1719 C  CB    . ASP C 3  114 ? 43.98395 -6.40502  -22.15253 1.000 46.35435  ? 113  ASP A CB    1 
ATOM   1720 C  CG    . ASP C 3  114 ? 44.57818 -6.91533  -23.45188 1.000 60.88874  ? 113  ASP A CG    1 
ATOM   1721 O  OD1   . ASP C 3  114 ? 44.60632 -6.15007  -24.45093 1.000 66.11711  ? 113  ASP A OD1   1 
ATOM   1722 O  OD2   . ASP C 3  114 ? 45.02841 -8.07617  -23.47490 1.000 67.62119  ? 113  ASP A OD2   1 
ATOM   1723 N  N     . ALA C 3  115 ? 43.20497 -2.99568  -20.88056 1.000 36.57411  ? 114  ALA A N     1 
ATOM   1724 C  CA    . ALA C 3  115 ? 42.45438 -2.27368  -19.86221 1.000 35.03824  ? 114  ALA A CA    1 
ATOM   1725 C  C     . ALA C 3  115 ? 40.95084 -2.55569  -19.92760 1.000 36.57902  ? 114  ALA A C     1 
ATOM   1726 O  O     . ALA C 3  115 ? 40.35328 -2.99873  -18.93663 1.000 34.69400  ? 114  ALA A O     1 
ATOM   1727 C  CB    . ALA C 3  115 ? 42.74219 -0.78472  -19.99947 1.000 34.92748  ? 114  ALA A CB    1 
ATOM   1728 N  N     . TYR C 3  116 ? 40.31416 -2.27682  -21.07657 1.000 32.84593  ? 115  TYR A N     1 
ATOM   1729 C  CA    . TYR C 3  116 ? 38.87722 -2.52091  -21.19475 1.000 32.08107  ? 115  TYR A CA    1 
ATOM   1730 C  C     . TYR C 3  116 ? 38.54888 -3.97057  -20.85285 1.000 32.99631  ? 115  TYR A C     1 
ATOM   1731 O  O     . TYR C 3  116 ? 37.61845 -4.25007  -20.08969 1.000 31.19754  ? 115  TYR A O     1 
ATOM   1732 C  CB    . TYR C 3  116 ? 38.36180 -2.20738  -22.60404 1.000 26.08431  ? 115  TYR A CB    1 
ATOM   1733 C  CG    . TYR C 3  116 ? 38.14421 -0.74395  -22.97796 1.000 32.66753  ? 115  TYR A CG    1 
ATOM   1734 C  CD1   . TYR C 3  116 ? 38.64724 0.30644   -22.19972 1.000 32.76725  ? 115  TYR A CD1   1 
ATOM   1735 C  CD2   . TYR C 3  116 ? 37.44554 -0.41825  -24.14776 1.000 36.41849  ? 115  TYR A CD2   1 
ATOM   1736 C  CE1   . TYR C 3  116 ? 38.46453 1.63415   -22.58160 1.000 30.29851  ? 115  TYR A CE1   1 
ATOM   1737 C  CE2   . TYR C 3  116 ? 37.24909 0.89358   -24.53328 1.000 36.73211  ? 115  TYR A CE2   1 
ATOM   1738 C  CZ    . TYR C 3  116 ? 37.75513 1.91877   -23.75461 1.000 36.25167  ? 115  TYR A CZ    1 
ATOM   1739 O  OH    . TYR C 3  116 ? 37.54449 3.21471   -24.16731 1.000 34.32847  ? 115  TYR A OH    1 
ATOM   1740 N  N     . PHE C 3  117 ? 39.31541 -4.90657  -21.40074 1.000 34.94513  ? 116  PHE A N     1 
ATOM   1741 C  CA    . PHE C 3  117 ? 38.98924 -6.31262  -21.23311 1.000 35.63887  ? 116  PHE A CA    1 
ATOM   1742 C  C     . PHE C 3  117 ? 39.18057 -6.78831  -19.80375 1.000 37.15952  ? 116  PHE A C     1 
ATOM   1743 O  O     . PHE C 3  117 ? 38.96162 -7.97162  -19.52597 1.000 36.68704  ? 116  PHE A O     1 
ATOM   1744 C  CB    . PHE C 3  117 ? 39.82467 -7.14994  -22.19865 1.000 35.19720  ? 116  PHE A CB    1 
ATOM   1745 C  CG    . PHE C 3  117 ? 39.50718 -6.89245  -23.64004 1.000 40.39505  ? 116  PHE A CG    1 
ATOM   1746 C  CD1   . PHE C 3  117 ? 38.33149 -6.25343  -23.99884 1.000 40.70713  ? 116  PHE A CD1   1 
ATOM   1747 C  CD2   . PHE C 3  117 ? 40.37120 -7.29868  -24.63844 1.000 43.69039  ? 116  PHE A CD2   1 
ATOM   1748 C  CE1   . PHE C 3  117 ? 38.03043 -6.02285  -25.31528 1.000 41.23652  ? 116  PHE A CE1   1 
ATOM   1749 C  CE2   . PHE C 3  117 ? 40.06730 -7.07954  -25.96178 1.000 43.64334  ? 116  PHE A CE2   1 
ATOM   1750 C  CZ    . PHE C 3  117 ? 38.89837 -6.43713  -26.30009 1.000 42.92033  ? 116  PHE A CZ    1 
ATOM   1751 N  N     . SER C 3  118 ? 39.58753 -5.90332  -18.89855 1.000 32.51236  ? 117  SER A N     1 
ATOM   1752 C  CA    . SER C 3  118 ? 39.69245 -6.23105  -17.48979 1.000 30.36134  ? 117  SER A CA    1 
ATOM   1753 C  C     . SER C 3  118 ? 38.53699 -5.67761  -16.67041 1.000 34.97383  ? 117  SER A C     1 
ATOM   1754 O  O     . SER C 3  118 ? 38.45998 -5.95063  -15.47238 1.000 44.71270  ? 117  SER A O     1 
ATOM   1755 C  CB    . SER C 3  118 ? 41.01533 -5.71681  -16.92313 1.000 32.91583  ? 117  SER A CB    1 
ATOM   1756 O  OG    . SER C 3  118 ? 42.11968 -6.35574  -17.53108 1.000 40.33876  ? 117  SER A OG    1 
ATOM   1757 N  N     . VAL C 3  119 ? 37.62950 -4.92876  -17.27389 1.000 31.53656  ? 118  VAL A N     1 
ATOM   1758 C  CA    . VAL C 3  119 ? 36.52158 -4.33499  -16.53805 1.000 32.82799  ? 118  VAL A CA    1 
ATOM   1759 C  C     . VAL C 3  119 ? 35.25602 -5.10420  -16.89120 1.000 36.34684  ? 118  VAL A C     1 
ATOM   1760 O  O     . VAL C 3  119 ? 34.90861 -5.20790  -18.07371 1.000 40.31907  ? 118  VAL A O     1 
ATOM   1761 C  CB    . VAL C 3  119 ? 36.37225 -2.83395  -16.83864 1.000 29.23512  ? 118  VAL A CB    1 
ATOM   1762 C  CG1   . VAL C 3  119 ? 35.16397 -2.26351  -16.10552 1.000 25.91622  ? 118  VAL A CG1   1 
ATOM   1763 C  CG2   . VAL C 3  119 ? 37.63092 -2.09682  -16.39432 1.000 25.91943  ? 118  VAL A CG2   1 
ATOM   1764 N  N     . PRO C 3  120 ? 34.54544 -5.65576  -15.91843 1.000 35.54015  ? 119  PRO A N     1 
ATOM   1765 C  CA    . PRO C 3  120 ? 33.35373 -6.44956  -16.24554 1.000 38.53414  ? 119  PRO A CA    1 
ATOM   1766 C  C     . PRO C 3  120 ? 32.23115 -5.56996  -16.77745 1.000 38.30591  ? 119  PRO A C     1 
ATOM   1767 O  O     . PRO C 3  120 ? 32.14846 -4.37383  -16.48160 1.000 41.60526  ? 119  PRO A O     1 
ATOM   1768 C  CB    . PRO C 3  120 ? 32.97552 -7.10321  -14.90739 1.000 26.90586  ? 119  PRO A CB    1 
ATOM   1769 C  CG    . PRO C 3  120 ? 33.55002 -6.18465  -13.85292 1.000 35.41176  ? 119  PRO A CG    1 
ATOM   1770 C  CD    . PRO C 3  120 ? 34.79290 -5.54749  -14.46504 1.000 33.13810  ? 119  PRO A CD    1 
ATOM   1771 N  N     . LEU C 3  121 ? 31.35966 -6.18477  -17.57403 1.000 35.31870  ? 120  LEU A N     1 
ATOM   1772 C  CA    . LEU C 3  121 ? 30.19323 -5.52782  -18.14467 1.000 33.07118  ? 120  LEU A CA    1 
ATOM   1773 C  C     . LEU C 3  121 ? 28.93110 -6.04635  -17.46746 1.000 34.16235  ? 120  LEU A C     1 
ATOM   1774 O  O     . LEU C 3  121 ? 28.85759 -7.21576  -17.09409 1.000 38.26306  ? 120  LEU A O     1 
ATOM   1775 C  CB    . LEU C 3  121 ? 30.11115 -5.77085  -19.65882 1.000 33.61781  ? 120  LEU A CB    1 
ATOM   1776 C  CG    . LEU C 3  121 ? 28.83479 -5.33706  -20.38563 1.000 36.81124  ? 120  LEU A CG    1 
ATOM   1777 C  CD1   . LEU C 3  121 ? 28.77305 -3.81366  -20.48143 1.000 40.33739  ? 120  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU C 3  121 ? 28.78222 -5.94617  -21.74471 1.000 31.12406  ? 120  LEU A CD2   1 
ATOM   1779 N  N     . ASP C 3  122 ? 27.95323 -5.16040  -17.30271 1.000 38.21392  ? 121  ASP A N     1 
ATOM   1780 C  CA    . ASP C 3  122 ? 26.66067 -5.50216  -16.72467 1.000 45.74117  ? 121  ASP A CA    1 
ATOM   1781 C  C     . ASP C 3  122 ? 26.09924 -6.76922  -17.35769 1.000 50.02691  ? 121  ASP A C     1 
ATOM   1782 O  O     . ASP C 3  122 ? 25.99890 -6.86648  -18.58361 1.000 55.34168  ? 121  ASP A O     1 
ATOM   1783 C  CB    . ASP C 3  122 ? 25.70456 -4.32794  -16.93538 1.000 51.53335  ? 121  ASP A CB    1 
ATOM   1784 C  CG    . ASP C 3  122 ? 24.35113 -4.55284  -16.31754 1.000 62.61297  ? 121  ASP A CG    1 
ATOM   1785 O  OD1   . ASP C 3  122 ? 24.17949 -4.23527  -15.12478 1.000 68.24074  ? 121  ASP A OD1   1 
ATOM   1786 O  OD2   . ASP C 3  122 ? 23.44915 -5.03293  -17.02966 1.000 69.51336  ? 121  ASP A OD2   1 
ATOM   1787 N  N     . GLU C 3  123 ? 25.74307 -7.74559  -16.51408 1.000 45.08975  ? 122  GLU A N     1 
ATOM   1788 C  CA    . GLU C 3  123 ? 25.27452 -9.03040  -17.02884 1.000 51.43348  ? 122  GLU A CA    1 
ATOM   1789 C  C     . GLU C 3  123 ? 24.03994 -8.86861  -17.90431 1.000 55.88227  ? 122  GLU A C     1 
ATOM   1790 O  O     . GLU C 3  123 ? 23.96639 -9.44288  -18.99962 1.000 56.51990  ? 122  GLU A O     1 
ATOM   1791 C  CB    . GLU C 3  123 ? 24.98117 -9.99195  -15.87949 1.000 55.70058  ? 122  GLU A CB    1 
ATOM   1792 C  CG    . GLU C 3  123 ? 26.20244 -10.74910 -15.43058 1.000 67.65882  ? 122  GLU A CG    1 
ATOM   1793 C  CD    . GLU C 3  123 ? 25.96829 -11.57603 -14.18357 1.000 81.64503  ? 122  GLU A CD    1 
ATOM   1794 O  OE1   . GLU C 3  123 ? 24.94718 -12.30892 -14.12697 1.000 88.13235  ? 122  GLU A OE1   1 
ATOM   1795 O  OE2   . GLU C 3  123 ? 26.81554 -11.48718 -13.26221 1.000 82.67413  ? 122  GLU A OE2   1 
ATOM   1796 N  N     . ASP C 3  124 ? 23.06547 -8.07719  -17.44509 1.000 58.05515  ? 123  ASP A N     1 
ATOM   1797 C  CA    . ASP C 3  124 ? 21.82859 -7.89799  -18.20212 1.000 60.84819  ? 123  ASP A CA    1 
ATOM   1798 C  C     . ASP C 3  124 ? 22.08796 -7.34993  -19.60043 1.000 54.24169  ? 123  ASP A C     1 
ATOM   1799 O  O     . ASP C 3  124 ? 21.30021 -7.60040  -20.51588 1.000 59.25532  ? 123  ASP A O     1 
ATOM   1800 C  CB    . ASP C 3  124 ? 20.87077 -6.97127  -17.44876 1.000 69.47574  ? 123  ASP A CB    1 
ATOM   1801 C  CG    . ASP C 3  124 ? 20.12410 -7.67487  -16.32331 1.000 78.84898  ? 123  ASP A CG    1 
ATOM   1802 O  OD1   . ASP C 3  124 ? 19.92821 -8.90990  -16.39736 1.000 82.46816  ? 123  ASP A OD1   1 
ATOM   1803 O  OD2   . ASP C 3  124 ? 19.71840 -6.97803  -15.36676 1.000 81.94935  ? 123  ASP A OD2   1 
ATOM   1804 N  N     . PHE C 3  125 ? 23.17710 -6.60877  -19.78962 1.000 48.48962  ? 124  PHE A N     1 
ATOM   1805 C  CA    . PHE C 3  125 ? 23.47882 -6.02222  -21.08684 1.000 44.79419  ? 124  PHE A CA    1 
ATOM   1806 C  C     . PHE C 3  125 ? 24.27201 -6.96514  -21.99155 1.000 42.46657  ? 124  PHE A C     1 
ATOM   1807 O  O     . PHE C 3  125 ? 24.26565 -6.77563  -23.21370 1.000 46.89966  ? 124  PHE A O     1 
ATOM   1808 C  CB    . PHE C 3  125 ? 24.23699 -4.69902  -20.87141 1.000 38.90221  ? 124  PHE A CB    1 
ATOM   1809 C  CG    . PHE C 3  125 ? 24.08114 -3.68506  -21.98429 1.000 46.10059  ? 124  PHE A CG    1 
ATOM   1810 C  CD1   . PHE C 3  125 ? 22.97916 -2.83625  -22.02769 1.000 50.37748  ? 124  PHE A CD1   1 
ATOM   1811 C  CD2   . PHE C 3  125 ? 25.07005 -3.52888  -22.95137 1.000 46.23136  ? 124  PHE A CD2   1 
ATOM   1812 C  CE1   . PHE C 3  125 ? 22.84955 -1.87426  -23.03469 1.000 46.43704  ? 124  PHE A CE1   1 
ATOM   1813 C  CE2   . PHE C 3  125 ? 24.94535 -2.57176  -23.95732 1.000 43.17618  ? 124  PHE A CE2   1 
ATOM   1814 C  CZ    . PHE C 3  125 ? 23.83190 -1.74681  -23.99893 1.000 45.01345  ? 124  PHE A CZ    1 
ATOM   1815 N  N     . ARG C 3  126 ? 24.90354 -8.00504  -21.43207 1.000 36.75288  ? 125  ARG A N     1 
ATOM   1816 C  CA    . ARG C 3  126 ? 25.87561 -8.79002  -22.19649 1.000 41.29313  ? 125  ARG A CA    1 
ATOM   1817 C  C     . ARG C 3  126 ? 25.30352 -9.32553  -23.50966 1.000 44.42881  ? 125  ARG A C     1 
ATOM   1818 O  O     . ARG C 3  126 ? 26.00763 -9.35462  -24.53112 1.000 47.00191  ? 125  ARG A O     1 
ATOM   1819 C  CB    . ARG C 3  126 ? 26.41241 -9.93706  -21.34058 1.000 42.57724  ? 125  ARG A CB    1 
ATOM   1820 C  CG    . ARG C 3  126 ? 27.35245 -9.44373  -20.25530 1.000 44.23668  ? 125  ARG A CG    1 
ATOM   1821 C  CD    . ARG C 3  126 ? 27.80131 -10.52962 -19.32291 1.000 40.27079  ? 125  ARG A CD    1 
ATOM   1822 N  NE    . ARG C 3  126 ? 28.47443 -9.94568  -18.16902 1.000 38.52396  ? 125  ARG A NE    1 
ATOM   1823 C  CZ    . ARG C 3  126 ? 29.09403 -10.64903 -17.23077 1.000 38.80924  ? 125  ARG A CZ    1 
ATOM   1824 N  NH1   . ARG C 3  126 ? 29.12708 -11.96858 -17.30939 1.000 43.30811  ? 125  ARG A NH1   1 
ATOM   1825 N  NH2   . ARG C 3  126 ? 29.67434 -10.03341 -16.21347 1.000 36.63074  ? 125  ARG A NH2   1 
ATOM   1826 N  N     . LYS C 3  127 ? 24.03144 -9.73957  -23.51543 1.000 50.66816  ? 126  LYS A N     1 
ATOM   1827 C  CA    . LYS C 3  127 ? 23.49537 -10.39374 -24.70745 1.000 55.44682  ? 126  LYS A CA    1 
ATOM   1828 C  C     . LYS C 3  127 ? 23.49369 -9.46481  -25.91785 1.000 54.02937  ? 126  LYS A C     1 
ATOM   1829 O  O     . LYS C 3  127 ? 23.54417 -9.94052  -27.06068 1.000 50.09970  ? 126  LYS A O     1 
ATOM   1830 C  CB    . LYS C 3  127 ? 22.08334 -10.91805 -24.44729 1.000 61.64004  ? 126  LYS A CB    1 
ATOM   1831 C  CG    . LYS C 3  127 ? 21.12175 -9.86525  -23.94339 1.000 66.20567  ? 126  LYS A CG    1 
ATOM   1832 C  CD    . LYS C 3  127 ? 19.77564 -10.45684 -23.59521 1.000 67.53062  ? 126  LYS A CD    1 
ATOM   1833 C  CE    . LYS C 3  127 ? 19.04340 -9.54346  -22.62729 1.000 72.78319  ? 126  LYS A CE    1 
ATOM   1834 N  NZ    . LYS C 3  127 ? 17.63178 -9.96780  -22.42809 1.000 80.99692  ? 126  LYS A NZ    1 
ATOM   1835 N  N     . TYR C 3  128 ? 23.44970 -8.14670  -25.69715 1.000 49.60177  ? 127  TYR A N     1 
ATOM   1836 C  CA    . TYR C 3  128 ? 23.41538 -7.23237  -26.83175 1.000 52.28601  ? 127  TYR A CA    1 
ATOM   1837 C  C     . TYR C 3  128 ? 24.76256 -7.09190  -27.51881 1.000 54.63209  ? 127  TYR A C     1 
ATOM   1838 O  O     . TYR C 3  128 ? 24.82296 -6.49833  -28.60187 1.000 58.60440  ? 127  TYR A O     1 
ATOM   1839 C  CB    . TYR C 3  128 ? 22.92171 -5.85641  -26.39657 1.000 52.53078  ? 127  TYR A CB    1 
ATOM   1840 C  CG    . TYR C 3  128 ? 21.58188 -5.90786  -25.71102 1.000 54.35428  ? 127  TYR A CG    1 
ATOM   1841 C  CD1   . TYR C 3  128 ? 20.57759 -6.72587  -26.18687 1.000 55.52869  ? 127  TYR A CD1   1 
ATOM   1842 C  CD2   . TYR C 3  128 ? 21.33191 -5.15117  -24.57172 1.000 55.69501  ? 127  TYR A CD2   1 
ATOM   1843 C  CE1   . TYR C 3  128 ? 19.36072 -6.78626  -25.56005 1.000 60.73111  ? 127  TYR A CE1   1 
ATOM   1844 C  CE2   . TYR C 3  128 ? 20.11564 -5.20110  -23.93641 1.000 57.30961  ? 127  TYR A CE2   1 
ATOM   1845 C  CZ    . TYR C 3  128 ? 19.13180 -6.02199  -24.43364 1.000 62.37139  ? 127  TYR A CZ    1 
ATOM   1846 O  OH    . TYR C 3  128 ? 17.90765 -6.08409  -23.80430 1.000 68.35066  ? 127  TYR A OH    1 
ATOM   1847 N  N     . THR C 3  129 ? 25.82994 -7.63448  -26.93218 1.000 53.65822  ? 128  THR A N     1 
ATOM   1848 C  CA    . THR C 3  129 ? 27.16679 -7.53423  -27.50240 1.000 50.41983  ? 128  THR A CA    1 
ATOM   1849 C  C     . THR C 3  129 ? 27.52156 -8.73066  -28.39880 1.000 50.85301  ? 128  THR A C     1 
ATOM   1850 O  O     . THR C 3  129 ? 28.68843 -8.88381  -28.78138 1.000 47.11513  ? 128  THR A O     1 
ATOM   1851 C  CB    . THR C 3  129 ? 28.19608 -7.36357  -26.37150 1.000 50.55607  ? 128  THR A CB    1 
ATOM   1852 O  OG1   . THR C 3  129 ? 28.07126 -8.43763  -25.43009 1.000 51.72058  ? 128  THR A OG1   1 
ATOM   1853 C  CG2   . THR C 3  129 ? 27.95723 -6.05874  -25.63319 1.000 45.15670  ? 128  THR A CG2   1 
ATOM   1854 N  N     . ALA C 3  130 ? 26.53531 -9.55720  -28.75781 1.000 47.80503  ? 129  ALA A N     1 
ATOM   1855 C  CA    . ALA C 3  130 ? 26.76632 -10.73825 -29.58732 1.000 48.85502  ? 129  ALA A CA    1 
ATOM   1856 C  C     . ALA C 3  130 ? 27.50974 -10.39011 -30.87218 1.000 55.55022  ? 129  ALA A C     1 
ATOM   1857 O  O     . ALA C 3  130 ? 27.21429 -9.38572  -31.52936 1.000 58.49759  ? 129  ALA A O     1 
ATOM   1858 C  CB    . ALA C 3  130 ? 25.42953 -11.40110 -29.92926 1.000 50.50637  ? 129  ALA A CB    1 
ATOM   1859 N  N     . PHE C 3  131 ? 28.48475 -11.22999 -31.22601 1.000 50.07015  ? 130  PHE A N     1 
ATOM   1860 C  CA    . PHE C 3  131 ? 29.18617 -11.12245 -32.50200 1.000 53.30481  ? 130  PHE A CA    1 
ATOM   1861 C  C     . PHE C 3  131 ? 29.52249 -12.52261 -33.01090 1.000 59.47951  ? 130  PHE A C     1 
ATOM   1862 O  O     . PHE C 3  131 ? 29.21957 -13.53241 -32.36426 1.000 64.37241  ? 130  PHE A O     1 
ATOM   1863 C  CB    . PHE C 3  131 ? 30.44072 -10.24947 -32.38480 1.000 51.28684  ? 130  PHE A CB    1 
ATOM   1864 C  CG    . PHE C 3  131 ? 31.49825 -10.80929 -31.47821 1.000 50.24162  ? 130  PHE A CG    1 
ATOM   1865 C  CD1   . PHE C 3  131 ? 31.40937 -10.64427 -30.10550 1.000 48.79009  ? 130  PHE A CD1   1 
ATOM   1866 C  CD2   . PHE C 3  131 ? 32.59247 -11.48920 -31.99827 1.000 53.11362  ? 130  PHE A CD2   1 
ATOM   1867 C  CE1   . PHE C 3  131 ? 32.38331 -11.16247 -29.26062 1.000 49.19042  ? 130  PHE A CE1   1 
ATOM   1868 C  CE2   . PHE C 3  131 ? 33.57663 -12.00603 -31.15685 1.000 52.38359  ? 130  PHE A CE2   1 
ATOM   1869 C  CZ    . PHE C 3  131 ? 33.46971 -11.83443 -29.78543 1.000 50.89442  ? 130  PHE A CZ    1 
ATOM   1870 N  N     . THR C 3  132 ? 30.14455 -12.57169 -34.19295 1.000 63.00913  ? 131  THR A N     1 
ATOM   1871 C  CA    . THR C 3  132 ? 30.43758 -13.80454 -34.92576 1.000 62.69464  ? 131  THR A CA    1 
ATOM   1872 C  C     . THR C 3  132 ? 31.84308 -13.71300 -35.50215 1.000 67.68978  ? 131  THR A C     1 
ATOM   1873 O  O     . THR C 3  132 ? 32.19067 -12.70125 -36.11867 1.000 71.15050  ? 131  THR A O     1 
ATOM   1874 C  CB    . THR C 3  132 ? 29.43777 -14.02771 -36.08040 1.000 61.03982  ? 131  THR A CB    1 
ATOM   1875 O  OG1   . THR C 3  132 ? 28.09858 -14.02539 -35.58140 1.000 58.38841  ? 131  THR A OG1   1 
ATOM   1876 C  CG2   . THR C 3  132 ? 29.70141 -15.34710 -36.79755 1.000 64.60585  ? 131  THR A CG2   1 
ATOM   1877 N  N     . ILE C 3  133 ? 32.64602 -14.75457 -35.32766 1.000 69.81247  ? 132  ILE A N     1 
ATOM   1878 C  CA    . ILE C 3  133 ? 33.93198 -14.86499 -36.01177 1.000 77.52164  ? 132  ILE A CA    1 
ATOM   1879 C  C     . ILE C 3  133 ? 33.73489 -15.75487 -37.23410 1.000 89.07594  ? 132  ILE A C     1 
ATOM   1880 O  O     . ILE C 3  133 ? 33.39403 -16.93541 -37.07062 1.000 91.22224  ? 132  ILE A O     1 
ATOM   1881 C  CB    . ILE C 3  133 ? 35.03539 -15.42450 -35.10322 1.000 70.56137  ? 132  ILE A CB    1 
ATOM   1882 C  CG1   . ILE C 3  133 ? 35.39560 -14.41094 -34.02361 1.000 75.73193  ? 132  ILE A CG1   1 
ATOM   1883 C  CG2   . ILE C 3  133 ? 36.28052 -15.75153 -35.92208 1.000 63.98844  ? 132  ILE A CG2   1 
ATOM   1884 C  CD1   . ILE C 3  133 ? 36.84911 -14.44379 -33.66752 1.000 80.26721  ? 132  ILE A CD1   1 
ATOM   1885 N  N     . PRO C 3  134 ? 33.91885 -15.24289 -38.44919 1.000 96.71156  ? 133  PRO A N     1 
ATOM   1886 C  CA    . PRO C 3  134 ? 33.81722 -16.09226 -39.63916 1.000 101.78325 ? 133  PRO A CA    1 
ATOM   1887 C  C     . PRO C 3  134 ? 35.04249 -16.97724 -39.79311 1.000 102.98053 ? 133  PRO A C     1 
ATOM   1888 O  O     . PRO C 3  134 ? 36.15386 -16.62095 -39.39176 1.000 103.82338 ? 133  PRO A O     1 
ATOM   1889 C  CB    . PRO C 3  134 ? 33.72106 -15.07869 -40.78647 1.000 107.10383 ? 133  PRO A CB    1 
ATOM   1890 C  CG    . PRO C 3  134 ? 34.48289 -13.89503 -40.28602 1.000 106.64448 ? 133  PRO A CG    1 
ATOM   1891 C  CD    . PRO C 3  134 ? 34.21233 -13.83989 -38.79360 1.000 100.95911 ? 133  PRO A CD    1 
ATOM   1892 N  N     . SER C 3  135 ? 34.82407 -18.14627 -40.38882 1.000 103.51731 ? 134  SER A N     1 
ATOM   1893 C  CA    . SER C 3  135 ? 35.87964 -19.13923 -40.51237 1.000 103.02685 ? 134  SER A CA    1 
ATOM   1894 C  C     . SER C 3  135 ? 36.58619 -19.01699 -41.85819 1.000 106.55102 ? 134  SER A C     1 
ATOM   1895 O  O     . SER C 3  135 ? 36.10627 -18.36013 -42.78549 1.000 106.65449 ? 134  SER A O     1 
ATOM   1896 C  CB    . SER C 3  135 ? 35.31517 -20.55299 -40.34526 1.000 99.77548  ? 134  SER A CB    1 
ATOM   1897 N  N     . ILE C 3  136 ? 37.76324 -19.63065 -41.93895 1.000 107.20800 ? 135  ILE A N     1 
ATOM   1898 C  CA    . ILE C 3  136 ? 38.37528 -19.95360 -43.23945 1.000 112.32732 ? 135  ILE A CA    1 
ATOM   1899 C  C     . ILE C 3  136 ? 37.89805 -21.36327 -43.57345 1.000 115.73475 ? 135  ILE A C     1 
ATOM   1900 O  O     . ILE C 3  136 ? 38.57490 -22.36909 -43.34147 1.000 118.44688 ? 135  ILE A O     1 
ATOM   1901 C  CB    . ILE C 3  136 ? 39.90125 -19.82342 -43.21240 1.000 113.00789 ? 135  ILE A CB    1 
ATOM   1902 N  N     . ASN C 3  137 ? 36.69161 -21.43862 -44.13248 1.000 115.63205 ? 136  ASN A N     1 
ATOM   1903 C  CA    . ASN C 3  137 ? 36.01114 -22.71649 -44.33342 1.000 111.12776 ? 136  ASN A CA    1 
ATOM   1904 C  C     . ASN C 3  137 ? 36.73353 -23.60056 -45.33357 1.000 109.96598 ? 136  ASN A C     1 
ATOM   1905 O  O     . ASN C 3  137 ? 36.26425 -24.69106 -45.64413 1.000 112.23339 ? 136  ASN A O     1 
ATOM   1906 C  CB    . ASN C 3  137 ? 34.57083 -22.49063 -44.79780 1.000 112.10503 ? 136  ASN A CB    1 
ATOM   1907 N  N     . THR C 3  140 ? 35.34621 -25.67443 -42.04125 1.000 119.95148 ? 139  THR A N     1 
ATOM   1908 C  CA    . THR C 3  140 ? 35.37434 -25.15186 -40.67859 1.000 117.90213 ? 139  THR A CA    1 
ATOM   1909 C  C     . THR C 3  140 ? 34.23705 -24.15532 -40.44169 1.000 119.07853 ? 139  THR A C     1 
ATOM   1910 O  O     . THR C 3  140 ? 33.97870 -23.29229 -41.28431 1.000 120.87562 ? 139  THR A O     1 
ATOM   1911 C  CB    . THR C 3  140 ? 36.72160 -24.47151 -40.36452 1.000 114.76581 ? 139  THR A CB    1 
ATOM   1912 N  N     . PRO C 3  141 ? 33.54640 -24.29248 -39.30895 1.000 118.27629 ? 140  PRO A N     1 
ATOM   1913 C  CA    . PRO C 3  141 ? 32.46998 -23.35800 -38.96174 1.000 116.43112 ? 140  PRO A CA    1 
ATOM   1914 C  C     . PRO C 3  141 ? 32.94113 -22.18804 -38.10931 1.000 110.19623 ? 140  PRO A C     1 
ATOM   1915 O  O     . PRO C 3  141 ? 33.95003 -22.25224 -37.40398 1.000 106.70139 ? 140  PRO A O     1 
ATOM   1916 C  CB    . PRO C 3  141 ? 31.49656 -24.24730 -38.17518 1.000 117.88203 ? 140  PRO A CB    1 
ATOM   1917 C  CG    . PRO C 3  141 ? 32.38906 -25.23217 -37.49236 1.000 118.98207 ? 140  PRO A CG    1 
ATOM   1918 C  CD    . PRO C 3  141 ? 33.56306 -25.47059 -38.42040 1.000 119.48120 ? 140  PRO A CD    1 
ATOM   1919 N  N     . GLY C 3  142 ? 32.17537 -21.10080 -38.18378 1.000 107.12680 ? 141  GLY A N     1 
ATOM   1920 C  CA    . GLY C 3  142 ? 32.49888 -19.88306 -37.44889 1.000 101.20401 ? 141  GLY A CA    1 
ATOM   1921 C  C     . GLY C 3  142 ? 31.78936 -19.79752 -36.10415 1.000 93.35407  ? 141  GLY A C     1 
ATOM   1922 O  O     . GLY C 3  142 ? 30.63820 -20.20579 -35.96591 1.000 95.83711  ? 141  GLY A O     1 
ATOM   1923 N  N     . ILE C 3  143 ? 32.48720 -19.22578 -35.11642 1.000 85.79814  ? 142  ILE A N     1 
ATOM   1924 C  CA    . ILE C 3  143 ? 32.07018 -19.28557 -33.71505 1.000 76.59736  ? 142  ILE A CA    1 
ATOM   1925 C  C     . ILE C 3  143 ? 31.39612 -17.97591 -33.31243 1.000 70.59821  ? 142  ILE A C     1 
ATOM   1926 O  O     . ILE C 3  143 ? 31.79530 -16.88855 -33.75064 1.000 67.30079  ? 142  ILE A O     1 
ATOM   1927 C  CB    . ILE C 3  143 ? 33.26996 -19.60708 -32.79684 1.000 68.53557  ? 142  ILE A CB    1 
ATOM   1928 C  CG1   . ILE C 3  143 ? 34.11384 -20.73647 -33.39407 1.000 66.16171  ? 142  ILE A CG1   1 
ATOM   1929 C  CG2   . ILE C 3  143 ? 32.80240 -20.00675 -31.39397 1.000 66.56425  ? 142  ILE A CG2   1 
ATOM   1930 C  CD1   . ILE C 3  143 ? 35.13016 -21.31951 -32.42789 1.000 65.99467  ? 142  ILE A CD1   1 
ATOM   1931 N  N     . ARG C 3  144 ? 30.36433 -18.08776 -32.47461 1.000 71.03818  ? 143  ARG A N     1 
ATOM   1932 C  CA    . ARG C 3  144 ? 29.58839 -16.97059 -31.95230 1.000 65.63394  ? 143  ARG A CA    1 
ATOM   1933 C  C     . ARG C 3  144 ? 29.96983 -16.69053 -30.49997 1.000 66.73184  ? 143  ARG A C     1 
ATOM   1934 O  O     . ARG C 3  144 ? 30.26380 -17.60722 -29.72866 1.000 68.89872  ? 143  ARG A O     1 
ATOM   1935 C  CB    . ARG C 3  144 ? 28.08392 -17.26331 -32.03201 1.000 62.68668  ? 143  ARG A CB    1 
ATOM   1936 C  CG    . ARG C 3  144 ? 27.53132 -17.32131 -33.43753 1.000 64.78568  ? 143  ARG A CG    1 
ATOM   1937 C  CD    . ARG C 3  144 ? 26.54388 -16.19882 -33.67483 1.000 67.45207  ? 143  ARG A CD    1 
ATOM   1938 N  NE    . ARG C 3  144 ? 25.25159 -16.43989 -33.03649 1.000 69.48957  ? 143  ARG A NE    1 
ATOM   1939 C  CZ    . ARG C 3  144 ? 24.53998 -15.50598 -32.40642 1.000 72.58510  ? 143  ARG A CZ    1 
ATOM   1940 N  NH1   . ARG C 3  144 ? 23.37136 -15.82670 -31.86152 1.000 73.33482  ? 143  ARG A NH1   1 
ATOM   1941 N  NH2   . ARG C 3  144 ? 25.00293 -14.25784 -32.30214 1.000 71.03494  ? 143  ARG A NH2   1 
ATOM   1942 N  N     . TYR C 3  145 ? 29.94362 -15.41601 -30.12018 1.000 64.87773  ? 144  TYR A N     1 
ATOM   1943 C  CA    . TYR C 3  145 ? 30.32935 -15.03004 -28.77094 1.000 60.19256  ? 144  TYR A CA    1 
ATOM   1944 C  C     . TYR C 3  145 ? 29.49583 -13.84247 -28.30535 1.000 56.52856  ? 144  TYR A C     1 
ATOM   1945 O  O     . TYR C 3  145 ? 28.79875 -13.19065 -29.08280 1.000 60.85525  ? 144  TYR A O     1 
ATOM   1946 C  CB    . TYR C 3  145 ? 31.80826 -14.64724 -28.68890 1.000 56.61595  ? 144  TYR A CB    1 
ATOM   1947 C  CG    . TYR C 3  145 ? 32.82690 -15.72677 -28.99621 1.000 55.62024  ? 144  TYR A CG    1 
ATOM   1948 C  CD1   . TYR C 3  145 ? 33.19574 -16.65994 -28.03240 1.000 56.84612  ? 144  TYR A CD1   1 
ATOM   1949 C  CD2   . TYR C 3  145 ? 33.47416 -15.76552 -30.22305 1.000 52.42325  ? 144  TYR A CD2   1 
ATOM   1950 C  CE1   . TYR C 3  145 ? 34.15811 -17.62543 -28.29687 1.000 56.40735  ? 144  TYR A CE1   1 
ATOM   1951 C  CE2   . TYR C 3  145 ? 34.43528 -16.71545 -30.49430 1.000 54.13356  ? 144  TYR A CE2   1 
ATOM   1952 C  CZ    . TYR C 3  145 ? 34.77785 -17.64259 -29.53029 1.000 57.00153  ? 144  TYR A CZ    1 
ATOM   1953 O  OH    . TYR C 3  145 ? 35.73357 -18.59607 -29.80655 1.000 61.27326  ? 144  TYR A OH    1 
ATOM   1954 N  N     . GLN C 3  146 ? 29.58540 -13.57263 -27.01250 1.000 54.24165  ? 145  GLN A N     1 
ATOM   1955 C  CA    . GLN C 3  146 ? 29.16896 -12.30835 -26.42616 1.000 55.36617  ? 145  GLN A CA    1 
ATOM   1956 C  C     . GLN C 3  146 ? 30.25524 -11.84214 -25.46680 1.000 47.69001  ? 145  GLN A C     1 
ATOM   1957 O  O     . GLN C 3  146 ? 31.12987 -12.61690 -25.06174 1.000 45.29752  ? 145  GLN A O     1 
ATOM   1958 C  CB    . GLN C 3  146 ? 27.83912 -12.42623 -25.68176 1.000 57.28403  ? 145  GLN A CB    1 
ATOM   1959 C  CG    . GLN C 3  146 ? 27.99219 -12.99154 -24.28468 1.000 53.22844  ? 145  GLN A CG    1 
ATOM   1960 C  CD    . GLN C 3  146 ? 26.66134 -13.24623 -23.61226 1.000 53.44671  ? 145  GLN A CD    1 
ATOM   1961 O  OE1   . GLN C 3  146 ? 25.62499 -13.30958 -24.27143 1.000 52.47854  ? 145  GLN A OE1   1 
ATOM   1962 N  NE2   . GLN C 3  146 ? 26.68225 -13.39017 -22.28911 1.000 55.98125  ? 145  GLN A NE2   1 
ATOM   1963 N  N     . TYR C 3  147 ? 30.17772 -10.56613 -25.10291 1.000 46.45263  ? 146  TYR A N     1 
ATOM   1964 C  CA    . TYR C 3  147 ? 31.13963 -9.93923  -24.20643 1.000 42.77133  ? 146  TYR A CA    1 
ATOM   1965 C  C     . TYR C 3  147 ? 30.71648 -10.07901 -22.74811 1.000 42.89545  ? 146  TYR A C     1 
ATOM   1966 O  O     . TYR C 3  147 ? 29.52914 -10.01768 -22.41866 1.000 44.10616  ? 146  TYR A O     1 
ATOM   1967 C  CB    . TYR C 3  147 ? 31.31834 -8.45788  -24.55828 1.000 44.80111  ? 146  TYR A CB    1 
ATOM   1968 C  CG    . TYR C 3  147 ? 32.39719 -8.23839  -25.59430 1.000 46.92501  ? 146  TYR A CG    1 
ATOM   1969 C  CD1   . TYR C 3  147 ? 32.12373 -8.38118  -26.95599 1.000 50.90579  ? 146  TYR A CD1   1 
ATOM   1970 C  CD2   . TYR C 3  147 ? 33.69545 -7.92629  -25.21580 1.000 41.64235  ? 146  TYR A CD2   1 
ATOM   1971 C  CE1   . TYR C 3  147 ? 33.11848 -8.20120  -27.91646 1.000 49.18882  ? 146  TYR A CE1   1 
ATOM   1972 C  CE2   . TYR C 3  147 ? 34.69409 -7.74914  -26.16479 1.000 44.18457  ? 146  TYR A CE2   1 
ATOM   1973 C  CZ    . TYR C 3  147 ? 34.40035 -7.89017  -27.51472 1.000 46.70971  ? 146  TYR A CZ    1 
ATOM   1974 O  OH    . TYR C 3  147 ? 35.38393 -7.71412  -28.46090 1.000 45.81149  ? 146  TYR A OH    1 
ATOM   1975 N  N     . ASN C 3  148 ? 31.70291 -10.30184 -21.88289 1.000 36.63894  ? 147  ASN A N     1 
ATOM   1976 C  CA    . ASN C 3  148 ? 31.53567 -10.19818 -20.44345 1.000 42.44378  ? 147  ASN A CA    1 
ATOM   1977 C  C     . ASN C 3  148 ? 32.35012 -9.05652  -19.87005 1.000 40.46299  ? 147  ASN A C     1 
ATOM   1978 O  O     . ASN C 3  148 ? 32.23570 -8.76410  -18.67435 1.000 41.29557  ? 147  ASN A O     1 
ATOM   1979 C  CB    . ASN C 3  148 ? 31.95513 -11.50373 -19.74394 1.000 36.80355  ? 147  ASN A CB    1 
ATOM   1980 C  CG    . ASN C 3  148 ? 31.31885 -12.74131 -20.36217 1.000 40.09285  ? 147  ASN A CG    1 
ATOM   1981 O  OD1   . ASN C 3  148 ? 30.17569 -12.71510 -20.80787 1.000 45.70803  ? 147  ASN A OD1   1 
ATOM   1982 N  ND2   . ASN C 3  148 ? 32.06812 -13.83276 -20.39129 1.000 37.97383  ? 147  ASN A ND2   1 
ATOM   1983 N  N     . VAL C 3  149 ? 33.19665 -8.44012  -20.68516 1.000 40.66509  ? 148  VAL A N     1 
ATOM   1984 C  CA    . VAL C 3  149 ? 34.00131 -7.29988  -20.28139 1.000 39.17723  ? 148  VAL A CA    1 
ATOM   1985 C  C     . VAL C 3  149 ? 33.65735 -6.17560  -21.24746 1.000 39.65371  ? 148  VAL A C     1 
ATOM   1986 O  O     . VAL C 3  149 ? 32.83333 -6.37112  -22.14541 1.000 41.76282  ? 148  VAL A O     1 
ATOM   1987 C  CB    . VAL C 3  149 ? 35.49619 -7.65202  -20.28758 1.000 33.25016  ? 148  VAL A CB    1 
ATOM   1988 C  CG1   . VAL C 3  149 ? 35.78001 -8.64465  -19.19068 1.000 31.89529  ? 148  VAL A CG1   1 
ATOM   1989 C  CG2   . VAL C 3  149 ? 35.88145 -8.23515  -21.62658 1.000 33.28134  ? 148  VAL A CG2   1 
ATOM   1990 N  N     . LEU C 3  150 ? 34.26174 -5.00574  -21.07244 1.000 39.14276  ? 149  LEU A N     1 
ATOM   1991 C  CA    . LEU C 3  150 ? 33.92792 -3.85339  -21.92289 1.000 42.74836  ? 149  LEU A CA    1 
ATOM   1992 C  C     . LEU C 3  150 ? 34.44130 -4.06049  -23.34517 1.000 39.29180  ? 149  LEU A C     1 
ATOM   1993 O  O     . LEU C 3  150 ? 35.61239 -4.41232  -23.53998 1.000 46.20219  ? 149  LEU A O     1 
ATOM   1994 C  CB    . LEU C 3  150 ? 34.51669 -2.56372  -21.35217 1.000 29.61753  ? 149  LEU A CB    1 
ATOM   1995 C  CG    . LEU C 3  150 ? 34.03077 -2.08263  -19.98857 1.000 36.59867  ? 149  LEU A CG    1 
ATOM   1996 C  CD1   . LEU C 3  150 ? 34.81199 -0.81704  -19.53500 1.000 37.02261  ? 149  LEU A CD1   1 
ATOM   1997 C  CD2   . LEU C 3  150 ? 32.54032 -1.83366  -20.02235 1.000 29.96298  ? 149  LEU A CD2   1 
ATOM   1998 N  N     . PRO C 3  151 ? 33.61463 -3.85365  -24.35656 1.000 37.72889  ? 150  PRO A N     1 
ATOM   1999 C  CA    . PRO C 3  151 ? 34.07845 -3.98367  -25.74082 1.000 38.42648  ? 150  PRO A CA    1 
ATOM   2000 C  C     . PRO C 3  151 ? 34.55613 -2.65918  -26.33269 1.000 39.09317  ? 150  PRO A C     1 
ATOM   2001 O  O     . PRO C 3  151 ? 34.16963 -1.57325  -25.90082 1.000 37.54139  ? 150  PRO A O     1 
ATOM   2002 C  CB    . PRO C 3  151 ? 32.82451 -4.48889  -26.46468 1.000 39.37073  ? 150  PRO A CB    1 
ATOM   2003 C  CG    . PRO C 3  151 ? 31.69275 -3.87735  -25.70865 1.000 38.72185  ? 150  PRO A CG    1 
ATOM   2004 C  CD    . PRO C 3  151 ? 32.14947 -3.73143  -24.26176 1.000 36.37515  ? 150  PRO A CD    1 
ATOM   2005 N  N     . GLN C 3  152 ? 35.42299 -2.77008  -27.34249 1.000 41.89885  ? 151  GLN A N     1 
ATOM   2006 C  CA    . GLN C 3  152 ? 35.99094 -1.59974  -28.00998 1.000 40.84804  ? 151  GLN A CA    1 
ATOM   2007 C  C     . GLN C 3  152 ? 35.13458 -1.24949  -29.21483 1.000 42.35719  ? 151  GLN A C     1 
ATOM   2008 O  O     . GLN C 3  152 ? 34.95333 -2.07402  -30.12091 1.000 45.97873  ? 151  GLN A O     1 
ATOM   2009 C  CB    . GLN C 3  152 ? 37.43814 -1.84591  -28.42578 1.000 37.52878  ? 151  GLN A CB    1 
ATOM   2010 C  CG    . GLN C 3  152 ? 38.26935 -2.34197  -27.26615 1.000 38.20249  ? 151  GLN A CG    1 
ATOM   2011 C  CD    . GLN C 3  152 ? 39.74712 -2.25697  -27.51893 1.000 44.66503  ? 151  GLN A CD    1 
ATOM   2012 O  OE1   . GLN C 3  152 ? 40.23729 -1.27457  -28.07800 1.000 46.16966  ? 151  GLN A OE1   1 
ATOM   2013 N  NE2   . GLN C 3  152 ? 40.47751 -3.28848  -27.10387 1.000 47.80581  ? 151  GLN A NE2   1 
ATOM   2014 N  N     . GLY C 3  153 ? 34.60030 -0.03399  -29.21525 1.000 41.16659  ? 152  GLY A N     1 
ATOM   2015 C  CA    . GLY C 3  153 ? 33.61556 0.39624   -30.18721 1.000 38.45146  ? 152  GLY A CA    1 
ATOM   2016 C  C     . GLY C 3  153 ? 32.26691 0.70679   -29.57930 1.000 47.42563  ? 152  GLY A C     1 
ATOM   2017 O  O     . GLY C 3  153 ? 31.44754 1.37365   -30.22271 1.000 45.56043  ? 152  GLY A O     1 
ATOM   2018 N  N     . TRP C 3  154 ? 32.00573 0.24284   -28.35816 1.000 45.24995  ? 153  TRP A N     1 
ATOM   2019 C  CA    . TRP C 3  154 ? 30.78608 0.60549   -27.65100 1.000 41.56475  ? 153  TRP A CA    1 
ATOM   2020 C  C     . TRP C 3  154 ? 30.95230 1.99265   -27.04987 1.000 39.42381  ? 153  TRP A C     1 
ATOM   2021 O  O     . TRP C 3  154 ? 32.03913 2.35111   -26.58898 1.000 34.72795  ? 153  TRP A O     1 
ATOM   2022 C  CB    . TRP C 3  154 ? 30.47831 -0.41819  -26.55495 1.000 39.29913  ? 153  TRP A CB    1 
ATOM   2023 C  CG    . TRP C 3  154 ? 29.16263 -0.21220  -25.84000 1.000 39.15160  ? 153  TRP A CG    1 
ATOM   2024 C  CD1   . TRP C 3  154 ? 27.93960 -0.00417  -26.41028 1.000 40.10531  ? 153  TRP A CD1   1 
ATOM   2025 C  CD2   . TRP C 3  154 ? 28.94767 -0.20947  -24.42155 1.000 39.00203  ? 153  TRP A CD2   1 
ATOM   2026 N  NE1   . TRP C 3  154 ? 26.97622 0.12742   -25.43807 1.000 42.73047  ? 153  TRP A NE1   1 
ATOM   2027 C  CE2   . TRP C 3  154 ? 27.56910 0.00804   -24.20798 1.000 42.09143  ? 153  TRP A CE2   1 
ATOM   2028 C  CE3   . TRP C 3  154 ? 29.78642 -0.37338  -23.31170 1.000 38.76967  ? 153  TRP A CE3   1 
ATOM   2029 C  CZ2   . TRP C 3  154 ? 27.01114 0.06915   -22.92981 1.000 43.13225  ? 153  TRP A CZ2   1 
ATOM   2030 C  CZ3   . TRP C 3  154 ? 29.23079 -0.31629  -22.04551 1.000 34.33176  ? 153  TRP A CZ3   1 
ATOM   2031 C  CH2   . TRP C 3  154 ? 27.85684 -0.09828  -21.86631 1.000 42.58423  ? 153  TRP A CH2   1 
ATOM   2032 N  N     . LYS C 3  155 ? 29.86694 2.77335   -27.05368 1.000 40.07639  ? 154  LYS A N     1 
ATOM   2033 C  CA    . LYS C 3  155 ? 29.95685 4.15454   -26.60198 1.000 39.62405  ? 154  LYS A CA    1 
ATOM   2034 C  C     . LYS C 3  155 ? 29.97531 4.27427   -25.08583 1.000 41.73703  ? 154  LYS A C     1 
ATOM   2035 O  O     . LYS C 3  155 ? 30.46803 5.27808   -24.57063 1.000 37.16840  ? 154  LYS A O     1 
ATOM   2036 C  CB    . LYS C 3  155 ? 28.80902 4.98669   -27.18495 1.000 42.74097  ? 154  LYS A CB    1 
ATOM   2037 C  CG    . LYS C 3  155 ? 27.53107 4.96469   -26.38746 1.000 43.06938  ? 154  LYS A CG    1 
ATOM   2038 C  CD    . LYS C 3  155 ? 26.59131 6.10827   -26.77539 1.000 41.97732  ? 154  LYS A CD    1 
ATOM   2039 C  CE    . LYS C 3  155 ? 25.19310 5.83710   -26.21833 1.000 47.08472  ? 154  LYS A CE    1 
ATOM   2040 N  NZ    . LYS C 3  155 ? 24.30241 7.02158   -26.28142 1.000 50.81797  ? 154  LYS A NZ    1 
ATOM   2041 N  N     . GLY C 3  156 ? 29.48617 3.26579   -24.35448 1.000 45.78242  ? 155  GLY A N     1 
ATOM   2042 C  CA    . GLY C 3  156 ? 29.58786 3.30835   -22.90189 1.000 40.91229  ? 155  GLY A CA    1 
ATOM   2043 C  C     . GLY C 3  156 ? 30.96022 2.98137   -22.35348 1.000 36.41103  ? 155  GLY A C     1 
ATOM   2044 O  O     . GLY C 3  156 ? 31.25054 3.30812   -21.19328 1.000 35.61924  ? 155  GLY A O     1 
ATOM   2045 N  N     . SER C 3  157 ? 31.80757 2.34346   -23.16018 1.000 38.30097  ? 156  SER A N     1 
ATOM   2046 C  CA    . SER C 3  157 ? 33.07941 1.84365   -22.64169 1.000 35.54648  ? 156  SER A CA    1 
ATOM   2047 C  C     . SER C 3  157 ? 34.00218 2.94275   -22.13640 1.000 36.21752  ? 156  SER A C     1 
ATOM   2048 O  O     . SER C 3  157 ? 34.58126 2.76711   -21.05409 1.000 37.63208  ? 156  SER A O     1 
ATOM   2049 C  CB    . SER C 3  157 ? 33.77317 0.98726   -23.70498 1.000 33.99571  ? 156  SER A CB    1 
ATOM   2050 O  OG    . SER C 3  157 ? 33.09081 -0.23539  -23.88494 1.000 37.73077  ? 156  SER A OG    1 
ATOM   2051 N  N     . PRO C 3  158 ? 34.22697 4.05366   -22.85051 1.000 36.04888  ? 157  PRO A N     1 
ATOM   2052 C  CA    . PRO C 3  158 ? 35.20823 5.02614   -22.33994 1.000 34.17928  ? 157  PRO A CA    1 
ATOM   2053 C  C     . PRO C 3  158 ? 34.82777 5.58671   -20.98569 1.000 34.20701  ? 157  PRO A C     1 
ATOM   2054 O  O     . PRO C 3  158 ? 35.66828 5.62831   -20.08445 1.000 25.34126  ? 157  PRO A O     1 
ATOM   2055 C  CB    . PRO C 3  158 ? 35.23699 6.10414   -23.43738 1.000 36.45123  ? 157  PRO A CB    1 
ATOM   2056 C  CG    . PRO C 3  158 ? 34.83198 5.38755   -24.66612 1.000 34.32921  ? 157  PRO A CG    1 
ATOM   2057 C  CD    . PRO C 3  158 ? 33.76979 4.42941   -24.20249 1.000 36.21938  ? 157  PRO A CD    1 
ATOM   2058 N  N     . ALA C 3  159 ? 33.57566 6.00265   -20.80240 1.000 34.12762  ? 158  ALA A N     1 
ATOM   2059 C  CA    . ALA C 3  159 ? 33.20507 6.58664   -19.51934 1.000 33.55035  ? 158  ALA A CA    1 
ATOM   2060 C  C     . ALA C 3  159 ? 33.18561 5.52718   -18.42812 1.000 32.10261  ? 158  ALA A C     1 
ATOM   2061 O  O     . ALA C 3  159 ? 33.67204 5.77244   -17.31595 1.000 29.89682  ? 158  ALA A O     1 
ATOM   2062 C  CB    . ALA C 3  159 ? 31.85513 7.29238   -19.61454 1.000 27.86883  ? 158  ALA A CB    1 
ATOM   2063 N  N     . ILE C 3  160 ? 32.62074 4.34413   -18.71121 1.000 31.08105  ? 159  ILE A N     1 
ATOM   2064 C  CA    . ILE C 3  160 ? 32.59662 3.31459   -17.67833 1.000 29.72635  ? 159  ILE A CA    1 
ATOM   2065 C  C     . ILE C 3  160 ? 34.01661 2.93838   -17.28048 1.000 37.63109  ? 159  ILE A C     1 
ATOM   2066 O  O     . ILE C 3  160 ? 34.30873 2.71965   -16.09592 1.000 36.20019  ? 159  ILE A O     1 
ATOM   2067 C  CB    . ILE C 3  160 ? 31.77151 2.09823   -18.13718 1.000 28.75437  ? 159  ILE A CB    1 
ATOM   2068 C  CG1   . ILE C 3  160 ? 30.30094 2.51127   -18.21781 1.000 29.60769  ? 159  ILE A CG1   1 
ATOM   2069 C  CG2   . ILE C 3  160 ? 31.93537 0.95612   -17.16315 1.000 27.87751  ? 159  ILE A CG2   1 
ATOM   2070 C  CD1   . ILE C 3  160 ? 29.41567 1.50258   -18.82699 1.000 31.18492  ? 159  ILE A CD1   1 
ATOM   2071 N  N     . PHE C 3  161 ? 34.94752 2.95342   -18.23570 1.000 25.42916  ? 160  PHE A N     1 
ATOM   2072 C  CA    . PHE C 3  161 ? 36.31840 2.65328   -17.85927 1.000 28.43016  ? 160  PHE A CA    1 
ATOM   2073 C  C     . PHE C 3  161 ? 36.94220 3.78824   -17.05559 1.000 27.26156  ? 160  PHE A C     1 
ATOM   2074 O  O     . PHE C 3  161 ? 37.63495 3.53294   -16.07151 1.000 30.43193  ? 160  PHE A O     1 
ATOM   2075 C  CB    . PHE C 3  161 ? 37.19140 2.33621   -19.07581 1.000 24.61087  ? 160  PHE A CB    1 
ATOM   2076 C  CG    . PHE C 3  161 ? 38.56467 1.89793   -18.67469 1.000 26.78326  ? 160  PHE A CG    1 
ATOM   2077 C  CD1   . PHE C 3  161 ? 38.80323 0.57839   -18.36427 1.000 30.02103  ? 160  PHE A CD1   1 
ATOM   2078 C  CD2   . PHE C 3  161 ? 39.59447 2.81690   -18.49857 1.000 26.90504  ? 160  PHE A CD2   1 
ATOM   2079 C  CE1   . PHE C 3  161 ? 40.06052 0.16132   -17.93604 1.000 29.66472  ? 160  PHE A CE1   1 
ATOM   2080 C  CE2   . PHE C 3  161 ? 40.83809 2.39780   -18.06485 1.000 22.55540  ? 160  PHE A CE2   1 
ATOM   2081 C  CZ    . PHE C 3  161 ? 41.06577 1.06963   -17.78799 1.000 29.32604  ? 160  PHE A CZ    1 
ATOM   2082 N  N     . GLN C 3  162 ? 36.75629 5.04244   -17.48185 1.000 32.28692  ? 161  GLN A N     1 
ATOM   2083 C  CA    . GLN C 3  162 ? 37.37196 6.16103   -16.76824 1.000 29.15114  ? 161  GLN A CA    1 
ATOM   2084 C  C     . GLN C 3  162 ? 36.84299 6.26475   -15.33853 1.000 27.44393  ? 161  GLN A C     1 
ATOM   2085 O  O     . GLN C 3  162 ? 37.61531 6.43025   -14.38224 1.000 28.91596  ? 161  GLN A O     1 
ATOM   2086 C  CB    . GLN C 3  162 ? 37.14530 7.44581   -17.55701 1.000 27.87008  ? 161  GLN A CB    1 
ATOM   2087 C  CG    . GLN C 3  162 ? 37.94081 7.46256   -18.88459 1.000 23.07007  ? 161  GLN A CG    1 
ATOM   2088 C  CD    . GLN C 3  162 ? 37.25758 8.27536   -19.95801 1.000 30.22874  ? 161  GLN A CD    1 
ATOM   2089 O  OE1   . GLN C 3  162 ? 36.14759 8.78341   -19.75635 1.000 32.82741  ? 161  GLN A OE1   1 
ATOM   2090 N  NE2   . GLN C 3  162 ? 37.89794 8.38405   -21.11979 1.000 29.63266  ? 161  GLN A NE2   1 
ATOM   2091 N  N     . SER C 3  163 ? 35.53868 6.07671   -15.16802 1.000 26.54715  ? 162  SER A N     1 
ATOM   2092 C  CA    . SER C 3  163 ? 34.95506 6.04254   -13.83435 1.000 26.46027  ? 162  SER A CA    1 
ATOM   2093 C  C     . SER C 3  163 ? 35.46412 4.85419   -13.02144 1.000 30.28967  ? 162  SER A C     1 
ATOM   2094 O  O     . SER C 3  163 ? 35.75272 4.99691   -11.82313 1.000 29.40863  ? 162  SER A O     1 
ATOM   2095 C  CB    . SER C 3  163 ? 33.43629 5.99692   -13.94189 1.000 27.91747  ? 162  SER A CB    1 
ATOM   2096 O  OG    . SER C 3  163 ? 32.85539 5.89662   -12.66917 1.000 30.77211  ? 162  SER A OG    1 
ATOM   2097 N  N     . SER C 3  164 ? 35.56048 3.66340   -13.63876 1.000 29.82432  ? 163  SER A N     1 
ATOM   2098 C  CA    . SER C 3  164 ? 36.00362 2.49345   -12.88134 1.000 26.82793  ? 163  SER A CA    1 
ATOM   2099 C  C     . SER C 3  164 ? 37.45334 2.64014   -12.45445 1.000 26.64106  ? 163  SER A C     1 
ATOM   2100 O  O     . SER C 3  164 ? 37.80598 2.30861   -11.31539 1.000 28.01379  ? 163  SER A O     1 
ATOM   2101 C  CB    . SER C 3  164 ? 35.79687 1.21912   -13.69619 1.000 25.15444  ? 163  SER A CB    1 
ATOM   2102 O  OG    . SER C 3  164 ? 34.40968 1.04449   -13.99611 1.000 26.37215  ? 163  SER A OG    1 
ATOM   2103 N  N     . MET C 3  165 ? 38.29097 3.18369   -13.34261 1.000 26.54305  ? 164  MET A N     1 
ATOM   2104 C  CA    . MET C 3  165 ? 39.67370 3.50381   -13.00448 1.000 25.28174  ? 164  MET A CA    1 
ATOM   2105 C  C     . MET C 3  165 ? 39.74418 4.45862   -11.82235 1.000 30.29762  ? 164  MET A C     1 
ATOM   2106 O  O     . MET C 3  165 ? 40.58504 4.28810   -10.93086 1.000 31.35858  ? 164  MET A O     1 
ATOM   2107 C  CB    . MET C 3  165 ? 40.37274 4.10877   -14.22500 1.000 26.88502  ? 164  MET A CB    1 
ATOM   2108 C  CG    . MET C 3  165 ? 41.88106 4.30340   -14.08053 1.000 35.31271  ? 164  MET A CG    1 
ATOM   2109 S  SD    . MET C 3  165 ? 42.78173 2.76419   -13.77361 1.000 45.82011  ? 164  MET A SD    1 
ATOM   2110 C  CE    . MET C 3  165 ? 44.28114 3.11424   -14.67233 1.000 49.88762  ? 164  MET A CE    1 
ATOM   2111 N  N     . THR C 3  166 ? 38.86620 5.47140   -11.80187 1.000 32.52129  ? 165  THR A N     1 
ATOM   2112 C  CA    . THR C 3  166 ? 38.86744 6.43741   -10.70714 1.000 28.25878  ? 165  THR A CA    1 
ATOM   2113 C  C     . THR C 3  166 ? 38.48710 5.77599   -9.38082  1.000 30.01660  ? 165  THR A C     1 
ATOM   2114 O  O     . THR C 3  166 ? 39.16918 5.97553   -8.36704  1.000 33.51609  ? 165  THR A O     1 
ATOM   2115 C  CB    . THR C 3  166 ? 37.92605 7.61074   -11.03565 1.000 24.79681  ? 165  THR A CB    1 
ATOM   2116 O  OG1   . THR C 3  166 ? 38.39408 8.30314   -12.19724 1.000 26.76286  ? 165  THR A OG1   1 
ATOM   2117 C  CG2   . THR C 3  166 ? 37.89435 8.59617   -9.91329  1.000 23.06996  ? 165  THR A CG2   1 
ATOM   2118 N  N     . LYS C 3  167 ? 37.38214 5.00954   -9.35968  1.000 29.34570  ? 166  LYS A N     1 
ATOM   2119 C  CA    . LYS C 3  167 ? 37.02844 4.24069   -8.16270  1.000 30.36174  ? 166  LYS A CA    1 
ATOM   2120 C  C     . LYS C 3  167 ? 38.20079 3.37670   -7.69522  1.000 31.37119  ? 166  LYS A C     1 
ATOM   2121 O  O     . LYS C 3  167 ? 38.50710 3.31818   -6.49853  1.000 38.03973  ? 166  LYS A O     1 
ATOM   2122 C  CB    . LYS C 3  167 ? 35.80773 3.34228   -8.41142  1.000 41.51413  ? 166  LYS A CB    1 
ATOM   2123 C  CG    . LYS C 3  167 ? 34.50958 4.04469   -8.80962  1.000 59.48806  ? 166  LYS A CG    1 
ATOM   2124 C  CD    . LYS C 3  167 ? 33.96090 4.95347   -7.70593  1.000 71.53041  ? 166  LYS A CD    1 
ATOM   2125 C  CE    . LYS C 3  167 ? 32.81985 5.85729   -8.20802  1.000 73.79552  ? 166  LYS A CE    1 
ATOM   2126 N  NZ    . LYS C 3  167 ? 31.56167 5.12371   -8.52345  1.000 72.40226  ? 166  LYS A NZ    1 
ATOM   2127 N  N     . ILE C 3  168 ? 38.88471 2.71671   -8.63186  1.000 28.93412  ? 167  ILE A N     1 
ATOM   2128 C  CA    . ILE C 3  168 ? 39.97171 1.81716   -8.26764  1.000 25.81141  ? 167  ILE A CA    1 
ATOM   2129 C  C     . ILE C 3  168 ? 41.15006 2.59407   -7.68487  1.000 28.16654  ? 167  ILE A C     1 
ATOM   2130 O  O     . ILE C 3  168 ? 41.80735 2.13809   -6.74171  1.000 32.06423  ? 167  ILE A O     1 
ATOM   2131 C  CB    . ILE C 3  168 ? 40.38079 0.97521   -9.49143  1.000 25.24960  ? 167  ILE A CB    1 
ATOM   2132 C  CG1   . ILE C 3  168 ? 39.32172 -0.08316  -9.79182  1.000 22.81070  ? 167  ILE A CG1   1 
ATOM   2133 C  CG2   . ILE C 3  168 ? 41.78795 0.38314   -9.32884  1.000 22.29869  ? 167  ILE A CG2   1 
ATOM   2134 C  CD1   . ILE C 3  168 ? 39.58580 -0.83564  -11.08363 1.000 22.67212  ? 167  ILE A CD1   1 
ATOM   2135 N  N     . LEU C 3  169 ? 41.45243 3.76282   -8.23662  1.000 23.67015  ? 168  LEU A N     1 
ATOM   2136 C  CA    . LEU C 3  169 ? 42.56365 4.54319   -7.70294  1.000 24.31306  ? 168  LEU A CA    1 
ATOM   2137 C  C     . LEU C 3  169 ? 42.22150 5.26566   -6.40050  1.000 30.61811  ? 168  LEU A C     1 
ATOM   2138 O  O     . LEU C 3  169 ? 43.14131 5.71827   -5.70407  1.000 33.37503  ? 168  LEU A O     1 
ATOM   2139 C  CB    . LEU C 3  169 ? 43.04807 5.56674   -8.74357  1.000 25.33396  ? 168  LEU A CB    1 
ATOM   2140 C  CG    . LEU C 3  169 ? 43.85334 4.97114   -9.91004  1.000 26.72872  ? 168  LEU A CG    1 
ATOM   2141 C  CD1   . LEU C 3  169 ? 44.11083 6.00631   -11.00642 1.000 24.91581  ? 168  LEU A CD1   1 
ATOM   2142 C  CD2   . LEU C 3  169 ? 45.16161 4.37328   -9.40872  1.000 20.61535  ? 168  LEU A CD2   1 
ATOM   2143 N  N     . GLU C 3  170 ? 40.93540 5.40050   -6.05717  1.000 30.68586  ? 169  GLU A N     1 
ATOM   2144 C  CA    . GLU C 3  170 ? 40.58866 6.20343   -4.88065  1.000 36.01560  ? 169  GLU A CA    1 
ATOM   2145 C  C     . GLU C 3  170 ? 41.27128 5.73598   -3.59527  1.000 39.68338  ? 169  GLU A C     1 
ATOM   2146 O  O     . GLU C 3  170 ? 41.85818 6.58635   -2.90126  1.000 46.74893  ? 169  GLU A O     1 
ATOM   2147 C  CB    . GLU C 3  170 ? 39.06598 6.25767   -4.71521  1.000 40.41512  ? 169  GLU A CB    1 
ATOM   2148 C  CG    . GLU C 3  170 ? 38.56691 7.38403   -3.83090  1.000 50.55504  ? 169  GLU A CG    1 
ATOM   2149 C  CD    . GLU C 3  170 ? 38.40260 6.99829   -2.36910  1.000 64.70403  ? 169  GLU A CD    1 
ATOM   2150 O  OE1   . GLU C 3  170 ? 38.38727 7.92957   -1.53284  1.000 75.13689  ? 169  GLU A OE1   1 
ATOM   2151 O  OE2   . GLU C 3  170 ? 38.27627 5.78827   -2.04603  1.000 64.14790  ? 169  GLU A OE2   1 
ATOM   2152 N  N     . PRO C 3  171 ? 41.23313 4.44575   -3.20323  1.000 34.76769  ? 170  PRO A N     1 
ATOM   2153 C  CA    . PRO C 3  171 ? 41.90058 4.06379   -1.93736  1.000 32.58432  ? 170  PRO A CA    1 
ATOM   2154 C  C     . PRO C 3  171 ? 43.39298 4.35573   -1.93626  1.000 36.07424  ? 170  PRO A C     1 
ATOM   2155 O  O     . PRO C 3  171 ? 43.95767 4.74232   -0.89884  1.000 39.84864  ? 170  PRO A O     1 
ATOM   2156 C  CB    . PRO C 3  171 ? 41.62420 2.54739   -1.81553  1.000 25.99923  ? 170  PRO A CB    1 
ATOM   2157 C  CG    . PRO C 3  171 ? 40.47845 2.28835   -2.68011  1.000 26.92190  ? 170  PRO A CG    1 
ATOM   2158 C  CD    . PRO C 3  171 ? 40.56447 3.29156   -3.82908  1.000 28.28464  ? 170  PRO A CD    1 
ATOM   2159 N  N     . PHE C 3  172 ? 44.05376 4.17517   -3.08158  1.000 35.13965  ? 171  PHE A N     1 
ATOM   2160 C  CA    . PHE C 3  172 ? 45.47405 4.49157   -3.15584  1.000 36.53325  ? 171  PHE A CA    1 
ATOM   2161 C  C     . PHE C 3  172 ? 45.71045 5.99815   -3.04080  1.000 28.28493  ? 171  PHE A C     1 
ATOM   2162 O  O     . PHE C 3  172 ? 46.64445 6.43372   -2.34771  1.000 25.24628  ? 171  PHE A O     1 
ATOM   2163 C  CB    . PHE C 3  172 ? 46.07439 3.94008   -4.45105  1.000 22.49561  ? 171  PHE A CB    1 
ATOM   2164 C  CG    . PHE C 3  172 ? 47.54859 4.17065   -4.56239  1.000 23.49890  ? 171  PHE A CG    1 
ATOM   2165 C  CD1   . PHE C 3  172 ? 48.04874 5.38212   -5.05183  1.000 22.68205  ? 171  PHE A CD1   1 
ATOM   2166 C  CD2   . PHE C 3  172 ? 48.44531 3.19403   -4.15631  1.000 23.34971  ? 171  PHE A CD2   1 
ATOM   2167 C  CE1   . PHE C 3  172 ? 49.40312 5.59840   -5.14061  1.000 23.15148  ? 171  PHE A CE1   1 
ATOM   2168 C  CE2   . PHE C 3  172 ? 49.82443 3.40465   -4.24643  1.000 23.86661  ? 171  PHE A CE2   1 
ATOM   2169 C  CZ    . PHE C 3  172 ? 50.29743 4.60150   -4.73966  1.000 28.37767  ? 171  PHE A CZ    1 
ATOM   2170 N  N     . ARG C 3  173 ? 44.87133 6.80544   -3.70773  1.000 26.98778  ? 172  ARG A N     1 
ATOM   2171 C  CA    . ARG C 3  173 ? 45.03785 8.25348   -3.64561  1.000 26.64206  ? 172  ARG A CA    1 
ATOM   2172 C  C     . ARG C 3  173 ? 44.81725 8.75134   -2.23551  1.000 29.75142  ? 172  ARG A C     1 
ATOM   2173 O  O     . ARG C 3  173 ? 45.54279 9.63658   -1.77260  1.000 27.34836  ? 172  ARG A O     1 
ATOM   2174 C  CB    . ARG C 3  173 ? 44.10376 8.97452   -4.63497  1.000 27.64624  ? 172  ARG A CB    1 
ATOM   2175 C  CG    . ARG C 3  173 ? 44.65232 9.06664   -6.07975  1.000 21.61984  ? 172  ARG A CG    1 
ATOM   2176 C  CD    . ARG C 3  173 ? 43.77629 9.92267   -7.00800  1.000 28.79338  ? 172  ARG A CD    1 
ATOM   2177 N  NE    . ARG C 3  173 ? 44.30405 10.03038  -8.37232  1.000 25.95191  ? 172  ARG A NE    1 
ATOM   2178 C  CZ    . ARG C 3  173 ? 43.66077 9.60540   -9.45576  1.000 32.54951  ? 172  ARG A CZ    1 
ATOM   2179 N  NH1   . ARG C 3  173 ? 42.46077 9.05715   -9.33640  1.000 35.40032  ? 172  ARG A NH1   1 
ATOM   2180 N  NH2   . ARG C 3  173 ? 44.20001 9.73417   -10.66228 1.000 33.88005  ? 172  ARG A NH2   1 
ATOM   2181 N  N     . LYS C 3  174 ? 43.85024 8.15538   -1.52397  1.000 36.06059  ? 173  LYS A N     1 
ATOM   2182 C  CA    . LYS C 3  174 ? 43.59561 8.51050   -0.12757  1.000 38.32660  ? 173  LYS A CA    1 
ATOM   2183 C  C     . LYS C 3  174 ? 44.77523 8.14597   0.76237   1.000 42.10531  ? 173  LYS A C     1 
ATOM   2184 O  O     . LYS C 3  174 ? 45.18455 8.93860   1.61940   1.000 40.88540  ? 173  LYS A O     1 
ATOM   2185 C  CB    . LYS C 3  174 ? 42.33407 7.81439   0.37742   1.000 43.94931  ? 173  LYS A CB    1 
ATOM   2186 C  CG    . LYS C 3  174 ? 41.04281 8.47475   -0.01966  1.000 52.60026  ? 173  LYS A CG    1 
ATOM   2187 C  CD    . LYS C 3  174 ? 40.61600 9.51486   0.99403   1.000 58.21610  ? 173  LYS A CD    1 
ATOM   2188 C  CE    . LYS C 3  174 ? 39.33177 10.18693  0.54076   1.000 63.86409  ? 173  LYS A CE    1 
ATOM   2189 N  NZ    . LYS C 3  174 ? 39.41592 10.53360  -0.91281  1.000 67.11585  ? 173  LYS A NZ    1 
ATOM   2190 N  N     . GLN C 3  175 ? 45.32354 6.93447   0.59714   1.000 45.41752  ? 174  GLN A N     1 
ATOM   2191 C  CA    . GLN C 3  175 ? 46.49027 6.57311   1.39531   1.000 43.99781  ? 174  GLN A CA    1 
ATOM   2192 C  C     . GLN C 3  175 ? 47.72771 7.38345   1.01646   1.000 37.76253  ? 174  GLN A C     1 
ATOM   2193 O  O     . GLN C 3  175 ? 48.63874 7.51312   1.83529   1.000 36.29527  ? 174  GLN A O     1 
ATOM   2194 C  CB    . GLN C 3  175 ? 46.79205 5.08322   1.26159   1.000 45.97230  ? 174  GLN A CB    1 
ATOM   2195 C  CG    . GLN C 3  175 ? 47.71949 4.53549   2.34280   1.000 52.53087  ? 174  GLN A CG    1 
ATOM   2196 C  CD    . GLN C 3  175 ? 48.04467 3.05498   2.14957   1.000 59.20391  ? 174  GLN A CD    1 
ATOM   2197 O  OE1   . GLN C 3  175 ? 47.18562 2.25826   1.74431   1.000 61.51197  ? 174  GLN A OE1   1 
ATOM   2198 N  NE2   . GLN C 3  175 ? 49.29546 2.68487   2.42523   1.000 58.35981  ? 174  GLN A NE2   1 
ATOM   2199 N  N     . ASN C 3  176 ? 47.79275 7.91930   -0.19852  1.000 31.24457  ? 175  ASN A N     1 
ATOM   2200 C  CA    . ASN C 3  176 ? 48.98344 8.60595   -0.69030  1.000 34.93461  ? 175  ASN A CA    1 
ATOM   2201 C  C     . ASN C 3  176 ? 48.57828 9.96287   -1.25481  1.000 39.29154  ? 175  ASN A C     1 
ATOM   2202 O  O     . ASN C 3  176 ? 48.61643 10.18391  -2.47467  1.000 36.50776  ? 175  ASN A O     1 
ATOM   2203 C  CB    . ASN C 3  176 ? 49.69600 7.76196   -1.74419  1.000 37.95189  ? 175  ASN A CB    1 
ATOM   2204 C  CG    . ASN C 3  176 ? 50.01805 6.35686   -1.25540  1.000 40.24366  ? 175  ASN A CG    1 
ATOM   2205 O  OD1   . ASN C 3  176 ? 51.08446 6.11591   -0.70754  1.000 39.86267  ? 175  ASN A OD1   1 
ATOM   2206 N  ND2   . ASN C 3  176 ? 49.09702 5.42315   -1.46683  1.000 40.27850  ? 175  ASN A ND2   1 
ATOM   2207 N  N     . PRO C 3  177 ? 48.18743 10.90593  -0.38500  1.000 37.39007  ? 176  PRO A N     1 
ATOM   2208 C  CA    . PRO C 3  177 ? 47.73554 12.21768  -0.89057  1.000 36.51555  ? 176  PRO A CA    1 
ATOM   2209 C  C     . PRO C 3  177 ? 48.79831 12.96625  -1.65967  1.000 35.24364  ? 176  PRO A C     1 
ATOM   2210 O  O     . PRO C 3  177 ? 48.46072 13.77905  -2.52370  1.000 40.72131  ? 176  PRO A O     1 
ATOM   2211 C  CB    . PRO C 3  177 ? 47.34363 12.97337  0.38796   1.000 31.00215  ? 176  PRO A CB    1 
ATOM   2212 C  CG    . PRO C 3  177 ? 48.05810 12.26260  1.48705   1.000 29.30282  ? 176  PRO A CG    1 
ATOM   2213 C  CD    . PRO C 3  177 ? 48.14310 10.83596  1.08586   1.000 28.09358  ? 176  PRO A CD    1 
ATOM   2214 N  N     . ASP C 3  178 ? 50.07637 12.71887  -1.38621  1.000 32.95532  ? 177  ASP A N     1 
ATOM   2215 C  CA    . ASP C 3  178 ? 51.13410 13.52798  -1.96264  1.000 38.09939  ? 177  ASP A CA    1 
ATOM   2216 C  C     . ASP C 3  178 ? 51.86964 12.82723  -3.09985  1.000 37.08568  ? 177  ASP A C     1 
ATOM   2217 O  O     . ASP C 3  178 ? 52.97627 13.22885  -3.46017  1.000 43.67520  ? 177  ASP A O     1 
ATOM   2218 C  CB    . ASP C 3  178 ? 52.07947 13.97843  -0.85370  1.000 47.69797  ? 177  ASP A CB    1 
ATOM   2219 C  CG    . ASP C 3  178 ? 51.39404 14.94072  0.11422   1.000 56.59690  ? 177  ASP A CG    1 
ATOM   2220 O  OD1   . ASP C 3  178 ? 50.86574 15.97692  -0.34818  1.000 59.03883  ? 177  ASP A OD1   1 
ATOM   2221 O  OD2   . ASP C 3  178 ? 51.34270 14.65068  1.32555   1.000 60.45465  ? 177  ASP A OD2   1 
ATOM   2222 N  N     . ILE C 3  179 ? 51.26667 11.81257  -3.69720  1.000 31.30482  ? 178  ILE A N     1 
ATOM   2223 C  CA    . ILE C 3  179 ? 51.75850 11.24597  -4.93770  1.000 32.16884  ? 178  ILE A CA    1 
ATOM   2224 C  C     . ILE C 3  179 ? 50.76178 11.62320  -6.01674  1.000 33.23902  ? 178  ILE A C     1 
ATOM   2225 O  O     . ILE C 3  179 ? 49.56197 11.34758  -5.88674  1.000 33.32970  ? 178  ILE A O     1 
ATOM   2226 C  CB    . ILE C 3  179 ? 51.94967 9.73037   -4.83579  1.000 35.04260  ? 178  ILE A CB    1 
ATOM   2227 C  CG1   . ILE C 3  179 ? 53.31707 9.43807   -4.20442  1.000 37.74902  ? 178  ILE A CG1   1 
ATOM   2228 C  CG2   . ILE C 3  179 ? 51.84254 9.09144   -6.21113  1.000 26.38038  ? 178  ILE A CG2   1 
ATOM   2229 C  CD1   . ILE C 3  179 ? 53.30192 8.30880   -3.25896  1.000 36.62568  ? 178  ILE A CD1   1 
ATOM   2230 N  N     . VAL C 3  180 ? 51.24104 12.30778  -7.05068  1.000 29.61011  ? 179  VAL A N     1 
ATOM   2231 C  CA    . VAL C 3  180 ? 50.35584 12.82489  -8.08107  1.000 32.28474  ? 179  VAL A CA    1 
ATOM   2232 C  C     . VAL C 3  180 ? 50.23014 11.77674  -9.17702  1.000 33.71467  ? 179  VAL A C     1 
ATOM   2233 O  O     . VAL C 3  180 ? 51.23986 11.27414  -9.69172  1.000 22.39738  ? 179  VAL A O     1 
ATOM   2234 C  CB    . VAL C 3  180 ? 50.85560 14.17578  -8.63742  1.000 34.67286  ? 179  VAL A CB    1 
ATOM   2235 C  CG1   . VAL C 3  180 ? 52.32243 14.12383  -9.04040  1.000 33.39010  ? 179  VAL A CG1   1 
ATOM   2236 C  CG2   . VAL C 3  180 ? 50.03125 14.55647  -9.83237  1.000 35.32703  ? 179  VAL A CG2   1 
ATOM   2237 N  N     . ILE C 3  181 ? 48.98767 11.42226  -9.50712  1.000 29.34044  ? 180  ILE A N     1 
ATOM   2238 C  CA    . ILE C 3  181 ? 48.68692 10.42781  -10.53374 1.000 27.07612  ? 180  ILE A CA    1 
ATOM   2239 C  C     . ILE C 3  181 ? 47.79713 11.11052  -11.56240 1.000 25.95924  ? 180  ILE A C     1 
ATOM   2240 O  O     . ILE C 3  181 ? 46.59764 11.31156  -11.32502 1.000 29.16924  ? 180  ILE A O     1 
ATOM   2241 C  CB    . ILE C 3  181 ? 48.01666 9.17205   -9.95753  1.000 31.22436  ? 180  ILE A CB    1 
ATOM   2242 C  CG1   . ILE C 3  181 ? 48.79159 8.66640   -8.73304  1.000 27.77266  ? 180  ILE A CG1   1 
ATOM   2243 C  CG2   . ILE C 3  181 ? 47.90043 8.09330   -11.02355 1.000 20.65556  ? 180  ILE A CG2   1 
ATOM   2244 C  CD1   . ILE C 3  181 ? 48.25592 7.37390   -8.15402  1.000 28.04107  ? 180  ILE A CD1   1 
ATOM   2245 N  N     . TYR C 3  182 ? 48.39117 11.50999  -12.68508 1.000 24.29631  ? 181  TYR A N     1 
ATOM   2246 C  CA    . TYR C 3  182 ? 47.62831 11.92731  -13.85939 1.000 27.18050  ? 181  TYR A CA    1 
ATOM   2247 C  C     . TYR C 3  182 ? 47.11060 10.67868  -14.57194 1.000 28.33973  ? 181  TYR A C     1 
ATOM   2248 O  O     . TYR C 3  182 ? 47.89914 9.82674   -14.98794 1.000 29.05558  ? 181  TYR A O     1 
ATOM   2249 C  CB    . TYR C 3  182 ? 48.49233 12.77883  -14.79382 1.000 27.91446  ? 181  TYR A CB    1 
ATOM   2250 C  CG    . TYR C 3  182 ? 48.46482 14.27501  -14.48661 1.000 27.68814  ? 181  TYR A CG    1 
ATOM   2251 C  CD1   . TYR C 3  182 ? 49.22376 14.81637  -13.44510 1.000 28.14339  ? 181  TYR A CD1   1 
ATOM   2252 C  CD2   . TYR C 3  182 ? 47.67354 15.14015  -15.23683 1.000 27.42701  ? 181  TYR A CD2   1 
ATOM   2253 C  CE1   . TYR C 3  182 ? 49.18867 16.18264  -13.16130 1.000 31.86839  ? 181  TYR A CE1   1 
ATOM   2254 C  CE2   . TYR C 3  182 ? 47.63275 16.50547  -14.97170 1.000 29.89733  ? 181  TYR A CE2   1 
ATOM   2255 C  CZ    . TYR C 3  182 ? 48.38936 17.02060  -13.94119 1.000 32.82098  ? 181  TYR A CZ    1 
ATOM   2256 O  OH    . TYR C 3  182 ? 48.34713 18.36679  -13.69162 1.000 32.38628  ? 181  TYR A OH    1 
ATOM   2257 N  N     . GLN C 3  183 ? 45.78911 10.57396  -14.69334 1.000 27.80735  ? 182  GLN A N     1 
ATOM   2258 C  CA    . GLN C 3  183 ? 45.07222 9.37416   -15.12004 1.000 25.92851  ? 182  GLN A CA    1 
ATOM   2259 C  C     . GLN C 3  183 ? 44.38389 9.68318   -16.44749 1.000 33.29297  ? 182  GLN A C     1 
ATOM   2260 O  O     . GLN C 3  183 ? 43.30708 10.29010  -16.45916 1.000 35.63177  ? 182  GLN A O     1 
ATOM   2261 C  CB    . GLN C 3  183 ? 44.06505 8.98356   -14.03912 1.000 23.79557  ? 182  GLN A CB    1 
ATOM   2262 C  CG    . GLN C 3  183 ? 42.95788 8.01981   -14.43782 1.000 21.56255  ? 182  GLN A CG    1 
ATOM   2263 C  CD    . GLN C 3  183 ? 41.82825 8.01587   -13.40963 1.000 26.80976  ? 182  GLN A CD    1 
ATOM   2264 O  OE1   . GLN C 3  183 ? 42.01219 8.44615   -12.25370 1.000 25.48655  ? 182  GLN A OE1   1 
ATOM   2265 N  NE2   . GLN C 3  183 ? 40.65252 7.54408   -13.82175 1.000 27.51601  ? 182  GLN A NE2   1 
ATOM   2266 N  N     . TYR C 3  184 ? 44.99873 9.31188   -17.57334 1.000 31.31685  ? 183  TYR A N     1 
ATOM   2267 C  CA    . TYR C 3  184 ? 44.39536 9.60944   -18.87179 1.000 33.28728  ? 183  TYR A CA    1 
ATOM   2268 C  C     . TYR C 3  184 ? 44.06331 8.29022   -19.55016 1.000 30.82418  ? 183  TYR A C     1 
ATOM   2269 O  O     . TYR C 3  184 ? 44.89222 7.61474   -20.16863 1.000 32.80617  ? 183  TYR A O     1 
ATOM   2270 C  CB    . TYR C 3  184 ? 45.24057 10.50004  -19.76103 1.000 30.97647  ? 183  TYR A CB    1 
ATOM   2271 C  CG    . TYR C 3  184 ? 44.41868 10.95550  -20.93624 1.000 27.92663  ? 183  TYR A CG    1 
ATOM   2272 C  CD1   . TYR C 3  184 ? 43.61292 12.08908  -20.85529 1.000 24.22687  ? 183  TYR A CD1   1 
ATOM   2273 C  CD2   . TYR C 3  184 ? 44.40678 10.22666  -22.10326 1.000 22.59752  ? 183  TYR A CD2   1 
ATOM   2274 C  CE1   . TYR C 3  184 ? 42.83900 12.49486  -21.94352 1.000 27.57948  ? 183  TYR A CE1   1 
ATOM   2275 C  CE2   . TYR C 3  184 ? 43.65701 10.62052  -23.19976 1.000 23.97581  ? 183  TYR A CE2   1 
ATOM   2276 C  CZ    . TYR C 3  184 ? 42.87075 11.74432  -23.11872 1.000 26.78628  ? 183  TYR A CZ    1 
ATOM   2277 O  OH    . TYR C 3  184 ? 42.11326 12.10135  -24.20342 1.000 27.31936  ? 183  TYR A OH    1 
ATOM   2278 N  N     . MET C 3  185 ? 42.82552 7.92492   -19.32929 1.000 32.59101  ? 184  MET A N     1 
ATOM   2279 C  CA    . MET C 3  185 ? 42.09411 6.73017   -19.70825 1.000 38.80396  ? 184  MET A CA    1 
ATOM   2280 C  C     . MET C 3  185 ? 42.61539 5.44588   -19.07532 1.000 47.56826  ? 184  MET A C     1 
ATOM   2281 O  O     . MET C 3  185 ? 41.95030 4.92377   -18.18819 1.000 55.58571  ? 184  MET A O     1 
ATOM   2282 C  CB    . MET C 3  185 ? 42.16169 6.55289   -21.22606 1.000 35.52380  ? 184  MET A CB    1 
ATOM   2283 C  CG    . MET C 3  185 ? 41.51081 5.27314   -21.70257 1.000 41.57757  ? 184  MET A CG    1 
ATOM   2284 S  SD    . MET C 3  185 ? 39.72652 5.50932   -21.87503 1.000 47.74847  ? 184  MET A SD    1 
ATOM   2285 C  CE    . MET C 3  185 ? 39.72491 6.69968   -23.21613 1.000 40.01474  ? 184  MET A CE    1 
ATOM   2286 N  N     . ASP C 3  186 ? 43.88145 5.10467   -19.26063 1.000 44.21238  ? 185  ASP A N     1 
ATOM   2287 C  CA    . ASP C 3  186 ? 44.43909 3.93850   -18.58657 1.000 44.11777  ? 185  ASP A CA    1 
ATOM   2288 C  C     . ASP C 3  186 ? 45.93371 4.13769   -18.49513 1.000 39.76717  ? 185  ASP A C     1 
ATOM   2289 O  O     . ASP C 3  186 ? 46.67237 3.25459   -18.04923 1.000 35.19181  ? 185  ASP A O     1 
ATOM   2290 C  CB    . ASP C 3  186 ? 44.10778 2.62783   -19.29687 1.000 46.04452  ? 185  ASP A CB    1 
ATOM   2291 C  CG    . ASP C 3  186 ? 44.87253 2.45814   -20.59243 1.000 46.40025  ? 185  ASP A CG    1 
ATOM   2292 O  OD1   . ASP C 3  186 ? 45.06227 3.48965   -21.29520 1.000 49.85724  ? 185  ASP A OD1   1 
ATOM   2293 O  OD2   . ASP C 3  186 ? 45.26819 1.29939   -20.89991 1.000 33.02100  ? 185  ASP A OD2   1 
ATOM   2294 N  N     . ASP C 3  187 ? 46.38383 5.28432   -18.97515 1.000 35.95316  ? 186  ASP A N     1 
ATOM   2295 C  CA    . ASP C 3  187 ? 47.77859 5.64081   -18.87489 1.000 39.84825  ? 186  ASP A CA    1 
ATOM   2296 C  C     . ASP C 3  187 ? 47.94542 6.48104   -17.61953 1.000 37.20182  ? 186  ASP A C     1 
ATOM   2297 O  O     . ASP C 3  187 ? 47.19004 7.43433   -17.39880 1.000 35.05519  ? 186  ASP A O     1 
ATOM   2298 C  CB    . ASP C 3  187 ? 48.22965 6.38882   -20.12277 1.000 46.54296  ? 186  ASP A CB    1 
ATOM   2299 C  CG    . ASP C 3  187 ? 49.71466 6.43141   -20.24424 1.000 54.61721  ? 186  ASP A CG    1 
ATOM   2300 O  OD1   . ASP C 3  187 ? 50.27010 7.48705   -19.86008 1.000 56.74981  ? 186  ASP A OD1   1 
ATOM   2301 O  OD2   . ASP C 3  187 ? 50.31726 5.40138   -20.68249 1.000 51.62118  ? 186  ASP A OD2   1 
ATOM   2302 N  N     . LEU C 3  188 ? 48.90222 6.10240   -16.78335 1.000 35.71755  ? 187  LEU A N     1 
ATOM   2303 C  CA    . LEU C 3  188 ? 49.13225 6.75064   -15.50270 1.000 37.04766  ? 187  LEU A CA    1 
ATOM   2304 C  C     . LEU C 3  188 ? 50.50658 7.40423   -15.50734 1.000 35.01609  ? 187  LEU A C     1 
ATOM   2305 O  O     . LEU C 3  188 ? 51.52707 6.71180   -15.60192 1.000 33.37789  ? 187  LEU A O     1 
ATOM   2306 C  CB    . LEU C 3  188 ? 49.01973 5.73546   -14.36546 1.000 34.89820  ? 187  LEU A CB    1 
ATOM   2307 C  CG    . LEU C 3  188 ? 47.68266 5.00536   -14.33982 1.000 30.64493  ? 187  LEU A CG    1 
ATOM   2308 C  CD1   . LEU C 3  188 ? 47.64554 3.97968   -13.19848 1.000 29.43289  ? 187  LEU A CD1   1 
ATOM   2309 C  CD2   . LEU C 3  188 ? 46.55418 6.02049   -14.20121 1.000 24.38019  ? 187  LEU A CD2   1 
ATOM   2310 N  N     . TYR C 3  189 ? 50.53050 8.73400   -15.41635 1.000 29.20740  ? 188  TYR A N     1 
ATOM   2311 C  CA    . TYR C 3  189 ? 51.74507 9.45758   -15.06370 1.000 27.56631  ? 188  TYR A CA    1 
ATOM   2312 C  C     . TYR C 3  189 ? 51.75350 9.56821   -13.54783 1.000 21.97060  ? 188  TYR A C     1 
ATOM   2313 O  O     . TYR C 3  189 ? 50.75591 9.96826   -12.95028 1.000 24.23135  ? 188  TYR A O     1 
ATOM   2314 C  CB    . TYR C 3  189 ? 51.76396 10.83013  -15.74871 1.000 29.38882  ? 188  TYR A CB    1 
ATOM   2315 C  CG    . TYR C 3  189 ? 52.76452 11.84627  -15.21710 1.000 26.45106  ? 188  TYR A CG    1 
ATOM   2316 C  CD1   . TYR C 3  189 ? 52.56979 12.46611  -13.98940 1.000 25.64042  ? 188  TYR A CD1   1 
ATOM   2317 C  CD2   . TYR C 3  189 ? 53.88253 12.20881  -15.96772 1.000 27.25896  ? 188  TYR A CD2   1 
ATOM   2318 C  CE1   . TYR C 3  189 ? 53.47579 13.37263  -13.49618 1.000 33.58002  ? 188  TYR A CE1   1 
ATOM   2319 C  CE2   . TYR C 3  189 ? 54.78870 13.12409  -15.49376 1.000 28.56950  ? 188  TYR A CE2   1 
ATOM   2320 C  CZ    . TYR C 3  189 ? 54.57887 13.71609  -14.25606 1.000 36.96672  ? 188  TYR A CZ    1 
ATOM   2321 O  OH    . TYR C 3  189 ? 55.46517 14.64554  -13.75727 1.000 45.10874  ? 188  TYR A OH    1 
ATOM   2322 N  N     . VAL C 3  190 ? 52.85630 9.19333   -12.92055 1.000 22.64178  ? 189  VAL A N     1 
ATOM   2323 C  CA    . VAL C 3  190 ? 52.96323 9.17980   -11.46697 1.000 30.19368  ? 189  VAL A CA    1 
ATOM   2324 C  C     . VAL C 3  190 ? 54.19740 9.96110   -11.05424 1.000 31.77422  ? 189  VAL A C     1 
ATOM   2325 O  O     . VAL C 3  190 ? 55.31925 9.59126   -11.42263 1.000 33.28925  ? 189  VAL A O     1 
ATOM   2326 C  CB    . VAL C 3  190 ? 53.05222 7.75605   -10.91119 1.000 28.25349  ? 189  VAL A CB    1 
ATOM   2327 C  CG1   . VAL C 3  190 ? 53.02251 7.81579   -9.38745  1.000 25.37554  ? 189  VAL A CG1   1 
ATOM   2328 C  CG2   . VAL C 3  190 ? 51.93806 6.88764   -11.49282 1.000 30.87149  ? 189  VAL A CG2   1 
ATOM   2329 N  N     . GLY C 3  191 ? 53.99969 11.00500  -10.25969 1.000 31.01680  ? 190  GLY A N     1 
ATOM   2330 C  CA    . GLY C 3  191 ? 55.09817 11.83691  -9.81353  1.000 27.36556  ? 190  GLY A CA    1 
ATOM   2331 C  C     . GLY C 3  191 ? 55.11477 11.95381  -8.30771  1.000 29.80827  ? 190  GLY A C     1 
ATOM   2332 O  O     . GLY C 3  191 ? 54.07851 11.87306  -7.64278  1.000 35.34215  ? 190  GLY A O     1 
ATOM   2333 N  N     . SER C 3  192 ? 56.31851 12.14596  -7.77255  1.000 29.29580  ? 191  SER A N     1 
ATOM   2334 C  CA    . SER C 3  192 ? 56.49033 12.17037  -6.32564  1.000 33.09143  ? 191  SER A CA    1 
ATOM   2335 C  C     . SER C 3  192 ? 57.69986 13.01967  -5.94386  1.000 35.22644  ? 191  SER A C     1 
ATOM   2336 O  O     . SER C 3  192 ? 58.60080 13.26976  -6.75190  1.000 29.84837  ? 191  SER A O     1 
ATOM   2337 C  CB    . SER C 3  192 ? 56.64541 10.75390  -5.75672  1.000 28.09118  ? 191  SER A CB    1 
ATOM   2338 O  OG    . SER C 3  192 ? 57.98054 10.28236  -5.89786  1.000 29.83157  ? 191  SER A OG    1 
ATOM   2339 N  N     . ASP C 3  193 ? 57.71847 13.43585  -4.67916  1.000 30.29794  ? 192  ASP A N     1 
ATOM   2340 C  CA    . ASP C 3  193 ? 58.84133 14.17272  -4.11430  1.000 43.53616  ? 192  ASP A CA    1 
ATOM   2341 C  C     . ASP C 3  193 ? 59.75289 13.27372  -3.28386  1.000 39.37255  ? 192  ASP A C     1 
ATOM   2342 O  O     . ASP C 3  193 ? 60.41777 13.74012  -2.35094  1.000 38.59665  ? 192  ASP A O     1 
ATOM   2343 C  CB    . ASP C 3  193 ? 58.32956 15.35174  -3.29275  1.000 41.12151  ? 192  ASP A CB    1 
ATOM   2344 C  CG    . ASP C 3  193 ? 57.46495 16.29317  -4.11671  1.000 46.30047  ? 192  ASP A CG    1 
ATOM   2345 O  OD1   . ASP C 3  193 ? 57.90791 16.71714  -5.21406  1.000 48.03466  ? 192  ASP A OD1   1 
ATOM   2346 O  OD2   . ASP C 3  193 ? 56.33867 16.59356  -3.67430  1.000 46.35762  ? 192  ASP A OD2   1 
ATOM   2347 N  N     . LEU C 3  194 ? 59.80057 11.99101  -3.63126  1.000 37.33045  ? 193  LEU A N     1 
ATOM   2348 C  CA    . LEU C 3  194 ? 60.63638 10.99188  -2.98795  1.000 36.97405  ? 193  LEU A CA    1 
ATOM   2349 C  C     . LEU C 3  194 ? 61.93024 10.78636  -3.76433  1.000 35.49733  ? 193  LEU A C     1 
ATOM   2350 O  O     . LEU C 3  194 ? 62.00434 11.03551  -4.97122  1.000 34.74514  ? 193  LEU A O     1 
ATOM   2351 C  CB    . LEU C 3  194 ? 59.87510 9.66795   -2.88113  1.000 37.01534  ? 193  LEU A CB    1 
ATOM   2352 C  CG    . LEU C 3  194 ? 58.45711 9.85773   -2.33125  1.000 32.27173  ? 193  LEU A CG    1 
ATOM   2353 C  CD1   . LEU C 3  194 ? 57.62273 8.61516   -2.52687  1.000 31.06162  ? 193  LEU A CD1   1 
ATOM   2354 C  CD2   . LEU C 3  194 ? 58.52558 10.25142  -0.84595  1.000 36.41019  ? 193  LEU A CD2   1 
ATOM   2355 N  N     . GLU C 3  195 ? 62.95532 10.32949  -3.05193  1.000 40.38155  ? 194  GLU A N     1 
ATOM   2356 C  CA    . GLU C 3  195 ? 64.14349 9.80983   -3.70635  1.000 45.81431  ? 194  GLU A CA    1 
ATOM   2357 C  C     . GLU C 3  195 ? 63.76677 8.60127   -4.56534  1.000 48.24529  ? 194  GLU A C     1 
ATOM   2358 O  O     . GLU C 3  195 ? 62.69067 8.00722   -4.41623  1.000 46.46191  ? 194  GLU A O     1 
ATOM   2359 C  CB    . GLU C 3  195 ? 65.18728 9.42508   -2.66701  1.000 61.01193  ? 194  GLU A CB    1 
ATOM   2360 C  CG    . GLU C 3  195 ? 66.61257 9.72601   -3.06686  1.000 77.49654  ? 194  GLU A CG    1 
ATOM   2361 C  CD    . GLU C 3  195 ? 66.97814 11.18491  -2.85830  1.000 87.60095  ? 194  GLU A CD    1 
ATOM   2362 O  OE1   . GLU C 3  195 ? 67.43079 11.83367  -3.82680  1.000 89.38542  ? 194  GLU A OE1   1 
ATOM   2363 O  OE2   . GLU C 3  195 ? 66.81583 11.68103  -1.72177  1.000 90.84295  ? 194  GLU A OE2   1 
ATOM   2364 N  N     . ILE C 3  196 ? 64.67286 8.22668   -5.47275  1.000 50.03720  ? 195  ILE A N     1 
ATOM   2365 C  CA    . ILE C 3  196 ? 64.30076 7.28640   -6.52881  1.000 42.92568  ? 195  ILE A CA    1 
ATOM   2366 C  C     . ILE C 3  196 ? 63.96207 5.90774   -5.94987  1.000 38.87928  ? 195  ILE A C     1 
ATOM   2367 O  O     . ILE C 3  196 ? 62.99426 5.27046   -6.37936  1.000 34.92637  ? 195  ILE A O     1 
ATOM   2368 C  CB    . ILE C 3  196 ? 65.40238 7.23500   -7.61235  1.000 37.82901  ? 195  ILE A CB    1 
ATOM   2369 C  CG1   . ILE C 3  196 ? 64.95326 6.40289   -8.81150  1.000 36.61475  ? 195  ILE A CG1   1 
ATOM   2370 C  CG2   . ILE C 3  196 ? 66.71555 6.72463   -7.06001  1.000 40.22950  ? 195  ILE A CG2   1 
ATOM   2371 C  CD1   . ILE C 3  196 ? 63.61897 6.88694   -9.41622  1.000 40.28611  ? 195  ILE A CD1   1 
ATOM   2372 N  N     . GLY C 3  197 ? 64.70646 5.44603   -4.94190  1.000 38.27587  ? 196  GLY A N     1 
ATOM   2373 C  CA    . GLY C 3  197 ? 64.42413 4.13211   -4.37712  1.000 38.24056  ? 196  GLY A CA    1 
ATOM   2374 C  C     . GLY C 3  197 ? 63.05530 4.04726   -3.72498  1.000 45.55797  ? 196  GLY A C     1 
ATOM   2375 O  O     . GLY C 3  197 ? 62.27601 3.11720   -3.97860  1.000 48.25325  ? 196  GLY A O     1 
ATOM   2376 N  N     . GLN C 3  198 ? 62.74348 5.01977   -2.86918  1.000 42.70807  ? 197  GLN A N     1 
ATOM   2377 C  CA    . GLN C 3  198 ? 61.42773 5.06608   -2.24437  1.000 41.39811  ? 197  GLN A CA    1 
ATOM   2378 C  C     . GLN C 3  198 ? 60.32086 5.29848   -3.27448  1.000 37.32615  ? 197  GLN A C     1 
ATOM   2379 O  O     . GLN C 3  198 ? 59.22431 4.74189   -3.13870  1.000 34.31841  ? 197  GLN A O     1 
ATOM   2380 C  CB    . GLN C 3  198 ? 61.42354 6.14066   -1.16190  1.000 45.07510  ? 197  GLN A CB    1 
ATOM   2381 C  CG    . GLN C 3  198 ? 60.16756 6.21969   -0.33499  1.000 46.87352  ? 197  GLN A CG    1 
ATOM   2382 C  CD    . GLN C 3  198 ? 60.29840 7.23367   0.79289   1.000 54.98298  ? 197  GLN A CD    1 
ATOM   2383 O  OE1   . GLN C 3  198 ? 61.40320 7.68542   1.12588   1.000 53.82774  ? 197  GLN A OE1   1 
ATOM   2384 N  NE2   . GLN C 3  198 ? 59.16808 7.60191   1.38246   1.000 58.37136  ? 197  GLN A NE2   1 
ATOM   2385 N  N     . HIS C 3  199 ? 60.58934 6.08357   -4.32338  1.000 36.90766  ? 198  HIS A N     1 
ATOM   2386 C  CA    . HIS C 3  199 ? 59.59678 6.25124   -5.38184  1.000 31.12492  ? 198  HIS A CA    1 
ATOM   2387 C  C     . HIS C 3  199 ? 59.28461 4.91567   -6.04066  1.000 36.52584  ? 198  HIS A C     1 
ATOM   2388 O  O     . HIS C 3  199 ? 58.11465 4.56051   -6.22704  1.000 29.06230  ? 198  HIS A O     1 
ATOM   2389 C  CB    . HIS C 3  199 ? 60.08412 7.27064   -6.41920  1.000 31.13187  ? 198  HIS A CB    1 
ATOM   2390 C  CG    . HIS C 3  199 ? 59.25295 7.31921   -7.66917  1.000 29.56205  ? 198  HIS A CG    1 
ATOM   2391 N  ND1   . HIS C 3  199 ? 58.11309 8.08732   -7.78005  1.000 28.34355  ? 198  HIS A ND1   1 
ATOM   2392 C  CD2   . HIS C 3  199 ? 59.40285 6.69798   -8.86769  1.000 29.25519  ? 198  HIS A CD2   1 
ATOM   2393 C  CE1   . HIS C 3  199 ? 57.59662 7.93810   -8.99009  1.000 31.91561  ? 198  HIS A CE1   1 
ATOM   2394 N  NE2   . HIS C 3  199 ? 58.35503 7.09272   -9.66682  1.000 27.84948  ? 198  HIS A NE2   1 
ATOM   2395 N  N     . ARG C 3  200 ? 60.32748 4.15926   -6.39621  1.000 38.12346  ? 199  ARG A N     1 
ATOM   2396 C  CA    . ARG C 3  200 ? 60.11915 2.86965   -7.05046  1.000 41.34986  ? 199  ARG A CA    1 
ATOM   2397 C  C     . ARG C 3  200 ? 59.34168 1.92235   -6.15121  1.000 35.58142  ? 199  ARG A C     1 
ATOM   2398 O  O     . ARG C 3  200 ? 58.44924 1.20561   -6.61358  1.000 33.43470  ? 199  ARG A O     1 
ATOM   2399 C  CB    . ARG C 3  200 ? 61.46074 2.26297   -7.44988  1.000 49.15965  ? 199  ARG A CB    1 
ATOM   2400 C  CG    . ARG C 3  200 ? 62.21933 3.11083   -8.44305  1.000 58.99169  ? 199  ARG A CG    1 
ATOM   2401 C  CD    . ARG C 3  200 ? 62.92806 2.25962   -9.46276  1.000 69.80230  ? 199  ARG A CD    1 
ATOM   2402 N  NE    . ARG C 3  200 ? 63.20428 2.99558   -10.69390 1.000 74.42217  ? 199  ARG A NE    1 
ATOM   2403 C  CZ    . ARG C 3  200 ? 64.42615 3.31582   -11.10163 1.000 76.81013  ? 199  ARG A CZ    1 
ATOM   2404 N  NH1   . ARG C 3  200 ? 65.48169 2.95699   -10.37133 1.000 76.66667  ? 199  ARG A NH1   1 
ATOM   2405 N  NH2   . ARG C 3  200 ? 64.59141 3.98790   -12.23699 1.000 75.58478  ? 199  ARG A NH2   1 
ATOM   2406 N  N     . THR C 3  201 ? 59.65972 1.91478   -4.85813  1.000 38.25326  ? 200  THR A N     1 
ATOM   2407 C  CA    . THR C 3  201 ? 58.87019 1.12947   -3.91147  1.000 37.93664  ? 200  THR A CA    1 
ATOM   2408 C  C     . THR C 3  201 ? 57.39102 1.52775   -3.94030  1.000 36.55518  ? 200  THR A C     1 
ATOM   2409 O  O     . THR C 3  201 ? 56.50032 0.66250   -3.95636  1.000 31.11158  ? 200  THR A O     1 
ATOM   2410 C  CB    . THR C 3  201 ? 59.45719 1.29603   -2.51949  1.000 42.20205  ? 200  THR A CB    1 
ATOM   2411 O  OG1   . THR C 3  201 ? 60.49436 0.32450   -2.33798  1.000 44.06603  ? 200  THR A OG1   1 
ATOM   2412 C  CG2   . THR C 3  201 ? 58.37987 1.14417   -1.45039  1.000 44.65762  ? 200  THR A CG2   1 
ATOM   2413 N  N     . LYS C 3  202 ? 57.11021 2.84108   -3.94265  1.000 31.97491  ? 201  LYS A N     1 
ATOM   2414 C  CA    . LYS C 3  202 ? 55.72722 3.29783   -4.02093  1.000 28.01742  ? 201  LYS A CA    1 
ATOM   2415 C  C     . LYS C 3  202 ? 55.07944 2.86438   -5.33057  1.000 32.85297  ? 201  LYS A C     1 
ATOM   2416 O  O     . LYS C 3  202 ? 53.88383 2.55291   -5.37053  1.000 33.89464  ? 201  LYS A O     1 
ATOM   2417 C  CB    . LYS C 3  202 ? 55.64965 4.82461   -3.87265  1.000 27.99963  ? 201  LYS A CB    1 
ATOM   2418 C  CG    . LYS C 3  202 ? 54.77945 5.28830   -2.69693  1.000 32.27565  ? 201  LYS A CG    1 
ATOM   2419 C  CD    . LYS C 3  202 ? 55.42950 4.87670   -1.36757  1.000 39.89244  ? 201  LYS A CD    1 
ATOM   2420 C  CE    . LYS C 3  202 ? 54.59224 5.23727   -0.15011  1.000 38.33917  ? 201  LYS A CE    1 
ATOM   2421 N  NZ    . LYS C 3  202 ? 53.24516 4.63690   -0.22112  1.000 35.58836  ? 201  LYS A NZ    1 
ATOM   2422 N  N     . ILE C 3  203 ? 55.85150 2.85341   -6.41613  1.000 28.04755  ? 202  ILE A N     1 
ATOM   2423 C  CA    . ILE C 3  203 ? 55.31618 2.42117   -7.69947  1.000 25.98387  ? 202  ILE A CA    1 
ATOM   2424 C  C     . ILE C 3  203 ? 54.92192 0.95750   -7.62853  1.000 28.08599  ? 202  ILE A C     1 
ATOM   2425 O  O     . ILE C 3  203 ? 53.88460 0.54843   -8.16816  1.000 26.21294  ? 202  ILE A O     1 
ATOM   2426 C  CB    . ILE C 3  203 ? 56.33425 2.67046   -8.82682  1.000 30.50323  ? 202  ILE A CB    1 
ATOM   2427 C  CG1   . ILE C 3  203 ? 56.43185 4.16342   -9.12973  1.000 33.42934  ? 202  ILE A CG1   1 
ATOM   2428 C  CG2   . ILE C 3  203 ? 55.89489 1.95014   -10.07779 1.000 28.51059  ? 202  ILE A CG2   1 
ATOM   2429 C  CD1   . ILE C 3  203 ? 55.10387 4.80337   -9.45141  1.000 27.46207  ? 202  ILE A CD1   1 
ATOM   2430 N  N     . GLU C 3  204 ? 55.74375 0.14699   -6.95812  1.000 26.94401  ? 203  GLU A N     1 
ATOM   2431 C  CA    . GLU C 3  204 ? 55.39486 -1.25201  -6.77203  1.000 26.97154  ? 203  GLU A CA    1 
ATOM   2432 C  C     . GLU C 3  204 ? 54.13113 -1.39457  -5.93369  1.000 28.50267  ? 203  GLU A C     1 
ATOM   2433 O  O     . GLU C 3  204 ? 53.27837 -2.23989  -6.22539  1.000 32.80077  ? 203  GLU A O     1 
ATOM   2434 C  CB    . GLU C 3  204 ? 56.56324 -2.01654  -6.15123  1.000 29.71011  ? 203  GLU A CB    1 
ATOM   2435 C  CG    . GLU C 3  204 ? 57.72742 -2.20545  -7.12229  1.000 42.36620  ? 203  GLU A CG    1 
ATOM   2436 C  CD    . GLU C 3  204 ? 57.25430 -2.61893  -8.52225  1.000 52.14574  ? 203  GLU A CD    1 
ATOM   2437 O  OE1   . GLU C 3  204 ? 56.57339 -3.66230  -8.64000  1.000 54.43291  ? 203  GLU A OE1   1 
ATOM   2438 O  OE2   . GLU C 3  204 ? 57.53821 -1.88600  -9.49753  1.000 54.97637  ? 203  GLU A OE2   1 
ATOM   2439 N  N     . GLU C 3  205 ? 53.98019 -0.56766  -4.89920  1.000 27.54533  ? 204  GLU A N     1 
ATOM   2440 C  CA    . GLU C 3  205 ? 52.74506 -0.61382  -4.12823  1.000 26.97454  ? 204  GLU A CA    1 
ATOM   2441 C  C     . GLU C 3  205 ? 51.55548 -0.27477  -5.01564  1.000 31.98850  ? 204  GLU A C     1 
ATOM   2442 O  O     . GLU C 3  205 ? 50.50709 -0.92981  -4.94293  1.000 36.65068  ? 204  GLU A O     1 
ATOM   2443 C  CB    . GLU C 3  205 ? 52.82559 0.32593   -2.92107  1.000 33.45705  ? 204  GLU A CB    1 
ATOM   2444 C  CG    . GLU C 3  205 ? 51.65135 0.18245   -1.92046  1.000 47.94179  ? 204  GLU A CG    1 
ATOM   2445 C  CD    . GLU C 3  205 ? 51.30407 1.48609   -1.15485  1.000 60.39300  ? 204  GLU A CD    1 
ATOM   2446 O  OE1   . GLU C 3  205 ? 50.13722 1.94946   -1.25243  1.000 61.08067  ? 204  GLU A OE1   1 
ATOM   2447 O  OE2   . GLU C 3  205 ? 52.19062 2.03798   -0.45031  1.000 63.87978  ? 204  GLU A OE2   1 
ATOM   2448 N  N     . LEU C 3  206 ? 51.71747 0.71887   -5.89740  1.000 34.95961  ? 205  LEU A N     1 
ATOM   2449 C  CA    . LEU C 3  206 ? 50.63528 1.10570   -6.80514  1.000 30.56496  ? 205  LEU A CA    1 
ATOM   2450 C  C     . LEU C 3  206 ? 50.30607 -0.01910  -7.78469  1.000 30.04691  ? 205  LEU A C     1 
ATOM   2451 O  O     . LEU C 3  206 ? 49.13202 -0.27486  -8.08699  1.000 25.86920  ? 205  LEU A O     1 
ATOM   2452 C  CB    . LEU C 3  206 ? 51.01080 2.39643   -7.54906  1.000 27.13732  ? 205  LEU A CB    1 
ATOM   2453 C  CG    . LEU C 3  206 ? 50.09792 2.85220   -8.69786  1.000 22.27183  ? 205  LEU A CG    1 
ATOM   2454 C  CD1   . LEU C 3  206 ? 48.66539 3.07593   -8.22160  1.000 21.79142  ? 205  LEU A CD1   1 
ATOM   2455 C  CD2   . LEU C 3  206 ? 50.65884 4.10918   -9.39278  1.000 29.17767  ? 205  LEU A CD2   1 
ATOM   2456 N  N     . ARG C 3  207 ? 51.33055 -0.71104  -8.27618  1.000 31.64679  ? 206  ARG A N     1 
ATOM   2457 C  CA    . ARG C 3  207 ? 51.10168 -1.81069  -9.20855  1.000 32.31544  ? 206  ARG A CA    1 
ATOM   2458 C  C     . ARG C 3  207 ? 50.38898 -2.97563  -8.53411  1.000 34.82894  ? 206  ARG A C     1 
ATOM   2459 O  O     . ARG C 3  207 ? 49.50218 -3.59100  -9.13317  1.000 34.09374  ? 206  ARG A O     1 
ATOM   2460 C  CB    . ARG C 3  207 ? 52.41790 -2.27659  -9.80751  1.000 28.90925  ? 206  ARG A CB    1 
ATOM   2461 C  CG    . ARG C 3  207 ? 52.87795 -1.45561  -10.97496 1.000 28.14316  ? 206  ARG A CG    1 
ATOM   2462 C  CD    . ARG C 3  207 ? 54.31029 -1.78500  -11.24134 1.000 35.38821  ? 206  ARG A CD    1 
ATOM   2463 N  NE    . ARG C 3  207 ? 54.51242 -2.37163  -12.54953 1.000 46.00541  ? 206  ARG A NE    1 
ATOM   2464 C  CZ    . ARG C 3  207 ? 54.68165 -3.67022  -12.78169 1.000 49.82831  ? 206  ARG A CZ    1 
ATOM   2465 N  NH1   . ARG C 3  207 ? 54.88794 -4.09176  -14.03149 1.000 61.06758  ? 206  ARG A NH1   1 
ATOM   2466 N  NH2   . ARG C 3  207 ? 54.67327 -4.53639  -11.77929 1.000 32.55392  ? 206  ARG A NH2   1 
ATOM   2467 N  N     . GLN C 3  208 ? 50.76286 -3.29726  -7.29482  1.000 34.70269  ? 207  GLN A N     1 
ATOM   2468 C  CA    . GLN C 3  208 ? 50.06855 -4.36647  -6.58246  1.000 36.37005  ? 207  GLN A CA    1 
ATOM   2469 C  C     . GLN C 3  208 ? 48.65269 -3.95442  -6.23205  1.000 38.39794  ? 207  GLN A C     1 
ATOM   2470 O  O     . GLN C 3  208 ? 47.73922 -4.79620  -6.22833  1.000 36.56839  ? 207  GLN A O     1 
ATOM   2471 C  CB    . GLN C 3  208 ? 50.82792 -4.77348  -5.32065  1.000 41.68486  ? 207  GLN A CB    1 
ATOM   2472 C  CG    . GLN C 3  208 ? 51.82262 -5.88873  -5.58510  1.000 60.79702  ? 207  GLN A CG    1 
ATOM   2473 C  CD    . GLN C 3  208 ? 52.44842 -6.44482  -4.31920  1.000 77.54399  ? 207  GLN A CD    1 
ATOM   2474 O  OE1   . GLN C 3  208 ? 51.84716 -6.40465  -3.23307  1.000 79.94696  ? 207  GLN A OE1   1 
ATOM   2475 N  NE2   . GLN C 3  208 ? 53.67214 -6.96875  -4.45006  1.000 82.81421  ? 207  GLN A NE2   1 
ATOM   2476 N  N     . HIS C 3  209 ? 48.44143 -2.66217  -5.97707  1.000 35.02327  ? 208  HIS A N     1 
ATOM   2477 C  CA    . HIS C 3  209 ? 47.08590 -2.19631  -5.73523  1.000 27.43146  ? 208  HIS A CA    1 
ATOM   2478 C  C     . HIS C 3  209 ? 46.22630 -2.39177  -6.97199  1.000 27.61650  ? 208  HIS A C     1 
ATOM   2479 O  O     . HIS C 3  209 ? 45.09004 -2.87381  -6.87543  1.000 27.20089  ? 208  HIS A O     1 
ATOM   2480 C  CB    . HIS C 3  209 ? 47.09217 -0.73373  -5.29952  1.000 23.08048  ? 208  HIS A CB    1 
ATOM   2481 C  CG    . HIS C 3  209 ? 45.72123 -0.14866  -5.19246  1.000 30.47443  ? 208  HIS A CG    1 
ATOM   2482 N  ND1   . HIS C 3  209 ? 44.98146 -0.19444  -4.02975  1.000 32.53793  ? 208  HIS A ND1   1 
ATOM   2483 C  CD2   . HIS C 3  209 ? 44.94324 0.47581   -6.11063  1.000 31.60995  ? 208  HIS A CD2   1 
ATOM   2484 C  CE1   . HIS C 3  209 ? 43.80733 0.37761   -4.23615  1.000 32.03398  ? 208  HIS A CE1   1 
ATOM   2485 N  NE2   . HIS C 3  209 ? 43.76079 0.79595   -5.48833  1.000 30.83803  ? 208  HIS A NE2   1 
ATOM   2486 N  N     . LEU C 3  210 ? 46.76360 -2.04314  -8.15136  1.000 30.86887  ? 209  LEU A N     1 
ATOM   2487 C  CA    . LEU C 3  210 ? 46.00741 -2.22125  -9.39229  1.000 26.98141  ? 209  LEU A CA    1 
ATOM   2488 C  C     . LEU C 3  210 ? 45.77304 -3.70202  -9.68344  1.000 27.56954  ? 209  LEU A C     1 
ATOM   2489 O  O     . LEU C 3  210 ? 44.67462 -4.09892  -10.09051 1.000 28.39629  ? 209  LEU A O     1 
ATOM   2490 C  CB    . LEU C 3  210 ? 46.73586 -1.54694  -10.56090 1.000 27.97006  ? 209  LEU A CB    1 
ATOM   2491 C  CG    . LEU C 3  210 ? 46.71304 -0.01396  -10.60752 1.000 29.02812  ? 209  LEU A CG    1 
ATOM   2492 C  CD1   . LEU C 3  210 ? 47.66126 0.51159   -11.68475 1.000 26.69069  ? 209  LEU A CD1   1 
ATOM   2493 C  CD2   . LEU C 3  210 ? 45.29885 0.51902   -10.83957 1.000 26.05206  ? 209  LEU A CD2   1 
ATOM   2494 N  N     . LEU C 3  211 ? 46.79303 -4.53383  -9.46861  1.000 29.68622  ? 210  LEU A N     1 
ATOM   2495 C  CA    . LEU C 3  211 ? 46.67166 -5.95622  -9.75501  1.000 29.51884  ? 210  LEU A CA    1 
ATOM   2496 C  C     . LEU C 3  211 ? 45.62134 -6.60927  -8.86578  1.000 32.42176  ? 210  LEU A C     1 
ATOM   2497 O  O     . LEU C 3  211 ? 44.85228 -7.46397  -9.32733  1.000 32.02410  ? 210  LEU A O     1 
ATOM   2498 C  CB    . LEU C 3  211 ? 48.02319 -6.61461  -9.56605  1.000 28.48635  ? 210  LEU A CB    1 
ATOM   2499 C  CG    . LEU C 3  211 ? 48.17506 -8.09839  -9.84817  1.000 26.61253  ? 210  LEU A CG    1 
ATOM   2500 C  CD1   . LEU C 3  211 ? 48.00152 -8.32570  -11.32879 1.000 25.16967  ? 210  LEU A CD1   1 
ATOM   2501 C  CD2   . LEU C 3  211 ? 49.55960 -8.52229  -9.38416  1.000 25.05020  ? 210  LEU A CD2   1 
ATOM   2502 N  N     . ARG C 3  212 ? 45.55867 -6.19605  -7.59058  1.000 32.14642  ? 211  ARG A N     1 
ATOM   2503 C  CA    . ARG C 3  212 ? 44.48559 -6.64661  -6.70999  1.000 23.44309  ? 211  ARG A CA    1 
ATOM   2504 C  C     . ARG C 3  212 ? 43.11857 -6.32627  -7.30252  1.000 38.51267  ? 211  ARG A C     1 
ATOM   2505 O  O     . ARG C 3  212 ? 42.16278 -7.09215  -7.12163  1.000 33.53712  ? 211  ARG A O     1 
ATOM   2506 C  CB    . ARG C 3  212 ? 44.65421 -6.01286  -5.32129  1.000 23.60953  ? 211  ARG A CB    1 
ATOM   2507 C  CG    . ARG C 3  212 ? 43.53393 -6.28514  -4.29213  1.000 28.67278  ? 211  ARG A CG    1 
ATOM   2508 C  CD    . ARG C 3  212 ? 42.44077 -5.23322  -4.39151  1.000 33.70186  ? 211  ARG A CD    1 
ATOM   2509 N  NE    . ARG C 3  212 ? 41.34870 -5.41932  -3.44169  1.000 41.23788  ? 211  ARG A NE    1 
ATOM   2510 C  CZ    . ARG C 3  212 ? 40.27944 -6.17630  -3.66297  1.000 49.34526  ? 211  ARG A CZ    1 
ATOM   2511 N  NH1   . ARG C 3  212 ? 40.16630 -6.84741  -4.79984  1.000 57.72030  ? 211  ARG A NH1   1 
ATOM   2512 N  NH2   . ARG C 3  212 ? 39.32292 -6.27076  -2.74472  1.000 48.65047  ? 211  ARG A NH2   1 
ATOM   2513 N  N     . TRP C 3  213 ? 42.99891 -5.19243  -8.00684  1.000 29.67174  ? 212  TRP A N     1 
ATOM   2514 C  CA    . TRP C 3  213 ? 41.74390 -4.82945  -8.64604  1.000 28.63986  ? 212  TRP A CA    1 
ATOM   2515 C  C     . TRP C 3  213 ? 41.67122 -5.26882  -10.10677 1.000 29.52307  ? 212  TRP A C     1 
ATOM   2516 O  O     . TRP C 3  213 ? 40.81254 -4.77170  -10.84985 1.000 34.14608  ? 212  TRP A O     1 
ATOM   2517 C  CB    . TRP C 3  213 ? 41.48900 -3.31560  -8.51839  1.000 30.51936  ? 212  TRP A CB    1 
ATOM   2518 C  CG    . TRP C 3  213 ? 41.07201 -2.92650  -7.13067  1.000 30.28448  ? 212  TRP A CG    1 
ATOM   2519 C  CD1   . TRP C 3  213 ? 41.85415 -2.35049  -6.17958  1.000 36.21411  ? 212  TRP A CD1   1 
ATOM   2520 C  CD2   . TRP C 3  213 ? 39.79192 -3.14324  -6.52137  1.000 24.37593  ? 212  TRP A CD2   1 
ATOM   2521 N  NE1   . TRP C 3  213 ? 41.13997 -2.17496  -5.01273  1.000 36.27593  ? 212  TRP A NE1   1 
ATOM   2522 C  CE2   . TRP C 3  213 ? 39.87167 -2.65453  -5.19447  1.000 28.18351  ? 212  TRP A CE2   1 
ATOM   2523 C  CE3   . TRP C 3  213 ? 38.59275 -3.70788  -6.96300  1.000 25.01389  ? 212  TRP A CE3   1 
ATOM   2524 C  CZ2   . TRP C 3  213 ? 38.79039 -2.69420  -4.30824  1.000 23.81208  ? 212  TRP A CZ2   1 
ATOM   2525 C  CZ3   . TRP C 3  213 ? 37.51687 -3.74664  -6.09214  1.000 29.36357  ? 212  TRP A CZ3   1 
ATOM   2526 C  CH2   . TRP C 3  213 ? 37.62276 -3.24051  -4.77472  1.000 29.97006  ? 212  TRP A CH2   1 
ATOM   2527 N  N     . GLY C 3  214 ? 42.54169 -6.18295  -10.53620 1.000 24.33702  ? 213  GLY A N     1 
ATOM   2528 C  CA    . GLY C 3  214 ? 42.40984 -6.79249  -11.84124 1.000 23.42142  ? 213  GLY A CA    1 
ATOM   2529 C  C     . GLY C 3  214 ? 43.13969 -6.12132  -12.98752 1.000 29.84781  ? 213  GLY A C     1 
ATOM   2530 O  O     . GLY C 3  214 ? 43.00864 -6.57815  -14.13098 1.000 28.82975  ? 213  GLY A O     1 
ATOM   2531 N  N     . LEU C 3  215 ? 43.89607 -5.05840  -12.73956 1.000 27.00099  ? 214  LEU A N     1 
ATOM   2532 C  CA    . LEU C 3  215 ? 44.58556 -4.34773  -13.80795 1.000 24.38973  ? 214  LEU A CA    1 
ATOM   2533 C  C     . LEU C 3  215 ? 46.07433 -4.67136  -13.73901 1.000 28.51371  ? 214  LEU A C     1 
ATOM   2534 O  O     . LEU C 3  215 ? 46.75672 -4.31612  -12.76973 1.000 27.88027  ? 214  LEU A O     1 
ATOM   2535 C  CB    . LEU C 3  215 ? 44.32554 -2.85168  -13.72260 1.000 25.72212  ? 214  LEU A CB    1 
ATOM   2536 C  CG    . LEU C 3  215 ? 42.82635 -2.49887  -13.74231 1.000 30.71801  ? 214  LEU A CG    1 
ATOM   2537 C  CD1   . LEU C 3  215 ? 42.58886 -1.01291  -13.51513 1.000 26.62879  ? 214  LEU A CD1   1 
ATOM   2538 C  CD2   . LEU C 3  215 ? 42.18214 -2.91578  -15.03700 1.000 35.93931  ? 214  LEU A CD2   1 
ATOM   2539 N  N     . THR C 3  216 ? 46.56388 -5.35899  -14.76561 1.000 28.35981  ? 215  THR A N     1 
ATOM   2540 C  CA    . THR C 3  216 ? 47.98359 -5.59216  -14.94876 1.000 29.45077  ? 215  THR A CA    1 
ATOM   2541 C  C     . THR C 3  216 ? 48.65591 -4.35570  -15.51500 1.000 36.49491  ? 215  THR A C     1 
ATOM   2542 O  O     . THR C 3  216 ? 48.04358 -3.53963  -16.21489 1.000 40.18863  ? 215  THR A O     1 
ATOM   2543 C  CB    . THR C 3  216 ? 48.23493 -6.74345  -15.91759 1.000 28.64958  ? 215  THR A CB    1 
ATOM   2544 O  OG1   . THR C 3  216 ? 47.69943 -6.38677  -17.19472 1.000 33.22480  ? 215  THR A OG1   1 
ATOM   2545 C  CG2   . THR C 3  216 ? 47.59034 -8.01457  -15.42017 1.000 25.18232  ? 215  THR A CG2   1 
ATOM   2546 N  N     . THR C 3  217 ? 49.94701 -4.24492  -15.23887 1.000 33.69371  ? 216  THR A N     1 
ATOM   2547 C  CA    . THR C 3  217 ? 50.74717 -3.13295  -15.73142 1.000 37.49764  ? 216  THR A CA    1 
ATOM   2548 C  C     . THR C 3  217 ? 51.96898 -3.75498  -16.37627 1.000 25.27784  ? 216  THR A C     1 
ATOM   2549 O  O     . THR C 3  217 ? 53.02052 -3.90673  -15.74186 1.000 35.83224  ? 216  THR A O     1 
ATOM   2550 C  CB    . THR C 3  217 ? 51.09993 -2.14103  -14.61971 1.000 31.82592  ? 216  THR A CB    1 
ATOM   2551 O  OG1   . THR C 3  217 ? 51.43727 -2.85418  -13.42338 1.000 31.50164  ? 216  THR A OG1   1 
ATOM   2552 C  CG2   . THR C 3  217 ? 49.91117 -1.25533  -14.33096 1.000 28.92867  ? 216  THR A CG2   1 
ATOM   2553 N  N     . PRO C 3  218 ? 51.87088 -4.10538  -17.64931 1.000 30.99418  ? 217  PRO A N     1 
ATOM   2554 C  CA    . PRO C 3  218 ? 52.97300 -4.82212  -18.30164 1.000 35.96804  ? 217  PRO A CA    1 
ATOM   2555 C  C     . PRO C 3  218 ? 54.21836 -3.95536  -18.35575 1.000 35.19745  ? 217  PRO A C     1 
ATOM   2556 O  O     . PRO C 3  218 ? 54.15118 -2.76464  -18.66772 1.000 31.91438  ? 217  PRO A O     1 
ATOM   2557 C  CB    . PRO C 3  218 ? 52.42481 -5.12993  -19.70311 1.000 27.65688  ? 217  PRO A CB    1 
ATOM   2558 C  CG    . PRO C 3  218 ? 51.31197 -4.15053  -19.90569 1.000 28.90236  ? 217  PRO A CG    1 
ATOM   2559 C  CD    . PRO C 3  218 ? 50.73804 -3.84981  -18.55472 1.000 27.64479  ? 217  PRO A CD    1 
ATOM   2560 N  N     . ASP C 3  219 ? 55.36043 -4.57197  -18.02978 1.000 37.31081  ? 218  ASP A N     1 
ATOM   2561 C  CA    . ASP C 3  219 ? 56.63049 -3.85364  -18.02737 1.000 36.49292  ? 218  ASP A CA    1 
ATOM   2562 C  C     . ASP C 3  219 ? 56.92191 -3.20460  -19.38202 1.000 40.70469  ? 218  ASP A C     1 
ATOM   2563 O  O     . ASP C 3  219 ? 57.50330 -2.11289  -19.43467 1.000 41.29150  ? 218  ASP A O     1 
ATOM   2564 C  CB    . ASP C 3  219 ? 57.75424 -4.81048  -17.62181 1.000 35.69716  ? 218  ASP A CB    1 
ATOM   2565 C  CG    . ASP C 3  219 ? 59.08223 -4.10252  -17.43288 1.000 41.35963  ? 218  ASP A CG    1 
ATOM   2566 O  OD1   . ASP C 3  219 ? 59.22993 -3.35841  -16.43051 1.000 44.52302  ? 218  ASP A OD1   1 
ATOM   2567 O  OD2   . ASP C 3  219 ? 59.97557 -4.27673  -18.29339 1.000 40.44987  ? 218  ASP A OD2   1 
ATOM   2568 N  N     . LYS C 3  220 ? 56.50267 -3.84990  -20.47772 1.000 43.64201  ? 219  LYS A N     1 
ATOM   2569 C  CA    . LYS C 3  220 ? 56.69707 -3.30561  -21.81629 1.000 37.92185  ? 219  LYS A CA    1 
ATOM   2570 C  C     . LYS C 3  220 ? 56.29999 -1.83452  -21.87920 1.000 41.44326  ? 219  LYS A C     1 
ATOM   2571 O  O     . LYS C 3  220 ? 56.96508 -1.03164  -22.54298 1.000 44.17247  ? 219  LYS A O     1 
ATOM   2572 C  CB    . LYS C 3  220 ? 55.89165 -4.13180  -22.82262 1.000 35.50328  ? 219  LYS A CB    1 
ATOM   2573 C  CG    . LYS C 3  220 ? 56.57125 -4.38994  -24.16535 1.000 47.31669  ? 219  LYS A CG    1 
ATOM   2574 C  CD    . LYS C 3  220 ? 56.36300 -3.25699  -25.17016 1.000 51.44587  ? 219  LYS A CD    1 
ATOM   2575 C  CE    . LYS C 3  220 ? 57.18939 -3.46906  -26.45610 1.000 51.36696  ? 219  LYS A CE    1 
ATOM   2576 N  NZ    . LYS C 3  220 ? 56.72239 -4.61247  -27.29139 1.000 51.31328  ? 219  LYS A NZ    1 
ATOM   2577 N  N     . LYS C 3  221 ? 55.23675 -1.45157  -21.16897 1.000 39.54617  ? 220  LYS A N     1 
ATOM   2578 C  CA    . LYS C 3  221 ? 54.75287 -0.07280  -21.17995 1.000 36.35988  ? 220  LYS A CA    1 
ATOM   2579 C  C     . LYS C 3  221 ? 55.01232 0.64524   -19.86001 1.000 33.24304  ? 220  LYS A C     1 
ATOM   2580 O  O     . LYS C 3  221 ? 54.28354 1.57045   -19.50124 1.000 32.47895  ? 220  LYS A O     1 
ATOM   2581 C  CB    . LYS C 3  221 ? 53.26529 -0.02649  -21.52376 1.000 35.96415  ? 220  LYS A CB    1 
ATOM   2582 C  CG    . LYS C 3  221 ? 52.96739 -0.57133  -22.90864 1.000 42.37321  ? 220  LYS A CG    1 
ATOM   2583 C  CD    . LYS C 3  221 ? 51.47593 -0.67587  -23.16997 1.000 44.67208  ? 220  LYS A CD    1 
ATOM   2584 C  CE    . LYS C 3  221 ? 50.99144 0.45859   -24.06190 1.000 46.30237  ? 220  LYS A CE    1 
ATOM   2585 N  NZ    . LYS C 3  221 ? 49.53360 0.34675   -24.35809 1.000 45.68914  ? 220  LYS A NZ    1 
ATOM   2586 N  N     . HIS C 3  222 ? 56.04858 0.23160   -19.13018 1.000 33.91579  ? 221  HIS A N     1 
ATOM   2587 C  CA    . HIS C 3  222 ? 56.41095 0.83698   -17.85039 1.000 36.07134  ? 221  HIS A CA    1 
ATOM   2588 C  C     . HIS C 3  222 ? 57.64361 1.70395   -18.08504 1.000 32.86968  ? 221  HIS A C     1 
ATOM   2589 O  O     . HIS C 3  222 ? 58.77365 1.20877   -18.09061 1.000 32.43628  ? 221  HIS A O     1 
ATOM   2590 C  CB    . HIS C 3  222 ? 56.66051 -0.23840  -16.79433 1.000 38.67142  ? 221  HIS A CB    1 
ATOM   2591 C  CG    . HIS C 3  222 ? 56.96754 0.30139   -15.42961 1.000 41.45111  ? 221  HIS A CG    1 
ATOM   2592 N  ND1   . HIS C 3  222 ? 57.07330 -0.50713  -14.31797 1.000 43.45433  ? 221  HIS A ND1   1 
ATOM   2593 C  CD2   . HIS C 3  222 ? 57.19139 1.56398   -14.99438 1.000 42.92656  ? 221  HIS A CD2   1 
ATOM   2594 C  CE1   . HIS C 3  222 ? 57.35251 0.23225   -13.25906 1.000 43.08514  ? 221  HIS A CE1   1 
ATOM   2595 N  NE2   . HIS C 3  222 ? 57.43064 1.49337   -13.64163 1.000 43.64598  ? 221  HIS A NE2   1 
ATOM   2596 N  N     . GLN C 3  223 ? 57.42848 3.00129   -18.28365 1.000 29.27302  ? 222  GLN A N     1 
ATOM   2597 C  CA    . GLN C 3  223 ? 58.54004 3.90810   -18.54796 1.000 37.13867  ? 222  GLN A CA    1 
ATOM   2598 C  C     . GLN C 3  223 ? 59.17865 4.34023   -17.22868 1.000 40.68513  ? 222  GLN A C     1 
ATOM   2599 O  O     . GLN C 3  223 ? 58.49655 4.84102   -16.32407 1.000 40.37920  ? 222  GLN A O     1 
ATOM   2600 C  CB    . GLN C 3  223 ? 58.06724 5.11133   -19.34865 1.000 28.13685  ? 222  GLN A CB    1 
ATOM   2601 C  CG    . GLN C 3  223 ? 57.16237 4.76203   -20.49990 1.000 27.87195  ? 222  GLN A CG    1 
ATOM   2602 C  CD    . GLN C 3  223 ? 56.82016 5.98866   -21.34499 1.000 36.10021  ? 222  GLN A CD    1 
ATOM   2603 O  OE1   . GLN C 3  223 ? 57.70748 6.75906   -21.71632 1.000 30.30785  ? 222  GLN A OE1   1 
ATOM   2604 N  NE2   . GLN C 3  223 ? 55.53528 6.18038   -21.63381 1.000 26.79822  ? 222  GLN A NE2   1 
ATOM   2605 N  N     . LYS C 3  224 ? 60.48564 4.13039   -17.11597 1.000 43.40472  ? 223  LYS A N     1 
ATOM   2606 C  CA    . LYS C 3  224 ? 61.21345 4.40351   -15.89083 1.000 42.48040  ? 223  LYS A CA    1 
ATOM   2607 C  C     . LYS C 3  224 ? 62.27477 5.48306   -16.04465 1.000 43.82480  ? 223  LYS A C     1 
ATOM   2608 O  O     . LYS C 3  224 ? 62.81847 5.92668   -15.02914 1.000 42.08005  ? 223  LYS A O     1 
ATOM   2609 C  CB    . LYS C 3  224 ? 61.87909 3.11314   -15.36626 1.000 39.26490  ? 223  LYS A CB    1 
ATOM   2610 C  CG    . LYS C 3  224 ? 60.89618 1.98650   -15.01477 1.000 38.28494  ? 223  LYS A CG    1 
ATOM   2611 C  CD    . LYS C 3  224 ? 61.61506 0.76163   -14.42072 1.000 41.97719  ? 223  LYS A CD    1 
ATOM   2612 C  CE    . LYS C 3  224 ? 60.94688 -0.54809  -14.83226 1.000 42.27489  ? 223  LYS A CE    1 
ATOM   2613 N  NZ    . LYS C 3  224 ? 60.86075 -0.70901  -16.32738 1.000 44.44737  ? 223  LYS A NZ    1 
ATOM   2614 N  N     . GLU C 3  225 ? 62.58938 5.90937   -17.26829 1.000 46.04058  ? 224  GLU A N     1 
ATOM   2615 C  CA    . GLU C 3  225 ? 63.66168 6.85716   -17.53554 1.000 53.12545  ? 224  GLU A CA    1 
ATOM   2616 C  C     . GLU C 3  225 ? 63.19636 7.95647   -18.47992 1.000 49.13998  ? 224  GLU A C     1 
ATOM   2617 O  O     . GLU C 3  225 ? 62.41061 7.70000   -19.39680 1.000 44.87185  ? 224  GLU A O     1 
ATOM   2618 C  CB    . GLU C 3  225 ? 64.87601 6.15025   -18.15404 1.000 60.84190  ? 224  GLU A CB    1 
ATOM   2619 C  CG    . GLU C 3  225 ? 65.58241 5.21464   -17.20823 1.000 71.64783  ? 224  GLU A CG    1 
ATOM   2620 C  CD    . GLU C 3  225 ? 66.07910 5.92565   -15.96519 1.000 83.82022  ? 224  GLU A CD    1 
ATOM   2621 O  OE1   . GLU C 3  225 ? 66.60395 7.05234   -16.09572 1.000 88.88683  ? 224  GLU A OE1   1 
ATOM   2622 O  OE2   . GLU C 3  225 ? 65.93775 5.36409   -14.85496 1.000 88.19614  ? 224  GLU A OE2   1 
ATOM   2623 N  N     . PRO C 3  226 ? 63.68941 9.18071   -18.30273 1.000 49.09250  ? 225  PRO A N     1 
ATOM   2624 C  CA    . PRO C 3  226 ? 63.34454 10.26309  -19.23303 1.000 44.56081  ? 225  PRO A CA    1 
ATOM   2625 C  C     . PRO C 3  226 ? 64.09695 10.10322  -20.54239 1.000 41.09474  ? 225  PRO A C     1 
ATOM   2626 O  O     . PRO C 3  226 ? 65.20086 9.54107   -20.57416 1.000 40.68179  ? 225  PRO A O     1 
ATOM   2627 C  CB    . PRO C 3  226 ? 63.78420 11.53755  -18.48560 1.000 42.48977  ? 225  PRO A CB    1 
ATOM   2628 C  CG    . PRO C 3  226 ? 64.33468 11.07611  -17.16267 1.000 45.16783  ? 225  PRO A CG    1 
ATOM   2629 C  CD    . PRO C 3  226 ? 64.67328 9.62851   -17.30642 1.000 48.17468  ? 225  PRO A CD    1 
ATOM   2630 N  N     . PRO C 3  227 ? 63.54867 10.61292  -21.65162 1.000 45.10550  ? 226  PRO A N     1 
ATOM   2631 C  CA    . PRO C 3  227 ? 62.30658 11.39830  -21.66089 1.000 42.94141  ? 226  PRO A CA    1 
ATOM   2632 C  C     . PRO C 3  227 ? 61.06841 10.50540  -21.66302 1.000 37.24819  ? 226  PRO A C     1 
ATOM   2633 O  O     . PRO C 3  227 ? 61.00654 9.55409   -22.44006 1.000 39.24216  ? 226  PRO A O     1 
ATOM   2634 C  CB    . PRO C 3  227 ? 62.42186 12.20432  -22.96055 1.000 42.44074  ? 226  PRO A CB    1 
ATOM   2635 C  CG    . PRO C 3  227 ? 63.19077 11.28498  -23.87465 1.000 41.37699  ? 226  PRO A CG    1 
ATOM   2636 C  CD    . PRO C 3  227 ? 64.13124 10.48200  -23.00248 1.000 40.43770  ? 226  PRO A CD    1 
ATOM   2637 N  N     . PHE C 3  228 ? 60.10934 10.78887  -20.78986 1.000 31.60793  ? 227  PHE A N     1 
ATOM   2638 C  CA    . PHE C 3  228 ? 58.88841 10.00314  -20.76436 1.000 34.88912  ? 227  PHE A CA    1 
ATOM   2639 C  C     . PHE C 3  228 ? 58.00455 10.38033  -21.94091 1.000 35.88149  ? 227  PHE A C     1 
ATOM   2640 O  O     . PHE C 3  228 ? 57.89360 11.55248  -22.29639 1.000 41.93963  ? 227  PHE A O     1 
ATOM   2641 C  CB    . PHE C 3  228 ? 58.14916 10.20061  -19.44170 1.000 27.50262  ? 227  PHE A CB    1 
ATOM   2642 C  CG    . PHE C 3  228 ? 58.97421 9.82341   -18.25183 1.000 40.11294  ? 227  PHE A CG    1 
ATOM   2643 C  CD1   . PHE C 3  228 ? 58.94336 8.52976   -17.74671 1.000 36.38738  ? 227  PHE A CD1   1 
ATOM   2644 C  CD2   . PHE C 3  228 ? 59.81665 10.74919  -17.65859 1.000 38.31455  ? 227  PHE A CD2   1 
ATOM   2645 C  CE1   . PHE C 3  228 ? 59.72303 8.17465   -16.65422 1.000 36.75510  ? 227  PHE A CE1   1 
ATOM   2646 C  CE2   . PHE C 3  228 ? 60.59724 10.40244  -16.57173 1.000 40.77761  ? 227  PHE A CE2   1 
ATOM   2647 C  CZ    . PHE C 3  228 ? 60.55543 9.10725   -16.06759 1.000 39.91678  ? 227  PHE A CZ    1 
ATOM   2648 N  N     . LEU C 3  229 ? 57.39844 9.37277   -22.56338 1.000 35.57996  ? 228  LEU A N     1 
ATOM   2649 C  CA    . LEU C 3  229 ? 56.43506 9.58067   -23.63743 1.000 35.26060  ? 228  LEU A CA    1 
ATOM   2650 C  C     . LEU C 3  229 ? 55.04034 9.69370   -23.02530 1.000 33.03665  ? 228  LEU A C     1 
ATOM   2651 O  O     . LEU C 3  229 ? 54.51348 8.72024   -22.48384 1.000 35.00966  ? 228  LEU A O     1 
ATOM   2652 C  CB    . LEU C 3  229 ? 56.52352 8.44124   -24.64612 1.000 37.07223  ? 228  LEU A CB    1 
ATOM   2653 C  CG    . LEU C 3  229 ? 57.93914 8.35841   -25.23315 1.000 43.43742  ? 228  LEU A CG    1 
ATOM   2654 C  CD1   . LEU C 3  229 ? 58.05037 7.30962   -26.32350 1.000 46.68062  ? 228  LEU A CD1   1 
ATOM   2655 C  CD2   . LEU C 3  229 ? 58.38358 9.71414   -25.76227 1.000 46.42497  ? 228  LEU A CD2   1 
ATOM   2656 N  N     . TRP C 3  230 ? 54.43144 10.87606  -23.11458 1.000 29.69752  ? 229  TRP A N     1 
ATOM   2657 C  CA    . TRP C 3  230 ? 53.17125 11.09772  -22.41480 1.000 28.19298  ? 229  TRP A CA    1 
ATOM   2658 C  C     . TRP C 3  230 ? 52.29114 12.07967  -23.17293 1.000 31.35914  ? 229  TRP A C     1 
ATOM   2659 O  O     . TRP C 3  230 ? 52.68559 13.22810  -23.39599 1.000 34.50560  ? 229  TRP A O     1 
ATOM   2660 C  CB    . TRP C 3  230 ? 53.45390 11.60447  -21.00117 1.000 33.19467  ? 229  TRP A CB    1 
ATOM   2661 C  CG    . TRP C 3  230 ? 52.24512 11.90381  -20.20102 1.000 34.08827  ? 229  TRP A CG    1 
ATOM   2662 C  CD1   . TRP C 3  230 ? 51.43202 11.00659  -19.57039 1.000 26.93974  ? 229  TRP A CD1   1 
ATOM   2663 C  CD2   . TRP C 3  230 ? 51.70747 13.20296  -19.92374 1.000 35.19097  ? 229  TRP A CD2   1 
ATOM   2664 N  NE1   . TRP C 3  230 ? 50.42059 11.66949  -18.91831 1.000 28.08867  ? 229  TRP A NE1   1 
ATOM   2665 C  CE2   . TRP C 3  230 ? 50.57119 13.01926  -19.11429 1.000 31.11473  ? 229  TRP A CE2   1 
ATOM   2666 C  CE3   . TRP C 3  230 ? 52.07416 14.50436  -20.28808 1.000 36.44925  ? 229  TRP A CE3   1 
ATOM   2667 C  CZ2   . TRP C 3  230 ? 49.79240 14.09455  -18.66025 1.000 27.56207  ? 229  TRP A CZ2   1 
ATOM   2668 C  CZ3   . TRP C 3  230 ? 51.29507 15.57253  -19.83898 1.000 28.60559  ? 229  TRP A CZ3   1 
ATOM   2669 C  CH2   . TRP C 3  230 ? 50.17408 15.35743  -19.03295 1.000 27.15121  ? 229  TRP A CH2   1 
ATOM   2670 N  N     . MET C 3  231 ? 51.09132 11.62748  -23.54208 1.000 31.96673  ? 230  MET A N     1 
ATOM   2671 C  CA    . MET C 3  231 ? 50.06358 12.46647  -24.16709 1.000 30.34971  ? 230  MET A CA    1 
ATOM   2672 C  C     . MET C 3  231 ? 50.53620 13.10171  -25.47741 1.000 35.41952  ? 230  MET A C     1 
ATOM   2673 O  O     . MET C 3  231 ? 50.02465 14.14677  -25.90010 1.000 39.74089  ? 230  MET A O     1 
ATOM   2674 C  CB    . MET C 3  231 ? 49.57393 13.53882  -23.19148 1.000 31.76766  ? 230  MET A CB    1 
ATOM   2675 C  CG    . MET C 3  231 ? 48.85249 12.95674  -21.97834 1.000 32.62559  ? 230  MET A CG    1 
ATOM   2676 S  SD    . MET C 3  231 ? 47.39248 11.99363  -22.45520 1.000 37.83531  ? 230  MET A SD    1 
ATOM   2677 C  CE    . MET C 3  231 ? 46.24783 13.29792  -22.89238 1.000 29.01370  ? 230  MET A CE    1 
ATOM   2678 N  N     . GLY C 3  232 ? 51.49018 12.47186  -26.15059 1.000 33.09087  ? 231  GLY A N     1 
ATOM   2679 C  CA    . GLY C 3  232 ? 52.03735 13.02761  -27.36753 1.000 39.13754  ? 231  GLY A CA    1 
ATOM   2680 C  C     . GLY C 3  232 ? 53.21729 13.95373  -27.17204 1.000 44.24737  ? 231  GLY A C     1 
ATOM   2681 O  O     . GLY C 3  232 ? 53.65483 14.58154  -28.14183 1.000 47.59192  ? 231  GLY A O     1 
ATOM   2682 N  N     . TYR C 3  233 ? 53.74250 14.06056  -25.95340 1.000 41.76728  ? 232  TYR A N     1 
ATOM   2683 C  CA    . TYR C 3  233 ? 54.89921 14.88411  -25.64495 1.000 37.54341  ? 232  TYR A CA    1 
ATOM   2684 C  C     . TYR C 3  233 ? 56.05188 14.02877  -25.13709 1.000 41.45400  ? 232  TYR A C     1 
ATOM   2685 O  O     . TYR C 3  233 ? 55.88309 12.87142  -24.72786 1.000 46.38856  ? 232  TYR A O     1 
ATOM   2686 C  CB    . TYR C 3  233 ? 54.57336 15.93925  -24.57921 1.000 35.58940  ? 232  TYR A CB    1 
ATOM   2687 C  CG    . TYR C 3  233 ? 53.27707 16.69347  -24.81191 1.000 36.47190  ? 232  TYR A CG    1 
ATOM   2688 C  CD1   . TYR C 3  233 ? 53.24990 17.85967  -25.57408 1.000 30.19624  ? 232  TYR A CD1   1 
ATOM   2689 C  CD2   . TYR C 3  233 ? 52.07760 16.23677  -24.25824 1.000 35.14511  ? 232  TYR A CD2   1 
ATOM   2690 C  CE1   . TYR C 3  233 ? 52.06480 18.54804  -25.77925 1.000 31.57622  ? 232  TYR A CE1   1 
ATOM   2691 C  CE2   . TYR C 3  233 ? 50.88841 16.90854  -24.46231 1.000 29.82240  ? 232  TYR A CE2   1 
ATOM   2692 C  CZ    . TYR C 3  233 ? 50.88821 18.07353  -25.21467 1.000 34.84468  ? 232  TYR A CZ    1 
ATOM   2693 O  OH    . TYR C 3  233 ? 49.70628 18.76178  -25.40068 1.000 36.72385  ? 232  TYR A OH    1 
ATOM   2694 N  N     . GLU C 3  234 ? 57.22944 14.63512  -25.15041 1.000 43.48301  ? 233  GLU A N     1 
ATOM   2695 C  CA    . GLU C 3  234 ? 58.41242 14.10398  -24.49121 1.000 46.62378  ? 233  GLU A CA    1 
ATOM   2696 C  C     . GLU C 3  234 ? 58.67541 14.93578  -23.24613 1.000 41.80821  ? 233  GLU A C     1 
ATOM   2697 O  O     . GLU C 3  234 ? 58.87320 16.15274  -23.34193 1.000 40.75633  ? 233  GLU A O     1 
ATOM   2698 C  CB    . GLU C 3  234 ? 59.61784 14.12987  -25.42466 1.000 52.58250  ? 233  GLU A CB    1 
ATOM   2699 C  CG    . GLU C 3  234 ? 59.45300 13.24692  -26.63554 1.000 60.25555  ? 233  GLU A CG    1 
ATOM   2700 C  CD    . GLU C 3  234 ? 60.73285 13.11803  -27.42551 1.000 72.27830  ? 233  GLU A CD    1 
ATOM   2701 O  OE1   . GLU C 3  234 ? 61.64409 12.39320  -26.97240 1.000 73.82536  ? 233  GLU A OE1   1 
ATOM   2702 O  OE2   . GLU C 3  234 ? 60.83144 13.75894  -28.49400 1.000 81.30605  ? 233  GLU A OE2   1 
ATOM   2703 N  N     . LEU C 3  235 ? 58.64946 14.28473  -22.08565 1.000 39.62030  ? 234  LEU A N     1 
ATOM   2704 C  CA    . LEU C 3  235 ? 58.87672 14.94170  -20.80187 1.000 42.02955  ? 234  LEU A CA    1 
ATOM   2705 C  C     . LEU C 3  235 ? 60.31445 14.65492  -20.38534 1.000 46.05096  ? 234  LEU A C     1 
ATOM   2706 O  O     . LEU C 3  235 ? 60.63954 13.54709  -19.94960 1.000 48.50935  ? 234  LEU A O     1 
ATOM   2707 C  CB    . LEU C 3  235 ? 57.88600 14.46454  -19.74216 1.000 35.86852  ? 234  LEU A CB    1 
ATOM   2708 C  CG    . LEU C 3  235 ? 56.40440 14.36432  -20.10792 1.000 36.01100  ? 234  LEU A CG    1 
ATOM   2709 C  CD1   . LEU C 3  235 ? 55.56090 14.12846  -18.85886 1.000 25.02795  ? 234  LEU A CD1   1 
ATOM   2710 C  CD2   . LEU C 3  235 ? 55.94389 15.61151  -20.84717 1.000 35.50839  ? 234  LEU A CD2   1 
ATOM   2711 N  N     . HIS C 3  236 ? 61.17616 15.64593  -20.55369 1.000 46.43060  ? 235  HIS A N     1 
ATOM   2712 C  CA    . HIS C 3  236 ? 62.51665 15.62461  -19.99322 1.000 42.67784  ? 235  HIS A CA    1 
ATOM   2713 C  C     . HIS C 3  236 ? 62.46198 16.15484  -18.57411 1.000 38.93291  ? 235  HIS A C     1 
ATOM   2714 O  O     . HIS C 3  236 ? 61.41268 16.60331  -18.10941 1.000 37.67698  ? 235  HIS A O     1 
ATOM   2715 C  CB    . HIS C 3  236 ? 63.45159 16.44852  -20.87143 1.000 44.03830  ? 235  HIS A CB    1 
ATOM   2716 C  CG    . HIS C 3  236 ? 63.52307 15.97120  -22.28605 1.000 46.40917  ? 235  HIS A CG    1 
ATOM   2717 N  ND1   . HIS C 3  236 ? 62.57983 16.31070  -23.23521 1.000 47.27321  ? 235  HIS A ND1   1 
ATOM   2718 C  CD2   . HIS C 3  236 ? 64.42391 15.18014  -22.91437 1.000 49.22839  ? 235  HIS A CD2   1 
ATOM   2719 C  CE1   . HIS C 3  236 ? 62.90052 15.75203  -24.38870 1.000 48.68417  ? 235  HIS A CE1   1 
ATOM   2720 N  NE2   . HIS C 3  236 ? 64.01144 15.05530  -24.21966 1.000 49.48343  ? 235  HIS A NE2   1 
ATOM   2721 N  N     . PRO C 3  237 ? 63.56317 16.08870  -17.82547 1.000 41.73596  ? 236  PRO A N     1 
ATOM   2722 C  CA    . PRO C 3  237 ? 63.48428 16.56947  -16.43588 1.000 43.35813  ? 236  PRO A CA    1 
ATOM   2723 C  C     . PRO C 3  237 ? 63.07744 18.02709  -16.32339 1.000 44.74837  ? 236  PRO A C     1 
ATOM   2724 O  O     . PRO C 3  237 ? 62.26233 18.35689  -15.45793 1.000 45.47955  ? 236  PRO A O     1 
ATOM   2725 C  CB    . PRO C 3  237 ? 64.89822 16.31148  -15.89764 1.000 43.60352  ? 236  PRO A CB    1 
ATOM   2726 C  CG    . PRO C 3  237 ? 65.38446 15.14537  -16.71690 1.000 42.23196  ? 236  PRO A CG    1 
ATOM   2727 C  CD    . PRO C 3  237 ? 64.84465 15.40357  -18.09476 1.000 40.19562  ? 236  PRO A CD    1 
ATOM   2728 N  N     . ASP C 3  238 ? 63.57863 18.90760  -17.19211 1.000 49.08003  ? 237  ASP A N     1 
ATOM   2729 C  CA    . ASP C 3  238 ? 63.34564 20.34244  -17.02961 1.000 57.38229  ? 237  ASP A CA    1 
ATOM   2730 C  C     . ASP C 3  238 ? 62.61372 21.00381  -18.19035 1.000 55.25509  ? 237  ASP A C     1 
ATOM   2731 O  O     . ASP C 3  238 ? 62.34683 22.21209  -18.12553 1.000 57.03696  ? 237  ASP A O     1 
ATOM   2732 C  CB    . ASP C 3  238 ? 64.67822 21.07516  -16.79081 1.000 62.99902  ? 237  ASP A CB    1 
ATOM   2733 C  CG    . ASP C 3  238 ? 65.31335 20.69665  -15.46507 1.000 66.92380  ? 237  ASP A CG    1 
ATOM   2734 O  OD1   . ASP C 3  238 ? 64.59631 20.72601  -14.43744 1.000 63.98249  ? 237  ASP A OD1   1 
ATOM   2735 O  OD2   . ASP C 3  238 ? 66.51579 20.34793  -15.45419 1.000 70.84999  ? 237  ASP A OD2   1 
ATOM   2736 N  N     . LYS C 3  239 ? 62.28088 20.26371  -19.24158 1.000 50.77608  ? 238  LYS A N     1 
ATOM   2737 C  CA    . LYS C 3  239 ? 61.58170 20.84278  -20.37372 1.000 46.98773  ? 238  LYS A CA    1 
ATOM   2738 C  C     . LYS C 3  239 ? 60.75120 19.75153  -21.02851 1.000 50.56306  ? 238  LYS A C     1 
ATOM   2739 O  O     . LYS C 3  239 ? 61.02530 18.55634  -20.87633 1.000 52.39098  ? 238  LYS A O     1 
ATOM   2740 C  CB    . LYS C 3  239 ? 62.55460 21.47157  -21.37968 1.000 44.34516  ? 238  LYS A CB    1 
ATOM   2741 C  CG    . LYS C 3  239 ? 63.36459 20.44756  -22.13445 1.000 49.65946  ? 238  LYS A CG    1 
ATOM   2742 C  CD    . LYS C 3  239 ? 64.46371 21.06511  -22.97350 1.000 56.20417  ? 238  LYS A CD    1 
ATOM   2743 C  CE    . LYS C 3  239 ? 65.32456 19.96825  -23.63236 1.000 62.09984  ? 238  LYS A CE    1 
ATOM   2744 N  NZ    . LYS C 3  239 ? 65.72528 20.31195  -25.03841 1.000 64.42986  ? 238  LYS A NZ    1 
ATOM   2745 N  N     . TRP C 3  240 ? 59.71681 20.17430  -21.74685 1.000 48.68613  ? 239  TRP A N     1 
ATOM   2746 C  CA    . TRP C 3  240 ? 58.90017 19.25918  -22.52340 1.000 47.99893  ? 239  TRP A CA    1 
ATOM   2747 C  C     . TRP C 3  240 ? 58.91869 19.68356  -23.98840 1.000 46.11150  ? 239  TRP A C     1 
ATOM   2748 O  O     . TRP C 3  240 ? 59.07278 20.86668  -24.31328 1.000 46.08892  ? 239  TRP A O     1 
ATOM   2749 C  CB    . TRP C 3  240 ? 57.45820 19.17894  -21.96543 1.000 46.28529  ? 239  TRP A CB    1 
ATOM   2750 C  CG    . TRP C 3  240 ? 56.71894 20.46685  -21.96298 1.000 44.14100  ? 239  TRP A CG    1 
ATOM   2751 C  CD1   . TRP C 3  240 ? 56.67173 21.39307  -20.95291 1.000 40.30814  ? 239  TRP A CD1   1 
ATOM   2752 C  CD2   . TRP C 3  240 ? 55.90407 20.98687  -23.02138 1.000 42.64960  ? 239  TRP A CD2   1 
ATOM   2753 N  NE1   . TRP C 3  240 ? 55.88200 22.45724  -21.32499 1.000 34.59190  ? 239  TRP A NE1   1 
ATOM   2754 C  CE2   . TRP C 3  240 ? 55.39741 22.23252  -22.58714 1.000 36.37196  ? 239  TRP A CE2   1 
ATOM   2755 C  CE3   . TRP C 3  240 ? 55.55164 20.51980  -24.29016 1.000 43.78038  ? 239  TRP A CE3   1 
ATOM   2756 C  CZ2   . TRP C 3  240 ? 54.56563 23.01425  -23.37720 1.000 39.60149  ? 239  TRP A CZ2   1 
ATOM   2757 C  CZ3   . TRP C 3  240 ? 54.71722 21.29816  -25.07021 1.000 46.41981  ? 239  TRP A CZ3   1 
ATOM   2758 C  CH2   . TRP C 3  240 ? 54.23554 22.53552  -24.61256 1.000 43.46888  ? 239  TRP A CH2   1 
ATOM   2759 N  N     . THR C 3  241 ? 58.83906 18.69492  -24.87310 1.000 44.03556  ? 240  THR A N     1 
ATOM   2760 C  CA    . THR C 3  241 ? 58.76623 18.94946  -26.30595 1.000 48.29724  ? 240  THR A CA    1 
ATOM   2761 C  C     . THR C 3  241 ? 57.55498 18.22336  -26.86584 1.000 51.37032  ? 240  THR A C     1 
ATOM   2762 O  O     . THR C 3  241 ? 57.00497 17.31759  -26.23548 1.000 50.70012  ? 240  THR A O     1 
ATOM   2763 C  CB    . THR C 3  241 ? 60.03123 18.49712  -27.07979 1.000 48.40663  ? 240  THR A CB    1 
ATOM   2764 O  OG1   . THR C 3  241 ? 60.31834 17.11808  -26.80086 1.000 50.23081  ? 240  THR A OG1   1 
ATOM   2765 C  CG2   . THR C 3  241 ? 61.25122 19.37571  -26.74954 1.000 44.38856  ? 240  THR A CG2   1 
ATOM   2766 N  N     . VAL C 3  242 ? 57.13873 18.62742  -28.05933 1.000 53.15621  ? 241  VAL A N     1 
ATOM   2767 C  CA    . VAL C 3  242 ? 56.06255 17.94370  -28.76041 1.000 52.55032  ? 241  VAL A CA    1 
ATOM   2768 C  C     . VAL C 3  242 ? 56.69728 17.09150  -29.84047 1.000 57.63908  ? 241  VAL A C     1 
ATOM   2769 O  O     . VAL C 3  242 ? 57.65982 17.50572  -30.50353 1.000 55.37214  ? 241  VAL A O     1 
ATOM   2770 C  CB    . VAL C 3  242 ? 55.01517 18.92375  -29.33616 1.000 48.09381  ? 241  VAL A CB    1 
ATOM   2771 C  CG1   . VAL C 3  242 ? 55.48144 19.56435  -30.63928 1.000 45.96189  ? 241  VAL A CG1   1 
ATOM   2772 C  CG2   . VAL C 3  242 ? 53.67703 18.22444  -29.52211 1.000 47.60853  ? 241  VAL A CG2   1 
ATOM   2773 N  N     . GLN C 3  243 ? 56.20771 15.87136  -29.96512 1.000 66.30117  ? 242  GLN A N     1 
ATOM   2774 C  CA    . GLN C 3  243 ? 56.70699 14.98985  -31.00056 1.000 75.54090  ? 242  GLN A CA    1 
ATOM   2775 C  C     . GLN C 3  243 ? 56.34046 15.58395  -32.35831 1.000 75.28065  ? 242  GLN A C     1 
ATOM   2776 O  O     . GLN C 3  243 ? 55.23190 16.10481  -32.52624 1.000 76.31435  ? 242  GLN A O     1 
ATOM   2777 C  CB    . GLN C 3  243 ? 56.13546 13.58683  -30.79171 1.000 81.12963  ? 242  GLN A CB    1 
ATOM   2778 C  CG    . GLN C 3  243 ? 56.26428 13.16232  -29.31715 1.000 83.78945  ? 242  GLN A CG    1 
ATOM   2779 C  CD    . GLN C 3  243 ? 55.73628 11.76755  -29.02442 1.000 89.00520  ? 242  GLN A CD    1 
ATOM   2780 O  OE1   . GLN C 3  243 ? 55.79595 10.88070  -29.87639 1.000 90.38583  ? 242  GLN A OE1   1 
ATOM   2781 N  NE2   . GLN C 3  243 ? 55.21659 11.56654  -27.80603 1.000 88.77473  ? 242  GLN A NE2   1 
ATOM   2782 N  N     . PRO C 3  244 ? 57.24234 15.53668  -33.33496 1.000 78.35847  ? 243  PRO A N     1 
ATOM   2783 C  CA    . PRO C 3  244 ? 57.26745 16.57352  -34.37763 1.000 80.71485  ? 243  PRO A CA    1 
ATOM   2784 C  C     . PRO C 3  244 ? 56.01103 16.59908  -35.23443 1.000 80.18993  ? 243  PRO A C     1 
ATOM   2785 O  O     . PRO C 3  244 ? 55.25214 15.63073  -35.32171 1.000 79.65546  ? 243  PRO A O     1 
ATOM   2786 C  CB    . PRO C 3  244 ? 58.49743 16.20563  -35.21968 1.000 82.01572  ? 243  PRO A CB    1 
ATOM   2787 C  CG    . PRO C 3  244 ? 59.25720 15.18868  -34.40005 1.000 82.04062  ? 243  PRO A CG    1 
ATOM   2788 C  CD    . PRO C 3  244 ? 58.23310 14.47879  -33.58029 1.000 80.38620  ? 243  PRO A CD    1 
ATOM   2789 N  N     . ILE C 3  245 ? 55.80368 17.73990  -35.88369 1.000 78.58520  ? 244  ILE A N     1 
ATOM   2790 C  CA    . ILE C 3  245 ? 54.65383 17.95117  -36.75160 1.000 74.58531  ? 244  ILE A CA    1 
ATOM   2791 C  C     . ILE C 3  245 ? 55.14413 17.97815  -38.18989 1.000 75.14782  ? 244  ILE A C     1 
ATOM   2792 O  O     . ILE C 3  245 ? 55.90451 18.87229  -38.58165 1.000 76.52949  ? 244  ILE A O     1 
ATOM   2793 C  CB    . ILE C 3  245 ? 53.89710 19.24147  -36.40326 1.000 68.61785  ? 244  ILE A CB    1 
ATOM   2794 C  CG1   . ILE C 3  245 ? 53.08846 19.05785  -35.12131 1.000 62.15011  ? 244  ILE A CG1   1 
ATOM   2795 C  CG2   . ILE C 3  245 ? 52.97911 19.65037  -37.54816 1.000 70.55357  ? 244  ILE A CG2   1 
ATOM   2796 C  CD1   . ILE C 3  245 ? 53.85256 19.37998  -33.86930 1.000 60.24169  ? 244  ILE A CD1   1 
ATOM   2797 N  N     . VAL C 3  246 ? 54.70155 17.00397  -38.97453 1.000 74.05940  ? 245  VAL A N     1 
ATOM   2798 C  CA    . VAL C 3  246 ? 54.97307 16.95812  -40.40291 1.000 75.21915  ? 245  VAL A CA    1 
ATOM   2799 C  C     . VAL C 3  246 ? 53.75544 17.53045  -41.10951 1.000 76.38599  ? 245  VAL A C     1 
ATOM   2800 O  O     . VAL C 3  246 ? 52.68093 16.91509  -41.10678 1.000 77.54071  ? 245  VAL A O     1 
ATOM   2801 C  CB    . VAL C 3  246 ? 55.26457 15.53153  -40.88422 1.000 75.22261  ? 245  VAL A CB    1 
ATOM   2802 C  CG1   . VAL C 3  246 ? 56.12757 15.56838  -42.13969 1.000 74.55089  ? 245  VAL A CG1   1 
ATOM   2803 C  CG2   . VAL C 3  246 ? 55.90785 14.69936  -39.76889 1.000 72.45886  ? 245  VAL A CG2   1 
ATOM   2804 N  N     . LEU C 3  247 ? 53.91997 18.71805  -41.70590 1.000 75.04101  ? 246  LEU A N     1 
ATOM   2805 C  CA    . LEU C 3  247 ? 52.87472 19.26914  -42.54835 1.000 76.22238  ? 246  LEU A CA    1 
ATOM   2806 C  C     . LEU C 3  247 ? 52.88213 18.57533  -43.90825 1.000 86.68872  ? 246  LEU A C     1 
ATOM   2807 O  O     . LEU C 3  247 ? 53.94948 18.22325  -44.41949 1.000 88.58362  ? 246  LEU A O     1 
ATOM   2808 C  CB    . LEU C 3  247 ? 53.06951 20.77366  -42.75046 1.000 72.34355  ? 246  LEU A CB    1 
ATOM   2809 C  CG    . LEU C 3  247 ? 52.95219 21.72227  -41.56249 1.000 65.58967  ? 246  LEU A CG    1 
ATOM   2810 C  CD1   . LEU C 3  247 ? 52.73314 23.14261  -42.05801 1.000 64.31688  ? 246  LEU A CD1   1 
ATOM   2811 C  CD2   . LEU C 3  247 ? 51.82723 21.29777  -40.63585 1.000 62.21990  ? 246  LEU A CD2   1 
ATOM   2812 N  N     . PRO C 3  248 ? 51.71253 18.37190  -44.51238 1.000 93.38647  ? 247  PRO A N     1 
ATOM   2813 C  CA    . PRO C 3  248 ? 51.67550 17.88569  -45.89729 1.000 97.77487  ? 247  PRO A CA    1 
ATOM   2814 C  C     . PRO C 3  248 ? 52.44349 18.81076  -46.83281 1.000 101.70425 ? 247  PRO A C     1 
ATOM   2815 O  O     . PRO C 3  248 ? 52.45997 20.03036  -46.65703 1.000 103.17477 ? 247  PRO A O     1 
ATOM   2816 C  CB    . PRO C 3  248 ? 50.17647 17.86323  -46.22721 1.000 99.47741  ? 247  PRO A CB    1 
ATOM   2817 C  CG    . PRO C 3  248 ? 49.51547 18.70664  -45.15718 1.000 98.30539  ? 247  PRO A CG    1 
ATOM   2818 C  CD    . PRO C 3  248 ? 50.36380 18.52047  -43.93973 1.000 94.67505  ? 247  PRO A CD    1 
ATOM   2819 N  N     . GLU C 3  249 ? 53.09312 18.20830  -47.82971 1.000 104.11763 ? 248  GLU A N     1 
ATOM   2820 C  CA    . GLU C 3  249 ? 53.86905 18.93319  -48.83034 1.000 104.21828 ? 248  GLU A CA    1 
ATOM   2821 C  C     . GLU C 3  249 ? 53.29014 18.65217  -50.21680 1.000 102.70058 ? 248  GLU A C     1 
ATOM   2822 O  O     . GLU C 3  249 ? 54.02394 18.34624  -51.16238 1.000 108.42625 ? 248  GLU A O     1 
ATOM   2823 C  CB    . GLU C 3  249 ? 55.35585 18.54549  -48.73376 1.000 107.85548 ? 248  GLU A CB    1 
ATOM   2824 C  CG    . GLU C 3  249 ? 56.33082 19.32606  -49.64210 1.000 112.85451 ? 248  GLU A CG    1 
ATOM   2825 C  CD    . GLU C 3  249 ? 56.25141 20.84733  -49.48785 1.000 113.70267 ? 248  GLU A CD    1 
ATOM   2826 O  OE1   . GLU C 3  249 ? 56.53910 21.35628  -48.38541 1.000 112.22075 ? 248  GLU A OE1   1 
ATOM   2827 O  OE2   . GLU C 3  249 ? 55.91369 21.53914  -50.47527 1.000 114.64028 ? 248  GLU A OE2   1 
ATOM   2828 N  N     . LYS C 3  250 ? 51.96694 18.74234  -50.34363 1.000 99.42546  ? 249  LYS A N     1 
ATOM   2829 C  CA    . LYS C 3  250 ? 51.28882 18.44548  -51.59793 1.000 98.42143  ? 249  LYS A CA    1 
ATOM   2830 C  C     . LYS C 3  250 ? 51.27856 19.66879  -52.52294 1.000 99.86331  ? 249  LYS A C     1 
ATOM   2831 O  O     . LYS C 3  250 ? 51.57463 20.79470  -52.11795 1.000 95.36815  ? 249  LYS A O     1 
ATOM   2832 C  CB    . LYS C 3  250 ? 49.86325 17.96249  -51.32478 1.000 91.26538  ? 249  LYS A CB    1 
ATOM   2833 N  N     . ASP C 3  251 ? 50.93348 19.43372  -53.78930 1.000 104.39022 ? 250  ASP A N     1 
ATOM   2834 C  CA    . ASP C 3  251 ? 50.85343 20.48541  -54.80368 1.000 115.31027 ? 250  ASP A CA    1 
ATOM   2835 C  C     . ASP C 3  251 ? 49.42823 20.87322  -55.16039 1.000 115.14419 ? 250  ASP A C     1 
ATOM   2836 O  O     . ASP C 3  251 ? 49.15157 22.05104  -55.41105 1.000 111.38982 ? 250  ASP A O     1 
ATOM   2837 C  CB    . ASP C 3  251 ? 51.57938 20.04967  -56.08254 1.000 127.08814 ? 250  ASP A CB    1 
ATOM   2838 C  CG    . ASP C 3  251 ? 53.06776 19.86183  -55.87390 1.000 131.86854 ? 250  ASP A CG    1 
ATOM   2839 O  OD1   . ASP C 3  251 ? 53.53807 20.09011  -54.73779 1.000 132.28683 ? 250  ASP A OD1   1 
ATOM   2840 O  OD2   . ASP C 3  251 ? 53.76370 19.48660  -56.84431 1.000 134.18944 ? 250  ASP A OD2   1 
ATOM   2841 N  N     . SER C 3  252 ? 48.53081 19.89777  -55.22966 1.000 115.67055 ? 251  SER A N     1 
ATOM   2842 C  CA    . SER C 3  252 ? 47.10082 20.13704  -55.32707 1.000 112.11099 ? 251  SER A CA    1 
ATOM   2843 C  C     . SER C 3  252 ? 46.49295 19.92226  -53.94784 1.000 105.82827 ? 251  SER A C     1 
ATOM   2844 O  O     . SER C 3  252 ? 46.84437 18.96819  -53.24765 1.000 107.26232 ? 251  SER A O     1 
ATOM   2845 C  CB    . SER C 3  252 ? 46.45849 19.20185  -56.35784 1.000 111.86782 ? 251  SER A CB    1 
ATOM   2846 O  OG    . SER C 3  252 ? 45.13389 19.59643  -56.66540 1.000 110.35298 ? 251  SER A OG    1 
ATOM   2847 N  N     . TRP C 3  253 ? 45.60133 20.82213  -53.54631 1.000 99.60905  ? 252  TRP A N     1 
ATOM   2848 C  CA    . TRP C 3  253 ? 45.05098 20.81304  -52.19597 1.000 89.06856  ? 252  TRP A CA    1 
ATOM   2849 C  C     . TRP C 3  253 ? 43.53798 20.65484  -52.25185 1.000 86.72709  ? 252  TRP A C     1 
ATOM   2850 O  O     . TRP C 3  253 ? 42.85065 21.44657  -52.90480 1.000 89.97622  ? 252  TRP A O     1 
ATOM   2851 C  CB    . TRP C 3  253 ? 45.42914 22.09319  -51.44727 1.000 82.68371  ? 252  TRP A CB    1 
ATOM   2852 C  CG    . TRP C 3  253 ? 46.90580 22.23506  -51.15589 1.000 78.05880  ? 252  TRP A CG    1 
ATOM   2853 C  CD1   . TRP C 3  253 ? 47.85561 22.77056  -51.97408 1.000 79.11452  ? 252  TRP A CD1   1 
ATOM   2854 C  CD2   . TRP C 3  253 ? 47.58678 21.85078  -49.95019 1.000 74.13212  ? 252  TRP A CD2   1 
ATOM   2855 N  NE1   . TRP C 3  253 ? 49.08514 22.74126  -51.35842 1.000 78.21429  ? 252  TRP A NE1   1 
ATOM   2856 C  CE2   . TRP C 3  253 ? 48.94852 22.17949  -50.11633 1.000 73.14053  ? 252  TRP A CE2   1 
ATOM   2857 C  CE3   . TRP C 3  253 ? 47.17559 21.26088  -48.74819 1.000 69.10830  ? 252  TRP A CE3   1 
ATOM   2858 C  CZ2   . TRP C 3  253 ? 49.90253 21.93700  -49.12856 1.000 67.60817  ? 252  TRP A CZ2   1 
ATOM   2859 C  CZ3   . TRP C 3  253 ? 48.12184 21.02218  -47.76994 1.000 68.34596  ? 252  TRP A CZ3   1 
ATOM   2860 C  CH2   . TRP C 3  253 ? 49.47130 21.36077  -47.96576 1.000 67.51752  ? 252  TRP A CH2   1 
ATOM   2861 N  N     . THR C 3  254 ? 43.02631 19.63744  -51.56792 1.000 83.15182  ? 253  THR A N     1 
ATOM   2862 C  CA    . THR C 3  254 ? 41.59563 19.45379  -51.38429 1.000 80.84732  ? 253  THR A CA    1 
ATOM   2863 C  C     . THR C 3  254 ? 41.16893 19.99624  -50.02280 1.000 78.19498  ? 253  THR A C     1 
ATOM   2864 O  O     . THR C 3  254 ? 41.99351 20.27055  -49.14712 1.000 77.49452  ? 253  THR A O     1 
ATOM   2865 C  CB    . THR C 3  254 ? 41.21073 17.97499  -51.49980 1.000 79.49433  ? 253  THR A CB    1 
ATOM   2866 O  OG1   . THR C 3  254 ? 41.78605 17.24207  -50.40932 1.000 81.36872  ? 253  THR A OG1   1 
ATOM   2867 C  CG2   . THR C 3  254 ? 41.70587 17.39426  -52.79859 1.000 79.39486  ? 253  THR A CG2   1 
ATOM   2868 N  N     . VAL C 3  255 ? 39.85111 20.14664  -49.85623 1.000 78.17392  ? 254  VAL A N     1 
ATOM   2869 C  CA    . VAL C 3  255 ? 39.29699 20.56987  -48.57221 1.000 81.65433  ? 254  VAL A CA    1 
ATOM   2870 C  C     . VAL C 3  255 ? 39.83079 19.69179  -47.44642 1.000 86.52104  ? 254  VAL A C     1 
ATOM   2871 O  O     . VAL C 3  255 ? 40.18280 20.18585  -46.36943 1.000 88.27561  ? 254  VAL A O     1 
ATOM   2872 C  CB    . VAL C 3  255 ? 37.75591 20.55668  -48.62437 1.000 82.01470  ? 254  VAL A CB    1 
ATOM   2873 C  CG1   . VAL C 3  255 ? 37.15379 20.58669  -47.21387 1.000 79.87650  ? 254  VAL A CG1   1 
ATOM   2874 C  CG2   . VAL C 3  255 ? 37.23916 21.72033  -49.45741 1.000 81.82939  ? 254  VAL A CG2   1 
ATOM   2875 N  N     . ASN C 3  256 ? 39.92347 18.38017  -47.68669 1.000 87.23424  ? 255  ASN A N     1 
ATOM   2876 C  CA    . ASN C 3  256 ? 40.44781 17.47103  -46.67109 1.000 85.63338  ? 255  ASN A CA    1 
ATOM   2877 C  C     . ASN C 3  256 ? 41.91745 17.75721  -46.38254 1.000 82.11831  ? 255  ASN A C     1 
ATOM   2878 O  O     . ASN C 3  256 ? 42.34622 17.73394  -45.21925 1.000 82.52051  ? 255  ASN A O     1 
ATOM   2879 C  CB    . ASN C 3  256 ? 40.25561 16.02177  -47.12474 1.000 91.94072  ? 255  ASN A CB    1 
ATOM   2880 C  CG    . ASN C 3  256 ? 40.22092 15.04270  -45.96791 1.000 93.26291  ? 255  ASN A CG    1 
ATOM   2881 O  OD1   . ASN C 3  256 ? 41.25998 14.56831  -45.51210 1.000 93.59386  ? 255  ASN A OD1   1 
ATOM   2882 N  ND2   . ASN C 3  256 ? 39.01961 14.72905  -45.49061 1.000 94.42436  ? 255  ASN A ND2   1 
ATOM   2883 N  N     . ASP C 3  257 ? 42.70120 18.03636  -47.42942 1.000 80.73352  ? 256  ASP A N     1 
ATOM   2884 C  CA    . ASP C 3  257 ? 44.09899 18.41497  -47.23842 1.000 75.77314  ? 256  ASP A CA    1 
ATOM   2885 C  C     . ASP C 3  257 ? 44.21806 19.63393  -46.32860 1.000 70.13803  ? 256  ASP A C     1 
ATOM   2886 O  O     . ASP C 3  257 ? 45.08595 19.67720  -45.44289 1.000 66.83124  ? 256  ASP A O     1 
ATOM   2887 C  CB    . ASP C 3  257 ? 44.76156 18.69228  -48.59501 1.000 79.08650  ? 256  ASP A CB    1 
ATOM   2888 C  CG    . ASP C 3  257 ? 45.03866 17.41898  -49.40149 1.000 80.37637  ? 256  ASP A CG    1 
ATOM   2889 O  OD1   . ASP C 3  257 ? 45.07458 16.32248  -48.79723 1.000 78.01217  ? 256  ASP A OD1   1 
ATOM   2890 O  OD2   . ASP C 3  257 ? 45.23931 17.52234  -50.63785 1.000 81.74365  ? 256  ASP A OD2   1 
ATOM   2891 N  N     . ILE C 3  258 ? 43.32845 20.62067  -46.51456 1.000 66.48544  ? 257  ILE A N     1 
ATOM   2892 C  CA    . ILE C 3  258 ? 43.39239 21.86522  -45.75007 1.000 62.68511  ? 257  ILE A CA    1 
ATOM   2893 C  C     . ILE C 3  258 ? 42.90513 21.65479  -44.31441 1.000 62.35911  ? 257  ILE A C     1 
ATOM   2894 O  O     . ILE C 3  258 ? 43.44300 22.24206  -43.36886 1.000 54.92650  ? 257  ILE A O     1 
ATOM   2895 C  CB    . ILE C 3  258 ? 42.59683 22.96517  -46.47505 1.000 63.68352  ? 257  ILE A CB    1 
ATOM   2896 C  CG1   . ILE C 3  258 ? 43.33099 23.38918  -47.74206 1.000 71.87369  ? 257  ILE A CG1   1 
ATOM   2897 C  CG2   . ILE C 3  258 ? 42.42800 24.18637  -45.59110 1.000 57.25478  ? 257  ILE A CG2   1 
ATOM   2898 C  CD1   . ILE C 3  258 ? 44.62956 24.13054  -47.45731 1.000 72.11457  ? 257  ILE A CD1   1 
ATOM   2899 N  N     . CYS C 3  259 ? 41.87594 20.83058  -44.12503 1.000 66.92888  ? 258  CYS A N     1 
ATOM   2900 C  CA    . CYS C 3  259 ? 41.49093 20.46117  -42.77320 1.000 65.31426  ? 258  CYS A CA    1 
ATOM   2901 C  C     . CYS C 3  259 ? 42.65832 19.82164  -42.03575 1.000 64.89491  ? 258  CYS A C     1 
ATOM   2902 O  O     . CYS C 3  259 ? 42.90615 20.13856  -40.86755 1.000 61.00188  ? 258  CYS A O     1 
ATOM   2903 C  CB    . CYS C 3  259 ? 40.29151 19.52333  -42.80371 1.000 73.54506  ? 258  CYS A CB    1 
ATOM   2904 S  SG    . CYS C 3  259 ? 38.74658 20.31073  -43.23625 1.000 91.48773  ? 258  CYS A SG    1 
ATOM   2905 N  N     . LYS C 3  260 ? 43.41144 18.94350  -42.71017 1.000 67.44996  ? 259  LYS A N     1 
ATOM   2906 C  CA    . LYS C 3  260 ? 44.56802 18.32138  -42.05900 1.000 68.82942  ? 259  LYS A CA    1 
ATOM   2907 C  C     . LYS C 3  260 ? 45.62386 19.36112  -41.70583 1.000 66.43572  ? 259  LYS A C     1 
ATOM   2908 O  O     . LYS C 3  260 ? 46.15447 19.37515  -40.58600 1.000 65.84165  ? 259  LYS A O     1 
ATOM   2909 C  CB    . LYS C 3  260 ? 45.18164 17.24646  -42.95637 1.000 72.44073  ? 259  LYS A CB    1 
ATOM   2910 C  CG    . LYS C 3  260 ? 44.44015 15.93419  -42.99460 1.000 74.12758  ? 259  LYS A CG    1 
ATOM   2911 C  CD    . LYS C 3  260 ? 45.23518 14.93198  -43.81494 1.000 79.37659  ? 259  LYS A CD    1 
ATOM   2912 C  CE    . LYS C 3  260 ? 44.47816 13.63475  -44.03710 1.000 83.40769  ? 259  LYS A CE    1 
ATOM   2913 N  NZ    . LYS C 3  260 ? 45.22825 12.73459  -44.96114 1.000 86.85174  ? 259  LYS A NZ    1 
ATOM   2914 N  N     . LEU C 3  261 ? 45.94886 20.22966  -42.66693 1.000 66.05687  ? 260  LEU A N     1 
ATOM   2915 C  CA    . LEU C 3  261 ? 46.93492 21.28364  -42.44424 1.000 62.34675  ? 260  LEU A CA    1 
ATOM   2916 C  C     . LEU C 3  261 ? 46.54293 22.17689  -41.27455 1.000 55.91376  ? 260  LEU A C     1 
ATOM   2917 O  O     . LEU C 3  261 ? 47.35783 22.44748  -40.38363 1.000 54.97919  ? 260  LEU A O     1 
ATOM   2918 C  CB    . LEU C 3  261 ? 47.09314 22.11138  -43.71592 1.000 64.44279  ? 260  LEU A CB    1 
ATOM   2919 C  CG    . LEU C 3  261 ? 48.18306 23.17410  -43.71768 1.000 63.14789  ? 260  LEU A CG    1 
ATOM   2920 C  CD1   . LEU C 3  261 ? 49.56081 22.53280  -43.64842 1.000 62.46424  ? 260  LEU A CD1   1 
ATOM   2921 C  CD2   . LEU C 3  261 ? 48.02695 24.04126  -44.96019 1.000 64.22601  ? 260  LEU A CD2   1 
ATOM   2922 N  N     . VAL C 3  262 ? 45.29219 22.63911  -41.25818 1.000 54.37492  ? 261  VAL A N     1 
ATOM   2923 C  CA    . VAL C 3  262 ? 44.84278 23.55823  -40.21689 1.000 53.66177  ? 261  VAL A CA    1 
ATOM   2924 C  C     . VAL C 3  262 ? 44.80993 22.86602  -38.85950 1.000 51.81120  ? 261  VAL A C     1 
ATOM   2925 O  O     . VAL C 3  262 ? 45.16161 23.47030  -37.83470 1.000 51.56932  ? 261  VAL A O     1 
ATOM   2926 C  CB    . VAL C 3  262 ? 43.47120 24.15263  -40.58367 1.000 52.64207  ? 261  VAL A CB    1 
ATOM   2927 C  CG1   . VAL C 3  262 ? 42.92132 24.97121  -39.42255 1.000 49.86101  ? 261  VAL A CG1   1 
ATOM   2928 C  CG2   . VAL C 3  262 ? 43.59607 25.02395  -41.81883 1.000 56.88535  ? 261  VAL A CG2   1 
ATOM   2929 N  N     . GLY C 3  263 ? 44.38884 21.59425  -38.82244 1.000 47.11521  ? 262  GLY A N     1 
ATOM   2930 C  CA    . GLY C 3  263 ? 44.42345 20.85579  -37.57070 1.000 42.00059  ? 262  GLY A CA    1 
ATOM   2931 C  C     . GLY C 3  263 ? 45.83021 20.72659  -37.01943 1.000 45.36353  ? 262  GLY A C     1 
ATOM   2932 O  O     . GLY C 3  263 ? 46.06156 20.92918  -35.82127 1.000 42.09843  ? 262  GLY A O     1 
ATOM   2933 N  N     . LYS C 3  264 ? 46.79796 20.41839  -37.89566 1.000 49.83784  ? 263  LYS A N     1 
ATOM   2934 C  CA    . LYS C 3  264 ? 48.17745 20.25979  -37.44329 1.000 45.61335  ? 263  LYS A CA    1 
ATOM   2935 C  C     . LYS C 3  264 ? 48.76848 21.58925  -36.99609 1.000 44.38125  ? 263  LYS A C     1 
ATOM   2936 O  O     . LYS C 3  264 ? 49.53657 21.63882  -36.02800 1.000 40.46386  ? 263  LYS A O     1 
ATOM   2937 C  CB    . LYS C 3  264 ? 49.02455 19.63363  -38.54682 1.000 47.63567  ? 263  LYS A CB    1 
ATOM   2938 C  CG    . LYS C 3  264 ? 48.68729 18.17742  -38.79593 1.000 55.15437  ? 263  LYS A CG    1 
ATOM   2939 C  CD    . LYS C 3  264 ? 49.84187 17.44117  -39.43036 1.000 61.33489  ? 263  LYS A CD    1 
ATOM   2940 C  CE    . LYS C 3  264 ? 49.80579 15.96577  -39.05670 1.000 63.11688  ? 263  LYS A CE    1 
ATOM   2941 N  NZ    . LYS C 3  264 ? 51.03715 15.28306  -39.52776 1.000 65.87440  ? 263  LYS A NZ    1 
ATOM   2942 N  N     . LEU C 3  265 ? 48.42049 22.68143  -37.68325 1.000 44.27632  ? 264  LEU A N     1 
ATOM   2943 C  CA    . LEU C 3  265 ? 48.92493 23.98170  -37.26328 1.000 45.13681  ? 264  LEU A CA    1 
ATOM   2944 C  C     . LEU C 3  265 ? 48.34661 24.36830  -35.90536 1.000 47.89116  ? 264  LEU A C     1 
ATOM   2945 O  O     . LEU C 3  265 ? 49.06990 24.87955  -35.03628 1.000 46.57531  ? 264  LEU A O     1 
ATOM   2946 C  CB    . LEU C 3  265 ? 48.61354 25.03466  -38.32830 1.000 45.33041  ? 264  LEU A CB    1 
ATOM   2947 C  CG    . LEU C 3  265 ? 49.44665 24.92505  -39.61905 1.000 50.15199  ? 264  LEU A CG    1 
ATOM   2948 C  CD1   . LEU C 3  265 ? 48.85782 25.73854  -40.78230 1.000 45.95940  ? 264  LEU A CD1   1 
ATOM   2949 C  CD2   . LEU C 3  265 ? 50.89845 25.33610  -39.37531 1.000 52.02779  ? 264  LEU A CD2   1 
ATOM   2950 N  N     . ASN C 3  266 ? 47.05076 24.10677  -35.69498 1.000 45.29792  ? 265  ASN A N     1 
ATOM   2951 C  CA    . ASN C 3  266 ? 46.44650 24.41113  -34.40660 1.000 43.85913  ? 265  ASN A CA    1 
ATOM   2952 C  C     . ASN C 3  266 ? 47.12980 23.62211  -33.30313 1.000 41.10680  ? 265  ASN A C     1 
ATOM   2953 O  O     . ASN C 3  266 ? 47.52229 24.18210  -32.27284 1.000 40.14054  ? 265  ASN A O     1 
ATOM   2954 C  CB    . ASN C 3  266 ? 44.94483 24.12492  -34.44058 1.000 48.93557  ? 265  ASN A CB    1 
ATOM   2955 C  CG    . ASN C 3  266 ? 44.17636 25.11685  -35.31767 1.000 58.91334  ? 265  ASN A CG    1 
ATOM   2956 O  OD1   . ASN C 3  266 ? 44.49513 26.31473  -35.37379 1.000 53.23853  ? 265  ASN A OD1   1 
ATOM   2957 N  ND2   . ASN C 3  266 ? 43.15971 24.61330  -36.01361 1.000 67.88453  ? 265  ASN A ND2   1 
ATOM   2958 N  N     . TRP C 3  267 ? 47.31357 22.32041  -33.52323 1.000 38.29435  ? 266  TRP A N     1 
ATOM   2959 C  CA    . TRP C 3  267 ? 48.06685 21.50497  -32.57972 1.000 36.01572  ? 266  TRP A CA    1 
ATOM   2960 C  C     . TRP C 3  267 ? 49.44841 22.09966  -32.31445 1.000 39.80460  ? 266  TRP A C     1 
ATOM   2961 O  O     . TRP C 3  267 ? 49.90134 22.15876  -31.16594 1.000 40.28800  ? 266  TRP A O     1 
ATOM   2962 C  CB    . TRP C 3  267 ? 48.17474 20.07349  -33.11976 1.000 34.36345  ? 266  TRP A CB    1 
ATOM   2963 C  CG    . TRP C 3  267 ? 49.00544 19.15758  -32.28412 1.000 36.20774  ? 266  TRP A CG    1 
ATOM   2964 C  CD1   . TRP C 3  267 ? 50.19660 18.59290  -32.63187 1.000 37.48121  ? 266  TRP A CD1   1 
ATOM   2965 C  CD2   . TRP C 3  267 ? 48.70900 18.68615  -30.95689 1.000 38.93793  ? 266  TRP A CD2   1 
ATOM   2966 N  NE1   . TRP C 3  267 ? 50.66427 17.79994  -31.60271 1.000 36.99071  ? 266  TRP A NE1   1 
ATOM   2967 C  CE2   . TRP C 3  267 ? 49.77017 17.83969  -30.56605 1.000 38.25759  ? 266  TRP A CE2   1 
ATOM   2968 C  CE3   . TRP C 3  267 ? 47.64885 18.89235  -30.06536 1.000 39.05208  ? 266  TRP A CE3   1 
ATOM   2969 C  CZ2   . TRP C 3  267 ? 49.80887 17.21185  -29.31537 1.000 37.42491  ? 266  TRP A CZ2   1 
ATOM   2970 C  CZ3   . TRP C 3  267 ? 47.69176 18.26593  -28.81652 1.000 34.96116  ? 266  TRP A CZ3   1 
ATOM   2971 C  CH2   . TRP C 3  267 ? 48.76206 17.43662  -28.46050 1.000 33.88754  ? 266  TRP A CH2   1 
ATOM   2972 N  N     . ALA C 3  268 ? 50.12987 22.56257  -33.36358 1.000 38.79620  ? 267  ALA A N     1 
ATOM   2973 C  CA    . ALA C 3  268 ? 51.47053 23.09777  -33.18123 1.000 38.29097  ? 267  ALA A CA    1 
ATOM   2974 C  C     . ALA C 3  268 ? 51.47173 24.41214  -32.41495 1.000 38.55890  ? 267  ALA A C     1 
ATOM   2975 O  O     . ALA C 3  268 ? 52.48997 24.76312  -31.81004 1.000 36.93194  ? 267  ALA A O     1 
ATOM   2976 C  CB    . ALA C 3  268 ? 52.14294 23.28384  -34.53326 1.000 34.50447  ? 267  ALA A CB    1 
ATOM   2977 N  N     . SER C 3  269 ? 50.36225 25.15049  -32.43477 1.000 38.01083  ? 268  SER A N     1 
ATOM   2978 C  CA    . SER C 3  269 ? 50.40884 26.49862  -31.88565 1.000 41.73553  ? 268  SER A CA    1 
ATOM   2979 C  C     . SER C 3  269 ? 50.48908 26.51397  -30.36298 1.000 44.05334  ? 268  SER A C     1 
ATOM   2980 O  O     . SER C 3  269 ? 50.73669 27.58058  -29.78738 1.000 45.10504  ? 268  SER A O     1 
ATOM   2981 C  CB    . SER C 3  269 ? 49.20309 27.30414  -32.36165 1.000 43.21653  ? 268  SER A CB    1 
ATOM   2982 O  OG    . SER C 3  269 ? 48.00706 26.79229  -31.80526 1.000 46.34590  ? 268  SER A OG    1 
ATOM   2983 N  N     . GLN C 3  270 ? 50.29451 25.36557  -29.70581 1.000 40.96092  ? 269  GLN A N     1 
ATOM   2984 C  CA    . GLN C 3  270 ? 50.46900 25.26200  -28.26333 1.000 32.72762  ? 269  GLN A CA    1 
ATOM   2985 C  C     . GLN C 3  270 ? 51.91665 25.47923  -27.83262 1.000 35.71203  ? 269  GLN A C     1 
ATOM   2986 O  O     . GLN C 3  270 ? 52.16429 25.77695  -26.65578 1.000 27.78006  ? 269  GLN A O     1 
ATOM   2987 C  CB    . GLN C 3  270 ? 49.99539 23.88872  -27.77530 1.000 30.26429  ? 269  GLN A CB    1 
ATOM   2988 C  CG    . GLN C 3  270 ? 50.86836 22.72844  -28.22064 1.000 30.82224  ? 269  GLN A CG    1 
ATOM   2989 C  CD    . GLN C 3  270 ? 50.32348 21.37204  -27.75565 1.000 35.95941  ? 269  GLN A CD    1 
ATOM   2990 O  OE1   . GLN C 3  270 ? 50.20020 21.11828  -26.55350 1.000 36.43190  ? 269  GLN A OE1   1 
ATOM   2991 N  NE2   . GLN C 3  270 ? 49.99431 20.49803  -28.71356 1.000 32.92769  ? 269  GLN A NE2   1 
ATOM   2992 N  N     . ILE C 3  271 ? 52.88304 25.30718  -28.73348 1.000 37.70448  ? 270  ILE A N     1 
ATOM   2993 C  CA    . ILE C 3  271 ? 54.27742 25.55672  -28.37714 1.000 41.19243  ? 270  ILE A CA    1 
ATOM   2994 C  C     . ILE C 3  271 ? 55.03405 26.35780  -29.42722 1.000 39.54846  ? 270  ILE A C     1 
ATOM   2995 O  O     . ILE C 3  271 ? 56.11302 26.89213  -29.12393 1.000 38.57027  ? 270  ILE A O     1 
ATOM   2996 C  CB    . ILE C 3  271 ? 55.00503 24.21989  -28.08030 1.000 41.28134  ? 270  ILE A CB    1 
ATOM   2997 C  CG1   . ILE C 3  271 ? 56.30458 24.46035  -27.29998 1.000 40.46355  ? 270  ILE A CG1   1 
ATOM   2998 C  CG2   . ILE C 3  271 ? 55.28142 23.47460  -29.37115 1.000 41.11268  ? 270  ILE A CG2   1 
ATOM   2999 C  CD1   . ILE C 3  271 ? 56.14485 25.40645  -26.10058 1.000 40.23577  ? 270  ILE A CD1   1 
ATOM   3000 N  N     . TYR C 3  272 ? 54.52850 26.49200  -30.66018 1.000 41.42171  ? 271  TYR A N     1 
ATOM   3001 C  CA    . TYR C 3  272 ? 55.17792 27.30730  -31.68714 1.000 45.48502  ? 271  TYR A CA    1 
ATOM   3002 C  C     . TYR C 3  272 ? 54.55588 28.69107  -31.71226 1.000 47.92801  ? 271  TYR A C     1 
ATOM   3003 O  O     . TYR C 3  272 ? 53.35203 28.80740  -31.97921 1.000 51.62282  ? 271  TYR A O     1 
ATOM   3004 C  CB    . TYR C 3  272 ? 55.04846 26.65803  -33.06034 1.000 47.19702  ? 271  TYR A CB    1 
ATOM   3005 C  CG    . TYR C 3  272 ? 55.89347 25.41784  -33.23609 1.000 43.73796  ? 271  TYR A CG    1 
ATOM   3006 C  CD1   . TYR C 3  272 ? 55.41091 24.16495  -32.85663 1.000 39.85065  ? 271  TYR A CD1   1 
ATOM   3007 C  CD2   . TYR C 3  272 ? 57.17518 25.49864  -33.77878 1.000 44.08836  ? 271  TYR A CD2   1 
ATOM   3008 C  CE1   . TYR C 3  272 ? 56.18610 23.02190  -33.00969 1.000 41.50604  ? 271  TYR A CE1   1 
ATOM   3009 C  CE2   . TYR C 3  272 ? 57.96333 24.36203  -33.94089 1.000 48.56043  ? 271  TYR A CE2   1 
ATOM   3010 C  CZ    . TYR C 3  272 ? 57.46203 23.12746  -33.55213 1.000 49.93492  ? 271  TYR A CZ    1 
ATOM   3011 O  OH    . TYR C 3  272 ? 58.24246 22.00389  -33.70872 1.000 56.66217  ? 271  TYR A OH    1 
ATOM   3012 N  N     . PRO C 3  273 ? 55.31203 29.75269  -31.45155 1.000 49.90910  ? 272  PRO A N     1 
ATOM   3013 C  CA    . PRO C 3  273 ? 54.74118 31.10519  -31.50769 1.000 50.21357  ? 272  PRO A CA    1 
ATOM   3014 C  C     . PRO C 3  273 ? 54.50258 31.58209  -32.93288 1.000 49.36310  ? 272  PRO A C     1 
ATOM   3015 O  O     . PRO C 3  273 ? 55.27599 31.28584  -33.84769 1.000 51.87055  ? 272  PRO A O     1 
ATOM   3016 C  CB    . PRO C 3  273 ? 55.81271 31.96670  -30.82626 1.000 50.06337  ? 272  PRO A CB    1 
ATOM   3017 C  CG    . PRO C 3  273 ? 56.70090 30.99897  -30.10484 1.000 52.75481  ? 272  PRO A CG    1 
ATOM   3018 C  CD    . PRO C 3  273 ? 56.67990 29.75565  -30.91573 1.000 53.34176  ? 272  PRO A CD    1 
ATOM   3019 N  N     . GLY C 3  274 ? 53.42120 32.33671  -33.11132 1.000 43.89084  ? 273  GLY A N     1 
ATOM   3020 C  CA    . GLY C 3  274 ? 53.17871 33.04178  -34.35093 1.000 45.11442  ? 273  GLY A CA    1 
ATOM   3021 C  C     . GLY C 3  274 ? 52.41414 32.29634  -35.42213 1.000 53.00738  ? 273  GLY A C     1 
ATOM   3022 O  O     . GLY C 3  274 ? 52.31560 32.80684  -36.54613 1.000 56.00773  ? 273  GLY A O     1 
ATOM   3023 N  N     . ILE C 3  275 ? 51.87066 31.11007  -35.12154 1.000 53.42003  ? 274  ILE A N     1 
ATOM   3024 C  CA    . ILE C 3  275 ? 51.14888 30.34488  -36.13457 1.000 51.99886  ? 274  ILE A CA    1 
ATOM   3025 C  C     . ILE C 3  275 ? 49.90014 31.10593  -36.56913 1.000 48.08906  ? 274  ILE A C     1 
ATOM   3026 O  O     . ILE C 3  275 ? 49.23553 31.75748  -35.75379 1.000 48.30266  ? 274  ILE A O     1 
ATOM   3027 C  CB    . ILE C 3  275 ? 50.79079 28.95132  -35.59062 1.000 52.61732  ? 274  ILE A CB    1 
ATOM   3028 C  CG1   . ILE C 3  275 ? 52.05551 28.17542  -35.24127 1.000 53.69689  ? 274  ILE A CG1   1 
ATOM   3029 C  CG2   . ILE C 3  275 ? 49.96903 28.17014  -36.60977 1.000 52.87177  ? 274  ILE A CG2   1 
ATOM   3030 C  CD1   . ILE C 3  275 ? 52.87993 27.81585  -36.44859 1.000 54.02929  ? 274  ILE A CD1   1 
ATOM   3031 N  N     . LYS C 3  276 ? 49.57149 31.02390  -37.86316 1.000 47.92701  ? 275  LYS A N     1 
ATOM   3032 C  CA    . LYS C 3  276 ? 48.42258 31.72650  -38.42982 1.000 49.53360  ? 275  LYS A CA    1 
ATOM   3033 C  C     . LYS C 3  276 ? 47.65457 30.81894  -39.38433 1.000 54.84126  ? 275  LYS A C     1 
ATOM   3034 O  O     . LYS C 3  276 ? 48.25731 30.08923  -40.17761 1.000 62.02817  ? 275  LYS A O     1 
ATOM   3035 C  CB    . LYS C 3  276 ? 48.86394 33.00564  -39.15610 1.000 50.16833  ? 275  LYS A CB    1 
ATOM   3036 C  CG    . LYS C 3  276 ? 49.37884 34.07490  -38.20860 1.000 48.48362  ? 275  LYS A CG    1 
ATOM   3037 C  CD    . LYS C 3  276 ? 49.55751 35.40862  -38.89384 1.000 53.41258  ? 275  LYS A CD    1 
ATOM   3038 C  CE    . LYS C 3  276 ? 50.95021 35.57289  -39.45258 1.000 56.43854  ? 275  LYS A CE    1 
ATOM   3039 N  NZ    . LYS C 3  276 ? 51.21833 37.02841  -39.67837 1.000 61.10518  ? 275  LYS A NZ    1 
ATOM   3040 N  N     . VAL C 3  277 ? 46.32054 30.84086  -39.28727 1.000 53.65056  ? 276  VAL A N     1 
ATOM   3041 C  CA    . VAL C 3  277 ? 45.48719 29.96938  -40.11421 1.000 52.58373  ? 276  VAL A CA    1 
ATOM   3042 C  C     . VAL C 3  277 ? 44.31127 30.71654  -40.73697 1.000 57.73524  ? 276  VAL A C     1 
ATOM   3043 O  O     . VAL C 3  277 ? 43.42216 30.09642  -41.33250 1.000 57.36269  ? 276  VAL A O     1 
ATOM   3044 C  CB    . VAL C 3  277 ? 44.98888 28.75922  -39.30216 1.000 48.44424  ? 276  VAL A CB    1 
ATOM   3045 C  CG1   . VAL C 3  277 ? 46.16751 27.96704  -38.78336 1.000 50.75731  ? 276  VAL A CG1   1 
ATOM   3046 C  CG2   . VAL C 3  277 ? 44.08853 29.20177  -38.16190 1.000 39.08146  ? 276  VAL A CG2   1 
ATOM   3047 N  N     . ARG C 3  278 ? 44.31484 32.04869  -40.63596 1.000 59.83198  ? 277  ARG A N     1 
ATOM   3048 C  CA    . ARG C 3  278 ? 43.20527 32.85330  -41.14231 1.000 65.92187  ? 277  ARG A CA    1 
ATOM   3049 C  C     . ARG C 3  278 ? 42.91471 32.55477  -42.60805 1.000 71.26589  ? 277  ARG A C     1 
ATOM   3050 O  O     . ARG C 3  278 ? 41.80302 32.15269  -42.96836 1.000 75.10242  ? 277  ARG A O     1 
ATOM   3051 C  CB    . ARG C 3  278 ? 43.52203 34.33956  -40.96817 1.000 69.38880  ? 277  ARG A CB    1 
ATOM   3052 C  CG    . ARG C 3  278 ? 42.75131 35.28089  -41.89390 1.000 72.04215  ? 277  ARG A CG    1 
ATOM   3053 C  CD    . ARG C 3  278 ? 41.30762 35.44724  -41.45544 1.000 76.55610  ? 277  ARG A CD    1 
ATOM   3054 N  NE    . ARG C 3  278 ? 41.20745 35.91796  -40.07214 1.000 78.66842  ? 277  ARG A NE    1 
ATOM   3055 C  CZ    . ARG C 3  278 ? 40.89693 35.14337  -39.03573 1.000 70.70980  ? 277  ARG A CZ    1 
ATOM   3056 N  NH1   . ARG C 3  278 ? 40.83070 35.65895  -37.81460 1.000 65.39931  ? 277  ARG A NH1   1 
ATOM   3057 N  NH2   . ARG C 3  278 ? 40.65054 33.85519  -39.22362 1.000 68.26004  ? 277  ARG A NH2   1 
ATOM   3058 N  N     . GLN C 3  279 ? 43.91296 32.77049  -43.46784 1.000 67.07100  ? 278  GLN A N     1 
ATOM   3059 C  CA    . GLN C 3  279 ? 43.71764 32.64530  -44.90679 1.000 71.74365  ? 278  GLN A CA    1 
ATOM   3060 C  C     . GLN C 3  279 ? 43.37222 31.21348  -45.29697 1.000 77.25930  ? 278  GLN A C     1 
ATOM   3061 O  O     . GLN C 3  279 ? 42.42965 30.96982  -46.06609 1.000 80.70448  ? 278  GLN A O     1 
ATOM   3062 C  CB    . GLN C 3  279 ? 44.98009 33.11677  -45.62574 1.000 73.42476  ? 278  GLN A CB    1 
ATOM   3063 C  CG    . GLN C 3  279 ? 45.38280 34.53262  -45.25336 1.000 70.87377  ? 278  GLN A CG    1 
ATOM   3064 C  CD    . GLN C 3  279 ? 44.29928 35.54652  -45.58486 1.000 68.97306  ? 278  GLN A CD    1 
ATOM   3065 O  OE1   . GLN C 3  279 ? 43.58657 35.40437  -46.58070 1.000 72.41401  ? 278  GLN A OE1   1 
ATOM   3066 N  NE2   . GLN C 3  279 ? 44.16913 36.57436  -44.75012 1.000 64.77124  ? 278  GLN A NE2   1 
ATOM   3067 N  N     . LEU C 3  280 ? 44.13033 30.25065  -44.76613 1.000 75.48980  ? 279  LEU A N     1 
ATOM   3068 C  CA    . LEU C 3  280 ? 43.86990 28.84686  -45.05210 1.000 69.62174  ? 279  LEU A CA    1 
ATOM   3069 C  C     . LEU C 3  280 ? 42.47281 28.43525  -44.59435 1.000 66.64665  ? 279  LEU A C     1 
ATOM   3070 O  O     . LEU C 3  280 ? 41.81375 27.62226  -45.25339 1.000 68.54025  ? 279  LEU A O     1 
ATOM   3071 C  CB    . LEU C 3  280 ? 44.94773 27.98842  -44.39317 1.000 66.16264  ? 279  LEU A CB    1 
ATOM   3072 C  CG    . LEU C 3  280 ? 46.36572 28.37894  -44.82117 1.000 65.09400  ? 279  LEU A CG    1 
ATOM   3073 C  CD1   . LEU C 3  280 ? 47.40176 27.93729  -43.79124 1.000 65.89853  ? 279  LEU A CD1   1 
ATOM   3074 C  CD2   . LEU C 3  280 ? 46.68879 27.79499  -46.17912 1.000 64.58263  ? 279  LEU A CD2   1 
ATOM   3075 N  N     . SER C 3  281 ? 41.98913 28.99936  -43.48488 1.000 60.27459  ? 280  SER A N     1 
ATOM   3076 C  CA    . SER C 3  281 ? 40.66492 28.61899  -43.00350 1.000 61.09556  ? 280  SER A CA    1 
ATOM   3077 C  C     . SER C 3  281 ? 39.55537 29.25721  -43.83072 1.000 67.94310  ? 280  SER A C     1 
ATOM   3078 O  O     . SER C 3  281 ? 38.61273 28.57159  -44.24187 1.000 71.72304  ? 280  SER A O     1 
ATOM   3079 C  CB    . SER C 3  281 ? 40.51408 28.98030  -41.53106 1.000 60.75826  ? 280  SER A CB    1 
ATOM   3080 O  OG    . SER C 3  281 ? 41.31334 28.11028  -40.75163 1.000 66.24044  ? 280  SER A OG    1 
ATOM   3081 N  N     . LYS C 3  282 ? 39.64359 30.56728  -44.08767 1.000 68.62008  ? 281  LYS A N     1 
ATOM   3082 C  CA    . LYS C 3  282 ? 38.63943 31.21425  -44.92784 1.000 73.79932  ? 281  LYS A CA    1 
ATOM   3083 C  C     . LYS C 3  282 ? 38.61262 30.61313  -46.32519 1.000 77.20322  ? 281  LYS A C     1 
ATOM   3084 O  O     . LYS C 3  282 ? 37.59311 30.71602  -47.01728 1.000 79.14341  ? 281  LYS A O     1 
ATOM   3085 C  CB    . LYS C 3  282 ? 38.88647 32.72391  -45.01085 1.000 77.40494  ? 281  LYS A CB    1 
ATOM   3086 C  CG    . LYS C 3  282 ? 37.63488 33.52742  -45.34631 1.000 81.20583  ? 281  LYS A CG    1 
ATOM   3087 C  CD    . LYS C 3  282 ? 37.86635 34.44937  -46.53504 1.000 85.71936  ? 281  LYS A CD    1 
ATOM   3088 C  CE    . LYS C 3  282 ? 36.55608 34.81954  -47.22409 1.000 85.98085  ? 281  LYS A CE    1 
ATOM   3089 N  NZ    . LYS C 3  282 ? 36.78956 35.63554  -48.44756 1.000 87.80667  ? 281  LYS A NZ    1 
ATOM   3090 N  N     . LEU C 3  283 ? 39.70847 29.96973  -46.73454 1.000 76.74632  ? 282  LEU A N     1 
ATOM   3091 C  CA    . LEU C 3  283 ? 39.79990 29.18833  -47.96050 1.000 73.95831  ? 282  LEU A CA    1 
ATOM   3092 C  C     . LEU C 3  283 ? 38.88148 27.96046  -47.96299 1.000 76.95817  ? 282  LEU A C     1 
ATOM   3093 O  O     . LEU C 3  283 ? 38.81263 27.23353  -48.95964 1.000 76.28333  ? 282  LEU A O     1 
ATOM   3094 C  CB    . LEU C 3  283 ? 41.25903 28.77322  -48.14362 1.000 66.63842  ? 282  LEU A CB    1 
ATOM   3095 C  CG    . LEU C 3  283 ? 41.73458 28.18806  -49.45325 1.000 68.49895  ? 282  LEU A CG    1 
ATOM   3096 C  CD1   . LEU C 3  283 ? 41.89977 29.31336  -50.46407 1.000 73.26180  ? 282  LEU A CD1   1 
ATOM   3097 C  CD2   . LEU C 3  283 ? 43.03216 27.45185  -49.20014 1.000 65.52746  ? 282  LEU A CD2   1 
ATOM   3098 N  N     . LEU C 3  284 ? 38.17990 27.70880  -46.85566 1.000 77.84875  ? 283  LEU A N     1 
ATOM   3099 C  CA    . LEU C 3  284 ? 37.22364 26.61177  -46.75713 1.000 78.85453  ? 283  LEU A CA    1 
ATOM   3100 C  C     . LEU C 3  284 ? 35.78456 27.09291  -46.70604 1.000 83.53846  ? 283  LEU A C     1 
ATOM   3101 O  O     . LEU C 3  284 ? 34.87764 26.28037  -46.49749 1.000 82.13670  ? 283  LEU A O     1 
ATOM   3102 C  CB    . LEU C 3  284 ? 37.50299 25.76761  -45.51888 1.000 75.04211  ? 283  LEU A CB    1 
ATOM   3103 C  CG    . LEU C 3  284 ? 38.82290 25.01629  -45.48138 1.000 74.28793  ? 283  LEU A CG    1 
ATOM   3104 C  CD1   . LEU C 3  284 ? 39.20094 24.80545  -44.03311 1.000 66.80366  ? 283  LEU A CD1   1 
ATOM   3105 C  CD2   . LEU C 3  284 ? 38.71254 23.69427  -46.22215 1.000 77.08160  ? 283  LEU A CD2   1 
ATOM   3106 N  N     . ARG C 3  285 ? 35.55648 28.39303  -46.86372 1.000 88.64850  ? 284  ARG A N     1 
ATOM   3107 C  CA    . ARG C 3  285 ? 34.20758 28.92761  -46.77689 1.000 88.66512  ? 284  ARG A CA    1 
ATOM   3108 C  C     . ARG C 3  285 ? 33.33667 28.36187  -47.89519 1.000 90.98616  ? 284  ARG A C     1 
ATOM   3109 O  O     . ARG C 3  285 ? 33.72231 28.36571  -49.06871 1.000 87.51695  ? 284  ARG A O     1 
ATOM   3110 C  CB    . ARG C 3  285 ? 34.24595 30.45559  -46.83344 1.000 86.92683  ? 284  ARG A CB    1 
ATOM   3111 N  N     . GLY C 3  286 ? 32.17110 27.84216  -47.51375 1.000 94.12708  ? 285  GLY A N     1 
ATOM   3112 C  CA    . GLY C 3  286 ? 31.18822 27.37523  -48.47263 1.000 100.12428 ? 285  GLY A CA    1 
ATOM   3113 C  C     . GLY C 3  286 ? 31.63061 26.21746  -49.33265 1.000 105.46838 ? 285  GLY A C     1 
ATOM   3114 O  O     . GLY C 3  286 ? 31.06926 26.01382  -50.41154 1.000 108.85140 ? 285  GLY A O     1 
ATOM   3115 N  N     . THR C 3  287 ? 32.62042 25.44565  -48.88770 1.000 105.30827 ? 286  THR A N     1 
ATOM   3116 C  CA    . THR C 3  287 ? 33.11352 24.33350  -49.68444 1.000 105.92421 ? 286  THR A CA    1 
ATOM   3117 C  C     . THR C 3  287 ? 32.00156 23.31231  -49.91847 1.000 107.41299 ? 286  THR A C     1 
ATOM   3118 O  O     . THR C 3  287 ? 30.95284 23.32574  -49.27112 1.000 108.15021 ? 286  THR A O     1 
ATOM   3119 C  CB    . THR C 3  287 ? 34.30521 23.66604  -49.00058 1.000 101.89826 ? 286  THR A CB    1 
ATOM   3120 N  N     . LYS C 3  288 ? 32.24169 22.41635  -50.87079 1.000 108.05021 ? 287  LYS A N     1 
ATOM   3121 C  CA    . LYS C 3  288 ? 31.23652 21.42010  -51.21786 1.000 107.35955 ? 287  LYS A CA    1 
ATOM   3122 C  C     . LYS C 3  288 ? 31.42224 20.14990  -50.39500 1.000 107.16216 ? 287  LYS A C     1 
ATOM   3123 O  O     . LYS C 3  288 ? 30.54437 19.76927  -49.61411 1.000 110.41482 ? 287  LYS A O     1 
ATOM   3124 C  CB    . LYS C 3  288 ? 31.29871 21.10993  -52.71845 1.000 109.22153 ? 287  LYS A CB    1 
ATOM   3125 N  N     . ALA C 3  289 ? 32.57520 19.50540  -50.53713 1.000 103.04168 ? 288  ALA A N     1 
ATOM   3126 C  CA    . ALA C 3  289 ? 32.82652 18.22821  -49.89212 1.000 93.89969  ? 288  ALA A CA    1 
ATOM   3127 C  C     . ALA C 3  289 ? 34.32583 18.07957  -49.69359 1.000 88.96169  ? 288  ALA A C     1 
ATOM   3128 O  O     . ALA C 3  289 ? 35.12390 18.84152  -50.24587 1.000 89.33892  ? 288  ALA A O     1 
ATOM   3129 C  CB    . ALA C 3  289 ? 32.26084 17.06231  -50.71354 1.000 95.90693  ? 288  ALA A CB    1 
ATOM   3130 N  N     . LEU C 3  290 ? 34.69856 17.06791  -48.90244 1.000 85.62595  ? 289  LEU A N     1 
ATOM   3131 C  CA    . LEU C 3  290 ? 36.09949 16.84682  -48.55226 1.000 85.39531  ? 289  LEU A CA    1 
ATOM   3132 C  C     . LEU C 3  290 ? 36.99223 16.73611  -49.78427 1.000 90.57756  ? 289  LEU A C     1 
ATOM   3133 O  O     . LEU C 3  290 ? 38.17517 17.09570  -49.72947 1.000 89.52921  ? 289  LEU A O     1 
ATOM   3134 C  CB    . LEU C 3  290 ? 36.22514 15.58192  -47.69251 1.000 82.43510  ? 289  LEU A CB    1 
ATOM   3135 C  CG    . LEU C 3  290 ? 35.50419 15.57627  -46.33723 1.000 78.29886  ? 289  LEU A CG    1 
ATOM   3136 C  CD1   . LEU C 3  290 ? 35.44260 14.16852  -45.73412 1.000 74.80777  ? 289  LEU A CD1   1 
ATOM   3137 C  CD2   . LEU C 3  290 ? 36.15780 16.56660  -45.36456 1.000 73.01297  ? 289  LEU A CD2   1 
ATOM   3138 N  N     . THR C 3  291 ? 36.44514 16.26231  -50.90508 1.000 92.41334  ? 290  THR A N     1 
ATOM   3139 C  CA    . THR C 3  291 ? 37.23713 16.00038  -52.09859 1.000 93.52932  ? 290  THR A CA    1 
ATOM   3140 C  C     . THR C 3  291 ? 37.36715 17.19781  -53.03364 1.000 94.20235  ? 290  THR A C     1 
ATOM   3141 O  O     . THR C 3  291 ? 38.21003 17.15193  -53.93664 1.000 100.41833 ? 290  THR A O     1 
ATOM   3142 C  CB    . THR C 3  291 ? 36.64711 14.82089  -52.88630 1.000 96.36820  ? 290  THR A CB    1 
ATOM   3143 O  OG1   . THR C 3  291 ? 35.21819 14.92177  -52.90462 1.000 97.58501  ? 290  THR A OG1   1 
ATOM   3144 C  CG2   . THR C 3  291 ? 37.06043 13.48983  -52.26996 1.000 92.27189  ? 290  THR A CG2   1 
ATOM   3145 N  N     . GLU C 3  292 ? 36.56206 18.25028  -52.86311 1.000 88.73643  ? 291  GLU A N     1 
ATOM   3146 C  CA    . GLU C 3  292 ? 36.68186 19.41911  -53.73059 1.000 82.00724  ? 291  GLU A CA    1 
ATOM   3147 C  C     . GLU C 3  292 ? 38.10259 19.96389  -53.67129 1.000 81.04901  ? 291  GLU A C     1 
ATOM   3148 O  O     . GLU C 3  292 ? 38.73995 19.96519  -52.61750 1.000 81.02505  ? 291  GLU A O     1 
ATOM   3149 C  CB    . GLU C 3  292 ? 35.68064 20.50539  -53.32428 1.000 78.01923  ? 291  GLU A CB    1 
ATOM   3150 N  N     . VAL C 3  293 ? 38.61283 20.40280  -54.81314 1.000 86.07025  ? 292  VAL A N     1 
ATOM   3151 C  CA    . VAL C 3  293 ? 39.98116 20.89632  -54.91517 1.000 88.85173  ? 292  VAL A CA    1 
ATOM   3152 C  C     . VAL C 3  293 ? 39.95227 22.41615  -54.82781 1.000 92.51794  ? 292  VAL A C     1 
ATOM   3153 O  O     . VAL C 3  293 ? 39.35160 23.08237  -55.67921 1.000 96.32531  ? 292  VAL A O     1 
ATOM   3154 C  CB    . VAL C 3  293 ? 40.65299 20.42074  -56.21267 1.000 90.06116  ? 292  VAL A CB    1 
ATOM   3155 C  CG1   . VAL C 3  293 ? 42.03797 21.03084  -56.34657 1.000 87.42086  ? 292  VAL A CG1   1 
ATOM   3156 C  CG2   . VAL C 3  293 ? 40.73615 18.90006  -56.22515 1.000 89.27600  ? 292  VAL A CG2   1 
ATOM   3157 N  N     . ILE C 3  294 ? 40.59177 22.96114  -53.79489 1.000 92.09831  ? 293  ILE A N     1 
ATOM   3158 C  CA    . ILE C 3  294 ? 40.69265 24.40625  -53.59879 1.000 92.38840  ? 293  ILE A CA    1 
ATOM   3159 C  C     . ILE C 3  294 ? 42.03094 24.88659  -54.14988 1.000 96.96051  ? 293  ILE A C     1 
ATOM   3160 O  O     . ILE C 3  294 ? 43.06024 24.22621  -53.93855 1.000 95.02834  ? 293  ILE A O     1 
ATOM   3161 C  CB    . ILE C 3  294 ? 40.54212 24.78672  -52.11545 1.000 83.25386  ? 293  ILE A CB    1 
ATOM   3162 N  N     . PRO C 3  295 ? 42.06599 26.00966  -54.87801 1.000 101.64413 ? 294  PRO A N     1 
ATOM   3163 C  CA    . PRO C 3  295 ? 43.35431 26.60972  -55.24139 1.000 102.75125 ? 294  PRO A CA    1 
ATOM   3164 C  C     . PRO C 3  295 ? 43.84272 27.55942  -54.15764 1.000 98.85592  ? 294  PRO A C     1 
ATOM   3165 O  O     . PRO C 3  295 ? 43.08598 28.41849  -53.69086 1.000 96.07309  ? 294  PRO A O     1 
ATOM   3166 C  CB    . PRO C 3  295 ? 43.03537 27.34272  -56.54889 1.000 106.88094 ? 294  PRO A CB    1 
ATOM   3167 C  CG    . PRO C 3  295 ? 41.60531 27.75242  -56.38691 1.000 107.23421 ? 294  PRO A CG    1 
ATOM   3168 C  CD    . PRO C 3  295 ? 40.93540 26.69048  -55.53599 1.000 105.40682 ? 294  PRO A CD    1 
ATOM   3169 N  N     . LEU C 3  296 ? 45.09250 27.39695  -53.72881 1.000 97.14766  ? 295  LEU A N     1 
ATOM   3170 C  CA    . LEU C 3  296 ? 45.64599 28.27338  -52.70562 1.000 94.53294  ? 295  LEU A CA    1 
ATOM   3171 C  C     . LEU C 3  296 ? 45.70588 29.69714  -53.22443 1.000 96.77093  ? 295  LEU A C     1 
ATOM   3172 O  O     . LEU C 3  296 ? 46.40729 29.97514  -54.20168 1.000 102.89195 ? 295  LEU A O     1 
ATOM   3173 C  CB    . LEU C 3  296 ? 47.04648 27.81568  -52.29882 1.000 95.41794  ? 295  LEU A CB    1 
ATOM   3174 C  CG    . LEU C 3  296 ? 47.22141 26.52796  -51.49681 1.000 92.31961  ? 295  LEU A CG    1 
ATOM   3175 C  CD1   . LEU C 3  296 ? 48.61189 26.47655  -50.89330 1.000 89.84484  ? 295  LEU A CD1   1 
ATOM   3176 C  CD2   . LEU C 3  296 ? 46.16978 26.43469  -50.42199 1.000 89.85022  ? 295  LEU A CD2   1 
ATOM   3177 N  N     . THR C 3  297 ? 44.96606 30.59771  -52.58218 1.000 93.44088  ? 296  THR A N     1 
ATOM   3178 C  CA    . THR C 3  297 ? 45.14618 32.01006  -52.87448 1.000 88.07420  ? 296  THR A CA    1 
ATOM   3179 C  C     . THR C 3  297 ? 46.54911 32.43707  -52.45206 1.000 93.82024  ? 296  THR A C     1 
ATOM   3180 O  O     . THR C 3  297 ? 47.19464 31.79659  -51.61604 1.000 90.83402  ? 296  THR A O     1 
ATOM   3181 C  CB    . THR C 3  297 ? 44.08732 32.85419  -52.16418 1.000 72.95485  ? 296  THR A CB    1 
ATOM   3182 O  OG1   . THR C 3  297 ? 44.35821 32.88678  -50.75871 1.000 73.80699  ? 296  THR A OG1   1 
ATOM   3183 C  CG2   . THR C 3  297 ? 42.70176 32.26898  -52.39263 1.000 66.92328  ? 296  THR A CG2   1 
ATOM   3184 N  N     . GLU C 3  298 ? 47.03601 33.51913  -53.06694 1.000 97.22238  ? 297  GLU A N     1 
ATOM   3185 C  CA    . GLU C 3  298 ? 48.38680 33.98509  -52.76830 1.000 102.08566 ? 297  GLU A CA    1 
ATOM   3186 C  C     . GLU C 3  298 ? 48.53867 34.36783  -51.29562 1.000 102.11018 ? 297  GLU A C     1 
ATOM   3187 O  O     . GLU C 3  298 ? 49.62441 34.20537  -50.71680 1.000 104.28401 ? 297  GLU A O     1 
ATOM   3188 C  CB    . GLU C 3  298 ? 48.72966 35.14775  -53.69388 1.000 108.50496 ? 297  GLU A CB    1 
ATOM   3189 C  CG    . GLU C 3  298 ? 48.26043 34.88797  -55.12269 1.000 118.03849 ? 297  GLU A CG    1 
ATOM   3190 C  CD    . GLU C 3  298 ? 48.67720 35.96756  -56.10156 1.000 123.30064 ? 297  GLU A CD    1 
ATOM   3191 O  OE1   . GLU C 3  298 ? 49.23786 35.62406  -57.16884 1.000 129.32507 ? 297  GLU A OE1   1 
ATOM   3192 O  OE2   . GLU C 3  298 ? 48.43793 37.15711  -55.80297 1.000 120.16671 ? 297  GLU A OE2   1 
ATOM   3193 N  N     . GLU C 3  299 ? 47.45666 34.83307  -50.66244 1.000 98.46673  ? 298  GLU A N     1 
ATOM   3194 C  CA    . GLU C 3  299 ? 47.48853 35.08439  -49.22391 1.000 96.52106  ? 298  GLU A CA    1 
ATOM   3195 C  C     . GLU C 3  299 ? 47.68611 33.78854  -48.44821 1.000 92.45957  ? 298  GLU A C     1 
ATOM   3196 O  O     . GLU C 3  299 ? 48.51181 33.71786  -47.52722 1.000 91.61388  ? 298  GLU A O     1 
ATOM   3197 C  CB    . GLU C 3  299 ? 46.19946 35.77317  -48.77441 1.000 98.94860  ? 298  GLU A CB    1 
ATOM   3198 C  CG    . GLU C 3  299 ? 45.76470 36.94113  -49.63924 1.000 103.47537 ? 298  GLU A CG    1 
ATOM   3199 C  CD    . GLU C 3  299 ? 44.61207 36.58044  -50.55544 1.000 106.06838 ? 298  GLU A CD    1 
ATOM   3200 O  OE1   . GLU C 3  299 ? 44.85893 35.98122  -51.62702 1.000 106.08069 ? 298  GLU A OE1   1 
ATOM   3201 O  OE2   . GLU C 3  299 ? 43.45625 36.88619  -50.18898 1.000 106.50586 ? 298  GLU A OE2   1 
ATOM   3202 N  N     . ALA C 3  300 ? 46.91732 32.75399  -48.79932 1.000 91.48495  ? 299  ALA A N     1 
ATOM   3203 C  CA    . ALA C 3  300 ? 47.08649 31.45292  -48.16067 1.000 89.32454  ? 299  ALA A CA    1 
ATOM   3204 C  C     . ALA C 3  300 ? 48.47459 30.88633  -48.43021 1.000 89.77998  ? 299  ALA A C     1 
ATOM   3205 O  O     . ALA C 3  300 ? 49.09262 30.28829  -47.54306 1.000 85.61145  ? 299  ALA A O     1 
ATOM   3206 C  CB    . ALA C 3  300 ? 46.00312 30.48608  -48.64185 1.000 87.53799  ? 299  ALA A CB    1 
ATOM   3207 N  N     . GLU C 3  301 ? 48.97497 31.06259  -49.65369 1.000 95.28891  ? 300  GLU A N     1 
ATOM   3208 C  CA    . GLU C 3  301 ? 50.34169 30.67888  -49.99052 1.000 99.41528  ? 300  GLU A CA    1 
ATOM   3209 C  C     . GLU C 3  301 ? 51.33712 31.27279  -48.99834 1.000 92.89465  ? 300  GLU A C     1 
ATOM   3210 O  O     . GLU C 3  301 ? 52.13833 30.55466  -48.38175 1.000 84.42872  ? 300  GLU A O     1 
ATOM   3211 C  CB    . GLU C 3  301 ? 50.64941 31.15289  -51.41208 1.000 109.04327 ? 300  GLU A CB    1 
ATOM   3212 C  CG    . GLU C 3  301 ? 51.34413 30.15469  -52.31722 1.000 117.44964 ? 300  GLU A CG    1 
ATOM   3213 C  CD    . GLU C 3  301 ? 50.87543 30.29790  -53.75313 1.000 125.29874 ? 300  GLU A CD    1 
ATOM   3214 O  OE1   . GLU C 3  301 ? 49.67521 30.06107  -53.99166 1.000 126.96516 ? 300  GLU A OE1   1 
ATOM   3215 O  OE2   . GLU C 3  301 ? 51.68370 30.67305  -54.63140 1.000 129.68134 ? 300  GLU A OE2   1 
ATOM   3216 N  N     . LEU C 3  302 ? 51.28793 32.60214  -48.83949 1.000 93.85658  ? 301  LEU A N     1 
ATOM   3217 C  CA    . LEU C 3  302 ? 52.23032 33.29811  -47.96472 1.000 91.60838  ? 301  LEU A CA    1 
ATOM   3218 C  C     . LEU C 3  302 ? 52.08829 32.84469  -46.51729 1.000 85.12574  ? 301  LEU A C     1 
ATOM   3219 O  O     . LEU C 3  302 ? 53.09167 32.64352  -45.81374 1.000 81.17069  ? 301  LEU A O     1 
ATOM   3220 C  CB    . LEU C 3  302 ? 52.01497 34.81056  -48.07026 1.000 91.42092  ? 301  LEU A CB    1 
ATOM   3221 C  CG    . LEU C 3  302 ? 52.90620 35.60219  -49.02764 1.000 93.97250  ? 301  LEU A CG    1 
ATOM   3222 C  CD1   . LEU C 3  302 ? 54.31382 35.68744  -48.46032 1.000 94.30632  ? 301  LEU A CD1   1 
ATOM   3223 C  CD2   . LEU C 3  302 ? 52.91716 34.98407  -50.42369 1.000 97.46794  ? 301  LEU A CD2   1 
ATOM   3224 N  N     . GLU C 3  303 ? 50.84633 32.70278  -46.04866 1.000 81.45097  ? 302  GLU A N     1 
ATOM   3225 C  CA    . GLU C 3  303 ? 50.62310 32.27966  -44.67171 1.000 74.44902  ? 302  GLU A CA    1 
ATOM   3226 C  C     . GLU C 3  303 ? 51.23029 30.90606  -44.43113 1.000 67.28269  ? 302  GLU A C     1 
ATOM   3227 O  O     . GLU C 3  303 ? 51.93669 30.68516  -43.43674 1.000 66.07890  ? 302  GLU A O     1 
ATOM   3228 C  CB    . GLU C 3  303 ? 49.12479 32.27714  -44.36470 1.000 74.30063  ? 302  GLU A CB    1 
ATOM   3229 C  CG    . GLU C 3  303 ? 48.78253 32.31648  -42.88252 1.000 74.09716  ? 302  GLU A CG    1 
ATOM   3230 C  CD    . GLU C 3  303 ? 47.29033 32.17926  -42.63120 1.000 75.74190  ? 302  GLU A CD    1 
ATOM   3231 O  OE1   . GLU C 3  303 ? 46.74380 31.09329  -42.92685 1.000 74.44492  ? 302  GLU A OE1   1 
ATOM   3232 O  OE2   . GLU C 3  303 ? 46.66591 33.15728  -42.15369 1.000 76.19439  ? 302  GLU A OE2   1 
ATOM   3233 N  N     . LEU C 3  304 ? 50.96944 29.97308  -45.34650 1.000 65.22454  ? 303  LEU A N     1 
ATOM   3234 C  CA    . LEU C 3  304 ? 51.51663 28.62955  -45.22648 1.000 67.02036  ? 303  LEU A CA    1 
ATOM   3235 C  C     . LEU C 3  304 ? 53.03890 28.65244  -45.23021 1.000 70.35731  ? 303  LEU A C     1 
ATOM   3236 O  O     . LEU C 3  304 ? 53.68072 27.90637  -44.48260 1.000 72.74216  ? 303  LEU A O     1 
ATOM   3237 C  CB    . LEU C 3  304 ? 50.98049 27.75922  -46.36223 1.000 67.40690  ? 303  LEU A CB    1 
ATOM   3238 C  CG    . LEU C 3  304 ? 51.50923 26.33510  -46.50936 1.000 65.72070  ? 303  LEU A CG    1 
ATOM   3239 C  CD1   . LEU C 3  304 ? 51.25412 25.53240  -45.22450 1.000 62.19383  ? 303  LEU A CD1   1 
ATOM   3240 C  CD2   . LEU C 3  304 ? 50.85724 25.67902  -47.71007 1.000 61.49067  ? 303  LEU A CD2   1 
ATOM   3241 N  N     . ALA C 3  305 ? 53.63781 29.50634  -46.05822 1.000 72.18733  ? 304  ALA A N     1 
ATOM   3242 C  CA    . ALA C 3  305 ? 55.09381 29.59310  -46.06250 1.000 73.52500  ? 304  ALA A CA    1 
ATOM   3243 C  C     . ALA C 3  305 ? 55.61728 30.08134  -44.71258 1.000 69.67160  ? 304  ALA A C     1 
ATOM   3244 O  O     . ALA C 3  305 ? 56.59313 29.53374  -44.17460 1.000 71.71394  ? 304  ALA A O     1 
ATOM   3245 C  CB    . ALA C 3  305 ? 55.56188 30.50190  -47.20043 1.000 75.08867  ? 304  ALA A CB    1 
ATOM   3246 N  N     . GLU C 3  306 ? 54.98096 31.10887  -44.14725 1.000 65.52760  ? 305  GLU A N     1 
ATOM   3247 C  CA    . GLU C 3  306 ? 55.43029 31.61539  -42.85332 1.000 66.53832  ? 305  GLU A CA    1 
ATOM   3248 C  C     . GLU C 3  306 ? 55.33767 30.52784  -41.78900 1.000 67.04956  ? 305  GLU A C     1 
ATOM   3249 O  O     . GLU C 3  306 ? 56.27633 30.32130  -41.00745 1.000 65.89465  ? 305  GLU A O     1 
ATOM   3250 C  CB    . GLU C 3  306 ? 54.61647 32.84885  -42.45343 1.000 64.85274  ? 305  GLU A CB    1 
ATOM   3251 N  N     . ASN C 3  307 ? 54.21032 29.80940  -41.76443 1.000 64.43356  ? 306  ASN A N     1 
ATOM   3252 C  CA    . ASN C 3  307 ? 54.04009 28.69381  -40.83803 1.000 56.62169  ? 306  ASN A CA    1 
ATOM   3253 C  C     . ASN C 3  307 ? 55.11661 27.62094  -41.02999 1.000 58.04706  ? 306  ASN A C     1 
ATOM   3254 O  O     . ASN C 3  307 ? 55.61492 27.05252  -40.04941 1.000 55.71676  ? 306  ASN A O     1 
ATOM   3255 C  CB    . ASN C 3  307 ? 52.65442 28.07818  -41.02207 1.000 54.22274  ? 306  ASN A CB    1 
ATOM   3256 C  CG    . ASN C 3  307 ? 51.54376 28.94423  -40.47528 1.000 50.35926  ? 306  ASN A CG    1 
ATOM   3257 O  OD1   . ASN C 3  307 ? 51.62139 29.44913  -39.35240 1.000 51.40143  ? 306  ASN A OD1   1 
ATOM   3258 N  ND2   . ASN C 3  307 ? 50.48313 29.10095  -41.26099 1.000 49.87515  ? 306  ASN A ND2   1 
ATOM   3259 N  N     . ARG C 3  308 ? 55.46659 27.30216  -42.28279 1.000 56.86920  ? 307  ARG A N     1 
ATOM   3260 C  CA    . ARG C 3  308 ? 56.49671 26.28929  -42.51256 1.000 59.93937  ? 307  ARG A CA    1 
ATOM   3261 C  C     . ARG C 3  308 ? 57.83804 26.73661  -41.94843 1.000 62.34044  ? 307  ARG A C     1 
ATOM   3262 O  O     . ARG C 3  308 ? 58.56069 25.95045  -41.31518 1.000 66.60344  ? 307  ARG A O     1 
ATOM   3263 C  CB    . ARG C 3  308 ? 56.62574 25.97709  -44.00265 1.000 63.83395  ? 307  ARG A CB    1 
ATOM   3264 C  CG    . ARG C 3  308 ? 55.37810 25.38647  -44.62929 1.000 67.94048  ? 307  ARG A CG    1 
ATOM   3265 C  CD    . ARG C 3  308 ? 55.67868 24.72759  -45.96855 1.000 75.13315  ? 307  ARG A CD    1 
ATOM   3266 N  NE    . ARG C 3  308 ? 55.59564 23.27436  -45.84569 1.000 81.27175  ? 307  ARG A NE    1 
ATOM   3267 C  CZ    . ARG C 3  308 ? 54.54842 22.54850  -46.22708 1.000 85.90131  ? 307  ARG A CZ    1 
ATOM   3268 N  NH1   . ARG C 3  308 ? 53.49600 23.13867  -46.78230 1.000 86.83692  ? 307  ARG A NH1   1 
ATOM   3269 N  NH2   . ARG C 3  308 ? 54.55677 21.23050  -46.06156 1.000 87.46106  ? 307  ARG A NH2   1 
ATOM   3270 N  N     . GLU C 3  309 ? 58.18420 28.00399  -42.15040 1.000 62.52732  ? 308  GLU A N     1 
ATOM   3271 C  CA    . GLU C 3  309 ? 59.42881 28.49277  -41.57207 1.000 65.62510  ? 308  GLU A CA    1 
ATOM   3272 C  C     . GLU C 3  309 ? 59.37422 28.42314  -40.04817 1.000 63.36881  ? 308  GLU A C     1 
ATOM   3273 O  O     . GLU C 3  309 ? 60.30145 27.91257  -39.40449 1.000 61.60195  ? 308  GLU A O     1 
ATOM   3274 C  CB    . GLU C 3  309 ? 59.72137 29.90700  -42.07273 1.000 70.05099  ? 308  GLU A CB    1 
ATOM   3275 C  CG    . GLU C 3  309 ? 59.81860 29.98765  -43.59579 1.000 78.62565  ? 308  GLU A CG    1 
ATOM   3276 C  CD    . GLU C 3  309 ? 60.61890 28.83461  -44.20850 1.000 90.57864  ? 308  GLU A CD    1 
ATOM   3277 O  OE1   . GLU C 3  309 ? 61.74048 28.54861  -43.72901 1.000 93.57463  ? 308  GLU A OE1   1 
ATOM   3278 O  OE2   . GLU C 3  309 ? 60.12139 28.20294  -45.17101 1.000 94.65735  ? 308  GLU A OE2   1 
ATOM   3279 N  N     . ILE C 3  310 ? 58.26466 28.88737  -39.46138 1.000 59.52437  ? 309  ILE A N     1 
ATOM   3280 C  CA    . ILE C 3  310 ? 58.06094 28.78294  -38.01609 1.000 53.94168  ? 309  ILE A CA    1 
ATOM   3281 C  C     . ILE C 3  310 ? 58.29762 27.35286  -37.53985 1.000 59.35253  ? 309  ILE A C     1 
ATOM   3282 O  O     . ILE C 3  310 ? 58.96122 27.11598  -36.52023 1.000 60.08913  ? 309  ILE A O     1 
ATOM   3283 C  CB    . ILE C 3  310 ? 56.65069 29.27195  -37.63459 1.000 45.97078  ? 309  ILE A CB    1 
ATOM   3284 C  CG1   . ILE C 3  310 ? 56.56121 30.79058  -37.73516 1.000 44.35209  ? 309  ILE A CG1   1 
ATOM   3285 C  CG2   . ILE C 3  310 ? 56.27862 28.82641  -36.22445 1.000 41.80472  ? 309  ILE A CG2   1 
ATOM   3286 C  CD1   . ILE C 3  310 ? 55.27630 31.34938  -37.17988 1.000 42.05520  ? 309  ILE A CD1   1 
ATOM   3287 N  N     . LEU C 3  311 ? 57.76022 26.37587  -38.27155 1.000 61.13713  ? 310  LEU A N     1 
ATOM   3288 C  CA    . LEU C 3  311 ? 57.83553 24.99989  -37.79231 1.000 64.00942  ? 310  LEU A CA    1 
ATOM   3289 C  C     . LEU C 3  311 ? 59.22110 24.39764  -37.97870 1.000 66.95683  ? 310  LEU A C     1 
ATOM   3290 O  O     . LEU C 3  311 ? 59.54401 23.41012  -37.30469 1.000 61.15619  ? 310  LEU A O     1 
ATOM   3291 C  CB    . LEU C 3  311 ? 56.77294 24.13151  -38.47226 1.000 61.42965  ? 310  LEU A CB    1 
ATOM   3292 C  CG    . LEU C 3  311 ? 55.37035 24.21157  -37.85380 1.000 55.55718  ? 310  LEU A CG    1 
ATOM   3293 C  CD1   . LEU C 3  311 ? 54.34372 23.57649  -38.76908 1.000 60.84720  ? 310  LEU A CD1   1 
ATOM   3294 C  CD2   . LEU C 3  311 ? 55.34486 23.53254  -36.50266 1.000 48.06847  ? 310  LEU A CD2   1 
ATOM   3295 N  N     . LYS C 3  312 ? 60.05496 24.97693  -38.85557 1.000 73.40375  ? 311  LYS A N     1 
ATOM   3296 C  CA    . LYS C 3  312 ? 61.43850 24.49709  -38.95039 1.000 74.70070  ? 311  LYS A CA    1 
ATOM   3297 C  C     . LYS C 3  312 ? 62.28081 24.79623  -37.70334 1.000 77.75603  ? 311  LYS A C     1 
ATOM   3298 O  O     . LYS C 3  312 ? 63.44352 24.38410  -37.65655 1.000 78.60163  ? 311  LYS A O     1 
ATOM   3299 C  CB    . LYS C 3  312 ? 62.13041 25.09817  -40.17381 1.000 69.47132  ? 311  LYS A CB    1 
ATOM   3300 C  CG    . LYS C 3  312 ? 61.54570 24.66665  -41.49429 1.000 69.20325  ? 311  LYS A CG    1 
ATOM   3301 C  CD    . LYS C 3  312 ? 62.18923 25.43455  -42.64077 1.000 75.31604  ? 311  LYS A CD    1 
ATOM   3302 C  CE    . LYS C 3  312 ? 61.69758 24.94881  -43.99608 1.000 81.30574  ? 311  LYS A CE    1 
ATOM   3303 N  NZ    . LYS C 3  312 ? 62.19772 25.81609  -45.10734 1.000 89.60369  ? 311  LYS A NZ    1 
ATOM   3304 N  N     . GLU C 3  313 ? 61.73412 25.49229  -36.68747 1.000 78.91995  ? 312  GLU A N     1 
ATOM   3305 C  CA    . GLU C 3  313 ? 62.47041 25.97889  -35.52900 1.000 80.77084  ? 312  GLU A CA    1 
ATOM   3306 C  C     . GLU C 3  313 ? 62.38497 25.01282  -34.34667 1.000 76.16431  ? 312  GLU A C     1 
ATOM   3307 O  O     . GLU C 3  313 ? 61.39220 24.29012  -34.18380 1.000 71.15842  ? 312  GLU A O     1 
ATOM   3308 C  CB    . GLU C 3  313 ? 61.93375 27.34618  -35.10226 1.000 85.48822  ? 312  GLU A CB    1 
ATOM   3309 C  CG    . GLU C 3  313 ? 62.13582 28.42369  -36.15351 1.000 95.02189  ? 312  GLU A CG    1 
ATOM   3310 C  CD    . GLU C 3  313 ? 63.60286 28.72700  -36.40599 1.000 104.43310 ? 312  GLU A CD    1 
ATOM   3311 O  OE1   . GLU C 3  313 ? 64.41227 28.57291  -35.46589 1.000 106.90625 ? 312  GLU A OE1   1 
ATOM   3312 O  OE2   . GLU C 3  313 ? 63.94793 29.11811  -37.54397 1.000 108.68912 ? 312  GLU A OE2   1 
ATOM   3313 N  N     . PRO C 3  314 ? 63.42841 24.99241  -33.51310 1.000 72.95754  ? 313  PRO A N     1 
ATOM   3314 C  CA    . PRO C 3  314 ? 63.42246 24.16075  -32.30271 1.000 69.35149  ? 313  PRO A CA    1 
ATOM   3315 C  C     . PRO C 3  314 ? 62.84282 24.90487  -31.11179 1.000 62.22972  ? 313  PRO A C     1 
ATOM   3316 O  O     . PRO C 3  314 ? 63.17153 26.06400  -30.85232 1.000 57.99750  ? 313  PRO A O     1 
ATOM   3317 C  CB    . PRO C 3  314 ? 64.91411 23.87336  -32.09066 1.000 71.20807  ? 313  PRO A CB    1 
ATOM   3318 C  CG    . PRO C 3  314 ? 65.58221 25.12549  -32.58947 1.000 69.84576  ? 313  PRO A CG    1 
ATOM   3319 C  CD    . PRO C 3  314 ? 64.73745 25.63123  -33.73848 1.000 70.86825  ? 313  PRO A CD    1 
ATOM   3320 N  N     . VAL C 3  315 ? 61.97427 24.22317  -30.36277 1.000 57.90987  ? 314  VAL A N     1 
ATOM   3321 C  CA    . VAL C 3  315 ? 61.18564 24.89022  -29.33399 1.000 51.93795  ? 314  VAL A CA    1 
ATOM   3322 C  C     . VAL C 3  315 ? 60.77781 23.88534  -28.26514 1.000 47.54797  ? 314  VAL A C     1 
ATOM   3323 O  O     . VAL C 3  315 ? 60.70969 22.68062  -28.50864 1.000 50.73480  ? 314  VAL A O     1 
ATOM   3324 C  CB    . VAL C 3  315 ? 59.95664 25.58938  -29.96642 1.000 54.24192  ? 314  VAL A CB    1 
ATOM   3325 C  CG1   . VAL C 3  315 ? 58.83336 24.59264  -30.22351 1.000 51.71555  ? 314  VAL A CG1   1 
ATOM   3326 C  CG2   . VAL C 3  315 ? 59.50568 26.72384  -29.09064 1.000 58.78577  ? 314  VAL A CG2   1 
ATOM   3327 N  N     . HIS C 3  316 ? 60.50742 24.38500  -27.06506 1.000 43.37393  ? 315  HIS A N     1 
ATOM   3328 C  CA    . HIS C 3  316 ? 60.15388 23.52558  -25.94759 1.000 43.65023  ? 315  HIS A CA    1 
ATOM   3329 C  C     . HIS C 3  316 ? 59.40581 24.35558  -24.92077 1.000 44.72564  ? 315  HIS A C     1 
ATOM   3330 O  O     . HIS C 3  316 ? 59.39860 25.58736  -24.97216 1.000 46.37292  ? 315  HIS A O     1 
ATOM   3331 C  CB    . HIS C 3  316 ? 61.38608 22.86955  -25.32064 1.000 43.90781  ? 315  HIS A CB    1 
ATOM   3332 C  CG    . HIS C 3  316 ? 62.37438 23.84431  -24.75697 1.000 47.26193  ? 315  HIS A CG    1 
ATOM   3333 N  ND1   . HIS C 3  316 ? 62.22220 24.42837  -23.51637 1.000 46.96961  ? 315  HIS A ND1   1 
ATOM   3334 C  CD2   . HIS C 3  316 ? 63.53535 24.33111  -25.26288 1.000 49.01406  ? 315  HIS A CD2   1 
ATOM   3335 C  CE1   . HIS C 3  316 ? 63.24764 25.23003  -23.28231 1.000 48.07580  ? 315  HIS A CE1   1 
ATOM   3336 N  NE2   . HIS C 3  316 ? 64.05733 25.18799  -24.32550 1.000 48.69523  ? 315  HIS A NE2   1 
ATOM   3337 N  N     . GLY C 3  317 ? 58.75811 23.65257  -23.99073 1.000 41.54535  ? 316  GLY A N     1 
ATOM   3338 C  CA    . GLY C 3  317 ? 58.09474 24.26934  -22.86951 1.000 38.38786  ? 316  GLY A CA    1 
ATOM   3339 C  C     . GLY C 3  317 ? 58.83801 23.96422  -21.58020 1.000 40.21824  ? 316  GLY A C     1 
ATOM   3340 O  O     . GLY C 3  317 ? 59.81292 23.22203  -21.54451 1.000 45.00950  ? 316  GLY A O     1 
ATOM   3341 N  N     . VAL C 3  318 ? 58.36799 24.58490  -20.51078 1.000 38.13557  ? 317  VAL A N     1 
ATOM   3342 C  CA    . VAL C 3  318 ? 58.87488 24.34945  -19.17673 1.000 35.40783  ? 317  VAL A CA    1 
ATOM   3343 C  C     . VAL C 3  318 ? 57.68738 23.97874  -18.30358 1.000 37.15660  ? 317  VAL A C     1 
ATOM   3344 O  O     . VAL C 3  318 ? 56.54793 23.96692  -18.76108 1.000 42.11719  ? 317  VAL A O     1 
ATOM   3345 C  CB    . VAL C 3  318 ? 59.63161 25.56699  -18.61434 1.000 39.84314  ? 317  VAL A CB    1 
ATOM   3346 C  CG1   . VAL C 3  318 ? 60.88522 25.81876  -19.44130 1.000 36.33937  ? 317  VAL A CG1   1 
ATOM   3347 C  CG2   . VAL C 3  318 ? 58.72415 26.79836  -18.58840 1.000 33.79459  ? 317  VAL A CG2   1 
ATOM   3348 N  N     . TYR C 3  319 ? 57.95918 23.63938  -17.05448 1.000 38.72638  ? 318  TYR A N     1 
ATOM   3349 C  CA    . TYR C 3  319 ? 56.90707 23.17967  -16.16112 1.000 38.66645  ? 318  TYR A CA    1 
ATOM   3350 C  C     . TYR C 3  319 ? 56.47179 24.30557  -15.22972 1.000 30.88731  ? 318  TYR A C     1 
ATOM   3351 O  O     . TYR C 3  319 ? 57.16160 25.30761  -15.05939 1.000 34.72790  ? 318  TYR A O     1 
ATOM   3352 C  CB    . TYR C 3  319 ? 57.36515 21.95440  -15.36151 1.000 31.72689  ? 318  TYR A CB    1 
ATOM   3353 C  CG    . TYR C 3  319 ? 57.75159 20.79493  -16.25838 1.000 36.58754  ? 318  TYR A CG    1 
ATOM   3354 C  CD1   . TYR C 3  319 ? 56.78948 20.10389  -16.99719 1.000 30.51320  ? 318  TYR A CD1   1 
ATOM   3355 C  CD2   . TYR C 3  319 ? 59.08086 20.39181  -16.37237 1.000 34.42597  ? 318  TYR A CD2   1 
ATOM   3356 C  CE1   . TYR C 3  319 ? 57.14634 19.04742  -17.83442 1.000 33.01724  ? 318  TYR A CE1   1 
ATOM   3357 C  CE2   . TYR C 3  319 ? 59.44808 19.34378  -17.20110 1.000 37.71483  ? 318  TYR A CE2   1 
ATOM   3358 C  CZ    . TYR C 3  319 ? 58.47931 18.67118  -17.93049 1.000 39.20134  ? 318  TYR A CZ    1 
ATOM   3359 O  OH    . TYR C 3  319 ? 58.85478 17.62664  -18.75393 1.000 42.88747  ? 318  TYR A OH    1 
ATOM   3360 N  N     . TYR C 3  320 ? 55.29867 24.11922  -14.63786 1.000 32.60505  ? 319  TYR A N     1 
ATOM   3361 C  CA    . TYR C 3  320 ? 54.71048 25.10578  -13.74629 1.000 32.99723  ? 319  TYR A CA    1 
ATOM   3362 C  C     . TYR C 3  320 ? 55.40186 25.14461  -12.38989 1.000 31.14002  ? 319  TYR A C     1 
ATOM   3363 O  O     . TYR C 3  320 ? 55.59625 24.11031  -11.74399 1.000 31.61648  ? 319  TYR A O     1 
ATOM   3364 C  CB    . TYR C 3  320 ? 53.23818 24.78355  -13.56147 1.000 34.96252  ? 319  TYR A CB    1 
ATOM   3365 C  CG    . TYR C 3  320 ? 52.47357 25.78017  -12.73142 1.000 36.03321  ? 319  TYR A CG    1 
ATOM   3366 C  CD1   . TYR C 3  320 ? 52.56871 27.14520  -12.97281 1.000 31.76659  ? 319  TYR A CD1   1 
ATOM   3367 C  CD2   . TYR C 3  320 ? 51.62418 25.34818  -11.72959 1.000 37.90404  ? 319  TYR A CD2   1 
ATOM   3368 C  CE1   . TYR C 3  320 ? 51.83484 28.04442  -12.22471 1.000 33.55201  ? 319  TYR A CE1   1 
ATOM   3369 C  CE2   . TYR C 3  320 ? 50.90056 26.23206  -10.98300 1.000 39.22215  ? 319  TYR A CE2   1 
ATOM   3370 C  CZ    . TYR C 3  320 ? 51.00260 27.57436  -11.23243 1.000 36.42382  ? 319  TYR A CZ    1 
ATOM   3371 O  OH    . TYR C 3  320 ? 50.26043 28.42715  -10.47252 1.000 38.80659  ? 319  TYR A OH    1 
ATOM   3372 N  N     . ASP C 3  321 ? 55.74947 26.35370  -11.95086 1.000 40.13543  ? 320  ASP A N     1 
ATOM   3373 C  CA    . ASP C 3  321 ? 56.20956 26.62141  -10.59052 1.000 39.62939  ? 320  ASP A CA    1 
ATOM   3374 C  C     . ASP C 3  321 ? 55.13431 27.42218  -9.86135  1.000 43.75199  ? 320  ASP A C     1 
ATOM   3375 O  O     . ASP C 3  321 ? 54.98656 28.62781  -10.10888 1.000 43.67508  ? 320  ASP A O     1 
ATOM   3376 C  CB    . ASP C 3  321 ? 57.53023 27.39106  -10.62124 1.000 38.41708  ? 320  ASP A CB    1 
ATOM   3377 C  CG    . ASP C 3  321 ? 58.05778 27.70594  -9.23873  1.000 40.29092  ? 320  ASP A CG    1 
ATOM   3378 O  OD1   . ASP C 3  321 ? 57.42200 27.29829  -8.24410  1.000 42.56299  ? 320  ASP A OD1   1 
ATOM   3379 O  OD2   . ASP C 3  321 ? 59.11732 28.36324  -9.14830  1.000 41.41246  ? 320  ASP A OD2   1 
ATOM   3380 N  N     . PRO C 3  322 ? 54.36852 26.81630  -8.94831  1.000 45.50481  ? 321  PRO A N     1 
ATOM   3381 C  CA    . PRO C 3  322 ? 53.18736 27.51002  -8.39942  1.000 45.10675  ? 321  PRO A CA    1 
ATOM   3382 C  C     . PRO C 3  322 ? 53.52095 28.65923  -7.46157  1.000 46.99230  ? 321  PRO A C     1 
ATOM   3383 O  O     . PRO C 3  322 ? 52.60854 29.40541  -7.08059  1.000 48.00834  ? 321  PRO A O     1 
ATOM   3384 C  CB    . PRO C 3  322 ? 52.44706 26.39883  -7.65393  1.000 42.56357  ? 321  PRO A CB    1 
ATOM   3385 C  CG    . PRO C 3  322 ? 53.55152 25.49720  -7.18542  1.000 41.42440  ? 321  PRO A CG    1 
ATOM   3386 C  CD    . PRO C 3  322 ? 54.63544 25.54577  -8.25455  1.000 43.42239  ? 321  PRO A CD    1 
ATOM   3387 N  N     . SER C 3  323 ? 54.78030 28.81799  -7.07168  1.000 47.74641  ? 322  SER A N     1 
ATOM   3388 C  CA    . SER C 3  323 ? 55.21091 29.91321  -6.21537  1.000 50.49160  ? 322  SER A CA    1 
ATOM   3389 C  C     . SER C 3  323 ? 55.51380 31.18516  -6.99554  1.000 49.32085  ? 322  SER A C     1 
ATOM   3390 O  O     . SER C 3  323 ? 56.00547 32.15566  -6.40998  1.000 45.14019  ? 322  SER A O     1 
ATOM   3391 C  CB    . SER C 3  323 ? 56.45426 29.49543  -5.42090  1.000 54.99813  ? 322  SER A CB    1 
ATOM   3392 O  OG    . SER C 3  323 ? 57.57125 29.32300  -6.28300  1.000 56.28123  ? 322  SER A OG    1 
ATOM   3393 N  N     . LYS C 3  324 ? 55.26560 31.19471  -8.30373  1.000 51.44741  ? 323  LYS A N     1 
ATOM   3394 C  CA    . LYS C 3  324 ? 55.57912 32.33546  -9.14787  1.000 50.18774  ? 323  LYS A CA    1 
ATOM   3395 C  C     . LYS C 3  324 ? 54.36297 32.70024  -9.97372  1.000 50.99471  ? 323  LYS A C     1 
ATOM   3396 O  O     . LYS C 3  324 ? 53.51658 31.85299  -10.27763 1.000 53.60266  ? 323  LYS A O     1 
ATOM   3397 C  CB    . LYS C 3  324 ? 56.78554 32.05603  -10.05838 1.000 48.15138  ? 323  LYS A CB    1 
ATOM   3398 C  CG    . LYS C 3  324 ? 58.02184 31.67769  -9.26089  1.000 51.01151  ? 323  LYS A CG    1 
ATOM   3399 C  CD    . LYS C 3  324 ? 59.31048 31.86118  -10.03014 1.000 56.65211  ? 323  LYS A CD    1 
ATOM   3400 C  CE    . LYS C 3  324 ? 60.48827 31.23150  -9.26956  1.000 65.06534  ? 323  LYS A CE    1 
ATOM   3401 N  NZ    . LYS C 3  324 ? 60.42306 31.37585  -7.76873  1.000 67.32747  ? 323  LYS A NZ    1 
ATOM   3402 N  N     . ASP C 3  325 ? 54.28229 33.97879  -10.32387 1.000 54.11365  ? 324  ASP A N     1 
ATOM   3403 C  CA    . ASP C 3  325 ? 53.16581 34.46903  -11.11560 1.000 53.00670  ? 324  ASP A CA    1 
ATOM   3404 C  C     . ASP C 3  325 ? 53.17355 33.84159  -12.50291 1.000 47.24899  ? 324  ASP A C     1 
ATOM   3405 O  O     . ASP C 3  325 ? 54.22445 33.48704  -13.04641 1.000 50.10535  ? 324  ASP A O     1 
ATOM   3406 C  CB    . ASP C 3  325 ? 53.22662 35.99476  -11.23901 1.000 61.37462  ? 324  ASP A CB    1 
ATOM   3407 C  CG    . ASP C 3  325 ? 52.81774 36.70700  -9.95812  1.000 65.38506  ? 324  ASP A CG    1 
ATOM   3408 O  OD1   . ASP C 3  325 ? 51.83086 36.27539  -9.32303  1.000 67.29185  ? 324  ASP A OD1   1 
ATOM   3409 O  OD2   . ASP C 3  325 ? 53.48543 37.69583  -9.58818  1.000 67.38694  ? 324  ASP A OD2   1 
ATOM   3410 N  N     . LEU C 3  326 ? 51.97880 33.69061  -13.06612 1.000 39.40450  ? 325  LEU A N     1 
ATOM   3411 C  CA    . LEU C 3  326 ? 51.82375 33.39201  -14.47589 1.000 37.45599  ? 325  LEU A CA    1 
ATOM   3412 C  C     . LEU C 3  326 ? 51.72937 34.70043  -15.24326 1.000 41.01638  ? 325  LEU A C     1 
ATOM   3413 O  O     . LEU C 3  326 ? 50.92228 35.56772  -14.89900 1.000 48.08122  ? 325  LEU A O     1 
ATOM   3414 C  CB    . LEU C 3  326 ? 50.56448 32.56583  -14.72126 1.000 40.13949  ? 325  LEU A CB    1 
ATOM   3415 C  CG    . LEU C 3  326 ? 50.55322 31.08492  -14.39660 1.000 43.52339  ? 325  LEU A CG    1 
ATOM   3416 C  CD1   . LEU C 3  326 ? 49.11006 30.61217  -14.43879 1.000 46.34977  ? 325  LEU A CD1   1 
ATOM   3417 C  CD2   . LEU C 3  326 ? 51.41723 30.30631  -15.37321 1.000 40.49390  ? 325  LEU A CD2   1 
ATOM   3418 N  N     . ILE C 3  327 ? 52.52479 34.83258  -16.29485 1.000 36.86215  ? 326  ILE A N     1 
ATOM   3419 C  CA    . ILE C 3  327 ? 52.48541 35.99838  -17.16748 1.000 37.33349  ? 326  ILE A CA    1 
ATOM   3420 C  C     . ILE C 3  327 ? 52.03395 35.55765  -18.55031 1.000 40.77677  ? 326  ILE A C     1 
ATOM   3421 O  O     . ILE C 3  327 ? 52.54492 34.57123  -19.09224 1.000 46.81895  ? 326  ILE A O     1 
ATOM   3422 C  CB    . ILE C 3  327 ? 53.85403 36.69357  -17.23995 1.000 40.86333  ? 326  ILE A CB    1 
ATOM   3423 C  CG1   . ILE C 3  327 ? 54.27496 37.16012  -15.84530 1.000 38.73960  ? 326  ILE A CG1   1 
ATOM   3424 C  CG2   . ILE C 3  327 ? 53.81193 37.86062  -18.22948 1.000 39.67051  ? 326  ILE A CG2   1 
ATOM   3425 C  CD1   . ILE C 3  327 ? 55.67869 37.59701  -15.78913 1.000 35.87273  ? 326  ILE A CD1   1 
ATOM   3426 N  N     . ALA C 3  328 ? 51.07814 36.28629  -19.11739 1.000 40.23833  ? 327  ALA A N     1 
ATOM   3427 C  CA    . ALA C 3  328 ? 50.60562 36.06083  -20.47924 1.000 38.65315  ? 327  ALA A CA    1 
ATOM   3428 C  C     . ALA C 3  328 ? 50.83984 37.32756  -21.29158 1.000 44.10950  ? 327  ALA A C     1 
ATOM   3429 O  O     . ALA C 3  328 ? 50.29222 38.38402  -20.96643 1.000 45.46919  ? 327  ALA A O     1 
ATOM   3430 C  CB    . ALA C 3  328 ? 49.12445 35.67780  -20.49033 1.000 30.91108  ? 327  ALA A CB    1 
ATOM   3431 N  N     . GLU C 3  329 ? 51.65100 37.22337  -22.33858 1.000 44.88055  ? 328  GLU A N     1 
ATOM   3432 C  CA    . GLU C 3  329 ? 51.92689 38.33208  -23.24347 1.000 44.51433  ? 328  GLU A CA    1 
ATOM   3433 C  C     . GLU C 3  329 ? 51.24313 38.08123  -24.57894 1.000 43.34790  ? 328  GLU A C     1 
ATOM   3434 O  O     . GLU C 3  329 ? 51.46382 37.03621  -25.20567 1.000 46.31844  ? 328  GLU A O     1 
ATOM   3435 C  CB    . GLU C 3  329 ? 53.43082 38.51748  -23.44962 1.000 50.98188  ? 328  GLU A CB    1 
ATOM   3436 C  CG    . GLU C 3  329 ? 53.78234 39.68199  -24.35179 1.000 63.22551  ? 328  GLU A CG    1 
ATOM   3437 C  CD    . GLU C 3  329 ? 55.20715 40.17558  -24.13690 1.000 76.84245  ? 328  GLU A CD    1 
ATOM   3438 O  OE1   . GLU C 3  329 ? 55.81579 39.78282  -23.11091 1.000 78.93151  ? 328  GLU A OE1   1 
ATOM   3439 O  OE2   . GLU C 3  329 ? 55.71130 40.95462  -24.98920 1.000 81.31840  ? 328  GLU A OE2   1 
ATOM   3440 N  N     . ILE C 3  330 ? 50.42744 39.04625  -25.01686 1.000 42.24460  ? 329  ILE A N     1 
ATOM   3441 C  CA    . ILE C 3  330 ? 49.69487 38.94125  -26.28089 1.000 40.58040  ? 329  ILE A CA    1 
ATOM   3442 C  C     . ILE C 3  330 ? 50.36280 39.79698  -27.35108 1.000 44.02591  ? 329  ILE A C     1 
ATOM   3443 O  O     . ILE C 3  330 ? 50.87274 40.89223  -27.07013 1.000 49.02036  ? 329  ILE A O     1 
ATOM   3444 C  CB    . ILE C 3  330 ? 48.21979 39.34330  -26.10768 1.000 34.50229  ? 329  ILE A CB    1 
ATOM   3445 C  CG1   . ILE C 3  330 ? 47.57861 38.56568  -24.95464 1.000 31.88887  ? 329  ILE A CG1   1 
ATOM   3446 C  CG2   . ILE C 3  330 ? 47.44361 39.08083  -27.38300 1.000 30.21604  ? 329  ILE A CG2   1 
ATOM   3447 C  CD1   . ILE C 3  330 ? 46.05600 38.72665  -24.91033 1.000 29.55325  ? 329  ILE A CD1   1 
ATOM   3448 N  N     . GLN C 3  331 ? 50.35703 39.29700  -28.58528 1.000 42.44711  ? 330  GLN A N     1 
ATOM   3449 C  CA    . GLN C 3  331 ? 50.83261 40.02378  -29.75310 1.000 44.77230  ? 330  GLN A CA    1 
ATOM   3450 C  C     . GLN C 3  331 ? 49.77220 39.98212  -30.84600 1.000 43.81872  ? 330  GLN A C     1 
ATOM   3451 O  O     . GLN C 3  331 ? 49.04319 38.99448  -30.99901 1.000 44.96731  ? 330  GLN A O     1 
ATOM   3452 C  CB    . GLN C 3  331 ? 52.15813 39.44636  -30.29738 1.000 51.90331  ? 330  GLN A CB    1 
ATOM   3453 C  CG    . GLN C 3  331 ? 53.41575 40.18557  -29.83993 1.000 61.14185  ? 330  GLN A CG    1 
ATOM   3454 C  CD    . GLN C 3  331 ? 53.71087 39.99797  -28.35829 1.000 68.57237  ? 330  GLN A CD    1 
ATOM   3455 O  OE1   . GLN C 3  331 ? 53.90984 38.86723  -27.89121 1.000 70.60415  ? 330  GLN A OE1   1 
ATOM   3456 N  NE2   . GLN C 3  331 ? 53.73709 41.10782  -27.60708 1.000 67.51723  ? 330  GLN A NE2   1 
ATOM   3457 N  N     . LYS C 3  332 ? 49.70682 41.06352  -31.61585 1.000 46.62632  ? 331  LYS A N     1 
ATOM   3458 C  CA    . LYS C 3  332 ? 48.72978 41.21992  -32.68437 1.000 46.16501  ? 331  LYS A CA    1 
ATOM   3459 C  C     . LYS C 3  332 ? 49.37583 40.92926  -34.02791 1.000 47.96076  ? 331  LYS A C     1 
ATOM   3460 O  O     . LYS C 3  332 ? 50.50672 41.35867  -34.27770 1.000 49.40559  ? 331  LYS A O     1 
ATOM   3461 C  CB    . LYS C 3  332 ? 48.15351 42.63731  -32.68077 1.000 42.43731  ? 331  LYS A CB    1 
ATOM   3462 C  CG    . LYS C 3  332 ? 47.51250 43.07012  -33.99529 1.000 43.96502  ? 331  LYS A CG    1 
ATOM   3463 C  CD    . LYS C 3  332 ? 46.84471 44.43501  -33.84949 1.000 48.64460  ? 331  LYS A CD    1 
ATOM   3464 C  CE    . LYS C 3  332 ? 46.76110 45.19373  -35.17501 1.000 57.28134  ? 331  LYS A CE    1 
ATOM   3465 N  NZ    . LYS C 3  332 ? 45.47594 44.99027  -35.90515 1.000 57.43234  ? 331  LYS A NZ    1 
ATOM   3466 N  N     . GLN C 3  333 ? 48.67602 40.17005  -34.87003 1.000 53.99738  ? 332  GLN A N     1 
ATOM   3467 C  CA    . GLN C 3  333 ? 48.82794 40.20955  -36.31892 1.000 63.71010  ? 332  GLN A CA    1 
ATOM   3468 C  C     . GLN C 3  333 ? 47.48085 40.59282  -36.92462 1.000 65.79475  ? 332  GLN A C     1 
ATOM   3469 O  O     . GLN C 3  333 ? 46.46503 40.70981  -36.22752 1.000 71.71563  ? 332  GLN A O     1 
ATOM   3470 C  CB    . GLN C 3  333 ? 49.31876 38.87518  -36.88247 1.000 71.44921  ? 332  GLN A CB    1 
ATOM   3471 C  CG    . GLN C 3  333 ? 50.67664 38.45443  -36.35317 1.000 79.00073  ? 332  GLN A CG    1 
ATOM   3472 C  CD    . GLN C 3  333 ? 50.58544 37.34936  -35.32153 1.000 77.33865  ? 332  GLN A CD    1 
ATOM   3473 O  OE1   . GLN C 3  333 ? 49.48991 36.94393  -34.92452 1.000 76.03064  ? 332  GLN A OE1   1 
ATOM   3474 N  NE2   . GLN C 3  333 ? 51.73991 36.84641  -34.89010 1.000 74.65244  ? 332  GLN A NE2   1 
ATOM   3475 N  N     . GLY C 3  334 ? 47.46761 40.79653  -38.23186 1.000 63.86803  ? 333  GLY A N     1 
ATOM   3476 C  CA    . GLY C 3  334 ? 46.30640 41.38727  -38.85316 1.000 64.85930  ? 333  GLY A CA    1 
ATOM   3477 C  C     . GLY C 3  334 ? 45.10859 40.45484  -38.86884 1.000 65.82000  ? 333  GLY A C     1 
ATOM   3478 O  O     . GLY C 3  334 ? 45.06753 39.40601  -38.22508 1.000 66.30601  ? 333  GLY A O     1 
ATOM   3479 N  N     . GLN C 3  335 ? 44.10742 40.86865  -39.65333 1.000 65.16188  ? 334  GLN A N     1 
ATOM   3480 C  CA    . GLN C 3  335 ? 42.89263 40.09270  -39.94784 1.000 69.63550  ? 334  GLN A CA    1 
ATOM   3481 C  C     . GLN C 3  335 ? 42.27966 39.44796  -38.70481 1.000 63.47846  ? 334  GLN A C     1 
ATOM   3482 O  O     . GLN C 3  335 ? 41.68794 38.36665  -38.78234 1.000 65.61434  ? 334  GLN A O     1 
ATOM   3483 C  CB    . GLN C 3  335 ? 43.12753 39.01983  -41.02966 1.000 82.84125  ? 334  GLN A CB    1 
ATOM   3484 C  CG    . GLN C 3  335 ? 44.56922 38.71671  -41.43982 1.000 90.80834  ? 334  GLN A CG    1 
ATOM   3485 C  CD    . GLN C 3  335 ? 45.17986 39.82491  -42.25494 1.000 98.82797  ? 334  GLN A CD    1 
ATOM   3486 O  OE1   . GLN C 3  335 ? 44.53554 40.37793  -43.14738 1.000 105.08351 ? 334  GLN A OE1   1 
ATOM   3487 N  NE2   . GLN C 3  335 ? 46.42428 40.17284  -41.94472 1.000 99.54833  ? 334  GLN A NE2   1 
ATOM   3488 N  N     . GLY C 3  336 ? 42.39397 40.09817  -37.55337 1.000 55.89590  ? 335  GLY A N     1 
ATOM   3489 C  CA    . GLY C 3  336 ? 41.80998 39.51523  -36.35756 1.000 50.05547  ? 335  GLY A CA    1 
ATOM   3490 C  C     . GLY C 3  336 ? 42.54278 38.28003  -35.88059 1.000 49.71096  ? 335  GLY A C     1 
ATOM   3491 O  O     . GLY C 3  336 ? 41.90237 37.29016  -35.47390 1.000 40.19871  ? 335  GLY A O     1 
ATOM   3492 N  N     . GLN C 3  337 ? 43.87647 38.31693  -35.91514 1.000 49.36367  ? 336  GLN A N     1 
ATOM   3493 C  CA    . GLN C 3  337 ? 44.71627 37.21236  -35.48481 1.000 43.56972  ? 336  GLN A CA    1 
ATOM   3494 C  C     . GLN C 3  337 ? 45.64129 37.66259  -34.36753 1.000 41.79598  ? 336  GLN A C     1 
ATOM   3495 O  O     . GLN C 3  337 ? 46.21200 38.75358  -34.42568 1.000 44.76806  ? 336  GLN A O     1 
ATOM   3496 C  CB    . GLN C 3  337 ? 45.53364 36.67431  -36.63918 1.000 44.00455  ? 336  GLN A CB    1 
ATOM   3497 C  CG    . GLN C 3  337 ? 44.71185 35.90689  -37.63390 1.000 47.29837  ? 336  GLN A CG    1 
ATOM   3498 C  CD    . GLN C 3  337 ? 45.56330 35.36423  -38.74354 1.000 53.06849  ? 336  GLN A CD    1 
ATOM   3499 O  OE1   . GLN C 3  337 ? 45.89117 34.17693  -38.76869 1.000 54.74639  ? 336  GLN A OE1   1 
ATOM   3500 N  NE2   . GLN C 3  337 ? 45.92845 36.22939  -39.67900 1.000 55.46323  ? 336  GLN A NE2   1 
ATOM   3501 N  N     . TRP C 3  338 ? 45.79866 36.80641  -33.35845 1.000 37.27626  ? 337  TRP A N     1 
ATOM   3502 C  CA    . TRP C 3  338 ? 46.58848 37.11487  -32.18166 1.000 41.89243  ? 337  TRP A CA    1 
ATOM   3503 C  C     . TRP C 3  338 ? 47.35763 35.87418  -31.75964 1.000 48.24506  ? 337  TRP A C     1 
ATOM   3504 O  O     . TRP C 3  338 ? 46.86482 34.75110  -31.88235 1.000 51.31036  ? 337  TRP A O     1 
ATOM   3505 C  CB    . TRP C 3  338 ? 45.68417 37.59287  -31.03439 1.000 41.60664  ? 337  TRP A CB    1 
ATOM   3506 C  CG    . TRP C 3  338 ? 44.69649 38.64653  -31.47826 1.000 40.47903  ? 337  TRP A CG    1 
ATOM   3507 C  CD1   . TRP C 3  338 ? 43.55251 38.44552  -32.20009 1.000 42.38636  ? 337  TRP A CD1   1 
ATOM   3508 C  CD2   . TRP C 3  338 ? 44.77820 40.05614  -31.24249 1.000 34.16661  ? 337  TRP A CD2   1 
ATOM   3509 N  NE1   . TRP C 3  338 ? 42.92274 39.64645  -32.43688 1.000 42.16135  ? 337  TRP A NE1   1 
ATOM   3510 C  CE2   . TRP C 3  338 ? 43.64741 40.64874  -31.84809 1.000 36.18168  ? 337  TRP A CE2   1 
ATOM   3511 C  CE3   . TRP C 3  338 ? 45.68923 40.87544  -30.57127 1.000 35.24663  ? 337  TRP A CE3   1 
ATOM   3512 C  CZ2   . TRP C 3  338 ? 43.41164 42.02225  -31.81015 1.000 32.05006  ? 337  TRP A CZ2   1 
ATOM   3513 C  CZ3   . TRP C 3  338 ? 45.45159 42.24420  -30.53154 1.000 34.61203  ? 337  TRP A CZ3   1 
ATOM   3514 C  CH2   . TRP C 3  338 ? 44.32182 42.80064  -31.14575 1.000 34.15975  ? 337  TRP A CH2   1 
ATOM   3515 N  N     . THR C 3  339 ? 48.56222 36.07607  -31.24569 1.000 45.56162  ? 338  THR A N     1 
ATOM   3516 C  CA    . THR C 3  339 ? 49.25331 34.98710  -30.57592 1.000 40.95409  ? 338  THR A CA    1 
ATOM   3517 C  C     . THR C 3  339 ? 49.57273 35.41012  -29.15289 1.000 40.06586  ? 338  THR A C     1 
ATOM   3518 O  O     . THR C 3  339 ? 49.47424 36.58799  -28.79665 1.000 35.62321  ? 338  THR A O     1 
ATOM   3519 C  CB    . THR C 3  339 ? 50.53089 34.57381  -31.31253 1.000 40.38456  ? 338  THR A CB    1 
ATOM   3520 O  OG1   . THR C 3  339 ? 51.10499 35.72500  -31.93148 1.000 43.88786  ? 338  THR A OG1   1 
ATOM   3521 C  CG2   . THR C 3  339 ? 50.21981 33.50889  -32.36941 1.000 43.23472  ? 338  THR A CG2   1 
ATOM   3522 N  N     . TYR C 3  340 ? 49.94724 34.42828  -28.33150 1.000 38.52296  ? 339  TYR A N     1 
ATOM   3523 C  CA    . TYR C 3  340 ? 50.30995 34.73429  -26.95559 1.000 40.52234  ? 339  TYR A CA    1 
ATOM   3524 C  C     . TYR C 3  340 ? 51.30571 33.71067  -26.42559 1.000 43.75854  ? 339  TYR A C     1 
ATOM   3525 O  O     . TYR C 3  340 ? 51.37122 32.56550  -26.88896 1.000 47.92413  ? 339  TYR A O     1 
ATOM   3526 C  CB    . TYR C 3  340 ? 49.07596 34.79559  -26.04073 1.000 38.66019  ? 339  TYR A CB    1 
ATOM   3527 C  CG    . TYR C 3  340 ? 48.25466 33.50799  -25.97564 1.000 37.28948  ? 339  TYR A CG    1 
ATOM   3528 C  CD1   . TYR C 3  340 ? 48.53233 32.52315  -25.02890 1.000 32.77986  ? 339  TYR A CD1   1 
ATOM   3529 C  CD2   . TYR C 3  340 ? 47.20115 33.29079  -26.85215 1.000 34.26684  ? 339  TYR A CD2   1 
ATOM   3530 C  CE1   . TYR C 3  340 ? 47.78754 31.36411  -24.96171 1.000 25.96149  ? 339  TYR A CE1   1 
ATOM   3531 C  CE2   . TYR C 3  340 ? 46.44828 32.15178  -26.78187 1.000 35.47702  ? 339  TYR A CE2   1 
ATOM   3532 C  CZ    . TYR C 3  340 ? 46.75073 31.18261  -25.83732 1.000 32.88398  ? 339  TYR A CZ    1 
ATOM   3533 O  OH    . TYR C 3  340 ? 45.99785 30.03205  -25.78595 1.000 37.61144  ? 339  TYR A OH    1 
ATOM   3534 N  N     . GLN C 3  341 ? 52.06674 34.14618  -25.42445 1.000 40.24403  ? 340  GLN A N     1 
ATOM   3535 C  CA    . GLN C 3  341 ? 52.95638 33.27231  -24.67736 1.000 42.51766  ? 340  GLN A CA    1 
ATOM   3536 C  C     . GLN C 3  341 ? 52.63220 33.35867  -23.19681 1.000 44.60043  ? 340  GLN A C     1 
ATOM   3537 O  O     . GLN C 3  341 ? 52.39349 34.44715  -22.66835 1.000 45.87131  ? 340  GLN A O     1 
ATOM   3538 C  CB    . GLN C 3  341 ? 54.41238 33.63315  -24.90391 1.000 43.66047  ? 340  GLN A CB    1 
ATOM   3539 C  CG    . GLN C 3  341 ? 54.88111 33.30026  -26.28383 1.000 49.73762  ? 340  GLN A CG    1 
ATOM   3540 C  CD    . GLN C 3  341 ? 55.32647 34.51895  -27.04158 1.000 62.93807  ? 340  GLN A CD    1 
ATOM   3541 O  OE1   . GLN C 3  341 ? 54.69267 35.58538  -26.97701 1.000 63.05767  ? 340  GLN A OE1   1 
ATOM   3542 N  NE2   . GLN C 3  341 ? 56.44091 34.38238  -27.76043 1.000 70.73983  ? 340  GLN A NE2   1 
ATOM   3543 N  N     . ILE C 3  342 ? 52.60605 32.20649  -22.53392 1.000 41.67230  ? 341  ILE A N     1 
ATOM   3544 C  CA    . ILE C 3  342 ? 52.42586 32.12742  -21.09073 1.000 40.85642  ? 341  ILE A CA    1 
ATOM   3545 C  C     . ILE C 3  342 ? 53.71778 31.58402  -20.49661 1.000 42.82573  ? 341  ILE A C     1 
ATOM   3546 O  O     . ILE C 3  342 ? 54.15932 30.47873  -20.85193 1.000 47.44869  ? 341  ILE A O     1 
ATOM   3547 C  CB    . ILE C 3  342 ? 51.22331 31.24881  -20.71969 1.000 36.95383  ? 341  ILE A CB    1 
ATOM   3548 C  CG1   . ILE C 3  342 ? 50.00022 31.65402  -21.55963 1.000 29.47141  ? 341  ILE A CG1   1 
ATOM   3549 C  CG2   . ILE C 3  342 ? 50.96587 31.31664  -19.20701 1.000 33.81890  ? 341  ILE A CG2   1 
ATOM   3550 C  CD1   . ILE C 3  342 ? 48.69004 31.12059  -21.01946 1.000 26.12479  ? 341  ILE A CD1   1 
ATOM   3551 N  N     . TYR C 3  343 ? 54.31287 32.36580  -19.59773 1.000 42.24646  ? 342  TYR A N     1 
ATOM   3552 C  CA    . TYR C 3  343 ? 55.63050 32.09611  -19.04048 1.000 42.86551  ? 342  TYR A CA    1 
ATOM   3553 C  C     . TYR C 3  343 ? 55.68161 32.62611  -17.61315 1.000 44.44903  ? 342  TYR A C     1 
ATOM   3554 O  O     . TYR C 3  343 ? 54.76705 33.30899  -17.14962 1.000 44.94476  ? 342  TYR A O     1 
ATOM   3555 C  CB    . TYR C 3  343 ? 56.73727 32.72790  -19.89192 1.000 42.79924  ? 342  TYR A CB    1 
ATOM   3556 C  CG    . TYR C 3  343 ? 56.67061 34.24144  -19.99086 1.000 45.62003  ? 342  TYR A CG    1 
ATOM   3557 C  CD1   . TYR C 3  343 ? 57.32096 35.04835  -19.06509 1.000 45.93605  ? 342  TYR A CD1   1 
ATOM   3558 C  CD2   . TYR C 3  343 ? 55.96864 34.86289  -21.01937 1.000 46.33842  ? 342  TYR A CD2   1 
ATOM   3559 C  CE1   . TYR C 3  343 ? 57.26569 36.42173  -19.15507 1.000 47.42850  ? 342  TYR A CE1   1 
ATOM   3560 C  CE2   . TYR C 3  343 ? 55.91047 36.24354  -21.11843 1.000 43.09286  ? 342  TYR A CE2   1 
ATOM   3561 C  CZ    . TYR C 3  343 ? 56.56120 37.01426  -20.18408 1.000 46.24092  ? 342  TYR A CZ    1 
ATOM   3562 O  OH    . TYR C 3  343 ? 56.50896 38.38163  -20.27002 1.000 47.84779  ? 342  TYR A OH    1 
ATOM   3563 N  N     . GLN C 3  344 ? 56.76055 32.28840  -16.90677 1.000 44.59836  ? 343  GLN A N     1 
ATOM   3564 C  CA    . GLN C 3  344 ? 56.96356 32.73027  -15.53115 1.000 44.51750  ? 343  GLN A CA    1 
ATOM   3565 C  C     . GLN C 3  344 ? 58.25360 33.51048  -15.37180 1.000 55.94770  ? 343  GLN A C     1 
ATOM   3566 O  O     . GLN C 3  344 ? 58.25329 34.57834  -14.74617 1.000 56.33877  ? 343  GLN A O     1 
ATOM   3567 C  CB    . GLN C 3  344 ? 56.94818 31.52686  -14.57057 1.000 39.52416  ? 343  GLN A CB    1 
ATOM   3568 C  CG    . GLN C 3  344 ? 55.60858 30.80098  -14.55876 1.000 34.88890  ? 343  GLN A CG    1 
ATOM   3569 C  CD    . GLN C 3  344 ? 55.50469 29.75365  -13.48254 1.000 40.40428  ? 343  GLN A CD    1 
ATOM   3570 O  OE1   . GLN C 3  344 ? 56.15044 28.68437  -13.54852 1.000 43.34193  ? 343  GLN A OE1   1 
ATOM   3571 N  NE2   . GLN C 3  344 ? 54.67622 30.04012  -12.47464 1.000 39.66711  ? 343  GLN A NE2   1 
ATOM   3572 N  N     . GLU C 3  345 ? 59.39456 32.97449  -15.93477 1.000 61.77375  ? 344  GLU A N     1 
ATOM   3573 C  CA    . GLU C 3  345 ? 60.73045 33.46344  -16.22899 1.000 64.35727  ? 344  GLU A CA    1 
ATOM   3574 C  C     . GLU C 3  345 ? 60.76500 34.01307  -17.65280 1.000 65.09005  ? 344  GLU A C     1 
ATOM   3575 O  O     . GLU C 3  345 ? 60.05117 33.51643  -18.52904 1.000 61.24740  ? 344  GLU A O     1 
ATOM   3576 C  CB    . GLU C 3  345 ? 61.75948 32.34388  -16.07141 1.000 66.34663  ? 344  GLU A CB    1 
ATOM   3577 N  N     . PRO C 3  346 ? 61.60318 35.02551  -17.90221 1.000 72.42861  ? 345  PRO A N     1 
ATOM   3578 C  CA    . PRO C 3  346 ? 61.38746 35.89221  -19.08026 1.000 75.03430  ? 345  PRO A CA    1 
ATOM   3579 C  C     . PRO C 3  346 ? 61.28608 35.17989  -20.42183 1.000 73.07318  ? 345  PRO A C     1 
ATOM   3580 O  O     . PRO C 3  346 ? 60.31862 35.40926  -21.16283 1.000 77.35292  ? 345  PRO A O     1 
ATOM   3581 C  CB    . PRO C 3  346 ? 62.59502 36.83390  -19.02402 1.000 80.49411  ? 345  PRO A CB    1 
ATOM   3582 C  CG    . PRO C 3  346 ? 62.93124 36.90747  -17.56564 1.000 82.37159  ? 345  PRO A CG    1 
ATOM   3583 C  CD    . PRO C 3  346 ? 62.68729 35.52491  -17.03891 1.000 79.05997  ? 345  PRO A CD    1 
ATOM   3584 N  N     . PHE C 3  347 ? 62.24831 34.33492  -20.77140 1.000 67.13257  ? 346  PHE A N     1 
ATOM   3585 C  CA    . PHE C 3  347 ? 62.26097 33.71972  -22.09275 1.000 63.64767  ? 346  PHE A CA    1 
ATOM   3586 C  C     . PHE C 3  347 ? 62.05004 32.21191  -22.02415 1.000 62.71946  ? 346  PHE A C     1 
ATOM   3587 O  O     . PHE C 3  347 ? 62.62765 31.45108  -22.80266 1.000 64.83973  ? 346  PHE A O     1 
ATOM   3588 C  CB    . PHE C 3  347 ? 63.55095 34.06316  -22.83044 1.000 66.10281  ? 346  PHE A CB    1 
ATOM   3589 C  CG    . PHE C 3  347 ? 63.49283 35.38748  -23.53786 1.000 73.07756  ? 346  PHE A CG    1 
ATOM   3590 C  CD1   . PHE C 3  347 ? 62.79555 35.51997  -24.73415 1.000 73.41112  ? 346  PHE A CD1   1 
ATOM   3591 C  CD2   . PHE C 3  347 ? 64.10654 36.51153  -23.00167 1.000 75.71209  ? 346  PHE A CD2   1 
ATOM   3592 C  CE1   . PHE C 3  347 ? 62.72824 36.74661  -25.39041 1.000 72.15723  ? 346  PHE A CE1   1 
ATOM   3593 C  CE2   . PHE C 3  347 ? 64.04089 37.73718  -23.65572 1.000 72.74858  ? 346  PHE A CE2   1 
ATOM   3594 C  CZ    . PHE C 3  347 ? 63.35330 37.85224  -24.84989 1.000 69.78984  ? 346  PHE A CZ    1 
ATOM   3595 N  N     . LYS C 3  348 ? 61.18968 31.76471  -21.09968 1.000 55.24396  ? 347  LYS A N     1 
ATOM   3596 C  CA    . LYS C 3  348 ? 60.94653 30.34355  -20.86443 1.000 43.32065  ? 347  LYS A CA    1 
ATOM   3597 C  C     . LYS C 3  348 ? 59.43520 30.09268  -20.87726 1.000 38.91109  ? 347  LYS A C     1 
ATOM   3598 O  O     . LYS C 3  348 ? 58.78251 30.02383  -19.83496 1.000 37.05845  ? 347  LYS A O     1 
ATOM   3599 C  CB    . LYS C 3  348 ? 61.58143 29.92119  -19.55749 1.000 44.28255  ? 347  LYS A CB    1 
ATOM   3600 C  CG    . LYS C 3  348 ? 63.05221 30.31508  -19.38489 1.000 47.02711  ? 347  LYS A CG    1 
ATOM   3601 C  CD    . LYS C 3  348 ? 63.56433 29.77078  -18.05351 1.000 53.10159  ? 347  LYS A CD    1 
ATOM   3602 C  CE    . LYS C 3  348 ? 65.05686 29.95437  -17.84176 1.000 60.10327  ? 347  LYS A CE    1 
ATOM   3603 N  NZ    . LYS C 3  348 ? 65.54222 28.86616  -16.92368 1.000 68.20606  ? 347  LYS A NZ    1 
ATOM   3604 N  N     . ASN C 3  349 ? 58.88640 29.91342  -22.07166 1.000 34.19241  ? 348  ASN A N     1 
ATOM   3605 C  CA    . ASN C 3  349 ? 57.45805 29.69187  -22.21840 1.000 32.24443  ? 348  ASN A CA    1 
ATOM   3606 C  C     . ASN C 3  349 ? 57.00586 28.45224  -21.47151 1.000 45.75657  ? 348  ASN A C     1 
ATOM   3607 O  O     . ASN C 3  349 ? 57.59598 27.37504  -21.61090 1.000 50.11076  ? 348  ASN A O     1 
ATOM   3608 C  CB    . ASN C 3  349 ? 57.10496 29.53504  -23.69149 1.000 34.72509  ? 348  ASN A CB    1 
ATOM   3609 C  CG    . ASN C 3  349 ? 57.20487 30.82735  -24.45596 1.000 40.63631  ? 348  ASN A CG    1 
ATOM   3610 O  OD1   . ASN C 3  349 ? 57.19708 31.91230  -23.87524 1.000 40.57065  ? 348  ASN A OD1   1 
ATOM   3611 N  ND2   . ASN C 3  349 ? 57.29193 30.72134  -25.77065 1.000 43.96289  ? 348  ASN A ND2   1 
ATOM   3612 N  N     . LEU C 3  350 ? 55.94036 28.59657  -20.68895 1.000 38.48434  ? 349  LEU A N     1 
ATOM   3613 C  CA    . LEU C 3  350 ? 55.18432 27.41154  -20.30967 1.000 41.92498  ? 349  LEU A CA    1 
ATOM   3614 C  C     . LEU C 3  350 ? 54.44431 26.87509  -21.51424 1.000 44.67099  ? 349  LEU A C     1 
ATOM   3615 O  O     . LEU C 3  350 ? 54.54099 25.68290  -21.84387 1.000 40.56050  ? 349  LEU A O     1 
ATOM   3616 C  CB    . LEU C 3  350 ? 54.21101 27.71920  -19.17649 1.000 43.54262  ? 349  LEU A CB    1 
ATOM   3617 C  CG    . LEU C 3  350 ? 54.93363 27.56143  -17.84324 1.000 52.63761  ? 349  LEU A CG    1 
ATOM   3618 C  CD1   . LEU C 3  350 ? 55.42709 28.92234  -17.38882 1.000 58.75325  ? 349  LEU A CD1   1 
ATOM   3619 C  CD2   . LEU C 3  350 ? 54.05761 26.92070  -16.80599 1.000 54.61150  ? 349  LEU A CD2   1 
ATOM   3620 N  N     . LYS C 3  351 ? 53.73191 27.75592  -22.21096 1.000 42.96558  ? 350  LYS A N     1 
ATOM   3621 C  CA    . LYS C 3  351 ? 53.12908 27.35446  -23.47460 1.000 39.09788  ? 350  LYS A CA    1 
ATOM   3622 C  C     . LYS C 3  351 ? 52.87667 28.59250  -24.30850 1.000 41.20819  ? 350  LYS A C     1 
ATOM   3623 O  O     . LYS C 3  351 ? 53.15518 29.71804  -23.89139 1.000 48.50773  ? 350  LYS A O     1 
ATOM   3624 C  CB    . LYS C 3  351 ? 51.83399 26.55504  -23.27262 1.000 31.34129  ? 350  LYS A CB    1 
ATOM   3625 C  CG    . LYS C 3  351 ? 50.70512 27.31640  -22.63323 1.000 27.43503  ? 350  LYS A CG    1 
ATOM   3626 C  CD    . LYS C 3  351 ? 49.56661 26.38697  -22.25137 1.000 27.75540  ? 350  LYS A CD    1 
ATOM   3627 C  CE    . LYS C 3  351 ? 49.04407 25.60852  -23.46029 1.000 26.11139  ? 350  LYS A CE    1 
ATOM   3628 N  NZ    . LYS C 3  351 ? 48.52194 26.53226  -24.51897 1.000 28.81416  ? 350  LYS A NZ    1 
ATOM   3629 N  N     . THR C 3  352 ? 52.34313 28.36940  -25.50217 1.000 38.76659  ? 351  THR A N     1 
ATOM   3630 C  CA    . THR C 3  352 ? 51.92805 29.43928  -26.38119 1.000 37.84048  ? 351  THR A CA    1 
ATOM   3631 C  C     . THR C 3  352 ? 50.52266 29.13458  -26.87239 1.000 34.40073  ? 351  THR A C     1 
ATOM   3632 O  O     . THR C 3  352 ? 49.95744 28.07804  -26.58443 1.000 31.23642  ? 351  THR A O     1 
ATOM   3633 C  CB    . THR C 3  352 ? 52.89100 29.61201  -27.55978 1.000 36.53175  ? 351  THR A CB    1 
ATOM   3634 O  OG1   . THR C 3  352 ? 52.83663 28.44646  -28.38063 1.000 38.03367  ? 351  THR A OG1   1 
ATOM   3635 C  CG2   . THR C 3  352 ? 54.31476 29.82209  -27.06708 1.000 33.06321  ? 351  THR A CG2   1 
ATOM   3636 N  N     . GLY C 3  353 ? 49.94702 30.09511  -27.58897 1.000 33.00636  ? 352  GLY A N     1 
ATOM   3637 C  CA    . GLY C 3  353 ? 48.63781 29.89359  -28.17513 1.000 29.48662  ? 352  GLY A CA    1 
ATOM   3638 C  C     . GLY C 3  353 ? 48.36668 30.92790  -29.24423 1.000 33.88982  ? 352  GLY A C     1 
ATOM   3639 O  O     . GLY C 3  353 ? 49.15854 31.84907  -29.46417 1.000 35.44896  ? 352  GLY A O     1 
ATOM   3640 N  N     . LYS C 3  354 ? 47.21349 30.76565  -29.89928 1.000 35.17073  ? 353  LYS A N     1 
ATOM   3641 C  CA    . LYS C 3  354 ? 46.70895 31.72403  -30.87393 1.000 43.16747  ? 353  LYS A CA    1 
ATOM   3642 C  C     . LYS C 3  354 ? 45.21954 31.93495  -30.63255 1.000 44.82958  ? 353  LYS A C     1 
ATOM   3643 O  O     . LYS C 3  354 ? 44.50720 31.03187  -30.19472 1.000 42.86097  ? 353  LYS A O     1 
ATOM   3644 C  CB    . LYS C 3  354 ? 46.95079 31.26896  -32.33237 1.000 44.93336  ? 353  LYS A CB    1 
ATOM   3645 C  CG    . LYS C 3  354 ? 46.20667 29.98910  -32.75072 1.000 44.36187  ? 353  LYS A CG    1 
ATOM   3646 C  CD    . LYS C 3  354 ? 46.16228 29.78010  -34.28297 1.000 41.80907  ? 353  LYS A CD    1 
ATOM   3647 N  N     . TYR C 3  355 ? 44.75437 33.14523  -30.90407 1.000 44.61264  ? 354  TYR A N     1 
ATOM   3648 C  CA    . TYR C 3  355 ? 43.32851 33.43490  -30.91191 1.000 42.50754  ? 354  TYR A CA    1 
ATOM   3649 C  C     . TYR C 3  355 ? 42.99968 34.16405  -32.20236 1.000 49.83549  ? 354  TYR A C     1 
ATOM   3650 O  O     . TYR C 3  355 ? 43.57112 35.22178  -32.48297 1.000 55.89731  ? 354  TYR A O     1 
ATOM   3651 C  CB    . TYR C 3  355 ? 42.91242 34.27237  -29.70495 1.000 34.63431  ? 354  TYR A CB    1 
ATOM   3652 C  CG    . TYR C 3  355 ? 41.46282 34.67847  -29.77654 1.000 35.99351  ? 354  TYR A CG    1 
ATOM   3653 C  CD1   . TYR C 3  355 ? 40.45589 33.76827  -29.45227 1.000 30.49857  ? 354  TYR A CD1   1 
ATOM   3654 C  CD2   . TYR C 3  355 ? 41.09084 35.96581  -30.17852 1.000 34.98592  ? 354  TYR A CD2   1 
ATOM   3655 C  CE1   . TYR C 3  355 ? 39.12521 34.12285  -29.51482 1.000 33.02293  ? 354  TYR A CE1   1 
ATOM   3656 C  CE2   . TYR C 3  355 ? 39.74958 36.33323  -30.25294 1.000 37.72455  ? 354  TYR A CE2   1 
ATOM   3657 C  CZ    . TYR C 3  355 ? 38.76754 35.40009  -29.92374 1.000 40.25491  ? 354  TYR A CZ    1 
ATOM   3658 O  OH    . TYR C 3  355 ? 37.42683 35.73378  -29.98302 1.000 42.54671  ? 354  TYR A OH    1 
ATOM   3659 N  N     . ALA C 3  356 ? 42.09242 33.60401  -32.99280 1.000 50.63029  ? 355  ALA A N     1 
ATOM   3660 C  CA    . ALA C 3  356 ? 41.74831 34.27803  -34.23567 1.000 52.20367  ? 355  ALA A CA    1 
ATOM   3661 C  C     . ALA C 3  356 ? 40.26474 34.17632  -34.55645 1.000 58.47186  ? 355  ALA A C     1 
ATOM   3662 O  O     . ALA C 3  356 ? 39.88031 34.24827  -35.72963 1.000 64.16652  ? 355  ALA A O     1 
ATOM   3663 C  CB    . ALA C 3  356 ? 42.56608 33.73402  -35.40628 1.000 47.07768  ? 355  ALA A CB    1 
ATOM   3664 N  N     . ARG C 3  357 ? 39.41074 34.02708  -33.54827 1.000 56.97254  ? 356  ARG A N     1 
ATOM   3665 C  CA    . ARG C 3  357 ? 37.99369 33.85719  -33.82984 1.000 59.18084  ? 356  ARG A CA    1 
ATOM   3666 C  C     . ARG C 3  357 ? 37.36433 35.19445  -34.19558 1.000 62.87676  ? 356  ARG A C     1 
ATOM   3667 O  O     . ARG C 3  357 ? 37.58315 36.20356  -33.51721 1.000 62.41760  ? 356  ARG A O     1 
ATOM   3668 C  CB    . ARG C 3  357 ? 37.26297 33.24299  -32.64502 1.000 57.58150  ? 356  ARG A CB    1 
ATOM   3669 C  CG    . ARG C 3  357 ? 35.80744 33.01216  -32.95122 1.000 62.06842  ? 356  ARG A CG    1 
ATOM   3670 C  CD    . ARG C 3  357 ? 35.07818 32.36475  -31.80234 1.000 66.42300  ? 356  ARG A CD    1 
ATOM   3671 N  NE    . ARG C 3  357 ? 33.65417 32.27931  -32.10119 1.000 74.24951  ? 356  ARG A NE    1 
ATOM   3672 C  CZ    . ARG C 3  357 ? 32.74489 31.77541  -31.27693 1.000 75.58134  ? 356  ARG A CZ    1 
ATOM   3673 N  NH1   . ARG C 3  357 ? 33.11358 31.30357  -30.09297 1.000 72.21664  ? 356  ARG A NH1   1 
ATOM   3674 N  NH2   . ARG C 3  357 ? 31.46806 31.74769  -31.64167 1.000 77.29689  ? 356  ARG A NH2   1 
ATOM   3675 N  N     . MET C 3  358 ? 36.58501 35.20027  -35.27474 1.000 65.31795  ? 357  MET A N     1 
ATOM   3676 C  CA    . MET C 3  358 ? 35.86100 36.39196  -35.69989 1.000 69.14852  ? 357  MET A CA    1 
ATOM   3677 C  C     . MET C 3  358 ? 34.48380 36.38496  -35.04214 1.000 62.25518  ? 357  MET A C     1 
ATOM   3678 O  O     . MET C 3  358 ? 33.63702 35.54482  -35.36011 1.000 67.22825  ? 357  MET A O     1 
ATOM   3679 C  CB    . MET C 3  358 ? 35.75796 36.45579  -37.22403 1.000 81.10919  ? 357  MET A CB    1 
ATOM   3680 C  CG    . MET C 3  358 ? 37.07522 36.79268  -37.94546 1.000 88.18194  ? 357  MET A CG    1 
ATOM   3681 S  SD    . MET C 3  358 ? 37.90081 38.28600  -37.32798 1.000 92.07529  ? 357  MET A SD    1 
ATOM   3682 C  CE    . MET C 3  358 ? 36.54857 39.47445  -37.39402 1.000 91.83635  ? 357  MET A CE    1 
ATOM   3683 N  N     . ARG C 3  359 ? 34.27429 37.30930  -34.11055 1.000 56.04130  ? 358  ARG A N     1 
ATOM   3684 C  CA    . ARG C 3  359 ? 33.00590 37.49170  -33.41844 1.000 54.94190  ? 358  ARG A CA    1 
ATOM   3685 C  C     . ARG C 3  359 ? 32.32004 38.72686  -33.98422 1.000 55.61290  ? 358  ARG A C     1 
ATOM   3686 O  O     . ARG C 3  359 ? 32.86486 39.83383  -33.90254 1.000 58.16654  ? 358  ARG A O     1 
ATOM   3687 C  CB    . ARG C 3  359 ? 33.22074 37.65225  -31.91249 1.000 54.92729  ? 358  ARG A CB    1 
ATOM   3688 C  CG    . ARG C 3  359 ? 33.83104 36.44852  -31.23657 1.000 60.26202  ? 358  ARG A CG    1 
ATOM   3689 C  CD    . ARG C 3  359 ? 32.80069 35.36003  -31.07953 1.000 71.80576  ? 358  ARG A CD    1 
ATOM   3690 N  NE    . ARG C 3  359 ? 31.79757 35.73807  -30.09125 1.000 79.66040  ? 358  ARG A NE    1 
ATOM   3691 C  CZ    . ARG C 3  359 ? 31.85184 35.38057  -28.81516 1.000 82.02102  ? 358  ARG A CZ    1 
ATOM   3692 N  NH1   . ARG C 3  359 ? 32.85824 34.62550  -28.38540 1.000 84.56745  ? 358  ARG A NH1   1 
ATOM   3693 N  NH2   . ARG C 3  359 ? 30.90175 35.77042  -27.97510 1.000 80.71919  ? 358  ARG A NH2   1 
ATOM   3694 N  N     . GLY C 3  360 ? 31.14211 38.53844  -34.56950 1.000 50.02661  ? 359  GLY A N     1 
ATOM   3695 C  CA    . GLY C 3  360 ? 30.34281 39.67931  -34.97518 1.000 46.15408  ? 359  GLY A CA    1 
ATOM   3696 C  C     . GLY C 3  360 ? 30.58492 40.21235  -36.37310 1.000 42.54457  ? 359  GLY A C     1 
ATOM   3697 O  O     . GLY C 3  360 ? 31.71229 40.20814  -36.87572 1.000 47.73665  ? 359  GLY A O     1 
ATOM   3698 N  N     . ALA C 3  361 ? 29.50495 40.66656  -37.00807 1.000 37.55860  ? 360  ALA A N     1 
ATOM   3699 C  CA    . ALA C 3  361 ? 29.60300 41.35157  -38.29508 1.000 46.65983  ? 360  ALA A CA    1 
ATOM   3700 C  C     . ALA C 3  361 ? 30.59776 42.51288  -38.25567 1.000 46.92358  ? 360  ALA A C     1 
ATOM   3701 O  O     . ALA C 3  361 ? 31.35199 42.72418  -39.21347 1.000 48.35878  ? 360  ALA A O     1 
ATOM   3702 C  CB    . ALA C 3  361 ? 28.21948 41.85763  -38.72336 1.000 41.24300  ? 360  ALA A CB    1 
ATOM   3703 N  N     . HIS C 3  362 ? 30.60245 43.29192  -37.17130 1.000 43.43544  ? 361  HIS A N     1 
ATOM   3704 C  CA    . HIS C 3  362 ? 31.47005 44.46097  -37.08887 1.000 43.42594  ? 361  HIS A CA    1 
ATOM   3705 C  C     . HIS C 3  362 ? 32.12090 44.50732  -35.71798 1.000 41.67170  ? 361  HIS A C     1 
ATOM   3706 O  O     . HIS C 3  362 ? 31.48747 44.20203  -34.70421 1.000 45.92640  ? 361  HIS A O     1 
ATOM   3707 C  CB    . HIS C 3  362 ? 30.70579 45.76704  -37.36572 1.000 38.13163  ? 361  HIS A CB    1 
ATOM   3708 C  CG    . HIS C 3  362 ? 29.56036 45.59743  -38.30550 1.000 40.19773  ? 361  HIS A CG    1 
ATOM   3709 N  ND1   . HIS C 3  362 ? 29.72551 45.50230  -39.66770 1.000 50.87475  ? 361  HIS A ND1   1 
ATOM   3710 C  CD2   . HIS C 3  362 ? 28.23156 45.46863  -38.07815 1.000 40.83700  ? 361  HIS A CD2   1 
ATOM   3711 C  CE1   . HIS C 3  362 ? 28.54580 45.33768  -40.24231 1.000 50.27880  ? 361  HIS A CE1   1 
ATOM   3712 N  NE2   . HIS C 3  362 ? 27.62176 45.31208  -39.29963 1.000 43.16192  ? 361  HIS A NE2   1 
ATOM   3713 N  N     . THR C 3  363 ? 33.38928 44.89707  -35.69665 1.000 34.33532  ? 362  THR A N     1 
ATOM   3714 C  CA    . THR C 3  363 ? 34.17710 44.85464  -34.47671 1.000 36.46883  ? 362  THR A CA    1 
ATOM   3715 C  C     . THR C 3  363 ? 35.39793 45.74302  -34.65573 1.000 32.61960  ? 362  THR A C     1 
ATOM   3716 O  O     . THR C 3  363 ? 35.66390 46.25484  -35.74511 1.000 33.98501  ? 362  THR A O     1 
ATOM   3717 C  CB    . THR C 3  363 ? 34.59042 43.41971  -34.13574 1.000 42.32833  ? 362  THR A CB    1 
ATOM   3718 O  OG1   . THR C 3  363 ? 35.32373 43.42476  -32.90769 1.000 45.30954  ? 362  THR A OG1   1 
ATOM   3719 C  CG2   . THR C 3  363 ? 35.46379 42.84036  -35.23238 1.000 32.57528  ? 362  THR A CG2   1 
ATOM   3720 N  N     . ASN C 3  364 ? 36.14125 45.92522  -33.56156 1.000 35.62489  ? 363  ASN A N     1 
ATOM   3721 C  CA    . ASN C 3  364 ? 37.43681 46.59051  -33.66150 1.000 37.32850  ? 363  ASN A CA    1 
ATOM   3722 C  C     . ASN C 3  364 ? 38.51706 45.81772  -32.91204 1.000 37.89427  ? 363  ASN A C     1 
ATOM   3723 O  O     . ASN C 3  364 ? 38.27275 44.71433  -32.40587 1.000 35.39626  ? 363  ASN A O     1 
ATOM   3724 C  CB    . ASN C 3  364 ? 37.35630 48.02594  -33.15101 1.000 31.37323  ? 363  ASN A CB    1 
ATOM   3725 C  CG    . ASN C 3  364 ? 36.84850 48.11604  -31.73429 1.000 36.87804  ? 363  ASN A CG    1 
ATOM   3726 O  OD1   . ASN C 3  364 ? 37.28850 47.37813  -30.84248 1.000 34.39214  ? 363  ASN A OD1   1 
ATOM   3727 N  ND2   . ASN C 3  364 ? 35.91541 49.03694  -31.51002 1.000 34.71705  ? 363  ASN A ND2   1 
ATOM   3728 N  N     . ASP C 3  365 ? 39.71448 46.40065  -32.83977 1.000 38.53782  ? 364  ASP A N     1 
ATOM   3729 C  CA    . ASP C 3  365 ? 40.85373 45.69290  -32.27494 1.000 38.03435  ? 364  ASP A CA    1 
ATOM   3730 C  C     . ASP C 3  365 ? 40.78756 45.61772  -30.75784 1.000 36.99407  ? 364  ASP A C     1 
ATOM   3731 O  O     . ASP C 3  365 ? 41.30765 44.65730  -30.16838 1.000 38.67627  ? 364  ASP A O     1 
ATOM   3732 C  CB    . ASP C 3  365 ? 42.15417 46.35949  -32.71562 1.000 47.00741  ? 364  ASP A CB    1 
ATOM   3733 C  CG    . ASP C 3  365 ? 42.73215 45.73881  -33.96966 1.000 59.97388  ? 364  ASP A CG    1 
ATOM   3734 O  OD1   . ASP C 3  365 ? 42.04714 44.91245  -34.60941 1.000 65.72492  ? 364  ASP A OD1   1 
ATOM   3735 O  OD2   . ASP C 3  365 ? 43.88683 46.06748  -34.30962 1.000 65.94362  ? 364  ASP A OD2   1 
ATOM   3736 N  N     . VAL C 3  366 ? 40.15074 46.59513  -30.10402 1.000 32.25777  ? 365  VAL A N     1 
ATOM   3737 C  CA    . VAL C 3  366 ? 40.05350 46.53519  -28.64411 1.000 32.32780  ? 365  VAL A CA    1 
ATOM   3738 C  C     . VAL C 3  366 ? 39.10506 45.41221  -28.20506 1.000 30.32509  ? 365  VAL A C     1 
ATOM   3739 O  O     . VAL C 3  366 ? 39.39548 44.67047  -27.25626 1.000 32.45435  ? 365  VAL A O     1 
ATOM   3740 C  CB    . VAL C 3  366 ? 39.64114 47.91148  -28.07898 1.000 34.75444  ? 365  VAL A CB    1 
ATOM   3741 C  CG1   . VAL C 3  366 ? 39.51162 47.85870  -26.57626 1.000 26.70225  ? 365  VAL A CG1   1 
ATOM   3742 C  CG2   . VAL C 3  366 ? 40.67523 48.94031  -28.45323 1.000 30.80937  ? 365  VAL A CG2   1 
ATOM   3743 N  N     . LYS C 3  367 ? 37.96638 45.25528  -28.88898 1.000 30.82389  ? 366  LYS A N     1 
ATOM   3744 C  CA    . LYS C 3  367 ? 37.09318 44.11611  -28.61178 1.000 29.65318  ? 366  LYS A CA    1 
ATOM   3745 C  C     . LYS C 3  367 ? 37.83518 42.78805  -28.78763 1.000 36.54738  ? 366  LYS A C     1 
ATOM   3746 O  O     . LYS C 3  367 ? 37.75296 41.89774  -27.92835 1.000 35.74587  ? 366  LYS A O     1 
ATOM   3747 C  CB    . LYS C 3  367 ? 35.86404 44.15559  -29.51545 1.000 27.85962  ? 366  LYS A CB    1 
ATOM   3748 C  CG    . LYS C 3  367 ? 34.84310 45.26606  -29.23618 1.000 31.93990  ? 366  LYS A CG    1 
ATOM   3749 C  CD    . LYS C 3  367 ? 33.71351 45.17594  -30.27419 1.000 35.85539  ? 366  LYS A CD    1 
ATOM   3750 C  CE    . LYS C 3  367 ? 32.59045 46.16848  -30.04862 1.000 40.25999  ? 366  LYS A CE    1 
ATOM   3751 N  NZ    . LYS C 3  367 ? 31.46356 45.94453  -31.02333 1.000 43.48421  ? 366  LYS A NZ    1 
ATOM   3752 N  N     . GLN C 3  368 ? 38.55862 42.63227  -29.90487 1.000 37.50217  ? 367  GLN A N     1 
ATOM   3753 C  CA    . GLN C 3  368 ? 39.23342 41.36494  -30.16694 1.000 36.88521  ? 367  GLN A CA    1 
ATOM   3754 C  C     . GLN C 3  368 ? 40.30578 41.08387  -29.11974 1.000 39.77846  ? 367  GLN A C     1 
ATOM   3755 O  O     . GLN C 3  368 ? 40.50054 39.92436  -28.71298 1.000 38.55625  ? 367  GLN A O     1 
ATOM   3756 C  CB    . GLN C 3  368 ? 39.83519 41.36532  -31.56789 1.000 37.42923  ? 367  GLN A CB    1 
ATOM   3757 C  CG    . GLN C 3  368 ? 38.83616 41.13095  -32.66923 1.000 40.90228  ? 367  GLN A CG    1 
ATOM   3758 C  CD    . GLN C 3  368 ? 39.39290 41.48899  -34.03027 1.000 51.65402  ? 367  GLN A CD    1 
ATOM   3759 O  OE1   . GLN C 3  368 ? 40.53654 41.93842  -34.14770 1.000 55.07622  ? 367  GLN A OE1   1 
ATOM   3760 N  NE2   . GLN C 3  368 ? 38.58010 41.31277  -35.06949 1.000 56.37831  ? 367  GLN A NE2   1 
ATOM   3761 N  N     . LEU C 3  369 ? 41.00337 42.13612  -28.65777 1.000 36.63169  ? 368  LEU A N     1 
ATOM   3762 C  CA    . LEU C 3  369 ? 41.96063 41.96618  -27.56620 1.000 31.16468  ? 368  LEU A CA    1 
ATOM   3763 C  C     . LEU C 3  369 ? 41.26780 41.52293  -26.27817 1.000 37.31946  ? 368  LEU A C     1 
ATOM   3764 O  O     . LEU C 3  369 ? 41.77985 40.66109  -25.55079 1.000 36.32879  ? 368  LEU A O     1 
ATOM   3765 C  CB    . LEU C 3  369 ? 42.72573 43.26122  -27.33046 1.000 30.13939  ? 368  LEU A CB    1 
ATOM   3766 C  CG    . LEU C 3  369 ? 43.82052 43.17028  -26.26825 1.000 33.92471  ? 368  LEU A CG    1 
ATOM   3767 C  CD1   . LEU C 3  369 ? 44.76455 41.96420  -26.50639 1.000 31.02520  ? 368  LEU A CD1   1 
ATOM   3768 C  CD2   . LEU C 3  369 ? 44.60585 44.46431  -26.22851 1.000 36.23241  ? 368  LEU A CD2   1 
ATOM   3769 N  N     . THR C 3  370 ? 40.10480 42.10649  -25.97255 1.000 39.21229  ? 369  THR A N     1 
ATOM   3770 C  CA    . THR C 3  370 ? 39.38968 41.71269  -24.76195 1.000 35.87988  ? 369  THR A CA    1 
ATOM   3771 C  C     . THR C 3  370 ? 38.95870 40.25135  -24.83073 1.000 37.65287  ? 369  THR A C     1 
ATOM   3772 O  O     . THR C 3  370 ? 39.03661 39.51351  -23.83311 1.000 38.01633  ? 369  THR A O     1 
ATOM   3773 C  CB    . THR C 3  370 ? 38.18014 42.62171  -24.55476 1.000 34.40377  ? 369  THR A CB    1 
ATOM   3774 O  OG1   . THR C 3  370 ? 38.61212 43.98721  -24.56503 1.000 38.16093  ? 369  THR A OG1   1 
ATOM   3775 C  CG2   . THR C 3  370 ? 37.51348 42.31903  -23.22017 1.000 31.71445  ? 369  THR A CG2   1 
ATOM   3776 N  N     . GLU C 3  371 ? 38.52656 39.79925  -26.00917 1.000 36.54251  ? 370  GLU A N     1 
ATOM   3777 C  CA    . GLU C 3  371 ? 38.10420 38.40915  -26.07701 1.000 36.63490  ? 370  GLU A CA    1 
ATOM   3778 C  C     . GLU C 3  371 ? 39.29635 37.44249  -26.08720 1.000 35.75689  ? 370  GLU A C     1 
ATOM   3779 O  O     . GLU C 3  371 ? 39.19182 36.33626  -25.53903 1.000 32.79822  ? 370  GLU A O     1 
ATOM   3780 C  CB    . GLU C 3  371 ? 37.14986 38.19252  -27.25421 1.000 35.74746  ? 370  GLU A CB    1 
ATOM   3781 C  CG    . GLU C 3  371 ? 37.55663 38.71260  -28.56108 1.000 49.14904  ? 370  GLU A CG    1 
ATOM   3782 C  CD    . GLU C 3  371 ? 36.35357 38.90720  -29.47564 1.000 53.93575  ? 370  GLU A CD    1 
ATOM   3783 O  OE1   . GLU C 3  371 ? 35.51936 39.79026  -29.17257 1.000 48.26566  ? 370  GLU A OE1   1 
ATOM   3784 O  OE2   . GLU C 3  371 ? 36.24285 38.16457  -30.48229 1.000 57.88071  ? 370  GLU A OE2   1 
ATOM   3785 N  N     . ALA C 3  372 ? 40.44658 37.86036  -26.62039 1.000 33.86481  ? 371  ALA A N     1 
ATOM   3786 C  CA    . ALA C 3  372 ? 41.65854 37.05716  -26.47522 1.000 31.53210  ? 371  ALA A CA    1 
ATOM   3787 C  C     . ALA C 3  372 ? 42.06352 36.93307  -25.01283 1.000 36.22328  ? 371  ALA A C     1 
ATOM   3788 O  O     . ALA C 3  372 ? 42.45332 35.84903  -24.56146 1.000 39.72916  ? 371  ALA A O     1 
ATOM   3789 C  CB    . ALA C 3  372 ? 42.79909 37.67156  -27.29444 1.000 32.48418  ? 371  ALA A CB    1 
ATOM   3790 N  N     . VAL C 3  373 ? 42.00211 38.04352  -24.26115 1.000 36.83249  ? 372  VAL A N     1 
ATOM   3791 C  CA    . VAL C 3  373 ? 42.27476 38.00262  -22.82439 1.000 28.43604  ? 372  VAL A CA    1 
ATOM   3792 C  C     . VAL C 3  373 ? 41.33054 37.02164  -22.13227 1.000 35.09005  ? 372  VAL A C     1 
ATOM   3793 O  O     . VAL C 3  373 ? 41.74500 36.24365  -21.25875 1.000 35.01720  ? 372  VAL A O     1 
ATOM   3794 C  CB    . VAL C 3  373 ? 42.18217 39.41695  -22.21288 1.000 28.89466  ? 372  VAL A CB    1 
ATOM   3795 C  CG1   . VAL C 3  373 ? 42.17515 39.37632  -20.68030 1.000 22.76205  ? 372  VAL A CG1   1 
ATOM   3796 C  CG2   . VAL C 3  373 ? 43.35787 40.29652  -22.69121 1.000 30.16741  ? 372  VAL A CG2   1 
ATOM   3797 N  N     . GLN C 3  374 ? 40.04785 37.04245  -22.50323 1.000 36.36589  ? 373  GLN A N     1 
ATOM   3798 C  CA    . GLN C 3  374 ? 39.10132 36.12303  -21.87960 1.000 37.12788  ? 373  GLN A CA    1 
ATOM   3799 C  C     . GLN C 3  374 ? 39.45846 34.66423  -22.17768 1.000 35.33694  ? 373  GLN A C     1 
ATOM   3800 O  O     . GLN C 3  374 ? 39.49109 33.81509  -21.26673 1.000 33.19979  ? 373  GLN A O     1 
ATOM   3801 C  CB    . GLN C 3  374 ? 37.68392 36.45280  -22.33597 1.000 44.05086  ? 373  GLN A CB    1 
ATOM   3802 C  CG    . GLN C 3  374 ? 37.03772 37.54750  -21.50339 1.000 52.55941  ? 373  GLN A CG    1 
ATOM   3803 C  CD    . GLN C 3  374 ? 36.30260 38.59549  -22.34329 1.000 60.30979  ? 373  GLN A CD    1 
ATOM   3804 O  OE1   . GLN C 3  374 ? 36.17013 39.75636  -21.93412 1.000 61.57154  ? 373  GLN A OE1   1 
ATOM   3805 N  NE2   . GLN C 3  374 ? 35.81403 38.18601  -23.51371 1.000 60.09655  ? 373  GLN A NE2   1 
ATOM   3806 N  N     . LYS C 3  375 ? 39.73446 34.36050  -23.45158 1.000 31.21604  ? 374  LYS A N     1 
ATOM   3807 C  CA    . LYS C 3  375 ? 40.11393 33.00438  -23.83399 1.000 27.99884  ? 374  LYS A CA    1 
ATOM   3808 C  C     . LYS C 3  375 ? 41.31267 32.53300  -23.02759 1.000 33.42196  ? 374  LYS A C     1 
ATOM   3809 O  O     . LYS C 3  375 ? 41.31553 31.41141  -22.48419 1.000 37.93985  ? 374  LYS A O     1 
ATOM   3810 C  CB    . LYS C 3  375 ? 40.41963 32.93367  -25.33180 1.000 25.34909  ? 374  LYS A CB    1 
ATOM   3811 C  CG    . LYS C 3  375 ? 40.20705 31.55037  -25.94340 1.000 32.58457  ? 374  LYS A CG    1 
ATOM   3812 C  CD    . LYS C 3  375 ? 41.27472 31.21935  -26.99814 1.000 38.16665  ? 374  LYS A CD    1 
ATOM   3813 N  N     . ILE C 3  376 ? 42.32759 33.39878  -22.90304 1.000 30.61198  ? 375  ILE A N     1 
ATOM   3814 C  CA    . ILE C 3  376 ? 43.54075 33.00987  -22.19105 1.000 30.64371  ? 375  ILE A CA    1 
ATOM   3815 C  C     . ILE C 3  376 ? 43.25868 32.81828  -20.70086 1.000 31.97849  ? 375  ILE A C     1 
ATOM   3816 O  O     . ILE C 3  376 ? 43.80940 31.91682  -20.05971 1.000 32.23411  ? 375  ILE A O     1 
ATOM   3817 C  CB    . ILE C 3  376 ? 44.64960 34.04099  -22.44988 1.000 29.64040  ? 375  ILE A CB    1 
ATOM   3818 C  CG1   . ILE C 3  376 ? 45.08177 33.97889  -23.91425 1.000 28.41087  ? 375  ILE A CG1   1 
ATOM   3819 C  CG2   . ILE C 3  376 ? 45.84910 33.80979  -21.54933 1.000 33.12024  ? 375  ILE A CG2   1 
ATOM   3820 C  CD1   . ILE C 3  376 ? 45.77922 35.24508  -24.39082 1.000 26.96297  ? 375  ILE A CD1   1 
ATOM   3821 N  N     . THR C 3  377 ? 42.39214 33.64740  -20.13009 1.000 30.58988  ? 376  THR A N     1 
ATOM   3822 C  CA    . THR C 3  377 ? 42.08949 33.52731  -18.71121 1.000 29.35134  ? 376  THR A CA    1 
ATOM   3823 C  C     . THR C 3  377 ? 41.46575 32.17811  -18.40979 1.000 32.05332  ? 376  THR A C     1 
ATOM   3824 O  O     . THR C 3  377 ? 41.86420 31.48825  -17.46278 1.000 36.24319  ? 376  THR A O     1 
ATOM   3825 C  CB    . THR C 3  377 ? 41.15455 34.66495  -18.28274 1.000 27.60719  ? 376  THR A CB    1 
ATOM   3826 O  OG1   . THR C 3  377 ? 41.85987 35.89686  -18.36185 1.000 26.40271  ? 376  THR A OG1   1 
ATOM   3827 C  CG2   . THR C 3  377 ? 40.66985 34.49659  -16.87874 1.000 21.68530  ? 376  THR A CG2   1 
ATOM   3828 N  N     . THR C 3  378 ? 40.47362 31.78064  -19.20542 1.000 34.95325  ? 377  THR A N     1 
ATOM   3829 C  CA    . THR C 3  378 ? 39.80929 30.52975  -18.86534 1.000 38.52106  ? 377  THR A CA    1 
ATOM   3830 C  C     . THR C 3  378 ? 40.70029 29.33148  -19.18197 1.000 33.80424  ? 377  THR A C     1 
ATOM   3831 O  O     . THR C 3  378 ? 40.68130 28.33545  -18.44108 1.000 36.59473  ? 377  THR A O     1 
ATOM   3832 C  CB    . THR C 3  378 ? 38.43750 30.43510  -19.54508 1.000 43.34062  ? 377  THR A CB    1 
ATOM   3833 O  OG1   . THR C 3  378 ? 38.59731 30.38287  -20.95873 1.000 54.16267  ? 377  THR A OG1   1 
ATOM   3834 C  CG2   . THR C 3  378 ? 37.58882 31.65988  -19.18819 1.000 35.61472  ? 377  THR A CG2   1 
ATOM   3835 N  N     . GLU C 3  379 ? 41.52923 29.42618  -20.22729 1.000 27.40299  ? 378  GLU A N     1 
ATOM   3836 C  CA    . GLU C 3  379 ? 42.50036 28.36572  -20.46506 1.000 28.38429  ? 378  GLU A CA    1 
ATOM   3837 C  C     . GLU C 3  379 ? 43.47216 28.23457  -19.29107 1.000 30.68800  ? 378  GLU A C     1 
ATOM   3838 O  O     . GLU C 3  379 ? 43.77674 27.11483  -18.84338 1.000 32.79956  ? 378  GLU A O     1 
ATOM   3839 C  CB    . GLU C 3  379 ? 43.24332 28.61863  -21.77331 1.000 31.59685  ? 378  GLU A CB    1 
ATOM   3840 C  CG    . GLU C 3  379 ? 44.45202 27.72142  -21.98950 1.000 45.46167  ? 378  GLU A CG    1 
ATOM   3841 C  CD    . GLU C 3  379 ? 45.15330 28.01871  -23.30537 1.000 54.54941  ? 378  GLU A CD    1 
ATOM   3842 O  OE1   . GLU C 3  379 ? 44.47197 28.54453  -24.22253 1.000 59.17679  ? 378  GLU A OE1   1 
ATOM   3843 O  OE2   . GLU C 3  379 ? 46.37680 27.74526  -23.41575 1.000 51.62368  ? 378  GLU A OE2   1 
ATOM   3844 N  N     . SER C 3  380 ? 43.95548 29.36833  -18.77162 1.000 30.80091  ? 379  SER A N     1 
ATOM   3845 C  CA    . SER C 3  380 ? 44.83696 29.34705  -17.60968 1.000 30.01388  ? 379  SER A CA    1 
ATOM   3846 C  C     . SER C 3  380 ? 44.14855 28.73235  -16.40480 1.000 34.26433  ? 379  SER A C     1 
ATOM   3847 O  O     . SER C 3  380 ? 44.78417 28.05737  -15.59270 1.000 36.98761  ? 379  SER A O     1 
ATOM   3848 C  CB    . SER C 3  380 ? 45.30928 30.75767  -17.27129 1.000 30.31039  ? 379  SER A CB    1 
ATOM   3849 O  OG    . SER C 3  380 ? 46.17144 31.23792  -18.28280 1.000 39.87468  ? 379  SER A OG    1 
ATOM   3850 N  N     . ILE C 3  381 ? 42.85732 28.97294  -16.24817 1.000 21.14983  ? 380  ILE A N     1 
ATOM   3851 C  CA    . ILE C 3  381 ? 42.19295 28.41148  -15.08437 1.000 28.14214  ? 380  ILE A CA    1 
ATOM   3852 C  C     . ILE C 3  381 ? 42.09836 26.89536  -15.20313 1.000 32.19894  ? 380  ILE A C     1 
ATOM   3853 O  O     . ILE C 3  381 ? 42.35853 26.16486  -14.23921 1.000 34.35943  ? 380  ILE A O     1 
ATOM   3854 C  CB    . ILE C 3  381 ? 40.82929 29.07776  -14.90356 1.000 31.39837  ? 380  ILE A CB    1 
ATOM   3855 C  CG1   . ILE C 3  381 ? 41.06118 30.52424  -14.40008 1.000 32.92352  ? 380  ILE A CG1   1 
ATOM   3856 C  CG2   . ILE C 3  381 ? 39.92729 28.20825  -14.01032 1.000 21.46745  ? 380  ILE A CG2   1 
ATOM   3857 C  CD1   . ILE C 3  381 ? 39.82876 31.37094  -14.31824 1.000 21.88133  ? 380  ILE A CD1   1 
ATOM   3858 N  N     . VAL C 3  382 ? 41.74942 26.39646  -16.39067 1.000 31.30339  ? 381  VAL A N     1 
ATOM   3859 C  CA    . VAL C 3  382 ? 41.78384 24.95128  -16.62240 1.000 26.88556  ? 381  VAL A CA    1 
ATOM   3860 C  C     . VAL C 3  382 ? 43.16582 24.37996  -16.29726 1.000 27.35199  ? 381  VAL A C     1 
ATOM   3861 O  O     . VAL C 3  382 ? 43.29871 23.43754  -15.50694 1.000 31.40640  ? 381  VAL A O     1 
ATOM   3862 C  CB    . VAL C 3  382 ? 41.37331 24.63526  -18.07157 1.000 28.11913  ? 381  VAL A CB    1 
ATOM   3863 C  CG1   . VAL C 3  382 ? 41.64622 23.18311  -18.39761 1.000 25.29011  ? 381  VAL A CG1   1 
ATOM   3864 C  CG2   . VAL C 3  382 ? 39.90401 24.97810  -18.29602 1.000 32.28480  ? 381  VAL A CG2   1 
ATOM   3865 N  N     . ILE C 3  383 ? 44.22090 24.95736  -16.87802 1.000 26.46109  ? 382  ILE A N     1 
ATOM   3866 C  CA    . ILE C 3  383 ? 45.52872 24.30516  -16.82351 1.000 28.00323  ? 382  ILE A CA    1 
ATOM   3867 C  C     . ILE C 3  383 ? 46.19056 24.47832  -15.45956 1.000 32.79109  ? 382  ILE A C     1 
ATOM   3868 O  O     . ILE C 3  383 ? 46.70865 23.50805  -14.89351 1.000 33.93651  ? 382  ILE A O     1 
ATOM   3869 C  CB    . ILE C 3  383 ? 46.43886 24.80048  -17.95794 1.000 32.28568  ? 382  ILE A CB    1 
ATOM   3870 C  CG1   . ILE C 3  383 ? 45.93445 24.27484  -19.30702 1.000 21.36795  ? 382  ILE A CG1   1 
ATOM   3871 C  CG2   . ILE C 3  383 ? 47.87452 24.34440  -17.72974 1.000 22.46556  ? 382  ILE A CG2   1 
ATOM   3872 C  CD1   . ILE C 3  383 ? 46.69370 24.84817  -20.48886 1.000 21.81825  ? 382  ILE A CD1   1 
ATOM   3873 N  N     . TRP C 3  384 ? 46.20184 25.70360  -14.91526 1.000 33.34158  ? 383  TRP A N     1 
ATOM   3874 C  CA    . TRP C 3  384 ? 46.86801 26.01314  -13.64561 1.000 31.06282  ? 383  TRP A CA    1 
ATOM   3875 C  C     . TRP C 3  384 ? 45.92391 26.40628  -12.51081 1.000 33.30840  ? 383  TRP A C     1 
ATOM   3876 O  O     . TRP C 3  384 ? 46.39681 26.64471  -11.39435 1.000 38.48909  ? 383  TRP A O     1 
ATOM   3877 C  CB    . TRP C 3  384 ? 47.90189 27.13738  -13.83227 1.000 27.16451  ? 383  TRP A CB    1 
ATOM   3878 C  CG    . TRP C 3  384 ? 48.91238 26.84781  -14.90617 1.000 32.94467  ? 383  TRP A CG    1 
ATOM   3879 C  CD1   . TRP C 3  384 ? 49.97795 25.99803  -14.82459 1.000 32.43159  ? 383  TRP A CD1   1 
ATOM   3880 C  CD2   . TRP C 3  384 ? 48.94365 27.40265  -16.22992 1.000 32.58822  ? 383  TRP A CD2   1 
ATOM   3881 N  NE1   . TRP C 3  384 ? 50.67202 25.98870  -16.01677 1.000 33.83904  ? 383  TRP A NE1   1 
ATOM   3882 C  CE2   . TRP C 3  384 ? 50.05429 26.84038  -16.89403 1.000 33.12453  ? 383  TRP A CE2   1 
ATOM   3883 C  CE3   . TRP C 3  384 ? 48.14140 28.32091  -16.91483 1.000 28.80188  ? 383  TRP A CE3   1 
ATOM   3884 C  CZ2   . TRP C 3  384 ? 50.38004 27.16772  -18.20531 1.000 32.39343  ? 383  TRP A CZ2   1 
ATOM   3885 C  CZ3   . TRP C 3  384 ? 48.46562 28.64564  -18.20754 1.000 27.34180  ? 383  TRP A CZ3   1 
ATOM   3886 C  CH2   . TRP C 3  384 ? 49.57165 28.06922  -18.84526 1.000 30.64697  ? 383  TRP A CH2   1 
ATOM   3887 N  N     . GLY C 3  385 ? 44.61919 26.50623  -12.75280 1.000 30.59379  ? 384  GLY A N     1 
ATOM   3888 C  CA    . GLY C 3  385 ? 43.70901 26.85443  -11.67656 1.000 24.26514  ? 384  GLY A CA    1 
ATOM   3889 C  C     . GLY C 3  385 ? 43.84926 28.25837  -11.14325 1.000 28.40100  ? 384  GLY A C     1 
ATOM   3890 O  O     . GLY C 3  385 ? 43.36052 28.54893  -10.04656 1.000 29.31259  ? 384  GLY A O     1 
ATOM   3891 N  N     . LYS C 3  386 ? 44.49689 29.15017  -11.88657 1.000 31.05893  ? 385  LYS A N     1 
ATOM   3892 C  CA    . LYS C 3  386 ? 44.56570 30.54166  -11.47814 1.000 32.33387  ? 385  LYS A CA    1 
ATOM   3893 C  C     . LYS C 3  386 ? 44.69968 31.41306  -12.72105 1.000 40.47478  ? 385  LYS A C     1 
ATOM   3894 O  O     . LYS C 3  386 ? 44.96979 30.93348  -13.82505 1.000 44.96302  ? 385  LYS A O     1 
ATOM   3895 C  CB    . LYS C 3  386 ? 45.70788 30.76636  -10.47741 1.000 29.37637  ? 385  LYS A CB    1 
ATOM   3896 C  CG    . LYS C 3  386 ? 47.09817 30.88856  -11.06133 1.000 34.84722  ? 385  LYS A CG    1 
ATOM   3897 C  CD    . LYS C 3  386 ? 48.14924 30.93277  -9.92919  1.000 44.34769  ? 385  LYS A CD    1 
ATOM   3898 C  CE    . LYS C 3  386 ? 49.35545 31.80633  -10.28635 1.000 50.13976  ? 385  LYS A CE    1 
ATOM   3899 N  NZ    . LYS C 3  386 ? 50.65631 31.19868  -9.83864  1.000 50.89699  ? 385  LYS A NZ    1 
ATOM   3900 N  N     . THR C 3  387 ? 44.50491 32.70194  -12.52801 1.000 39.52122  ? 386  THR A N     1 
ATOM   3901 C  CA    . THR C 3  387 ? 44.48466 33.67034  -13.61191 1.000 33.96578  ? 386  THR A CA    1 
ATOM   3902 C  C     . THR C 3  387 ? 45.87233 34.28080  -13.79761 1.000 31.91279  ? 386  THR A C     1 
ATOM   3903 O  O     . THR C 3  387 ? 46.58235 34.49902  -12.81985 1.000 35.91628  ? 386  THR A O     1 
ATOM   3904 C  CB    . THR C 3  387 ? 43.45267 34.74570  -13.29565 1.000 40.41987  ? 386  THR A CB    1 
ATOM   3905 O  OG1   . THR C 3  387 ? 42.15244 34.23447  -13.62438 1.000 41.29150  ? 386  THR A OG1   1 
ATOM   3906 C  CG2   . THR C 3  387 ? 43.72205 36.06816  -14.03657 1.000 45.86484  ? 386  THR A CG2   1 
ATOM   3907 N  N     . PRO C 3  388 ? 46.33948 34.52945  -15.01684 1.000 31.32911  ? 387  PRO A N     1 
ATOM   3908 C  CA    . PRO C 3  388 ? 47.66615 35.12845  -15.19276 1.000 34.86001  ? 387  PRO A CA    1 
ATOM   3909 C  C     . PRO C 3  388 ? 47.60684 36.64935  -15.20093 1.000 34.10002  ? 387  PRO A C     1 
ATOM   3910 O  O     . PRO C 3  388 ? 46.54738 37.26117  -15.35824 1.000 33.71324  ? 387  PRO A O     1 
ATOM   3911 C  CB    . PRO C 3  388 ? 48.10327 34.60385  -16.56729 1.000 24.68160  ? 387  PRO A CB    1 
ATOM   3912 C  CG    . PRO C 3  388 ? 46.80987 34.54761  -17.31968 1.000 23.64639  ? 387  PRO A CG    1 
ATOM   3913 C  CD    . PRO C 3  388 ? 45.71689 34.20371  -16.31320 1.000 25.91225  ? 387  PRO A CD    1 
ATOM   3914 N  N     . LYS C 3  389 ? 48.78421 37.24850  -15.02498 1.000 43.02457  ? 388  LYS A N     1 
ATOM   3915 C  CA    . LYS C 3  389 ? 48.97104 38.68486  -15.19312 1.000 39.46140  ? 388  LYS A CA    1 
ATOM   3916 C  C     . LYS C 3  389 ? 49.33485 38.96502  -16.64362 1.000 43.76899  ? 388  LYS A C     1 
ATOM   3917 O  O     . LYS C 3  389 ? 50.18158 38.27756  -17.21998 1.000 54.47396  ? 388  LYS A O     1 
ATOM   3918 C  CB    . LYS C 3  389 ? 50.06169 39.20144  -14.25702 1.000 40.42880  ? 388  LYS A CB    1 
ATOM   3919 C  CG    . LYS C 3  389 ? 49.88129 38.73859  -12.83017 1.000 46.95421  ? 388  LYS A CG    1 
ATOM   3920 C  CD    . LYS C 3  389 ? 50.80973 39.45956  -11.87746 1.000 55.68741  ? 388  LYS A CD    1 
ATOM   3921 C  CE    . LYS C 3  389 ? 50.43516 39.15990  -10.42368 1.000 63.64298  ? 388  LYS A CE    1 
ATOM   3922 N  NZ    . LYS C 3  389 ? 50.88129 40.26177  -9.49788  1.000 68.23145  ? 388  LYS A NZ    1 
ATOM   3923 N  N     . PHE C 3  390 ? 48.70286 39.96838  -17.23131 1.000 42.64929  ? 389  PHE A N     1 
ATOM   3924 C  CA    . PHE C 3  390 ? 48.80218 40.19472  -18.66536 1.000 42.61107  ? 389  PHE A CA    1 
ATOM   3925 C  C     . PHE C 3  390 ? 49.79444 41.29304  -19.03304 1.000 41.76059  ? 389  PHE A C     1 
ATOM   3926 O  O     . PHE C 3  390 ? 49.98918 42.26769  -18.30557 1.000 36.90340  ? 389  PHE A O     1 
ATOM   3927 C  CB    . PHE C 3  390 ? 47.43464 40.53570  -19.24554 1.000 34.03491  ? 389  PHE A CB    1 
ATOM   3928 C  CG    . PHE C 3  390 ? 46.52748 39.37645  -19.30092 1.000 37.13107  ? 389  PHE A CG    1 
ATOM   3929 C  CD1   . PHE C 3  390 ? 46.47346 38.57898  -20.43971 1.000 37.93445  ? 389  PHE A CD1   1 
ATOM   3930 C  CD2   . PHE C 3  390 ? 45.74987 39.04454  -18.20700 1.000 34.08655  ? 389  PHE A CD2   1 
ATOM   3931 C  CE1   . PHE C 3  390 ? 45.63916 37.48972  -20.49048 1.000 34.03572  ? 389  PHE A CE1   1 
ATOM   3932 C  CE2   . PHE C 3  390 ? 44.90647 37.95279  -18.25660 1.000 32.80579  ? 389  PHE A CE2   1 
ATOM   3933 C  CZ    . PHE C 3  390 ? 44.85529 37.17741  -19.39531 1.000 35.86632  ? 389  PHE A CZ    1 
ATOM   3934 N  N     . LYS C 3  391 ? 50.42327 41.10315  -20.18896 1.000 41.10835  ? 390  LYS A N     1 
ATOM   3935 C  CA    . LYS C 3  391 ? 51.26418 42.09604  -20.83674 1.000 40.58665  ? 390  LYS A CA    1 
ATOM   3936 C  C     . LYS C 3  391 ? 50.70830 42.26945  -22.24255 1.000 40.77051  ? 390  LYS A C     1 
ATOM   3937 O  O     . LYS C 3  391 ? 50.72805 41.32196  -23.04161 1.000 42.75791  ? 390  LYS A O     1 
ATOM   3938 C  CB    . LYS C 3  391 ? 52.72492 41.66110  -20.83091 1.000 40.95208  ? 390  LYS A CB    1 
ATOM   3939 C  CG    . LYS C 3  391 ? 53.37104 41.87431  -19.46976 1.000 46.37112  ? 390  LYS A CG    1 
ATOM   3940 C  CD    . LYS C 3  391 ? 54.86368 41.60254  -19.47915 1.000 59.43996  ? 390  LYS A CD    1 
ATOM   3941 C  CE    . LYS C 3  391 ? 55.45043 41.78850  -18.07385 1.000 68.75869  ? 390  LYS A CE    1 
ATOM   3942 N  NZ    . LYS C 3  391 ? 56.60140 40.86034  -17.77657 1.000 72.76453  ? 390  LYS A NZ    1 
ATOM   3943 N  N     . LEU C 3  392 ? 50.18817 43.47497  -22.52452 1.000 35.92598  ? 391  LEU A N     1 
ATOM   3944 C  CA    . LEU C 3  392 ? 49.34460 43.77192  -23.67416 1.000 38.30135  ? 391  LEU A CA    1 
ATOM   3945 C  C     . LEU C 3  392 ? 49.89684 44.93800  -24.48580 1.000 45.77265  ? 391  LEU A C     1 
ATOM   3946 O  O     . LEU C 3  392 ? 50.38827 45.92768  -23.91674 1.000 48.64066  ? 391  LEU A O     1 
ATOM   3947 C  CB    . LEU C 3  392 ? 47.91565 44.10522  -23.21702 1.000 33.61999  ? 391  LEU A CB    1 
ATOM   3948 C  CG    . LEU C 3  392 ? 47.22584 43.10517  -22.28702 1.000 36.89217  ? 391  LEU A CG    1 
ATOM   3949 C  CD1   . LEU C 3  392 ? 45.81434 43.56070  -21.90988 1.000 32.26879  ? 391  LEU A CD1   1 
ATOM   3950 C  CD2   . LEU C 3  392 ? 47.20712 41.70622  -22.92355 1.000 32.63283  ? 391  LEU A CD2   1 
ATOM   3951 N  N     . PRO C 3  393 ? 49.80099 44.87318  -25.82469 1.000 44.78316  ? 392  PRO A N     1 
ATOM   3952 C  CA    . PRO C 3  393 ? 50.25767 45.97147  -26.68736 1.000 49.62691  ? 392  PRO A CA    1 
ATOM   3953 C  C     . PRO C 3  393 ? 49.22788 47.09462  -26.86237 1.000 47.00732  ? 392  PRO A C     1 
ATOM   3954 O  O     . PRO C 3  393 ? 48.90339 47.49469  -27.97861 1.000 42.52930  ? 392  PRO A O     1 
ATOM   3955 C  CB    . PRO C 3  393 ? 50.53976 45.25558  -28.01069 1.000 35.91581  ? 392  PRO A CB    1 
ATOM   3956 C  CG    . PRO C 3  393 ? 49.50448 44.17384  -28.04605 1.000 35.21215  ? 392  PRO A CG    1 
ATOM   3957 C  CD    . PRO C 3  393 ? 49.27976 43.74117  -26.61197 1.000 36.83150  ? 392  PRO A CD    1 
ATOM   3958 N  N     . ILE C 3  394 ? 48.69814 47.59745  -25.74648 1.000 46.29764  ? 393  ILE A N     1 
ATOM   3959 C  CA    . ILE C 3  394 ? 47.67902 48.64494  -25.77183 1.000 41.97909  ? 393  ILE A CA    1 
ATOM   3960 C  C     . ILE C 3  394 ? 47.97804 49.64546  -24.66163 1.000 43.56960  ? 393  ILE A C     1 
ATOM   3961 O  O     . ILE C 3  394 ? 48.17167 49.26103  -23.50467 1.000 44.76446  ? 393  ILE A O     1 
ATOM   3962 C  CB    . ILE C 3  394 ? 46.24469 48.07865  -25.64419 1.000 38.00850  ? 393  ILE A CB    1 
ATOM   3963 C  CG1   . ILE C 3  394 ? 45.20736 49.18575  -25.86581 1.000 35.54754  ? 393  ILE A CG1   1 
ATOM   3964 C  CG2   . ILE C 3  394 ? 46.01461 47.37321  -24.31005 1.000 37.99671  ? 393  ILE A CG2   1 
ATOM   3965 C  CD1   . ILE C 3  394 ? 43.81875 48.83695  -25.39357 1.000 33.91385  ? 393  ILE A CD1   1 
ATOM   3966 N  N     . GLN C 3  395 ? 48.04801 50.92503  -25.01705 1.000 45.34377  ? 394  GLN A N     1 
ATOM   3967 C  CA    . GLN C 3  395 ? 48.34413 51.94863  -24.02683 1.000 50.47901  ? 394  GLN A CA    1 
ATOM   3968 C  C     . GLN C 3  395 ? 47.19748 52.06558  -23.03157 1.000 51.28659  ? 394  GLN A C     1 
ATOM   3969 O  O     . GLN C 3  395 ? 46.02645 51.84754  -23.36595 1.000 49.83252  ? 394  GLN A O     1 
ATOM   3970 C  CB    . GLN C 3  395 ? 48.62193 53.29019  -24.70893 1.000 53.41311  ? 394  GLN A CB    1 
ATOM   3971 C  CG    . GLN C 3  395 ? 50.03976 53.35487  -25.28433 1.000 64.90015  ? 394  GLN A CG    1 
ATOM   3972 C  CD    . GLN C 3  395 ? 50.32672 54.61588  -26.08509 1.000 76.99268  ? 394  GLN A CD    1 
ATOM   3973 O  OE1   . GLN C 3  395 ? 49.60835 55.61106  -25.98674 1.000 86.67323  ? 394  GLN A OE1   1 
ATOM   3974 N  NE2   . GLN C 3  395 ? 51.38780 54.57839  -26.88505 1.000 78.70103  ? 394  GLN A NE2   1 
ATOM   3975 N  N     . LYS C 3  396 ? 47.55654 52.36955  -21.78098 1.000 51.13701  ? 395  LYS A N     1 
ATOM   3976 C  CA    . LYS C 3  396 ? 46.55055 52.51155  -20.73393 1.000 47.87915  ? 395  LYS A CA    1 
ATOM   3977 C  C     . LYS C 3  396 ? 45.49380 53.53963  -21.11841 1.000 54.31117  ? 395  LYS A C     1 
ATOM   3978 O  O     . LYS C 3  396 ? 44.30735 53.34568  -20.83207 1.000 60.12603  ? 395  LYS A O     1 
ATOM   3979 C  CB    . LYS C 3  396 ? 47.21930 52.89403  -19.41694 1.000 47.40316  ? 395  LYS A CB    1 
ATOM   3980 C  CG    . LYS C 3  396 ? 48.03569 51.77002  -18.77989 1.000 46.24045  ? 395  LYS A CG    1 
ATOM   3981 C  CD    . LYS C 3  396 ? 47.11967 50.80646  -18.06095 1.000 49.49127  ? 395  LYS A CD    1 
ATOM   3982 C  CE    . LYS C 3  396 ? 47.87617 49.72018  -17.30976 1.000 54.08950  ? 395  LYS A CE    1 
ATOM   3983 N  NZ    . LYS C 3  396 ? 46.94805 48.58545  -16.96137 1.000 52.98209  ? 395  LYS A NZ    1 
ATOM   3984 N  N     . GLU C 3  397 ? 45.89963 54.62693  -21.79356 1.000 50.46224  ? 396  GLU A N     1 
ATOM   3985 C  CA    . GLU C 3  397 ? 44.94728 55.66954  -22.17250 1.000 45.44839  ? 396  GLU A CA    1 
ATOM   3986 C  C     . GLU C 3  397 ? 43.99127 55.18679  -23.25716 1.000 40.74976  ? 396  GLU A C     1 
ATOM   3987 O  O     . GLU C 3  397 ? 42.81353 55.55961  -23.26299 1.000 38.11792  ? 396  GLU A O     1 
ATOM   3988 C  CB    . GLU C 3  397 ? 45.68747 56.93609  -22.63479 1.000 44.14617  ? 396  GLU A CB    1 
ATOM   3989 N  N     . THR C 3  398 ? 44.47899 54.38580  -24.20543 1.000 41.36464  ? 397  THR A N     1 
ATOM   3990 C  CA    . THR C 3  398 ? 43.57871 53.79849  -25.19610 1.000 39.99014  ? 397  THR A CA    1 
ATOM   3991 C  C     . THR C 3  398 ? 42.45654 53.02823  -24.50475 1.000 45.92186  ? 397  THR A C     1 
ATOM   3992 O  O     . THR C 3  398 ? 41.26215 53.23385  -24.78765 1.000 43.40683  ? 397  THR A O     1 
ATOM   3993 C  CB    . THR C 3  398 ? 44.36185 52.87704  -26.13512 1.000 37.07171  ? 397  THR A CB    1 
ATOM   3994 O  OG1   . THR C 3  398 ? 45.49546 53.57010  -26.65345 1.000 43.25874  ? 397  THR A OG1   1 
ATOM   3995 C  CG2   . THR C 3  398 ? 43.49654 52.42563  -27.29506 1.000 31.64180  ? 397  THR A CG2   1 
ATOM   3996 N  N     . TRP C 3  399 ? 42.83438 52.14636  -23.57049 1.000 44.74008  ? 398  TRP A N     1 
ATOM   3997 C  CA    . TRP C 3  399 ? 41.84876 51.36942  -22.83639 1.000 42.57517  ? 398  TRP A CA    1 
ATOM   3998 C  C     . TRP C 3  399 ? 40.92746 52.26895  -22.02454 1.000 43.21598  ? 398  TRP A C     1 
ATOM   3999 O  O     . TRP C 3  399 ? 39.71734 52.03788  -21.96744 1.000 43.07442  ? 398  TRP A O     1 
ATOM   4000 C  CB    . TRP C 3  399 ? 42.54740 50.36020  -21.92899 1.000 44.02346  ? 398  TRP A CB    1 
ATOM   4001 C  CG    . TRP C 3  399 ? 41.56364 49.54987  -21.17794 1.000 45.10299  ? 398  TRP A CG    1 
ATOM   4002 C  CD1   . TRP C 3  399 ? 41.26573 49.64447  -19.85222 1.000 46.94779  ? 398  TRP A CD1   1 
ATOM   4003 C  CD2   . TRP C 3  399 ? 40.69106 48.55334  -21.71781 1.000 39.83004  ? 398  TRP A CD2   1 
ATOM   4004 N  NE1   . TRP C 3  399 ? 40.27769 48.75679  -19.52704 1.000 47.54306  ? 398  TRP A NE1   1 
ATOM   4005 C  CE2   . TRP C 3  399 ? 39.90560 48.07055  -20.65407 1.000 46.17975  ? 398  TRP A CE2   1 
ATOM   4006 C  CE3   . TRP C 3  399 ? 40.51063 48.01251  -22.99206 1.000 37.76867  ? 398  TRP A CE3   1 
ATOM   4007 C  CZ2   . TRP C 3  399 ? 38.94990 47.05982  -20.82184 1.000 48.34278  ? 398  TRP A CZ2   1 
ATOM   4008 C  CZ3   . TRP C 3  399 ? 39.55398 47.01705  -23.16680 1.000 44.00457  ? 398  TRP A CZ3   1 
ATOM   4009 C  CH2   . TRP C 3  399 ? 38.78711 46.54866  -22.08300 1.000 48.30218  ? 398  TRP A CH2   1 
ATOM   4010 N  N     . GLU C 3  400 ? 41.48205 53.30083  -21.39238 1.000 51.30860  ? 399  GLU A N     1 
ATOM   4011 C  CA    . GLU C 3  400 ? 40.67192 54.23293  -20.61015 1.000 54.56421  ? 399  GLU A CA    1 
ATOM   4012 C  C     . GLU C 3  400 ? 39.60240 54.89380  -21.47000 1.000 50.13650  ? 399  GLU A C     1 
ATOM   4013 O  O     . GLU C 3  400 ? 38.41673 54.89969  -21.11372 1.000 47.87753  ? 399  GLU A O     1 
ATOM   4014 C  CB    . GLU C 3  400 ? 41.57535 55.28879  -19.97941 1.000 61.10659  ? 399  GLU A CB    1 
ATOM   4015 C  CG    . GLU C 3  400 ? 40.87113 56.19891  -19.01882 1.000 71.46780  ? 399  GLU A CG    1 
ATOM   4016 C  CD    . GLU C 3  400 ? 40.70974 55.56952  -17.65852 1.000 81.34086  ? 399  GLU A CD    1 
ATOM   4017 O  OE1   . GLU C 3  400 ? 40.25735 56.27832  -16.72879 1.000 88.05738  ? 399  GLU A OE1   1 
ATOM   4018 O  OE2   . GLU C 3  400 ? 41.04806 54.37202  -17.51713 1.000 82.40524  ? 399  GLU A OE2   1 
ATOM   4019 N  N     . THR C 3  401 ? 40.02057 55.47492  -22.59971 1.000 47.98103  ? 400  THR A N     1 
ATOM   4020 C  CA    . THR C 3  401 ? 39.10196 56.04850  -23.58050 1.000 44.63021  ? 400  THR A CA    1 
ATOM   4021 C  C     . THR C 3  401 ? 37.99442 55.07383  -23.95916 1.000 45.06988  ? 400  THR A C     1 
ATOM   4022 O  O     . THR C 3  401 ? 36.81070 55.43859  -23.98080 1.000 40.86224  ? 400  THR A O     1 
ATOM   4023 C  CB    . THR C 3  401 ? 39.87816 56.44781  -24.83709 1.000 44.37179  ? 400  THR A CB    1 
ATOM   4024 O  OG1   . THR C 3  401 ? 40.84064 57.45836  -24.51566 1.000 49.55574  ? 400  THR A OG1   1 
ATOM   4025 C  CG2   . THR C 3  401 ? 38.93111 56.95035  -25.93054 1.000 34.24611  ? 400  THR A CG2   1 
ATOM   4026 N  N     . TRP C 3  402 ? 38.36891 53.82696  -24.29088 1.000 42.94384  ? 401  TRP A N     1 
ATOM   4027 C  CA    . TRP C 3  402 ? 37.37803 52.87052  -24.77434 1.000 35.54177  ? 401  TRP A CA    1 
ATOM   4028 C  C     . TRP C 3  402 ? 36.38327 52.51719  -23.68295 1.000 36.99892  ? 401  TRP A C     1 
ATOM   4029 O  O     . TRP C 3  402 ? 35.16982 52.48290  -23.92246 1.000 34.79169  ? 401  TRP A O     1 
ATOM   4030 C  CB    . TRP C 3  402 ? 38.06769 51.61596  -25.29421 1.000 35.76134  ? 401  TRP A CB    1 
ATOM   4031 C  CG    . TRP C 3  402 ? 37.13445 50.45433  -25.56985 1.000 38.07004  ? 401  TRP A CG    1 
ATOM   4032 C  CD1   . TRP C 3  402 ? 37.01157 49.30749  -24.82791 1.000 36.60866  ? 401  TRP A CD1   1 
ATOM   4033 C  CD2   . TRP C 3  402 ? 36.20989 50.32369  -26.66527 1.000 36.40880  ? 401  TRP A CD2   1 
ATOM   4034 N  NE1   . TRP C 3  402 ? 36.07601 48.47704  -25.39307 1.000 36.82268  ? 401  TRP A NE1   1 
ATOM   4035 C  CE2   . TRP C 3  402 ? 35.56978 49.06831  -26.52191 1.000 34.70249  ? 401  TRP A CE2   1 
ATOM   4036 C  CE3   . TRP C 3  402 ? 35.86202 51.14455  -27.75231 1.000 35.39545  ? 401  TRP A CE3   1 
ATOM   4037 C  CZ2   . TRP C 3  402 ? 34.60245 48.60857  -27.42729 1.000 33.34890  ? 401  TRP A CZ2   1 
ATOM   4038 C  CZ3   . TRP C 3  402 ? 34.90107 50.69065  -28.65342 1.000 35.73198  ? 401  TRP A CZ3   1 
ATOM   4039 C  CH2   . TRP C 3  402 ? 34.27616 49.43188  -28.47962 1.000 35.00909  ? 401  TRP A CH2   1 
ATOM   4040 N  N     . TRP C 3  403 ? 36.88160 52.25433  -22.47418 1.000 42.80082  ? 402  TRP A N     1 
ATOM   4041 C  CA    . TRP C 3  403 ? 36.01108 51.84257  -21.37839 1.000 52.16896  ? 402  TRP A CA    1 
ATOM   4042 C  C     . TRP C 3  403 ? 35.11655 52.98770  -20.93026 1.000 57.06703  ? 402  TRP A C     1 
ATOM   4043 O  O     . TRP C 3  403 ? 34.01525 52.75386  -20.41956 1.000 59.84862  ? 402  TRP A O     1 
ATOM   4044 C  CB    . TRP C 3  403 ? 36.86503 51.30285  -20.22435 1.000 59.10266  ? 402  TRP A CB    1 
ATOM   4045 C  CG    . TRP C 3  403 ? 36.26349 51.39867  -18.85755 1.000 64.65083  ? 402  TRP A CG    1 
ATOM   4046 C  CD1   . TRP C 3  403 ? 35.66087 50.39789  -18.15300 1.000 67.51692  ? 402  TRP A CD1   1 
ATOM   4047 C  CD2   . TRP C 3  403 ? 36.22981 52.55769  -18.01597 1.000 67.50918  ? 402  TRP A CD2   1 
ATOM   4048 N  NE1   . TRP C 3  403 ? 35.24237 50.86553  -16.92882 1.000 67.24601  ? 402  TRP A NE1   1 
ATOM   4049 C  CE2   . TRP C 3  403 ? 35.58125 52.18843  -16.82151 1.000 67.96080  ? 402  TRP A CE2   1 
ATOM   4050 C  CE3   . TRP C 3  403 ? 36.67119 53.87885  -18.16516 1.000 68.58324  ? 402  TRP A CE3   1 
ATOM   4051 C  CZ2   . TRP C 3  403 ? 35.36991 53.08838  -15.78088 1.000 70.48217  ? 402  TRP A CZ2   1 
ATOM   4052 C  CZ3   . TRP C 3  403 ? 36.46010 54.77036  -17.13378 1.000 68.67471  ? 402  TRP A CZ3   1 
ATOM   4053 C  CH2   . TRP C 3  403 ? 35.81631 54.37136  -15.95501 1.000 71.73665  ? 402  TRP A CH2   1 
ATOM   4054 N  N     . THR C 3  404 ? 35.56874 54.22584  -21.12039 1.000 58.89612  ? 403  THR A N     1 
ATOM   4055 C  CA    . THR C 3  404 ? 34.71445 55.38044  -20.86974 1.000 60.22759  ? 403  THR A CA    1 
ATOM   4056 C  C     . THR C 3  404 ? 33.62369 55.48457  -21.92778 1.000 62.53247  ? 403  THR A C     1 
ATOM   4057 O  O     . THR C 3  404 ? 32.43378 55.57738  -21.60227 1.000 67.27840  ? 403  THR A O     1 
ATOM   4058 C  CB    . THR C 3  404 ? 35.56816 56.65453  -20.84084 1.000 59.38435  ? 403  THR A CB    1 
ATOM   4059 O  OG1   . THR C 3  404 ? 36.62870 56.50025  -19.88959 1.000 56.34702  ? 403  THR A OG1   1 
ATOM   4060 C  CG2   . THR C 3  404 ? 34.73387 57.86685  -20.46376 1.000 59.73926  ? 403  THR A CG2   1 
ATOM   4061 N  N     . GLU C 3  405 ? 34.01905 55.44856  -23.20533 1.000 61.18825  ? 404  GLU A N     1 
ATOM   4062 C  CA    . GLU C 3  405 ? 33.07872 55.60811  -24.31147 1.000 58.28028  ? 404  GLU A CA    1 
ATOM   4063 C  C     . GLU C 3  405 ? 32.12973 54.41940  -24.43749 1.000 58.44819  ? 404  GLU A C     1 
ATOM   4064 O  O     . GLU C 3  405 ? 30.92937 54.60839  -24.66098 1.000 60.65427  ? 404  GLU A O     1 
ATOM   4065 C  CB    . GLU C 3  405 ? 33.84827 55.80707  -25.62049 1.000 59.57679  ? 404  GLU A CB    1 
ATOM   4066 N  N     . TYR C 3  406 ? 32.64368 53.19270  -24.31288 1.000 56.18547  ? 405  TYR A N     1 
ATOM   4067 C  CA    . TYR C 3  406 ? 31.85947 52.00788  -24.65127 1.000 52.92358  ? 405  TYR A CA    1 
ATOM   4068 C  C     . TYR C 3  406 ? 30.67978 51.84050  -23.70598 1.000 53.97923  ? 405  TYR A C     1 
ATOM   4069 O  O     . TYR C 3  406 ? 30.84032 51.85599  -22.48224 1.000 53.48126  ? 405  TYR A O     1 
ATOM   4070 C  CB    . TYR C 3  406 ? 32.72917 50.75362  -24.60738 1.000 50.73335  ? 405  TYR A CB    1 
ATOM   4071 C  CG    . TYR C 3  406 ? 32.12381 49.58989  -25.35113 1.000 51.70933  ? 405  TYR A CG    1 
ATOM   4072 C  CD1   . TYR C 3  406 ? 31.50092 49.78087  -26.57777 1.000 49.99502  ? 405  TYR A CD1   1 
ATOM   4073 C  CD2   . TYR C 3  406 ? 32.17552 48.29739  -24.83735 1.000 53.20457  ? 405  TYR A CD2   1 
ATOM   4074 C  CE1   . TYR C 3  406 ? 30.94653 48.72787  -27.26749 1.000 46.86471  ? 405  TYR A CE1   1 
ATOM   4075 C  CE2   . TYR C 3  406 ? 31.62431 47.23714  -25.53162 1.000 48.09513  ? 405  TYR A CE2   1 
ATOM   4076 C  CZ    . TYR C 3  406 ? 31.01413 47.46536  -26.74357 1.000 48.19713  ? 405  TYR A CZ    1 
ATOM   4077 O  OH    . TYR C 3  406 ? 30.46626 46.42611  -27.44760 1.000 59.00043  ? 405  TYR A OH    1 
ATOM   4078 N  N     . TRP C 3  407 ? 29.49451 51.64492  -24.27322 1.000 56.25119  ? 406  TRP A N     1 
ATOM   4079 C  CA    . TRP C 3  407 ? 28.29189 51.60946  -23.45304 1.000 61.49605  ? 406  TRP A CA    1 
ATOM   4080 C  C     . TRP C 3  407 ? 28.08202 50.27169  -22.74850 1.000 53.39533  ? 406  TRP A C     1 
ATOM   4081 O  O     . TRP C 3  407 ? 27.12547 50.14697  -21.97895 1.000 50.44470  ? 406  TRP A O     1 
ATOM   4082 C  CB    . TRP C 3  407 ? 27.06593 51.96328  -24.30558 1.000 70.89848  ? 406  TRP A CB    1 
ATOM   4083 C  CG    . TRP C 3  407 ? 26.78298 50.98332  -25.39375 1.000 79.47802  ? 406  TRP A CG    1 
ATOM   4084 C  CD1   . TRP C 3  407 ? 26.17664 49.76628  -25.26396 1.000 83.49952  ? 406  TRP A CD1   1 
ATOM   4085 C  CD2   . TRP C 3  407 ? 27.09122 51.13193  -26.78316 1.000 84.52390  ? 406  TRP A CD2   1 
ATOM   4086 N  NE1   . TRP C 3  407 ? 26.09974 49.14277  -26.48325 1.000 87.20163  ? 406  TRP A NE1   1 
ATOM   4087 C  CE2   . TRP C 3  407 ? 26.64956 49.96147  -27.43542 1.000 87.64786  ? 406  TRP A CE2   1 
ATOM   4088 C  CE3   . TRP C 3  407 ? 27.70561 52.13503  -27.53939 1.000 83.87300  ? 406  TRP A CE3   1 
ATOM   4089 C  CZ2   . TRP C 3  407 ? 26.79702 49.76985  -28.81073 1.000 87.01853  ? 406  TRP A CZ2   1 
ATOM   4090 C  CZ3   . TRP C 3  407 ? 27.85294 51.93871  -28.90202 1.000 84.60073  ? 406  TRP A CZ3   1 
ATOM   4091 C  CH2   . TRP C 3  407 ? 27.39630 50.76910  -29.52401 1.000 85.64777  ? 406  TRP A CH2   1 
ATOM   4092 N  N     . GLN C 3  408 ? 28.94158 49.28442  -22.98132 1.000 49.26723  ? 407  GLN A N     1 
ATOM   4093 C  CA    . GLN C 3  408 ? 28.83061 47.97213  -22.36426 1.000 49.90723  ? 407  GLN A CA    1 
ATOM   4094 C  C     . GLN C 3  408 ? 29.80762 47.81947  -21.20340 1.000 47.68680  ? 407  GLN A C     1 
ATOM   4095 O  O     . GLN C 3  408 ? 30.80886 48.52965  -21.09409 1.000 48.39486  ? 407  GLN A O     1 
ATOM   4096 C  CB    . GLN C 3  408 ? 29.09877 46.86097  -23.38222 1.000 55.95314  ? 407  GLN A CB    1 
ATOM   4097 C  CG    . GLN C 3  408 ? 28.04433 46.68058  -24.43806 1.000 61.86897  ? 407  GLN A CG    1 
ATOM   4098 C  CD    . GLN C 3  408 ? 27.62958 45.21904  -24.60198 1.000 70.44384  ? 407  GLN A CD    1 
ATOM   4099 O  OE1   . GLN C 3  408 ? 28.46834 44.30473  -24.59914 1.000 74.38858  ? 407  GLN A OE1   1 
ATOM   4100 N  NE2   . GLN C 3  408 ? 26.32626 44.99407  -24.74498 1.000 69.70895  ? 407  GLN A NE2   1 
ATOM   4101 N  N     . ALA C 3  409 ? 29.50484 46.86276  -20.33462 1.000 46.73455  ? 408  ALA A N     1 
ATOM   4102 C  CA    . ALA C 3  409 ? 30.44081 46.48363  -19.28867 1.000 46.81416  ? 408  ALA A CA    1 
ATOM   4103 C  C     . ALA C 3  409 ? 31.58333 45.69156  -19.90826 1.000 49.48952  ? 408  ALA A C     1 
ATOM   4104 O  O     . ALA C 3  409 ? 31.35719 44.68327  -20.59033 1.000 54.17961  ? 408  ALA A O     1 
ATOM   4105 C  CB    . ALA C 3  409 ? 29.73645 45.66163  -18.21441 1.000 45.41831  ? 408  ALA A CB    1 
ATOM   4106 N  N     . THR C 3  410 ? 32.80902 46.14508  -19.68077 1.000 46.56372  ? 409  THR A N     1 
ATOM   4107 C  CA    . THR C 3  410 ? 33.97248 45.48742  -20.25085 1.000 42.54385  ? 409  THR A CA    1 
ATOM   4108 C  C     . THR C 3  410 ? 35.12414 45.65346  -19.27330 1.000 45.35371  ? 409  THR A C     1 
ATOM   4109 O  O     . THR C 3  410 ? 35.23376 46.68961  -18.60866 1.000 53.60361  ? 409  THR A O     1 
ATOM   4110 C  CB    . THR C 3  410 ? 34.31225 46.06808  -21.63380 1.000 40.59654  ? 409  THR A CB    1 
ATOM   4111 O  OG1   . THR C 3  410 ? 35.29592 45.25293  -22.28342 1.000 43.40910  ? 409  THR A OG1   1 
ATOM   4112 C  CG2   . THR C 3  410 ? 34.83443 47.48719  -21.51430 1.000 40.45571  ? 409  THR A CG2   1 
ATOM   4113 N  N     . TRP C 3  411 ? 35.97194 44.63180  -19.17753 1.000 42.13650  ? 410  TRP A N     1 
ATOM   4114 C  CA    . TRP C 3  411 ? 37.03218 44.66688  -18.18237 1.000 43.87957  ? 410  TRP A CA    1 
ATOM   4115 C  C     . TRP C 3  411 ? 38.18238 43.74685  -18.57331 1.000 45.65273  ? 410  TRP A C     1 
ATOM   4116 O  O     . TRP C 3  411 ? 37.97352 42.68008  -19.15827 1.000 54.38092  ? 410  TRP A O     1 
ATOM   4117 C  CB    . TRP C 3  411 ? 36.48938 44.27678  -16.80842 1.000 44.80252  ? 410  TRP A CB    1 
ATOM   4118 C  CG    . TRP C 3  411 ? 37.51437 44.37216  -15.74067 1.000 43.89404  ? 410  TRP A CG    1 
ATOM   4119 C  CD1   . TRP C 3  411 ? 38.08313 45.51843  -15.23666 1.000 38.83064  ? 410  TRP A CD1   1 
ATOM   4120 C  CD2   . TRP C 3  411 ? 38.09796 43.27963  -15.02481 1.000 43.88394  ? 410  TRP A CD2   1 
ATOM   4121 N  NE1   . TRP C 3  411 ? 38.98344 45.19558  -14.24866 1.000 43.57982  ? 410  TRP A NE1   1 
ATOM   4122 C  CE2   . TRP C 3  411 ? 39.01424 43.83007  -14.09818 1.000 43.02291  ? 410  TRP A CE2   1 
ATOM   4123 C  CE3   . TRP C 3  411 ? 37.92840 41.89108  -15.06904 1.000 41.54993  ? 410  TRP A CE3   1 
ATOM   4124 C  CZ2   . TRP C 3  411 ? 39.76143 43.03785  -13.22892 1.000 36.79726  ? 410  TRP A CZ2   1 
ATOM   4125 C  CZ3   . TRP C 3  411 ? 38.66800 41.10570  -14.20856 1.000 38.22944  ? 410  TRP A CZ3   1 
ATOM   4126 C  CH2   . TRP C 3  411 ? 39.57809 41.68127  -13.30045 1.000 39.44607  ? 410  TRP A CH2   1 
ATOM   4127 N  N     . ILE C 3  412 ? 39.39531 44.17189  -18.22718 1.000 42.18439  ? 411  ILE A N     1 
ATOM   4128 C  CA    . ILE C 3  412 ? 40.60891 43.37672  -18.41083 1.000 44.40469  ? 411  ILE A CA    1 
ATOM   4129 C  C     . ILE C 3  412 ? 41.30324 43.24884  -17.06125 1.000 42.46783  ? 411  ILE A C     1 
ATOM   4130 O  O     . ILE C 3  412 ? 41.43394 44.24508  -16.33581 1.000 43.10184  ? 411  ILE A O     1 
ATOM   4131 C  CB    . ILE C 3  412 ? 41.55397 44.00475  -19.44748 1.000 50.46184  ? 411  ILE A CB    1 
ATOM   4132 C  CG1   . ILE C 3  412 ? 40.93657 43.98326  -20.84275 1.000 52.44955  ? 411  ILE A CG1   1 
ATOM   4133 C  CG2   . ILE C 3  412 ? 42.88354 43.27308  -19.47031 1.000 52.66669  ? 411  ILE A CG2   1 
ATOM   4134 C  CD1   . ILE C 3  412 ? 41.83403 44.63383  -21.88335 1.000 53.26089  ? 411  ILE A CD1   1 
ATOM   4135 N  N     . PRO C 3  413 ? 41.76318 42.06209  -16.68257 1.000 47.18511  ? 412  PRO A N     1 
ATOM   4136 C  CA    . PRO C 3  413 ? 42.41769 41.91297  -15.37541 1.000 48.08828  ? 412  PRO A CA    1 
ATOM   4137 C  C     . PRO C 3  413 ? 43.77345 42.59573  -15.33308 1.000 48.86491  ? 412  PRO A C     1 
ATOM   4138 O  O     . PRO C 3  413 ? 44.13864 43.31714  -16.27126 1.000 48.38704  ? 412  PRO A O     1 
ATOM   4139 C  CB    . PRO C 3  413 ? 42.52570 40.38891  -15.19739 1.000 50.50009  ? 412  PRO A CB    1 
ATOM   4140 C  CG    . PRO C 3  413 ? 42.37108 39.80416  -16.57574 1.000 48.69201  ? 412  PRO A CG    1 
ATOM   4141 C  CD    . PRO C 3  413 ? 41.51416 40.76468  -17.34064 1.000 51.50197  ? 412  PRO A CD    1 
ATOM   4142 N  N     . GLU C 3  414 ? 44.49753 42.40384  -14.22477 1.000 52.33054  ? 413  GLU A N     1 
ATOM   4143 C  CA    . GLU C 3  414 ? 45.77004 43.08177  -13.98113 1.000 55.48728  ? 413  GLU A CA    1 
ATOM   4144 C  C     . GLU C 3  414 ? 46.66304 43.01459  -15.21001 1.000 54.07113  ? 413  GLU A C     1 
ATOM   4145 O  O     . GLU C 3  414 ? 46.99741 41.92519  -15.69120 1.000 52.38987  ? 413  GLU A O     1 
ATOM   4146 C  CB    . GLU C 3  414 ? 46.47219 42.46138  -12.76400 1.000 60.46265  ? 413  GLU A CB    1 
ATOM   4147 C  CG    . GLU C 3  414 ? 48.00007 42.55691  -12.79913 1.000 69.00803  ? 413  GLU A CG    1 
ATOM   4148 C  CD    . GLU C 3  414 ? 48.62488 42.82062  -11.44167 1.000 75.67822  ? 413  GLU A CD    1 
ATOM   4149 O  OE1   . GLU C 3  414 ? 48.98917 43.98617  -11.16434 1.000 78.12580  ? 413  GLU A OE1   1 
ATOM   4150 O  OE2   . GLU C 3  414 ? 48.75298 41.86254  -10.65023 1.000 79.29550  ? 413  GLU A OE2   1 
ATOM   4151 N  N     . TRP C 3  415 ? 47.02414 44.18050  -15.74464 1.000 51.13492  ? 414  TRP A N     1 
ATOM   4152 C  CA    . TRP C 3  415 ? 47.77364 44.17049  -16.98910 1.000 50.39339  ? 414  TRP A CA    1 
ATOM   4153 C  C     . TRP C 3  415 ? 48.69119 45.37544  -17.06567 1.000 48.35630  ? 414  TRP A C     1 
ATOM   4154 O  O     . TRP C 3  415 ? 48.42078 46.42009  -16.47556 1.000 51.29451  ? 414  TRP A O     1 
ATOM   4155 C  CB    . TRP C 3  415 ? 46.84247 44.12634  -18.20082 1.000 51.54019  ? 414  TRP A CB    1 
ATOM   4156 C  CG    . TRP C 3  415 ? 46.07242 45.38381  -18.44890 1.000 49.00368  ? 414  TRP A CG    1 
ATOM   4157 C  CD1   . TRP C 3  415 ? 44.88483 45.75895  -17.87095 1.000 49.19920  ? 414  TRP A CD1   1 
ATOM   4158 C  CD2   . TRP C 3  415 ? 46.41446 46.41965  -19.36797 1.000 40.44806  ? 414  TRP A CD2   1 
ATOM   4159 N  NE1   . TRP C 3  415 ? 44.48213 46.97815  -18.36694 1.000 42.11975  ? 414  TRP A NE1   1 
ATOM   4160 C  CE2   . TRP C 3  415 ? 45.40097 47.39974  -19.29223 1.000 41.22016  ? 414  TRP A CE2   1 
ATOM   4161 C  CE3   . TRP C 3  415 ? 47.48392 46.61971  -20.23943 1.000 36.52699  ? 414  TRP A CE3   1 
ATOM   4162 C  CZ2   . TRP C 3  415 ? 45.42745 48.55567  -20.05932 1.000 41.50427  ? 414  TRP A CZ2   1 
ATOM   4163 C  CZ3   . TRP C 3  415 ? 47.50497 47.75859  -20.99832 1.000 39.30859  ? 414  TRP A CZ3   1 
ATOM   4164 C  CH2   . TRP C 3  415 ? 46.48474 48.71583  -20.90762 1.000 40.80204  ? 414  TRP A CH2   1 
ATOM   4165 N  N     . GLU C 3  416 ? 49.78660 45.20071  -17.79889 1.000 47.49823  ? 415  GLU A N     1 
ATOM   4166 C  CA    . GLU C 3  416 ? 50.82700 46.19708  -17.98518 1.000 49.69881  ? 415  GLU A CA    1 
ATOM   4167 C  C     . GLU C 3  416 ? 51.06511 46.37259  -19.47788 1.000 53.50762  ? 415  GLU A C     1 
ATOM   4168 O  O     . GLU C 3  416 ? 50.96881 45.41300  -20.24559 1.000 57.81156  ? 415  GLU A O     1 
ATOM   4169 C  CB    . GLU C 3  416 ? 52.11510 45.77532  -17.26909 1.000 54.95740  ? 415  GLU A CB    1 
ATOM   4170 C  CG    . GLU C 3  416 ? 53.40866 46.22800  -17.93137 1.000 65.86594  ? 415  GLU A CG    1 
ATOM   4171 C  CD    . GLU C 3  416 ? 54.60282 45.37128  -17.51841 1.000 81.36604  ? 415  GLU A CD    1 
ATOM   4172 O  OE1   . GLU C 3  416 ? 55.53802 45.20526  -18.34236 1.000 86.36597  ? 415  GLU A OE1   1 
ATOM   4173 O  OE2   . GLU C 3  416 ? 54.59735 44.85165  -16.37483 1.000 85.63072  ? 415  GLU A OE2   1 
ATOM   4174 N  N     . PHE C 3  417 ? 51.35178 47.60320  -19.88811 1.000 57.22197  ? 416  PHE A N     1 
ATOM   4175 C  CA    . PHE C 3  417 ? 51.51912 47.91457  -21.30031 1.000 54.37833  ? 416  PHE A CA    1 
ATOM   4176 C  C     . PHE C 3  417 ? 52.85709 47.40167  -21.80196 1.000 53.70661  ? 416  PHE A C     1 
ATOM   4177 O  O     . PHE C 3  417 ? 53.87685 47.49846  -21.11632 1.000 55.86594  ? 416  PHE A O     1 
ATOM   4178 C  CB    . PHE C 3  417 ? 51.41008 49.42534  -21.53816 1.000 54.34166  ? 416  PHE A CB    1 
ATOM   4179 C  CG    . PHE C 3  417 ? 51.96468 49.87724  -22.86399 1.000 56.59359  ? 416  PHE A CG    1 
ATOM   4180 C  CD1   . PHE C 3  417 ? 51.44090 49.40008  -24.05406 1.000 58.81925  ? 416  PHE A CD1   1 
ATOM   4181 C  CD2   . PHE C 3  417 ? 53.00160 50.79083  -22.91868 1.000 61.30517  ? 416  PHE A CD2   1 
ATOM   4182 C  CE1   . PHE C 3  417 ? 51.95324 49.80920  -25.27434 1.000 62.91183  ? 416  PHE A CE1   1 
ATOM   4183 C  CE2   . PHE C 3  417 ? 53.51625 51.20865  -24.13590 1.000 66.63181  ? 416  PHE A CE2   1 
ATOM   4184 C  CZ    . PHE C 3  417 ? 52.98582 50.71625  -25.31673 1.000 66.58774  ? 416  PHE A CZ    1 
ATOM   4185 N  N     . VAL C 3  418 ? 52.84422 46.85881  -23.01002 1.000 55.92388  ? 417  VAL A N     1 
ATOM   4186 C  CA    . VAL C 3  418 ? 54.02004 46.27952  -23.64046 1.000 59.53391  ? 417  VAL A CA    1 
ATOM   4187 C  C     . VAL C 3  418 ? 54.23652 46.99713  -24.96586 1.000 58.11648  ? 417  VAL A C     1 
ATOM   4188 O  O     . VAL C 3  418 ? 53.32671 47.07053  -25.79735 1.000 56.65265  ? 417  VAL A O     1 
ATOM   4189 C  CB    . VAL C 3  418 ? 53.85608 44.75587  -23.80906 1.000 59.85022  ? 417  VAL A CB    1 
ATOM   4190 C  CG1   . VAL C 3  418 ? 54.40053 44.27342  -25.12410 1.000 63.87029  ? 417  VAL A CG1   1 
ATOM   4191 C  CG2   . VAL C 3  418 ? 54.56348 44.04971  -22.67655 1.000 62.90533  ? 417  VAL A CG2   1 
ATOM   4192 N  N     . ASN C 3  419 ? 55.43991 47.52527  -25.16199 1.000 61.47516  ? 418  ASN A N     1 
ATOM   4193 C  CA    . ASN C 3  419 ? 55.69892 48.46713  -26.24131 1.000 71.43910  ? 418  ASN A CA    1 
ATOM   4194 C  C     . ASN C 3  419 ? 56.06112 47.78718  -27.55512 1.000 72.50445  ? 418  ASN A C     1 
ATOM   4195 O  O     . ASN C 3  419 ? 56.77289 48.37871  -28.37554 1.000 79.05713  ? 418  ASN A O     1 
ATOM   4196 C  CB    . ASN C 3  419 ? 56.79775 49.44693  -25.82835 1.000 82.92882  ? 418  ASN A CB    1 
ATOM   4197 C  CG    . ASN C 3  419 ? 56.64910 50.79714  -26.50191 1.000 89.42199  ? 418  ASN A CG    1 
ATOM   4198 O  OD1   . ASN C 3  419 ? 55.92121 50.92917  -27.48892 1.000 89.62316  ? 418  ASN A OD1   1 
ATOM   4199 N  ND2   . ASN C 3  419 ? 57.33728 51.80848  -25.97353 1.000 93.81195  ? 418  ASN A ND2   1 
ATOM   4200 N  N     . THR C 3  420 ? 55.59882 46.56132  -27.77974 1.000 69.01092  ? 419  THR A N     1 
ATOM   4201 C  CA    . THR C 3  420 ? 55.88208 45.85583  -29.02244 1.000 67.32252  ? 419  THR A CA    1 
ATOM   4202 C  C     . THR C 3  420 ? 54.77470 46.13519  -30.02836 1.000 66.15599  ? 419  THR A C     1 
ATOM   4203 O  O     . THR C 3  420 ? 53.63461 45.69308  -29.81544 1.000 68.74822  ? 419  THR A O     1 
ATOM   4204 C  CB    . THR C 3  420 ? 55.99348 44.36019  -28.77910 1.000 65.54268  ? 419  THR A CB    1 
ATOM   4205 O  OG1   . THR C 3  420 ? 54.68275 43.81300  -28.56628 1.000 59.61821  ? 419  THR A OG1   1 
ATOM   4206 C  CG2   . THR C 3  420 ? 56.87786 44.08381  -27.56809 1.000 69.52444  ? 419  THR A CG2   1 
ATOM   4207 N  N     . PRO C 3  421 ? 55.04712 46.83206  -31.12391 1.000 64.54676  ? 420  PRO A N     1 
ATOM   4208 C  CA    . PRO C 3  421 ? 54.01456 47.04401  -32.14250 1.000 60.59764  ? 420  PRO A CA    1 
ATOM   4209 C  C     . PRO C 3  421 ? 53.69857 45.74604  -32.86457 1.000 53.83125  ? 420  PRO A C     1 
ATOM   4210 O  O     . PRO C 3  421 ? 54.46240 44.77920  -32.76414 1.000 54.07914  ? 420  PRO A O     1 
ATOM   4211 C  CB    . PRO C 3  421 ? 54.65629 48.07830  -33.08005 1.000 60.50122  ? 420  PRO A CB    1 
ATOM   4212 C  CG    . PRO C 3  421 ? 56.09777 47.87974  -32.90159 1.000 62.46168  ? 420  PRO A CG    1 
ATOM   4213 C  CD    . PRO C 3  421 ? 56.29911 47.52480  -31.46142 1.000 63.57598  ? 420  PRO A CD    1 
ATOM   4214 N  N     . PRO C 3  422 ? 52.57042 45.66532  -33.59258 1.000 51.38226  ? 421  PRO A N     1 
ATOM   4215 C  CA    . PRO C 3  422 ? 51.52664 46.68178  -33.80362 1.000 49.45108  ? 421  PRO A CA    1 
ATOM   4216 C  C     . PRO C 3  422 ? 50.75744 47.02615  -32.53605 1.000 44.25594  ? 421  PRO A C     1 
ATOM   4217 O  O     . PRO C 3  422 ? 50.12350 46.15440  -31.97085 1.000 43.43192  ? 421  PRO A O     1 
ATOM   4218 C  CB    . PRO C 3  422 ? 50.58576 46.02353  -34.82808 1.000 47.51177  ? 421  PRO A CB    1 
ATOM   4219 C  CG    . PRO C 3  422 ? 51.38211 44.93175  -35.44164 1.000 50.18963  ? 421  PRO A CG    1 
ATOM   4220 C  CD    . PRO C 3  422 ? 52.30772 44.44675  -34.37639 1.000 47.80370  ? 421  PRO A CD    1 
ATOM   4221 N  N     . LEU C 3  423 ? 50.81869 48.27966  -32.10029 1.000 47.43587  ? 422  LEU A N     1 
ATOM   4222 C  CA    . LEU C 3  423 ? 50.00451 48.70501  -30.97188 1.000 47.13396  ? 422  LEU A CA    1 
ATOM   4223 C  C     . LEU C 3  423 ? 48.52761 48.70157  -31.34877 1.000 47.28288  ? 422  LEU A C     1 
ATOM   4224 O  O     . LEU C 3  423 ? 48.14460 49.05838  -32.46590 1.000 50.83263  ? 422  LEU A O     1 
ATOM   4225 C  CB    . LEU C 3  423 ? 50.41862 50.09817  -30.49019 1.000 46.24718  ? 422  LEU A CB    1 
ATOM   4226 C  CG    . LEU C 3  423 ? 51.81188 50.26851  -29.88356 1.000 44.80971  ? 422  LEU A CG    1 
ATOM   4227 C  CD1   . LEU C 3  423 ? 51.87859 51.58788  -29.17285 1.000 42.62571  ? 422  LEU A CD1   1 
ATOM   4228 C  CD2   . LEU C 3  423 ? 52.15095 49.12518  -28.92594 1.000 49.02324  ? 422  LEU A CD2   1 
ATOM   4229 N  N     . VAL C 3  424 ? 47.70471 48.27651  -30.40847 1.000 44.85219  ? 423  VAL A N     1 
ATOM   4230 C  CA    . VAL C 3  424 ? 46.26358 48.25119  -30.58933 1.000 45.60337  ? 423  VAL A CA    1 
ATOM   4231 C  C     . VAL C 3  424 ? 45.72820 49.63382  -30.26291 1.000 49.35234  ? 423  VAL A C     1 
ATOM   4232 O  O     . VAL C 3  424 ? 46.02997 50.19068  -29.20004 1.000 50.79651  ? 423  VAL A O     1 
ATOM   4233 C  CB    . VAL C 3  424 ? 45.63106 47.17704  -29.68789 1.000 44.36396  ? 423  VAL A CB    1 
ATOM   4234 C  CG1   . VAL C 3  424 ? 44.13163 47.12427  -29.88044 1.000 44.15131  ? 423  VAL A CG1   1 
ATOM   4235 C  CG2   . VAL C 3  424 ? 46.27838 45.82376  -29.95029 1.000 40.69715  ? 423  VAL A CG2   1 
ATOM   4236 N  N     . LYS C 3  425 ? 44.94695 50.20050  -31.17791 1.000 50.52142  ? 424  LYS A N     1 
ATOM   4237 C  CA    . LYS C 3  425 ? 44.44294 51.55018  -30.98257 1.000 49.03739  ? 424  LYS A CA    1 
ATOM   4238 C  C     . LYS C 3  425 ? 43.05711 51.66666  -31.59140 1.000 45.84812  ? 424  LYS A C     1 
ATOM   4239 O  O     . LYS C 3  425 ? 42.67194 50.88909  -32.46238 1.000 47.89138  ? 424  LYS A O     1 
ATOM   4240 C  CB    . LYS C 3  425 ? 45.38836 52.59713  -31.59330 1.000 49.75305  ? 424  LYS A CB    1 
ATOM   4241 C  CG    . LYS C 3  425 ? 45.78496 52.28589  -33.01691 1.000 58.50029  ? 424  LYS A CG    1 
ATOM   4242 C  CD    . LYS C 3  425 ? 46.75429 53.30851  -33.59807 1.000 67.92052  ? 424  LYS A CD    1 
ATOM   4243 C  CE    . LYS C 3  425 ? 46.03867 54.59009  -34.01957 1.000 75.52878  ? 424  LYS A CE    1 
ATOM   4244 N  NZ    . LYS C 3  425 ? 46.94534 55.53243  -34.75244 1.000 80.80583  ? 424  LYS A NZ    1 
ATOM   4245 N  N     . LEU C 3  426 ? 42.30449 52.64024  -31.09558 1.000 46.27865  ? 425  LEU A N     1 
ATOM   4246 C  CA    . LEU C 3  426 ? 41.09747 53.10486  -31.75964 1.000 41.67356  ? 425  LEU A CA    1 
ATOM   4247 C  C     . LEU C 3  426 ? 41.47871 54.02418  -32.91554 1.000 38.37567  ? 425  LEU A C     1 
ATOM   4248 O  O     . LEU C 3  426 ? 42.36310 54.87383  -32.78931 1.000 38.81812  ? 425  LEU A O     1 
ATOM   4249 C  CB    . LEU C 3  426 ? 40.21298 53.83984  -30.75874 1.000 44.72174  ? 425  LEU A CB    1 
ATOM   4250 C  CG    . LEU C 3  426 ? 39.89370 52.99406  -29.52205 1.000 43.43648  ? 425  LEU A CG    1 
ATOM   4251 C  CD1   . LEU C 3  426 ? 39.35402 53.86400  -28.36613 1.000 41.52593  ? 425  LEU A CD1   1 
ATOM   4252 C  CD2   . LEU C 3  426 ? 38.91453 51.89832  -29.90465 1.000 36.24206  ? 425  LEU A CD2   1 
ATOM   4253 N  N     . TRP C 3  427 ? 40.83447 53.83939  -34.05862 1.000 39.48697  ? 426  TRP A N     1 
ATOM   4254 C  CA    . TRP C 3  427 ? 41.29105 54.55042  -35.24371 1.000 41.68624  ? 426  TRP A CA    1 
ATOM   4255 C  C     . TRP C 3  427 ? 40.54488 55.84874  -35.48204 1.000 40.81366  ? 426  TRP A C     1 
ATOM   4256 O  O     . TRP C 3  427 ? 41.03165 56.69094  -36.23919 1.000 41.73434  ? 426  TRP A O     1 
ATOM   4257 C  CB    . TRP C 3  427 ? 41.20295 53.63360  -36.46671 1.000 44.70648  ? 426  TRP A CB    1 
ATOM   4258 C  CG    . TRP C 3  427 ? 42.23819 52.54743  -36.36988 1.000 50.62601  ? 426  TRP A CG    1 
ATOM   4259 C  CD1   . TRP C 3  427 ? 42.05151 51.27059  -35.92345 1.000 46.55613  ? 426  TRP A CD1   1 
ATOM   4260 C  CD2   . TRP C 3  427 ? 43.63503 52.66944  -36.66177 1.000 58.70030  ? 426  TRP A CD2   1 
ATOM   4261 N  NE1   . TRP C 3  427 ? 43.23866 50.58390  -35.94293 1.000 51.31691  ? 426  TRP A NE1   1 
ATOM   4262 C  CE2   . TRP C 3  427 ? 44.22777 51.41850  -36.39253 1.000 60.20301  ? 426  TRP A CE2   1 
ATOM   4263 C  CE3   . TRP C 3  427 ? 44.44103 53.71328  -37.12927 1.000 62.83514  ? 426  TRP A CE3   1 
ATOM   4264 C  CZ2   . TRP C 3  427 ? 45.59020 51.18146  -36.58051 1.000 66.83225  ? 426  TRP A CZ2   1 
ATOM   4265 C  CZ3   . TRP C 3  427 ? 45.78883 53.48001  -37.31595 1.000 66.24794  ? 426  TRP A CZ3   1 
ATOM   4266 C  CH2   . TRP C 3  427 ? 46.35173 52.22495  -37.04098 1.000 69.88953  ? 426  TRP A CH2   1 
ATOM   4267 N  N     . TYR C 3  428 ? 39.39415 56.03604  -34.84461 1.000 38.23644  ? 427  TYR A N     1 
ATOM   4268 C  CA    . TYR C 3  428 ? 38.71713 57.32243  -34.84566 1.000 36.05091  ? 427  TYR A CA    1 
ATOM   4269 C  C     . TYR C 3  428 ? 37.88537 57.41068  -33.58193 1.000 41.42419  ? 427  TYR A C     1 
ATOM   4270 O  O     . TYR C 3  428 ? 37.62186 56.41115  -32.91785 1.000 44.58214  ? 427  TYR A O     1 
ATOM   4271 C  CB    . TYR C 3  428 ? 37.82698 57.50203  -36.07145 1.000 30.86587  ? 427  TYR A CB    1 
ATOM   4272 C  CG    . TYR C 3  428 ? 36.81735 56.39161  -36.21098 1.000 34.59036  ? 427  TYR A CG    1 
ATOM   4273 C  CD1   . TYR C 3  428 ? 37.08740 55.28236  -36.99247 1.000 36.59153  ? 427  TYR A CD1   1 
ATOM   4274 C  CD2   . TYR C 3  428 ? 35.60185 56.44493  -35.54563 1.000 36.12326  ? 427  TYR A CD2   1 
ATOM   4275 C  CE1   . TYR C 3  428 ? 36.17321 54.27072  -37.11340 1.000 42.18653  ? 427  TYR A CE1   1 
ATOM   4276 C  CE2   . TYR C 3  428 ? 34.68370 55.43856  -35.65771 1.000 35.78589  ? 427  TYR A CE2   1 
ATOM   4277 C  CZ    . TYR C 3  428 ? 34.97043 54.35385  -36.44224 1.000 39.75713  ? 427  TYR A CZ    1 
ATOM   4278 O  OH    . TYR C 3  428 ? 34.05414 53.33909  -36.55993 1.000 38.37521  ? 427  TYR A OH    1 
ATOM   4279 N  N     . GLN C 3  429 ? 37.44093 58.61947  -33.27507 1.000 47.77060  ? 428  GLN A N     1 
ATOM   4280 C  CA    . GLN C 3  429 ? 36.63544 58.86347  -32.09059 1.000 49.72715  ? 428  GLN A CA    1 
ATOM   4281 C  C     . GLN C 3  429 ? 35.50158 59.80320  -32.47361 1.000 46.42639  ? 428  GLN A C     1 
ATOM   4282 O  O     . GLN C 3  429 ? 35.74856 60.86526  -33.05194 1.000 51.06308  ? 428  GLN A O     1 
ATOM   4283 C  CB    . GLN C 3  429 ? 37.49206 59.45493  -30.96693 1.000 57.47883  ? 428  GLN A CB    1 
ATOM   4284 C  CG    . GLN C 3  429 ? 36.69740 59.84395  -29.73563 1.000 69.00927  ? 428  GLN A CG    1 
ATOM   4285 C  CD    . GLN C 3  429 ? 37.21146 59.18526  -28.47385 1.000 73.00560  ? 428  GLN A CD    1 
ATOM   4286 O  OE1   . GLN C 3  429 ? 36.65591 58.17739  -28.00207 1.000 72.16758  ? 428  GLN A OE1   1 
ATOM   4287 N  NE2   . GLN C 3  429 ? 38.27957 59.75198  -27.91413 1.000 71.71124  ? 428  GLN A NE2   1 
ATOM   4288 N  N     . LEU C 3  430 ? 34.26411 59.39906  -32.18633 1.000 39.35733  ? 429  LEU A N     1 
ATOM   4289 C  CA    . LEU C 3  430 ? 33.12893 60.28844  -32.37212 1.000 37.47482  ? 429  LEU A CA    1 
ATOM   4290 C  C     . LEU C 3  430 ? 33.17158 61.42724  -31.35796 1.000 39.79169  ? 429  LEU A C     1 
ATOM   4291 O  O     . LEU C 3  430 ? 33.57092 61.24182  -30.20467 1.000 43.91441  ? 429  LEU A O     1 
ATOM   4292 C  CB    . LEU C 3  430 ? 31.81385 59.52141  -32.23282 1.000 34.27117  ? 429  LEU A CB    1 
ATOM   4293 C  CG    . LEU C 3  430 ? 31.53983 58.43660  -33.27422 1.000 37.49892  ? 429  LEU A CG    1 
ATOM   4294 C  CD1   . LEU C 3  430 ? 30.07957 58.05017  -33.22675 1.000 39.20843  ? 429  LEU A CD1   1 
ATOM   4295 C  CD2   . LEU C 3  430 ? 31.94674 58.87863  -34.68160 1.000 38.77655  ? 429  LEU A CD2   1 
ATOM   4296 N  N     . GLU C 3  431 ? 32.75450 62.61042  -31.79095 1.000 36.78405  ? 430  GLU A N     1 
ATOM   4297 C  CA    . GLU C 3  431 ? 32.65081 63.73659  -30.87163 1.000 36.49383  ? 430  GLU A CA    1 
ATOM   4298 C  C     . GLU C 3  431 ? 31.49649 63.53181  -29.90069 1.000 34.13652  ? 430  GLU A C     1 
ATOM   4299 O  O     . GLU C 3  431 ? 30.47353 62.93308  -30.23913 1.000 32.57725  ? 430  GLU A O     1 
ATOM   4300 C  CB    . GLU C 3  431 ? 32.43871 65.04327  -31.63649 1.000 33.73372  ? 430  GLU A CB    1 
ATOM   4301 C  CG    . GLU C 3  431 ? 33.58863 65.43387  -32.54293 1.000 37.54546  ? 430  GLU A CG    1 
ATOM   4302 C  CD    . GLU C 3  431 ? 34.89709 65.58866  -31.79701 1.000 49.50523  ? 430  GLU A CD    1 
ATOM   4303 O  OE1   . GLU C 3  431 ? 35.91041 65.01930  -32.25074 1.000 55.98176  ? 430  GLU A OE1   1 
ATOM   4304 O  OE2   . GLU C 3  431 ? 34.91677 66.27636  -30.75614 1.000 56.82237  ? 430  GLU A OE2   1 
ATOM   4305 N  N     . LYS C 3  432 ? 31.65715 64.05596  -28.68570 1.000 36.59412  ? 431  LYS A N     1 
ATOM   4306 C  CA    . LYS C 3  432 ? 30.53444 64.08155  -27.74907 1.000 44.89262  ? 431  LYS A CA    1 
ATOM   4307 C  C     . LYS C 3  432 ? 29.57125 65.24935  -27.98997 1.000 42.53524  ? 431  LYS A C     1 
ATOM   4308 O  O     . LYS C 3  432 ? 28.40000 65.14768  -27.61594 1.000 43.77218  ? 431  LYS A O     1 
ATOM   4309 C  CB    . LYS C 3  432 ? 31.03460 64.12572  -26.29824 1.000 53.14833  ? 431  LYS A CB    1 
ATOM   4310 C  CG    . LYS C 3  432 ? 31.67843 62.82613  -25.80332 1.000 61.68813  ? 431  LYS A CG    1 
ATOM   4311 C  CD    . LYS C 3  432 ? 32.07274 62.92703  -24.32384 1.000 69.94785  ? 431  LYS A CD    1 
ATOM   4312 C  CE    . LYS C 3  432 ? 32.77769 61.66275  -23.81767 1.000 70.50010  ? 431  LYS A CE    1 
ATOM   4313 N  NZ    . LYS C 3  432 ? 33.31795 61.81111  -22.42628 1.000 69.87234  ? 431  LYS A NZ    1 
ATOM   4314 N  N     . GLU C 3  433 ? 30.01317 66.33655  -28.60730 1.000 37.92642  ? 432  GLU A N     1 
ATOM   4315 C  CA    . GLU C 3  433 ? 29.16381 67.49230  -28.85330 1.000 39.83736  ? 432  GLU A CA    1 
ATOM   4316 C  C     . GLU C 3  433 ? 29.19847 67.87085  -30.32629 1.000 37.09742  ? 432  GLU A C     1 
ATOM   4317 O  O     . GLU C 3  433 ? 30.14859 67.52992  -31.03514 1.000 39.44458  ? 432  GLU A O     1 
ATOM   4318 C  CB    . GLU C 3  433 ? 29.60686 68.68343  -27.98976 1.000 39.62427  ? 432  GLU A CB    1 
ATOM   4319 C  CG    . GLU C 3  433 ? 29.55210 68.41030  -26.49186 1.000 45.89427  ? 432  GLU A CG    1 
ATOM   4320 C  CD    . GLU C 3  433 ? 28.13163 68.36204  -25.92666 1.000 59.12344  ? 432  GLU A CD    1 
ATOM   4321 O  OE1   . GLU C 3  433 ? 27.15808 68.60918  -26.67624 1.000 62.43326  ? 432  GLU A OE1   1 
ATOM   4322 O  OE2   . GLU C 3  433 ? 27.98799 68.08982  -24.71107 1.000 66.31425  ? 432  GLU A OE2   1 
ATOM   4323 N  N     . PRO C 3  434 ? 28.17021 68.55958  -30.82760 1.000 33.21321  ? 433  PRO A N     1 
ATOM   4324 C  CA    . PRO C 3  434 ? 28.20754 68.98768  -32.23294 1.000 33.28801  ? 433  PRO A CA    1 
ATOM   4325 C  C     . PRO C 3  434 ? 29.33563 69.98937  -32.46161 1.000 38.77413  ? 433  PRO A C     1 
ATOM   4326 O  O     . PRO C 3  434 ? 29.75732 70.70535  -31.55073 1.000 41.35226  ? 433  PRO A O     1 
ATOM   4327 C  CB    . PRO C 3  434 ? 26.82593 69.62446  -32.45216 1.000 32.58362  ? 433  PRO A CB    1 
ATOM   4328 C  CG    . PRO C 3  434 ? 26.38833 70.07383  -31.09115 1.000 31.31343  ? 433  PRO A CG    1 
ATOM   4329 C  CD    . PRO C 3  434 ? 26.96340 69.05687  -30.13173 1.000 35.08685  ? 433  PRO A CD    1 
ATOM   4330 N  N     . ILE C 3  435 ? 29.83714 70.02864  -33.69057 1.000 32.20027  ? 434  ILE A N     1 
ATOM   4331 C  CA    . ILE C 3  435 ? 31.03568 70.79189  -34.02326 1.000 32.59427  ? 434  ILE A CA    1 
ATOM   4332 C  C     . ILE C 3  435 ? 30.63025 72.16720  -34.55657 1.000 40.66372  ? 434  ILE A C     1 
ATOM   4333 O  O     . ILE C 3  435 ? 29.79548 72.27398  -35.46871 1.000 32.71018  ? 434  ILE A O     1 
ATOM   4334 C  CB    . ILE C 3  435 ? 31.90610 70.02207  -35.03170 1.000 32.22973  ? 434  ILE A CB    1 
ATOM   4335 C  CG1   . ILE C 3  435 ? 32.14542 68.58817  -34.52606 1.000 31.36622  ? 434  ILE A CG1   1 
ATOM   4336 C  CG2   . ILE C 3  435 ? 33.23606 70.72073  -35.26022 1.000 33.68811  ? 434  ILE A CG2   1 
ATOM   4337 C  CD1   . ILE C 3  435 ? 32.16988 67.52151  -35.65043 1.000 30.37906  ? 434  ILE A CD1   1 
ATOM   4338 N  N     . VAL C 3  436 ? 31.19798 73.22225  -33.96229 1.000 34.87114  ? 435  VAL A N     1 
ATOM   4339 C  CA    . VAL C 3  436 ? 31.01525 74.57480  -34.48326 1.000 40.52891  ? 435  VAL A CA    1 
ATOM   4340 C  C     . VAL C 3  436 ? 31.78481 74.71224  -35.79222 1.000 45.23912  ? 435  VAL A C     1 
ATOM   4341 O  O     . VAL C 3  436 ? 32.95976 74.32547  -35.89091 1.000 46.11911  ? 435  VAL A O     1 
ATOM   4342 C  CB    . VAL C 3  436 ? 31.47471 75.62739  -33.45757 1.000 37.62584  ? 435  VAL A CB    1 
ATOM   4343 C  CG1   . VAL C 3  436 ? 31.40002 77.04246  -34.05345 1.000 43.47142  ? 435  VAL A CG1   1 
ATOM   4344 C  CG2   . VAL C 3  436 ? 30.64559 75.55584  -32.20011 1.000 37.54989  ? 435  VAL A CG2   1 
ATOM   4345 N  N     . GLY C 3  437 ? 31.12574 75.26131  -36.80748 1.000 36.00165  ? 436  GLY A N     1 
ATOM   4346 C  CA    . GLY C 3  437 ? 31.76833 75.50430  -38.07554 1.000 36.52492  ? 436  GLY A CA    1 
ATOM   4347 C  C     . GLY C 3  437 ? 31.76705 74.33804  -39.03620 1.000 45.99373  ? 436  GLY A C     1 
ATOM   4348 O  O     . GLY C 3  437 ? 32.25193 74.48764  -40.16361 1.000 47.44752  ? 436  GLY A O     1 
ATOM   4349 N  N     . ALA C 3  438 ? 31.26372 73.17788  -38.63236 1.000 38.07272  ? 437  ALA A N     1 
ATOM   4350 C  CA    . ALA C 3  438 ? 31.18343 72.03382  -39.52317 1.000 32.85885  ? 437  ALA A CA    1 
ATOM   4351 C  C     . ALA C 3  438 ? 29.77573 71.92501  -40.08699 1.000 35.55642  ? 437  ALA A C     1 
ATOM   4352 O  O     . ALA C 3  438 ? 28.79053 72.07623  -39.35944 1.000 35.51136  ? 437  ALA A O     1 
ATOM   4353 C  CB    . ALA C 3  438 ? 31.57452 70.74978  -38.79662 1.000 32.11913  ? 437  ALA A CB    1 
ATOM   4354 N  N     . GLU C 3  439 ? 29.68807 71.68682  -41.39233 1.000 32.33609  ? 438  GLU A N     1 
ATOM   4355 C  CA    . GLU C 3  439 ? 28.39215 71.60770  -42.05907 1.000 32.19112  ? 438  GLU A CA    1 
ATOM   4356 C  C     . GLU C 3  439 ? 27.54988 70.47819  -41.46350 1.000 29.52686  ? 438  GLU A C     1 
ATOM   4357 O  O     . GLU C 3  439 ? 28.07345 69.42461  -41.07573 1.000 29.45959  ? 438  GLU A O     1 
ATOM   4358 C  CB    . GLU C 3  439 ? 28.61428 71.39516  -43.55613 1.000 35.35766  ? 438  GLU A CB    1 
ATOM   4359 C  CG    . GLU C 3  439 ? 27.39423 71.49790  -44.44633 1.000 37.74349  ? 438  GLU A CG    1 
ATOM   4360 C  CD    . GLU C 3  439 ? 27.77425 71.45745  -45.92861 1.000 39.01812  ? 438  GLU A CD    1 
ATOM   4361 O  OE1   . GLU C 3  439 ? 28.94556 71.12474  -46.24300 1.000 36.95571  ? 438  GLU A OE1   1 
ATOM   4362 O  OE2   . GLU C 3  439 ? 26.91113 71.76915  -46.77518 1.000 38.31398  ? 438  GLU A OE2   1 
ATOM   4363 N  N     . THR C 3  440 ? 26.22913 70.70410  -41.38934 1.000 29.04534  ? 439  THR A N     1 
ATOM   4364 C  CA    . THR C 3  440 ? 25.28733 69.73801  -40.81450 1.000 34.07951  ? 439  THR A CA    1 
ATOM   4365 C  C     . THR C 3  440 ? 24.52914 69.01441  -41.93054 1.000 34.89194  ? 439  THR A C     1 
ATOM   4366 O  O     . THR C 3  440 ? 23.69091 69.61875  -42.60814 1.000 35.77863  ? 439  THR A O     1 
ATOM   4367 C  CB    . THR C 3  440 ? 24.30826 70.42645  -39.86374 1.000 33.88765  ? 439  THR A CB    1 
ATOM   4368 O  OG1   . THR C 3  440 ? 25.02970 71.07498  -38.80479 1.000 35.11107  ? 439  THR A OG1   1 
ATOM   4369 C  CG2   . THR C 3  440 ? 23.32721 69.41809  -39.25845 1.000 27.43594  ? 439  THR A CG2   1 
ATOM   4370 N  N     . PHE C 3  441 ? 24.82269 67.71888  -42.11480 1.000 30.20035  ? 440  PHE A N     1 
ATOM   4371 C  CA    . PHE C 3  441 ? 24.11549 66.86419  -43.06626 1.000 31.64750  ? 440  PHE A CA    1 
ATOM   4372 C  C     . PHE C 3  441 ? 22.97803 66.14935  -42.35576 1.000 33.45710  ? 440  PHE A C     1 
ATOM   4373 O  O     . PHE C 3  441 ? 23.20507 65.48651  -41.34338 1.000 42.91341  ? 440  PHE A O     1 
ATOM   4374 C  CB    . PHE C 3  441 ? 25.04783 65.81440  -43.67997 1.000 26.32437  ? 440  PHE A CB    1 
ATOM   4375 C  CG    . PHE C 3  441 ? 26.04687 66.36533  -44.66874 1.000 27.14479  ? 440  PHE A CG    1 
ATOM   4376 C  CD1   . PHE C 3  441 ? 26.96067 67.34572  -44.29546 1.000 28.22998  ? 440  PHE A CD1   1 
ATOM   4377 C  CD2   . PHE C 3  441 ? 26.08803 65.88165  -45.97564 1.000 31.10121  ? 440  PHE A CD2   1 
ATOM   4378 C  CE1   . PHE C 3  441 ? 27.87443 67.85330  -45.20859 1.000 28.86770  ? 440  PHE A CE1   1 
ATOM   4379 C  CE2   . PHE C 3  441 ? 26.99423 66.38810  -46.90234 1.000 30.30514  ? 440  PHE A CE2   1 
ATOM   4380 C  CZ    . PHE C 3  441 ? 27.89919 67.36621  -46.51460 1.000 33.48067  ? 440  PHE A CZ    1 
ATOM   4381 N  N     . TYR C 3  442 ? 21.76577 66.27646  -42.87993 1.000 29.12941  ? 441  TYR A N     1 
ATOM   4382 C  CA    . TYR C 3  442 ? 20.64690 65.42919  -42.48668 1.000 29.31128  ? 441  TYR A CA    1 
ATOM   4383 C  C     . TYR C 3  442 ? 20.50127 64.33914  -43.54603 1.000 35.46429  ? 441  TYR A C     1 
ATOM   4384 O  O     . TYR C 3  442 ? 20.23872 64.63870  -44.72573 1.000 38.01008  ? 441  TYR A O     1 
ATOM   4385 C  CB    . TYR C 3  442 ? 19.36084 66.24204  -42.34852 1.000 31.21564  ? 441  TYR A CB    1 
ATOM   4386 C  CG    . TYR C 3  442 ? 19.43746 67.29449  -41.27736 1.000 31.90096  ? 441  TYR A CG    1 
ATOM   4387 C  CD1   . TYR C 3  442 ? 19.97501 68.54396  -41.53944 1.000 34.20795  ? 441  TYR A CD1   1 
ATOM   4388 C  CD2   . TYR C 3  442 ? 18.99645 67.02828  -39.99528 1.000 32.54886  ? 441  TYR A CD2   1 
ATOM   4389 C  CE1   . TYR C 3  442 ? 20.05956 69.50561  -40.54638 1.000 38.72983  ? 441  TYR A CE1   1 
ATOM   4390 C  CE2   . TYR C 3  442 ? 19.07810 67.97263  -38.99933 1.000 33.42274  ? 441  TYR A CE2   1 
ATOM   4391 C  CZ    . TYR C 3  442 ? 19.61066 69.20537  -39.27371 1.000 35.92539  ? 441  TYR A CZ    1 
ATOM   4392 O  OH    . TYR C 3  442 ? 19.67427 70.13632  -38.27532 1.000 37.91908  ? 441  TYR A OH    1 
ATOM   4393 N  N     . VAL C 3  443 ? 20.69684 63.08728  -43.13504 1.000 32.15207  ? 442  VAL A N     1 
ATOM   4394 C  CA    . VAL C 3  443 ? 20.80194 61.98395  -44.07743 1.000 35.52994  ? 442  VAL A CA    1 
ATOM   4395 C  C     . VAL C 3  443 ? 19.59956 61.07537  -43.91505 1.000 36.90478  ? 442  VAL A C     1 
ATOM   4396 O  O     . VAL C 3  443 ? 18.94217 61.04211  -42.86964 1.000 41.16300  ? 442  VAL A O     1 
ATOM   4397 C  CB    . VAL C 3  443 ? 22.10876 61.17659  -43.91073 1.000 39.70016  ? 442  VAL A CB    1 
ATOM   4398 C  CG1   . VAL C 3  443 ? 23.33378 62.09321  -44.06493 1.000 24.87809  ? 442  VAL A CG1   1 
ATOM   4399 C  CG2   . VAL C 3  443 ? 22.11447 60.43419  -42.56958 1.000 24.17742  ? 442  VAL A CG2   1 
ATOM   4400 N  N     . ASP C 3  444 ? 19.30379 60.33514  -44.97869 1.000 34.54477  ? 443  ASP A N     1 
ATOM   4401 C  CA    . ASP C 3  444 ? 18.25483 59.33450  -44.86137 1.000 35.27818  ? 443  ASP A CA    1 
ATOM   4402 C  C     . ASP C 3  444 ? 18.31632 58.39546  -46.04633 1.000 34.40009  ? 443  ASP A C     1 
ATOM   4403 O  O     . ASP C 3  444 ? 18.97558 58.66393  -47.05836 1.000 35.58819  ? 443  ASP A O     1 
ATOM   4404 C  CB    . ASP C 3  444 ? 16.85870 59.96102  -44.75366 1.000 44.11622  ? 443  ASP A CB    1 
ATOM   4405 C  CG    . ASP C 3  444 ? 15.86051 59.05148  -44.04320 1.000 48.48197  ? 443  ASP A CG    1 
ATOM   4406 O  OD1   . ASP C 3  444 ? 16.26185 57.97061  -43.55526 1.000 51.45742  ? 443  ASP A OD1   1 
ATOM   4407 O  OD2   . ASP C 3  444 ? 14.67060 59.42042  -43.97843 1.000 49.60998  ? 443  ASP A OD2   1 
ATOM   4408 N  N     . GLY C 3  445 ? 17.63490 57.26823  -45.88081 1.000 34.51930  ? 444  GLY A N     1 
ATOM   4409 C  CA    . GLY C 3  445 ? 17.49643 56.26656  -46.91112 1.000 31.15447  ? 444  GLY A CA    1 
ATOM   4410 C  C     . GLY C 3  445 ? 16.11932 55.65547  -46.83354 1.000 35.84916  ? 444  GLY A C     1 
ATOM   4411 O  O     . GLY C 3  445 ? 15.57146 55.48333  -45.73812 1.000 41.57880  ? 444  GLY A O     1 
ATOM   4412 N  N     . ALA C 3  446 ? 15.53803 55.36052  -47.99133 1.000 34.20915  ? 445  ALA A N     1 
ATOM   4413 C  CA    . ALA C 3  446 ? 14.31614 54.57869  -48.08059 1.000 32.37402  ? 445  ALA A CA    1 
ATOM   4414 C  C     . ALA C 3  446 ? 14.54186 53.46611  -49.08740 1.000 40.89392  ? 445  ALA A C     1 
ATOM   4415 O  O     . ALA C 3  446 ? 15.34460 53.60602  -50.01528 1.000 40.56572  ? 445  ALA A O     1 
ATOM   4416 C  CB    . ALA C 3  446 ? 13.11633 55.42433  -48.49943 1.000 30.57018  ? 445  ALA A CB    1 
ATOM   4417 N  N     . ALA C 3  447 ? 13.85304 52.34516  -48.88085 1.000 44.53629  ? 446  ALA A N     1 
ATOM   4418 C  CA    . ALA C 3  447 ? 13.94051 51.21236  -49.79185 1.000 42.72129  ? 446  ALA A CA    1 
ATOM   4419 C  C     . ALA C 3  447 ? 12.57040 50.56859  -49.92386 1.000 47.40789  ? 446  ALA A C     1 
ATOM   4420 O  O     . ALA C 3  447 ? 11.83891 50.43420  -48.94158 1.000 51.81043  ? 446  ALA A O     1 
ATOM   4421 C  CB    . ALA C 3  447 ? 14.97157 50.18011  -49.31474 1.000 34.27900  ? 446  ALA A CB    1 
ATOM   4422 N  N     . ASN C 3  448 ? 12.22274 50.18876  -51.14141 1.000 50.92533  ? 447  ASN A N     1 
ATOM   4423 C  CA    . ASN C 3  448 ? 10.94773 49.54439  -51.41691 1.000 55.43702  ? 447  ASN A CA    1 
ATOM   4424 C  C     . ASN C 3  448 ? 11.10957 48.04423  -51.22235 1.000 52.87628  ? 447  ASN A C     1 
ATOM   4425 O  O     . ASN C 3  448 ? 11.97239 47.43205  -51.85146 1.000 51.00317  ? 447  ASN A O     1 
ATOM   4426 C  CB    . ASN C 3  448 ? 10.49026 49.86372  -52.83959 1.000 59.61805  ? 447  ASN A CB    1 
ATOM   4427 C  CG    . ASN C 3  448 ? 9.17228  49.21671  -53.17858 1.000 64.26730  ? 447  ASN A CG    1 
ATOM   4428 O  OD1   . ASN C 3  448 ? 9.10990  48.01617  -53.45021 1.000 65.78913  ? 447  ASN A OD1   1 
ATOM   4429 N  ND2   . ASN C 3  448 ? 8.10422  50.00552  -53.15853 1.000 66.15552  ? 447  ASN A ND2   1 
ATOM   4430 N  N     . ARG C 3  449 ? 10.28418 47.45212  -50.35544 1.000 57.67567  ? 448  ARG A N     1 
ATOM   4431 C  CA    . ARG C 3  449 ? 10.45232 46.03360  -50.04265 1.000 60.46167  ? 448  ARG A CA    1 
ATOM   4432 C  C     . ARG C 3  449 ? 10.03007 45.14863  -51.20847 1.000 58.85389  ? 448  ARG A C     1 
ATOM   4433 O  O     . ARG C 3  449 ? 10.52744 44.02465  -51.34255 1.000 62.70787  ? 448  ARG A O     1 
ATOM   4434 C  CB    . ARG C 3  449 ? 9.66807  45.65685  -48.77952 1.000 70.98915  ? 448  ARG A CB    1 
ATOM   4435 C  CG    . ARG C 3  449 ? 8.14493  45.72160  -48.94398 1.000 86.30432  ? 448  ARG A CG    1 
ATOM   4436 C  CD    . ARG C 3  449 ? 7.37603  45.18944  -47.72559 1.000 94.72708  ? 448  ARG A CD    1 
ATOM   4437 N  NE    . ARG C 3  449 ? 7.92645  45.68519  -46.46743 1.000 96.21717  ? 448  ARG A NE    1 
ATOM   4438 C  CZ    . ARG C 3  449 ? 8.51961  44.91023  -45.56941 1.000 92.61605  ? 448  ARG A CZ    1 
ATOM   4439 N  NH1   . ARG C 3  449 ? 8.61337  43.61180  -45.79400 1.000 91.86944  ? 448  ARG A NH1   1 
ATOM   4440 N  NH2   . ARG C 3  449 ? 9.00445  45.42727  -44.45017 1.000 88.87599  ? 448  ARG A NH2   1 
ATOM   4441 N  N     . GLU C 3  450 ? 9.12984  45.62730  -52.06598 1.000 58.89579  ? 449  GLU A N     1 
ATOM   4442 C  CA    . GLU C 3  450 ? 8.70607  44.80391  -53.19059 1.000 61.18806  ? 449  GLU A CA    1 
ATOM   4443 C  C     . GLU C 3  450 ? 9.77744  44.77966  -54.27804 1.000 64.96648  ? 449  GLU A C     1 
ATOM   4444 O  O     . GLU C 3  450 ? 10.30901 43.71286  -54.61388 1.000 63.13106  ? 449  GLU A O     1 
ATOM   4445 C  CB    . GLU C 3  450 ? 7.36461  45.29977  -53.73732 1.000 57.00038  ? 449  GLU A CB    1 
ATOM   4446 N  N     . THR C 3  451 ? 10.13598 45.95816  -54.81281 1.000 63.47609  ? 450  THR A N     1 
ATOM   4447 C  CA    . THR C 3  451 ? 11.06153 46.05504  -55.94222 1.000 60.17972  ? 450  THR A CA    1 
ATOM   4448 C  C     . THR C 3  451 ? 12.52942 46.02446  -55.53149 1.000 54.84180  ? 450  THR A C     1 
ATOM   4449 O  O     . THR C 3  451 ? 13.39296 45.85121  -56.40003 1.000 53.94839  ? 450  THR A O     1 
ATOM   4450 C  CB    . THR C 3  451 ? 10.80960 47.34142  -56.74699 1.000 61.16379  ? 450  THR A CB    1 
ATOM   4451 O  OG1   . THR C 3  451 ? 11.17472 48.49080  -55.96580 1.000 61.48207  ? 450  THR A OG1   1 
ATOM   4452 C  CG2   . THR C 3  451 ? 9.35006  47.45297  -57.14782 1.000 60.43983  ? 450  THR A CG2   1 
ATOM   4453 N  N     . LYS C 3  452 ? 12.83155 46.20301  -54.24898 1.000 50.80658  ? 451  LYS A N     1 
ATOM   4454 C  CA    . LYS C 3  452 ? 14.19081 46.34025  -53.73561 1.000 50.16774  ? 451  LYS A CA    1 
ATOM   4455 C  C     . LYS C 3  452 ? 14.90166 47.59687  -54.24829 1.000 49.49306  ? 451  LYS A C     1 
ATOM   4456 O  O     . LYS C 3  452 ? 16.09746 47.77215  -53.99138 1.000 48.20491  ? 451  LYS A O     1 
ATOM   4457 C  CB    . LYS C 3  452 ? 15.02619 45.09064  -54.03919 1.000 52.34871  ? 451  LYS A CB    1 
ATOM   4458 C  CG    . LYS C 3  452 ? 14.39237 43.79209  -53.53669 1.000 56.76774  ? 451  LYS A CG    1 
ATOM   4459 C  CD    . LYS C 3  452 ? 14.10159 43.85613  -52.04868 1.000 60.62256  ? 451  LYS A CD    1 
ATOM   4460 C  CE    . LYS C 3  452 ? 13.30786 42.63730  -51.55913 1.000 67.47232  ? 451  LYS A CE    1 
ATOM   4461 N  NZ    . LYS C 3  452 ? 14.15617 41.46129  -51.20205 1.000 70.74792  ? 451  LYS A NZ    1 
ATOM   4462 N  N     . LEU C 3  453 ? 14.20637 48.47851  -54.96637 1.000 49.42850  ? 452  LEU A N     1 
ATOM   4463 C  CA    . LEU C 3  453 ? 14.79371 49.75217  -55.36523 1.000 50.52079  ? 452  LEU A CA    1 
ATOM   4464 C  C     . LEU C 3  453 ? 14.78020 50.72611  -54.18780 1.000 45.99789  ? 452  LEU A C     1 
ATOM   4465 O  O     . LEU C 3  453 ? 13.87061 50.71304  -53.35519 1.000 47.95550  ? 452  LEU A O     1 
ATOM   4466 C  CB    . LEU C 3  453 ? 14.03996 50.34122  -56.56257 1.000 49.59006  ? 452  LEU A CB    1 
ATOM   4467 C  CG    . LEU C 3  453 ? 13.89572 49.38847  -57.76364 1.000 48.23659  ? 452  LEU A CG    1 
ATOM   4468 C  CD1   . LEU C 3  453 ? 13.12635 50.02023  -58.92419 1.000 45.11594  ? 452  LEU A CD1   1 
ATOM   4469 C  CD2   . LEU C 3  453 ? 15.25634 48.90901  -58.22848 1.000 48.85808  ? 452  LEU A CD2   1 
ATOM   4470 N  N     . GLY C 3  454 ? 15.81061 51.56633  -54.10810 1.000 39.80554  ? 453  GLY A N     1 
ATOM   4471 C  CA    . GLY C 3  454 ? 15.96659 52.43268  -52.95580 1.000 37.29445  ? 453  GLY A CA    1 
ATOM   4472 C  C     . GLY C 3  454 ? 16.60584 53.75529  -53.32042 1.000 36.01156  ? 453  GLY A C     1 
ATOM   4473 O  O     . GLY C 3  454 ? 17.06458 53.96726  -54.44285 1.000 38.14031  ? 453  GLY A O     1 
ATOM   4474 N  N     . LYS C 3  455 ? 16.62580 54.65241  -52.34311 1.000 31.49907  ? 454  LYS A N     1 
ATOM   4475 C  CA    . LYS C 3  455 ? 17.29511 55.93246  -52.47385 1.000 34.13302  ? 454  LYS A CA    1 
ATOM   4476 C  C     . LYS C 3  455 ? 17.99327 56.26508  -51.16404 1.000 35.09860  ? 454  LYS A C     1 
ATOM   4477 O  O     . LYS C 3  455 ? 17.50904 55.92038  -50.08046 1.000 32.61538  ? 454  LYS A O     1 
ATOM   4478 C  CB    . LYS C 3  455 ? 16.32053 57.05260  -52.85457 1.000 35.50794  ? 454  LYS A CB    1 
ATOM   4479 C  CG    . LYS C 3  455 ? 15.76609 56.93018  -54.26029 1.000 41.85703  ? 454  LYS A CG    1 
ATOM   4480 C  CD    . LYS C 3  455 ? 15.07135 58.20615  -54.69424 1.000 42.61956  ? 454  LYS A CD    1 
ATOM   4481 C  CE    . LYS C 3  455 ? 14.34380 58.00367  -56.00285 1.000 43.49392  ? 454  LYS A CE    1 
ATOM   4482 N  NZ    . LYS C 3  455 ? 13.51154 59.19652  -56.32421 1.000 43.98363  ? 454  LYS A NZ    1 
ATOM   4483 N  N     . ALA C 3  456 ? 19.14515 56.93537  -51.28986 1.000 34.05304  ? 455  ALA A N     1 
ATOM   4484 C  CA    . ALA C 3  456 ? 19.94652 57.41653  -50.17362 1.000 33.91879  ? 455  ALA A CA    1 
ATOM   4485 C  C     . ALA C 3  456 ? 20.32845 58.86472  -50.43576 1.000 39.00830  ? 455  ALA A C     1 
ATOM   4486 O  O     . ALA C 3  456 ? 20.55862 59.25269  -51.57829 1.000 40.83122  ? 455  ALA A O     1 
ATOM   4487 C  CB    . ALA C 3  456 ? 21.22095 56.58486  -49.99676 1.000 31.26669  ? 455  ALA A CB    1 
ATOM   4488 N  N     . GLY C 3  457 ? 20.40638 59.67995  -49.39344 1.000 37.88879  ? 456  GLY A N     1 
ATOM   4489 C  CA    . GLY C 3  457 ? 20.77462 61.05285  -49.68316 1.000 32.95474  ? 456  GLY A CA    1 
ATOM   4490 C  C     . GLY C 3  457 ? 20.93097 61.90337  -48.44786 1.000 34.04508  ? 456  GLY A C     1 
ATOM   4491 O  O     . GLY C 3  457 ? 20.79821 61.43791  -47.30631 1.000 38.23855  ? 456  GLY A O     1 
ATOM   4492 N  N     . TYR C 3  458 ? 21.20941 63.17925  -48.71078 1.000 31.68862  ? 457  TYR A N     1 
ATOM   4493 C  CA    . TYR C 3  458 ? 21.36114 64.16954  -47.65721 1.000 32.29445  ? 457  TYR A CA    1 
ATOM   4494 C  C     . TYR C 3  458 ? 20.82377 65.50843  -48.13822 1.000 35.97091  ? 457  TYR A C     1 
ATOM   4495 O  O     . TYR C 3  458 ? 20.79656 65.78758  -49.34398 1.000 35.04279  ? 457  TYR A O     1 
ATOM   4496 C  CB    . TYR C 3  458 ? 22.83250 64.32169  -47.22617 1.000 27.58445  ? 457  TYR A CB    1 
ATOM   4497 C  CG    . TYR C 3  458 ? 23.76088 64.77548  -48.35046 1.000 30.89550  ? 457  TYR A CG    1 
ATOM   4498 C  CD1   . TYR C 3  458 ? 23.83130 66.11133  -48.74072 1.000 28.91289  ? 457  TYR A CD1   1 
ATOM   4499 C  CD2   . TYR C 3  458 ? 24.57909 63.85751  -49.01109 1.000 36.25403  ? 457  TYR A CD2   1 
ATOM   4500 C  CE1   . TYR C 3  458 ? 24.66922 66.50692  -49.75795 1.000 33.75716  ? 457  TYR A CE1   1 
ATOM   4501 C  CE2   . TYR C 3  458 ? 25.42170 64.24314  -50.02501 1.000 34.08498  ? 457  TYR A CE2   1 
ATOM   4502 C  CZ    . TYR C 3  458 ? 25.47006 65.56703  -50.40221 1.000 38.02148  ? 457  TYR A CZ    1 
ATOM   4503 O  OH    . TYR C 3  458 ? 26.32174 65.94767  -51.43257 1.000 37.94296  ? 457  TYR A OH    1 
ATOM   4504 N  N     . VAL C 3  459 ? 20.37397 66.32329  -47.17510 1.000 36.14976  ? 458  VAL A N     1 
ATOM   4505 C  CA    . VAL C 3  459 ? 20.33192 67.77528  -47.33642 1.000 38.44900  ? 458  VAL A CA    1 
ATOM   4506 C  C     . VAL C 3  459 ? 21.27991 68.36083  -46.30051 1.000 40.51981  ? 458  VAL A C     1 
ATOM   4507 O  O     . VAL C 3  459 ? 21.59210 67.72586  -45.29522 1.000 42.54294  ? 458  VAL A O     1 
ATOM   4508 C  CB    . VAL C 3  459 ? 18.92150 68.39008  -47.18543 1.000 34.37654  ? 458  VAL A CB    1 
ATOM   4509 C  CG1   . VAL C 3  459 ? 18.00604 67.94575  -48.31582 1.000 27.55798  ? 458  VAL A CG1   1 
ATOM   4510 C  CG2   . VAL C 3  459 ? 18.31999 68.07019  -45.80536 1.000 30.90591  ? 458  VAL A CG2   1 
ATOM   4511 N  N     . THR C 3  460 ? 21.77391 69.56829  -46.56398 1.000 35.61740  ? 459  THR A N     1 
ATOM   4512 C  CA    . THR C 3  460 ? 22.67606 70.22033  -45.62302 1.000 32.22974  ? 459  THR A CA    1 
ATOM   4513 C  C     . THR C 3  460 ? 22.16762 71.60867  -45.28116 1.000 39.21625  ? 459  THR A C     1 
ATOM   4514 O  O     . THR C 3  460 ? 21.49547 72.26417  -46.08886 1.000 38.97950  ? 459  THR A O     1 
ATOM   4515 C  CB    . THR C 3  460 ? 24.09785 70.35975  -46.15631 1.000 31.41970  ? 459  THR A CB    1 
ATOM   4516 O  OG1   . THR C 3  460 ? 24.14608 71.47898  -47.04087 1.000 37.42774  ? 459  THR A OG1   1 
ATOM   4517 C  CG2   . THR C 3  460 ? 24.54465 69.10098  -46.89609 1.000 27.29476  ? 459  THR A CG2   1 
ATOM   4518 N  N     . ASN C 3  461 ? 22.51801 72.06591  -44.07369 1.000 38.56078  ? 460  ASN A N     1 
ATOM   4519 C  CA    . ASN C 3  461 ? 22.09103 73.39367  -43.65175 1.000 30.76587  ? 460  ASN A CA    1 
ATOM   4520 C  C     . ASN C 3  461 ? 22.63694 74.49068  -44.55640 1.000 31.17032  ? 460  ASN A C     1 
ATOM   4521 O  O     . ASN C 3  461 ? 22.08602 75.58908  -44.57652 1.000 30.58440  ? 460  ASN A O     1 
ATOM   4522 C  CB    . ASN C 3  461 ? 22.51866 73.65116  -42.21705 1.000 28.08513  ? 460  ASN A CB    1 
ATOM   4523 C  CG    . ASN C 3  461 ? 24.00779 73.84425  -42.08381 1.000 42.47645  ? 460  ASN A CG    1 
ATOM   4524 O  OD1   . ASN C 3  461 ? 24.78514 72.89943  -42.27006 1.000 38.66033  ? 460  ASN A OD1   1 
ATOM   4525 N  ND2   . ASN C 3  461 ? 24.42330 75.07051  -41.75041 1.000 29.35676  ? 460  ASN A ND2   1 
ATOM   4526 N  N     . ARG C 3  462 ? 23.70317 74.22978  -45.29591 1.000 29.05808  ? 461  ARG A N     1 
ATOM   4527 C  CA    . ARG C 3  462 ? 24.22693 75.20583  -46.23531 1.000 34.11561  ? 461  ARG A CA    1 
ATOM   4528 C  C     . ARG C 3  462 ? 23.59982 75.08309  -47.62588 1.000 36.14128  ? 461  ARG A C     1 
ATOM   4529 O  O     . ARG C 3  462 ? 24.13344 75.64969  -48.58282 1.000 37.02454  ? 461  ARG A O     1 
ATOM   4530 C  CB    . ARG C 3  462 ? 25.74911 75.07783  -46.32686 1.000 30.34824  ? 461  ARG A CB    1 
ATOM   4531 C  CG    . ARG C 3  462 ? 26.44341 75.22493  -44.99669 1.000 30.16437  ? 461  ARG A CG    1 
ATOM   4532 C  CD    . ARG C 3  462 ? 27.92672 75.04439  -45.12360 1.000 34.05898  ? 461  ARG A CD    1 
ATOM   4533 N  NE    . ARG C 3  462 ? 28.56277 75.25283  -43.82607 1.000 43.32195  ? 461  ARG A NE    1 
ATOM   4534 C  CZ    . ARG C 3  462 ? 29.80832 74.88097  -43.53102 1.000 47.13192  ? 461  ARG A CZ    1 
ATOM   4535 N  NH1   . ARG C 3  462 ? 30.55562 74.27469  -44.44719 1.000 46.39518  ? 461  ARG A NH1   1 
ATOM   4536 N  NH2   . ARG C 3  462 ? 30.30462 75.11490  -42.31939 1.000 44.20216  ? 461  ARG A NH2   1 
ATOM   4537 N  N     . GLY C 3  463 ? 22.49361 74.35123  -47.75982 1.000 30.30847  ? 462  GLY A N     1 
ATOM   4538 C  CA    . GLY C 3  463 ? 21.72277 74.32965  -48.98468 1.000 34.98526  ? 462  GLY A CA    1 
ATOM   4539 C  C     . GLY C 3  463 ? 22.05337 73.22738  -49.97344 1.000 35.89650  ? 462  GLY A C     1 
ATOM   4540 O  O     . GLY C 3  463 ? 21.42079 73.16396  -51.03231 1.000 33.86275  ? 462  GLY A O     1 
ATOM   4541 N  N     . ARG C 3  464 ? 23.02990 72.37570  -49.68743 1.000 36.29871  ? 463  ARG A N     1 
ATOM   4542 C  CA    . ARG C 3  464 ? 23.35516 71.30011  -50.60956 1.000 39.75938  ? 463  ARG A CA    1 
ATOM   4543 C  C     . ARG C 3  464 ? 22.40771 70.12580  -50.39483 1.000 39.79947  ? 463  ARG A C     1 
ATOM   4544 O  O     . ARG C 3  464 ? 22.02638 69.81260  -49.26205 1.000 38.89909  ? 463  ARG A O     1 
ATOM   4545 C  CB    . ARG C 3  464 ? 24.80318 70.85113  -50.42408 1.000 37.25348  ? 463  ARG A CB    1 
ATOM   4546 C  CG    . ARG C 3  464 ? 25.82844 71.92341  -50.73876 1.000 38.61819  ? 463  ARG A CG    1 
ATOM   4547 C  CD    . ARG C 3  464 ? 27.15534 71.60928  -50.06031 1.000 39.80202  ? 463  ARG A CD    1 
ATOM   4548 N  NE    . ARG C 3  464 ? 27.71068 70.38039  -50.59283 1.000 43.41380  ? 463  ARG A NE    1 
ATOM   4549 C  CZ    . ARG C 3  464 ? 28.59532 69.59811  -49.98537 1.000 39.60877  ? 463  ARG A CZ    1 
ATOM   4550 N  NH1   . ARG C 3  464 ? 29.07183 69.87195  -48.78113 1.000 27.62923  ? 463  ARG A NH1   1 
ATOM   4551 N  NH2   . ARG C 3  464 ? 29.00579 68.52509  -50.61546 1.000 35.79432  ? 463  ARG A NH2   1 
ATOM   4552 N  N     . GLN C 3  465 ? 22.01539 69.48806  -51.49441 1.000 39.04531  ? 464  GLN A N     1 
ATOM   4553 C  CA    . GLN C 3  465 ? 21.20148 68.28328  -51.44261 1.000 42.64449  ? 464  GLN A CA    1 
ATOM   4554 C  C     . GLN C 3  465 ? 21.69198 67.29380  -52.49402 1.000 43.91758  ? 464  GLN A C     1 
ATOM   4555 O  O     . GLN C 3  465 ? 22.12887 67.69508  -53.58035 1.000 47.38030  ? 464  GLN A O     1 
ATOM   4556 C  CB    . GLN C 3  465 ? 19.71751 68.59665  -51.65506 1.000 46.77803  ? 464  GLN A CB    1 
ATOM   4557 C  CG    . GLN C 3  465 ? 19.31328 68.85066  -53.09292 1.000 53.83717  ? 464  GLN A CG    1 
ATOM   4558 C  CD    . GLN C 3  465 ? 17.80224 68.84928  -53.27609 1.000 62.49192  ? 464  GLN A CD    1 
ATOM   4559 O  OE1   . GLN C 3  465 ? 17.08338 69.63788  -52.65250 1.000 59.00916  ? 464  GLN A OE1   1 
ATOM   4560 N  NE2   . GLN C 3  465 ? 17.31192 67.94850  -54.12735 1.000 70.02162  ? 464  GLN A NE2   1 
ATOM   4561 N  N     . LYS C 3  466 ? 21.64073 66.00288  -52.15173 1.000 33.70258  ? 465  LYS A N     1 
ATOM   4562 C  CA    . LYS C 3  466 ? 21.98433 64.93925  -53.08464 1.000 30.56698  ? 465  LYS A CA    1 
ATOM   4563 C  C     . LYS C 3  466 ? 21.16138 63.69156  -52.79049 1.000 33.68640  ? 465  LYS A C     1 
ATOM   4564 O  O     . LYS C 3  466 ? 20.93348 63.34008  -51.62780 1.000 31.53407  ? 465  LYS A O     1 
ATOM   4565 C  CB    . LYS C 3  466 ? 23.47102 64.58562  -53.03231 1.000 30.27365  ? 465  LYS A CB    1 
ATOM   4566 C  CG    . LYS C 3  466 ? 23.90127 63.66985  -54.18641 1.000 32.08340  ? 465  LYS A CG    1 
ATOM   4567 C  CD    . LYS C 3  466 ? 25.39377 63.33703  -54.17479 1.000 35.50223  ? 465  LYS A CD    1 
ATOM   4568 C  CE    . LYS C 3  466 ? 26.22064 64.51683  -54.66517 1.000 43.19381  ? 465  LYS A CE    1 
ATOM   4569 N  NZ    . LYS C 3  466 ? 27.67727 64.21068  -54.74878 1.000 43.45302  ? 465  LYS A NZ    1 
ATOM   4570 N  N     . VAL C 3  467 ? 20.74575 63.01654  -53.85874 1.000 36.14089  ? 466  VAL A N     1 
ATOM   4571 C  CA    . VAL C 3  467 ? 19.99298 61.77029  -53.78595 1.000 39.42153  ? 466  VAL A CA    1 
ATOM   4572 C  C     . VAL C 3  467 ? 20.59123 60.78875  -54.79131 1.000 38.60376  ? 466  VAL A C     1 
ATOM   4573 O  O     . VAL C 3  467 ? 20.71083 61.10699  -55.97895 1.000 41.08340  ? 466  VAL A O     1 
ATOM   4574 C  CB    . VAL C 3  467 ? 18.49632 62.00056  -54.05958 1.000 40.30540  ? 466  VAL A CB    1 
ATOM   4575 C  CG1   . VAL C 3  467 ? 17.79076 60.69489  -54.33717 1.000 36.38037  ? 466  VAL A CG1   1 
ATOM   4576 C  CG2   . VAL C 3  467 ? 17.85962 62.70682  -52.86831 1.000 43.71363  ? 466  VAL A CG2   1 
ATOM   4577 N  N     . VAL C 3  468 ? 20.96668 59.60648  -54.31464 1.000 35.75343  ? 467  VAL A N     1 
ATOM   4578 C  CA    . VAL C 3  468 ? 21.49927 58.51984  -55.12778 1.000 35.28040  ? 467  VAL A CA    1 
ATOM   4579 C  C     . VAL C 3  468 ? 20.47101 57.39673  -55.16052 1.000 37.45479  ? 467  VAL A C     1 
ATOM   4580 O  O     . VAL C 3  468 ? 19.90700 57.03295  -54.11957 1.000 41.09457  ? 467  VAL A O     1 
ATOM   4581 C  CB    . VAL C 3  468 ? 22.84090 58.01833  -54.56520 1.000 36.12855  ? 467  VAL A CB    1 
ATOM   4582 C  CG1   . VAL C 3  468 ? 23.21128 56.67220  -55.16925 1.000 38.09202  ? 467  VAL A CG1   1 
ATOM   4583 C  CG2   . VAL C 3  468 ? 23.94202 59.04828  -54.82153 1.000 30.28749  ? 467  VAL A CG2   1 
ATOM   4584 N  N     . THR C 3  469 ? 20.22184 56.85049  -56.34669 1.000 38.09219  ? 468  THR A N     1 
ATOM   4585 C  CA    . THR C 3  469 ? 19.34718 55.69098  -56.47814 1.000 40.33138  ? 468  THR A CA    1 
ATOM   4586 C  C     . THR C 3  469 ? 20.15055 54.39125  -56.36440 1.000 41.98197  ? 468  THR A C     1 
ATOM   4587 O  O     . THR C 3  469 ? 21.30755 54.30540  -56.78302 1.000 48.30269  ? 468  THR A O     1 
ATOM   4588 C  CB    . THR C 3  469 ? 18.57986 55.73342  -57.80502 1.000 41.22273  ? 468  THR A CB    1 
ATOM   4589 O  OG1   . THR C 3  469 ? 19.49966 55.60110  -58.89502 1.000 48.39536  ? 468  THR A OG1   1 
ATOM   4590 C  CG2   . THR C 3  469 ? 17.81968 57.06053  -57.95577 1.000 34.50823  ? 468  THR A CG2   1 
ATOM   4591 N  N     . LEU C 3  470 ? 19.52396 53.37656  -55.78265 1.000 39.99877  ? 469  LEU A N     1 
ATOM   4592 C  CA    . LEU C 3  470 ? 20.16772 52.10510  -55.48958 1.000 40.33072  ? 469  LEU A CA    1 
ATOM   4593 C  C     . LEU C 3  470 ? 19.26036 50.96032  -55.93246 1.000 47.61677  ? 469  LEU A C     1 
ATOM   4594 O  O     . LEU C 3  470 ? 18.03378 51.04614  -55.81319 1.000 48.79169  ? 469  LEU A O     1 
ATOM   4595 C  CB    . LEU C 3  470 ? 20.46646 51.99232  -53.99109 1.000 38.43034  ? 469  LEU A CB    1 
ATOM   4596 C  CG    . LEU C 3  470 ? 21.30085 53.10158  -53.34072 1.000 40.45561  ? 469  LEU A CG    1 
ATOM   4597 C  CD1   . LEU C 3  470 ? 20.92394 53.26338  -51.88615 1.000 42.41321  ? 469  LEU A CD1   1 
ATOM   4598 C  CD2   . LEU C 3  470 ? 22.78437 52.81272  -53.44164 1.000 37.56303  ? 469  LEU A CD2   1 
ATOM   4599 N  N     . THR C 3  471 ? 19.85327 49.88877  -56.44916 1.000 50.64304  ? 470  THR A N     1 
ATOM   4600 C  CA    . THR C 3  471 ? 19.09046 48.70219  -56.81570 1.000 52.58797  ? 470  THR A CA    1 
ATOM   4601 C  C     . THR C 3  471 ? 19.42398 47.56297  -55.86755 1.000 53.43732  ? 470  THR A C     1 
ATOM   4602 O  O     . THR C 3  471 ? 20.52936 47.49827  -55.31822 1.000 45.93524  ? 470  THR A O     1 
ATOM   4603 C  CB    . THR C 3  471 ? 19.37526 48.24881  -58.24956 1.000 49.61923  ? 470  THR A CB    1 
ATOM   4604 O  OG1   . THR C 3  471 ? 20.78617 48.06115  -58.40801 1.000 51.04357  ? 470  THR A OG1   1 
ATOM   4605 C  CG2   . THR C 3  471 ? 18.87780 49.27291  -59.25458 1.000 45.54016  ? 470  THR A CG2   1 
ATOM   4606 N  N     . ASP C 3  472 ? 18.44807 46.67069  -55.68867 1.000 58.94472  ? 471  ASP A N     1 
ATOM   4607 C  CA    . ASP C 3  472 ? 18.60245 45.44333  -54.91009 1.000 58.50192  ? 471  ASP A CA    1 
ATOM   4608 C  C     . ASP C 3  472 ? 19.19674 45.74366  -53.53442 1.000 50.42911  ? 471  ASP A C     1 
ATOM   4609 O  O     . ASP C 3  472 ? 20.28848 45.29674  -53.17742 1.000 51.02301  ? 471  ASP A O     1 
ATOM   4610 C  CB    . ASP C 3  472 ? 19.45010 44.42338  -55.67892 1.000 69.80722  ? 471  ASP A CB    1 
ATOM   4611 C  CG    . ASP C 3  472 ? 19.57002 43.09215  -54.95327 1.000 79.15250  ? 471  ASP A CG    1 
ATOM   4612 O  OD1   . ASP C 3  472 ? 18.66273 42.73587  -54.16013 1.000 82.32390  ? 471  ASP A OD1   1 
ATOM   4613 O  OD2   . ASP C 3  472 ? 20.58941 42.40694  -55.16499 1.000 82.97725  ? 471  ASP A OD2   1 
ATOM   4614 N  N     . THR C 3  473 ? 18.44838 46.52134  -52.75619 1.000 45.28331  ? 472  THR A N     1 
ATOM   4615 C  CA    . THR C 3  473 ? 18.95606 47.08281  -51.51424 1.000 36.89443  ? 472  THR A CA    1 
ATOM   4616 C  C     . THR C 3  473 ? 17.89047 46.93153  -50.43536 1.000 39.48013  ? 472  THR A C     1 
ATOM   4617 O  O     . THR C 3  473 ? 16.80676 46.38036  -50.67002 1.000 38.95242  ? 472  THR A O     1 
ATOM   4618 C  CB    . THR C 3  473 ? 19.38520 48.55012  -51.71751 1.000 36.19576  ? 472  THR A CB    1 
ATOM   4619 O  OG1   . THR C 3  473 ? 19.82041 49.11936  -50.47860 1.000 35.04588  ? 472  THR A OG1   1 
ATOM   4620 C  CG2   . THR C 3  473 ? 18.24188 49.39113  -52.28105 1.000 36.62259  ? 472  THR A CG2   1 
ATOM   4621 N  N     . THR C 3  474 ? 18.22344 47.40472  -49.23240 1.000 36.04677  ? 473  THR A N     1 
ATOM   4622 C  CA    . THR C 3  474 ? 17.36794 47.29815  -48.06148 1.000 32.95645  ? 473  THR A CA    1 
ATOM   4623 C  C     . THR C 3  474 ? 17.39164 48.62249  -47.31675 1.000 41.38533  ? 473  THR A C     1 
ATOM   4624 O  O     . THR C 3  474 ? 18.31043 49.43202  -47.48946 1.000 46.22012  ? 473  THR A O     1 
ATOM   4625 C  CB    . THR C 3  474 ? 17.84185 46.18379  -47.11651 1.000 38.26054  ? 473  THR A CB    1 
ATOM   4626 O  OG1   . THR C 3  474 ? 18.98069 46.64698  -46.37158 1.000 30.44705  ? 473  THR A OG1   1 
ATOM   4627 C  CG2   . THR C 3  474 ? 18.22791 44.92059  -47.89914 1.000 30.07980  ? 473  THR A CG2   1 
ATOM   4628 N  N     . ASN C 3  475 ? 16.39002 48.82429  -46.45034 1.000 44.18733  ? 474  ASN A N     1 
ATOM   4629 C  CA    . ASN C 3  475 ? 16.32333 50.06264  -45.67061 1.000 45.23150  ? 474  ASN A CA    1 
ATOM   4630 C  C     . ASN C 3  475 ? 17.61387 50.29189  -44.90375 1.000 43.97251  ? 474  ASN A C     1 
ATOM   4631 O  O     . ASN C 3  475 ? 18.17883 51.39976  -44.91877 1.000 43.29954  ? 474  ASN A O     1 
ATOM   4632 C  CB    . ASN C 3  475 ? 15.13592 50.03893  -44.70389 1.000 45.24320  ? 474  ASN A CB    1 
ATOM   4633 C  CG    . ASN C 3  475 ? 13.82116 50.41128  -45.37715 1.000 52.44156  ? 474  ASN A CG    1 
ATOM   4634 O  OD1   . ASN C 3  475 ? 12.86591 49.64233  -45.33742 1.000 57.82549  ? 474  ASN A OD1   1 
ATOM   4635 N  ND2   . ASN C 3  475 ? 13.76909 51.59217  -46.00361 1.000 52.70337  ? 474  ASN A ND2   1 
ATOM   4636 N  N     . GLN C 3  476 ? 18.10183 49.24133  -44.23724 1.000 39.19588  ? 475  GLN A N     1 
ATOM   4637 C  CA    . GLN C 3  476 ? 19.32798 49.35832  -43.45875 1.000 37.51294  ? 475  GLN A CA    1 
ATOM   4638 C  C     . GLN C 3  476 ? 20.50165 49.75229  -44.34859 1.000 34.61034  ? 475  GLN A C     1 
ATOM   4639 O  O     . GLN C 3  476 ? 21.30969 50.63061  -43.99001 1.000 34.69342  ? 475  GLN A O     1 
ATOM   4640 C  CB    . GLN C 3  476 ? 19.58954 48.04131  -42.72782 1.000 38.89808  ? 475  GLN A CB    1 
ATOM   4641 C  CG    . GLN C 3  476 ? 18.48715 47.66491  -41.71915 1.000 44.29050  ? 475  GLN A CG    1 
ATOM   4642 C  CD    . GLN C 3  476 ? 17.35402 46.84888  -42.33784 1.000 55.73860  ? 475  GLN A CD    1 
ATOM   4643 O  OE1   . GLN C 3  476 ? 17.06772 46.95792  -43.53225 1.000 63.57003  ? 475  GLN A OE1   1 
ATOM   4644 N  NE2   . GLN C 3  476 ? 16.71288 46.01781  -41.52461 1.000 58.74973  ? 475  GLN A NE2   1 
ATOM   4645 N  N     . LYS C 3  477 ? 20.58493 49.13984  -45.53236 1.000 31.23611  ? 476  LYS A N     1 
ATOM   4646 C  CA    . LYS C 3  477 ? 21.66135 49.46335  -46.45873 1.000 38.07322  ? 476  LYS A CA    1 
ATOM   4647 C  C     . LYS C 3  477 ? 21.54344 50.90122  -46.96126 1.000 36.96906  ? 476  LYS A C     1 
ATOM   4648 O  O     . LYS C 3  477 ? 22.55831 51.59205  -47.09808 1.000 33.35942  ? 476  LYS A O     1 
ATOM   4649 C  CB    . LYS C 3  477 ? 21.68194 48.46920  -47.62481 1.000 39.79816  ? 476  LYS A CB    1 
ATOM   4650 C  CG    . LYS C 3  477 ? 22.09821 47.05385  -47.23394 1.000 44.21353  ? 476  LYS A CG    1 
ATOM   4651 C  CD    . LYS C 3  477 ? 22.29399 46.15959  -48.45945 1.000 48.64466  ? 476  LYS A CD    1 
ATOM   4652 C  CE    . LYS C 3  477 ? 22.73069 44.75682  -48.06148 1.000 49.76341  ? 476  LYS A CE    1 
ATOM   4653 N  NZ    . LYS C 3  477 ? 23.28346 44.00955  -49.23471 1.000 52.87841  ? 476  LYS A NZ    1 
ATOM   4654 N  N     . THR C 3  478 ? 20.32172 51.38374  -47.21600 1.000 32.22941  ? 477  THR A N     1 
ATOM   4655 C  CA    . THR C 3  478 ? 20.20420 52.76787  -47.66422 1.000 33.74386  ? 477  THR A CA    1 
ATOM   4656 C  C     . THR C 3  478 ? 20.58429 53.74753  -46.56185 1.000 36.38650  ? 477  THR A C     1 
ATOM   4657 O  O     . THR C 3  478 ? 21.15032 54.80968  -46.85603 1.000 36.36791  ? 477  THR A O     1 
ATOM   4658 C  CB    . THR C 3  478 ? 18.79368 53.07393  -48.18101 1.000 36.63935  ? 477  THR A CB    1 
ATOM   4659 O  OG1   . THR C 3  478 ? 17.84810 53.01546  -47.10395 1.000 38.88984  ? 477  THR A OG1   1 
ATOM   4660 C  CG2   . THR C 3  478 ? 18.38813 52.09332  -49.29921 1.000 36.26249  ? 477  THR A CG2   1 
ATOM   4661 N  N     . GLU C 3  479 ? 20.31103 53.41357  -45.29278 1.000 36.63937  ? 478  GLU A N     1 
ATOM   4662 C  CA    . GLU C 3  479 ? 20.74324 54.30802  -44.21396 1.000 36.34228  ? 478  GLU A CA    1 
ATOM   4663 C  C     . GLU C 3  479 ? 22.27010 54.36718  -44.13355 1.000 34.73263  ? 478  GLU A C     1 
ATOM   4664 O  O     . GLU C 3  479 ? 22.86383 55.45422  -43.99694 1.000 30.54845  ? 478  GLU A O     1 
ATOM   4665 C  CB    . GLU C 3  479 ? 20.13878 53.86519  -42.87612 1.000 34.41806  ? 478  GLU A CB    1 
ATOM   4666 C  CG    . GLU C 3  479 ? 18.59741 53.84571  -42.82780 1.000 38.01757  ? 478  GLU A CG    1 
ATOM   4667 C  CD    . GLU C 3  479 ? 17.94828 55.23212  -42.67549 1.000 46.84889  ? 478  GLU A CD    1 
ATOM   4668 O  OE1   . GLU C 3  479 ? 18.65269 56.26128  -42.77873 1.000 51.24947  ? 478  GLU A OE1   1 
ATOM   4669 O  OE2   . GLU C 3  479 ? 16.72099 55.29163  -42.45248 1.000 51.12280  ? 478  GLU A OE2   1 
ATOM   4670 N  N     . LEU C 3  480 ? 22.92672 53.20721  -44.26183 1.000 35.35778  ? 479  LEU A N     1 
ATOM   4671 C  CA    . LEU C 3  480 ? 24.38830 53.20560  -44.27664 1.000 30.17520  ? 479  LEU A CA    1 
ATOM   4672 C  C     . LEU C 3  480 ? 24.93412 53.97128  -45.47627 1.000 32.65088  ? 479  LEU A C     1 
ATOM   4673 O  O     . LEU C 3  480 ? 25.92023 54.71105  -45.34948 1.000 35.62382  ? 479  LEU A O     1 
ATOM   4674 C  CB    . LEU C 3  480 ? 24.91710 51.77913  -44.26809 1.000 31.63764  ? 479  LEU A CB    1 
ATOM   4675 C  CG    . LEU C 3  480 ? 24.76984 51.06880  -42.93321 1.000 34.75589  ? 479  LEU A CG    1 
ATOM   4676 C  CD1   . LEU C 3  480 ? 25.45250 49.69170  -42.99355 1.000 36.08679  ? 479  LEU A CD1   1 
ATOM   4677 C  CD2   . LEU C 3  480 ? 25.34855 51.93541  -41.82614 1.000 31.32551  ? 479  LEU A CD2   1 
ATOM   4678 N  N     . GLN C 3  481 ? 24.30254 53.80764  -46.64919 1.000 31.07898  ? 480  GLN A N     1 
ATOM   4679 C  CA    . GLN C 3  481 ? 24.73283 54.51093  -47.85732 1.000 32.24336  ? 480  GLN A CA    1 
ATOM   4680 C  C     . GLN C 3  481 ? 24.58777 56.02758  -47.70873 1.000 34.32787  ? 480  GLN A C     1 
ATOM   4681 O  O     . GLN C 3  481 ? 25.45668 56.78743  -48.15429 1.000 31.15685  ? 480  GLN A O     1 
ATOM   4682 C  CB    . GLN C 3  481 ? 23.93182 54.01442  -49.06457 1.000 37.04925  ? 480  GLN A CB    1 
ATOM   4683 C  CG    . GLN C 3  481 ? 24.26881 52.60678  -49.54428 1.000 37.42263  ? 480  GLN A CG    1 
ATOM   4684 C  CD    . GLN C 3  481 ? 25.43533 52.56419  -50.51752 1.000 41.63213  ? 480  GLN A CD    1 
ATOM   4685 O  OE1   . GLN C 3  481 ? 25.96468 53.60232  -50.94330 1.000 43.43758  ? 480  GLN A OE1   1 
ATOM   4686 N  NE2   . GLN C 3  481 ? 25.83608 51.35540  -50.88572 1.000 40.33153  ? 480  GLN A NE2   1 
ATOM   4687 N  N     . ALA C 3  482 ? 23.49487 56.48875  -47.08921 1.000 35.11516  ? 481  ALA A N     1 
ATOM   4688 C  CA    . ALA C 3  482 ? 23.33507 57.92239  -46.86846 1.000 33.76940  ? 481  ALA A CA    1 
ATOM   4689 C  C     . ALA C 3  482 ? 24.44955 58.45605  -45.97815 1.000 34.36279  ? 481  ALA A C     1 
ATOM   4690 O  O     . ALA C 3  482 ? 25.02624 59.52070  -46.25813 1.000 33.89756  ? 481  ALA A O     1 
ATOM   4691 C  CB    . ALA C 3  482 ? 21.96184 58.21867  -46.26088 1.000 30.64922  ? 481  ALA A CB    1 
ATOM   4692 N  N     . ILE C 3  483 ? 24.78262 57.72269  -44.90821 1.000 32.31383  ? 482  ILE A N     1 
ATOM   4693 C  CA    . ILE C 3  483 ? 25.88858 58.16296  -44.05230 1.000 33.72509  ? 482  ILE A CA    1 
ATOM   4694 C  C     . ILE C 3  483 ? 27.19400 58.21916  -44.84624 1.000 34.78108  ? 482  ILE A C     1 
ATOM   4695 O  O     . ILE C 3  483 ? 27.94684 59.20116  -44.76719 1.000 36.24036  ? 482  ILE A O     1 
ATOM   4696 C  CB    . ILE C 3  483 ? 26.01711 57.26141  -42.80906 1.000 32.17942  ? 482  ILE A CB    1 
ATOM   4697 C  CG1   . ILE C 3  483 ? 25.08455 57.75067  -41.70099 1.000 28.53727  ? 482  ILE A CG1   1 
ATOM   4698 C  CG2   . ILE C 3  483 ? 27.46216 57.22986  -42.31069 1.000 29.20787  ? 482  ILE A CG2   1 
ATOM   4699 C  CD1   . ILE C 3  483 ? 24.68478 56.66069  -40.71802 1.000 28.85303  ? 482  ILE A CD1   1 
ATOM   4700 N  N     . TYR C 3  484 ? 27.47920 57.15951  -45.61835 1.000 33.47316  ? 483  TYR A N     1 
ATOM   4701 C  CA    . TYR C 3  484 ? 28.68480 57.10301  -46.45349 1.000 29.96719  ? 483  TYR A CA    1 
ATOM   4702 C  C     . TYR C 3  484 ? 28.75490 58.27982  -47.42397 1.000 33.02677  ? 483  TYR A C     1 
ATOM   4703 O  O     . TYR C 3  484 ? 29.83176 58.84020  -47.67120 1.000 34.01542  ? 483  TYR A O     1 
ATOM   4704 C  CB    . TYR C 3  484 ? 28.69157 55.77924  -47.22016 1.000 31.24582  ? 483  TYR A CB    1 
ATOM   4705 C  CG    . TYR C 3  484 ? 29.83396 55.57077  -48.19269 1.000 37.00022  ? 483  TYR A CG    1 
ATOM   4706 C  CD1   . TYR C 3  484 ? 31.15556 55.81363  -47.82715 1.000 37.96138  ? 483  TYR A CD1   1 
ATOM   4707 C  CD2   . TYR C 3  484 ? 29.59217 55.07251  -49.47176 1.000 39.02522  ? 483  TYR A CD2   1 
ATOM   4708 C  CE1   . TYR C 3  484 ? 32.19869 55.60057  -48.73059 1.000 37.34083  ? 483  TYR A CE1   1 
ATOM   4709 C  CE2   . TYR C 3  484 ? 30.62212 54.84820  -50.36825 1.000 37.14928  ? 483  TYR A CE2   1 
ATOM   4710 C  CZ    . TYR C 3  484 ? 31.91817 55.11604  -49.99683 1.000 39.84761  ? 483  TYR A CZ    1 
ATOM   4711 O  OH    . TYR C 3  484 ? 32.92947 54.88788  -50.90828 1.000 47.12043  ? 483  TYR A OH    1 
ATOM   4712 N  N     . LEU C 3  485 ? 27.60951 58.66139  -47.98511 1.000 33.41729  ? 484  LEU A N     1 
ATOM   4713 C  CA    . LEU C 3  485 ? 27.55138 59.74773  -48.95711 1.000 36.81383  ? 484  LEU A CA    1 
ATOM   4714 C  C     . LEU C 3  485 ? 27.84148 61.09417  -48.29268 1.000 38.84734  ? 484  LEU A C     1 
ATOM   4715 O  O     . LEU C 3  485 ? 28.61132 61.91502  -48.82149 1.000 40.81172  ? 484  LEU A O     1 
ATOM   4716 C  CB    . LEU C 3  485 ? 26.17219 59.73399  -49.61606 1.000 37.77264  ? 484  LEU A CB    1 
ATOM   4717 C  CG    . LEU C 3  485 ? 25.87688 60.38960  -50.95067 1.000 43.27997  ? 484  LEU A CG    1 
ATOM   4718 C  CD1   . LEU C 3  485 ? 26.54859 59.63708  -52.06227 1.000 41.75942  ? 484  LEU A CD1   1 
ATOM   4719 C  CD2   . LEU C 3  485 ? 24.36885 60.40221  -51.15056 1.000 47.92385  ? 484  LEU A CD2   1 
ATOM   4720 N  N     . ALA C 3  486 ? 27.22884 61.33782  -47.12766 1.000 37.34959  ? 485  ALA A N     1 
ATOM   4721 C  CA    . ALA C 3  486 ? 27.54424 62.54781  -46.36343 1.000 30.01079  ? 485  ALA A CA    1 
ATOM   4722 C  C     . ALA C 3  486 ? 29.02819 62.60350  -46.02493 1.000 30.11999  ? 485  ALA A C     1 
ATOM   4723 O  O     . ALA C 3  486 ? 29.64873 63.67534  -46.07438 1.000 33.51189  ? 485  ALA A O     1 
ATOM   4724 C  CB    . ALA C 3  486 ? 26.70712 62.60796  -45.08152 1.000 23.22831  ? 485  ALA A CB    1 
ATOM   4725 N  N     . LEU C 3  487 ? 29.61727 61.45292  -45.68313 1.000 24.51901  ? 486  LEU A N     1 
ATOM   4726 C  CA    . LEU C 3  487 ? 31.05207 61.41400  -45.41918 1.000 25.24158  ? 486  LEU A CA    1 
ATOM   4727 C  C     . LEU C 3  487 ? 31.86460 61.76540  -46.66882 1.000 29.00306  ? 486  LEU A C     1 
ATOM   4728 O  O     . LEU C 3  487 ? 32.85659 62.49587  -46.58718 1.000 35.56144  ? 486  LEU A O     1 
ATOM   4729 C  CB    . LEU C 3  487 ? 31.44186 60.03800  -44.87452 1.000 29.94110  ? 486  LEU A CB    1 
ATOM   4730 C  CG    . LEU C 3  487 ? 30.99572 59.68663  -43.44354 1.000 35.48480  ? 486  LEU A CG    1 
ATOM   4731 C  CD1   . LEU C 3  487 ? 31.31537 58.20188  -43.07775 1.000 31.31242  ? 486  LEU A CD1   1 
ATOM   4732 C  CD2   . LEU C 3  487 ? 31.62902 60.63761  -42.42930 1.000 22.23052  ? 486  LEU A CD2   1 
ATOM   4733 N  N     . GLN C 3  488 ? 31.46106 61.26213  -47.83618 1.000 28.62516  ? 487  GLN A N     1 
ATOM   4734 C  CA    . GLN C 3  488 ? 32.23081 61.54317  -49.04700 1.000 28.67879  ? 487  GLN A CA    1 
ATOM   4735 C  C     . GLN C 3  488 ? 32.16380 63.01904  -49.41815 1.000 35.21216  ? 487  GLN A C     1 
ATOM   4736 O  O     . GLN C 3  488 ? 33.14545 63.58376  -49.91181 1.000 36.24101  ? 487  GLN A O     1 
ATOM   4737 C  CB    . GLN C 3  488 ? 31.72881 60.70253  -50.21616 1.000 26.16745  ? 487  GLN A CB    1 
ATOM   4738 C  CG    . GLN C 3  488 ? 32.01736 59.22478  -50.10649 1.000 35.87942  ? 487  GLN A CG    1 
ATOM   4739 C  CD    . GLN C 3  488 ? 31.36047 58.44669  -51.22157 1.000 43.83206  ? 487  GLN A CD    1 
ATOM   4740 O  OE1   . GLN C 3  488 ? 30.14961 58.20613  -51.20610 1.000 48.49254  ? 487  GLN A OE1   1 
ATOM   4741 N  NE2   . GLN C 3  488 ? 32.15129 58.06254  -52.20929 1.000 44.17046  ? 487  GLN A NE2   1 
ATOM   4742 N  N     . ASP C 3  489 ? 31.01505 63.65697  -49.20006 1.000 35.37290  ? 488  ASP A N     1 
ATOM   4743 C  CA    . ASP C 3  489 ? 30.77471 64.99185  -49.72665 1.000 36.81444  ? 488  ASP A CA    1 
ATOM   4744 C  C     . ASP C 3  489 ? 30.97548 66.09571  -48.69584 1.000 37.42524  ? 488  ASP A C     1 
ATOM   4745 O  O     . ASP C 3  489 ? 30.56205 67.22383  -48.93958 1.000 37.56345  ? 488  ASP A O     1 
ATOM   4746 C  CB    . ASP C 3  489 ? 29.36426 65.07171  -50.31446 1.000 35.43556  ? 488  ASP A CB    1 
ATOM   4747 C  CG    . ASP C 3  489 ? 29.21326 64.23762  -51.57978 1.000 36.43943  ? 488  ASP A CG    1 
ATOM   4748 O  OD1   . ASP C 3  489 ? 30.23211 63.73524  -52.10119 1.000 37.59234  ? 488  ASP A OD1   1 
ATOM   4749 O  OD2   . ASP C 3  489 ? 28.07376 64.09668  -52.06174 1.000 37.12952  ? 488  ASP A OD2   1 
ATOM   4750 N  N     . SER C 3  490 ? 31.59719 65.80106  -47.56059 1.000 37.57821  ? 489  SER A N     1 
ATOM   4751 C  CA    . SER C 3  490 ? 31.80364 66.77480  -46.49941 1.000 33.84490  ? 489  SER A CA    1 
ATOM   4752 C  C     . SER C 3  490 ? 33.29154 67.04046  -46.30834 1.000 30.85524  ? 489  SER A C     1 
ATOM   4753 O  O     . SER C 3  490 ? 34.14914 66.32986  -46.83534 1.000 29.21575  ? 489  SER A O     1 
ATOM   4754 C  CB    . SER C 3  490 ? 31.17419 66.29420  -45.18773 1.000 37.81106  ? 489  SER A CB    1 
ATOM   4755 O  OG    . SER C 3  490 ? 31.63049 65.00028  -44.83021 1.000 38.53524  ? 489  SER A OG    1 
ATOM   4756 N  N     . GLY C 3  491 ? 33.59110 68.09806  -45.55650 1.000 33.01863  ? 490  GLY A N     1 
ATOM   4757 C  CA    . GLY C 3  491 ? 34.95479 68.45439  -45.25722 1.000 28.83899  ? 490  GLY A CA    1 
ATOM   4758 C  C     . GLY C 3  491 ? 35.48695 67.62809  -44.11101 1.000 30.15315  ? 490  GLY A C     1 
ATOM   4759 O  O     . GLY C 3  491 ? 34.83679 66.71235  -43.60530 1.000 28.42508  ? 490  GLY A O     1 
ATOM   4760 N  N     . LEU C 3  492 ? 36.70397 67.98161  -43.68348 1.000 31.69927  ? 491  LEU A N     1 
ATOM   4761 C  CA    . LEU C 3  492 ? 37.36909 67.29089  -42.58543 1.000 29.86811  ? 491  LEU A CA    1 
ATOM   4762 C  C     . LEU C 3  492 ? 36.55762 67.27309  -41.28598 1.000 39.68283  ? 491  LEU A C     1 
ATOM   4763 O  O     . LEU C 3  492 ? 36.78215 66.39661  -40.43926 1.000 38.40219  ? 491  LEU A O     1 
ATOM   4764 C  CB    . LEU C 3  492 ? 38.73130 67.92755  -42.35217 1.000 31.86650  ? 491  LEU A CB    1 
ATOM   4765 C  CG    . LEU C 3  492 ? 39.70989 67.68640  -43.50421 1.000 41.91875  ? 491  LEU A CG    1 
ATOM   4766 C  CD1   . LEU C 3  492 ? 41.09670 68.18696  -43.16526 1.000 35.41405  ? 491  LEU A CD1   1 
ATOM   4767 C  CD2   . LEU C 3  492 ? 39.74104 66.20015  -43.87881 1.000 32.45378  ? 491  LEU A CD2   1 
ATOM   4768 N  N     . GLU C 3  493 ? 35.62335 68.20188  -41.10305 1.000 31.32795  ? 492  GLU A N     1 
ATOM   4769 C  CA    . GLU C 3  493 ? 34.75674 68.21369  -39.93166 1.000 33.45227  ? 492  GLU A CA    1 
ATOM   4770 C  C     . GLU C 3  493 ? 33.31637 68.23834  -40.41231 1.000 31.81432  ? 492  GLU A C     1 
ATOM   4771 O  O     . GLU C 3  493 ? 33.00139 68.92656  -41.39080 1.000 34.83730  ? 492  GLU A O     1 
ATOM   4772 C  CB    . GLU C 3  493 ? 35.08352 69.42017  -38.99813 1.000 28.96093  ? 492  GLU A CB    1 
ATOM   4773 C  CG    . GLU C 3  493 ? 36.48511 69.28625  -38.36886 1.000 33.86551  ? 492  GLU A CG    1 
ATOM   4774 C  CD    . GLU C 3  493 ? 36.99814 70.52468  -37.60372 1.000 40.59449  ? 492  GLU A CD    1 
ATOM   4775 O  OE1   . GLU C 3  493 ? 38.22975 70.79813  -37.66279 1.000 40.35034  ? 492  GLU A OE1   1 
ATOM   4776 O  OE2   . GLU C 3  493 ? 36.19583 71.20498  -36.92138 1.000 43.76027  ? 492  GLU A OE2   1 
ATOM   4777 N  N     . VAL C 3  494 ? 32.44824 67.46510  -39.75487 1.000 27.74041  ? 493  VAL A N     1 
ATOM   4778 C  CA    . VAL C 3  494 ? 31.09047 67.29300  -40.26054 1.000 26.56717  ? 493  VAL A CA    1 
ATOM   4779 C  C     . VAL C 3  494 ? 30.17482 66.82548  -39.13393 1.000 31.01549  ? 493  VAL A C     1 
ATOM   4780 O  O     . VAL C 3  494 ? 30.54361 65.98275  -38.30878 1.000 27.45795  ? 493  VAL A O     1 
ATOM   4781 C  CB    . VAL C 3  494 ? 31.06616 66.32194  -41.47150 1.000 27.94229  ? 493  VAL A CB    1 
ATOM   4782 C  CG1   . VAL C 3  494 ? 31.58636 64.93199  -41.09829 1.000 25.00070  ? 493  VAL A CG1   1 
ATOM   4783 C  CG2   . VAL C 3  494 ? 29.67083 66.22070  -42.05573 1.000 25.55780  ? 493  VAL A CG2   1 
ATOM   4784 N  N     . ASN C 3  495 ? 28.97280 67.39753  -39.10769 1.000 34.93238  ? 494  ASN A N     1 
ATOM   4785 C  CA    . ASN C 3  495 ? 27.87347 66.94328  -38.27251 1.000 28.20372  ? 494  ASN A CA    1 
ATOM   4786 C  C     . ASN C 3  495 ? 26.94136 66.12732  -39.15176 1.000 29.77094  ? 494  ASN A C     1 
ATOM   4787 O  O     . ASN C 3  495 ? 26.55349 66.59291  -40.22685 1.000 33.29846  ? 494  ASN A O     1 
ATOM   4788 C  CB    . ASN C 3  495 ? 27.11550 68.13505  -37.68413 1.000 25.12145  ? 494  ASN A CB    1 
ATOM   4789 C  CG    . ASN C 3  495 ? 27.97118 68.97426  -36.73006 1.000 33.69987  ? 494  ASN A CG    1 
ATOM   4790 O  OD1   . ASN C 3  495 ? 28.58563 68.44645  -35.78862 1.000 36.69600  ? 494  ASN A OD1   1 
ATOM   4791 N  ND2   . ASN C 3  495 ? 28.00627 70.28488  -36.96605 1.000 30.31733  ? 494  ASN A ND2   1 
ATOM   4792 N  N     . ILE C 3  496 ? 26.58576 64.91949  -38.70922 1.000 29.19013  ? 495  ILE A N     1 
ATOM   4793 C  CA    . ILE C 3  496 ? 25.64193 64.06890  -39.43064 1.000 28.40188  ? 495  ILE A CA    1 
ATOM   4794 C  C     . ILE C 3  496 ? 24.49560 63.71466  -38.49019 1.000 26.90917  ? 495  ILE A C     1 
ATOM   4795 O  O     . ILE C 3  496 ? 24.73409 63.23329  -37.38058 1.000 28.85948  ? 495  ILE A O     1 
ATOM   4796 C  CB    . ILE C 3  496 ? 26.32376 62.79920  -39.98130 1.000 29.71058  ? 495  ILE A CB    1 
ATOM   4797 C  CG1   . ILE C 3  496 ? 27.38400 63.18293  -41.00985 1.000 24.93148  ? 495  ILE A CG1   1 
ATOM   4798 C  CG2   . ILE C 3  496 ? 25.29544 61.83489  -40.58521 1.000 20.39020  ? 495  ILE A CG2   1 
ATOM   4799 C  CD1   . ILE C 3  496 ? 28.30714 62.05486  -41.39602 1.000 26.67320  ? 495  ILE A CD1   1 
ATOM   4800 N  N     . VAL C 3  497 ? 23.26106 63.96189  -38.93927 1.000 24.94096  ? 496  VAL A N     1 
ATOM   4801 C  CA    . VAL C 3  497 ? 22.02980 63.59862  -38.24449 1.000 21.62998  ? 496  VAL A CA    1 
ATOM   4802 C  C     . VAL C 3  497 ? 21.35336 62.49087  -39.04498 1.000 34.61287  ? 496  VAL A C     1 
ATOM   4803 O  O     . VAL C 3  497 ? 20.94834 62.70133  -40.20008 1.000 35.98575  ? 496  VAL A O     1 
ATOM   4804 C  CB    . VAL C 3  497 ? 21.08160 64.79877  -38.09477 1.000 28.10945  ? 496  VAL A CB    1 
ATOM   4805 C  CG1   . VAL C 3  497 ? 19.85302 64.38563  -37.34187 1.000 27.34838  ? 496  VAL A CG1   1 
ATOM   4806 C  CG2   . VAL C 3  497 ? 21.77323 65.99149  -37.40017 1.000 22.98733  ? 496  VAL A CG2   1 
ATOM   4807 N  N     . THR C 3  498 ? 21.22452 61.31688  -38.42835 1.000 33.44581  ? 497  THR A N     1 
ATOM   4808 C  CA    . THR C 3  498 ? 20.54686 60.16034  -38.99304 1.000 33.52036  ? 497  THR A CA    1 
ATOM   4809 C  C     . THR C 3  498 ? 19.30835 59.85841  -38.15891 1.000 35.18123  ? 497  THR A C     1 
ATOM   4810 O  O     . THR C 3  498 ? 19.19811 60.28086  -37.00089 1.000 34.94643  ? 497  THR A O     1 
ATOM   4811 C  CB    . THR C 3  498 ? 21.47687 58.93131  -39.02600 1.000 33.91950  ? 497  THR A CB    1 
ATOM   4812 O  OG1   . THR C 3  498 ? 20.77869 57.80179  -39.55745 1.000 36.03973  ? 497  THR A OG1   1 
ATOM   4813 C  CG2   . THR C 3  498 ? 21.94167 58.57473  -37.63484 1.000 35.05892  ? 497  THR A CG2   1 
ATOM   4814 N  N     . ASP C 3  499 ? 18.36330 59.12946  -38.75634 1.000 33.83293  ? 498  ASP A N     1 
ATOM   4815 C  CA    . ASP C 3  499 ? 17.25390 58.57951  -37.98565 1.000 35.68630  ? 498  ASP A CA    1 
ATOM   4816 C  C     . ASP C 3  499 ? 17.35703 57.07390  -37.77450 1.000 35.01506  ? 498  ASP A C     1 
ATOM   4817 O  O     . ASP C 3  499 ? 16.45653 56.49226  -37.17106 1.000 40.30516  ? 498  ASP A O     1 
ATOM   4818 C  CB    . ASP C 3  499 ? 15.89873 58.93146  -38.62230 1.000 38.94733  ? 498  ASP A CB    1 
ATOM   4819 C  CG    . ASP C 3  499 ? 15.70893 58.36766  -40.02399 1.000 43.99855  ? 498  ASP A CG    1 
ATOM   4820 O  OD1   . ASP C 3  499 ? 16.43243 57.44341  -40.46450 1.000 46.84277  ? 498  ASP A OD1   1 
ATOM   4821 O  OD2   . ASP C 3  499 ? 14.80261 58.88545  -40.70474 1.000 47.23818  ? 498  ASP A OD2   1 
ATOM   4822 N  N     . SER C 3  500 ? 18.43767 56.43702  -38.22551 1.000 32.63025  ? 499  SER A N     1 
ATOM   4823 C  CA    . SER C 3  500 ? 18.58951 54.98581  -38.14935 1.000 33.07784  ? 499  SER A CA    1 
ATOM   4824 C  C     . SER C 3  500 ? 19.33981 54.60657  -36.87613 1.000 32.02771  ? 499  SER A C     1 
ATOM   4825 O  O     . SER C 3  500 ? 20.54862 54.83824  -36.76578 1.000 29.75314  ? 499  SER A O     1 
ATOM   4826 C  CB    . SER C 3  500 ? 19.33449 54.45810  -39.37325 1.000 35.39073  ? 499  SER A CB    1 
ATOM   4827 O  OG    . SER C 3  500 ? 19.95352 53.21296  -39.07184 1.000 38.15264  ? 499  SER A OG    1 
ATOM   4828 N  N     . GLN C 3  501 ? 18.64770 53.99091  -35.92086 1.000 35.69569  ? 500  GLN A N     1 
ATOM   4829 C  CA    . GLN C 3  501 ? 19.40612 53.53910  -34.76618 1.000 42.53817  ? 500  GLN A CA    1 
ATOM   4830 C  C     . GLN C 3  501 ? 20.22579 52.29828  -35.08671 1.000 37.08757  ? 500  GLN A C     1 
ATOM   4831 O  O     . GLN C 3  501 ? 21.20558 52.04070  -34.39421 1.000 39.45474  ? 500  GLN A O     1 
ATOM   4832 C  CB    . GLN C 3  501 ? 18.49670 53.31884  -33.55600 1.000 57.51488  ? 500  GLN A CB    1 
ATOM   4833 C  CG    . GLN C 3  501 ? 17.54593 52.15890  -33.61888 1.000 67.06891  ? 500  GLN A CG    1 
ATOM   4834 C  CD    . GLN C 3  501 ? 16.60197 52.15999  -32.43296 1.000 72.02464  ? 500  GLN A CD    1 
ATOM   4835 O  OE1   . GLN C 3  501 ? 16.82561 51.46170  -31.43833 1.000 75.61018  ? 500  GLN A OE1   1 
ATOM   4836 N  NE2   . GLN C 3  501 ? 15.54617 52.96482  -32.52430 1.000 71.89193  ? 500  GLN A NE2   1 
ATOM   4837 N  N     . TYR C 3  502 ? 19.88455 51.56900  -36.15261 1.000 33.34599  ? 501  TYR A N     1 
ATOM   4838 C  CA    . TYR C 3  502 ? 20.78129 50.55623  -36.70726 1.000 30.05972  ? 501  TYR A CA    1 
ATOM   4839 C  C     . TYR C 3  502 ? 22.15054 51.14712  -37.06241 1.000 35.08283  ? 501  TYR A C     1 
ATOM   4840 O  O     . TYR C 3  502 ? 23.19403 50.70267  -36.55217 1.000 38.30712  ? 501  TYR A O     1 
ATOM   4841 C  CB    . TYR C 3  502 ? 20.11784 49.91924  -37.93454 1.000 30.09610  ? 501  TYR A CB    1 
ATOM   4842 C  CG    . TYR C 3  502 ? 21.02565 49.04556  -38.77285 1.000 33.65410  ? 501  TYR A CG    1 
ATOM   4843 C  CD1   . TYR C 3  502 ? 21.37881 47.76341  -38.34544 1.000 36.06219  ? 501  TYR A CD1   1 
ATOM   4844 C  CD2   . TYR C 3  502 ? 21.52445 49.49469  -39.99653 1.000 31.44332  ? 501  TYR A CD2   1 
ATOM   4845 C  CE1   . TYR C 3  502 ? 22.20990 46.94964  -39.10927 1.000 39.65445  ? 501  TYR A CE1   1 
ATOM   4846 C  CE2   . TYR C 3  502 ? 22.36265 48.69405  -40.77163 1.000 36.34889  ? 501  TYR A CE2   1 
ATOM   4847 C  CZ    . TYR C 3  502 ? 22.70361 47.41955  -40.32071 1.000 42.70548  ? 501  TYR A CZ    1 
ATOM   4848 O  OH    . TYR C 3  502 ? 23.52971 46.60630  -41.07361 1.000 42.70085  ? 501  TYR A OH    1 
ATOM   4849 N  N     . ALA C 3  503 ? 22.17249 52.15366  -37.94960 1.000 33.24795  ? 502  ALA A N     1 
ATOM   4850 C  CA    . ALA C 3  503 ? 23.45532 52.71780  -38.36926 1.000 26.46222  ? 502  ALA A CA    1 
ATOM   4851 C  C     . ALA C 3  503 ? 24.17710 53.37515  -37.20624 1.000 25.89870  ? 502  ALA A C     1 
ATOM   4852 O  O     . ALA C 3  503 ? 25.39958 53.24327  -37.06575 1.000 25.69417  ? 502  ALA A O     1 
ATOM   4853 C  CB    . ALA C 3  503 ? 23.25562 53.70854  -39.50157 1.000 25.36421  ? 502  ALA A CB    1 
ATOM   4854 N  N     . LEU C 3  504 ? 23.43870 54.10572  -36.37443 1.000 33.74344  ? 503  LEU A N     1 
ATOM   4855 C  CA    . LEU C 3  504 ? 24.02940 54.72437  -35.19584 1.000 31.84113  ? 503  LEU A CA    1 
ATOM   4856 C  C     . LEU C 3  504 ? 24.66494 53.67813  -34.28484 1.000 36.06087  ? 503  LEU A C     1 
ATOM   4857 O  O     . LEU C 3  504 ? 25.78379 53.86770  -33.78803 1.000 32.94165  ? 503  LEU A O     1 
ATOM   4858 C  CB    . LEU C 3  504 ? 22.95085 55.49590  -34.44613 1.000 32.61840  ? 503  LEU A CB    1 
ATOM   4859 C  CG    . LEU C 3  504 ? 23.37297 56.04078  -33.09221 1.000 34.26140  ? 503  LEU A CG    1 
ATOM   4860 C  CD1   . LEU C 3  504 ? 24.11304 57.33962  -33.28247 1.000 27.27232  ? 503  LEU A CD1   1 
ATOM   4861 C  CD2   . LEU C 3  504 ? 22.15240 56.21046  -32.21000 1.000 39.26392  ? 503  LEU A CD2   1 
ATOM   4862 N  N     . GLY C 3  505 ? 23.95958 52.56646  -34.04738 1.000 33.00366  ? 504  GLY A N     1 
ATOM   4863 C  CA    . GLY C 3  505 ? 24.50487 51.53155  -33.19271 1.000 32.94663  ? 504  GLY A CA    1 
ATOM   4864 C  C     . GLY C 3  505 ? 25.78540 50.94285  -33.75211 1.000 36.60280  ? 504  GLY A C     1 
ATOM   4865 O  O     . GLY C 3  505 ? 26.72015 50.64148  -33.00409 1.000 40.20357  ? 504  GLY A O     1 
ATOM   4866 N  N     . ILE C 3  506 ? 25.85972 50.79664  -35.07695 1.000 32.63148  ? 505  ILE A N     1 
ATOM   4867 C  CA    . ILE C 3  506 ? 27.09943 50.30107  -35.66732 1.000 34.02027  ? 505  ILE A CA    1 
ATOM   4868 C  C     . ILE C 3  506 ? 28.22798 51.31113  -35.48334 1.000 34.75319  ? 505  ILE A C     1 
ATOM   4869 O  O     . ILE C 3  506 ? 29.29704 50.98601  -34.95194 1.000 37.57407  ? 505  ILE A O     1 
ATOM   4870 C  CB    . ILE C 3  506 ? 26.90007 49.94508  -37.15212 1.000 34.26801  ? 505  ILE A CB    1 
ATOM   4871 C  CG1   . ILE C 3  506 ? 26.16783 48.59893  -37.27316 1.000 31.35507  ? 505  ILE A CG1   1 
ATOM   4872 C  CG2   . ILE C 3  506 ? 28.26615 49.90865  -37.88844 1.000 24.83196  ? 505  ILE A CG2   1 
ATOM   4873 C  CD1   . ILE C 3  506 ? 25.70956 48.28721  -38.66900 1.000 32.01811  ? 505  ILE A CD1   1 
ATOM   4874 N  N     . ILE C 3  507 ? 28.01740 52.54912  -35.92271 1.000 35.18962  ? 506  ILE A N     1 
ATOM   4875 C  CA    . ILE C 3  507 ? 29.15287 53.46916  -35.98606 1.000 33.50239  ? 506  ILE A CA    1 
ATOM   4876 C  C     . ILE C 3  507 ? 29.59006 53.89624  -34.59032 1.000 34.12175  ? 506  ILE A C     1 
ATOM   4877 O  O     . ILE C 3  507 ? 30.78409 54.07143  -34.33355 1.000 35.20151  ? 506  ILE A O     1 
ATOM   4878 C  CB    . ILE C 3  507 ? 28.82133 54.67181  -36.88557 1.000 34.20348  ? 506  ILE A CB    1 
ATOM   4879 C  CG1   . ILE C 3  507 ? 28.57342 54.16928  -38.31565 1.000 23.59098  ? 506  ILE A CG1   1 
ATOM   4880 C  CG2   . ILE C 3  507 ? 29.96153 55.71767  -36.82266 1.000 21.62484  ? 506  ILE A CG2   1 
ATOM   4881 C  CD1   . ILE C 3  507 ? 27.75500 55.12220  -39.22470 1.000 21.85755  ? 506  ILE A CD1   1 
ATOM   4882 N  N     . GLN C 3  508 ? 28.64254 54.01598  -33.66229 1.000 38.64076  ? 507  GLN A N     1 
ATOM   4883 C  CA    . GLN C 3  508 ? 28.93160 54.40460  -32.28334 1.000 40.97942  ? 507  GLN A CA    1 
ATOM   4884 C  C     . GLN C 3  508 ? 29.94391 53.47575  -31.60680 1.000 41.52066  ? 507  GLN A C     1 
ATOM   4885 O  O     . GLN C 3  508 ? 30.75779 53.93714  -30.79424 1.000 38.93610  ? 507  GLN A O     1 
ATOM   4886 C  CB    . GLN C 3  508 ? 27.61325 54.42866  -31.51098 1.000 51.12745  ? 507  GLN A CB    1 
ATOM   4887 C  CG    . GLN C 3  508 ? 27.68712 55.02419  -30.14822 1.000 67.56095  ? 507  GLN A CG    1 
ATOM   4888 C  CD    . GLN C 3  508 ? 27.68906 56.51426  -30.18889 1.000 79.74862  ? 507  GLN A CD    1 
ATOM   4889 O  OE1   . GLN C 3  508 ? 28.33853 57.16196  -29.36814 1.000 85.65838  ? 507  GLN A OE1   1 
ATOM   4890 N  NE2   . GLN C 3  508 ? 26.96132 57.08269  -31.15089 1.000 83.14125  ? 507  GLN A NE2   1 
ATOM   4891 N  N     . ALA C 3  509 ? 29.91827 52.16901  -31.92598 1.000 40.57699  ? 508  ALA A N     1 
ATOM   4892 C  CA    . ALA C 3  509 ? 30.83960 51.21282  -31.32021 1.000 41.93584  ? 508  ALA A CA    1 
ATOM   4893 C  C     . ALA C 3  509 ? 32.20599 51.20296  -31.98162 1.000 40.41366  ? 508  ALA A C     1 
ATOM   4894 O  O     . ALA C 3  509 ? 33.00182 50.30031  -31.70951 1.000 44.49516  ? 508  ALA A O     1 
ATOM   4895 C  CB    . ALA C 3  509 ? 30.24879 49.79698  -31.34108 1.000 42.12192  ? 508  ALA A CB    1 
ATOM   4896 N  N     . GLN C 3  510 ? 32.47279 52.15397  -32.85043 1.000 39.72503  ? 509  GLN A N     1 
ATOM   4897 C  CA    . GLN C 3  510 ? 33.79219 52.44722  -33.39860 1.000 41.03047  ? 509  GLN A CA    1 
ATOM   4898 C  C     . GLN C 3  510 ? 34.46038 51.26583  -34.09470 1.000 35.45072  ? 509  GLN A C     1 
ATOM   4899 O  O     . GLN C 3  510 ? 35.62668 50.97374  -33.80924 1.000 37.74971  ? 509  GLN A O     1 
ATOM   4900 C  CB    . GLN C 3  510 ? 34.71581 52.94656  -32.28624 1.000 47.71470  ? 509  GLN A CB    1 
ATOM   4901 C  CG    . GLN C 3  510 ? 34.28568 54.24477  -31.58518 1.000 48.16372  ? 509  GLN A CG    1 
ATOM   4902 C  CD    . GLN C 3  510 ? 35.23971 54.60332  -30.44726 1.000 46.78263  ? 509  GLN A CD    1 
ATOM   4903 O  OE1   . GLN C 3  510 ? 36.35393 55.08204  -30.68507 1.000 46.25575  ? 509  GLN A OE1   1 
ATOM   4904 N  NE2   . GLN C 3  510 ? 34.81959 54.33904  -29.20759 1.000 42.30849  ? 509  GLN A NE2   1 
ATOM   4905 N  N     . PRO C 3  511 ? 33.79731 50.58750  -35.02327 1.000 30.58951  ? 510  PRO A N     1 
ATOM   4906 C  CA    . PRO C 3  511 ? 34.45360 49.46497  -35.70998 1.000 34.20708  ? 510  PRO A CA    1 
ATOM   4907 C  C     . PRO C 3  511 ? 35.62005 49.91817  -36.57294 1.000 38.29439  ? 510  PRO A C     1 
ATOM   4908 O  O     . PRO C 3  511 ? 35.60848 51.00494  -37.16086 1.000 45.96136  ? 510  PRO A O     1 
ATOM   4909 C  CB    . PRO C 3  511 ? 33.33724 48.88238  -36.58322 1.000 32.89996  ? 510  PRO A CB    1 
ATOM   4910 C  CG    . PRO C 3  511 ? 32.42753 50.06776  -36.84927 1.000 28.77977  ? 510  PRO A CG    1 
ATOM   4911 C  CD    . PRO C 3  511 ? 32.44663 50.84947  -35.55765 1.000 30.03686  ? 510  PRO A CD    1 
ATOM   4912 N  N     . ASP C 3  512 ? 36.63628 49.06029  -36.65333 1.000 35.33715  ? 511  ASP A N     1 
ATOM   4913 C  CA    . ASP C 3  512 ? 37.67494 49.20364  -37.65950 1.000 36.07925  ? 511  ASP A CA    1 
ATOM   4914 C  C     . ASP C 3  512 ? 37.71872 48.04280  -38.64610 1.000 42.11350  ? 511  ASP A C     1 
ATOM   4915 O  O     . ASP C 3  512 ? 38.43258 48.13955  -39.65134 1.000 46.84506  ? 511  ASP A O     1 
ATOM   4916 C  CB    . ASP C 3  512 ? 39.06202 49.38934  -37.00855 1.000 37.15008  ? 511  ASP A CB    1 
ATOM   4917 C  CG    . ASP C 3  512 ? 39.46968 48.23049  -36.09708 1.000 43.40934  ? 511  ASP A CG    1 
ATOM   4918 O  OD1   . ASP C 3  512 ? 39.15599 47.06556  -36.40702 1.000 46.97289  ? 511  ASP A OD1   1 
ATOM   4919 O  OD2   . ASP C 3  512 ? 40.14385 48.48569  -35.07068 1.000 47.77155  ? 511  ASP A OD2   1 
ATOM   4920 N  N     . GLN C 3  513 ? 36.99155 46.95206  -38.38373 1.000 42.11970  ? 512  GLN A N     1 
ATOM   4921 C  CA    . GLN C 3  513 ? 36.82375 45.83809  -39.31005 1.000 38.74887  ? 512  GLN A CA    1 
ATOM   4922 C  C     . GLN C 3  513 ? 35.34153 45.53855  -39.46881 1.000 36.72264  ? 512  GLN A C     1 
ATOM   4923 O  O     . GLN C 3  513 ? 34.54673 45.72845  -38.54241 1.000 35.11225  ? 512  GLN A O     1 
ATOM   4924 C  CB    . GLN C 3  513 ? 37.49208 44.54826  -38.83534 1.000 40.48716  ? 512  GLN A CB    1 
ATOM   4925 C  CG    . GLN C 3  513 ? 38.88406 44.66659  -38.34837 1.000 49.84533  ? 512  GLN A CG    1 
ATOM   4926 C  CD    . GLN C 3  513 ? 39.23091 43.55794  -37.36523 1.000 57.17752  ? 512  GLN A CD    1 
ATOM   4927 O  OE1   . GLN C 3  513 ? 39.16662 42.36262  -37.69459 1.000 52.94417  ? 512  GLN A OE1   1 
ATOM   4928 N  NE2   . GLN C 3  513 ? 39.58591 43.95173  -36.13939 1.000 60.40247  ? 512  GLN A NE2   1 
ATOM   4929 N  N     . SER C 3  514 ? 34.98154 45.02643  -40.63759 1.000 32.04434  ? 513  SER A N     1 
ATOM   4930 C  CA    . SER C 3  514 ? 33.60552 44.62434  -40.87509 1.000 30.87680  ? 513  SER A CA    1 
ATOM   4931 C  C     . SER C 3  514 ? 33.60180 43.61541  -42.00658 1.000 33.18403  ? 513  SER A C     1 
ATOM   4932 O  O     . SER C 3  514 ? 34.52352 43.57718  -42.82693 1.000 33.82024  ? 513  SER A O     1 
ATOM   4933 C  CB    . SER C 3  514 ? 32.72168 45.83028  -41.21444 1.000 33.45952  ? 513  SER A CB    1 
ATOM   4934 O  OG    . SER C 3  514 ? 31.47710 45.43102  -41.77480 1.000 34.80876  ? 513  SER A OG    1 
ATOM   4935 N  N     . GLU C 3  515 ? 32.55760 42.79508  -42.03770 1.000 35.23156  ? 514  GLU A N     1 
ATOM   4936 C  CA    . GLU C 3  515 ? 32.34355 41.89232  -43.16214 1.000 40.26662  ? 514  GLU A CA    1 
ATOM   4937 C  C     . GLU C 3  515 ? 31.50992 42.53710  -44.26588 1.000 39.04838  ? 514  GLU A C     1 
ATOM   4938 O  O     . GLU C 3  515 ? 31.31917 41.93215  -45.32660 1.000 39.28351  ? 514  GLU A O     1 
ATOM   4939 C  CB    . GLU C 3  515 ? 31.69637 40.58813  -42.68582 1.000 43.90205  ? 514  GLU A CB    1 
ATOM   4940 C  CG    . GLU C 3  515 ? 30.42572 40.75610  -41.89535 1.000 55.79200  ? 514  GLU A CG    1 
ATOM   4941 C  CD    . GLU C 3  515 ? 29.87999 39.41750  -41.37369 1.000 66.67657  ? 514  GLU A CD    1 
ATOM   4942 O  OE1   . GLU C 3  515 ? 30.68784 38.53933  -40.98359 1.000 64.58331  ? 514  GLU A OE1   1 
ATOM   4943 O  OE2   . GLU C 3  515 ? 28.63702 39.24732  -41.37138 1.000 70.30979  ? 514  GLU A OE2   1 
ATOM   4944 N  N     . SER C 3  516 ? 31.03940 43.75807  -44.04569 1.000 32.85806  ? 515  SER A N     1 
ATOM   4945 C  CA    . SER C 3  516 ? 30.31635 44.51307  -45.04814 1.000 31.89419  ? 515  SER A CA    1 
ATOM   4946 C  C     . SER C 3  516 ? 31.29218 45.41973  -45.79965 1.000 39.07106  ? 515  SER A C     1 
ATOM   4947 O  O     . SER C 3  516 ? 32.11266 46.10098  -45.17864 1.000 40.41601  ? 515  SER A O     1 
ATOM   4948 C  CB    . SER C 3  516 ? 29.21201 45.32055  -44.37113 1.000 30.51289  ? 515  SER A CB    1 
ATOM   4949 O  OG    . SER C 3  516 ? 28.83764 46.44517  -45.14117 1.000 35.03957  ? 515  SER A OG    1 
ATOM   4950 N  N     . GLU C 3  517 ? 31.23729 45.39300  -47.13726 1.000 39.45235  ? 516  GLU A N     1 
ATOM   4951 C  CA    . GLU C 3  517 ? 32.08383 46.30181  -47.90433 1.000 39.29692  ? 516  GLU A CA    1 
ATOM   4952 C  C     . GLU C 3  517 ? 31.69083 47.74551  -47.63533 1.000 39.33412  ? 516  GLU A C     1 
ATOM   4953 O  O     . GLU C 3  517 ? 32.55329 48.61858  -47.48992 1.000 40.33728  ? 516  GLU A O     1 
ATOM   4954 C  CB    . GLU C 3  517 ? 32.00335 45.99388  -49.40600 1.000 35.61666  ? 516  GLU A CB    1 
ATOM   4955 N  N     . LEU C 3  518 ? 30.38685 48.00590  -47.54771 1.000 37.81210  ? 517  LEU A N     1 
ATOM   4956 C  CA    . LEU C 3  518 ? 29.89718 49.36079  -47.31955 1.000 34.91729  ? 517  LEU A CA    1 
ATOM   4957 C  C     . LEU C 3  518 ? 30.37547 49.89807  -45.97239 1.000 35.07318  ? 517  LEU A C     1 
ATOM   4958 O  O     . LEU C 3  518 ? 30.90244 51.01271  -45.89146 1.000 36.28959  ? 517  LEU A O     1 
ATOM   4959 C  CB    . LEU C 3  518 ? 28.37258 49.36093  -47.41501 1.000 36.58877  ? 517  LEU A CB    1 
ATOM   4960 C  CG    . LEU C 3  518 ? 27.58539 50.61267  -47.04997 1.000 40.87346  ? 517  LEU A CG    1 
ATOM   4961 C  CD1   . LEU C 3  518 ? 28.05546 51.81178  -47.86108 1.000 33.83837  ? 517  LEU A CD1   1 
ATOM   4962 C  CD2   . LEU C 3  518 ? 26.11524 50.32091  -47.29492 1.000 43.84097  ? 517  LEU A CD2   1 
ATOM   4963 N  N     . VAL C 3  519 ? 30.23823 49.10079  -44.90648 1.000 35.30558  ? 518  VAL A N     1 
ATOM   4964 C  CA    . VAL C 3  519 ? 30.71710 49.54367  -43.59916 1.000 37.44525  ? 518  VAL A CA    1 
ATOM   4965 C  C     . VAL C 3  519 ? 32.22675 49.74960  -43.62111 1.000 42.05259  ? 518  VAL A C     1 
ATOM   4966 O  O     . VAL C 3  519 ? 32.74060 50.66961  -42.97784 1.000 45.76766  ? 518  VAL A O     1 
ATOM   4967 C  CB    . VAL C 3  519 ? 30.28653 48.56257  -42.49092 1.000 33.38144  ? 518  VAL A CB    1 
ATOM   4968 C  CG1   . VAL C 3  519 ? 30.96558 48.90772  -41.17051 1.000 27.01046  ? 518  VAL A CG1   1 
ATOM   4969 C  CG2   . VAL C 3  519 ? 28.78845 48.62348  -42.30003 1.000 33.39931  ? 518  VAL A CG2   1 
ATOM   4970 N  N     . ASN C 3  520 ? 32.96218 48.92283  -44.37571 1.000 38.62532  ? 519  ASN A N     1 
ATOM   4971 C  CA    . ASN C 3  520 ? 34.40234 49.15411  -44.50464 1.000 37.53131  ? 519  ASN A CA    1 
ATOM   4972 C  C     . ASN C 3  520 ? 34.69973 50.49742  -45.17617 1.000 37.29933  ? 519  ASN A C     1 
ATOM   4973 O  O     . ASN C 3  520 ? 35.59572 51.23100  -44.73401 1.000 39.62316  ? 519  ASN A O     1 
ATOM   4974 C  CB    . ASN C 3  520 ? 35.07311 48.00768  -45.27207 1.000 36.69126  ? 519  ASN A CB    1 
ATOM   4975 C  CG    . ASN C 3  520 ? 35.40833 46.80361  -44.37181 1.000 39.92279  ? 519  ASN A CG    1 
ATOM   4976 O  OD1   . ASN C 3  520 ? 35.55001 46.93715  -43.15704 1.000 41.42440  ? 519  ASN A OD1   1 
ATOM   4977 N  ND2   . ASN C 3  520 ? 35.52015 45.62924  -44.97346 1.000 38.21119  ? 519  ASN A ND2   1 
ATOM   4978 N  N     . GLN C 3  521 ? 33.96105 50.83788  -46.24497 1.000 36.20278  ? 520  GLN A N     1 
ATOM   4979 C  CA    . GLN C 3  521 ? 34.14181 52.14003  -46.89747 1.000 38.44652  ? 520  GLN A CA    1 
ATOM   4980 C  C     . GLN C 3  521 ? 33.84937 53.28095  -45.93114 1.000 36.77948  ? 520  GLN A C     1 
ATOM   4981 O  O     . GLN C 3  521 ? 34.57694 54.28418  -45.88894 1.000 35.82034  ? 520  GLN A O     1 
ATOM   4982 C  CB    . GLN C 3  521 ? 33.23268 52.25083  -48.12443 1.000 40.58169  ? 520  GLN A CB    1 
ATOM   4983 C  CG    . GLN C 3  521 ? 33.65485 51.41695  -49.32883 1.000 46.06991  ? 520  GLN A CG    1 
ATOM   4984 C  CD    . GLN C 3  521 ? 32.53029 51.25936  -50.34431 1.000 56.30593  ? 520  GLN A CD    1 
ATOM   4985 O  OE1   . GLN C 3  521 ? 32.77043 51.14838  -51.54643 1.000 61.76965  ? 520  GLN A OE1   1 
ATOM   4986 N  NE2   . GLN C 3  521 ? 31.29327 51.24517  -49.86079 1.000 59.02836  ? 520  GLN A NE2   1 
ATOM   4987 N  N     . ILE C 3  522 ? 32.78961 53.12436  -45.13223 1.000 35.66037  ? 521  ILE A N     1 
ATOM   4988 C  CA    . ILE C 3  522 ? 32.44047 54.11544  -44.12249 1.000 31.94589  ? 521  ILE A CA    1 
ATOM   4989 C  C     . ILE C 3  522 ? 33.56505 54.25970  -43.10870 1.000 35.24778  ? 521  ILE A C     1 
ATOM   4990 O  O     . ILE C 3  522 ? 33.92296 55.37674  -42.72004 1.000 34.48243  ? 521  ILE A O     1 
ATOM   4991 C  CB    . ILE C 3  522 ? 31.10390 53.73566  -43.45698 1.000 33.75553  ? 521  ILE A CB    1 
ATOM   4992 C  CG1   . ILE C 3  522 ? 29.96081 53.92845  -44.45365 1.000 28.94340  ? 521  ILE A CG1   1 
ATOM   4993 C  CG2   . ILE C 3  522 ? 30.85930 54.52047  -42.18632 1.000 21.92114  ? 521  ILE A CG2   1 
ATOM   4994 C  CD1   . ILE C 3  522 ? 28.62464 53.43592  -43.96188 1.000 27.91022  ? 521  ILE A CD1   1 
ATOM   4995 N  N     . ILE C 3  523 ? 34.14075 53.13532  -42.66479 1.000 38.78070  ? 522  ILE A N     1 
ATOM   4996 C  CA    . ILE C 3  523 ? 35.23061 53.18568  -41.68843 1.000 35.14396  ? 522  ILE A CA    1 
ATOM   4997 C  C     . ILE C 3  523 ? 36.42268 53.94226  -42.26815 1.000 35.85341  ? 522  ILE A C     1 
ATOM   4998 O  O     . ILE C 3  523 ? 37.08131 54.72821  -41.57681 1.000 33.31865  ? 522  ILE A O     1 
ATOM   4999 C  CB    . ILE C 3  523 ? 35.62095 51.76022  -41.23650 1.000 34.77156  ? 522  ILE A CB    1 
ATOM   5000 C  CG1   . ILE C 3  523 ? 34.54100 51.12969  -40.34057 1.000 30.51241  ? 522  ILE A CG1   1 
ATOM   5001 C  CG2   . ILE C 3  523 ? 36.98431 51.74353  -40.51532 1.000 27.43179  ? 522  ILE A CG2   1 
ATOM   5002 C  CD1   . ILE C 3  523 ? 34.69170 49.58892  -40.18476 1.000 26.23110  ? 522  ILE A CD1   1 
ATOM   5003 N  N     . GLU C 3  524 ? 36.72415 53.70845  -43.54155 1.000 36.07070  ? 523  GLU A N     1 
ATOM   5004 C  CA    . GLU C 3  524 ? 37.82824 54.42424  -44.16752 1.000 37.99177  ? 523  GLU A CA    1 
ATOM   5005 C  C     . GLU C 3  524 ? 37.57567 55.93591  -44.16370 1.000 37.19404  ? 523  GLU A C     1 
ATOM   5006 O  O     . GLU C 3  524 ? 38.46157 56.73619  -43.81594 1.000 31.49195  ? 523  GLU A O     1 
ATOM   5007 C  CB    . GLU C 3  524 ? 38.03027 53.88817  -45.57975 1.000 46.60683  ? 523  GLU A CB    1 
ATOM   5008 C  CG    . GLU C 3  524 ? 39.23346 54.46575  -46.28110 1.000 63.73377  ? 523  GLU A CG    1 
ATOM   5009 C  CD    . GLU C 3  524 ? 39.42102 53.89639  -47.67482 1.000 76.98959  ? 523  GLU A CD    1 
ATOM   5010 O  OE1   . GLU C 3  524 ? 38.91140 52.78118  -47.94981 1.000 78.67615  ? 523  GLU A OE1   1 
ATOM   5011 O  OE2   . GLU C 3  524 ? 40.07843 54.57641  -48.49534 1.000 84.95202  ? 523  GLU A OE2   1 
ATOM   5012 N  N     . GLN C 3  525 ? 36.35385 56.34111  -44.50939 1.000 36.90591  ? 524  GLN A N     1 
ATOM   5013 C  CA    . GLN C 3  525 ? 35.99769 57.75785  -44.44216 1.000 37.42639  ? 524  GLN A CA    1 
ATOM   5014 C  C     . GLN C 3  525 ? 36.13941 58.31128  -43.02192 1.000 36.96645  ? 524  GLN A C     1 
ATOM   5015 O  O     . GLN C 3  525 ? 36.73095 59.37692  -42.81362 1.000 38.21811  ? 524  GLN A O     1 
ATOM   5016 C  CB    . GLN C 3  525 ? 34.57358 57.95214  -44.95543 1.000 37.30753  ? 524  GLN A CB    1 
ATOM   5017 C  CG    . GLN C 3  525 ? 34.43559 57.72344  -46.44227 1.000 38.89470  ? 524  GLN A CG    1 
ATOM   5018 C  CD    . GLN C 3  525 ? 35.26948 58.69541  -47.24804 1.000 46.21827  ? 524  GLN A CD    1 
ATOM   5019 O  OE1   . GLN C 3  525 ? 35.75625 58.35409  -48.33191 1.000 50.39231  ? 524  GLN A OE1   1 
ATOM   5020 N  NE2   . GLN C 3  525 ? 35.44087 59.92282  -46.72627 1.000 44.38889  ? 524  GLN A NE2   1 
ATOM   5021 N  N     . LEU C 3  526 ? 35.59526 57.59885  -42.02970 1.000 37.09510  ? 525  LEU A N     1 
ATOM   5022 C  CA    . LEU C 3  526 ? 35.68817 58.04114  -40.63754 1.000 32.56889  ? 525  LEU A CA    1 
ATOM   5023 C  C     . LEU C 3  526 ? 37.13729 58.20747  -40.19443 1.000 33.78010  ? 525  LEU A C     1 
ATOM   5024 O  O     . LEU C 3  526 ? 37.47016 59.14458  -39.45170 1.000 32.73054  ? 525  LEU A O     1 
ATOM   5025 C  CB    . LEU C 3  526 ? 34.97434 57.05047  -39.72955 1.000 32.54639  ? 525  LEU A CB    1 
ATOM   5026 C  CG    . LEU C 3  526 ? 33.46273 57.03404  -39.86823 1.000 32.87840  ? 525  LEU A CG    1 
ATOM   5027 C  CD1   . LEU C 3  526 ? 32.92522 55.85274  -39.09327 1.000 25.99319  ? 525  LEU A CD1   1 
ATOM   5028 C  CD2   . LEU C 3  526 ? 32.88676 58.35401  -39.35237 1.000 32.54338  ? 525  LEU A CD2   1 
ATOM   5029 N  N     . ILE C 3  527 ? 38.01790 57.30862  -40.63829 1.000 34.52420  ? 526  ILE A N     1 
ATOM   5030 C  CA    . ILE C 3  527 ? 39.42182 57.45674  -40.27481 1.000 37.65547  ? 526  ILE A CA    1 
ATOM   5031 C  C     . ILE C 3  527 ? 40.00411 58.69431  -40.93274 1.000 39.41034  ? 526  ILE A C     1 
ATOM   5032 O  O     . ILE C 3  527 ? 40.89837 59.33620  -40.37181 1.000 38.36273  ? 526  ILE A O     1 
ATOM   5033 C  CB    . ILE C 3  527 ? 40.22538 56.19454  -40.63184 1.000 37.31495  ? 526  ILE A CB    1 
ATOM   5034 C  CG1   . ILE C 3  527 ? 39.64207 54.97731  -39.90976 1.000 35.45927  ? 526  ILE A CG1   1 
ATOM   5035 C  CG2   . ILE C 3  527 ? 41.66490 56.36446  -40.23799 1.000 32.30118  ? 526  ILE A CG2   1 
ATOM   5036 C  CD1   . ILE C 3  527 ? 40.34696 53.67427  -40.23641 1.000 37.66474  ? 526  ILE A CD1   1 
ATOM   5037 N  N     . LYS C 3  528 ? 39.50796 59.06203  -42.12181 1.000 43.02702  ? 527  LYS A N     1 
ATOM   5038 C  CA    . LYS C 3  528 ? 40.06277 60.23872  -42.79580 1.000 41.25222  ? 527  LYS A CA    1 
ATOM   5039 C  C     . LYS C 3  528 ? 39.68992 61.54088  -42.07978 1.000 36.76961  ? 527  LYS A C     1 
ATOM   5040 O  O     . LYS C 3  528 ? 40.49626 62.47050  -42.02672 1.000 34.25818  ? 527  LYS A O     1 
ATOM   5041 C  CB    . LYS C 3  528 ? 39.61318 60.27086  -44.25744 1.000 39.94493  ? 527  LYS A CB    1 
ATOM   5042 C  CG    . LYS C 3  528 ? 40.43038 59.36785  -45.15688 1.000 46.35939  ? 527  LYS A CG    1 
ATOM   5043 C  CD    . LYS C 3  528 ? 39.93069 59.39355  -46.59035 1.000 54.60631  ? 527  LYS A CD    1 
ATOM   5044 C  CE    . LYS C 3  528 ? 40.78248 58.49334  -47.48491 1.000 60.41492  ? 527  LYS A CE    1 
ATOM   5045 N  NZ    . LYS C 3  528 ? 40.24429 58.40207  -48.87997 1.000 63.59322  ? 527  LYS A NZ    1 
ATOM   5046 N  N     . LYS C 3  529 ? 38.49216 61.61765  -41.50443 1.000 37.06689  ? 528  LYS A N     1 
ATOM   5047 C  CA    . LYS C 3  529 ? 37.97680 62.87032  -40.96296 1.000 32.02880  ? 528  LYS A CA    1 
ATOM   5048 C  C     . LYS C 3  529 ? 38.77500 63.33726  -39.75391 1.000 33.32836  ? 528  LYS A C     1 
ATOM   5049 O  O     . LYS C 3  529 ? 39.40400 62.54299  -39.05428 1.000 35.29227  ? 528  LYS A O     1 
ATOM   5050 C  CB    . LYS C 3  529 ? 36.51493 62.70411  -40.56412 1.000 29.97970  ? 528  LYS A CB    1 
ATOM   5051 C  CG    . LYS C 3  529 ? 35.60688 62.30308  -41.72151 1.000 31.93543  ? 528  LYS A CG    1 
ATOM   5052 C  CD    . LYS C 3  529 ? 35.55822 63.40867  -42.76495 1.000 34.92877  ? 528  LYS A CD    1 
ATOM   5053 C  CE    . LYS C 3  529 ? 34.53025 63.10830  -43.84153 1.000 36.35076  ? 528  LYS A CE    1 
ATOM   5054 N  NZ    . LYS C 3  529 ? 34.40229 64.25085  -44.80314 1.000 34.83883  ? 528  LYS A NZ    1 
ATOM   5055 N  N     . GLU C 3  530 ? 38.76691 64.65730  -39.52926 1.000 38.12632  ? 529  GLU A N     1 
ATOM   5056 C  CA    . GLU C 3  530 ? 39.26674 65.21118  -38.27121 1.000 39.89266  ? 529  GLU A CA    1 
ATOM   5057 C  C     . GLU C 3  530 ? 38.23400 65.06013  -37.16166 1.000 37.24108  ? 529  GLU A C     1 
ATOM   5058 O  O     . GLU C 3  530 ? 38.57055 64.69814  -36.03342 1.000 39.92174  ? 529  GLU A O     1 
ATOM   5059 C  CB    . GLU C 3  530 ? 39.61306 66.69505  -38.42115 1.000 47.76185  ? 529  GLU A CB    1 
ATOM   5060 C  CG    . GLU C 3  530 ? 40.58948 67.05215  -39.51768 1.000 60.19422  ? 529  GLU A CG    1 
ATOM   5061 C  CD    . GLU C 3  530 ? 42.02073 66.92768  -39.07645 1.000 73.04846  ? 529  GLU A CD    1 
ATOM   5062 O  OE1   . GLU C 3  530 ? 42.24602 66.45875  -37.93750 1.000 77.89547  ? 529  GLU A OE1   1 
ATOM   5063 O  OE2   . GLU C 3  530 ? 42.91738 67.29983  -39.86731 1.000 77.28461  ? 529  GLU A OE2   1 
ATOM   5064 N  N     . LYS C 3  531 ? 36.97525 65.37945  -37.45284 1.000 33.88724  ? 530  LYS A N     1 
ATOM   5065 C  CA    . LYS C 3  531 ? 35.93351 65.38122  -36.43799 1.000 30.64896  ? 530  LYS A CA    1 
ATOM   5066 C  C     . LYS C 3  531 ? 34.61515 64.97130  -37.06441 1.000 31.52045  ? 530  LYS A C     1 
ATOM   5067 O  O     . LYS C 3  531 ? 34.18680 65.55643  -38.06278 1.000 35.01122  ? 530  LYS A O     1 
ATOM   5068 C  CB    . LYS C 3  531 ? 35.78395 66.75433  -35.79012 1.000 33.98385  ? 530  LYS A CB    1 
ATOM   5069 C  CG    . LYS C 3  531 ? 36.87285 67.13275  -34.80066 1.000 34.61889  ? 530  LYS A CG    1 
ATOM   5070 C  CD    . LYS C 3  531 ? 36.33663 68.27404  -33.97944 1.000 32.63731  ? 530  LYS A CD    1 
ATOM   5071 C  CE    . LYS C 3  531 ? 37.41059 69.06634  -33.31844 1.000 35.52877  ? 530  LYS A CE    1 
ATOM   5072 N  NZ    . LYS C 3  531 ? 36.77723 70.26495  -32.70912 1.000 40.47724  ? 530  LYS A NZ    1 
ATOM   5073 N  N     . VAL C 3  532 ? 33.98339 63.96698  -36.47271 1.000 27.69544  ? 531  VAL A N     1 
ATOM   5074 C  CA    . VAL C 3  532 ? 32.65398 63.53016  -36.85471 1.000 25.97826  ? 531  VAL A CA    1 
ATOM   5075 C  C     . VAL C 3  532 ? 31.78154 63.59642  -35.61599 1.000 28.90566  ? 531  VAL A C     1 
ATOM   5076 O  O     . VAL C 3  532 ? 32.19806 63.16680  -34.53528 1.000 36.45687  ? 531  VAL A O     1 
ATOM   5077 C  CB    . VAL C 3  532 ? 32.67192 62.10384  -37.43523 1.000 33.96839  ? 531  VAL A CB    1 
ATOM   5078 C  CG1   . VAL C 3  532 ? 31.28475 61.70121  -37.89892 1.000 22.39272  ? 531  VAL A CG1   1 
ATOM   5079 C  CG2   . VAL C 3  532 ? 33.66555 62.03764  -38.57555 1.000 33.14421  ? 531  VAL A CG2   1 
ATOM   5080 N  N     . TYR C 3  533 ? 30.59263 64.15858  -35.76268 1.000 28.70231  ? 532  TYR A N     1 
ATOM   5081 C  CA    . TYR C 3  533 ? 29.57900 64.13072  -34.72272 1.000 26.93656  ? 532  TYR A CA    1 
ATOM   5082 C  C     . TYR C 3  533 ? 28.32803 63.54048  -35.33598 1.000 32.67702  ? 532  TYR A C     1 
ATOM   5083 O  O     . TYR C 3  533 ? 27.81947 64.06619  -36.33378 1.000 37.05101  ? 532  TYR A O     1 
ATOM   5084 C  CB    . TYR C 3  533 ? 29.28416 65.51714  -34.16219 1.000 28.56613  ? 532  TYR A CB    1 
ATOM   5085 C  CG    . TYR C 3  533 ? 28.17504 65.50235  -33.13039 1.000 28.25615  ? 532  TYR A CG    1 
ATOM   5086 C  CD1   . TYR C 3  533 ? 28.41146 65.02594  -31.83183 1.000 31.83187  ? 532  TYR A CD1   1 
ATOM   5087 C  CD2   . TYR C 3  533 ? 26.88700 65.95203  -33.45012 1.000 26.14331  ? 532  TYR A CD2   1 
ATOM   5088 C  CE1   . TYR C 3  533 ? 27.39473 65.00742  -30.86513 1.000 25.71173  ? 532  TYR A CE1   1 
ATOM   5089 C  CE2   . TYR C 3  533 ? 25.86982 65.93610  -32.50049 1.000 30.20205  ? 532  TYR A CE2   1 
ATOM   5090 C  CZ    . TYR C 3  533 ? 26.13694 65.46191  -31.20853 1.000 32.71798  ? 532  TYR A CZ    1 
ATOM   5091 O  OH    . TYR C 3  533 ? 25.14190 65.44217  -30.26822 1.000 32.18884  ? 532  TYR A OH    1 
ATOM   5092 N  N     . LEU C 3  534 ? 27.82887 62.46143  -34.73719 1.000 35.29392  ? 533  LEU A N     1 
ATOM   5093 C  CA    . LEU C 3  534 ? 26.74392 61.68388  -35.31961 1.000 35.98866  ? 533  LEU A CA    1 
ATOM   5094 C  C     . LEU C 3  534 ? 25.58154 61.66695  -34.33375 1.000 34.50363  ? 533  LEU A C     1 
ATOM   5095 O  O     . LEU C 3  534 ? 25.65715 61.02764  -33.27885 1.000 39.65166  ? 533  LEU A O     1 
ATOM   5096 C  CB    . LEU C 3  534 ? 27.22830 60.27475  -35.66811 1.000 37.69388  ? 533  LEU A CB    1 
ATOM   5097 C  CG    . LEU C 3  534 ? 26.19356 59.27092  -36.17284 1.000 38.83494  ? 533  LEU A CG    1 
ATOM   5098 C  CD1   . LEU C 3  534 ? 25.68290 59.64948  -37.56585 1.000 39.37782  ? 533  LEU A CD1   1 
ATOM   5099 C  CD2   . LEU C 3  534 ? 26.78564 57.87773  -36.16541 1.000 41.76608  ? 533  LEU A CD2   1 
ATOM   5100 N  N     . ALA C 3  535 ? 24.50390 62.34909  -34.68780 1.000 29.87329  ? 534  ALA A N     1 
ATOM   5101 C  CA    . ALA C 3  535 ? 23.33592 62.46397  -33.83771 1.000 29.37716  ? 534  ALA A CA    1 
ATOM   5102 C  C     . ALA C 3  535 ? 22.18251 61.65489  -34.40995 1.000 31.34619  ? 534  ALA A C     1 
ATOM   5103 O  O     . ALA C 3  535 ? 22.15590 61.30729  -35.59382 1.000 39.90356  ? 534  ALA A O     1 
ATOM   5104 C  CB    . ALA C 3  535 ? 22.92559 63.92772  -33.67342 1.000 32.18019  ? 534  ALA A CB    1 
ATOM   5105 N  N     . TRP C 3  536 ? 21.23193 61.34991  -33.54306 1.000 27.07566  ? 535  TRP A N     1 
ATOM   5106 C  CA    . TRP C 3  536 ? 20.03866 60.61149  -33.90266 1.000 29.25421  ? 535  TRP A CA    1 
ATOM   5107 C  C     . TRP C 3  536 ? 18.81976 61.48061  -33.63491 1.000 31.33527  ? 535  TRP A C     1 
ATOM   5108 O  O     . TRP C 3  536 ? 18.81496 62.27703  -32.69781 1.000 32.89566  ? 535  TRP A O     1 
ATOM   5109 C  CB    . TRP C 3  536 ? 19.93289 59.30808  -33.09582 1.000 31.21855  ? 535  TRP A CB    1 
ATOM   5110 C  CG    . TRP C 3  536 ? 18.71552 58.50417  -33.40361 1.000 30.40283  ? 535  TRP A CG    1 
ATOM   5111 C  CD1   . TRP C 3  536 ? 18.53932 57.63765  -34.45667 1.000 29.17737  ? 535  TRP A CD1   1 
ATOM   5112 C  CD2   . TRP C 3  536 ? 17.49196 58.49187  -32.66462 1.000 28.97194  ? 535  TRP A CD2   1 
ATOM   5113 N  NE1   . TRP C 3  536 ? 17.28072 57.08888  -34.40709 1.000 27.62026  ? 535  TRP A NE1   1 
ATOM   5114 C  CE2   . TRP C 3  536 ? 16.61555 57.59360  -33.32097 1.000 25.55124  ? 535  TRP A CE2   1 
ATOM   5115 C  CE3   . TRP C 3  536 ? 17.05149 59.14801  -31.51227 1.000 26.86213  ? 535  TRP A CE3   1 
ATOM   5116 C  CZ2   . TRP C 3  536 ? 15.32568 57.32962  -32.85622 1.000 30.07787  ? 535  TRP A CZ2   1 
ATOM   5117 C  CZ3   . TRP C 3  536 ? 15.76460 58.89294  -31.04870 1.000 28.47907  ? 535  TRP A CZ3   1 
ATOM   5118 C  CH2   . TRP C 3  536 ? 14.91719 57.98138  -31.71972 1.000 33.41088  ? 535  TRP A CH2   1 
ATOM   5119 N  N     . VAL C 3  537 ? 17.80445 61.33730  -34.48117 1.000 31.31146  ? 536  VAL A N     1 
ATOM   5120 C  CA    . VAL C 3  537 ? 16.46421 61.86383  -34.21848 1.000 34.80611  ? 536  VAL A CA    1 
ATOM   5121 C  C     . VAL C 3  537 ? 15.44558 60.79012  -34.57352 1.000 36.14010  ? 536  VAL A C     1 
ATOM   5122 O  O     . VAL C 3  537 ? 15.73254 59.86854  -35.35123 1.000 31.33727  ? 536  VAL A O     1 
ATOM   5123 C  CB    . VAL C 3  537 ? 16.16793 63.15788  -35.02077 1.000 39.10587  ? 536  VAL A CB    1 
ATOM   5124 C  CG1   . VAL C 3  537 ? 17.06983 64.32694  -34.57293 1.000 25.81657  ? 536  VAL A CG1   1 
ATOM   5125 C  CG2   . VAL C 3  537 ? 16.27947 62.89593  -36.52241 1.000 25.01598  ? 536  VAL A CG2   1 
ATOM   5126 N  N     . PRO C 3  538 ? 14.23678 60.88842  -34.01867 1.000 34.70535  ? 537  PRO A N     1 
ATOM   5127 C  CA    . PRO C 3  538 ? 13.17315 59.95838  -34.41726 1.000 32.70949  ? 537  PRO A CA    1 
ATOM   5128 C  C     . PRO C 3  538 ? 12.65193 60.26246  -35.81701 1.000 35.61288  ? 537  PRO A C     1 
ATOM   5129 O  O     . PRO C 3  538 ? 12.40113 61.41822  -36.17367 1.000 33.65417  ? 537  PRO A O     1 
ATOM   5130 C  CB    . PRO C 3  538 ? 12.09091 60.18208  -33.35918 1.000 31.25200  ? 537  PRO A CB    1 
ATOM   5131 C  CG    . PRO C 3  538 ? 12.32497 61.55838  -32.87862 1.000 35.17235  ? 537  PRO A CG    1 
ATOM   5132 C  CD    . PRO C 3  538 ? 13.80414 61.78394  -32.93878 1.000 33.30390  ? 537  PRO A CD    1 
ATOM   5133 N  N     . ALA C 3  539 ? 12.47722 59.19728  -36.59790 1.000 33.61262  ? 538  ALA A N     1 
ATOM   5134 C  CA    . ALA C 3  539 ? 11.99941 59.30007  -37.96680 1.000 34.55837  ? 538  ALA A CA    1 
ATOM   5135 C  C     . ALA C 3  539 ? 10.50993 59.63222  -38.01486 1.000 44.87279  ? 538  ALA A C     1 
ATOM   5136 O  O     . ALA C 3  539 ? 9.74782  59.34383  -37.08488 1.000 46.15026  ? 538  ALA A O     1 
ATOM   5137 C  CB    . ALA C 3  539 ? 12.25922 57.99258  -38.71687 1.000 30.85057  ? 538  ALA A CB    1 
ATOM   5138 N  N     . HIS C 3  540 ? 10.10178 60.25891  -39.12308 1.000 48.56406  ? 539  HIS A N     1 
ATOM   5139 C  CA    . HIS C 3  540 ? 8.69172  60.51739  -39.41204 1.000 50.68408  ? 539  HIS A CA    1 
ATOM   5140 C  C     . HIS C 3  540 ? 8.01463  61.29201  -38.28810 1.000 52.04601  ? 539  HIS A C     1 
ATOM   5141 O  O     . HIS C 3  540 ? 6.82383  61.11891  -38.03552 1.000 58.31356  ? 539  HIS A O     1 
ATOM   5142 C  CB    . HIS C 3  540 ? 7.93608  59.21084  -39.69731 1.000 53.31334  ? 539  HIS A CB    1 
ATOM   5143 C  CG    . HIS C 3  540 ? 8.71685  58.23431  -40.52278 1.000 59.29726  ? 539  HIS A CG    1 
ATOM   5144 N  ND1   . HIS C 3  540 ? 9.18345  58.53407  -41.78640 1.000 63.70779  ? 539  HIS A ND1   1 
ATOM   5145 C  CD2   . HIS C 3  540 ? 9.13835  56.97339  -40.25769 1.000 62.47566  ? 539  HIS A CD2   1 
ATOM   5146 C  CE1   . HIS C 3  540 ? 9.85692  57.49997  -42.26521 1.000 63.05955  ? 539  HIS A CE1   1 
ATOM   5147 N  NE2   . HIS C 3  540 ? 9.84437  56.53922  -41.35778 1.000 62.59287  ? 539  HIS A NE2   1 
ATOM   5148 N  N     . LYS C 3  541 ? 8.76418  62.14190  -37.58987 1.000 49.42898  ? 540  LYS A N     1 
ATOM   5149 C  CA    . LYS C 3  541 ? 8.18791  63.04615  -36.60166 1.000 51.02238  ? 540  LYS A CA    1 
ATOM   5150 C  C     . LYS C 3  541 ? 8.26176  64.49933  -37.04427 1.000 49.48584  ? 540  LYS A C     1 
ATOM   5151 O  O     . LYS C 3  541 ? 7.90020  65.39550  -36.26976 1.000 52.21283  ? 540  LYS A O     1 
ATOM   5152 C  CB    . LYS C 3  541 ? 8.87429  62.87625  -35.23851 1.000 50.57870  ? 540  LYS A CB    1 
ATOM   5153 C  CG    . LYS C 3  541 ? 8.63305  61.53525  -34.56595 1.000 50.65573  ? 540  LYS A CG    1 
ATOM   5154 C  CD    . LYS C 3  541 ? 7.18116  61.36534  -34.19214 1.000 53.82542  ? 540  LYS A CD    1 
ATOM   5155 C  CE    . LYS C 3  541 ? 6.87309  59.91368  -33.82509 1.000 55.51647  ? 540  LYS A CE    1 
ATOM   5156 N  NZ    . LYS C 3  541 ? 5.40491  59.68794  -33.60432 1.000 56.40218  ? 540  LYS A NZ    1 
ATOM   5157 N  N     . GLY C 3  542 ? 8.72975  64.75306  -38.26291 1.000 47.83809  ? 541  GLY A N     1 
ATOM   5158 C  CA    . GLY C 3  542 ? 8.74319  66.09130  -38.81053 1.000 51.50700  ? 541  GLY A CA    1 
ATOM   5159 C  C     . GLY C 3  542 ? 9.84243  66.99043  -38.29955 1.000 55.49877  ? 541  GLY A C     1 
ATOM   5160 O  O     . GLY C 3  542 ? 9.74409  68.21163  -38.45422 1.000 62.98120  ? 541  GLY A O     1 
ATOM   5161 N  N     . ILE C 3  543 ? 10.88088 66.43865  -37.67393 1.000 52.37883  ? 542  ILE A N     1 
ATOM   5162 C  CA    . ILE C 3  543 ? 11.99215 67.27279  -37.24383 1.000 52.16328  ? 542  ILE A CA    1 
ATOM   5163 C  C     . ILE C 3  543 ? 12.68627 67.83667  -38.47482 1.000 55.68308  ? 542  ILE A C     1 
ATOM   5164 O  O     . ILE C 3  543 ? 12.99463 67.10443  -39.42574 1.000 60.26118  ? 542  ILE A O     1 
ATOM   5165 C  CB    . ILE C 3  543 ? 12.95832 66.47944  -36.35577 1.000 49.97009  ? 542  ILE A CB    1 
ATOM   5166 C  CG1   . ILE C 3  543 ? 12.35936 66.31338  -34.96472 1.000 48.47950  ? 542  ILE A CG1   1 
ATOM   5167 C  CG2   . ILE C 3  543 ? 14.30427 67.18665  -36.26056 1.000 50.93843  ? 542  ILE A CG2   1 
ATOM   5168 C  CD1   . ILE C 3  543 ? 11.67790 65.00513  -34.75564 1.000 49.55184  ? 542  ILE A CD1   1 
ATOM   5169 N  N     . GLY C 3  544 ? 12.91824 69.14746  -38.46954 1.000 54.95045  ? 543  GLY A N     1 
ATOM   5170 C  CA    . GLY C 3  544 ? 13.40620 69.80569  -39.66481 1.000 51.03995  ? 543  GLY A CA    1 
ATOM   5171 C  C     . GLY C 3  544 ? 14.75928 69.27811  -40.09766 1.000 47.50952  ? 543  GLY A C     1 
ATOM   5172 O  O     . GLY C 3  544 ? 15.59209 68.87654  -39.28760 1.000 51.54804  ? 543  GLY A O     1 
ATOM   5173 N  N     . GLY C 3  545 ? 14.97918 69.30235  -41.39984 1.000 46.34476  ? 544  GLY A N     1 
ATOM   5174 C  CA    . GLY C 3  545 ? 16.18983 68.75109  -41.96220 1.000 43.61785  ? 544  GLY A CA    1 
ATOM   5175 C  C     . GLY C 3  545 ? 15.91670 67.31112  -42.29889 1.000 39.22378  ? 544  GLY A C     1 
ATOM   5176 O  O     . GLY C 3  545 ? 15.93606 66.90835  -43.47195 1.000 39.69032  ? 544  GLY A O     1 
ATOM   5177 N  N     . ASN C 3  546 ? 15.63071 66.53587  -41.24975 1.000 39.21803  ? 545  ASN A N     1 
ATOM   5178 C  CA    . ASN C 3  546 ? 15.20319 65.15795  -41.44391 1.000 36.71578  ? 545  ASN A CA    1 
ATOM   5179 C  C     . ASN C 3  546 ? 13.95181 65.09868  -42.30371 1.000 38.50423  ? 545  ASN A C     1 
ATOM   5180 O  O     . ASN C 3  546 ? 13.84258 64.25140  -43.19521 1.000 37.14493  ? 545  ASN A O     1 
ATOM   5181 C  CB    . ASN C 3  546 ? 14.95266 64.47950  -40.09564 1.000 33.15508  ? 545  ASN A CB    1 
ATOM   5182 C  CG    . ASN C 3  546 ? 14.56427 63.01423  -40.24949 1.000 30.39159  ? 545  ASN A CG    1 
ATOM   5183 O  OD1   . ASN C 3  546 ? 13.40259 62.64142  -40.07258 1.000 28.72695  ? 545  ASN A OD1   1 
ATOM   5184 N  ND2   . ASN C 3  546 ? 15.53807 62.17976  -40.59672 1.000 28.13856  ? 545  ASN A ND2   1 
ATOM   5185 N  N     . GLU C 3  547 ? 12.99216 65.98859  -42.05008 1.000 41.20541  ? 546  GLU A N     1 
ATOM   5186 C  CA    . GLU C 3  547 ? 11.77961 65.99784  -42.86002 1.000 45.75267  ? 546  GLU A CA    1 
ATOM   5187 C  C     . GLU C 3  547 ? 12.10881 66.19528  -44.33902 1.000 44.00181  ? 546  GLU A C     1 
ATOM   5188 O  O     . GLU C 3  547 ? 11.59283 65.47071  -45.20428 1.000 42.70497  ? 546  GLU A O     1 
ATOM   5189 C  CB    . GLU C 3  547 ? 10.82641 67.08069  -42.36367 1.000 54.22271  ? 546  GLU A CB    1 
ATOM   5190 C  CG    . GLU C 3  547 ? 9.37673  66.76293  -42.68113 1.000 67.07801  ? 546  GLU A CG    1 
ATOM   5191 C  CD    . GLU C 3  547 ? 8.54028  68.00182  -42.90620 1.000 76.89553  ? 546  GLU A CD    1 
ATOM   5192 O  OE1   . GLU C 3  547 ? 8.93083  69.07816  -42.40526 1.000 79.54922  ? 546  GLU A OE1   1 
ATOM   5193 O  OE2   . GLU C 3  547 ? 7.49963  67.89654  -43.59210 1.000 80.31377  ? 546  GLU A OE2   1 
ATOM   5194 N  N     . GLN C 3  548 ? 12.99192 67.15927  -44.64233 1.000 39.87200  ? 547  GLN A N     1 
ATOM   5195 C  CA    . GLN C 3  548 ? 13.35968 67.43713  -46.02851 1.000 42.31232  ? 547  GLN A CA    1 
ATOM   5196 C  C     . GLN C 3  548 ? 14.00951 66.22241  -46.67802 1.000 46.62007  ? 547  GLN A C     1 
ATOM   5197 O  O     . GLN C 3  548 ? 13.62529 65.81226  -47.78385 1.000 53.82828  ? 547  GLN A O     1 
ATOM   5198 C  CB    . GLN C 3  548 ? 14.29729 68.64623  -46.10360 1.000 42.05105  ? 547  GLN A CB    1 
ATOM   5199 C  CG    . GLN C 3  548 ? 13.59560 69.99146  -46.03583 1.000 50.29595  ? 547  GLN A CG    1 
ATOM   5200 C  CD    . GLN C 3  548 ? 12.88956 70.23568  -44.70832 1.000 58.28578  ? 547  GLN A CD    1 
ATOM   5201 O  OE1   . GLN C 3  548 ? 11.68967 69.99668  -44.57325 1.000 62.00690  ? 547  GLN A OE1   1 
ATOM   5202 N  NE2   . GLN C 3  548 ? 13.63399 70.71534  -43.72435 1.000 61.30042  ? 547  GLN A NE2   1 
ATOM   5203 N  N     . VAL C 3  549 ? 14.99673 65.62508  -46.00509 1.000 39.31349  ? 548  VAL A N     1 
ATOM   5204 C  CA    . VAL C 3  549 ? 15.69921 64.52667  -46.66381 1.000 39.77996  ? 548  VAL A CA    1 
ATOM   5205 C  C     . VAL C 3  549 ? 14.80259 63.29635  -46.77090 1.000 40.23779  ? 548  VAL A C     1 
ATOM   5206 O  O     . VAL C 3  549 ? 14.88662 62.54397  -47.75467 1.000 38.08449  ? 548  VAL A O     1 
ATOM   5207 C  CB    . VAL C 3  549 ? 17.02663 64.20169  -45.95573 1.000 38.10705  ? 548  VAL A CB    1 
ATOM   5208 C  CG1   . VAL C 3  549 ? 16.77905 63.73069  -44.52504 1.000 38.24047  ? 548  VAL A CG1   1 
ATOM   5209 C  CG2   . VAL C 3  549 ? 17.81260 63.16110  -46.76884 1.000 34.76321  ? 548  VAL A CG2   1 
ATOM   5210 N  N     . ASP C 3  550 ? 13.92628 63.07339  -45.78359 1.000 40.08570  ? 549  ASP A N     1 
ATOM   5211 C  CA    . ASP C 3  550 ? 12.97887 61.97259  -45.87640 1.000 41.43017  ? 549  ASP A CA    1 
ATOM   5212 C  C     . ASP C 3  550 ? 12.06031 62.15181  -47.07423 1.000 44.09077  ? 549  ASP A C     1 
ATOM   5213 O  O     . ASP C 3  550 ? 11.80495 61.19252  -47.81495 1.000 44.67800  ? 549  ASP A O     1 
ATOM   5214 C  CB    . ASP C 3  550 ? 12.16305 61.85433  -44.59120 1.000 40.33860  ? 549  ASP A CB    1 
ATOM   5215 C  CG    . ASP C 3  550 ? 11.04853 60.82950  -44.70985 1.000 49.51184  ? 549  ASP A CG    1 
ATOM   5216 O  OD1   . ASP C 3  550 ? 11.34821 59.62486  -44.89063 1.000 54.04298  ? 549  ASP A OD1   1 
ATOM   5217 O  OD2   . ASP C 3  550 ? 9.86829  61.22481  -44.63014 1.000 54.92172  ? 549  ASP A OD2   1 
ATOM   5218 N  N     . LYS C 3  551 ? 11.56901 63.37937  -47.28690 1.000 42.22531  ? 550  LYS A N     1 
ATOM   5219 C  CA    . LYS C 3  551 ? 10.78054 63.67745  -48.47931 1.000 45.95555  ? 550  LYS A CA    1 
ATOM   5220 C  C     . LYS C 3  551 ? 11.56533 63.35521  -49.74629 1.000 47.33406  ? 550  LYS A C     1 
ATOM   5221 O  O     . LYS C 3  551 ? 11.05034 62.70333  -50.66260 1.000 52.19033  ? 550  LYS A O     1 
ATOM   5222 C  CB    . LYS C 3  551 ? 10.36730 65.14649  -48.46058 1.000 52.38384  ? 550  LYS A CB    1 
ATOM   5223 C  CG    . LYS C 3  551 ? 9.11021  65.46413  -49.22139 1.000 61.49353  ? 550  LYS A CG    1 
ATOM   5224 C  CD    . LYS C 3  551 ? 8.38568  66.63132  -48.55183 1.000 73.15645  ? 550  LYS A CD    1 
ATOM   5225 C  CE    . LYS C 3  551 ? 8.13349  66.34122  -47.06136 1.000 78.99745  ? 550  LYS A CE    1 
ATOM   5226 N  NZ    . LYS C 3  551 ? 7.49506  67.47571  -46.32463 1.000 81.12045  ? 550  LYS A NZ    1 
ATOM   5227 N  N     . LEU C 3  552 ? 12.82882 63.78708  -49.79901 1.000 43.00612  ? 551  LEU A N     1 
ATOM   5228 C  CA    . LEU C 3  552 ? 13.65470 63.58673  -50.98762 1.000 41.44395  ? 551  LEU A CA    1 
ATOM   5229 C  C     . LEU C 3  552 ? 13.83994 62.09871  -51.31445 1.000 48.39741  ? 551  LEU A C     1 
ATOM   5230 O  O     . LEU C 3  552 ? 13.54848 61.65369  -52.43245 1.000 51.06615  ? 551  LEU A O     1 
ATOM   5231 C  CB    . LEU C 3  552 ? 15.00572 64.26907  -50.78555 1.000 39.71154  ? 551  LEU A CB    1 
ATOM   5232 C  CG    . LEU C 3  552 ? 15.40186 65.31260  -51.82764 1.000 50.16094  ? 551  LEU A CG    1 
ATOM   5233 C  CD1   . LEU C 3  552 ? 14.31717 66.36141  -52.01197 1.000 47.48839  ? 551  LEU A CD1   1 
ATOM   5234 C  CD2   . LEU C 3  552 ? 16.71441 65.97897  -51.42487 1.000 55.37338  ? 551  LEU A CD2   1 
ATOM   5235 N  N     . VAL C 3  553 ? 14.34302 61.30745  -50.35543 1.000 46.68281  ? 552  VAL A N     1 
ATOM   5236 C  CA    . VAL C 3  553 ? 14.65251 59.90987  -50.66772 1.000 43.55791  ? 552  VAL A CA    1 
ATOM   5237 C  C     . VAL C 3  553 ? 13.42319 59.01987  -50.72770 1.000 44.61838  ? 552  VAL A C     1 
ATOM   5238 O  O     . VAL C 3  553 ? 13.54108 57.87401  -51.17424 1.000 45.49713  ? 552  VAL A O     1 
ATOM   5239 C  CB    . VAL C 3  553 ? 15.64294 59.24340  -49.68916 1.000 36.34379  ? 552  VAL A CB    1 
ATOM   5240 C  CG1   . VAL C 3  553 ? 16.91914 60.05734  -49.57881 1.000 32.47128  ? 552  VAL A CG1   1 
ATOM   5241 C  CG2   . VAL C 3  553 ? 15.00347 59.00049  -48.32819 1.000 36.21739  ? 552  VAL A CG2   1 
ATOM   5242 N  N     . SER C 3  554 ? 12.24831 59.50724  -50.30216 1.000 45.61570  ? 553  SER A N     1 
ATOM   5243 C  CA    . SER C 3  554 ? 11.01839 58.72604  -50.41228 1.000 44.86739  ? 553  SER A CA    1 
ATOM   5244 C  C     . SER C 3  554 ? 10.37360 58.81950  -51.78397 1.000 47.62625  ? 553  SER A C     1 
ATOM   5245 O  O     . SER C 3  554 ? 9.52649  57.98445  -52.10900 1.000 51.95790  ? 553  SER A O     1 
ATOM   5246 C  CB    . SER C 3  554 ? 9.99409  59.17627  -49.37532 1.000 47.77099  ? 553  SER A CB    1 
ATOM   5247 O  OG    . SER C 3  554 ? 10.29625 58.65875  -48.09333 1.000 54.61162  ? 553  SER A OG    1 
ATOM   5248 N  N     . ALA C 3  555 ? 10.76285 59.80656  -52.58899 1.000 47.75335  ? 554  ALA A N     1 
ATOM   5249 C  CA    . ALA C 3  555 ? 10.05845 60.11957  -53.82633 1.000 46.29752  ? 554  ALA A CA    1 
ATOM   5250 C  C     . ALA C 3  555 ? 9.88973  58.89189  -54.71728 1.000 49.31935  ? 554  ALA A C     1 
ATOM   5251 O  O     . ALA C 3  555 ? 8.76960  58.49851  -55.05728 1.000 51.66078  ? 554  ALA A O     1 
ATOM   5252 C  CB    . ALA C 3  555 ? 10.80286 61.23438  -54.55839 1.000 44.18259  ? 554  ALA A CB    1 
ATOM   5253 N  N     . GLY C 3  556 ? 10.98738 58.26219  -55.10979 1.000 53.60355  ? 555  GLY A N     1 
ATOM   5254 C  CA    . GLY C 3  556 ? 10.80689 57.09479  -55.95582 1.000 69.68073  ? 555  GLY A CA    1 
ATOM   5255 C  C     . GLY C 3  556 ? 10.31684 55.85007  -55.23794 1.000 76.38227  ? 555  GLY A C     1 
ATOM   5256 O  O     . GLY C 3  556 ? 9.73719  54.96863  -55.88135 1.000 67.62560  ? 555  GLY A O     1 
ATOM   5257 N  N     . ILE C 3  557 ? 10.51352 55.77160  -53.91938 1.000 49.84407  ? 556  ILE A N     1 
ATOM   5258 C  CA    . ILE C 3  557 ? 10.48151 54.50443  -53.21335 1.000 50.39548  ? 556  ILE A CA    1 
ATOM   5259 C  C     . ILE C 3  557 ? 9.20460  54.30769  -52.39792 1.000 57.00144  ? 556  ILE A C     1 
ATOM   5260 O  O     . ILE C 3  557 ? 8.72890  53.17118  -52.28410 1.000 60.06857  ? 556  ILE A O     1 
ATOM   5261 C  CB    . ILE C 3  557 ? 11.73387 54.36197  -52.32011 1.000 42.73973  ? 556  ILE A CB    1 
ATOM   5262 N  N     . ARG C 3  558 ? 8.63256  55.36767  -51.83664 1.000 60.10524  ? 557  ARG A N     1 
ATOM   5263 C  CA    . ARG C 3  558 ? 7.38759  55.25878  -51.07928 1.000 61.78563  ? 557  ARG A CA    1 
ATOM   5264 C  C     . ARG C 3  558 ? 6.25692  56.06274  -51.72511 1.000 67.18582  ? 557  ARG A C     1 
ATOM   5265 O  O     . ARG C 3  558 ? 5.08399  55.68119  -51.64632 1.000 71.27281  ? 557  ARG A O     1 
ATOM   5266 C  CB    . ARG C 3  558 ? 7.60136  55.73338  -49.64471 1.000 65.13115  ? 557  ARG A CB    1 
ATOM   5267 C  CG    . ARG C 3  558 ? 8.63792  54.93901  -48.88078 1.000 67.87614  ? 557  ARG A CG    1 
ATOM   5268 C  CD    . ARG C 3  558 ? 8.35407  54.98394  -47.38815 1.000 71.35703  ? 557  ARG A CD    1 
ATOM   5269 N  NE    . ARG C 3  558 ? 9.35527  55.74333  -46.64260 1.000 76.12328  ? 557  ARG A NE    1 
ATOM   5270 C  CZ    . ARG C 3  558 ? 10.43982 55.20806  -46.08478 1.000 76.86720  ? 557  ARG A CZ    1 
ATOM   5271 N  NH1   . ARG C 3  558 ? 10.66962 53.90084  -46.19522 1.000 74.40928  ? 557  ARG A NH1   1 
ATOM   5272 N  NH2   . ARG C 3  558 ? 11.29744 55.98181  -45.42227 1.000 76.57962  ? 557  ARG A NH2   1 
ATOM   5273 N  N     . GLU D 4  18  ? 10.64350 9.72541   6.43240   1.000 80.92961  ? 6    GLU B N     1 
ATOM   5274 C  CA    . GLU D 4  18  ? 9.82014  9.46799   5.25288   1.000 83.30662  ? 6    GLU B CA    1 
ATOM   5275 C  C     . GLU D 4  18  ? 9.86969  10.65453  4.30549   1.000 82.99054  ? 6    GLU B C     1 
ATOM   5276 O  O     . GLU D 4  18  ? 9.69645  11.79338  4.73555   1.000 81.22543  ? 6    GLU B O     1 
ATOM   5277 C  CB    . GLU D 4  18  ? 8.37293  9.17853   5.64978   1.000 83.43024  ? 6    GLU B CB    1 
ATOM   5278 N  N     . THR D 4  19  ? 10.09483 10.38470  3.01844   1.000 83.48504  ? 7    THR B N     1 
ATOM   5279 C  CA    . THR D 4  19  ? 10.29074 11.43557  2.02702   1.000 80.08406  ? 7    THR B CA    1 
ATOM   5280 C  C     . THR D 4  19  ? 8.96950  11.85347  1.38453   1.000 76.56156  ? 7    THR B C     1 
ATOM   5281 O  O     . THR D 4  19  ? 7.92250  11.23233  1.57656   1.000 78.92504  ? 7    THR B O     1 
ATOM   5282 C  CB    . THR D 4  19  ? 11.27108 10.99517  0.92945   1.000 78.96223  ? 7    THR B CB    1 
ATOM   5283 O  OG1   . THR D 4  19  ? 10.75096 9.85080   0.23737   1.000 82.28871  ? 7    THR B OG1   1 
ATOM   5284 C  CG2   . THR D 4  19  ? 12.64508 10.67142  1.50999   1.000 73.96667  ? 7    THR B CG2   1 
ATOM   5285 N  N     . VAL D 4  20  ? 9.04221  12.92804  0.60553   1.000 73.66516  ? 8    VAL B N     1 
ATOM   5286 C  CA    . VAL D 4  20  ? 7.93180  13.49503  -0.15095  1.000 74.04821  ? 8    VAL B CA    1 
ATOM   5287 C  C     . VAL D 4  20  ? 8.20806  13.24808  -1.63392  1.000 75.23057  ? 8    VAL B C     1 
ATOM   5288 O  O     . VAL D 4  20  ? 9.16602  13.81700  -2.18349  1.000 77.46714  ? 8    VAL B O     1 
ATOM   5289 C  CB    . VAL D 4  20  ? 7.75831  14.99435  0.13282   1.000 71.27994  ? 8    VAL B CB    1 
ATOM   5290 C  CG1   . VAL D 4  20  ? 6.79946  15.61475  -0.87197  1.000 67.41015  ? 8    VAL B CG1   1 
ATOM   5291 C  CG2   . VAL D 4  20  ? 7.26902  15.22680  1.55365   1.000 61.92121  ? 8    VAL B CG2   1 
ATOM   5292 N  N     . PRO D 4  21  ? 7.40705  12.43073  -2.32237  1.000 74.04537  ? 9    PRO B N     1 
ATOM   5293 C  CA    . PRO D 4  21  ? 7.66149  12.18353  -3.74884  1.000 73.49005  ? 9    PRO B CA    1 
ATOM   5294 C  C     . PRO D 4  21  ? 7.51858  13.46344  -4.56487  1.000 74.31634  ? 9    PRO B C     1 
ATOM   5295 O  O     . PRO D 4  21  ? 6.52784  14.18711  -4.45328  1.000 78.48703  ? 9    PRO B O     1 
ATOM   5296 C  CB    . PRO D 4  21  ? 6.59961  11.14057  -4.12306  1.000 70.42785  ? 9    PRO B CB    1 
ATOM   5297 C  CG    . PRO D 4  21  ? 5.50757  11.34283  -3.12451  1.000 70.00655  ? 9    PRO B CG    1 
ATOM   5298 C  CD    . PRO D 4  21  ? 6.20389  11.72287  -1.84821  1.000 72.16062  ? 9    PRO B CD    1 
ATOM   5299 N  N     . VAL D 4  22  ? 8.53296  13.74796  -5.37565  1.000 71.25129  ? 10   VAL B N     1 
ATOM   5300 C  CA    . VAL D 4  22  ? 8.55517  14.93060  -6.22150  1.000 73.27789  ? 10   VAL B CA    1 
ATOM   5301 C  C     . VAL D 4  22  ? 8.73125  14.48824  -7.66678  1.000 72.76081  ? 10   VAL B C     1 
ATOM   5302 O  O     . VAL D 4  22  ? 9.22557  13.39287  -7.95092  1.000 73.06264  ? 10   VAL B O     1 
ATOM   5303 C  CB    . VAL D 4  22  ? 9.66411  15.91415  -5.80925  1.000 73.87910  ? 10   VAL B CB    1 
ATOM   5304 C  CG1   . VAL D 4  22  ? 9.17574  16.79863  -4.69007  1.000 74.43047  ? 10   VAL B CG1   1 
ATOM   5305 C  CG2   . VAL D 4  22  ? 10.89045 15.14462  -5.36356  1.000 73.78485  ? 10   VAL B CG2   1 
ATOM   5306 N  N     . LYS D 4  23  ? 8.31109  15.35973  -8.58587  1.000 70.47266  ? 11   LYS B N     1 
ATOM   5307 C  CA    . LYS D 4  23  ? 8.28062  15.04017  -10.00552 1.000 70.28002  ? 11   LYS B CA    1 
ATOM   5308 C  C     . LYS D 4  23  ? 8.74700  16.23806  -10.81556 1.000 72.99062  ? 11   LYS B C     1 
ATOM   5309 O  O     . LYS D 4  23  ? 8.64447  17.38458  -10.37585 1.000 76.01817  ? 11   LYS B O     1 
ATOM   5310 C  CB    . LYS D 4  23  ? 6.87248  14.63252  -10.46031 1.000 71.01864  ? 11   LYS B CB    1 
ATOM   5311 N  N     . LEU D 4  24  ? 9.26482  15.96313  -12.00561 1.000 71.88223  ? 12   LEU B N     1 
ATOM   5312 C  CA    . LEU D 4  24  ? 9.52521  17.03504  -12.94780 1.000 66.07776  ? 12   LEU B CA    1 
ATOM   5313 C  C     . LEU D 4  24  ? 8.22094  17.45327  -13.61844 1.000 69.64265  ? 12   LEU B C     1 
ATOM   5314 O  O     . LEU D 4  24  ? 7.22731  16.71792  -13.60704 1.000 71.16186  ? 12   LEU B O     1 
ATOM   5315 C  CB    . LEU D 4  24  ? 10.54034 16.59838  -14.00436 1.000 65.35783  ? 12   LEU B CB    1 
ATOM   5316 C  CG    . LEU D 4  24  ? 11.96906 16.24256  -13.57827 1.000 67.03442  ? 12   LEU B CG    1 
ATOM   5317 C  CD1   . LEU D 4  24  ? 12.78946 15.80321  -14.78762 1.000 65.45802  ? 12   LEU B CD1   1 
ATOM   5318 C  CD2   . LEU D 4  24  ? 12.65410 17.40394  -12.86607 1.000 67.36292  ? 12   LEU B CD2   1 
ATOM   5319 N  N     . LYS D 4  25  ? 8.22650  18.66030  -14.18962 1.000 69.74746  ? 13   LYS B N     1 
ATOM   5320 C  CA    . LYS D 4  25  ? 7.09796  19.09828  -14.99412 1.000 71.17679  ? 13   LYS B CA    1 
ATOM   5321 C  C     . LYS D 4  25  ? 6.89684  18.11415  -16.14455 1.000 73.93584  ? 13   LYS B C     1 
ATOM   5322 O  O     . LYS D 4  25  ? 7.86611  17.53845  -16.65300 1.000 73.84360  ? 13   LYS B O     1 
ATOM   5323 C  CB    . LYS D 4  25  ? 7.32128  20.51679  -15.52479 1.000 71.09632  ? 13   LYS B CB    1 
ATOM   5324 C  CG    . LYS D 4  25  ? 7.16373  21.59296  -14.45398 1.000 66.89953  ? 13   LYS B CG    1 
ATOM   5325 C  CD    . LYS D 4  25  ? 7.45725  22.98842  -14.97387 1.000 65.68648  ? 13   LYS B CD    1 
ATOM   5326 C  CE    . LYS D 4  25  ? 7.60110  23.97237  -13.80698 1.000 67.24026  ? 13   LYS B CE    1 
ATOM   5327 N  NZ    . LYS D 4  25  ? 8.19226  25.29809  -14.17121 1.000 67.43167  ? 13   LYS B NZ    1 
ATOM   5328 N  N     . PRO D 4  26  ? 5.65029  17.87063  -16.54673 1.000 75.94355  ? 14   PRO B N     1 
ATOM   5329 C  CA    . PRO D 4  26  ? 5.39126  16.81267  -17.53050 1.000 79.01368  ? 14   PRO B CA    1 
ATOM   5330 C  C     . PRO D 4  26  ? 6.10457  17.09179  -18.84376 1.000 79.70788  ? 14   PRO B C     1 
ATOM   5331 O  O     . PRO D 4  26  ? 6.06907  18.20808  -19.36740 1.000 74.50840  ? 14   PRO B O     1 
ATOM   5332 C  CB    . PRO D 4  26  ? 3.86531  16.84023  -17.68947 1.000 77.83392  ? 14   PRO B CB    1 
ATOM   5333 C  CG    . PRO D 4  26  ? 3.45472  18.18577  -17.22825 1.000 75.95504  ? 14   PRO B CG    1 
ATOM   5334 C  CD    . PRO D 4  26  ? 4.41072  18.54084  -16.12726 1.000 75.03472  ? 14   PRO B CD    1 
ATOM   5335 N  N     . GLY D 4  27  ? 6.77322  16.06302  -19.36106 1.000 85.21579  ? 15   GLY B N     1 
ATOM   5336 C  CA    . GLY D 4  27  ? 7.47829  16.16062  -20.62168 1.000 87.57334  ? 15   GLY B CA    1 
ATOM   5337 C  C     . GLY D 4  27  ? 8.85389  16.77874  -20.54952 1.000 83.95245  ? 15   GLY B C     1 
ATOM   5338 O  O     . GLY D 4  27  ? 9.41447  17.12810  -21.59354 1.000 83.67031  ? 15   GLY B O     1 
ATOM   5339 N  N     . MET D 4  28  ? 9.42370  16.91934  -19.36043 1.000 81.70856  ? 16   MET B N     1 
ATOM   5340 C  CA    . MET D 4  28  ? 10.73880 17.51450  -19.19913 1.000 78.85883  ? 16   MET B CA    1 
ATOM   5341 C  C     . MET D 4  28  ? 11.69521 16.48494  -18.61947 1.000 75.35862  ? 16   MET B C     1 
ATOM   5342 O  O     . MET D 4  28  ? 11.35537 15.78615  -17.66041 1.000 72.32582  ? 16   MET B O     1 
ATOM   5343 C  CB    . MET D 4  28  ? 10.67101 18.75412  -18.30494 1.000 80.41003  ? 16   MET B CB    1 
ATOM   5344 C  CG    . MET D 4  28  ? 10.36637 20.03207  -19.06596 1.000 87.25021  ? 16   MET B CG    1 
ATOM   5345 S  SD    . MET D 4  28  ? 10.12057 21.46618  -18.00363 1.000 89.45983  ? 16   MET B SD    1 
ATOM   5346 C  CE    . MET D 4  28  ? 10.40325 22.79770  -19.17472 1.000 88.45976  ? 16   MET B CE    1 
ATOM   5347 N  N     . ASP D 4  29  ? 12.87959 16.39250  -19.21473 1.000 59.37538  ? 17   ASP B N     1 
ATOM   5348 C  CA    . ASP D 4  29  ? 13.99355 15.59967  -18.72052 1.000 54.85656  ? 17   ASP B CA    1 
ATOM   5349 C  C     . ASP D 4  29  ? 14.84330 16.45256  -17.78054 1.000 49.74975  ? 17   ASP B C     1 
ATOM   5350 O  O     . ASP D 4  29  ? 14.72032 17.67662  -17.73684 1.000 46.58980  ? 17   ASP B O     1 
ATOM   5351 C  CB    . ASP D 4  29  ? 14.82790 15.09066  -19.89523 1.000 60.16774  ? 17   ASP B CB    1 
ATOM   5352 C  CG    . ASP D 4  29  ? 15.59331 13.82220  -19.57772 1.000 68.01316  ? 17   ASP B CG    1 
ATOM   5353 O  OD1   . ASP D 4  29  ? 15.36674 13.22263  -18.50031 1.000 69.52150  ? 17   ASP B OD1   1 
ATOM   5354 O  OD2   . ASP D 4  29  ? 16.42925 13.42652  -20.42317 1.000 71.34220  ? 17   ASP B OD2   1 
ATOM   5355 N  N     . GLY D 4  30  ? 15.71668 15.79079  -17.01580 1.000 48.88804  ? 18   GLY B N     1 
ATOM   5356 C  CA    . GLY D 4  30  ? 16.52843 16.47015  -16.04367 1.000 45.60300  ? 18   GLY B CA    1 
ATOM   5357 C  C     . GLY D 4  30  ? 17.58828 17.35052  -16.68557 1.000 47.35131  ? 18   GLY B C     1 
ATOM   5358 O  O     . GLY D 4  30  ? 17.72397 17.41334  -17.91503 1.000 53.03336  ? 18   GLY B O     1 
ATOM   5359 N  N     . PRO D 4  31  ? 18.34476 18.05730  -15.84767 1.000 45.09579  ? 19   PRO B N     1 
ATOM   5360 C  CA    . PRO D 4  31  ? 19.37051 18.96757  -16.36892 1.000 37.94129  ? 19   PRO B CA    1 
ATOM   5361 C  C     . PRO D 4  31  ? 20.60250 18.23091  -16.86787 1.000 38.52345  ? 19   PRO B C     1 
ATOM   5362 O  O     . PRO D 4  31  ? 21.03000 17.21544  -16.30429 1.000 38.69515  ? 19   PRO B O     1 
ATOM   5363 C  CB    . PRO D 4  31  ? 19.70838 19.84692  -15.15765 1.000 39.30165  ? 19   PRO B CB    1 
ATOM   5364 C  CG    . PRO D 4  31  ? 19.36794 18.98798  -13.96435 1.000 40.22771  ? 19   PRO B CG    1 
ATOM   5365 C  CD    . PRO D 4  31  ? 18.13168 18.23835  -14.39988 1.000 46.27392  ? 19   PRO B CD    1 
ATOM   5366 N  N     . LYS D 4  32  ? 21.17857 18.77276  -17.93711 1.000 31.83984  ? 20   LYS B N     1 
ATOM   5367 C  CA    . LYS D 4  32  ? 22.35352 18.22787  -18.59923 1.000 32.63900  ? 20   LYS B CA    1 
ATOM   5368 C  C     . LYS D 4  32  ? 23.35359 19.33485  -18.88441 1.000 37.53223  ? 20   LYS B C     1 
ATOM   5369 O  O     . LYS D 4  32  ? 23.77563 19.54686  -20.01964 1.000 42.76934  ? 20   LYS B O     1 
ATOM   5370 C  CB    . LYS D 4  32  ? 21.95602 17.48869  -19.87197 1.000 34.65456  ? 20   LYS B CB    1 
ATOM   5371 C  CG    . LYS D 4  32  ? 20.99028 16.35642  -19.61448 1.000 33.00145  ? 20   LYS B CG    1 
ATOM   5372 C  CD    . LYS D 4  32  ? 20.96376 15.40327  -20.76569 1.000 38.54290  ? 20   LYS B CD    1 
ATOM   5373 C  CE    . LYS D 4  32  ? 20.09345 14.18689  -20.45677 1.000 47.12130  ? 20   LYS B CE    1 
ATOM   5374 N  NZ    . LYS D 4  32  ? 20.08459 13.24127  -21.60520 1.000 53.67170  ? 20   LYS B NZ    1 
ATOM   5375 N  N     . VAL D 4  33  ? 23.70116 20.09746  -17.85233 1.000 41.21400  ? 21   VAL B N     1 
ATOM   5376 C  CA    . VAL D 4  33  ? 24.51852 21.30061  -17.98066 1.000 40.02479  ? 21   VAL B CA    1 
ATOM   5377 C  C     . VAL D 4  33  ? 25.96429 21.00143  -17.61746 1.000 40.26832  ? 21   VAL B C     1 
ATOM   5378 O  O     . VAL D 4  33  ? 26.24788 20.50586  -16.51926 1.000 37.31176  ? 21   VAL B O     1 
ATOM   5379 C  CB    . VAL D 4  33  ? 23.97403 22.42121  -17.08982 1.000 37.66655  ? 21   VAL B CB    1 
ATOM   5380 C  CG1   . VAL D 4  33  ? 24.83611 23.67100  -17.26039 1.000 23.83741  ? 21   VAL B CG1   1 
ATOM   5381 C  CG2   . VAL D 4  33  ? 22.50409 22.65086  -17.41361 1.000 32.56642  ? 21   VAL B CG2   1 
ATOM   5382 N  N     . LYS D 4  34  ? 26.88173 21.37107  -18.50841 1.000 40.75258  ? 22   LYS B N     1 
ATOM   5383 C  CA    . LYS D 4  34  ? 28.28172 21.02178  -18.32868 1.000 37.78953  ? 22   LYS B CA    1 
ATOM   5384 C  C     . LYS D 4  34  ? 28.92991 21.85906  -17.23324 1.000 35.87645  ? 22   LYS B C     1 
ATOM   5385 O  O     . LYS D 4  34  ? 28.50122 22.97135  -16.91981 1.000 44.27791  ? 22   LYS B O     1 
ATOM   5386 C  CB    . LYS D 4  34  ? 29.03737 21.16014  -19.65060 1.000 39.62905  ? 22   LYS B CB    1 
ATOM   5387 C  CG    . LYS D 4  34  ? 28.96323 19.86629  -20.47280 1.000 46.11491  ? 22   LYS B CG    1 
ATOM   5388 C  CD    . LYS D 4  34  ? 29.45304 20.02152  -21.89144 1.000 52.01051  ? 22   LYS B CD    1 
ATOM   5389 C  CE    . LYS D 4  34  ? 30.92281 19.66766  -22.02701 1.000 55.89416  ? 22   LYS B CE    1 
ATOM   5390 N  NZ    . LYS D 4  34  ? 31.29470 19.50813  -23.47252 1.000 58.73967  ? 22   LYS B NZ    1 
ATOM   5391 N  N     . GLN D 4  35  ? 29.96034 21.29048  -16.63013 1.000 31.76084  ? 23   GLN B N     1 
ATOM   5392 C  CA    . GLN D 4  35  ? 30.63832 21.91789  -15.51151 1.000 33.23500  ? 23   GLN B CA    1 
ATOM   5393 C  C     . GLN D 4  35  ? 31.69251 22.87753  -16.04264 1.000 32.62719  ? 23   GLN B C     1 
ATOM   5394 O  O     . GLN D 4  35  ? 32.48067 22.52440  -16.92932 1.000 35.88254  ? 23   GLN B O     1 
ATOM   5395 C  CB    . GLN D 4  35  ? 31.27134 20.84596  -14.61916 1.000 34.17212  ? 23   GLN B CB    1 
ATOM   5396 C  CG    . GLN D 4  35  ? 32.25222 21.35683  -13.58469 1.000 33.04138  ? 23   GLN B CG    1 
ATOM   5397 C  CD    . GLN D 4  35  ? 31.59326 22.23034  -12.56068 1.000 36.97604  ? 23   GLN B CD    1 
ATOM   5398 O  OE1   . GLN D 4  35  ? 30.55088 21.88423  -12.00029 1.000 35.69880  ? 23   GLN B OE1   1 
ATOM   5399 N  NE2   . GLN D 4  35  ? 32.19459 23.37998  -12.30550 1.000 44.08272  ? 23   GLN B NE2   1 
ATOM   5400 N  N     . TRP D 4  36  ? 31.71482 24.07257  -15.50689 1.000 29.24030  ? 24   TRP B N     1 
ATOM   5401 C  CA    . TRP D 4  36  ? 32.66452 25.01749  -16.06404 1.000 34.62366  ? 24   TRP B CA    1 
ATOM   5402 C  C     . TRP D 4  36  ? 33.95761 25.02457  -15.25283 1.000 32.93982  ? 24   TRP B C     1 
ATOM   5403 O  O     . TRP D 4  36  ? 33.99410 24.52503  -14.12565 1.000 28.64999  ? 24   TRP B O     1 
ATOM   5404 C  CB    . TRP D 4  36  ? 32.03233 26.40679  -16.13046 1.000 37.29561  ? 24   TRP B CB    1 
ATOM   5405 C  CG    . TRP D 4  36  ? 31.57908 26.96295  -14.84001 1.000 34.59617  ? 24   TRP B CG    1 
ATOM   5406 C  CD1   . TRP D 4  36  ? 32.36263 27.36398  -13.79590 1.000 36.52622  ? 24   TRP B CD1   1 
ATOM   5407 C  CD2   . TRP D 4  36  ? 30.22701 27.25654  -14.46944 1.000 33.21341  ? 24   TRP B CD2   1 
ATOM   5408 N  NE1   . TRP D 4  36  ? 31.57573 27.86947  -12.78315 1.000 43.21210  ? 24   TRP B NE1   1 
ATOM   5409 C  CE2   . TRP D 4  36  ? 30.26075 27.81260  -13.16762 1.000 36.07481  ? 24   TRP B CE2   1 
ATOM   5410 C  CE3   . TRP D 4  36  ? 28.99299 27.09692  -15.10525 1.000 23.19530  ? 24   TRP B CE3   1 
ATOM   5411 C  CZ2   . TRP D 4  36  ? 29.10318 28.20979  -12.48627 1.000 31.82533  ? 24   TRP B CZ2   1 
ATOM   5412 C  CZ3   . TRP D 4  36  ? 27.83949 27.50025  -14.42936 1.000 26.24603  ? 24   TRP B CZ3   1 
ATOM   5413 C  CH2   . TRP D 4  36  ? 27.90543 28.05315  -13.13526 1.000 28.29274  ? 24   TRP B CH2   1 
ATOM   5414 N  N     . PRO D 4  37  ? 35.04758 25.56457  -15.80497 1.000 29.34940  ? 25   PRO B N     1 
ATOM   5415 C  CA    . PRO D 4  37  ? 36.33880 25.52326  -15.09277 1.000 33.92156  ? 25   PRO B CA    1 
ATOM   5416 C  C     . PRO D 4  37  ? 36.28945 26.24037  -13.74914 1.000 37.62349  ? 25   PRO B C     1 
ATOM   5417 O  O     . PRO D 4  37  ? 35.70330 27.31732  -13.62043 1.000 44.98187  ? 25   PRO B O     1 
ATOM   5418 C  CB    . PRO D 4  37  ? 37.29802 26.24186  -16.05136 1.000 28.64538  ? 25   PRO B CB    1 
ATOM   5419 C  CG    . PRO D 4  37  ? 36.59783 26.26597  -17.39242 1.000 28.85672  ? 25   PRO B CG    1 
ATOM   5420 C  CD    . PRO D 4  37  ? 35.14167 26.30035  -17.07785 1.000 27.14332  ? 25   PRO B CD    1 
ATOM   5421 N  N     . LEU D 4  38  ? 36.93661 25.64466  -12.74724 1.000 32.48126  ? 26   LEU B N     1 
ATOM   5422 C  CA    . LEU D 4  38  ? 37.03019 26.22597  -11.41631 1.000 30.39737  ? 26   LEU B CA    1 
ATOM   5423 C  C     . LEU D 4  38  ? 38.47898 26.53874  -11.07659 1.000 35.44000  ? 26   LEU B C     1 
ATOM   5424 O  O     . LEU D 4  38  ? 39.39832 25.85140  -11.53000 1.000 38.74034  ? 26   LEU B O     1 
ATOM   5425 C  CB    . LEU D 4  38  ? 36.46327 25.29346  -10.35222 1.000 32.20400  ? 26   LEU B CB    1 
ATOM   5426 C  CG    . LEU D 4  38  ? 34.97412 24.96514  -10.50248 1.000 36.61771  ? 26   LEU B CG    1 
ATOM   5427 C  CD1   . LEU D 4  38  ? 34.51529 23.95457  -9.43352  1.000 23.96473  ? 26   LEU B CD1   1 
ATOM   5428 C  CD2   . LEU D 4  38  ? 34.13358 26.25261  -10.48282 1.000 28.12564  ? 26   LEU B CD2   1 
ATOM   5429 N  N     . THR D 4  39  ? 38.67666 27.59454  -10.28311 1.000 33.31400  ? 27   THR B N     1 
ATOM   5430 C  CA    . THR D 4  39  ? 40.00303 27.88328  -9.76143  1.000 35.29901  ? 27   THR B CA    1 
ATOM   5431 C  C     . THR D 4  39  ? 40.41124 26.85046  -8.72044  1.000 33.75147  ? 27   THR B C     1 
ATOM   5432 O  O     . THR D 4  39  ? 39.57679 26.18191  -8.10159  1.000 30.56734  ? 27   THR B O     1 
ATOM   5433 C  CB    . THR D 4  39  ? 40.06808 29.26936  -9.11377  1.000 39.92364  ? 27   THR B CB    1 
ATOM   5434 O  OG1   . THR D 4  39  ? 38.91314 29.45998  -8.28418  1.000 46.22350  ? 27   THR B OG1   1 
ATOM   5435 C  CG2   . THR D 4  39  ? 40.15904 30.36789  -10.17315 1.000 34.51253  ? 27   THR B CG2   1 
ATOM   5436 N  N     . GLU D 4  40  ? 41.72243 26.76570  -8.50437  1.000 33.98497  ? 28   GLU B N     1 
ATOM   5437 C  CA    . GLU D 4  40  ? 42.27081 25.84798  -7.51702  1.000 37.74119  ? 28   GLU B CA    1 
ATOM   5438 C  C     . GLU D 4  40  ? 41.60587 26.00790  -6.15307  1.000 40.80860  ? 28   GLU B C     1 
ATOM   5439 O  O     . GLU D 4  40  ? 41.21299 25.01736  -5.52587  1.000 43.97251  ? 28   GLU B O     1 
ATOM   5440 C  CB    . GLU D 4  40  ? 43.77283 26.06688  -7.41624  1.000 37.90020  ? 28   GLU B CB    1 
ATOM   5441 C  CG    . GLU D 4  40  ? 44.45092 25.15326  -6.43329  1.000 41.02327  ? 28   GLU B CG    1 
ATOM   5442 C  CD    . GLU D 4  40  ? 45.88158 24.89361  -6.81663  1.000 50.39838  ? 28   GLU B CD    1 
ATOM   5443 O  OE1   . GLU D 4  40  ? 46.30904 23.71915  -6.70191  1.000 61.19957  ? 28   GLU B OE1   1 
ATOM   5444 O  OE2   . GLU D 4  40  ? 46.56939 25.85511  -7.25137  1.000 46.85711  ? 28   GLU B OE2   1 
ATOM   5445 N  N     . GLU D 4  41  ? 41.49099 27.25187  -5.67479  1.000 42.20784  ? 29   GLU B N     1 
ATOM   5446 C  CA    . GLU D 4  41  ? 40.82330 27.54477  -4.40422  1.000 45.78656  ? 29   GLU B CA    1 
ATOM   5447 C  C     . GLU D 4  41  ? 39.45347 26.88559  -4.31195  1.000 42.66271  ? 29   GLU B C     1 
ATOM   5448 O  O     . GLU D 4  41  ? 39.12870 26.20289  -3.33096  1.000 50.08725  ? 29   GLU B O     1 
ATOM   5449 C  CB    . GLU D 4  41  ? 40.64258 29.04893  -4.26833  1.000 54.55770  ? 29   GLU B CB    1 
ATOM   5450 C  CG    . GLU D 4  41  ? 41.46567 29.75823  -3.26866  1.000 66.30493  ? 29   GLU B CG    1 
ATOM   5451 C  CD    . GLU D 4  41  ? 41.13203 31.23382  -3.30895  1.000 75.47655  ? 29   GLU B CD    1 
ATOM   5452 O  OE1   . GLU D 4  41  ? 41.57729 31.99599  -2.41361  1.000 82.51919  ? 29   GLU B OE1   1 
ATOM   5453 O  OE2   . GLU D 4  41  ? 40.40056 31.61678  -4.25499  1.000 71.43890  ? 29   GLU B OE2   1 
ATOM   5454 N  N     . LYS D 4  42  ? 38.61937 27.12751  -5.31320  1.000 38.78119  ? 30   LYS B N     1 
ATOM   5455 C  CA    . LYS D 4  42  ? 37.25534 26.62505  -5.28004  1.000 42.21569  ? 30   LYS B CA    1 
ATOM   5456 C  C     . LYS D 4  42  ? 37.22862 25.10452  -5.34147  1.000 40.51037  ? 30   LYS B C     1 
ATOM   5457 O  O     . LYS D 4  42  ? 36.41771 24.47342  -4.66125  1.000 39.60258  ? 30   LYS B O     1 
ATOM   5458 C  CB    . LYS D 4  42  ? 36.43763 27.24266  -6.42625  1.000 37.57054  ? 30   LYS B CB    1 
ATOM   5459 C  CG    . LYS D 4  42  ? 36.39395 28.76263  -6.38676  1.000 33.89791  ? 30   LYS B CG    1 
ATOM   5460 C  CD    . LYS D 4  42  ? 35.35842 29.33203  -7.34502  1.000 37.29656  ? 30   LYS B CD    1 
ATOM   5461 C  CE    . LYS D 4  42  ? 35.42696 30.84926  -7.38097  1.000 43.67484  ? 30   LYS B CE    1 
ATOM   5462 N  NZ    . LYS D 4  42  ? 34.07050 31.47430  -7.23519  1.000 49.44074  ? 30   LYS B NZ    1 
ATOM   5463 N  N     . ILE D 4  43  ? 38.12088 24.49290  -6.12326  1.000 42.58349  ? 31   ILE B N     1 
ATOM   5464 C  CA    . ILE D 4  43  ? 38.15333 23.03115  -6.18500  1.000 40.98908  ? 31   ILE B CA    1 
ATOM   5465 C  C     . ILE D 4  43  ? 38.53584 22.44454  -4.83230  1.000 41.58591  ? 31   ILE B C     1 
ATOM   5466 O  O     . ILE D 4  43  ? 37.92075 21.47987  -4.36659  1.000 39.93387  ? 31   ILE B O     1 
ATOM   5467 C  CB    . ILE D 4  43  ? 39.10623 22.54665  -7.28924  1.000 43.07311  ? 31   ILE B CB    1 
ATOM   5468 C  CG1   . ILE D 4  43  ? 38.53956 22.91321  -8.66061  1.000 34.14885  ? 31   ILE B CG1   1 
ATOM   5469 C  CG2   . ILE D 4  43  ? 39.38322 21.02293  -7.13640  1.000 28.70668  ? 31   ILE B CG2   1 
ATOM   5470 C  CD1   . ILE D 4  43  ? 39.42359 22.49670  -9.77382  1.000 34.75826  ? 31   ILE B CD1   1 
ATOM   5471 N  N     . LYS D 4  44  ? 39.57131 23.00036  -4.19147  1.000 39.64197  ? 32   LYS B N     1 
ATOM   5472 C  CA    . LYS D 4  44  ? 39.98821 22.47653  -2.89284  1.000 37.02540  ? 32   LYS B CA    1 
ATOM   5473 C  C     . LYS D 4  44  ? 38.87204 22.61401  -1.86743  1.000 41.48863  ? 32   LYS B C     1 
ATOM   5474 O  O     . LYS D 4  44  ? 38.61377 21.68807  -1.07974  1.000 49.22160  ? 32   LYS B O     1 
ATOM   5475 C  CB    . LYS D 4  44  ? 41.23322 23.19836  -2.39629  1.000 35.96886  ? 32   LYS B CB    1 
ATOM   5476 C  CG    . LYS D 4  44  ? 42.54428 22.85614  -3.05903  1.000 36.99813  ? 32   LYS B CG    1 
ATOM   5477 C  CD    . LYS D 4  44  ? 43.61425 23.80549  -2.48013  1.000 51.42002  ? 32   LYS B CD    1 
ATOM   5478 C  CE    . LYS D 4  44  ? 45.04633 23.31265  -2.67075  1.000 62.14380  ? 32   LYS B CE    1 
ATOM   5479 N  NZ    . LYS D 4  44  ? 45.44254 23.21753  -4.11035  1.000 66.78611  ? 32   LYS B NZ    1 
ATOM   5480 N  N     . ALA D 4  45  ? 38.18921 23.76182  -1.86598  1.000 41.01382  ? 33   ALA B N     1 
ATOM   5481 C  CA    . ALA D 4  45  ? 37.08007 23.93727  -0.93339  1.000 41.93300  ? 33   ALA B CA    1 
ATOM   5482 C  C     . ALA D 4  45  ? 35.94192 22.96046  -1.23083  1.000 42.31060  ? 33   ALA B C     1 
ATOM   5483 O  O     . ALA D 4  45  ? 35.34921 22.39164  -0.30498  1.000 41.93004  ? 33   ALA B O     1 
ATOM   5484 C  CB    . ALA D 4  45  ? 36.58783 25.38437  -0.96427  1.000 35.83896  ? 33   ALA B CB    1 
ATOM   5485 N  N     . LEU D 4  46  ? 35.62856 22.74116  -2.51549  1.000 39.38922  ? 34   LEU B N     1 
ATOM   5486 C  CA    . LEU D 4  46  ? 34.58012 21.78346  -2.86701  1.000 39.46559  ? 34   LEU B CA    1 
ATOM   5487 C  C     . LEU D 4  46  ? 34.96181 20.36386  -2.47274  1.000 44.59800  ? 34   LEU B C     1 
ATOM   5488 O  O     . LEU D 4  46  ? 34.11381 19.59108  -2.02909  1.000 46.86529  ? 34   LEU B O     1 
ATOM   5489 C  CB    . LEU D 4  46  ? 34.27557 21.84256  -4.35978  1.000 36.89778  ? 34   LEU B CB    1 
ATOM   5490 C  CG    . LEU D 4  46  ? 33.54549 23.12202  -4.75414  1.000 37.91480  ? 34   LEU B CG    1 
ATOM   5491 C  CD1   . LEU D 4  46  ? 33.23230 23.13972  -6.24013  1.000 31.10037  ? 34   LEU B CD1   1 
ATOM   5492 C  CD2   . LEU D 4  46  ? 32.27743 23.28538  -3.92058  1.000 39.91042  ? 34   LEU B CD2   1 
ATOM   5493 N  N     . VAL D 4  47  ? 36.23005 19.99873  -2.63516  1.000 48.48984  ? 35   VAL B N     1 
ATOM   5494 C  CA    . VAL D 4  47  ? 36.66027 18.64214  -2.31575  1.000 47.54645  ? 35   VAL B CA    1 
ATOM   5495 C  C     . VAL D 4  47  ? 36.57028 18.38979  -0.81120  1.000 47.40331  ? 35   VAL B C     1 
ATOM   5496 O  O     . VAL D 4  47  ? 36.07506 17.34239  -0.37211  1.000 44.40654  ? 35   VAL B O     1 
ATOM   5497 C  CB    . VAL D 4  47  ? 38.07769 18.40061  -2.87068  1.000 48.64192  ? 35   VAL B CB    1 
ATOM   5498 C  CG1   . VAL D 4  47  ? 38.77037 17.23738  -2.14972  1.000 33.14483  ? 35   VAL B CG1   1 
ATOM   5499 C  CG2   . VAL D 4  47  ? 38.00503 18.17338  -4.38805  1.000 29.61346  ? 35   VAL B CG2   1 
ATOM   5500 N  N     . GLU D 4  48  ? 36.99237 19.36329  0.00147   1.000 45.78586  ? 36   GLU B N     1 
ATOM   5501 C  CA    . GLU D 4  48  ? 36.83681 19.23003  1.44775   1.000 50.64237  ? 36   GLU B CA    1 
ATOM   5502 C  C     . GLU D 4  48  ? 35.35745 19.17374  1.85539   1.000 52.02313  ? 36   GLU B C     1 
ATOM   5503 O  O     . GLU D 4  48  ? 34.93652 18.28181  2.61632   1.000 59.48884  ? 36   GLU B O     1 
ATOM   5504 C  CB    . GLU D 4  48  ? 37.55974 20.38321  2.14084   1.000 62.83421  ? 36   GLU B CB    1 
ATOM   5505 C  CG    . GLU D 4  48  ? 37.58534 20.28988  3.65336   1.000 75.83017  ? 36   GLU B CG    1 
ATOM   5506 C  CD    . GLU D 4  48  ? 37.53852 21.65317  4.31595   1.000 83.55067  ? 36   GLU B CD    1 
ATOM   5507 O  OE1   . GLU D 4  48  ? 37.99466 22.63751  3.68214   1.000 85.94009  ? 36   GLU B OE1   1 
ATOM   5508 O  OE2   . GLU D 4  48  ? 37.03183 21.73472  5.45994   1.000 85.86509  ? 36   GLU B OE2   1 
ATOM   5509 N  N     . ILE D 4  49  ? 34.55001 20.11787  1.35713   1.000 46.46728  ? 37   ILE B N     1 
ATOM   5510 C  CA    . ILE D 4  49  ? 33.13181 20.16300  1.71206   1.000 43.29516  ? 37   ILE B CA    1 
ATOM   5511 C  C     . ILE D 4  49  ? 32.42489 18.87799  1.29682   1.000 43.68408  ? 37   ILE B C     1 
ATOM   5512 O  O     . ILE D 4  49  ? 31.63472 18.30783  2.06204   1.000 48.27983  ? 37   ILE B O     1 
ATOM   5513 C  CB    . ILE D 4  49  ? 32.46766 21.39909  1.08253   1.000 40.44134  ? 37   ILE B CB    1 
ATOM   5514 C  CG1   . ILE D 4  49  ? 32.91630 22.66562  1.80774   1.000 40.75145  ? 37   ILE B CG1   1 
ATOM   5515 C  CG2   . ILE D 4  49  ? 30.95183 21.25779  1.08590   1.000 40.63585  ? 37   ILE B CG2   1 
ATOM   5516 C  CD1   . ILE D 4  49  ? 32.51037 23.95740  1.09513   1.000 43.19918  ? 37   ILE B CD1   1 
ATOM   5517 N  N     . CYS D 4  50  ? 32.69953 18.39308  0.08747   1.000 42.85133  ? 38   CYS B N     1 
ATOM   5518 C  CA    . CYS D 4  50  ? 32.06512 17.16508  -0.36608  1.000 50.70185  ? 38   CYS B CA    1 
ATOM   5519 C  C     . CYS D 4  50  ? 32.56504 15.94098  0.39356   1.000 53.29055  ? 38   CYS B C     1 
ATOM   5520 O  O     . CYS D 4  50  ? 31.79155 15.00583  0.60905   1.000 54.93849  ? 38   CYS B O     1 
ATOM   5521 C  CB    . CYS D 4  50  ? 32.26894 16.99822  -1.86650  1.000 50.63353  ? 38   CYS B CB    1 
ATOM   5522 S  SG    . CYS D 4  50  ? 31.25776 18.15740  -2.81892  1.000 50.89287  ? 38   CYS B SG    1 
ATOM   5523 N  N     . THR D 4  51  ? 33.83209 15.91499  0.81451   1.000 51.47046  ? 39   THR B N     1 
ATOM   5524 C  CA    . THR D 4  51  ? 34.27743 14.81052  1.65158   1.000 51.99458  ? 39   THR B CA    1 
ATOM   5525 C  C     . THR D 4  51  ? 33.45855 14.75141  2.93593   1.000 58.04546  ? 39   THR B C     1 
ATOM   5526 O  O     . THR D 4  51  ? 32.94817 13.68607  3.32074   1.000 60.38135  ? 39   THR B O     1 
ATOM   5527 C  CB    . THR D 4  51  ? 35.76884 14.94400  1.95754   1.000 53.49251  ? 39   THR B CB    1 
ATOM   5528 O  OG1   . THR D 4  51  ? 36.52091 14.77017  0.75009   1.000 57.32130  ? 39   THR B OG1   1 
ATOM   5529 C  CG2   . THR D 4  51  ? 36.19735 13.88177  2.95623   1.000 51.42035  ? 39   THR B CG2   1 
ATOM   5530 N  N     . GLU D 4  52  ? 33.29199 15.89780  3.60057   1.000 55.79710  ? 40   GLU B N     1 
ATOM   5531 C  CA    . GLU D 4  52  ? 32.51182 15.87345  4.83579   1.000 56.26223  ? 40   GLU B CA    1 
ATOM   5532 C  C     . GLU D 4  52  ? 31.05917 15.51198  4.56079   1.000 56.80796  ? 40   GLU B C     1 
ATOM   5533 O  O     . GLU D 4  52  ? 30.45877 14.74446  5.31774   1.000 65.45225  ? 40   GLU B O     1 
ATOM   5534 C  CB    . GLU D 4  52  ? 32.60088 17.20345  5.57788   1.000 45.70408  ? 40   GLU B CB    1 
ATOM   5535 N  N     . MET D 4  53  ? 30.48158 16.02614  3.47229   1.000 52.68403  ? 41   MET B N     1 
ATOM   5536 C  CA    . MET D 4  53  ? 29.07816 15.72949  3.18637   1.000 49.41317  ? 41   MET B CA    1 
ATOM   5537 C  C     . MET D 4  53  ? 28.87308 14.25108  2.87363   1.000 50.09894  ? 41   MET B C     1 
ATOM   5538 O  O     . MET D 4  53  ? 27.90863 13.63779  3.34845   1.000 52.94613  ? 41   MET B O     1 
ATOM   5539 C  CB    . MET D 4  53  ? 28.57014 16.59063  2.03229   1.000 40.85265  ? 41   MET B CB    1 
ATOM   5540 C  CG    . MET D 4  53  ? 28.33534 18.04659  2.38672   1.000 41.34163  ? 41   MET B CG    1 
ATOM   5541 S  SD    . MET D 4  53  ? 27.71462 18.97915  0.97107   1.000 50.26440  ? 41   MET B SD    1 
ATOM   5542 C  CE    . MET D 4  53  ? 25.96379 18.59032  1.01733   1.000 50.18701  ? 41   MET B CE    1 
ATOM   5543 N  N     . GLU D 4  54  ? 29.76473 13.66108  2.07820   1.000 44.66385  ? 42   GLU B N     1 
ATOM   5544 C  CA    . GLU D 4  54  ? 29.67695 12.23399  1.81619   1.000 47.46845  ? 42   GLU B CA    1 
ATOM   5545 C  C     . GLU D 4  54  ? 29.78100 11.43327  3.10963   1.000 53.73662  ? 42   GLU B C     1 
ATOM   5546 O  O     . GLU D 4  54  ? 28.99395 10.50668  3.32384   1.000 58.06631  ? 42   GLU B O     1 
ATOM   5547 C  CB    . GLU D 4  54  ? 30.75338 11.80993  0.81734   1.000 50.61644  ? 42   GLU B CB    1 
ATOM   5548 C  CG    . GLU D 4  54  ? 30.98296 10.29997  0.76409   1.000 58.30114  ? 42   GLU B CG    1 
ATOM   5549 C  CD    . GLU D 4  54  ? 31.89817 9.87529   -0.37015  1.000 63.01793  ? 42   GLU B CD    1 
ATOM   5550 O  OE1   . GLU D 4  54  ? 31.52563 8.93482   -1.11118  1.000 70.15750  ? 42   GLU B OE1   1 
ATOM   5551 O  OE2   . GLU D 4  54  ? 32.98363 10.47709  -0.52743  1.000 61.30304  ? 42   GLU B OE2   1 
ATOM   5552 N  N     . LYS D 4  55  ? 30.72022 11.79240  4.00449   1.000 60.12206  ? 43   LYS B N     1 
ATOM   5553 C  CA    . LYS D 4  55  ? 30.85329 11.03384  5.25204   1.000 50.12858  ? 43   LYS B CA    1 
ATOM   5554 C  C     . LYS D 4  55  ? 29.66375 11.20316  6.18708   1.000 60.49999  ? 43   LYS B C     1 
ATOM   5555 O  O     . LYS D 4  55  ? 29.59169 10.49030  7.18849   1.000 67.72095  ? 43   LYS B O     1 
ATOM   5556 C  CB    . LYS D 4  55  ? 32.13454 11.40986  6.00746   1.000 51.27154  ? 43   LYS B CB    1 
ATOM   5557 N  N     . GLU D 4  56  ? 28.74483 12.12559  5.90487   1.000 55.84239  ? 44   GLU B N     1 
ATOM   5558 C  CA    . GLU D 4  56  ? 27.54360 12.31055  6.71135   1.000 57.05006  ? 44   GLU B CA    1 
ATOM   5559 C  C     . GLU D 4  56  ? 26.29118 11.79545  6.02369   1.000 58.35686  ? 44   GLU B C     1 
ATOM   5560 O  O     . GLU D 4  56  ? 25.18734 12.01592  6.53219   1.000 60.79297  ? 44   GLU B O     1 
ATOM   5561 C  CB    . GLU D 4  56  ? 27.34439 13.79046  7.06198   1.000 57.70607  ? 44   GLU B CB    1 
ATOM   5562 C  CG    . GLU D 4  56  ? 28.31129 14.35303  8.08723   1.000 65.78242  ? 44   GLU B CG    1 
ATOM   5563 C  CD    . GLU D 4  56  ? 28.50990 15.85030  7.92220   1.000 72.18468  ? 44   GLU B CD    1 
ATOM   5564 O  OE1   . GLU D 4  56  ? 28.57328 16.30927  6.75893   1.000 74.01489  ? 44   GLU B OE1   1 
ATOM   5565 O  OE2   . GLU D 4  56  ? 28.59329 16.57132  8.94205   1.000 77.06323  ? 44   GLU B OE2   1 
ATOM   5566 N  N     . GLY D 4  57  ? 26.42686 11.14855  4.87106   1.000 55.71911  ? 45   GLY B N     1 
ATOM   5567 C  CA    . GLY D 4  57  ? 25.28889 10.63955  4.13867   1.000 57.38696  ? 45   GLY B CA    1 
ATOM   5568 C  C     . GLY D 4  57  ? 24.51856 11.65868  3.32642   1.000 57.40020  ? 45   GLY B C     1 
ATOM   5569 O  O     . GLY D 4  57  ? 23.51004 11.29660  2.70970   1.000 60.98091  ? 45   GLY B O     1 
ATOM   5570 N  N     . LYS D 4  58  ? 24.95398 12.91651  3.28484   1.000 55.62571  ? 46   LYS B N     1 
ATOM   5571 C  CA    . LYS D 4  58  ? 24.16232 13.91961  2.58124   1.000 51.25382  ? 46   LYS B CA    1 
ATOM   5572 C  C     . LYS D 4  58  ? 24.25459 13.77157  1.06612   1.000 44.82318  ? 46   LYS B C     1 
ATOM   5573 O  O     . LYS D 4  58  ? 23.31804 14.16591  0.36430   1.000 43.97021  ? 46   LYS B O     1 
ATOM   5574 C  CB    . LYS D 4  58  ? 24.57719 15.31569  3.05402   1.000 48.31181  ? 46   LYS B CB    1 
ATOM   5575 C  CG    . LYS D 4  58  ? 24.34557 15.49460  4.57985   1.000 56.69154  ? 46   LYS B CG    1 
ATOM   5576 C  CD    . LYS D 4  58  ? 24.90657 16.80758  5.10894   1.000 60.05953  ? 46   LYS B CD    1 
ATOM   5577 N  N     . ILE D 4  59  ? 25.33558 13.17601  0.55003   1.000 41.56001  ? 47   ILE B N     1 
ATOM   5578 C  CA    . ILE D 4  59  ? 25.51980 12.94725  -0.88011  1.000 40.26598  ? 47   ILE B CA    1 
ATOM   5579 C  C     . ILE D 4  59  ? 26.21431 11.59755  -1.08928  1.000 46.71953  ? 47   ILE B C     1 
ATOM   5580 O  O     . ILE D 4  59  ? 26.84475 11.05141  -0.18156  1.000 48.82570  ? 47   ILE B O     1 
ATOM   5581 C  CB    . ILE D 4  59  ? 26.33643 14.08579  -1.55184  1.000 39.34982  ? 47   ILE B CB    1 
ATOM   5582 C  CG1   . ILE D 4  59  ? 27.71500 14.21978  -0.89868  1.000 38.68753  ? 47   ILE B CG1   1 
ATOM   5583 C  CG2   . ILE D 4  59  ? 25.57712 15.42895  -1.52037  1.000 34.86904  ? 47   ILE B CG2   1 
ATOM   5584 C  CD1   . ILE D 4  59  ? 28.66096 15.15930  -1.62878  1.000 33.67799  ? 47   ILE B CD1   1 
ATOM   5585 N  N     . SER D 4  60  ? 26.09932 11.05802  -2.31372  1.000 46.82579  ? 48   SER B N     1 
ATOM   5586 C  CA    . SER D 4  60  ? 26.74308 9.79666   -2.68416  1.000 45.65908  ? 48   SER B CA    1 
ATOM   5587 C  C     . SER D 4  60  ? 27.47281 9.92521   -4.01570  1.000 43.37837  ? 48   SER B C     1 
ATOM   5588 O  O     . SER D 4  60  ? 26.96911 10.55439  -4.94250  1.000 42.70165  ? 48   SER B O     1 
ATOM   5589 C  CB    . SER D 4  60  ? 25.73072 8.64103   -2.78886  1.000 45.19616  ? 48   SER B CB    1 
ATOM   5590 O  OG    . SER D 4  60  ? 25.24788 8.25730   -1.51637  1.000 43.25085  ? 48   SER B OG    1 
ATOM   5591 N  N     . LYS D 4  61  ? 28.65360 9.30718   -4.10897  1.000 45.34346  ? 49   LYS B N     1 
ATOM   5592 C  CA    . LYS D 4  61  ? 29.33311 9.15265   -5.39348  1.000 41.70554  ? 49   LYS B CA    1 
ATOM   5593 C  C     . LYS D 4  61  ? 28.47887 8.34160   -6.35249  1.000 40.32469  ? 49   LYS B C     1 
ATOM   5594 O  O     . LYS D 4  61  ? 27.86382 7.34190   -5.96859  1.000 43.67265  ? 49   LYS B O     1 
ATOM   5595 C  CB    . LYS D 4  61  ? 30.68480 8.45248   -5.22491  1.000 40.65152  ? 49   LYS B CB    1 
ATOM   5596 C  CG    . LYS D 4  61  ? 31.82661 9.36244   -4.82261  1.000 47.17103  ? 49   LYS B CG    1 
ATOM   5597 C  CD    . LYS D 4  61  ? 33.13844 8.59687   -4.80946  1.000 50.62472  ? 49   LYS B CD    1 
ATOM   5598 C  CE    . LYS D 4  61  ? 34.32505 9.52993   -4.59172  1.000 56.60918  ? 49   LYS B CE    1 
ATOM   5599 N  NZ    . LYS D 4  61  ? 34.41849 9.99693   -3.17805  1.000 61.99349  ? 49   LYS B NZ    1 
ATOM   5600 N  N     . ILE D 4  62  ? 28.45747 8.77681   -7.61089  1.000 37.78387  ? 50   ILE B N     1 
ATOM   5601 C  CA    . ILE D 4  62  ? 27.70836 8.12697   -8.67799  1.000 38.58003  ? 50   ILE B CA    1 
ATOM   5602 C  C     . ILE D 4  62  ? 28.61679 7.95989   -9.89337  1.000 38.81543  ? 50   ILE B C     1 
ATOM   5603 O  O     . ILE D 4  62  ? 29.74441 8.45516   -9.93469  1.000 40.12926  ? 50   ILE B O     1 
ATOM   5604 C  CB    . ILE D 4  62  ? 26.44286 8.91790   -9.06417  1.000 37.84609  ? 50   ILE B CB    1 
ATOM   5605 C  CG1   . ILE D 4  62  ? 26.82993 10.32467  -9.52777  1.000 35.23380  ? 50   ILE B CG1   1 
ATOM   5606 C  CG2   . ILE D 4  62  ? 25.47346 8.97149   -7.90342  1.000 34.16172  ? 50   ILE B CG2   1 
ATOM   5607 C  CD1   . ILE D 4  62  ? 25.64330 11.22210  -9.74320  1.000 36.60657  ? 50   ILE B CD1   1 
ATOM   5608 N  N     . GLY D 4  63  ? 28.09904 7.26463   -10.89997 1.000 38.65076  ? 51   GLY B N     1 
ATOM   5609 C  CA    . GLY D 4  63  ? 28.85774 7.02341   -12.09989 1.000 41.53813  ? 51   GLY B CA    1 
ATOM   5610 C  C     . GLY D 4  63  ? 28.35017 7.76518   -13.32111 1.000 41.16425  ? 51   GLY B C     1 
ATOM   5611 O  O     . GLY D 4  63  ? 27.49293 8.65553   -13.24323 1.000 39.27436  ? 51   GLY B O     1 
ATOM   5612 N  N     . PRO D 4  64  ? 28.88311 7.39169   -14.49031 1.000 40.38486  ? 52   PRO B N     1 
ATOM   5613 C  CA    . PRO D 4  64  ? 28.44822 8.01852   -15.74481 1.000 38.28593  ? 52   PRO B CA    1 
ATOM   5614 C  C     . PRO D 4  64  ? 27.12416 7.49594   -16.27183 1.000 38.66245  ? 52   PRO B C     1 
ATOM   5615 O  O     . PRO D 4  64  ? 26.61094 8.05544   -17.24949 1.000 36.65481  ? 52   PRO B O     1 
ATOM   5616 C  CB    . PRO D 4  64  ? 29.58812 7.66675   -16.71145 1.000 42.21625  ? 52   PRO B CB    1 
ATOM   5617 C  CG    . PRO D 4  64  ? 30.06247 6.32378   -16.22726 1.000 32.92410  ? 52   PRO B CG    1 
ATOM   5618 C  CD    . PRO D 4  64  ? 29.93554 6.37853   -14.71208 1.000 37.10147  ? 52   PRO B CD    1 
ATOM   5619 N  N     . GLU D 4  65  ? 26.56696 6.43025   -15.68787 1.000 40.50480  ? 53   GLU B N     1 
ATOM   5620 C  CA    . GLU D 4  65  ? 25.30091 5.90379   -16.18630 1.000 40.59302  ? 53   GLU B CA    1 
ATOM   5621 C  C     . GLU D 4  65  ? 24.12327 6.77724   -15.78712 1.000 40.52930  ? 53   GLU B C     1 
ATOM   5622 O  O     . GLU D 4  65  ? 23.02352 6.58216   -16.31543 1.000 44.31140  ? 53   GLU B O     1 
ATOM   5623 C  CB    . GLU D 4  65  ? 25.08277 4.46100   -15.70588 1.000 45.96475  ? 53   GLU B CB    1 
ATOM   5624 C  CG    . GLU D 4  65  ? 24.61378 4.31319   -14.26388 1.000 49.93544  ? 53   GLU B CG    1 
ATOM   5625 C  CD    . GLU D 4  65  ? 25.70037 4.60781   -13.25191 1.000 60.11800  ? 53   GLU B CD    1 
ATOM   5626 O  OE1   . GLU D 4  65  ? 26.86697 4.81590   -13.65203 1.000 62.10861  ? 53   GLU B OE1   1 
ATOM   5627 O  OE2   . GLU D 4  65  ? 25.38757 4.63499   -12.04355 1.000 67.29995  ? 53   GLU B OE2   1 
ATOM   5628 N  N     . ASN D 4  66  ? 24.32697 7.70790   -14.86005 1.000 38.28785  ? 54   ASN B N     1 
ATOM   5629 C  CA    . ASN D 4  66  ? 23.43235 8.82684   -14.58803 1.000 38.26383  ? 54   ASN B CA    1 
ATOM   5630 C  C     . ASN D 4  66  ? 23.71502 9.91554   -15.62573 1.000 44.10594  ? 54   ASN B C     1 
ATOM   5631 O  O     . ASN D 4  66  ? 24.78964 10.53763  -15.60534 1.000 30.20423  ? 54   ASN B O     1 
ATOM   5632 C  CB    . ASN D 4  66  ? 23.64730 9.33172   -13.15341 1.000 36.38911  ? 54   ASN B CB    1 
ATOM   5633 C  CG    . ASN D 4  66  ? 22.74943 10.49523  -12.78124 1.000 42.24535  ? 54   ASN B CG    1 
ATOM   5634 O  OD1   . ASN D 4  66  ? 22.33042 11.27756  -13.62808 1.000 47.76458  ? 54   ASN B OD1   1 
ATOM   5635 N  ND2   . ASN D 4  66  ? 22.45705 10.61912  -11.49167 1.000 47.51969  ? 54   ASN B ND2   1 
ATOM   5636 N  N     . PRO D 4  67  ? 22.78049 10.18556  -16.53874 1.000 43.19611  ? 55   PRO B N     1 
ATOM   5637 C  CA    . PRO D 4  67  ? 23.04377 11.13338  -17.62939 1.000 41.19571  ? 55   PRO B CA    1 
ATOM   5638 C  C     . PRO D 4  67  ? 22.88611 12.59913  -17.25776 1.000 36.45803  ? 55   PRO B C     1 
ATOM   5639 O  O     . PRO D 4  67  ? 22.91035 13.44240  -18.15606 1.000 39.45698  ? 55   PRO B O     1 
ATOM   5640 C  CB    . PRO D 4  67  ? 21.98505 10.73587  -18.66944 1.000 37.99231  ? 55   PRO B CB    1 
ATOM   5641 C  CG    . PRO D 4  67  ? 20.81709 10.36607  -17.81575 1.000 40.15890  ? 55   PRO B CG    1 
ATOM   5642 C  CD    . PRO D 4  67  ? 21.40575 9.66067   -16.59969 1.000 42.66381  ? 55   PRO B CD    1 
ATOM   5643 N  N     . TYR D 4  68  ? 22.71467 12.93587  -15.98858 1.000 34.27734  ? 56   TYR B N     1 
ATOM   5644 C  CA    . TYR D 4  68  ? 22.34996 14.28976  -15.59483 1.000 37.35238  ? 56   TYR B CA    1 
ATOM   5645 C  C     . TYR D 4  68  ? 23.54752 15.04565  -15.02029 1.000 36.14857  ? 56   TYR B C     1 
ATOM   5646 O  O     . TYR D 4  68  ? 24.46765 14.44752  -14.45757 1.000 39.01058  ? 56   TYR B O     1 
ATOM   5647 C  CB    . TYR D 4  68  ? 21.20399 14.24758  -14.57863 1.000 36.32006  ? 56   TYR B CB    1 
ATOM   5648 C  CG    . TYR D 4  68  ? 19.98417 13.55118  -15.12519 1.000 43.84688  ? 56   TYR B CG    1 
ATOM   5649 C  CD1   . TYR D 4  68  ? 19.26660 14.10323  -16.18487 1.000 45.35112  ? 56   TYR B CD1   1 
ATOM   5650 C  CD2   . TYR D 4  68  ? 19.55665 12.32366  -14.60604 1.000 47.58539  ? 56   TYR B CD2   1 
ATOM   5651 C  CE1   . TYR D 4  68  ? 18.15534 13.46615  -16.70132 1.000 46.69408  ? 56   TYR B CE1   1 
ATOM   5652 C  CE2   . TYR D 4  68  ? 18.44148 11.68249  -15.11535 1.000 44.45934  ? 56   TYR B CE2   1 
ATOM   5653 C  CZ    . TYR D 4  68  ? 17.74657 12.25924  -16.16105 1.000 49.26239  ? 56   TYR B CZ    1 
ATOM   5654 O  OH    . TYR D 4  68  ? 16.63404 11.63736  -16.67868 1.000 54.74282  ? 56   TYR B OH    1 
ATOM   5655 N  N     . ASN D 4  69  ? 23.54153 16.36957  -15.18231 1.000 33.65595  ? 57   ASN B N     1 
ATOM   5656 C  CA    . ASN D 4  69  ? 24.57744 17.15474  -14.52556 1.000 37.27582  ? 57   ASN B CA    1 
ATOM   5657 C  C     . ASN D 4  69  ? 24.15330 18.60438  -14.35257 1.000 38.25049  ? 57   ASN B C     1 
ATOM   5658 O  O     . ASN D 4  69  ? 23.42091 19.15920  -15.17105 1.000 36.45777  ? 57   ASN B O     1 
ATOM   5659 C  CB    . ASN D 4  69  ? 25.89561 17.10947  -15.28079 1.000 36.07503  ? 57   ASN B CB    1 
ATOM   5660 C  CG    . ASN D 4  69  ? 27.05604 17.55701  -14.42364 1.000 38.42567  ? 57   ASN B CG    1 
ATOM   5661 O  OD1   . ASN D 4  69  ? 27.45252 16.85506  -13.48642 1.000 35.82382  ? 57   ASN B OD1   1 
ATOM   5662 N  ND2   . ASN D 4  69  ? 27.60678 18.73908  -14.72777 1.000 37.77311  ? 57   ASN B ND2   1 
ATOM   5663 N  N     . THR D 4  70  ? 24.67374 19.21394  -13.28464 1.000 37.55646  ? 58   THR B N     1 
ATOM   5664 C  CA    . THR D 4  70  ? 24.33844 20.54902  -12.85386 1.000 40.70563  ? 58   THR B CA    1 
ATOM   5665 C  C     . THR D 4  70  ? 25.62630 21.16841  -12.31442 1.000 40.56392  ? 58   THR B C     1 
ATOM   5666 O  O     . THR D 4  70  ? 26.29523 20.55386  -11.45597 1.000 37.93359  ? 58   THR B O     1 
ATOM   5667 C  CB    . THR D 4  70  ? 23.24070 20.52626  -11.78222 1.000 47.04566  ? 58   THR B CB    1 
ATOM   5668 O  OG1   . THR D 4  70  ? 21.98333 20.19119  -12.38557 1.000 51.72125  ? 58   THR B OG1   1 
ATOM   5669 C  CG2   . THR D 4  70  ? 23.11700 21.84895  -11.12466 1.000 47.68737  ? 58   THR B CG2   1 
ATOM   5670 N  N     . PRO D 4  71  ? 26.00502 22.36110  -12.78694 1.000 37.65654  ? 59   PRO B N     1 
ATOM   5671 C  CA    . PRO D 4  71  ? 27.31408 22.91506  -12.42796 1.000 32.01497  ? 59   PRO B CA    1 
ATOM   5672 C  C     . PRO D 4  71  ? 27.38843 23.28940  -10.95875 1.000 32.16030  ? 59   PRO B C     1 
ATOM   5673 O  O     . PRO D 4  71  ? 26.37981 23.57844  -10.31133 1.000 31.52513  ? 59   PRO B O     1 
ATOM   5674 C  CB    . PRO D 4  71  ? 27.44310 24.14950  -13.33020 1.000 32.47890  ? 59   PRO B CB    1 
ATOM   5675 C  CG    . PRO D 4  71  ? 26.06139 24.51967  -13.67099 1.000 36.46714  ? 59   PRO B CG    1 
ATOM   5676 C  CD    . PRO D 4  71  ? 25.25399 23.25156  -13.68790 1.000 39.29209  ? 59   PRO B CD    1 
ATOM   5677 N  N     . VAL D 4  72  ? 28.61315 23.25934  -10.43107 1.000 33.85799  ? 60   VAL B N     1 
ATOM   5678 C  CA    . VAL D 4  72  ? 28.87982 23.46356  -9.01171  1.000 32.99321  ? 60   VAL B CA    1 
ATOM   5679 C  C     . VAL D 4  72  ? 30.07347 24.39933  -8.88526  1.000 31.67349  ? 60   VAL B C     1 
ATOM   5680 O  O     . VAL D 4  72  ? 31.02747 24.30753  -9.66520  1.000 32.01312  ? 60   VAL B O     1 
ATOM   5681 C  CB    . VAL D 4  72  ? 29.13414 22.11352  -8.28462  1.000 31.11943  ? 60   VAL B CB    1 
ATOM   5682 C  CG1   . VAL D 4  72  ? 30.46886 21.48103  -8.71495  1.000 28.60547  ? 60   VAL B CG1   1 
ATOM   5683 C  CG2   . VAL D 4  72  ? 29.07307 22.26707  -6.78085  1.000 32.01129  ? 60   VAL B CG2   1 
ATOM   5684 N  N     . PHE D 4  73  ? 30.00895 25.32644  -7.93302  1.000 33.15252  ? 61   PHE B N     1 
ATOM   5685 C  CA    . PHE D 4  73  ? 31.17495 26.14021  -7.60942  1.000 33.88232  ? 61   PHE B CA    1 
ATOM   5686 C  C     . PHE D 4  73  ? 31.11085 26.49355  -6.13431  1.000 38.40679  ? 61   PHE B C     1 
ATOM   5687 O  O     . PHE D 4  73  ? 30.31936 25.92578  -5.37942  1.000 39.50140  ? 61   PHE B O     1 
ATOM   5688 C  CB    . PHE D 4  73  ? 31.28640 27.37116  -8.52031  1.000 34.93104  ? 61   PHE B CB    1 
ATOM   5689 C  CG    . PHE D 4  73  ? 30.18428 28.38024  -8.36864  1.000 39.61826  ? 61   PHE B CG    1 
ATOM   5690 C  CD1   . PHE D 4  73  ? 28.88722 28.08918  -8.75315  1.000 42.90663  ? 61   PHE B CD1   1 
ATOM   5691 C  CD2   . PHE D 4  73  ? 30.46832 29.66332  -7.92075  1.000 42.34580  ? 61   PHE B CD2   1 
ATOM   5692 C  CE1   . PHE D 4  73  ? 27.87741 29.05205  -8.64632  1.000 43.03022  ? 61   PHE B CE1   1 
ATOM   5693 C  CE2   . PHE D 4  73  ? 29.46807 30.62626  -7.81379  1.000 42.09864  ? 61   PHE B CE2   1 
ATOM   5694 C  CZ    . PHE D 4  73  ? 28.17112 30.31547  -8.17849  1.000 40.18962  ? 61   PHE B CZ    1 
ATOM   5695 N  N     . ALA D 4  74  ? 31.96494 27.41980  -5.71199  1.000 40.05624  ? 62   ALA B N     1 
ATOM   5696 C  CA    . ALA D 4  74  ? 32.04453 27.78224  -4.30963  1.000 37.38185  ? 62   ALA B CA    1 
ATOM   5697 C  C     . ALA D 4  74  ? 32.32090 29.27145  -4.19457  1.000 44.42936  ? 62   ALA B C     1 
ATOM   5698 O  O     . ALA D 4  74  ? 32.94793 29.87347  -5.07420  1.000 49.24615  ? 62   ALA B O     1 
ATOM   5699 C  CB    . ALA D 4  74  ? 33.13008 26.97202  -3.58066  1.000 34.65780  ? 62   ALA B CB    1 
ATOM   5700 N  N     . ILE D 4  75  ? 31.85510 29.85814  -3.09408  1.000 44.62053  ? 63   ILE B N     1 
ATOM   5701 C  CA    . ILE D 4  75  ? 32.05428 31.27502  -2.82299  1.000 48.39635  ? 63   ILE B CA    1 
ATOM   5702 C  C     . ILE D 4  75  ? 32.52059 31.44193  -1.38611  1.000 58.52950  ? 63   ILE B C     1 
ATOM   5703 O  O     . ILE D 4  75  ? 31.99938 30.79232  -0.47664  1.000 59.84894  ? 63   ILE B O     1 
ATOM   5704 C  CB    . ILE D 4  75  ? 30.77515 32.09433  -3.08206  1.000 44.56341  ? 63   ILE B CB    1 
ATOM   5705 C  CG1   . ILE D 4  75  ? 29.57116 31.45521  -2.39074  1.000 44.02650  ? 63   ILE B CG1   1 
ATOM   5706 C  CG2   . ILE D 4  75  ? 30.53994 32.23163  -4.57037  1.000 39.65233  ? 63   ILE B CG2   1 
ATOM   5707 C  CD1   . ILE D 4  75  ? 28.84195 32.39623  -1.47369  1.000 44.94855  ? 63   ILE B CD1   1 
ATOM   5708 N  N     . LYS D 4  76  ? 33.51373 32.30371  -1.18483  1.000 67.36040  ? 64   LYS B N     1 
ATOM   5709 C  CA    . LYS D 4  76  ? 34.11983 32.53951  0.12385   1.000 74.04138  ? 64   LYS B CA    1 
ATOM   5710 C  C     . LYS D 4  76  ? 33.62614 33.88574  0.63185   1.000 74.33208  ? 64   LYS B C     1 
ATOM   5711 O  O     . LYS D 4  76  ? 34.02824 34.93329  0.11690   1.000 67.21295  ? 64   LYS B O     1 
ATOM   5712 C  CB    . LYS D 4  76  ? 35.64373 32.50906  0.03592   1.000 77.38137  ? 64   LYS B CB    1 
ATOM   5713 C  CG    . LYS D 4  76  ? 36.34607 32.54334  1.37541   1.000 82.15041  ? 64   LYS B CG    1 
ATOM   5714 C  CD    . LYS D 4  76  ? 37.85116 32.63517  1.19221   1.000 83.45049  ? 64   LYS B CD    1 
ATOM   5715 C  CE    . LYS D 4  76  ? 38.56208 32.66542  2.53470   1.000 86.82711  ? 64   LYS B CE    1 
ATOM   5716 N  NZ    . LYS D 4  76  ? 40.00137 33.00044  2.39084   1.000 88.42543  ? 64   LYS B NZ    1 
ATOM   5717 N  N     . LYS D 4  77  ? 32.76610 33.85337  1.64301   1.000 85.60394  ? 65   LYS B N     1 
ATOM   5718 C  CA    . LYS D 4  77  ? 32.07347 35.05623  2.07555   1.000 102.62351 ? 65   LYS B CA    1 
ATOM   5719 C  C     . LYS D 4  77  ? 33.04242 36.06106  2.70356   1.000 112.29212 ? 65   LYS B C     1 
ATOM   5720 O  O     . LYS D 4  77  ? 34.14091 35.71773  3.15102   1.000 113.47464 ? 65   LYS B O     1 
ATOM   5721 C  CB    . LYS D 4  77  ? 30.94269 34.69242  3.03686   1.000 107.18160 ? 65   LYS B CB    1 
ATOM   5722 C  CG    . LYS D 4  77  ? 29.85342 33.86369  2.36211   1.000 104.88295 ? 65   LYS B CG    1 
ATOM   5723 C  CD    . LYS D 4  77  ? 28.72385 33.55372  3.31209   1.000 106.18834 ? 65   LYS B CD    1 
ATOM   5724 C  CE    . LYS D 4  77  ? 27.63527 32.76438  2.62344   1.000 104.52946 ? 65   LYS B CE    1 
ATOM   5725 N  NZ    . LYS D 4  77  ? 26.49331 32.54847  3.54896   1.000 107.78776 ? 65   LYS B NZ    1 
ATOM   5726 N  N     . LYS D 4  78  ? 32.60804 37.32360  2.72416   1.000 117.48842 ? 66   LYS B N     1 
ATOM   5727 C  CA    . LYS D 4  78  ? 33.49539 38.44767  3.01153   1.000 124.06215 ? 66   LYS B CA    1 
ATOM   5728 C  C     . LYS D 4  78  ? 34.04884 38.38133  4.43090   1.000 128.48269 ? 66   LYS B C     1 
ATOM   5729 O  O     . LYS D 4  78  ? 33.30178 38.19301  5.39693   1.000 132.74887 ? 66   LYS B O     1 
ATOM   5730 C  CB    . LYS D 4  78  ? 32.75038 39.76687  2.80018   1.000 126.73909 ? 66   LYS B CB    1 
ATOM   5731 N  N     . ASP D 4  79  ? 35.36894 38.54664  4.54884   1.000 125.74443 ? 67   ASP B N     1 
ATOM   5732 C  CA    . ASP D 4  79  ? 36.11761 38.45633  5.80054   1.000 122.97779 ? 67   ASP B CA    1 
ATOM   5733 C  C     . ASP D 4  79  ? 35.91302 37.12349  6.51315   1.000 120.12872 ? 67   ASP B C     1 
ATOM   5734 O  O     . ASP D 4  79  ? 36.25517 36.99797  7.69763   1.000 122.51225 ? 67   ASP B O     1 
ATOM   5735 C  CB    . ASP D 4  79  ? 35.77335 39.61589  6.74501   1.000 125.79482 ? 67   ASP B CB    1 
ATOM   5736 N  N     . SER D 4  80  ? 35.36820 36.12529  5.81835   1.000 114.40803 ? 68   SER B N     1 
ATOM   5737 C  CA    . SER D 4  80  ? 35.12170 34.80128  6.36981   1.000 110.53587 ? 68   SER B CA    1 
ATOM   5738 C  C     . SER D 4  80  ? 36.15220 33.82678  5.82619   1.000 103.09589 ? 68   SER B C     1 
ATOM   5739 O  O     . SER D 4  80  ? 36.47085 33.84626  4.63466   1.000 99.35758  ? 68   SER B O     1 
ATOM   5740 C  CB    . SER D 4  80  ? 33.71362 34.30650  6.02545   1.000 109.15923 ? 68   SER B CB    1 
ATOM   5741 N  N     . THR D 4  81  ? 36.68345 32.99158  6.71318   1.000 102.56458 ? 69   THR B N     1 
ATOM   5742 C  CA    . THR D 4  81  ? 37.56191 31.89510  6.33005   1.000 100.71361 ? 69   THR B CA    1 
ATOM   5743 C  C     . THR D 4  81  ? 36.79206 30.69292  5.77871   1.000 96.49823  ? 69   THR B C     1 
ATOM   5744 O  O     . THR D 4  81  ? 37.41187 29.72430  5.31854   1.000 93.47482  ? 69   THR B O     1 
ATOM   5745 C  CB    . THR D 4  81  ? 38.42039 31.48551  7.53978   1.000 101.75899 ? 69   THR B CB    1 
ATOM   5746 O  OG1   . THR D 4  81  ? 38.98469 30.18499  7.32882   1.000 98.70964  ? 69   THR B OG1   1 
ATOM   5747 C  CG2   . THR D 4  81  ? 37.59108 31.49251  8.83191   1.000 102.67875 ? 69   THR B CG2   1 
ATOM   5748 N  N     . LYS D 4  82  ? 35.46207 30.74073  5.79284   1.000 90.68897  ? 70   LYS B N     1 
ATOM   5749 C  CA    . LYS D 4  82  ? 34.62787 29.62346  5.37596   1.000 79.09049  ? 70   LYS B CA    1 
ATOM   5750 C  C     . LYS D 4  82  ? 34.21029 29.79491  3.92283   1.000 72.61439  ? 70   LYS B C     1 
ATOM   5751 O  O     . LYS D 4  82  ? 33.79829 30.88796  3.50629   1.000 71.77610  ? 70   LYS B O     1 
ATOM   5752 C  CB    . LYS D 4  82  ? 33.38692 29.50368  6.26187   1.000 76.82394  ? 70   LYS B CB    1 
ATOM   5753 N  N     . TRP D 4  83  ? 34.33100 28.71328  3.16040   1.000 63.48372  ? 71   TRP B N     1 
ATOM   5754 C  CA    . TRP D 4  83  ? 33.73422 28.60803  1.84278   1.000 49.77068  ? 71   TRP B CA    1 
ATOM   5755 C  C     . TRP D 4  83  ? 32.32960 28.05036  1.95626   1.000 45.77301  ? 71   TRP B C     1 
ATOM   5756 O  O     . TRP D 4  83  ? 31.98944 27.35824  2.91763   1.000 48.57958  ? 71   TRP B O     1 
ATOM   5757 C  CB    . TRP D 4  83  ? 34.57121 27.70835  0.94296   1.000 47.86792  ? 71   TRP B CB    1 
ATOM   5758 C  CG    . TRP D 4  83  ? 35.84417 28.34309  0.59372   1.000 48.17811  ? 71   TRP B CG    1 
ATOM   5759 C  CD1   . TRP D 4  83  ? 36.97189 28.39254  1.35833   1.000 45.74229  ? 71   TRP B CD1   1 
ATOM   5760 C  CD2   . TRP D 4  83  ? 36.13067 29.06932  -0.60359  1.000 49.88017  ? 71   TRP B CD2   1 
ATOM   5761 N  NE1   . TRP D 4  83  ? 37.94797 29.09854  0.70543   1.000 50.17281  ? 71   TRP B NE1   1 
ATOM   5762 C  CE2   . TRP D 4  83  ? 37.45884 29.52459  -0.50361  1.000 50.89674  ? 71   TRP B CE2   1 
ATOM   5763 C  CE3   . TRP D 4  83  ? 35.39204 29.38215  -1.74989  1.000 52.57983  ? 71   TRP B CE3   1 
ATOM   5764 C  CZ2   . TRP D 4  83  ? 38.07046 30.26776  -1.51119  1.000 50.59795  ? 71   TRP B CZ2   1 
ATOM   5765 C  CZ3   . TRP D 4  83  ? 35.99808 30.12888  -2.74677  1.000 52.00473  ? 71   TRP B CZ3   1 
ATOM   5766 C  CH2   . TRP D 4  83  ? 37.32396 30.56182  -2.61989  1.000 50.44272  ? 71   TRP B CH2   1 
ATOM   5767 N  N     . ARG D 4  84  ? 31.50917 28.36552  0.96612   1.000 45.54740  ? 72   ARG B N     1 
ATOM   5768 C  CA    . ARG D 4  84  ? 30.17249 27.81033  0.86370   1.000 46.49512  ? 72   ARG B CA    1 
ATOM   5769 C  C     . ARG D 4  84  ? 30.03364 27.19996  -0.51722  1.000 39.93294  ? 72   ARG B C     1 
ATOM   5770 O  O     . ARG D 4  84  ? 30.35501 27.84546  -1.51760  1.000 39.00398  ? 72   ARG B O     1 
ATOM   5771 C  CB    . ARG D 4  84  ? 29.08665 28.86845  1.09027   1.000 48.09946  ? 72   ARG B CB    1 
ATOM   5772 C  CG    . ARG D 4  84  ? 27.69025 28.27535  1.19418   1.000 56.45464  ? 72   ARG B CG    1 
ATOM   5773 C  CD    . ARG D 4  84  ? 26.62288 29.34211  1.09500   1.000 69.80628  ? 72   ARG B CD    1 
ATOM   5774 N  NE    . ARG D 4  84  ? 25.32553 28.86538  1.57346   1.000 79.41678  ? 72   ARG B NE    1 
ATOM   5775 C  CZ    . ARG D 4  84  ? 24.41280 28.26879  0.81141   1.000 78.64181  ? 72   ARG B CZ    1 
ATOM   5776 N  NH1   . ARG D 4  84  ? 24.64707 28.06624  -0.48109  1.000 74.35453  ? 72   ARG B NH1   1 
ATOM   5777 N  NH2   . ARG D 4  84  ? 23.25979 27.88456  1.34495   1.000 79.08767  ? 72   ARG B NH2   1 
ATOM   5778 N  N     . LYS D 4  85  ? 29.59050 25.95139  -0.56349  1.000 41.38802  ? 73   LYS B N     1 
ATOM   5779 C  CA    . LYS D 4  85  ? 29.28294 25.32836  -1.83745  1.000 36.62377  ? 73   LYS B CA    1 
ATOM   5780 C  C     . LYS D 4  85  ? 28.02170 25.95419  -2.39076  1.000 36.40470  ? 73   LYS B C     1 
ATOM   5781 O  O     . LYS D 4  85  ? 27.11070 26.31328  -1.64243  1.000 39.55465  ? 73   LYS B O     1 
ATOM   5782 C  CB    . LYS D 4  85  ? 29.10069 23.82071  -1.68070  1.000 30.55342  ? 73   LYS B CB    1 
ATOM   5783 C  CG    . LYS D 4  85  ? 28.73931 23.10810  -2.96647  1.000 34.02744  ? 73   LYS B CG    1 
ATOM   5784 C  CD    . LYS D 4  85  ? 29.03814 21.60631  -2.86924  1.000 45.44713  ? 73   LYS B CD    1 
ATOM   5785 C  CE    . LYS D 4  85  ? 27.91868 20.83186  -2.20696  1.000 52.73042  ? 73   LYS B CE    1 
ATOM   5786 N  NZ    . LYS D 4  85  ? 26.73362 20.74069  -3.10631  1.000 56.28089  ? 73   LYS B NZ    1 
ATOM   5787 N  N     . LEU D 4  86  ? 27.97653 26.09522  -3.70683  1.000 36.01497  ? 74   LEU B N     1 
ATOM   5788 C  CA    . LEU D 4  86  ? 26.81744 26.64203  -4.39098  1.000 39.05327  ? 74   LEU B CA    1 
ATOM   5789 C  C     . LEU D 4  86  ? 26.59103 25.80331  -5.63721  1.000 38.45609  ? 74   LEU B C     1 
ATOM   5790 O  O     . LEU D 4  86  ? 27.49199 25.66450  -6.47141  1.000 35.65245  ? 74   LEU B O     1 
ATOM   5791 C  CB    . LEU D 4  86  ? 27.03906 28.11133  -4.74705  1.000 37.56994  ? 74   LEU B CB    1 
ATOM   5792 C  CG    . LEU D 4  86  ? 25.79125 28.93464  -4.98371  1.000 47.52714  ? 74   LEU B CG    1 
ATOM   5793 C  CD1   . LEU D 4  86  ? 24.95962 28.92612  -3.72259  1.000 54.42400  ? 74   LEU B CD1   1 
ATOM   5794 C  CD2   . LEU D 4  86  ? 26.18514 30.35938  -5.35220  1.000 51.32439  ? 74   LEU B CD2   1 
ATOM   5795 N  N     . VAL D 4  87  ? 25.41311 25.22334  -5.74695  1.000 38.66409  ? 75   VAL B N     1 
ATOM   5796 C  CA    . VAL D 4  87  ? 25.00848 24.51977  -6.95329  1.000 35.37673  ? 75   VAL B CA    1 
ATOM   5797 C  C     . VAL D 4  87  ? 24.14073 25.44569  -7.79053  1.000 40.55138  ? 75   VAL B C     1 
ATOM   5798 O  O     . VAL D 4  87  ? 23.25514 26.13679  -7.27058  1.000 43.56106  ? 75   VAL B O     1 
ATOM   5799 C  CB    . VAL D 4  87  ? 24.25871 23.22615  -6.62168  1.000 34.56772  ? 75   VAL B CB    1 
ATOM   5800 C  CG1   . VAL D 4  87  ? 24.07883 22.44162  -7.87623  1.000 34.61189  ? 75   VAL B CG1   1 
ATOM   5801 C  CG2   . VAL D 4  87  ? 25.02572 22.43378  -5.57792  1.000 38.95080  ? 75   VAL B CG2   1 
ATOM   5802 N  N     . ASP D 4  88  ? 24.39287 25.46521  -9.09564  1.000 40.25618  ? 76   ASP B N     1 
ATOM   5803 C  CA    . ASP D 4  88  ? 23.60093 26.28911  -10.00034 1.000 40.06493  ? 76   ASP B CA    1 
ATOM   5804 C  C     . ASP D 4  88  ? 22.39469 25.46437  -10.43495 1.000 38.21969  ? 76   ASP B C     1 
ATOM   5805 O  O     . ASP D 4  88  ? 22.36934 24.84415  -11.49532 1.000 44.53523  ? 76   ASP B O     1 
ATOM   5806 C  CB    . ASP D 4  88  ? 24.43796 26.75642  -11.18418 1.000 38.62121  ? 76   ASP B CB    1 
ATOM   5807 C  CG    . ASP D 4  88  ? 23.66632 27.66439  -12.10470 1.000 39.54455  ? 76   ASP B CG    1 
ATOM   5808 O  OD1   . ASP D 4  88  ? 22.50161 27.99294  -11.77897 1.000 39.46949  ? 76   ASP B OD1   1 
ATOM   5809 O  OD2   . ASP D 4  88  ? 24.21996 28.04662  -13.15239 1.000 43.36826  ? 76   ASP B OD2   1 
ATOM   5810 N  N     . PHE D 4  89  ? 21.36813 25.47648  -9.59617  1.000 36.58199  ? 77   PHE B N     1 
ATOM   5811 C  CA    . PHE D 4  89  ? 20.17562 24.68332  -9.83801  1.000 43.34438  ? 77   PHE B CA    1 
ATOM   5812 C  C     . PHE D 4  89  ? 19.14825 25.39835  -10.71540 1.000 42.85897  ? 77   PHE B C     1 
ATOM   5813 O  O     . PHE D 4  89  ? 17.97534 25.01458  -10.70588 1.000 48.13923  ? 77   PHE B O     1 
ATOM   5814 C  CB    . PHE D 4  89  ? 19.54406 24.26926  -8.50371  1.000 47.21042  ? 77   PHE B CB    1 
ATOM   5815 C  CG    . PHE D 4  89  ? 20.08775 22.97514  -7.94466  1.000 45.75563  ? 77   PHE B CG    1 
ATOM   5816 C  CD1   . PHE D 4  89  ? 20.18969 21.84914  -8.74458  1.000 38.09431  ? 77   PHE B CD1   1 
ATOM   5817 C  CD2   . PHE D 4  89  ? 20.49816 22.88835  -6.61701  1.000 49.86126  ? 77   PHE B CD2   1 
ATOM   5818 C  CE1   . PHE D 4  89  ? 20.68282 20.66307  -8.24162  1.000 35.86130  ? 77   PHE B CE1   1 
ATOM   5819 C  CE2   . PHE D 4  89  ? 21.00193 21.69524  -6.10381  1.000 47.17008  ? 77   PHE B CE2   1 
ATOM   5820 C  CZ    . PHE D 4  89  ? 21.09743 20.58557  -6.92146  1.000 40.74337  ? 77   PHE B CZ    1 
ATOM   5821 N  N     . ARG D 4  90  ? 19.55827 26.40598  -11.48839 1.000 37.44250  ? 78   ARG B N     1 
ATOM   5822 C  CA    . ARG D 4  90  ? 18.58536 27.16273  -12.27911 1.000 39.34488  ? 78   ARG B CA    1 
ATOM   5823 C  C     . ARG D 4  90  ? 17.85348 26.25574  -13.26328 1.000 41.85813  ? 78   ARG B C     1 
ATOM   5824 O  O     . ARG D 4  90  ? 16.61878 26.27182  -13.33593 1.000 44.30087  ? 78   ARG B O     1 
ATOM   5825 C  CB    . ARG D 4  90  ? 19.26689 28.34148  -12.99560 1.000 29.67200  ? 78   ARG B CB    1 
ATOM   5826 C  CG    . ARG D 4  90  ? 19.39218 29.58230  -12.09861 1.000 28.53559  ? 78   ARG B CG    1 
ATOM   5827 C  CD    . ARG D 4  90  ? 20.18855 30.72487  -12.72059 1.000 31.13015  ? 78   ARG B CD    1 
ATOM   5828 N  NE    . ARG D 4  90  ? 21.56530 30.34074  -13.02659 1.000 32.69163  ? 78   ARG B NE    1 
ATOM   5829 C  CZ    . ARG D 4  90  ? 22.41612 31.08580  -13.72557 1.000 34.18023  ? 78   ARG B CZ    1 
ATOM   5830 N  NH1   . ARG D 4  90  ? 22.05110 32.27437  -14.18983 1.000 36.34717  ? 78   ARG B NH1   1 
ATOM   5831 N  NH2   . ARG D 4  90  ? 23.63466 30.64407  -13.96295 1.000 32.60878  ? 78   ARG B NH2   1 
ATOM   5832 N  N     . GLU D 4  91  ? 18.59489 25.42104  -13.99437 1.000 41.93954  ? 79   GLU B N     1 
ATOM   5833 C  CA    . GLU D 4  91  ? 17.95804 24.50244  -14.93367 1.000 44.99381  ? 79   GLU B CA    1 
ATOM   5834 C  C     . GLU D 4  91  ? 17.01070 23.54204  -14.21721 1.000 45.71303  ? 79   GLU B C     1 
ATOM   5835 O  O     . GLU D 4  91  ? 15.83842 23.42183  -14.58885 1.000 48.67970  ? 79   GLU B O     1 
ATOM   5836 C  CB    . GLU D 4  91  ? 19.02082 23.74253  -15.72692 1.000 48.07733  ? 79   GLU B CB    1 
ATOM   5837 C  CG    . GLU D 4  91  ? 18.63426 23.48809  -17.17904 1.000 55.30306  ? 79   GLU B CG    1 
ATOM   5838 C  CD    . GLU D 4  91  ? 18.08708 24.73346  -17.85766 1.000 62.45576  ? 79   GLU B CD    1 
ATOM   5839 O  OE1   . GLU D 4  91  ? 17.08554 24.61669  -18.59297 1.000 66.19443  ? 79   GLU B OE1   1 
ATOM   5840 O  OE2   . GLU D 4  91  ? 18.64904 25.83369  -17.64844 1.000 63.61767  ? 79   GLU B OE2   1 
ATOM   5841 N  N     . LEU D 4  92  ? 17.48840 22.87348  -13.16237 1.000 46.30745  ? 80   LEU B N     1 
ATOM   5842 C  CA    . LEU D 4  92  ? 16.64592 21.90226  -12.46450 1.000 43.39028  ? 80   LEU B CA    1 
ATOM   5843 C  C     . LEU D 4  92  ? 15.46096 22.57426  -11.78744 1.000 47.03956  ? 80   LEU B C     1 
ATOM   5844 O  O     . LEU D 4  92  ? 14.36414 22.00534  -11.74034 1.000 53.70263  ? 80   LEU B O     1 
ATOM   5845 C  CB    . LEU D 4  92  ? 17.46582 21.11668  -11.43927 1.000 38.87366  ? 80   LEU B CB    1 
ATOM   5846 C  CG    . LEU D 4  92  ? 16.64609 20.26523  -10.46108 1.000 38.32116  ? 80   LEU B CG    1 
ATOM   5847 C  CD1   . LEU D 4  92  ? 15.90305 19.12565  -11.16380 1.000 35.10043  ? 80   LEU B CD1   1 
ATOM   5848 C  CD2   . LEU D 4  92  ? 17.53583 19.72415  -9.38511  1.000 41.87572  ? 80   LEU B CD2   1 
ATOM   5849 N  N     . ASN D 4  93  ? 15.65964 23.78105  -11.25429 1.000 47.77474  ? 81   ASN B N     1 
ATOM   5850 C  CA    . ASN D 4  93  ? 14.53854 24.53775  -10.70385 1.000 49.39486  ? 81   ASN B CA    1 
ATOM   5851 C  C     . ASN D 4  93  ? 13.50968 24.87876  -11.77751 1.000 52.68716  ? 81   ASN B C     1 
ATOM   5852 O  O     . ASN D 4  93  ? 12.30438 24.89824  -11.50069 1.000 59.70276  ? 81   ASN B O     1 
ATOM   5853 C  CB    . ASN D 4  93  ? 15.04520 25.80614  -10.02055 1.000 45.43145  ? 81   ASN B CB    1 
ATOM   5854 C  CG    . ASN D 4  93  ? 15.81706 25.50807  -8.74644  1.000 48.35410  ? 81   ASN B CG    1 
ATOM   5855 O  OD1   . ASN D 4  93  ? 15.61586 24.46257  -8.11976  1.000 55.24184  ? 81   ASN B OD1   1 
ATOM   5856 N  ND2   . ASN D 4  93  ? 16.71207 26.41440  -8.36184  1.000 41.67984  ? 81   ASN B ND2   1 
ATOM   5857 N  N     . LYS D 4  94  ? 13.96012 25.14916  -13.00773 1.000 46.70184  ? 82   LYS B N     1 
ATOM   5858 C  CA    . LYS D 4  94  ? 13.01599 25.39435  -14.09667 1.000 49.41937  ? 82   LYS B CA    1 
ATOM   5859 C  C     . LYS D 4  94  ? 12.15838 24.16405  -14.36505 1.000 52.26531  ? 82   LYS B C     1 
ATOM   5860 O  O     . LYS D 4  94  ? 10.95458 24.27539  -14.63025 1.000 57.78355  ? 82   LYS B O     1 
ATOM   5861 C  CB    . LYS D 4  94  ? 13.76256 25.79354  -15.36935 1.000 50.42348  ? 82   LYS B CB    1 
ATOM   5862 C  CG    . LYS D 4  94  ? 13.73060 27.26011  -15.69805 1.000 55.18249  ? 82   LYS B CG    1 
ATOM   5863 C  CD    . LYS D 4  94  ? 14.44379 27.55943  -17.01385 1.000 58.69461  ? 82   LYS B CD    1 
ATOM   5864 C  CE    . LYS D 4  94  ? 15.94507 27.71003  -16.83353 1.000 58.93259  ? 82   LYS B CE    1 
ATOM   5865 N  NZ    . LYS D 4  94  ? 16.57925 28.19164  -18.09296 1.000 60.06817  ? 82   LYS B NZ    1 
ATOM   5866 N  N     . ARG D 4  95  ? 12.75509 22.98257  -14.28354 1.000 60.22825  ? 83   ARG B N     1 
ATOM   5867 C  CA    . ARG D 4  95  ? 12.08390 21.75553  -14.68094 1.000 60.49579  ? 83   ARG B CA    1 
ATOM   5868 C  C     . ARG D 4  95  ? 11.31674 21.08857  -13.54608 1.000 65.31576  ? 83   ARG B C     1 
ATOM   5869 O  O     . ARG D 4  95  ? 10.52450 20.17800  -13.81330 1.000 68.49521  ? 83   ARG B O     1 
ATOM   5870 C  CB    . ARG D 4  95  ? 13.11192 20.78201  -15.26363 1.000 54.55326  ? 83   ARG B CB    1 
ATOM   5871 C  CG    . ARG D 4  95  ? 13.95367 21.39999  -16.37495 1.000 53.08378  ? 83   ARG B CG    1 
ATOM   5872 C  CD    . ARG D 4  95  ? 15.20941 20.59461  -16.61066 1.000 56.14476  ? 83   ARG B CD    1 
ATOM   5873 N  NE    . ARG D 4  95  ? 16.12165 21.25562  -17.53857 1.000 59.70617  ? 83   ARG B NE    1 
ATOM   5874 C  CZ    . ARG D 4  95  ? 16.07574 21.11117  -18.85517 1.000 60.37139  ? 83   ARG B CZ    1 
ATOM   5875 N  NH1   . ARG D 4  95  ? 15.15633 20.32817  -19.39964 1.000 61.64873  ? 83   ARG B NH1   1 
ATOM   5876 N  NH2   . ARG D 4  95  ? 16.94053 21.75764  -19.62373 1.000 61.57385  ? 83   ARG B NH2   1 
ATOM   5877 N  N     . THR D 4  96  ? 11.50977 21.53074  -12.30318 1.000 63.22684  ? 84   THR B N     1 
ATOM   5878 C  CA    . THR D 4  96  ? 10.84856 20.92400  -11.15612 1.000 58.32260  ? 84   THR B CA    1 
ATOM   5879 C  C     . THR D 4  96  ? 9.40224  21.39022  -11.05188 1.000 65.00118  ? 84   THR B C     1 
ATOM   5880 O  O     . THR D 4  96  ? 9.10575  22.57971  -11.20871 1.000 66.85684  ? 84   THR B O     1 
ATOM   5881 C  CB    . THR D 4  96  ? 11.59626 21.27172  -9.86967  1.000 53.52480  ? 84   THR B CB    1 
ATOM   5882 O  OG1   . THR D 4  96  ? 12.94352 20.79949  -9.95825  1.000 51.52031  ? 84   THR B OG1   1 
ATOM   5883 C  CG2   . THR D 4  96  ? 10.92440 20.63386  -8.66717  1.000 51.06866  ? 84   THR B CG2   1 
ATOM   5884 N  N     . GLN D 4  97  ? 8.50469  20.43731  -10.76746 1.000 67.14432  ? 85   GLN B N     1 
ATOM   5885 C  CA    . GLN D 4  97  ? 7.06728  20.67723  -10.67412 1.000 69.21775  ? 85   GLN B CA    1 
ATOM   5886 C  C     . GLN D 4  97  ? 6.74004  21.78604  -9.67957  1.000 76.25856  ? 85   GLN B C     1 
ATOM   5887 O  O     . GLN D 4  97  ? 7.54271  22.09484  -8.79085  1.000 77.16113  ? 85   GLN B O     1 
ATOM   5888 C  CB    . GLN D 4  97  ? 6.34257  19.38667  -10.28348 1.000 64.75029  ? 85   GLN B CB    1 
ATOM   5889 N  N     . ASP D 4  98  ? 5.56861  22.39577  -9.82413  1.000 81.83784  ? 86   ASP B N     1 
ATOM   5890 C  CA    . ASP D 4  98  ? 5.17604  23.48785  -8.93941  1.000 86.88298  ? 86   ASP B CA    1 
ATOM   5891 C  C     . ASP D 4  98  ? 4.19423  23.00233  -7.87627  1.000 85.83396  ? 86   ASP B C     1 
ATOM   5892 O  O     . ASP D 4  98  ? 4.57994  22.74042  -6.73696  1.000 81.65392  ? 86   ASP B O     1 
ATOM   5893 C  CB    . ASP D 4  98  ? 4.56390  24.64459  -9.74221  1.000 92.81278  ? 86   ASP B CB    1 
ATOM   5894 C  CG    . ASP D 4  98  ? 5.55741  25.28542  -10.71410 1.000 93.20304  ? 86   ASP B CG    1 
ATOM   5895 O  OD1   . ASP D 4  98  ? 6.78760  25.17647  -10.49729 1.000 90.16725  ? 86   ASP B OD1   1 
ATOM   5896 O  OD2   . ASP D 4  98  ? 5.10029  25.90801  -11.69787 1.000 95.70741  ? 86   ASP B OD2   1 
ATOM   5897 N  N     . HIS D 4  108 ? 3.12066  36.34899  0.09694   1.000 76.90970  ? 96   HIS B N     1 
ATOM   5898 C  CA    . HIS D 4  108 ? 4.25550  37.25441  0.24612   1.000 73.60796  ? 96   HIS B CA    1 
ATOM   5899 C  C     . HIS D 4  108 ? 3.87169  38.45881  1.09575   1.000 75.33428  ? 96   HIS B C     1 
ATOM   5900 O  O     . HIS D 4  108 ? 2.88144  39.12978  0.81166   1.000 80.26760  ? 96   HIS B O     1 
ATOM   5901 C  CB    . HIS D 4  108 ? 4.77679  37.72115  -1.11898  1.000 70.11964  ? 96   HIS B CB    1 
ATOM   5902 C  CG    . HIS D 4  108 ? 5.93123  38.67246  -1.02355  1.000 67.88356  ? 96   HIS B CG    1 
ATOM   5903 N  ND1   . HIS D 4  108 ? 7.23993  38.24825  -0.91952  1.000 65.19968  ? 96   HIS B ND1   1 
ATOM   5904 C  CD2   . HIS D 4  108 ? 5.96985  40.02742  -0.98251  1.000 66.87919  ? 96   HIS B CD2   1 
ATOM   5905 C  CE1   . HIS D 4  108 ? 8.03431  39.30119  -0.83100  1.000 65.10419  ? 96   HIS B CE1   1 
ATOM   5906 N  NE2   . HIS D 4  108 ? 7.28935  40.39209  -0.86624  1.000 65.53300  ? 96   HIS B NE2   1 
ATOM   5907 N  N     . PRO D 4  109 ? 4.66654  38.74084  2.13115   1.000 73.30113  ? 97   PRO B N     1 
ATOM   5908 C  CA    . PRO D 4  109 ? 4.31698  39.80640  3.08442   1.000 74.28489  ? 97   PRO B CA    1 
ATOM   5909 C  C     . PRO D 4  109 ? 4.65589  41.18907  2.54885   1.000 72.98657  ? 97   PRO B C     1 
ATOM   5910 O  O     . PRO D 4  109 ? 5.82587  41.53654  2.36365   1.000 68.78923  ? 97   PRO B O     1 
ATOM   5911 C  CB    . PRO D 4  109 ? 5.15584  39.44515  4.32174   1.000 73.11996  ? 97   PRO B CB    1 
ATOM   5912 C  CG    . PRO D 4  109 ? 6.35282  38.74489  3.76431   1.000 72.15169  ? 97   PRO B CG    1 
ATOM   5913 C  CD    . PRO D 4  109 ? 5.89274  38.01996  2.51854   1.000 71.99566  ? 97   PRO B CD    1 
ATOM   5914 N  N     . ALA D 4  110 ? 3.61772  41.99902  2.31404   1.000 75.34339  ? 98   ALA B N     1 
ATOM   5915 C  CA    . ALA D 4  110 ? 3.83250  43.35085  1.81312   1.000 74.99602  ? 98   ALA B CA    1 
ATOM   5916 C  C     . ALA D 4  110 ? 4.56791  44.22937  2.81386   1.000 75.19030  ? 98   ALA B C     1 
ATOM   5917 O  O     . ALA D 4  110 ? 5.19447  45.21278  2.40904   1.000 77.64156  ? 98   ALA B O     1 
ATOM   5918 C  CB    . ALA D 4  110 ? 2.49901  43.99601  1.44191   1.000 75.46519  ? 98   ALA B CB    1 
ATOM   5919 N  N     . GLY D 4  111 ? 4.51561  43.89851  4.10602   1.000 75.80592  ? 99   GLY B N     1 
ATOM   5920 C  CA    . GLY D 4  111 ? 5.13334  44.74569  5.11246   1.000 78.14124  ? 99   GLY B CA    1 
ATOM   5921 C  C     . GLY D 4  111 ? 6.64709  44.67545  5.14780   1.000 78.67842  ? 99   GLY B C     1 
ATOM   5922 O  O     . GLY D 4  111 ? 7.28799  45.60229  5.65531   1.000 78.06713  ? 99   GLY B O     1 
ATOM   5923 N  N     . LEU D 4  112 ? 7.23215  43.60474  4.60739   1.000 76.63956  ? 100  LEU B N     1 
ATOM   5924 C  CA    . LEU D 4  112 ? 8.68153  43.43400  4.66095   1.000 74.41464  ? 100  LEU B CA    1 
ATOM   5925 C  C     . LEU D 4  112 ? 9.42124  44.59307  3.98940   1.000 74.57944  ? 100  LEU B C     1 
ATOM   5926 O  O     . LEU D 4  112 ? 10.42070 45.09388  4.52262   1.000 72.27440  ? 100  LEU B O     1 
ATOM   5927 C  CB    . LEU D 4  112 ? 9.06097  42.10402  4.01173   1.000 72.20367  ? 100  LEU B CB    1 
ATOM   5928 C  CG    . LEU D 4  112 ? 10.55332 41.80089  3.97754   1.000 71.03194  ? 100  LEU B CG    1 
ATOM   5929 C  CD1   . LEU D 4  112 ? 11.08932 41.68353  5.40302   1.000 72.11670  ? 100  LEU B CD1   1 
ATOM   5930 C  CD2   . LEU D 4  112 ? 10.81578 40.53752  3.18304   1.000 69.94252  ? 100  LEU B CD2   1 
ATOM   5931 N  N     . LYS D 4  113 ? 8.95341  45.03210  2.81644   1.000 74.43067  ? 101  LYS B N     1 
ATOM   5932 C  CA    . LYS D 4  113 ? 9.61170  46.13957  2.12940   1.000 74.41114  ? 101  LYS B CA    1 
ATOM   5933 C  C     . LYS D 4  113 ? 9.49647  47.46015  2.88250   1.000 80.01534  ? 101  LYS B C     1 
ATOM   5934 O  O     . LYS D 4  113 ? 10.05211 48.46135  2.42062   1.000 82.68937  ? 101  LYS B O     1 
ATOM   5935 C  CB    . LYS D 4  113 ? 9.04340  46.30489  0.71774   1.000 70.73975  ? 101  LYS B CB    1 
ATOM   5936 C  CG    . LYS D 4  113 ? 7.54775  46.09088  0.63070   1.000 68.62137  ? 101  LYS B CG    1 
ATOM   5937 C  CD    . LYS D 4  113 ? 6.85732  47.13314  -0.23041  1.000 61.13443  ? 101  LYS B CD    1 
ATOM   5938 C  CE    . LYS D 4  113 ? 5.39774  46.77224  -0.43152  1.000 60.09063  ? 101  LYS B CE    1 
ATOM   5939 N  NZ    . LYS D 4  113 ? 5.28486  45.56899  -1.30578  1.000 64.53951  ? 101  LYS B NZ    1 
ATOM   5940 N  N     . LYS D 4  114 ? 8.80971  47.49382  4.02782   1.000 80.17607  ? 102  LYS B N     1 
ATOM   5941 C  CA    . LYS D 4  114 ? 8.60853  48.73293  4.76269   1.000 77.86992  ? 102  LYS B CA    1 
ATOM   5942 C  C     . LYS D 4  114 ? 9.41891  48.83561  6.04603   1.000 77.86614  ? 102  LYS B C     1 
ATOM   5943 O  O     . LYS D 4  114 ? 9.65403  49.95275  6.50985   1.000 78.06157  ? 102  LYS B O     1 
ATOM   5944 C  CB    . LYS D 4  114 ? 7.11747  48.91162  5.08812   1.000 75.80519  ? 102  LYS B CB    1 
ATOM   5945 C  CG    . LYS D 4  114 ? 6.28259  49.06595  3.82932   1.000 78.06628  ? 102  LYS B CG    1 
ATOM   5946 C  CD    . LYS D 4  114 ? 4.81670  48.71159  4.01259   1.000 78.47932  ? 102  LYS B CD    1 
ATOM   5947 C  CE    . LYS D 4  114 ? 4.05194  49.03567  2.72655   1.000 79.45130  ? 102  LYS B CE    1 
ATOM   5948 N  NZ    . LYS D 4  114 ? 2.67217  48.48215  2.70604   1.000 81.73601  ? 102  LYS B NZ    1 
ATOM   5949 N  N     . LYS D 4  115 ? 9.87869  47.71625  6.60501   1.000 80.09643  ? 103  LYS B N     1 
ATOM   5950 C  CA    . LYS D 4  115 ? 10.53872 47.72962  7.90695   1.000 79.22955  ? 103  LYS B CA    1 
ATOM   5951 C  C     . LYS D 4  115 ? 11.78940 48.60570  7.88815   1.000 83.03887  ? 103  LYS B C     1 
ATOM   5952 O  O     . LYS D 4  115 ? 12.40882 48.82512  6.84360   1.000 82.27792  ? 103  LYS B O     1 
ATOM   5953 C  CB    . LYS D 4  115 ? 10.89976 46.30426  8.33440   1.000 72.67662  ? 103  LYS B CB    1 
ATOM   5954 C  CG    . LYS D 4  115 ? 9.69167  45.42699  8.69243   1.000 74.01124  ? 103  LYS B CG    1 
ATOM   5955 C  CD    . LYS D 4  115 ? 8.98609  45.87532  9.97817   1.000 72.90540  ? 103  LYS B CD    1 
ATOM   5956 N  N     . LYS D 4  116 ? 12.14180 49.12981  9.06847   1.000 86.40069  ? 104  LYS B N     1 
ATOM   5957 C  CA    . LYS D 4  116 ? 13.32051 49.98363  9.18825   1.000 86.87599  ? 104  LYS B CA    1 
ATOM   5958 C  C     . LYS D 4  116 ? 14.57738 49.24088  8.75300   1.000 89.45839  ? 104  LYS B C     1 
ATOM   5959 O  O     . LYS D 4  116 ? 15.35464 49.73476  7.92606   1.000 91.93935  ? 104  LYS B O     1 
ATOM   5960 C  CB    . LYS D 4  116 ? 13.46227 50.49018  10.62461  1.000 85.02757  ? 104  LYS B CB    1 
ATOM   5961 N  N     . SER D 4  117 ? 14.78540 48.04002  9.28040   1.000 87.25307  ? 105  SER B N     1 
ATOM   5962 C  CA    . SER D 4  117 ? 15.96132 47.27058  8.91118   1.000 84.84369  ? 105  SER B CA    1 
ATOM   5963 C  C     . SER D 4  117 ? 15.58098 45.81173  8.70514   1.000 79.33152  ? 105  SER B C     1 
ATOM   5964 O  O     . SER D 4  117 ? 14.65178 45.29444  9.33356   1.000 77.01456  ? 105  SER B O     1 
ATOM   5965 C  CB    . SER D 4  117 ? 17.07160 47.39781  9.96513   1.000 89.86089  ? 105  SER B CB    1 
ATOM   5966 O  OG    . SER D 4  117 ? 16.54491 47.79557  11.21932  1.000 96.59044  ? 105  SER B OG    1 
ATOM   5967 N  N     . VAL D 4  118 ? 16.31186 45.15803  7.80342   1.000 76.01706  ? 106  VAL B N     1 
ATOM   5968 C  CA    . VAL D 4  118 ? 16.07876 43.76475  7.44425   1.000 69.00040  ? 106  VAL B CA    1 
ATOM   5969 C  C     . VAL D 4  118 ? 17.42193 43.04345  7.43333   1.000 69.19218  ? 106  VAL B C     1 
ATOM   5970 O  O     . VAL D 4  118 ? 18.37213 43.50565  6.79151   1.000 74.53671  ? 106  VAL B O     1 
ATOM   5971 C  CB    . VAL D 4  118 ? 15.37587 43.64335  6.07582   1.000 61.85562  ? 106  VAL B CB    1 
ATOM   5972 C  CG1   . VAL D 4  118 ? 15.32329 42.19393  5.63790   1.000 61.49142  ? 106  VAL B CG1   1 
ATOM   5973 C  CG2   . VAL D 4  118 ? 13.97085 44.21296  6.14700   1.000 53.22178  ? 106  VAL B CG2   1 
ATOM   5974 N  N     . THR D 4  119 ? 17.50729 41.92478  8.15280   1.000 61.89680  ? 107  THR B N     1 
ATOM   5975 C  CA    . THR D 4  119 ? 18.69643 41.07860  8.17387   1.000 64.64622  ? 107  THR B CA    1 
ATOM   5976 C  C     . THR D 4  119 ? 18.43278 39.79190  7.39096   1.000 65.69555  ? 107  THR B C     1 
ATOM   5977 O  O     . THR D 4  119 ? 17.31564 39.26783  7.38581   1.000 73.00713  ? 107  THR B O     1 
ATOM   5978 C  CB    . THR D 4  119 ? 19.12280 40.74612  9.62115   1.000 64.93943  ? 107  THR B CB    1 
ATOM   5979 O  OG1   . THR D 4  119 ? 19.23272 41.95126  10.38991  1.000 65.47937  ? 107  THR B OG1   1 
ATOM   5980 C  CG2   . THR D 4  119 ? 20.47423 40.01970  9.65783   1.000 62.14387  ? 107  THR B CG2   1 
ATOM   5981 N  N     . VAL D 4  120 ? 19.46489 39.28107  6.72385   1.000 59.84806  ? 108  VAL B N     1 
ATOM   5982 C  CA    . VAL D 4  120 ? 19.34578 38.09272  5.88361   1.000 57.93296  ? 108  VAL B CA    1 
ATOM   5983 C  C     . VAL D 4  120 ? 20.17352 36.97358  6.50722   1.000 61.50707  ? 108  VAL B C     1 
ATOM   5984 O  O     . VAL D 4  120 ? 21.41009 37.02996  6.49912   1.000 64.08599  ? 108  VAL B O     1 
ATOM   5985 C  CB    . VAL D 4  120 ? 19.79364 38.35808  4.44100   1.000 57.81738  ? 108  VAL B CB    1 
ATOM   5986 C  CG1   . VAL D 4  120 ? 19.53969 37.12412  3.57814   1.000 46.63152  ? 108  VAL B CG1   1 
ATOM   5987 C  CG2   . VAL D 4  120 ? 19.07749 39.57459  3.87226   1.000 48.01915  ? 108  VAL B CG2   1 
ATOM   5988 N  N     . LEU D 4  121 ? 19.49611 35.94577  7.01940   1.000 59.48635  ? 109  LEU B N     1 
ATOM   5989 C  CA    . LEU D 4  121 ? 20.13321 34.79195  7.63710   1.000 59.07147  ? 109  LEU B CA    1 
ATOM   5990 C  C     . LEU D 4  121 ? 20.16361 33.62708  6.66199   1.000 62.78391  ? 109  LEU B C     1 
ATOM   5991 O  O     . LEU D 4  121 ? 19.20697 33.41031  5.91432   1.000 70.16934  ? 109  LEU B O     1 
ATOM   5992 C  CB    . LEU D 4  121 ? 19.38736 34.37434  8.90022   1.000 59.31364  ? 109  LEU B CB    1 
ATOM   5993 C  CG    . LEU D 4  121 ? 19.33155 35.43531  9.98202   1.000 63.13743  ? 109  LEU B CG    1 
ATOM   5994 C  CD1   . LEU D 4  121 ? 18.03610 35.31045  10.74133  1.000 68.20518  ? 109  LEU B CD1   1 
ATOM   5995 C  CD2   . LEU D 4  121 ? 20.50771 35.24511  10.90310  1.000 64.19715  ? 109  LEU B CD2   1 
ATOM   5996 N  N     . ASP D 4  122 ? 21.25494 32.86747  6.69644   1.000 61.30489  ? 110  ASP B N     1 
ATOM   5997 C  CA    . ASP D 4  122 ? 21.48635 31.74159  5.79067   1.000 63.95757  ? 110  ASP B CA    1 
ATOM   5998 C  C     . ASP D 4  122 ? 21.09869 30.45997  6.52303   1.000 69.47020  ? 110  ASP B C     1 
ATOM   5999 O  O     . ASP D 4  122 ? 21.91225 29.84058  7.20898   1.000 73.47131  ? 110  ASP B O     1 
ATOM   6000 C  CB    . ASP D 4  122 ? 22.94282 31.72105  5.34235   1.000 67.58987  ? 110  ASP B CB    1 
ATOM   6001 C  CG    . ASP D 4  122 ? 23.23213 30.64094  4.32318   1.000 73.94450  ? 110  ASP B CG    1 
ATOM   6002 O  OD1   . ASP D 4  122 ? 22.28940 29.94239  3.88593   1.000 76.53055  ? 110  ASP B OD1   1 
ATOM   6003 O  OD2   . ASP D 4  122 ? 24.41819 30.49053  3.95759   1.000 76.18184  ? 110  ASP B OD2   1 
ATOM   6004 N  N     . VAL D 4  123 ? 19.84635 30.05023  6.36388   1.000 69.10073  ? 111  VAL B N     1 
ATOM   6005 C  CA    . VAL D 4  123 ? 19.32480 28.88699  7.06333   1.000 65.79394  ? 111  VAL B CA    1 
ATOM   6006 C  C     . VAL D 4  123 ? 19.38314 27.62919  6.19010   1.000 64.66540  ? 111  VAL B C     1 
ATOM   6007 O  O     . VAL D 4  123 ? 18.70595 26.64697  6.48301   1.000 65.77466  ? 111  VAL B O     1 
ATOM   6008 C  CB    . VAL D 4  123 ? 17.90044 29.14064  7.58251   1.000 62.85018  ? 111  VAL B CB    1 
ATOM   6009 C  CG1   . VAL D 4  123 ? 17.90175 30.25537  8.60497   1.000 61.32222  ? 111  VAL B CG1   1 
ATOM   6010 C  CG2   . VAL D 4  123 ? 16.97039 29.48798  6.43773   1.000 60.66511  ? 111  VAL B CG2   1 
ATOM   6011 N  N     . GLY D 4  124 ? 20.19835 27.63993  5.12858   1.000 65.51247  ? 112  GLY B N     1 
ATOM   6012 C  CA    . GLY D 4  124 ? 20.21740 26.52245  4.19106   1.000 69.27197  ? 112  GLY B CA    1 
ATOM   6013 C  C     . GLY D 4  124 ? 20.63827 25.19833  4.80800   1.000 74.09081  ? 112  GLY B C     1 
ATOM   6014 O  O     . GLY D 4  124 ? 20.13775 24.14036  4.41416   1.000 73.45766  ? 112  GLY B O     1 
ATOM   6015 N  N     . ASP D 4  125 ? 21.55944 25.23696  5.77549   1.000 77.61183  ? 113  ASP B N     1 
ATOM   6016 C  CA    . ASP D 4  125 ? 22.03136 24.02222  6.44009   1.000 83.25549  ? 113  ASP B CA    1 
ATOM   6017 C  C     . ASP D 4  125 ? 20.87281 23.14764  6.93146   1.000 79.70231  ? 113  ASP B C     1 
ATOM   6018 O  O     . ASP D 4  125 ? 20.94230 21.91191  6.86545   1.000 84.67145  ? 113  ASP B O     1 
ATOM   6019 C  CB    . ASP D 4  125 ? 22.96087 24.41519  7.59645   1.000 94.99228  ? 113  ASP B CB    1 
ATOM   6020 C  CG    . ASP D 4  125 ? 23.44180 23.22319  8.40617   1.000 105.32071 ? 113  ASP B CG    1 
ATOM   6021 O  OD1   . ASP D 4  125 ? 23.98115 22.27340  7.79851   1.000 109.01946 ? 113  ASP B OD1   1 
ATOM   6022 O  OD2   . ASP D 4  125 ? 23.30117 23.24521  9.65273   1.000 108.78825 ? 113  ASP B OD2   1 
ATOM   6023 N  N     . ALA D 4  126 ? 19.78610 23.77414  7.39405   1.000 71.32402  ? 114  ALA B N     1 
ATOM   6024 C  CA    . ALA D 4  126 ? 18.63747 23.02969  7.90527   1.000 64.10765  ? 114  ALA B CA    1 
ATOM   6025 C  C     . ALA D 4  126 ? 18.16617 21.96173  6.92785   1.000 57.46795  ? 114  ALA B C     1 
ATOM   6026 O  O     . ALA D 4  126 ? 17.74797 20.86832  7.33910   1.000 58.75967  ? 114  ALA B O     1 
ATOM   6027 C  CB    . ALA D 4  126 ? 17.49341 23.99466  8.21249   1.000 62.40186  ? 114  ALA B CB    1 
ATOM   6028 N  N     . TYR D 4  127 ? 18.24722 22.25661  5.62633   1.000 50.40479  ? 115  TYR B N     1 
ATOM   6029 C  CA    . TYR D 4  127 ? 17.69562 21.36290  4.61449   1.000 53.79093  ? 115  TYR B CA    1 
ATOM   6030 C  C     . TYR D 4  127 ? 18.34664 19.98498  4.64217   1.000 59.92671  ? 115  TYR B C     1 
ATOM   6031 O  O     . TYR D 4  127 ? 17.73207 19.00067  4.21031   1.000 58.54028  ? 115  TYR B O     1 
ATOM   6032 C  CB    . TYR D 4  127 ? 17.86034 21.98415  3.23212   1.000 54.12258  ? 115  TYR B CB    1 
ATOM   6033 C  CG    . TYR D 4  127 ? 17.05492 23.23682  3.03214   1.000 56.58308  ? 115  TYR B CG    1 
ATOM   6034 C  CD1   . TYR D 4  127 ? 15.90510 23.46250  3.77160   1.000 56.20565  ? 115  TYR B CD1   1 
ATOM   6035 C  CD2   . TYR D 4  127 ? 17.44388 24.19776  2.10337   1.000 57.87340  ? 115  TYR B CD2   1 
ATOM   6036 C  CE1   . TYR D 4  127 ? 15.15686 24.59890  3.59298   1.000 58.70247  ? 115  TYR B CE1   1 
ATOM   6037 C  CE2   . TYR D 4  127 ? 16.69383 25.34785  1.91720   1.000 58.40582  ? 115  TYR B CE2   1 
ATOM   6038 C  CZ    . TYR D 4  127 ? 15.55147 25.53927  2.66644   1.000 59.14799  ? 115  TYR B CZ    1 
ATOM   6039 O  OH    . TYR D 4  127 ? 14.79790 26.67414  2.50163   1.000 61.80588  ? 115  TYR B OH    1 
ATOM   6040 N  N     . PHE D 4  128 ? 19.58785 19.88957  5.12872   1.000 61.89603  ? 116  PHE B N     1 
ATOM   6041 C  CA    . PHE D 4  128 ? 20.24848 18.59105  5.11388   1.000 61.64748  ? 116  PHE B CA    1 
ATOM   6042 C  C     . PHE D 4  128 ? 19.68236 17.63848  6.15403   1.000 65.95517  ? 116  PHE B C     1 
ATOM   6043 O  O     . PHE D 4  128 ? 20.18308 16.51483  6.27824   1.000 69.02552  ? 116  PHE B O     1 
ATOM   6044 C  CB    . PHE D 4  128 ? 21.75859 18.76247  5.31021   1.000 63.02934  ? 116  PHE B CB    1 
ATOM   6045 C  CG    . PHE D 4  128 ? 22.41241 19.61451  4.25480   1.000 69.63483  ? 116  PHE B CG    1 
ATOM   6046 C  CD1   . PHE D 4  128 ? 21.87342 19.69859  2.97244   1.000 71.38015  ? 116  PHE B CD1   1 
ATOM   6047 C  CD2   . PHE D 4  128 ? 23.55381 20.34380  4.54194   1.000 72.76504  ? 116  PHE B CD2   1 
ATOM   6048 C  CE1   . PHE D 4  128 ? 22.46673 20.48514  1.99130   1.000 70.60255  ? 116  PHE B CE1   1 
ATOM   6049 C  CE2   . PHE D 4  128 ? 24.14999 21.13308  3.56890   1.000 74.36578  ? 116  PHE B CE2   1 
ATOM   6050 C  CZ    . PHE D 4  128 ? 23.60371 21.20430  2.28802   1.000 72.28004  ? 116  PHE B CZ    1 
ATOM   6051 N  N     . SER D 4  129 ? 18.65543 18.03724  6.90131   1.000 66.13624  ? 117  SER B N     1 
ATOM   6052 C  CA    . SER D 4  129 ? 18.06275 17.10353  7.84472   1.000 65.92323  ? 117  SER B CA    1 
ATOM   6053 C  C     . SER D 4  129 ? 16.94705 16.27063  7.23357   1.000 63.13825  ? 117  SER B C     1 
ATOM   6054 O  O     . SER D 4  129 ? 16.49127 15.32101  7.87401   1.000 61.68460  ? 117  SER B O     1 
ATOM   6055 C  CB    . SER D 4  129 ? 17.52621 17.84929  9.06531   1.000 69.16627  ? 117  SER B CB    1 
ATOM   6056 O  OG    . SER D 4  129 ? 16.56725 18.81784  8.66958   1.000 76.14267  ? 117  SER B OG    1 
ATOM   6057 N  N     . VAL D 4  130 ? 16.50236 16.58490  6.02621   1.000 60.26290  ? 118  VAL B N     1 
ATOM   6058 C  CA    . VAL D 4  130 ? 15.32543 15.95908  5.42630   1.000 57.48935  ? 118  VAL B CA    1 
ATOM   6059 C  C     . VAL D 4  130 ? 15.77337 15.12845  4.23261   1.000 60.79003  ? 118  VAL B C     1 
ATOM   6060 O  O     . VAL D 4  130 ? 16.49524 15.64270  3.37259   1.000 63.65673  ? 118  VAL B O     1 
ATOM   6061 C  CB    . VAL D 4  130 ? 14.27705 17.00241  5.00116   1.000 55.01099  ? 118  VAL B CB    1 
ATOM   6062 C  CG1   . VAL D 4  130 ? 13.16987 16.34324  4.19958   1.000 57.45425  ? 118  VAL B CG1   1 
ATOM   6063 C  CG2   . VAL D 4  130 ? 13.70229 17.67034  6.22599   1.000 53.27215  ? 118  VAL B CG2   1 
ATOM   6064 N  N     . PRO D 4  131 ? 15.38081 13.86142  4.14021   1.000 63.84612  ? 119  PRO B N     1 
ATOM   6065 C  CA    . PRO D 4  131 ? 15.79567 13.04378  2.99641   1.000 62.38474  ? 119  PRO B CA    1 
ATOM   6066 C  C     . PRO D 4  131 ? 15.07664 13.46732  1.72471   1.000 58.56850  ? 119  PRO B C     1 
ATOM   6067 O  O     . PRO D 4  131 ? 13.99250 14.05560  1.75387   1.000 59.80161  ? 119  PRO B O     1 
ATOM   6068 C  CB    . PRO D 4  131 ? 15.39780 11.61706  3.40483   1.000 52.35103  ? 119  PRO B CB    1 
ATOM   6069 C  CG    . PRO D 4  131 ? 14.94950 11.69786  4.81979   1.000 54.29059  ? 119  PRO B CG    1 
ATOM   6070 C  CD    . PRO D 4  131 ? 14.55569 13.10226  5.09209   1.000 53.98040  ? 119  PRO B CD    1 
ATOM   6071 N  N     . LEU D 4  132 ? 15.70567 13.14042  0.59542   1.000 55.07802  ? 120  LEU B N     1 
ATOM   6072 C  CA    . LEU D 4  132 ? 15.19489 13.44390  -0.73676  1.000 52.22098  ? 120  LEU B CA    1 
ATOM   6073 C  C     . LEU D 4  132 ? 14.62171 12.18683  -1.38240  1.000 57.28220  ? 120  LEU B C     1 
ATOM   6074 O  O     . LEU D 4  132 ? 15.25177 11.12360  -1.34206  1.000 60.57884  ? 120  LEU B O     1 
ATOM   6075 C  CB    . LEU D 4  132 ? 16.30391 14.01048  -1.61715  1.000 46.89534  ? 120  LEU B CB    1 
ATOM   6076 C  CG    . LEU D 4  132 ? 15.90670 14.34241  -3.05797  1.000 48.39220  ? 120  LEU B CG    1 
ATOM   6077 C  CD1   . LEU D 4  132 ? 14.94324 15.52911  -3.09076  1.000 44.44661  ? 120  LEU B CD1   1 
ATOM   6078 C  CD2   . LEU D 4  132 ? 17.15487 14.61518  -3.90066  1.000 45.51589  ? 120  LEU B CD2   1 
ATOM   6079 N  N     . ASP D 4  133 ? 13.43871 12.32213  -1.98593  1.000 56.02553  ? 121  ASP B N     1 
ATOM   6080 C  CA    . ASP D 4  133 ? 12.76773 11.21303  -2.65576  1.000 59.93466  ? 121  ASP B CA    1 
ATOM   6081 C  C     . ASP D 4  133 ? 13.73688 10.45154  -3.55310  1.000 55.23180  ? 121  ASP B C     1 
ATOM   6082 O  O     . ASP D 4  133 ? 14.41134 11.04306  -4.40302  1.000 56.14582  ? 121  ASP B O     1 
ATOM   6083 C  CB    . ASP D 4  133 ? 11.58782 11.75652  -3.46875  1.000 70.52563  ? 121  ASP B CB    1 
ATOM   6084 C  CG    . ASP D 4  133 ? 10.98358 10.72189  -4.40738  1.000 76.42354  ? 121  ASP B CG    1 
ATOM   6085 O  OD1   . ASP D 4  133 ? 10.39666 9.73388   -3.91481  1.000 79.22647  ? 121  ASP B OD1   1 
ATOM   6086 O  OD2   . ASP D 4  133 ? 11.07897 10.91189  -5.64120  1.000 76.64181  ? 121  ASP B OD2   1 
ATOM   6087 N  N     . GLU D 4  134 ? 13.81006 9.13164   -3.34794  1.000 52.67728  ? 122  GLU B N     1 
ATOM   6088 C  CA    . GLU D 4  134 ? 14.87894 8.34258   -3.95704  1.000 54.17157  ? 122  GLU B CA    1 
ATOM   6089 C  C     . GLU D 4  134 ? 14.87078 8.46181   -5.47795  1.000 58.18047  ? 122  GLU B C     1 
ATOM   6090 O  O     . GLU D 4  134 ? 15.93397 8.59205   -6.09526  1.000 60.08694  ? 122  GLU B O     1 
ATOM   6091 C  CB    . GLU D 4  134 ? 14.77570 6.87692   -3.52600  1.000 51.91527  ? 122  GLU B CB    1 
ATOM   6092 N  N     . ASP D 4  135 ? 13.68282 8.45254   -6.09937  1.000 58.79347  ? 123  ASP B N     1 
ATOM   6093 C  CA    . ASP D 4  135 ? 13.59809 8.56754   -7.55445  1.000 57.49148  ? 123  ASP B CA    1 
ATOM   6094 C  C     . ASP D 4  135 ? 14.07625 9.91815   -8.05921  1.000 55.11103  ? 123  ASP B C     1 
ATOM   6095 O  O     . ASP D 4  135 ? 14.50363 10.01805  -9.21625  1.000 55.10093  ? 123  ASP B O     1 
ATOM   6096 C  CB    . ASP D 4  135 ? 12.17136 8.32507   -8.03895  1.000 64.12715  ? 123  ASP B CB    1 
ATOM   6097 C  CG    . ASP D 4  135 ? 11.83118 6.84772   -8.11853  1.000 74.35265  ? 123  ASP B CG    1 
ATOM   6098 O  OD1   . ASP D 4  135 ? 12.77185 6.02748   -8.22492  1.000 74.52404  ? 123  ASP B OD1   1 
ATOM   6099 O  OD2   . ASP D 4  135 ? 10.62691 6.50532   -8.08394  1.000 80.36070  ? 123  ASP B OD2   1 
ATOM   6100 N  N     . PHE D 4  136 ? 14.03492 10.94840  -7.21852  1.000 53.34514  ? 124  PHE B N     1 
ATOM   6101 C  CA    . PHE D 4  136 ? 14.42135 12.27730  -7.66101  1.000 54.24786  ? 124  PHE B CA    1 
ATOM   6102 C  C     . PHE D 4  136 ? 15.91919 12.51745  -7.56464  1.000 52.39366  ? 124  PHE B C     1 
ATOM   6103 O  O     . PHE D 4  136 ? 16.43225 13.40304  -8.25871  1.000 47.73368  ? 124  PHE B O     1 
ATOM   6104 C  CB    . PHE D 4  136 ? 13.68596 13.33688  -6.84431  1.000 54.79336  ? 124  PHE B CB    1 
ATOM   6105 C  CG    . PHE D 4  136 ? 13.66424 14.67690  -7.49553  1.000 55.01468  ? 124  PHE B CG    1 
ATOM   6106 C  CD1   . PHE D 4  136 ? 12.72398 14.96983  -8.46487  1.000 54.07168  ? 124  PHE B CD1   1 
ATOM   6107 C  CD2   . PHE D 4  136 ? 14.59153 15.63803  -7.15375  1.000 55.48907  ? 124  PHE B CD2   1 
ATOM   6108 C  CE1   . PHE D 4  136 ? 12.69833 16.19561  -9.07052  1.000 55.51131  ? 124  PHE B CE1   1 
ATOM   6109 C  CE2   . PHE D 4  136 ? 14.57266 16.87016  -7.75664  1.000 55.81852  ? 124  PHE B CE2   1 
ATOM   6110 C  CZ    . PHE D 4  136 ? 13.62146 17.15154  -8.71512  1.000 57.61338  ? 124  PHE B CZ    1 
ATOM   6111 N  N     . ARG D 4  137 ? 16.62656 11.73031  -6.74528  1.000 50.21560  ? 125  ARG B N     1 
ATOM   6112 C  CA    . ARG D 4  137 ? 18.02114 12.02678  -6.43338  1.000 45.67148  ? 125  ARG B CA    1 
ATOM   6113 C  C     . ARG D 4  137 ? 18.89074 12.09380  -7.67797  1.000 43.76283  ? 125  ARG B C     1 
ATOM   6114 O  O     . ARG D 4  137 ? 19.83048 12.89614  -7.73518  1.000 48.82147  ? 125  ARG B O     1 
ATOM   6115 C  CB    . ARG D 4  137 ? 18.56294 10.97999  -5.46243  1.000 47.98291  ? 125  ARG B CB    1 
ATOM   6116 C  CG    . ARG D 4  137 ? 17.81425 10.96624  -4.14783  1.000 50.94041  ? 125  ARG B CG    1 
ATOM   6117 C  CD    . ARG D 4  137 ? 18.39473 9.96931   -3.17320  1.000 51.40203  ? 125  ARG B CD    1 
ATOM   6118 N  NE    . ARG D 4  137 ? 17.61460 9.96385   -1.94027  1.000 54.16976  ? 125  ARG B NE    1 
ATOM   6119 C  CZ    . ARG D 4  137 ? 17.90002 9.22867   -0.87163  1.000 51.98269  ? 125  ARG B CZ    1 
ATOM   6120 N  NH1   . ARG D 4  137 ? 18.96489 8.42983   -0.87791  1.000 46.96120  ? 125  ARG B NH1   1 
ATOM   6121 N  NH2   . ARG D 4  137 ? 17.12078 9.29964   0.20571   1.000 49.03541  ? 125  ARG B NH2   1 
ATOM   6122 N  N     . LYS D 4  138 ? 18.58729 11.28076  -8.68682  1.000 39.79598  ? 126  LYS B N     1 
ATOM   6123 C  CA    . LYS D 4  138 ? 19.42127 11.23418  -9.87719  1.000 42.86022  ? 126  LYS B CA    1 
ATOM   6124 C  C     . LYS D 4  138 ? 19.48638 12.58176  -10.60250 1.000 46.69632  ? 126  LYS B C     1 
ATOM   6125 O  O     . LYS D 4  138 ? 20.45880 12.83045  -11.32496 1.000 44.68937  ? 126  LYS B O     1 
ATOM   6126 C  CB    . LYS D 4  138 ? 18.91234 10.14130  -10.81574 1.000 41.59339  ? 126  LYS B CB    1 
ATOM   6127 C  CG    . LYS D 4  138 ? 17.49866 10.37975  -11.30543 1.000 48.33033  ? 126  LYS B CG    1 
ATOM   6128 C  CD    . LYS D 4  138 ? 17.11232 9.39654   -12.38865 1.000 54.87788  ? 126  LYS B CD    1 
ATOM   6129 C  CE    . LYS D 4  138 ? 15.62261 9.45859   -12.66235 1.000 65.07815  ? 126  LYS B CE    1 
ATOM   6130 N  NZ    . LYS D 4  138 ? 15.16963 8.30794   -13.49541 1.000 72.47342  ? 126  LYS B NZ    1 
ATOM   6131 N  N     . TYR D 4  139 ? 18.49451 13.46304  -10.41900 1.000 46.09173  ? 127  TYR B N     1 
ATOM   6132 C  CA    . TYR D 4  139 ? 18.52222 14.75395  -11.10283 1.000 50.17245  ? 127  TYR B CA    1 
ATOM   6133 C  C     . TYR D 4  139 ? 19.37426 15.79595  -10.39048 1.000 45.82376  ? 127  TYR B C     1 
ATOM   6134 O  O     . TYR D 4  139 ? 19.51393 16.90709  -10.90858 1.000 43.16062  ? 127  TYR B O     1 
ATOM   6135 C  CB    . TYR D 4  139 ? 17.10839 15.32193  -11.28706 1.000 51.22820  ? 127  TYR B CB    1 
ATOM   6136 C  CG    . TYR D 4  139 ? 16.12967 14.38733  -11.96214 1.000 57.47032  ? 127  TYR B CG    1 
ATOM   6137 C  CD1   . TYR D 4  139 ? 16.32816 13.95451  -13.27374 1.000 54.17046  ? 127  TYR B CD1   1 
ATOM   6138 C  CD2   . TYR D 4  139 ? 14.99185 13.93828  -11.28298 1.000 63.36052  ? 127  TYR B CD2   1 
ATOM   6139 C  CE1   . TYR D 4  139 ? 15.42482 13.09206  -13.88569 1.000 56.63042  ? 127  TYR B CE1   1 
ATOM   6140 C  CE2   . TYR D 4  139 ? 14.08512 13.08262  -11.88532 1.000 61.52466  ? 127  TYR B CE2   1 
ATOM   6141 C  CZ    . TYR D 4  139 ? 14.30294 12.66409  -13.18366 1.000 62.04856  ? 127  TYR B CZ    1 
ATOM   6142 O  OH    . TYR D 4  139 ? 13.38845 11.81925  -13.77109 1.000 65.98096  ? 127  TYR B OH    1 
ATOM   6143 N  N     . THR D 4  140 ? 19.93408 15.48344  -9.22588  1.000 44.15059  ? 128  THR B N     1 
ATOM   6144 C  CA    . THR D 4  140 ? 20.78588 16.41935  -8.49908  1.000 44.50649  ? 128  THR B CA    1 
ATOM   6145 C  C     . THR D 4  140 ? 22.27529 16.17299  -8.74152  1.000 41.87660  ? 128  THR B C     1 
ATOM   6146 O  O     . THR D 4  140 ? 23.11028 16.71980  -8.02137  1.000 37.50824  ? 128  THR B O     1 
ATOM   6147 C  CB    . THR D 4  140 ? 20.47984 16.33693  -7.00970  1.000 45.05964  ? 128  THR B CB    1 
ATOM   6148 O  OG1   . THR D 4  140 ? 20.77121 15.00627  -6.55783  1.000 46.82352  ? 128  THR B OG1   1 
ATOM   6149 C  CG2   . THR D 4  140 ? 19.00509 16.62708  -6.77323  1.000 39.89885  ? 128  THR B CG2   1 
ATOM   6150 N  N     . ALA D 4  141 ? 22.61134 15.35827  -9.73858  1.000 41.23852  ? 129  ALA B N     1 
ATOM   6151 C  CA    . ALA D 4  141 ? 23.98957 15.01836  -10.05109 1.000 35.75958  ? 129  ALA B CA    1 
ATOM   6152 C  C     . ALA D 4  141 ? 24.82854 16.25751  -10.35460 1.000 35.66650  ? 129  ALA B C     1 
ATOM   6153 O  O     . ALA D 4  141 ? 24.38958 17.17533  -11.06180 1.000 34.88675  ? 129  ALA B O     1 
ATOM   6154 C  CB    . ALA D 4  141 ? 24.00797 14.07268  -11.24878 1.000 32.73505  ? 129  ALA B CB    1 
ATOM   6155 N  N     . PHE D 4  142 ? 26.05781 16.25971  -9.83222  1.000 33.75755  ? 130  PHE B N     1 
ATOM   6156 C  CA    . PHE D 4  142 ? 27.04180 17.28556  -10.14242 1.000 31.85089  ? 130  PHE B CA    1 
ATOM   6157 C  C     . PHE D 4  142 ? 28.42926 16.66199  -10.13973 1.000 33.16418  ? 130  PHE B C     1 
ATOM   6158 O  O     . PHE D 4  142 ? 28.63622 15.56314  -9.60742  1.000 31.04227  ? 130  PHE B O     1 
ATOM   6159 C  CB    . PHE D 4  142 ? 26.97935 18.45740  -9.15444  1.000 31.86533  ? 130  PHE B CB    1 
ATOM   6160 C  CG    . PHE D 4  142 ? 27.26809 18.07533  -7.74113  1.000 34.68331  ? 130  PHE B CG    1 
ATOM   6161 C  CD1   . PHE D 4  142 ? 26.26001 17.60487  -6.91967  1.000 33.66355  ? 130  PHE B CD1   1 
ATOM   6162 C  CD2   . PHE D 4  142 ? 28.55191 18.19201  -7.22494  1.000 39.31439  ? 130  PHE B CD2   1 
ATOM   6163 C  CE1   . PHE D 4  142 ? 26.52628 17.26154  -5.61480  1.000 37.44502  ? 130  PHE B CE1   1 
ATOM   6164 C  CE2   . PHE D 4  142 ? 28.83312 17.83273  -5.90372  1.000 33.41462  ? 130  PHE B CE2   1 
ATOM   6165 C  CZ    . PHE D 4  142 ? 27.82520 17.38261  -5.10533  1.000 37.53912  ? 130  PHE B CZ    1 
ATOM   6166 N  N     . THR D 4  143 ? 29.38784 17.39900  -10.71415 1.000 30.01496  ? 131  THR B N     1 
ATOM   6167 C  CA    . THR D 4  143 ? 30.71618 16.88262  -11.04020 1.000 36.20868  ? 131  THR B CA    1 
ATOM   6168 C  C     . THR D 4  143 ? 31.81135 17.84993  -10.59248 1.000 36.35121  ? 131  THR B C     1 
ATOM   6169 O  O     . THR D 4  143 ? 31.88175 18.98792  -11.07722 1.000 33.77443  ? 131  THR B O     1 
ATOM   6170 C  CB    . THR D 4  143 ? 30.84292 16.63779  -12.55378 1.000 33.49755  ? 131  THR B CB    1 
ATOM   6171 O  OG1   . THR D 4  143 ? 29.69122 15.93182  -13.04138 1.000 33.41892  ? 131  THR B OG1   1 
ATOM   6172 C  CG2   . THR D 4  143 ? 32.10714 15.84138  -12.86035 1.000 30.36459  ? 131  THR B CG2   1 
ATOM   6173 N  N     . ILE D 4  144 ? 32.70018 17.37824  -9.72608  1.000 36.66873  ? 132  ILE B N     1 
ATOM   6174 C  CA    . ILE D 4  144 ? 33.89344 18.14260  -9.34792  1.000 34.39368  ? 132  ILE B CA    1 
ATOM   6175 C  C     . ILE D 4  144 ? 34.95196 17.97572  -10.43394 1.000 34.05170  ? 132  ILE B C     1 
ATOM   6176 O  O     . ILE D 4  144 ? 35.29089 16.83154  -10.78881 1.000 40.44948  ? 132  ILE B O     1 
ATOM   6177 C  CB    . ILE D 4  144 ? 34.43120 17.67592  -8.00130  1.000 31.82671  ? 132  ILE B CB    1 
ATOM   6178 C  CG1   . ILE D 4  144 ? 33.29312 17.33308  -7.04328  1.000 35.57424  ? 132  ILE B CG1   1 
ATOM   6179 C  CG2   . ILE D 4  144 ? 35.34016 18.72951  -7.39824  1.000 31.08004  ? 132  ILE B CG2   1 
ATOM   6180 C  CD1   . ILE D 4  144 ? 32.63617 18.53414  -6.46398  1.000 43.09166  ? 132  ILE B CD1   1 
ATOM   6181 N  N     . PRO D 4  145 ? 35.48832 19.05849  -10.97190 1.000 28.64565  ? 133  PRO B N     1 
ATOM   6182 C  CA    . PRO D 4  145 ? 36.61257 18.96067  -11.90464 1.000 28.63063  ? 133  PRO B CA    1 
ATOM   6183 C  C     . PRO D 4  145 ? 37.92438 18.85974  -11.13344 1.000 30.75533  ? 133  PRO B C     1 
ATOM   6184 O  O     . PRO D 4  145 ? 37.95258 18.83860  -9.90933  1.000 29.17271  ? 133  PRO B O     1 
ATOM   6185 C  CB    . PRO D 4  145 ? 36.52606 20.26876  -12.69700 1.000 28.58497  ? 133  PRO B CB    1 
ATOM   6186 C  CG    . PRO D 4  145 ? 35.96647 21.26734  -11.67842 1.000 29.14792  ? 133  PRO B CG    1 
ATOM   6187 C  CD    . PRO D 4  145 ? 35.05094 20.45408  -10.76006 1.000 29.31728  ? 133  PRO B CD    1 
ATOM   6188 N  N     . SER D 4  146 ? 39.02351 18.81173  -11.88312 1.000 29.97443  ? 134  SER B N     1 
ATOM   6189 C  CA    . SER D 4  146 ? 40.35746 18.78376  -11.31192 1.000 28.34043  ? 134  SER B CA    1 
ATOM   6190 C  C     . SER D 4  146 ? 41.23120 19.75368  -12.08707 1.000 31.75553  ? 134  SER B C     1 
ATOM   6191 O  O     . SER D 4  146 ? 40.98601 20.02174  -13.26752 1.000 27.63817  ? 134  SER B O     1 
ATOM   6192 C  CB    . SER D 4  146 ? 40.98123 17.38677  -11.37107 1.000 32.40082  ? 134  SER B CB    1 
ATOM   6193 O  OG    . SER D 4  146 ? 40.95125 16.88092  -12.68713 1.000 35.83678  ? 134  SER B OG    1 
ATOM   6194 N  N     . ILE D 4  147 ? 42.25276 20.27881  -11.40673 1.000 30.84702  ? 135  ILE B N     1 
ATOM   6195 C  CA    . ILE D 4  147 ? 43.21911 21.14756  -12.05828 1.000 29.18232  ? 135  ILE B CA    1 
ATOM   6196 C  C     . ILE D 4  147 ? 43.90500 20.37185  -13.17115 1.000 31.70771  ? 135  ILE B C     1 
ATOM   6197 O  O     . ILE D 4  147 ? 44.52068 19.33027  -12.92935 1.000 34.02429  ? 135  ILE B O     1 
ATOM   6198 C  CB    . ILE D 4  147 ? 44.24560 21.68089  -11.04727 1.000 30.33620  ? 135  ILE B CB    1 
ATOM   6199 C  CG1   . ILE D 4  147 ? 43.55500 22.38187  -9.88286  1.000 31.24579  ? 135  ILE B CG1   1 
ATOM   6200 C  CG2   . ILE D 4  147 ? 45.21980 22.62559  -11.73160 1.000 30.67810  ? 135  ILE B CG2   1 
ATOM   6201 C  CD1   . ILE D 4  147 ? 42.81307 23.62116  -10.30385 1.000 37.66115  ? 135  ILE B CD1   1 
ATOM   6202 N  N     . ASN D 4  148 ? 43.81132 20.88206  -14.39824 1.000 36.95470  ? 136  ASN B N     1 
ATOM   6203 C  CA    . ASN D 4  148 ? 44.58399 20.37090  -15.52514 1.000 27.23428  ? 136  ASN B CA    1 
ATOM   6204 C  C     . ASN D 4  148 ? 44.17341 18.95745  -15.87059 1.000 26.33238  ? 136  ASN B C     1 
ATOM   6205 O  O     . ASN D 4  148 ? 44.96035 18.18741  -16.42618 1.000 34.43695  ? 136  ASN B O     1 
ATOM   6206 C  CB    . ASN D 4  148 ? 46.08838 20.43859  -15.24806 1.000 27.80439  ? 136  ASN B CB    1 
ATOM   6207 C  CG    . ASN D 4  148 ? 46.92580 20.26091  -16.50345 1.000 37.46426  ? 136  ASN B CG    1 
ATOM   6208 O  OD1   . ASN D 4  148 ? 46.46247 20.50210  -17.63741 1.000 31.67694  ? 136  ASN B OD1   1 
ATOM   6209 N  ND2   . ASN D 4  148 ? 48.17279 19.82954  -16.31050 1.000 31.43366  ? 136  ASN B ND2   1 
ATOM   6210 N  N     . ASN D 4  149 ? 42.94150 18.61310  -15.51678 1.000 26.16772  ? 137  ASN B N     1 
ATOM   6211 C  CA    . ASN D 4  149 ? 42.34252 17.34425  -15.91237 1.000 31.03565  ? 137  ASN B CA    1 
ATOM   6212 C  C     . ASN D 4  149 ? 43.21070 16.16505  -15.47069 1.000 27.30542  ? 137  ASN B C     1 
ATOM   6213 O  O     . ASN D 4  149 ? 43.40309 15.19453  -16.19649 1.000 30.00738  ? 137  ASN B O     1 
ATOM   6214 C  CB    . ASN D 4  149 ? 42.07128 17.34320  -17.41611 1.000 24.74518  ? 137  ASN B CB    1 
ATOM   6215 C  CG    . ASN D 4  149 ? 40.99437 18.33658  -17.78572 1.000 30.31239  ? 137  ASN B CG    1 
ATOM   6216 O  OD1   . ASN D 4  149 ? 39.81475 18.08200  -17.53389 1.000 26.70828  ? 137  ASN B OD1   1 
ATOM   6217 N  ND2   . ASN D 4  149 ? 41.38690 19.49417  -18.34626 1.000 25.18943  ? 137  ASN B ND2   1 
ATOM   6218 N  N     . GLU D 4  150 ? 43.75174 16.28082  -14.26149 1.000 30.64058  ? 138  GLU B N     1 
ATOM   6219 C  CA    . GLU D 4  150 ? 44.54038 15.21283  -13.66953 1.000 31.23238  ? 138  GLU B CA    1 
ATOM   6220 C  C     . GLU D 4  150 ? 43.73137 13.92413  -13.55947 1.000 33.75654  ? 138  GLU B C     1 
ATOM   6221 O  O     . GLU D 4  150 ? 44.25556 12.83052  -13.80734 1.000 31.32802  ? 138  GLU B O     1 
ATOM   6222 C  CB    . GLU D 4  150 ? 45.03734 15.66716  -12.29312 1.000 28.77682  ? 138  GLU B CB    1 
ATOM   6223 C  CG    . GLU D 4  150 ? 45.95578 14.70470  -11.59199 1.000 29.05864  ? 138  GLU B CG    1 
ATOM   6224 C  CD    . GLU D 4  150 ? 46.19410 15.08760  -10.14012 1.000 40.45644  ? 138  GLU B CD    1 
ATOM   6225 O  OE1   . GLU D 4  150 ? 46.14725 14.18405  -9.27385  1.000 42.47516  ? 138  GLU B OE1   1 
ATOM   6226 O  OE2   . GLU D 4  150 ? 46.44264 16.29082  -9.86612  1.000 46.93111  ? 138  GLU B OE2   1 
ATOM   6227 N  N     . THR D 4  151 ? 42.46673 14.03154  -13.17698 1.000 26.20721  ? 139  THR B N     1 
ATOM   6228 C  CA    . THR D 4  151 ? 41.55942 12.89824  -13.09767 1.000 35.49110  ? 139  THR B CA    1 
ATOM   6229 C  C     . THR D 4  151 ? 40.31758 13.20298  -13.91892 1.000 31.08905  ? 139  THR B C     1 
ATOM   6230 O  O     . THR D 4  151 ? 40.08518 14.34886  -14.30520 1.000 29.62019  ? 139  THR B O     1 
ATOM   6231 C  CB    . THR D 4  151 ? 41.16133 12.57331  -11.64334 1.000 34.23722  ? 139  THR B CB    1 
ATOM   6232 O  OG1   . THR D 4  151 ? 40.18935 13.51311  -11.17971 1.000 34.51605  ? 139  THR B OG1   1 
ATOM   6233 C  CG2   . THR D 4  151 ? 42.36723 12.59641  -10.72887 1.000 27.79623  ? 139  THR B CG2   1 
ATOM   6234 N  N     . PRO D 4  152 ? 39.52550 12.18762  -14.24632 1.000 33.24849  ? 140  PRO B N     1 
ATOM   6235 C  CA    . PRO D 4  152 ? 38.17234 12.45733  -14.73853 1.000 25.84632  ? 140  PRO B CA    1 
ATOM   6236 C  C     . PRO D 4  152 ? 37.37836 13.19181  -13.67090 1.000 27.91029  ? 140  PRO B C     1 
ATOM   6237 O  O     . PRO D 4  152 ? 37.74083 13.20658  -12.49520 1.000 31.27983  ? 140  PRO B O     1 
ATOM   6238 C  CB    . PRO D 4  152 ? 37.59146 11.05951  -14.98970 1.000 25.24740  ? 140  PRO B CB    1 
ATOM   6239 C  CG    . PRO D 4  152 ? 38.77628 10.13402  -15.04703 1.000 25.08091  ? 140  PRO B CG    1 
ATOM   6240 C  CD    . PRO D 4  152 ? 39.84405 10.74444  -14.19991 1.000 25.35533  ? 140  PRO B CD    1 
ATOM   6241 N  N     . GLY D 4  153 ? 36.27956 13.80994  -14.08362 1.000 28.01713  ? 141  GLY B N     1 
ATOM   6242 C  CA    . GLY D 4  153 ? 35.40470 14.43267  -13.11133 1.000 32.48022  ? 141  GLY B CA    1 
ATOM   6243 C  C     . GLY D 4  153 ? 34.89986 13.43243  -12.08746 1.000 37.37457  ? 141  GLY B C     1 
ATOM   6244 O  O     . GLY D 4  153 ? 34.74168 12.24448  -12.36758 1.000 42.68214  ? 141  GLY B O     1 
ATOM   6245 N  N     . ILE D 4  154 ? 34.61923 13.92450  -10.88531 1.000 38.25213  ? 142  ILE B N     1 
ATOM   6246 C  CA    . ILE D 4  154 ? 34.13933 13.08054  -9.79658  1.000 33.34943  ? 142  ILE B CA    1 
ATOM   6247 C  C     . ILE D 4  154 ? 32.70757 13.48230  -9.45610  1.000 34.20564  ? 142  ILE B C     1 
ATOM   6248 O  O     . ILE D 4  154 ? 32.43870 14.64092  -9.12781  1.000 38.64032  ? 142  ILE B O     1 
ATOM   6249 C  CB    . ILE D 4  154 ? 35.07568 13.15996  -8.58329  1.000 33.78963  ? 142  ILE B CB    1 
ATOM   6250 C  CG1   . ILE D 4  154 ? 36.41740 12.51253  -8.97466  1.000 34.65041  ? 142  ILE B CG1   1 
ATOM   6251 C  CG2   . ILE D 4  154 ? 34.45218 12.44054  -7.39989  1.000 31.52136  ? 142  ILE B CG2   1 
ATOM   6252 C  CD1   . ILE D 4  154 ? 37.48818 12.54738  -7.94722  1.000 32.61801  ? 142  ILE B CD1   1 
ATOM   6253 N  N     . ARG D 4  155 ? 31.78885 12.52422  -9.53366  1.000 35.92103  ? 143  ARG B N     1 
ATOM   6254 C  CA    . ARG D 4  155 ? 30.35983 12.79564  -9.61282  1.000 38.46782  ? 143  ARG B CA    1 
ATOM   6255 C  C     . ARG D 4  155 ? 29.62705 12.36751  -8.34541  1.000 41.00866  ? 143  ARG B C     1 
ATOM   6256 O  O     . ARG D 4  155 ? 29.87798 11.28993  -7.79521  1.000 38.19490  ? 143  ARG B O     1 
ATOM   6257 C  CB    . ARG D 4  155 ? 29.74969 12.08653  -10.83120 1.000 41.97354  ? 143  ARG B CB    1 
ATOM   6258 C  CG    . ARG D 4  155 ? 30.05998 12.77440  -12.15995 1.000 40.21452  ? 143  ARG B CG    1 
ATOM   6259 C  CD    . ARG D 4  155 ? 29.63605 11.95512  -13.37690 1.000 35.65025  ? 143  ARG B CD    1 
ATOM   6260 N  NE    . ARG D 4  155 ? 28.22184 11.58198  -13.40215 1.000 34.68598  ? 143  ARG B NE    1 
ATOM   6261 C  CZ    . ARG D 4  155 ? 27.20789 12.43625  -13.53378 1.000 34.33811  ? 143  ARG B CZ    1 
ATOM   6262 N  NH1   . ARG D 4  155 ? 27.42673 13.74417  -13.61469 1.000 29.57647  ? 143  ARG B NH1   1 
ATOM   6263 N  NH2   . ARG D 4  155 ? 25.96267 11.97701  -13.57775 1.000 34.20187  ? 143  ARG B NH2   1 
ATOM   6264 N  N     . TYR D 4  156 ? 28.68941 13.21082  -7.91503  1.000 44.89725  ? 144  TYR B N     1 
ATOM   6265 C  CA    . TYR D 4  156 ? 27.86749 12.96744  -6.74405  1.000 33.85427  ? 144  TYR B CA    1 
ATOM   6266 C  C     . TYR D 4  156 ? 26.41315 13.24643  -7.07933  1.000 42.25974  ? 144  TYR B C     1 
ATOM   6267 O  O     . TYR D 4  156 ? 26.09411 13.95205  -8.04222  1.000 44.24655  ? 144  TYR B O     1 
ATOM   6268 C  CB    . TYR D 4  156 ? 28.25822 13.85716  -5.55570  1.000 34.44033  ? 144  TYR B CB    1 
ATOM   6269 C  CG    . TYR D 4  156 ? 29.66935 13.70636  -5.03802  1.000 43.63684  ? 144  TYR B CG    1 
ATOM   6270 C  CD1   . TYR D 4  156 ? 30.73824 14.34636  -5.66627  1.000 37.96162  ? 144  TYR B CD1   1 
ATOM   6271 C  CD2   . TYR D 4  156 ? 29.93308 12.95802  -3.88893  1.000 46.27220  ? 144  TYR B CD2   1 
ATOM   6272 C  CE1   . TYR D 4  156 ? 32.03678 14.22864  -5.17851  1.000 37.09326  ? 144  TYR B CE1   1 
ATOM   6273 C  CE2   . TYR D 4  156 ? 31.22485 12.83097  -3.39601  1.000 49.00073  ? 144  TYR B CE2   1 
ATOM   6274 C  CZ    . TYR D 4  156 ? 32.26880 13.47284  -4.04636  1.000 46.39148  ? 144  TYR B CZ    1 
ATOM   6275 O  OH    . TYR D 4  156 ? 33.54709 13.35567  -3.55884  1.000 53.38634  ? 144  TYR B OH    1 
ATOM   6276 N  N     . GLN D 4  157 ? 25.53011 12.69935  -6.24997  1.000 37.40753  ? 145  GLN B N     1 
ATOM   6277 C  CA    . GLN D 4  157 ? 24.13821 13.11845  -6.21320  1.000 40.01812  ? 145  GLN B CA    1 
ATOM   6278 C  C     . GLN D 4  157 ? 23.73957 13.31115  -4.75950  1.000 42.49817  ? 145  GLN B C     1 
ATOM   6279 O  O     . GLN D 4  157 ? 24.42788 12.85238  -3.84337  1.000 39.55848  ? 145  GLN B O     1 
ATOM   6280 C  CB    . GLN D 4  157 ? 23.20436 12.11352  -6.90063  1.000 41.48936  ? 145  GLN B CB    1 
ATOM   6281 C  CG    . GLN D 4  157 ? 22.97291 10.84148  -6.11064  1.000 41.00978  ? 145  GLN B CG    1 
ATOM   6282 C  CD    . GLN D 4  157 ? 21.98887 9.91719   -6.79059  1.000 40.47927  ? 145  GLN B CD    1 
ATOM   6283 O  OE1   . GLN D 4  157 ? 21.74467 10.02336  -7.99322  1.000 41.51444  ? 145  GLN B OE1   1 
ATOM   6284 N  NE2   . GLN D 4  157 ? 21.41227 9.00639   -6.02209  1.000 39.96946  ? 145  GLN B NE2   1 
ATOM   6285 N  N     . TYR D 4  158 ? 22.63112 14.02306  -4.56168  1.000 44.49982  ? 146  TYR B N     1 
ATOM   6286 C  CA    . TYR D 4  158 ? 22.13743 14.33258  -3.22822  1.000 46.68288  ? 146  TYR B CA    1 
ATOM   6287 C  C     . TYR D 4  158 ? 21.28022 13.19815  -2.67155  1.000 48.36980  ? 146  TYR B C     1 
ATOM   6288 O  O     . TYR D 4  158 ? 20.65452 12.43733  -3.41459  1.000 50.71316  ? 146  TYR B O     1 
ATOM   6289 C  CB    . TYR D 4  158 ? 21.33361 15.63368  -3.25290  1.000 49.08298  ? 146  TYR B CB    1 
ATOM   6290 C  CG    . TYR D 4  158 ? 22.20319 16.83076  -2.98820  1.000 49.24492  ? 146  TYR B CG    1 
ATOM   6291 C  CD1   . TYR D 4  158 ? 22.90265 17.45055  -4.02127  1.000 40.35378  ? 146  TYR B CD1   1 
ATOM   6292 C  CD2   . TYR D 4  158 ? 22.36339 17.31518  -1.69026  1.000 51.27701  ? 146  TYR B CD2   1 
ATOM   6293 C  CE1   . TYR D 4  158 ? 23.72252 18.51109  -3.76987  1.000 38.05311  ? 146  TYR B CE1   1 
ATOM   6294 C  CE2   . TYR D 4  158 ? 23.17415 18.39021  -1.43056  1.000 47.18972  ? 146  TYR B CE2   1 
ATOM   6295 C  CZ    . TYR D 4  158 ? 23.85030 18.98443  -2.47188  1.000 44.83291  ? 146  TYR B CZ    1 
ATOM   6296 O  OH    . TYR D 4  158 ? 24.67063 20.04910  -2.20323  1.000 49.23674  ? 146  TYR B OH    1 
ATOM   6297 N  N     . ASN D 4  159 ? 21.27718 13.08060  -1.34409  1.000 45.21748  ? 147  ASN B N     1 
ATOM   6298 C  CA    . ASN D 4  159 ? 20.32290 12.24163  -0.63247  1.000 50.93181  ? 147  ASN B CA    1 
ATOM   6299 C  C     . ASN D 4  159 ? 19.37933 13.05269  0.23706   1.000 58.17148  ? 147  ASN B C     1 
ATOM   6300 O  O     . ASN D 4  159 ? 18.41684 12.48872  0.77163   1.000 60.95685  ? 147  ASN B O     1 
ATOM   6301 C  CB    . ASN D 4  159 ? 21.04634 11.21584  0.25777   1.000 50.00243  ? 147  ASN B CB    1 
ATOM   6302 C  CG    . ASN D 4  159 ? 21.97636 10.30987  -0.52267  1.000 47.77773  ? 147  ASN B CG    1 
ATOM   6303 O  OD1   . ASN D 4  159 ? 21.63017 9.79979   -1.59717  1.000 46.48045  ? 147  ASN B OD1   1 
ATOM   6304 N  ND2   . ASN D 4  159 ? 23.17634 10.11322  0.01024   1.000 43.80683  ? 147  ASN B ND2   1 
ATOM   6305 N  N     . VAL D 4  160 ? 19.64140 14.35237  0.39845   1.000 58.00509  ? 148  VAL B N     1 
ATOM   6306 C  CA    . VAL D 4  160 ? 18.86800 15.23472  1.25710   1.000 62.47340  ? 148  VAL B CA    1 
ATOM   6307 C  C     . VAL D 4  160 ? 18.42152 16.43752  0.43723   1.000 64.77249  ? 148  VAL B C     1 
ATOM   6308 O  O     . VAL D 4  160 ? 18.82938 16.62263  -0.71039  1.000 64.79301  ? 148  VAL B O     1 
ATOM   6309 C  CB    . VAL D 4  160 ? 19.66671 15.69883  2.49373   1.000 62.22219  ? 148  VAL B CB    1 
ATOM   6310 C  CG1   . VAL D 4  160 ? 20.04946 14.50968  3.36926   1.000 60.81134  ? 148  VAL B CG1   1 
ATOM   6311 C  CG2   . VAL D 4  160 ? 20.89842 16.47340  2.05273   1.000 59.59569  ? 148  VAL B CG2   1 
ATOM   6312 N  N     . LEU D 4  161 ? 17.57000 17.25795  1.04977   1.000 64.23824  ? 149  LEU B N     1 
ATOM   6313 C  CA    . LEU D 4  161 ? 17.10523 18.47989  0.41810   1.000 54.98808  ? 149  LEU B CA    1 
ATOM   6314 C  C     . LEU D 4  161 ? 18.30539 19.35143  0.08939   1.000 52.01706  ? 149  LEU B C     1 
ATOM   6315 O  O     . LEU D 4  161 ? 19.02069 19.77459  1.00973   1.000 52.38462  ? 149  LEU B O     1 
ATOM   6316 C  CB    . LEU D 4  161 ? 16.14385 19.23318  1.32946   1.000 52.62954  ? 149  LEU B CB    1 
ATOM   6317 C  CG    . LEU D 4  161 ? 14.83207 18.52816  1.65989   1.000 54.47106  ? 149  LEU B CG    1 
ATOM   6318 C  CD1   . LEU D 4  161 ? 13.86675 19.49292  2.33601   1.000 54.49206  ? 149  LEU B CD1   1 
ATOM   6319 C  CD2   . LEU D 4  161 ? 14.21122 17.89870  0.41623   1.000 52.30575  ? 149  LEU B CD2   1 
ATOM   6320 N  N     . PRO D 4  162 ? 18.58233 19.61656  -1.18616  1.000 51.68092  ? 150  PRO B N     1 
ATOM   6321 C  CA    . PRO D 4  162 ? 19.76498 20.41431  -1.54002  1.000 50.70888  ? 150  PRO B CA    1 
ATOM   6322 C  C     . PRO D 4  162 ? 19.53651 21.90134  -1.30801  1.000 47.57782  ? 150  PRO B C     1 
ATOM   6323 O  O     . PRO D 4  162 ? 18.44444 22.42615  -1.53586  1.000 46.58711  ? 150  PRO B O     1 
ATOM   6324 C  CB    . PRO D 4  162 ? 19.96123 20.12046  -3.03839  1.000 49.37304  ? 150  PRO B CB    1 
ATOM   6325 C  CG    . PRO D 4  162 ? 18.98260 19.02005  -3.38380  1.000 48.72088  ? 150  PRO B CG    1 
ATOM   6326 C  CD    . PRO D 4  162 ? 17.88313 19.10462  -2.37506  1.000 50.66053  ? 150  PRO B CD    1 
ATOM   6327 N  N     . GLN D 4  163 ? 20.58060 22.58336  -0.84456  1.000 46.41313  ? 151  GLN B N     1 
ATOM   6328 C  CA    . GLN D 4  163 ? 20.56815 24.03886  -0.88783  1.000 46.56646  ? 151  GLN B CA    1 
ATOM   6329 C  C     . GLN D 4  163 ? 20.46021 24.49988  -2.33742  1.000 48.91665  ? 151  GLN B C     1 
ATOM   6330 O  O     . GLN D 4  163 ? 21.08871 23.93274  -3.24007  1.000 49.92880  ? 151  GLN B O     1 
ATOM   6331 C  CB    . GLN D 4  163 ? 21.82981 24.62077  -0.25227  1.000 45.70418  ? 151  GLN B CB    1 
ATOM   6332 C  CG    . GLN D 4  163 ? 22.09398 24.15811  1.15948   1.000 57.36728  ? 151  GLN B CG    1 
ATOM   6333 C  CD    . GLN D 4  163 ? 23.33639 24.79874  1.74953   1.000 65.22827  ? 151  GLN B CD    1 
ATOM   6334 O  OE1   . GLN D 4  163 ? 23.31234 25.31316  2.86904   1.000 69.21920  ? 151  GLN B OE1   1 
ATOM   6335 N  NE2   . GLN D 4  163 ? 24.42940 24.77885  0.99354   1.000 68.08758  ? 151  GLN B NE2   1 
ATOM   6336 N  N     . GLY D 4  164 ? 19.64415 25.52304  -2.56540  1.000 46.31547  ? 152  GLY B N     1 
ATOM   6337 C  CA    . GLY D 4  164 ? 19.51019 26.07105  -3.89173  1.000 38.76479  ? 152  GLY B CA    1 
ATOM   6338 C  C     . GLY D 4  164 ? 18.43871 25.44302  -4.74826  1.000 43.24977  ? 152  GLY B C     1 
ATOM   6339 O  O     . GLY D 4  164 ? 18.22387 25.90955  -5.87598  1.000 38.29814  ? 152  GLY B O     1 
ATOM   6340 N  N     . TRP D 4  165 ? 17.74766 24.41556  -4.26050  1.000 43.58367  ? 153  TRP B N     1 
ATOM   6341 C  CA    . TRP D 4  165 ? 16.71791 23.75945  -5.05506  1.000 51.47155  ? 153  TRP B CA    1 
ATOM   6342 C  C     . TRP D 4  165 ? 15.34671 24.28148  -4.65321  1.000 55.53680  ? 153  TRP B C     1 
ATOM   6343 O  O     . TRP D 4  165 ? 15.05264 24.42375  -3.46305  1.000 59.83130  ? 153  TRP B O     1 
ATOM   6344 C  CB    . TRP D 4  165 ? 16.78125 22.23554  -4.90478  1.000 53.79188  ? 153  TRP B CB    1 
ATOM   6345 C  CG    . TRP D 4  165 ? 15.66342 21.47420  -5.61845  1.000 52.48602  ? 153  TRP B CG    1 
ATOM   6346 C  CD1   . TRP D 4  165 ? 15.32377 21.55196  -6.94251  1.000 49.18090  ? 153  TRP B CD1   1 
ATOM   6347 C  CD2   . TRP D 4  165 ? 14.77779 20.50090  -5.03537  1.000 50.22917  ? 153  TRP B CD2   1 
ATOM   6348 N  NE1   . TRP D 4  165 ? 14.27544 20.70283  -7.21354  1.000 48.81454  ? 153  TRP B NE1   1 
ATOM   6349 C  CE2   . TRP D 4  165 ? 13.92175 20.04705  -6.06114  1.000 52.33712  ? 153  TRP B CE2   1 
ATOM   6350 C  CE3   . TRP D 4  165 ? 14.62458 19.97663  -3.74508  1.000 44.61119  ? 153  TRP B CE3   1 
ATOM   6351 C  CZ2   . TRP D 4  165 ? 12.91983 19.09425  -5.83330  1.000 53.39368  ? 153  TRP B CZ2   1 
ATOM   6352 C  CZ3   . TRP D 4  165 ? 13.63190 19.03622  -3.51984  1.000 46.78027  ? 153  TRP B CZ3   1 
ATOM   6353 C  CH2   . TRP D 4  165 ? 12.79373 18.60163  -4.55965  1.000 50.76259  ? 153  TRP B CH2   1 
ATOM   6354 N  N     . LYS D 4  166 ? 14.52165 24.57509  -5.66607  1.000 56.93610  ? 154  LYS B N     1 
ATOM   6355 C  CA    . LYS D 4  166 ? 13.18226 25.11631  -5.44506  1.000 60.22340  ? 154  LYS B CA    1 
ATOM   6356 C  C     . LYS D 4  166 ? 12.37879 24.25403  -4.47290  1.000 59.13414  ? 154  LYS B C     1 
ATOM   6357 O  O     . LYS D 4  166 ? 11.59906 24.77349  -3.66510  1.000 59.71183  ? 154  LYS B O     1 
ATOM   6358 C  CB    . LYS D 4  166 ? 12.44850 25.24153  -6.79066  1.000 62.48942  ? 154  LYS B CB    1 
ATOM   6359 C  CG    . LYS D 4  166 ? 10.97202 25.62658  -6.68156  1.000 61.83834  ? 154  LYS B CG    1 
ATOM   6360 C  CD    . LYS D 4  166 ? 10.13566 25.03420  -7.81061  1.000 62.60515  ? 154  LYS B CD    1 
ATOM   6361 C  CE    . LYS D 4  166 ? 10.44377 25.67733  -9.14401  1.000 67.13520  ? 154  LYS B CE    1 
ATOM   6362 N  NZ    . LYS D 4  166 ? 9.55483  25.19127  -10.24597 1.000 71.23142  ? 154  LYS B NZ    1 
ATOM   6363 N  N     . GLY D 4  167 ? 12.57622 22.93538  -4.51873  1.000 56.15047  ? 155  GLY B N     1 
ATOM   6364 C  CA    . GLY D 4  167 ? 11.79786 22.03790  -3.68772  1.000 57.61762  ? 155  GLY B CA    1 
ATOM   6365 C  C     . GLY D 4  167 ? 12.16826 22.04439  -2.21834  1.000 60.28734  ? 155  GLY B C     1 
ATOM   6366 O  O     . GLY D 4  167 ? 11.36092 21.61004  -1.39105  1.000 61.77731  ? 155  GLY B O     1 
ATOM   6367 N  N     . SER D 4  168 ? 13.37370 22.51919  -1.86771  1.000 59.37651  ? 156  SER B N     1 
ATOM   6368 C  CA    . SER D 4  168 ? 13.79440 22.45023  -0.46704  1.000 57.55542  ? 156  SER B CA    1 
ATOM   6369 C  C     . SER D 4  168 ? 12.94162 23.33794  0.43450   1.000 57.18862  ? 156  SER B C     1 
ATOM   6370 O  O     . SER D 4  168 ? 12.37005 22.82574  1.41502   1.000 60.43068  ? 156  SER B O     1 
ATOM   6371 C  CB    . SER D 4  168 ? 15.28762 22.76258  -0.35127  1.000 57.34241  ? 156  SER B CB    1 
ATOM   6372 O  OG    . SER D 4  168 ? 16.05228 21.84068  -1.09702  1.000 57.22957  ? 156  SER B OG    1 
ATOM   6373 N  N     . PRO D 4  169 ? 12.81093 24.64840  0.18789   1.000 53.23890  ? 157  PRO B N     1 
ATOM   6374 C  CA    . PRO D 4  169 ? 11.95665 25.45160  1.08167   1.000 53.34612  ? 157  PRO B CA    1 
ATOM   6375 C  C     . PRO D 4  169 ? 10.51469 24.98240  1.08863   1.000 57.38752  ? 157  PRO B C     1 
ATOM   6376 O  O     . PRO D 4  169 ? 9.86231  25.01243  2.14035   1.000 57.38571  ? 157  PRO B O     1 
ATOM   6377 C  CB    . PRO D 4  169 ? 12.09352 26.87638  0.52442   1.000 46.99703  ? 157  PRO B CB    1 
ATOM   6378 C  CG    . PRO D 4  169 ? 12.47040 26.68983  -0.88507  1.000 48.24684  ? 157  PRO B CG    1 
ATOM   6379 C  CD    . PRO D 4  169 ? 13.33796 25.46102  -0.92444  1.000 48.40771  ? 157  PRO B CD    1 
ATOM   6380 N  N     . ALA D 4  170 ? 10.01246 24.50662  -0.05080  1.000 56.58341  ? 158  ALA B N     1 
ATOM   6381 C  CA    . ALA D 4  170 ? 8.64733  24.00204  -0.11343  1.000 52.51844  ? 158  ALA B CA    1 
ATOM   6382 C  C     . ALA D 4  170 ? 8.46251  22.80843  0.81470   1.000 55.25847  ? 158  ALA B C     1 
ATOM   6383 O  O     . ALA D 4  170 ? 7.64327  22.84143  1.74053   1.000 56.76229  ? 158  ALA B O     1 
ATOM   6384 C  CB    . ALA D 4  170 ? 8.31007  23.63004  -1.55703  1.000 51.69047  ? 158  ALA B CB    1 
ATOM   6385 N  N     . ILE D 4  171 ? 9.23155  21.73982  0.58044   1.000 57.35053  ? 159  ILE B N     1 
ATOM   6386 C  CA    . ILE D 4  171 ? 9.10518  20.51428  1.36439   1.000 58.11844  ? 159  ILE B CA    1 
ATOM   6387 C  C     . ILE D 4  171 ? 9.39094  20.77594  2.83989   1.000 59.95292  ? 159  ILE B C     1 
ATOM   6388 O  O     . ILE D 4  171 ? 8.83451  20.10340  3.71660   1.000 62.83389  ? 159  ILE B O     1 
ATOM   6389 C  CB    . ILE D 4  171 ? 10.03305 19.42533  0.77168   1.000 56.93366  ? 159  ILE B CB    1 
ATOM   6390 C  CG1   . ILE D 4  171 ? 9.54317  18.99027  -0.60632  1.000 47.85368  ? 159  ILE B CG1   1 
ATOM   6391 C  CG2   . ILE D 4  171 ? 10.11496 18.20376  1.66458   1.000 54.53767  ? 159  ILE B CG2   1 
ATOM   6392 C  CD1   . ILE D 4  171 ? 10.47198 18.01354  -1.27052  1.000 48.01760  ? 159  ILE B CD1   1 
ATOM   6393 N  N     . PHE D 4  172 ? 10.22776 21.76743  3.14658   1.000 59.01333  ? 160  PHE B N     1 
ATOM   6394 C  CA    . PHE D 4  172 ? 10.59159 22.04386  4.52954   1.000 59.85185  ? 160  PHE B CA    1 
ATOM   6395 C  C     . PHE D 4  172 ? 9.68218  23.06469  5.21605   1.000 63.41551  ? 160  PHE B C     1 
ATOM   6396 O  O     . PHE D 4  172 ? 9.77702  23.22009  6.43962   1.000 66.98368  ? 160  PHE B O     1 
ATOM   6397 C  CB    . PHE D 4  172 ? 12.04421 22.52711  4.57812   1.000 55.53064  ? 160  PHE B CB    1 
ATOM   6398 C  CG    . PHE D 4  172 ? 12.63131 22.54992  5.94936   1.000 55.15100  ? 160  PHE B CG    1 
ATOM   6399 C  CD1   . PHE D 4  172 ? 13.08501 21.38361  6.53600   1.000 57.85187  ? 160  PHE B CD1   1 
ATOM   6400 C  CD2   . PHE D 4  172 ? 12.74693 23.74189  6.64797   1.000 54.37504  ? 160  PHE B CD2   1 
ATOM   6401 C  CE1   . PHE D 4  172 ? 13.63415 21.40187  7.80266   1.000 59.74155  ? 160  PHE B CE1   1 
ATOM   6402 C  CE2   . PHE D 4  172 ? 13.29069 23.77264  7.91252   1.000 54.98604  ? 160  PHE B CE2   1 
ATOM   6403 C  CZ    . PHE D 4  172 ? 13.73658 22.60243  8.49174   1.000 59.53373  ? 160  PHE B CZ    1 
ATOM   6404 N  N     . GLN D 4  173 ? 8.79382  23.73655  4.47367   1.000 62.43790  ? 161  GLN B N     1 
ATOM   6405 C  CA    . GLN D 4  173 ? 8.02699  24.84675  5.03572   1.000 65.75361  ? 161  GLN B CA    1 
ATOM   6406 C  C     . GLN D 4  173 ? 7.28054  24.47870  6.31533   1.000 69.30860  ? 161  GLN B C     1 
ATOM   6407 O  O     . GLN D 4  173 ? 7.15255  25.30930  7.22019   1.000 71.61520  ? 161  GLN B O     1 
ATOM   6408 C  CB    . GLN D 4  173 ? 7.04534  25.38144  3.99752   1.000 68.54597  ? 161  GLN B CB    1 
ATOM   6409 C  CG    . GLN D 4  173 ? 6.34717  26.64743  4.44706   1.000 76.26829  ? 161  GLN B CG    1 
ATOM   6410 C  CD    . GLN D 4  173 ? 5.28415  27.09881  3.47480   1.000 82.48069  ? 161  GLN B CD    1 
ATOM   6411 O  OE1   . GLN D 4  173 ? 4.96577  26.39675  2.51246   1.000 81.53989  ? 161  GLN B OE1   1 
ATOM   6412 N  NE2   . GLN D 4  173 ? 4.72403  28.27875  3.71978   1.000 86.93804  ? 161  GLN B NE2   1 
ATOM   6413 N  N     . SER D 4  174 ? 6.76046  23.25538  6.41235   1.000 69.43139  ? 162  SER B N     1 
ATOM   6414 C  CA    . SER D 4  174 ? 6.01816  22.90117  7.61999   1.000 74.64502  ? 162  SER B CA    1 
ATOM   6415 C  C     . SER D 4  174 ? 6.93970  22.84596  8.83415   1.000 80.37331  ? 162  SER B C     1 
ATOM   6416 O  O     . SER D 4  174 ? 6.59725  23.36091  9.91119   1.000 84.48100  ? 162  SER B O     1 
ATOM   6417 C  CB    . SER D 4  174 ? 5.29899  21.57233  7.42514   1.000 74.43836  ? 162  SER B CB    1 
ATOM   6418 O  OG    . SER D 4  174 ? 6.23145  20.55312  7.12309   1.000 78.56604  ? 162  SER B OG    1 
ATOM   6419 N  N     . SER D 4  175 ? 8.11682  22.23119  8.67716   1.000 78.92601  ? 163  SER B N     1 
ATOM   6420 C  CA    . SER D 4  175 ? 9.09945  22.23294  9.75530   1.000 80.25773  ? 163  SER B CA    1 
ATOM   6421 C  C     . SER D 4  175 ? 9.52398  23.65252  10.09709  1.000 82.16124  ? 163  SER B C     1 
ATOM   6422 O  O     . SER D 4  175 ? 9.65925  24.00462  11.27636  1.000 88.23769  ? 163  SER B O     1 
ATOM   6423 C  CB    . SER D 4  175 ? 10.31488 21.39387  9.36311   1.000 78.25140  ? 163  SER B CB    1 
ATOM   6424 O  OG    . SER D 4  175 ? 9.92319  20.11232  8.91195   1.000 79.65162  ? 163  SER B OG    1 
ATOM   6425 N  N     . MET D 4  176 ? 9.72186  24.48486  9.07231   1.000 77.84556  ? 164  MET B N     1 
ATOM   6426 C  CA    . MET D 4  176 ? 10.12580 25.87032  9.29956   1.000 72.55172  ? 164  MET B CA    1 
ATOM   6427 C  C     . MET D 4  176 ? 9.08139  26.61856  10.11670  1.000 69.66508  ? 164  MET B C     1 
ATOM   6428 O  O     . MET D 4  176 ? 9.41450  27.31752  11.08075  1.000 73.35950  ? 164  MET B O     1 
ATOM   6429 C  CB    . MET D 4  176 ? 10.36867 26.57986  7.96665   1.000 69.47084  ? 164  MET B CB    1 
ATOM   6430 C  CG    . MET D 4  176 ? 10.85643 28.01216  8.12827   1.000 68.96124  ? 164  MET B CG    1 
ATOM   6431 S  SD    . MET D 4  176 ? 12.46307 28.11585  8.95195   1.000 67.30886  ? 164  MET B SD    1 
ATOM   6432 C  CE    . MET D 4  176 ? 13.52696 27.43446  7.68181   1.000 57.06325  ? 164  MET B CE    1 
ATOM   6433 N  N     . THR D 4  177 ? 7.80683  26.47801  9.74495   1.000 64.46042  ? 165  THR B N     1 
ATOM   6434 C  CA    . THR D 4  177 ? 6.74466  27.17350  10.45991  1.000 63.32005  ? 165  THR B CA    1 
ATOM   6435 C  C     . THR D 4  177 ? 6.62762  26.67743  11.89155  1.000 69.30697  ? 165  THR B C     1 
ATOM   6436 O  O     . THR D 4  177 ? 6.41842  27.47885  12.81411  1.000 74.61483  ? 165  THR B O     1 
ATOM   6437 C  CB    . THR D 4  177 ? 5.41644  27.00094  9.73383   1.000 62.69082  ? 165  THR B CB    1 
ATOM   6438 O  OG1   . THR D 4  177 ? 5.59147  27.30494  8.34562   1.000 69.27974  ? 165  THR B OG1   1 
ATOM   6439 C  CG2   . THR D 4  177 ? 4.39171  27.94008  10.31251  1.000 62.77026  ? 165  THR B CG2   1 
ATOM   6440 N  N     . LYS D 4  178 ? 6.74904  25.35928  12.09822  1.000 70.05631  ? 166  LYS B N     1 
ATOM   6441 C  CA    . LYS D 4  178 ? 6.70307  24.82676  13.45827  1.000 76.82479  ? 166  LYS B CA    1 
ATOM   6442 C  C     . LYS D 4  178 ? 7.86098  25.36320  14.29642  1.000 78.14507  ? 166  LYS B C     1 
ATOM   6443 O  O     . LYS D 4  178 ? 7.70300  25.63014  15.49439  1.000 78.66677  ? 166  LYS B O     1 
ATOM   6444 C  CB    . LYS D 4  178 ? 6.71274  23.29716  13.42541  1.000 78.33080  ? 166  LYS B CB    1 
ATOM   6445 N  N     . ILE D 4  179 ? 9.02785  25.54576  13.67423  1.000 77.33371  ? 167  ILE B N     1 
ATOM   6446 C  CA    . ILE D 4  179 ? 10.18412 26.10672  14.37092  1.000 79.36966  ? 167  ILE B CA    1 
ATOM   6447 C  C     . ILE D 4  179 ? 9.95902  27.57745  14.71260  1.000 80.22035  ? 167  ILE B C     1 
ATOM   6448 O  O     . ILE D 4  179 ? 10.34784 28.05176  15.78809  1.000 81.36803  ? 167  ILE B O     1 
ATOM   6449 C  CB    . ILE D 4  179 ? 11.44315 25.91351  13.50577  1.000 76.95986  ? 167  ILE B CB    1 
ATOM   6450 C  CG1   . ILE D 4  179 ? 11.87085 24.44277  13.53139  1.000 79.15430  ? 167  ILE B CG1   1 
ATOM   6451 C  CG2   . ILE D 4  179 ? 12.56434 26.86282  13.93023  1.000 73.57546  ? 167  ILE B CG2   1 
ATOM   6452 C  CD1   . ILE D 4  179 ? 13.15840 24.15668  12.79228  1.000 76.77224  ? 167  ILE B CD1   1 
ATOM   6453 N  N     . LEU D 4  180 ? 9.33767  28.32219  13.80658  1.000 77.75755  ? 168  LEU B N     1 
ATOM   6454 C  CA    . LEU D 4  180 ? 9.23960  29.76254  13.97365  1.000 73.09498  ? 168  LEU B CA    1 
ATOM   6455 C  C     . LEU D 4  180 ? 8.05811  30.19991  14.83656  1.000 76.49151  ? 168  LEU B C     1 
ATOM   6456 O  O     . LEU D 4  180 ? 8.13434  31.27500  15.44035  1.000 79.27110  ? 168  LEU B O     1 
ATOM   6457 C  CB    . LEU D 4  180 ? 9.18361  30.43906  12.59625  1.000 64.68771  ? 168  LEU B CB    1 
ATOM   6458 C  CG    . LEU D 4  180 ? 10.44845 30.23874  11.73054  1.000 64.42875  ? 168  LEU B CG    1 
ATOM   6459 C  CD1   . LEU D 4  180 ? 10.30323 30.82455  10.33279  1.000 53.35336  ? 168  LEU B CD1   1 
ATOM   6460 C  CD2   . LEU D 4  180 ? 11.71603 30.78509  12.38856  1.000 55.77304  ? 168  LEU B CD2   1 
ATOM   6461 N  N     . GLU D 4  181 ? 6.98905  29.38770  14.94230  1.000 77.29548  ? 169  GLU B N     1 
ATOM   6462 C  CA    . GLU D 4  181 ? 5.76515  29.78002  15.65285  1.000 85.13110  ? 169  GLU B CA    1 
ATOM   6463 C  C     . GLU D 4  181 ? 6.01148  30.56386  16.94492  1.000 93.08634  ? 169  GLU B C     1 
ATOM   6464 O  O     . GLU D 4  181 ? 5.48642  31.67756  17.08404  1.000 92.49387  ? 169  GLU B O     1 
ATOM   6465 C  CB    . GLU D 4  181 ? 4.89472  28.55097  15.96331  1.000 82.89790  ? 169  GLU B CB    1 
ATOM   6466 N  N     . PRO D 4  182 ? 6.79982  30.05132  17.90206  1.000 97.49482  ? 170  PRO B N     1 
ATOM   6467 C  CA    . PRO D 4  182 ? 6.92236  30.77931  19.17919  1.000 102.02593 ? 170  PRO B CA    1 
ATOM   6468 C  C     . PRO D 4  182 ? 7.66426  32.10330  19.06362  1.000 99.34424  ? 170  PRO B C     1 
ATOM   6469 O  O     . PRO D 4  182 ? 7.27861  33.08139  19.72031  1.000 101.69632 ? 170  PRO B O     1 
ATOM   6470 C  CB    . PRO D 4  182 ? 7.66923  29.78237  20.08015  1.000 104.38198 ? 170  PRO B CB    1 
ATOM   6471 C  CG    . PRO D 4  182 ? 7.54919  28.46330  19.39006  1.000 101.69478 ? 170  PRO B CG    1 
ATOM   6472 C  CD    . PRO D 4  182 ? 7.55548  28.78790  17.94428  1.000 97.08230  ? 170  PRO B CD    1 
ATOM   6473 N  N     . PHE D 4  183 ? 8.73181  32.16385  18.26445  1.000 92.38501  ? 171  PHE B N     1 
ATOM   6474 C  CA    . PHE D 4  183 ? 9.42659  33.43345  18.07729  1.000 87.35034  ? 171  PHE B CA    1 
ATOM   6475 C  C     . PHE D 4  183 ? 8.49746  34.47333  17.46125  1.000 85.19042  ? 171  PHE B C     1 
ATOM   6476 O  O     . PHE D 4  183 ? 8.56462  35.66220  17.80133  1.000 83.50991  ? 171  PHE B O     1 
ATOM   6477 C  CB    . PHE D 4  183 ? 10.67101 33.23243  17.20752  1.000 81.53626  ? 171  PHE B CB    1 
ATOM   6478 C  CG    . PHE D 4  183 ? 11.63488 34.39676  17.23338  1.000 76.88025  ? 171  PHE B CG    1 
ATOM   6479 C  CD1   . PHE D 4  183 ? 11.51877 35.43597  16.32194  1.000 74.14607  ? 171  PHE B CD1   1 
ATOM   6480 C  CD2   . PHE D 4  183 ? 12.66418 34.44135  18.16627  1.000 74.26166  ? 171  PHE B CD2   1 
ATOM   6481 C  CE1   . PHE D 4  183 ? 12.40544 36.50277  16.34736  1.000 72.21104  ? 171  PHE B CE1   1 
ATOM   6482 C  CE2   . PHE D 4  183 ? 13.54876 35.50311  18.20076  1.000 71.03445  ? 171  PHE B CE2   1 
ATOM   6483 C  CZ    . PHE D 4  183 ? 13.41900 36.53581  17.28933  1.000 71.70453  ? 171  PHE B CZ    1 
ATOM   6484 N  N     . ARG D 4  184 ? 7.60998  34.03917  16.56305  1.000 82.77085  ? 172  ARG B N     1 
ATOM   6485 C  CA    . ARG D 4  184 ? 6.65642  34.96584  15.96421  1.000 78.59375  ? 172  ARG B CA    1 
ATOM   6486 C  C     . ARG D 4  184 ? 5.60932  35.41300  16.97742  1.000 76.64941  ? 172  ARG B C     1 
ATOM   6487 O  O     . ARG D 4  184 ? 5.26285  36.59809  17.03135  1.000 75.53362  ? 172  ARG B O     1 
ATOM   6488 C  CB    . ARG D 4  184 ? 6.00491  34.32463  14.73679  1.000 74.92587  ? 172  ARG B CB    1 
ATOM   6489 C  CG    . ARG D 4  184 ? 6.86890  34.41897  13.50175  1.000 69.85071  ? 172  ARG B CG    1 
ATOM   6490 C  CD    . ARG D 4  184 ? 6.37099  33.55939  12.35609  1.000 70.56363  ? 172  ARG B CD    1 
ATOM   6491 N  NE    . ARG D 4  184 ? 7.02838  33.93393  11.10465  1.000 72.41867  ? 172  ARG B NE    1 
ATOM   6492 C  CZ    . ARG D 4  184 ? 7.28110  33.09967  10.09766  1.000 70.80812  ? 172  ARG B CZ    1 
ATOM   6493 N  NH1   . ARG D 4  184 ? 6.94015  31.81888  10.18616  1.000 70.56447  ? 172  ARG B NH1   1 
ATOM   6494 N  NH2   . ARG D 4  184 ? 7.88388  33.54848  8.99893   1.000 66.17516  ? 172  ARG B NH2   1 
ATOM   6495 N  N     . LYS D 4  185 ? 5.10496  34.48438  17.79672  1.000 78.79240  ? 173  LYS B N     1 
ATOM   6496 C  CA    . LYS D 4  185 ? 4.12902  34.85478  18.81908  1.000 83.65527  ? 173  LYS B CA    1 
ATOM   6497 C  C     . LYS D 4  185 ? 4.71937  35.85244  19.80857  1.000 86.71660  ? 173  LYS B C     1 
ATOM   6498 O  O     . LYS D 4  185 ? 4.05363  36.81962  20.19932  1.000 82.48724  ? 173  LYS B O     1 
ATOM   6499 C  CB    . LYS D 4  185 ? 3.62511  33.60716  19.54957  1.000 80.54256  ? 173  LYS B CB    1 
ATOM   6500 N  N     . GLN D 4  186 ? 5.97296  35.63856  20.21910  1.000 84.72850  ? 174  GLN B N     1 
ATOM   6501 C  CA    . GLN D 4  186 ? 6.63594  36.53522  21.15971  1.000 85.99336  ? 174  GLN B CA    1 
ATOM   6502 C  C     . GLN D 4  186 ? 7.09993  37.84062  20.51900  1.000 86.83764  ? 174  GLN B C     1 
ATOM   6503 O  O     . GLN D 4  186 ? 7.44760  38.77426  21.24937  1.000 90.49992  ? 174  GLN B O     1 
ATOM   6504 C  CB    . GLN D 4  186 ? 7.82940  35.82778  21.81609  1.000 81.86306  ? 174  GLN B CB    1 
ATOM   6505 N  N     . ASN D 4  187 ? 7.11657  37.93588  19.18941  1.000 83.20885  ? 175  ASN B N     1 
ATOM   6506 C  CA    . ASN D 4  187 ? 7.44922  39.18081  18.49302  1.000 86.71884  ? 175  ASN B CA    1 
ATOM   6507 C  C     . ASN D 4  187 ? 6.50684  39.36397  17.31183  1.000 86.74893  ? 175  ASN B C     1 
ATOM   6508 O  O     . ASN D 4  187 ? 6.87952  39.12370  16.15691  1.000 79.16766  ? 175  ASN B O     1 
ATOM   6509 C  CB    . ASN D 4  187 ? 8.90672  39.18558  18.01872  1.000 86.96897  ? 175  ASN B CB    1 
ATOM   6510 C  CG    . ASN D 4  187 ? 9.86082  38.58026  19.03380  1.000 86.98029  ? 175  ASN B CG    1 
ATOM   6511 O  OD1   . ASN D 4  187 ? 10.37236 39.27028  19.91896  1.000 85.97481  ? 175  ASN B OD1   1 
ATOM   6512 N  ND2   . ASN D 4  187 ? 10.11669 37.28274  18.89808  1.000 84.40328  ? 175  ASN B ND2   1 
ATOM   6513 N  N     . PRO D 4  188 ? 5.26382  39.79611  17.56423  1.000 93.00733  ? 176  PRO B N     1 
ATOM   6514 C  CA    . PRO D 4  188 ? 4.31577  39.99025  16.45163  1.000 94.04528  ? 176  PRO B CA    1 
ATOM   6515 C  C     . PRO D 4  188 ? 4.67666  41.13759  15.51897  1.000 95.74199  ? 176  PRO B C     1 
ATOM   6516 O  O     . PRO D 4  188 ? 4.20226  41.14875  14.37542  1.000 94.99553  ? 176  PRO B O     1 
ATOM   6517 C  CB    . PRO D 4  188 ? 2.98357  40.25252  17.16652  1.000 95.14027  ? 176  PRO B CB    1 
ATOM   6518 C  CG    . PRO D 4  188 ? 3.37427  40.77280  18.50239  1.000 97.01954  ? 176  PRO B CG    1 
ATOM   6519 C  CD    . PRO D 4  188 ? 4.62882  40.03716  18.87166  1.000 95.89311  ? 176  PRO B CD    1 
ATOM   6520 N  N     . ASP D 4  189 ? 5.49062  42.10020  15.96245  1.000 96.05109  ? 177  ASP B N     1 
ATOM   6521 C  CA    . ASP D 4  189 ? 5.90377  43.20178  15.09818  1.000 93.95764  ? 177  ASP B CA    1 
ATOM   6522 C  C     . ASP D 4  189 ? 6.98916  42.80548  14.10365  1.000 87.60650  ? 177  ASP B C     1 
ATOM   6523 O  O     . ASP D 4  189 ? 7.18577  43.51241  13.10858  1.000 88.03845  ? 177  ASP B O     1 
ATOM   6524 C  CB    . ASP D 4  189 ? 6.39656  44.38040  15.94028  1.000 99.97214  ? 177  ASP B CB    1 
ATOM   6525 C  CG    . ASP D 4  189 ? 5.26525  45.11843  16.63065  1.000 108.48586 ? 177  ASP B CG    1 
ATOM   6526 O  OD1   . ASP D 4  189 ? 4.08835  44.77206  16.38845  1.000 111.11601 ? 177  ASP B OD1   1 
ATOM   6527 O  OD2   . ASP D 4  189 ? 5.55304  46.04740  17.41554  1.000 111.94853 ? 177  ASP B OD2   1 
ATOM   6528 N  N     . ILE D 4  190 ? 7.69208  41.70287  14.34750  1.000 82.05812  ? 178  ILE B N     1 
ATOM   6529 C  CA    . ILE D 4  190 ? 8.75775  41.24478  13.46185  1.000 73.40667  ? 178  ILE B CA    1 
ATOM   6530 C  C     . ILE D 4  190 ? 8.15398  40.56136  12.24021  1.000 72.37885  ? 178  ILE B C     1 
ATOM   6531 O  O     . ILE D 4  190 ? 7.12879  39.87143  12.32832  1.000 74.75721  ? 178  ILE B O     1 
ATOM   6532 C  CB    . ILE D 4  190 ? 9.71428  40.30261  14.22181  1.000 66.13008  ? 178  ILE B CB    1 
ATOM   6533 C  CG1   . ILE D 4  190 ? 10.56768 41.08686  15.21624  1.000 66.44981  ? 178  ILE B CG1   1 
ATOM   6534 C  CG2   . ILE D 4  190 ? 10.60400 39.54544  13.27603  1.000 61.07695  ? 178  ILE B CG2   1 
ATOM   6535 C  CD1   . ILE D 4  190 ? 11.72396 40.29027  15.76709  1.000 65.89620  ? 178  ILE B CD1   1 
ATOM   6536 N  N     . VAL D 4  191 ? 8.78867  40.75481  11.08227  1.000 69.11957  ? 179  VAL B N     1 
ATOM   6537 C  CA    . VAL D 4  191 ? 8.35076  40.13328  9.83331   1.000 69.45980  ? 179  VAL B CA    1 
ATOM   6538 C  C     . VAL D 4  191 ? 9.44604  39.17975  9.36138   1.000 65.87701  ? 179  VAL B C     1 
ATOM   6539 O  O     . VAL D 4  191 ? 10.54157 39.61832  8.98526   1.000 67.77591  ? 179  VAL B O     1 
ATOM   6540 C  CB    . VAL D 4  191 ? 8.02513  41.17516  8.75638   1.000 59.00885  ? 179  VAL B CB    1 
ATOM   6541 C  CG1   . VAL D 4  191 ? 7.66154  40.48258  7.46147   1.000 57.31189  ? 179  VAL B CG1   1 
ATOM   6542 C  CG2   . VAL D 4  191 ? 6.89649  42.08521  9.21957   1.000 62.01684  ? 179  VAL B CG2   1 
ATOM   6543 N  N     . ILE D 4  192 ? 9.15119  37.87963  9.36579   1.000 60.89098  ? 180  ILE B N     1 
ATOM   6544 C  CA    . ILE D 4  192 ? 10.07929 36.85132  8.90170   1.000 59.14550  ? 180  ILE B CA    1 
ATOM   6545 C  C     . ILE D 4  192 ? 9.56588  36.28174  7.58337   1.000 57.43845  ? 180  ILE B C     1 
ATOM   6546 O  O     . ILE D 4  192 ? 8.40649  35.86297  7.48428   1.000 52.69106  ? 180  ILE B O     1 
ATOM   6547 C  CB    . ILE D 4  192 ? 10.26082 35.74173  9.95219   1.000 59.84643  ? 180  ILE B CB    1 
ATOM   6548 C  CG1   . ILE D 4  192 ? 10.84871 36.32760  11.24219  1.000 61.48929  ? 180  ILE B CG1   1 
ATOM   6549 C  CG2   . ILE D 4  192 ? 11.13642 34.60931  9.39806   1.000 56.86915  ? 180  ILE B CG2   1 
ATOM   6550 C  CD1   . ILE D 4  192 ? 10.59336 35.49018  12.48310  1.000 57.41280  ? 180  ILE B CD1   1 
ATOM   6551 N  N     . TYR D 4  193 ? 10.43083 36.25949  6.57555   1.000 54.17676  ? 181  TYR B N     1 
ATOM   6552 C  CA    . TYR D 4  193 ? 10.08112 35.75889  5.25370   1.000 54.96491  ? 181  TYR B CA    1 
ATOM   6553 C  C     . TYR D 4  193 ? 11.14562 34.78867  4.75436   1.000 56.71638  ? 181  TYR B C     1 
ATOM   6554 O  O     . TYR D 4  193 ? 12.34143 35.03970  4.88862   1.000 57.31759  ? 181  TYR B O     1 
ATOM   6555 C  CB    . TYR D 4  193 ? 9.92331  36.90411  4.26197   1.000 51.56413  ? 181  TYR B CB    1 
ATOM   6556 C  CG    . TYR D 4  193 ? 9.79868  36.44837  2.83391   1.000 52.68737  ? 181  TYR B CG    1 
ATOM   6557 C  CD1   . TYR D 4  193 ? 8.73992  35.65079  2.43233   1.000 52.67758  ? 181  TYR B CD1   1 
ATOM   6558 C  CD2   . TYR D 4  193 ? 10.74685 36.81569  1.88262   1.000 54.82829  ? 181  TYR B CD2   1 
ATOM   6559 C  CE1   . TYR D 4  193 ? 8.62542  35.23324  1.12452   1.000 57.44698  ? 181  TYR B CE1   1 
ATOM   6560 C  CE2   . TYR D 4  193 ? 10.63903 36.40708  0.57657   1.000 55.04978  ? 181  TYR B CE2   1 
ATOM   6561 C  CZ    . TYR D 4  193 ? 9.57436  35.61766  0.19815   1.000 59.47452  ? 181  TYR B CZ    1 
ATOM   6562 O  OH    . TYR D 4  193 ? 9.46230  35.20312  -1.11283  1.000 64.82579  ? 181  TYR B OH    1 
ATOM   6563 N  N     . GLN D 4  194 ? 10.71889 33.68342  4.16391   1.000 54.65681  ? 182  GLN B N     1 
ATOM   6564 C  CA    . GLN D 4  194 ? 11.64956 32.68304  3.66780   1.000 52.45851  ? 182  GLN B CA    1 
ATOM   6565 C  C     . GLN D 4  194 ? 11.72589 32.75041  2.14856   1.000 57.51324  ? 182  GLN B C     1 
ATOM   6566 O  O     . GLN D 4  194 ? 10.69620 32.70819  1.46551   1.000 62.83916  ? 182  GLN B O     1 
ATOM   6567 C  CB    . GLN D 4  194 ? 11.23374 31.28623  4.12107   1.000 50.95964  ? 182  GLN B CB    1 
ATOM   6568 C  CG    . GLN D 4  194 ? 11.99523 30.18860  3.42792   1.000 55.79359  ? 182  GLN B CG    1 
ATOM   6569 C  CD    . GLN D 4  194 ? 11.83510 28.85686  4.11575   1.000 61.15597  ? 182  GLN B CD    1 
ATOM   6570 O  OE1   . GLN D 4  194 ? 12.60038 27.92705  3.87244   1.000 66.14854  ? 182  GLN B OE1   1 
ATOM   6571 N  NE2   . GLN D 4  194 ? 10.83586 28.75467  4.98286   1.000 62.26964  ? 182  GLN B NE2   1 
ATOM   6572 N  N     . TYR D 4  195 ? 12.94183 32.87478  1.62285   1.000 56.43845  ? 183  TYR B N     1 
ATOM   6573 C  CA    . TYR D 4  195 ? 13.18096 32.67824  0.19916   1.000 54.89299  ? 183  TYR B CA    1 
ATOM   6574 C  C     . TYR D 4  195 ? 14.42739 31.82588  0.07371   1.000 56.25341  ? 183  TYR B C     1 
ATOM   6575 O  O     . TYR D 4  195 ? 15.43417 32.12681  0.70205   1.000 57.67439  ? 183  TYR B O     1 
ATOM   6576 C  CB    . TYR D 4  195 ? 13.35239 33.99374  -0.56493  1.000 52.30954  ? 183  TYR B CB    1 
ATOM   6577 C  CG    . TYR D 4  195 ? 13.45740 33.77644  -2.05220  1.000 46.70720  ? 183  TYR B CG    1 
ATOM   6578 C  CD1   . TYR D 4  195 ? 12.31874 33.66648  -2.83222  1.000 44.72487  ? 183  TYR B CD1   1 
ATOM   6579 C  CD2   . TYR D 4  195 ? 14.69345 33.65010  -2.66950  1.000 47.54322  ? 183  TYR B CD2   1 
ATOM   6580 C  CE1   . TYR D 4  195 ? 12.40108 33.45161  -4.18996  1.000 45.57494  ? 183  TYR B CE1   1 
ATOM   6581 C  CE2   . TYR D 4  195 ? 14.79159 33.42984  -4.03308  1.000 50.48006  ? 183  TYR B CE2   1 
ATOM   6582 C  CZ    . TYR D 4  195 ? 13.64013 33.33179  -4.78883  1.000 50.18588  ? 183  TYR B CZ    1 
ATOM   6583 O  OH    . TYR D 4  195 ? 13.72715 33.12192  -6.14995  1.000 53.26844  ? 183  TYR B OH    1 
ATOM   6584 N  N     . MET D 4  196 ? 14.42464 30.89392  -0.86493  1.000 59.52887  ? 184  MET B N     1 
ATOM   6585 C  CA    . MET D 4  196 ? 14.81197 29.51225  -0.59977  1.000 65.67804  ? 184  MET B CA    1 
ATOM   6586 C  C     . MET D 4  196 ? 15.80904 29.24434  0.53180   1.000 60.44037  ? 184  MET B C     1 
ATOM   6587 O  O     . MET D 4  196 ? 15.43163 28.58270  1.50337   1.000 58.41738  ? 184  MET B O     1 
ATOM   6588 C  CB    . MET D 4  196 ? 15.37649 28.93347  -1.89120  1.000 73.68936  ? 184  MET B CB    1 
ATOM   6589 C  CG    . MET D 4  196 ? 15.44000 29.93969  -3.00866  1.000 77.70292  ? 184  MET B CG    1 
ATOM   6590 S  SD    . MET D 4  196 ? 15.11959 29.10573  -4.56026  1.000 88.39304  ? 184  MET B SD    1 
ATOM   6591 C  CE    . MET D 4  196 ? 16.10872 30.11658  -5.67183  1.000 88.75582  ? 184  MET B CE    1 
ATOM   6592 N  N     . ASP D 4  197 ? 17.03803 29.76294  0.48725   1.000 56.89941  ? 185  ASP B N     1 
ATOM   6593 C  CA    . ASP D 4  197 ? 18.01809 29.40563  1.51760   1.000 54.20574  ? 185  ASP B CA    1 
ATOM   6594 C  C     . ASP D 4  197 ? 18.08804 30.41162  2.66590   1.000 52.74363  ? 185  ASP B C     1 
ATOM   6595 O  O     . ASP D 4  197 ? 18.87427 30.22027  3.59558   1.000 54.84337  ? 185  ASP B O     1 
ATOM   6596 C  CB    . ASP D 4  197 ? 19.42599 29.24819  0.91480   1.000 55.73026  ? 185  ASP B CB    1 
ATOM   6597 C  CG    . ASP D 4  197 ? 19.60652 27.95800  0.09617   1.000 56.98395  ? 185  ASP B CG    1 
ATOM   6598 O  OD1   . ASP D 4  197 ? 18.64529 27.17190  -0.06971  1.000 56.21347  ? 185  ASP B OD1   1 
ATOM   6599 O  OD2   . ASP D 4  197 ? 20.73889 27.74142  -0.39735  1.000 58.10872  ? 185  ASP B OD2   1 
ATOM   6600 N  N     . ASP D 4  198 ? 17.28523 31.46380  2.63433   1.000 53.33946  ? 186  ASP B N     1 
ATOM   6601 C  CA    . ASP D 4  198 ? 17.43751 32.61104  3.51369   1.000 55.55386  ? 186  ASP B CA    1 
ATOM   6602 C  C     . ASP D 4  198 ? 16.13760 32.90893  4.24801   1.000 61.22542  ? 186  ASP B C     1 
ATOM   6603 O  O     . ASP D 4  198 ? 15.03066 32.70296  3.72688   1.000 43.88760  ? 186  ASP B O     1 
ATOM   6604 C  CB    . ASP D 4  198 ? 17.85325 33.88767  2.74527   1.000 56.59252  ? 186  ASP B CB    1 
ATOM   6605 C  CG    . ASP D 4  198 ? 18.89235 33.62428  1.64905   1.000 61.97216  ? 186  ASP B CG    1 
ATOM   6606 O  OD1   . ASP D 4  198 ? 19.95358 33.02503  1.94685   1.000 65.66738  ? 186  ASP B OD1   1 
ATOM   6607 O  OD2   . ASP D 4  198 ? 18.64621 34.03415  0.48535   1.000 61.07322  ? 186  ASP B OD2   1 
ATOM   6608 N  N     . LEU D 4  199 ? 16.30403 33.40098  5.47400   1.000 59.60360  ? 187  LEU B N     1 
ATOM   6609 C  CA    . LEU D 4  199 ? 15.27576 34.14313  6.18688   1.000 56.06236  ? 187  LEU B CA    1 
ATOM   6610 C  C     . LEU D 4  199 ? 15.58586 35.63114  6.07680   1.000 56.93828  ? 187  LEU B C     1 
ATOM   6611 O  O     . LEU D 4  199 ? 16.73996 36.04064  6.22515   1.000 54.70147  ? 187  LEU B O     1 
ATOM   6612 C  CB    . LEU D 4  199 ? 15.21617 33.73709  7.65625   1.000 59.05968  ? 187  LEU B CB    1 
ATOM   6613 C  CG    . LEU D 4  199 ? 14.77100 32.31906  7.99445   1.000 58.39116  ? 187  LEU B CG    1 
ATOM   6614 C  CD1   . LEU D 4  199 ? 14.75889 32.14455  9.49773   1.000 55.66613  ? 187  LEU B CD1   1 
ATOM   6615 C  CD2   . LEU D 4  199 ? 13.39917 32.04886  7.40022   1.000 59.10685  ? 187  LEU B CD2   1 
ATOM   6616 N  N     . TYR D 4  200 ? 14.55591 36.42156  5.79501   1.000 57.81850  ? 188  TYR B N     1 
ATOM   6617 C  CA    . TYR D 4  200 ? 14.58522 37.87647  5.78723   1.000 56.35170  ? 188  TYR B CA    1 
ATOM   6618 C  C     . TYR D 4  200 ? 13.79881 38.32824  7.00906   1.000 62.63442  ? 188  TYR B C     1 
ATOM   6619 O  O     . TYR D 4  200 ? 12.58467 38.10863  7.07982   1.000 70.13397  ? 188  TYR B O     1 
ATOM   6620 C  CB    . TYR D 4  200 ? 13.97388 38.42211  4.49470   1.000 53.98984  ? 188  TYR B CB    1 
ATOM   6621 C  CG    . TYR D 4  200 ? 14.80388 38.12237  3.26646   1.000 51.47733  ? 188  TYR B CG    1 
ATOM   6622 C  CD1   . TYR D 4  200 ? 14.80398 36.85320  2.69257   1.000 52.52470  ? 188  TYR B CD1   1 
ATOM   6623 C  CD2   . TYR D 4  200 ? 15.59760 39.10395  2.68812   1.000 51.10504  ? 188  TYR B CD2   1 
ATOM   6624 C  CE1   . TYR D 4  200 ? 15.57889 36.56969  1.57432   1.000 53.09595  ? 188  TYR B CE1   1 
ATOM   6625 C  CE2   . TYR D 4  200 ? 16.37004 38.83712  1.56790   1.000 53.09232  ? 188  TYR B CE2   1 
ATOM   6626 C  CZ    . TYR D 4  200 ? 16.35894 37.57077  1.01645   1.000 53.45563  ? 188  TYR B CZ    1 
ATOM   6627 O  OH    . TYR D 4  200 ? 17.13062 37.31094  -0.09144  1.000 52.59660  ? 188  TYR B OH    1 
ATOM   6628 N  N     . VAL D 4  201 ? 14.48270 38.93319  7.97872   1.000 60.54396  ? 189  VAL B N     1 
ATOM   6629 C  CA    . VAL D 4  201 ? 13.87130 39.31200  9.25126   1.000 60.84631  ? 189  VAL B CA    1 
ATOM   6630 C  C     . VAL D 4  201 ? 13.89574 40.83428  9.35527   1.000 63.17792  ? 189  VAL B C     1 
ATOM   6631 O  O     . VAL D 4  201 ? 14.97419 41.43940  9.40102   1.000 64.87540  ? 189  VAL B O     1 
ATOM   6632 C  CB    . VAL D 4  201 ? 14.58925 38.65535  10.44219  1.000 57.93509  ? 189  VAL B CB    1 
ATOM   6633 C  CG1   . VAL D 4  201 ? 13.78284 38.82430  11.70951  1.000 56.18358  ? 189  VAL B CG1   1 
ATOM   6634 C  CG2   . VAL D 4  201 ? 14.82666 37.16860  10.16491  1.000 57.79961  ? 189  VAL B CG2   1 
ATOM   6635 N  N     . GLY D 4  202 ? 12.71633 41.44671  9.38534   1.000 62.27880  ? 190  GLY B N     1 
ATOM   6636 C  CA    . GLY D 4  202 ? 12.58804 42.89848  9.34783   1.000 63.90492  ? 190  GLY B CA    1 
ATOM   6637 C  C     . GLY D 4  202 ? 11.87828 43.45679  10.56674  1.000 67.61915  ? 190  GLY B C     1 
ATOM   6638 O  O     . GLY D 4  202 ? 10.90332 42.86921  11.05191  1.000 71.11329  ? 190  GLY B O     1 
ATOM   6639 N  N     . SER D 4  203 ? 12.35919 44.60923  11.04159  1.000 69.86817  ? 191  SER B N     1 
ATOM   6640 C  CA    . SER D 4  203 ? 11.77358 45.25722  12.21054  1.000 71.57484  ? 191  SER B CA    1 
ATOM   6641 C  C     . SER D 4  203 ? 12.06155 46.75595  12.19843  1.000 74.96794  ? 191  SER B C     1 
ATOM   6642 O  O     . SER D 4  203 ? 12.84846 47.26379  11.39025  1.000 74.88414  ? 191  SER B O     1 
ATOM   6643 C  CB    . SER D 4  203 ? 12.29796 44.64521  13.50739  1.000 68.99719  ? 191  SER B CB    1 
ATOM   6644 O  OG    . SER D 4  203 ? 13.48623 45.29776  13.91299  1.000 65.69589  ? 191  SER B OG    1 
ATOM   6645 N  N     . ASP D 4  204 ? 11.43311 47.44688  13.15550  1.000 79.03420  ? 192  ASP B N     1 
ATOM   6646 C  CA    . ASP D 4  204 ? 11.51360 48.89509  13.34043  1.000 83.07702  ? 192  ASP B CA    1 
ATOM   6647 C  C     . ASP D 4  204 ? 12.22321 49.24814  14.64721  1.000 85.90261  ? 192  ASP B C     1 
ATOM   6648 O  O     . ASP D 4  204 ? 11.78566 50.12396  15.39711  1.000 89.36883  ? 192  ASP B O     1 
ATOM   6649 C  CB    . ASP D 4  204 ? 10.11955 49.52118  13.32514  1.000 85.42106  ? 192  ASP B CB    1 
ATOM   6650 C  CG    . ASP D 4  204 ? 9.27459  49.04716  12.16026  1.000 86.21891  ? 192  ASP B CG    1 
ATOM   6651 O  OD1   . ASP D 4  204 ? 9.75412  49.12341  11.01149  1.000 86.40319  ? 192  ASP B OD1   1 
ATOM   6652 O  OD2   . ASP D 4  204 ? 8.13340  48.59303  12.39226  1.000 87.88802  ? 192  ASP B OD2   1 
ATOM   6653 N  N     . LEU D 4  205 ? 13.31638 48.55541  14.94289  1.000 84.79050  ? 193  LEU B N     1 
ATOM   6654 C  CA    . LEU D 4  205 ? 14.06194 48.74963  16.17568  1.000 87.63189  ? 193  LEU B CA    1 
ATOM   6655 C  C     . LEU D 4  205 ? 15.30205 49.60054  15.93324  1.000 92.15637  ? 193  LEU B C     1 
ATOM   6656 O  O     . LEU D 4  205 ? 15.84648 49.63691  14.82527  1.000 92.93129  ? 193  LEU B O     1 
ATOM   6657 C  CB    . LEU D 4  205 ? 14.47953 47.40400  16.77049  1.000 83.63838  ? 193  LEU B CB    1 
ATOM   6658 C  CG    . LEU D 4  205 ? 13.62026 46.81521  17.88682  1.000 85.97470  ? 193  LEU B CG    1 
ATOM   6659 C  CD1   . LEU D 4  205 ? 12.15646 46.78532  17.49239  1.000 88.14503  ? 193  LEU B CD1   1 
ATOM   6660 C  CD2   . LEU D 4  205 ? 14.10498 45.41902  18.21080  1.000 83.79172  ? 193  LEU B CD2   1 
ATOM   6661 N  N     . GLU D 4  206 ? 15.73507 50.29993  16.98494  1.000 94.94522  ? 194  GLU B N     1 
ATOM   6662 C  CA    . GLU D 4  206 ? 17.08615 50.84041  17.00603  1.000 92.94891  ? 194  GLU B CA    1 
ATOM   6663 C  C     . GLU D 4  206 ? 18.05039 49.70825  16.69955  1.000 90.88975  ? 194  GLU B C     1 
ATOM   6664 O  O     . GLU D 4  206 ? 17.86322 48.58343  17.16710  1.000 93.43322  ? 194  GLU B O     1 
ATOM   6665 C  CB    . GLU D 4  206 ? 17.40345 51.46437  18.36894  1.000 91.56242  ? 194  GLU B CB    1 
ATOM   6666 N  N     . ILE D 4  207 ? 19.07080 49.99908  15.88903  1.000 87.74152  ? 195  ILE B N     1 
ATOM   6667 C  CA    . ILE D 4  207 ? 19.84761 48.91833  15.28380  1.000 82.37130  ? 195  ILE B CA    1 
ATOM   6668 C  C     . ILE D 4  207 ? 20.47492 48.01098  16.34117  1.000 82.70180  ? 195  ILE B C     1 
ATOM   6669 O  O     . ILE D 4  207 ? 20.67437 46.81193  16.09649  1.000 82.91053  ? 195  ILE B O     1 
ATOM   6670 C  CB    . ILE D 4  207 ? 20.90518 49.48836  14.32121  1.000 76.90131  ? 195  ILE B CB    1 
ATOM   6671 C  CG1   . ILE D 4  207 ? 21.58509 48.34314  13.56371  1.000 73.64089  ? 195  ILE B CG1   1 
ATOM   6672 C  CG2   . ILE D 4  207 ? 21.90312 50.34330  15.07874  1.000 76.38353  ? 195  ILE B CG2   1 
ATOM   6673 C  CD1   . ILE D 4  207 ? 22.51048 48.79311  12.46897  1.000 77.75764  ? 195  ILE B CD1   1 
ATOM   6674 N  N     . GLY D 4  208 ? 20.76369 48.54535  17.53268  1.000 82.94320  ? 196  GLY B N     1 
ATOM   6675 C  CA    . GLY D 4  208 ? 21.28916 47.70705  18.60223  1.000 79.72931  ? 196  GLY B CA    1 
ATOM   6676 C  C     . GLY D 4  208 ? 20.26981 46.69767  19.10085  1.000 80.26262  ? 196  GLY B C     1 
ATOM   6677 O  O     . GLY D 4  208 ? 20.55394 45.49590  19.18959  1.000 76.40335  ? 196  GLY B O     1 
ATOM   6678 N  N     . GLN D 4  209 ? 19.06153 47.17174  19.42354  1.000 82.63085  ? 197  GLN B N     1 
ATOM   6679 C  CA    . GLN D 4  209 ? 17.97943 46.26245  19.79127  1.000 85.02695  ? 197  GLN B CA    1 
ATOM   6680 C  C     . GLN D 4  209 ? 17.64484 45.31062  18.64478  1.000 80.20700  ? 197  GLN B C     1 
ATOM   6681 O  O     . GLN D 4  209 ? 17.32859 44.13411  18.87453  1.000 77.08089  ? 197  GLN B O     1 
ATOM   6682 C  CB    . GLN D 4  209 ? 16.74621 47.06502  20.21066  1.000 88.89743  ? 197  GLN B CB    1 
ATOM   6683 N  N     . HIS D 4  210 ? 17.71608 45.80429  17.40201  1.000 79.01012  ? 198  HIS B N     1 
ATOM   6684 C  CA    . HIS D 4  210 ? 17.46043 44.96257  16.23544  1.000 78.19408  ? 198  HIS B CA    1 
ATOM   6685 C  C     . HIS D 4  210 ? 18.42800 43.78570  16.18066  1.000 80.95688  ? 198  HIS B C     1 
ATOM   6686 O  O     . HIS D 4  210 ? 18.00934 42.62676  16.06855  1.000 84.25194  ? 198  HIS B O     1 
ATOM   6687 C  CB    . HIS D 4  210 ? 17.55680 45.79336  14.95476  1.000 76.09716  ? 198  HIS B CB    1 
ATOM   6688 C  CG    . HIS D 4  210 ? 17.36658 44.99609  13.69681  1.000 74.48693  ? 198  HIS B CG    1 
ATOM   6689 N  ND1   . HIS D 4  210 ? 16.12479 44.74936  13.14896  1.000 73.52714  ? 198  HIS B ND1   1 
ATOM   6690 C  CD2   . HIS D 4  210 ? 18.26337 44.39525  12.87658  1.000 72.68932  ? 198  HIS B CD2   1 
ATOM   6691 C  CE1   . HIS D 4  210 ? 16.26487 44.02860  12.05004  1.000 71.60707  ? 198  HIS B CE1   1 
ATOM   6692 N  NE2   . HIS D 4  210 ? 17.55278 43.80238  11.86064  1.000 70.37847  ? 198  HIS B NE2   1 
ATOM   6693 N  N     . ARG D 4  211 ? 19.73231 44.06519  16.25303  1.000 80.03463  ? 199  ARG B N     1 
ATOM   6694 C  CA    . ARG D 4  211 ? 20.71508 42.98643  16.24492  1.000 75.55704  ? 199  ARG B CA    1 
ATOM   6695 C  C     . ARG D 4  211 ? 20.56380 42.07566  17.46081  1.000 80.81997  ? 199  ARG B C     1 
ATOM   6696 O  O     . ARG D 4  211 ? 20.79849 40.86487  17.36002  1.000 82.22071  ? 199  ARG B O     1 
ATOM   6697 C  CB    . ARG D 4  211 ? 22.12879 43.56671  16.16999  1.000 71.03633  ? 199  ARG B CB    1 
ATOM   6698 N  N     . THR D 4  212 ? 20.16442 42.62604  18.61257  1.000 83.85889  ? 200  THR B N     1 
ATOM   6699 C  CA    . THR D 4  212 ? 19.90900 41.77186  19.76835  1.000 85.71973  ? 200  THR B CA    1 
ATOM   6700 C  C     . THR D 4  212 ? 18.79025 40.77797  19.47359  1.000 84.79226  ? 200  THR B C     1 
ATOM   6701 O  O     . THR D 4  212 ? 18.89539 39.58817  19.80520  1.000 84.23966  ? 200  THR B O     1 
ATOM   6702 C  CB    . THR D 4  212 ? 19.56708 42.62137  20.99320  1.000 87.90135  ? 200  THR B CB    1 
ATOM   6703 O  OG1   . THR D 4  212 ? 20.47505 43.72663  21.07908  1.000 88.89995  ? 200  THR B OG1   1 
ATOM   6704 C  CG2   . THR D 4  212 ? 19.68255 41.78495  22.26339  1.000 87.21056  ? 200  THR B CG2   1 
ATOM   6705 N  N     . LYS D 4  213 ? 17.71803 41.24344  18.82622  1.000 82.67733  ? 201  LYS B N     1 
ATOM   6706 C  CA    . LYS D 4  213 ? 16.62594 40.33721  18.48298  1.000 76.03779  ? 201  LYS B CA    1 
ATOM   6707 C  C     . LYS D 4  213 ? 17.06553 39.32222  17.43078  1.000 70.44292  ? 201  LYS B C     1 
ATOM   6708 O  O     . LYS D 4  213 ? 16.66479 38.14713  17.47895  1.000 67.22223  ? 201  LYS B O     1 
ATOM   6709 C  CB    . LYS D 4  213 ? 15.41158 41.13159  18.00711  1.000 69.88847  ? 201  LYS B CB    1 
ATOM   6710 C  CG    . LYS D 4  213 ? 14.08262 40.50125  18.39947  1.000 69.82628  ? 201  LYS B CG    1 
ATOM   6711 C  CD    . LYS D 4  213 ? 13.83177 40.55980  19.90674  1.000 72.60461  ? 201  LYS B CD    1 
ATOM   6712 N  N     . ILE D 4  214 ? 17.90369 39.75275  16.48258  1.000 66.26096  ? 202  ILE B N     1 
ATOM   6713 C  CA    . ILE D 4  214 ? 18.40546 38.82900  15.46569  1.000 68.02604  ? 202  ILE B CA    1 
ATOM   6714 C  C     . ILE D 4  214 ? 19.23101 37.72174  16.11459  1.000 73.16812  ? 202  ILE B C     1 
ATOM   6715 O  O     . ILE D 4  214 ? 19.15884 36.54910  15.71748  1.000 65.99584  ? 202  ILE B O     1 
ATOM   6716 C  CB    . ILE D 4  214 ? 19.21055 39.58754  14.39362  1.000 67.52874  ? 202  ILE B CB    1 
ATOM   6717 C  CG1   . ILE D 4  214 ? 18.28160 40.45292  13.54172  1.000 66.94735  ? 202  ILE B CG1   1 
ATOM   6718 C  CG2   . ILE D 4  214 ? 19.98609 38.60810  13.50192  1.000 57.31641  ? 202  ILE B CG2   1 
ATOM   6719 C  CD1   . ILE D 4  214 ? 17.36922 39.64871  12.63981  1.000 66.53884  ? 202  ILE B CD1   1 
ATOM   6720 N  N     . GLU D 4  215 ? 20.02276 38.07196  17.12927  1.000 82.31752  ? 203  GLU B N     1 
ATOM   6721 C  CA    . GLU D 4  215 ? 20.75230 37.03840  17.85141  1.000 84.36159  ? 203  GLU B CA    1 
ATOM   6722 C  C     . GLU D 4  215 ? 19.81098 36.15794  18.66015  1.000 81.25550  ? 203  GLU B C     1 
ATOM   6723 O  O     . GLU D 4  215 ? 20.06959 34.95811  18.80376  1.000 82.67418  ? 203  GLU B O     1 
ATOM   6724 C  CB    . GLU D 4  215 ? 21.82204 37.65624  18.74917  1.000 93.57076  ? 203  GLU B CB    1 
ATOM   6725 C  CG    . GLU D 4  215 ? 23.24292 37.46352  18.22268  1.000 98.43073  ? 203  GLU B CG    1 
ATOM   6726 C  CD    . GLU D 4  215 ? 23.60154 35.99909  17.95328  1.000 102.07731 ? 203  GLU B CD    1 
ATOM   6727 O  OE1   . GLU D 4  215 ? 23.73380 35.62691  16.76242  1.000 101.70616 ? 203  GLU B OE1   1 
ATOM   6728 O  OE2   . GLU D 4  215 ? 23.75515 35.22655  18.92991  1.000 102.87040 ? 203  GLU B OE2   1 
ATOM   6729 N  N     . GLU D 4  216 ? 18.71642 36.72012  19.18431  1.000 77.56108  ? 204  GLU B N     1 
ATOM   6730 C  CA    . GLU D 4  216 ? 17.70452 35.86763  19.80495  1.000 78.00456  ? 204  GLU B CA    1 
ATOM   6731 C  C     . GLU D 4  216 ? 17.20907 34.82038  18.82025  1.000 74.69093  ? 204  GLU B C     1 
ATOM   6732 O  O     . GLU D 4  216 ? 17.03155 33.65009  19.17723  1.000 75.84876  ? 204  GLU B O     1 
ATOM   6733 C  CB    . GLU D 4  216 ? 16.52772 36.69360  20.31583  1.000 80.71730  ? 204  GLU B CB    1 
ATOM   6734 C  CG    . GLU D 4  216 ? 16.82935 37.56287  21.50772  1.000 87.88749  ? 204  GLU B CG    1 
ATOM   6735 C  CD    . GLU D 4  216 ? 15.65983 38.45485  21.86056  1.000 93.52080  ? 204  GLU B CD    1 
ATOM   6736 O  OE1   . GLU D 4  216 ? 14.50543 37.98735  21.74188  1.000 95.83724  ? 204  GLU B OE1   1 
ATOM   6737 O  OE2   . GLU D 4  216 ? 15.89242 39.62652  22.23449  1.000 94.92640  ? 204  GLU B OE2   1 
ATOM   6738 N  N     . LEU D 4  217 ? 16.99395 35.22404  17.56930  1.000 67.26154  ? 205  LEU B N     1 
ATOM   6739 C  CA    . LEU D 4  217 ? 16.51448 34.27398  16.57058  1.000 64.14839  ? 205  LEU B CA    1 
ATOM   6740 C  C     . LEU D 4  217 ? 17.58776 33.24224  16.22333  1.000 65.48431  ? 205  LEU B C     1 
ATOM   6741 O  O     . LEU D 4  217 ? 17.30057 32.04271  16.14457  1.000 62.75678  ? 205  LEU B O     1 
ATOM   6742 C  CB    . LEU D 4  217 ? 16.04570 35.01651  15.31959  1.000 64.55578  ? 205  LEU B CB    1 
ATOM   6743 C  CG    . LEU D 4  217 ? 15.33078 34.13650  14.29016  1.000 61.61437  ? 205  LEU B CG    1 
ATOM   6744 C  CD1   . LEU D 4  217 ? 14.12970 33.46289  14.92884  1.000 64.76514  ? 205  LEU B CD1   1 
ATOM   6745 C  CD2   . LEU D 4  217 ? 14.91110 34.93942  13.08724  1.000 57.06328  ? 205  LEU B CD2   1 
ATOM   6746 N  N     . ARG D 4  218 ? 18.83163 33.68774  16.01658  1.000 70.31215  ? 206  ARG B N     1 
ATOM   6747 C  CA    . ARG D 4  218 ? 19.90627 32.75707  15.66720  1.000 72.60903  ? 206  ARG B CA    1 
ATOM   6748 C  C     . ARG D 4  218 ? 20.17987 31.77213  16.80601  1.000 75.62609  ? 206  ARG B C     1 
ATOM   6749 O  O     . ARG D 4  218 ? 20.65682 30.65495  16.56286  1.000 75.21305  ? 206  ARG B O     1 
ATOM   6750 C  CB    . ARG D 4  218 ? 21.17103 33.54193  15.26375  1.000 74.55531  ? 206  ARG B CB    1 
ATOM   6751 C  CG    . ARG D 4  218 ? 22.46683 32.72920  15.10029  1.000 77.89311  ? 206  ARG B CG    1 
ATOM   6752 C  CD    . ARG D 4  218 ? 23.07417 32.79118  13.68192  1.000 83.38702  ? 206  ARG B CD    1 
ATOM   6753 N  NE    . ARG D 4  218 ? 22.61854 31.68756  12.82221  1.000 83.70650  ? 206  ARG B NE    1 
ATOM   6754 C  CZ    . ARG D 4  218 ? 23.25375 31.24073  11.73760  1.000 79.48372  ? 206  ARG B CZ    1 
ATOM   6755 N  NH1   . ARG D 4  218 ? 22.73835 30.23826  11.04334  1.000 75.29499  ? 206  ARG B NH1   1 
ATOM   6756 N  NH2   . ARG D 4  218 ? 24.40137 31.78096  11.34888  1.000 80.29431  ? 206  ARG B NH2   1 
ATOM   6757 N  N     . GLN D 4  219 ? 19.86048 32.15227  18.04729  1.000 79.36887  ? 207  GLN B N     1 
ATOM   6758 C  CA    . GLN D 4  219 ? 19.90213 31.19669  19.15151  1.000 85.49474  ? 207  GLN B CA    1 
ATOM   6759 C  C     . GLN D 4  219 ? 18.70521 30.25539  19.11525  1.000 87.20959  ? 207  GLN B C     1 
ATOM   6760 O  O     . GLN D 4  219 ? 18.85745 29.04147  19.30339  1.000 85.99434  ? 207  GLN B O     1 
ATOM   6761 C  CB    . GLN D 4  219 ? 19.94491 31.92970  20.49383  1.000 90.98606  ? 207  GLN B CB    1 
ATOM   6762 C  CG    . GLN D 4  219 ? 21.23213 32.69016  20.75058  1.000 97.22332  ? 207  GLN B CG    1 
ATOM   6763 C  CD    . GLN D 4  219 ? 22.46698 31.83277  20.54316  1.000 99.07327  ? 207  GLN B CD    1 
ATOM   6764 O  OE1   . GLN D 4  219 ? 23.32686 32.15505  19.72026  1.000 101.29634 ? 207  GLN B OE1   1 
ATOM   6765 N  NE2   . GLN D 4  219 ? 22.56357 30.73718  21.29025  1.000 98.14416  ? 207  GLN B NE2   1 
ATOM   6766 N  N     . HIS D 4  220 ? 17.51078 30.80809  18.88466  1.000 88.63780  ? 208  HIS B N     1 
ATOM   6767 C  CA    . HIS D 4  220 ? 16.30455 29.99624  18.77089  1.000 87.90995  ? 208  HIS B CA    1 
ATOM   6768 C  C     . HIS D 4  220 ? 16.47874 28.90136  17.72683  1.000 84.52059  ? 208  HIS B C     1 
ATOM   6769 O  O     . HIS D 4  220 ? 16.00645 27.77449  17.91061  1.000 81.63229  ? 208  HIS B O     1 
ATOM   6770 C  CB    . HIS D 4  220 ? 15.11968 30.90205  18.42273  1.000 89.23389  ? 208  HIS B CB    1 
ATOM   6771 C  CG    . HIS D 4  220 ? 13.78610 30.22535  18.48457  1.000 92.26270  ? 208  HIS B CG    1 
ATOM   6772 N  ND1   . HIS D 4  220 ? 12.71790 30.62221  17.70930  1.000 92.88624  ? 208  HIS B ND1   1 
ATOM   6773 C  CD2   . HIS D 4  220 ? 13.33992 29.19358  19.23825  1.000 94.75137  ? 208  HIS B CD2   1 
ATOM   6774 C  CE1   . HIS D 4  220 ? 11.67275 29.86048  17.97707  1.000 93.70069  ? 208  HIS B CE1   1 
ATOM   6775 N  NE2   . HIS D 4  220 ? 12.02421 28.98407  18.90036  1.000 95.06669  ? 208  HIS B NE2   1 
ATOM   6776 N  N     . LEU D 4  221 ? 17.18175 29.21000  16.63501  1.000 84.82965  ? 209  LEU B N     1 
ATOM   6777 C  CA    . LEU D 4  221 ? 17.41231 28.27978  15.53432  1.000 81.81328  ? 209  LEU B CA    1 
ATOM   6778 C  C     . LEU D 4  221 ? 18.51015 27.26284  15.83499  1.000 84.58129  ? 209  LEU B C     1 
ATOM   6779 O  O     . LEU D 4  221 ? 18.98929 26.59294  14.91216  1.000 85.43566  ? 209  LEU B O     1 
ATOM   6780 C  CB    . LEU D 4  221 ? 17.74916 29.05103  14.25195  1.000 76.44007  ? 209  LEU B CB    1 
ATOM   6781 C  CG    . LEU D 4  221 ? 16.60596 29.41529  13.29302  1.000 72.48867  ? 209  LEU B CG    1 
ATOM   6782 C  CD1   . LEU D 4  221 ? 15.37689 29.93144  14.02483  1.000 75.89146  ? 209  LEU B CD1   1 
ATOM   6783 C  CD2   . LEU D 4  221 ? 17.07395 30.44632  12.28565  1.000 69.75679  ? 209  LEU B CD2   1 
ATOM   6784 N  N     . LEU D 4  222 ? 18.92703 27.14095  17.09528  1.000 86.75741  ? 210  LEU B N     1 
ATOM   6785 C  CA    . LEU D 4  222 ? 19.76545 26.02180  17.52329  1.000 85.67912  ? 210  LEU B CA    1 
ATOM   6786 C  C     . LEU D 4  222 ? 18.82483 24.93545  18.04293  1.000 86.54651  ? 210  LEU B C     1 
ATOM   6787 O  O     . LEU D 4  222 ? 18.57850 24.78490  19.24222  1.000 81.48411  ? 210  LEU B O     1 
ATOM   6788 C  CB    . LEU D 4  222 ? 20.79027 26.47108  18.55736  1.000 80.84605  ? 210  LEU B CB    1 
ATOM   6789 C  CG    . LEU D 4  222 ? 21.78569 27.53347  18.06337  1.000 74.99610  ? 210  LEU B CG    1 
ATOM   6790 C  CD1   . LEU D 4  222 ? 23.03962 27.56385  18.93296  1.000 80.69715  ? 210  LEU B CD1   1 
ATOM   6791 C  CD2   . LEU D 4  222 ? 22.15606 27.33232  16.60722  1.000 65.83380  ? 210  LEU B CD2   1 
ATOM   6792 N  N     . ARG D 4  223 ? 18.27937 24.17968  17.09006  1.000 89.20817  ? 211  ARG B N     1 
ATOM   6793 C  CA    . ARG D 4  223 ? 17.18535 23.24391  17.31385  1.000 86.23525  ? 211  ARG B CA    1 
ATOM   6794 C  C     . ARG D 4  223 ? 17.36995 21.98968  16.46590  1.000 83.43251  ? 211  ARG B C     1 
ATOM   6795 O  O     . ARG D 4  223 ? 17.44669 22.06962  15.23645  1.000 82.24773  ? 211  ARG B O     1 
ATOM   6796 C  CB    . ARG D 4  223 ? 15.84670 23.91849  16.98659  1.000 83.33792  ? 211  ARG B CB    1 
ATOM   6797 C  CG    . ARG D 4  223 ? 14.78511 22.97945  16.46328  1.000 85.24876  ? 211  ARG B CG    1 
ATOM   6798 C  CD    . ARG D 4  223 ? 13.42518 23.63359  16.45010  1.000 89.21091  ? 211  ARG B CD    1 
ATOM   6799 N  NE    . ARG D 4  223 ? 12.99665 24.08558  17.77209  1.000 95.80240  ? 211  ARG B NE    1 
ATOM   6800 C  CZ    . ARG D 4  223 ? 12.75087 25.35425  18.08647  1.000 97.07289  ? 211  ARG B CZ    1 
ATOM   6801 N  NH1   . ARG D 4  223 ? 12.88718 26.29887  17.17136  1.000 98.69311  ? 211  ARG B NH1   1 
ATOM   6802 N  NH2   . ARG D 4  223 ? 12.35946 25.68067  19.31099  1.000 98.53834  ? 211  ARG B NH2   1 
ATOM   6803 N  N     . GLU D 4  245 ? 23.49119 44.30590  6.23284   1.000 82.06436  ? 233  GLU B N     1 
ATOM   6804 C  CA    . GLU D 4  245 ? 22.14047 44.59998  6.70709   1.000 82.43620  ? 233  GLU B CA    1 
ATOM   6805 C  C     . GLU D 4  245 ? 21.39950 45.55127  5.75707   1.000 87.39030  ? 233  GLU B C     1 
ATOM   6806 O  O     . GLU D 4  245 ? 21.95365 46.57081  5.33258   1.000 93.00772  ? 233  GLU B O     1 
ATOM   6807 C  CB    . GLU D 4  245 ? 22.18867 45.19955  8.11759   1.000 81.98657  ? 233  GLU B CB    1 
ATOM   6808 N  N     . LEU D 4  246 ? 20.14606 45.22053  5.43744   1.000 83.37539  ? 234  LEU B N     1 
ATOM   6809 C  CA    . LEU D 4  246 ? 19.31701 46.03449  4.55575   1.000 75.43847  ? 234  LEU B CA    1 
ATOM   6810 C  C     . LEU D 4  246 ? 18.50815 47.06670  5.33858   1.000 73.69498  ? 234  LEU B C     1 
ATOM   6811 O  O     . LEU D 4  246 ? 18.23330 46.91125  6.53047   1.000 72.00056  ? 234  LEU B O     1 
ATOM   6812 C  CB    . LEU D 4  246 ? 18.35207 45.16400  3.75296   1.000 66.05153  ? 234  LEU B CB    1 
ATOM   6813 C  CG    . LEU D 4  246 ? 18.92049 44.06517  2.86574   1.000 61.69702  ? 234  LEU B CG    1 
ATOM   6814 C  CD1   . LEU D 4  246 ? 17.77988 43.22950  2.30232   1.000 58.70834  ? 234  LEU B CD1   1 
ATOM   6815 C  CD2   . LEU D 4  246 ? 19.77312 44.65210  1.75022   1.000 61.99645  ? 234  LEU B CD2   1 
ATOM   6816 N  N     . HIS D 4  247 ? 18.10428 48.12019  4.63221   1.000 74.74482  ? 235  HIS B N     1 
ATOM   6817 C  CA    . HIS D 4  247 ? 17.17837 49.12616  5.15742   1.000 80.37029  ? 235  HIS B CA    1 
ATOM   6818 C  C     . HIS D 4  247 ? 16.19613 49.48254  4.05171   1.000 78.81693  ? 235  HIS B C     1 
ATOM   6819 O  O     . HIS D 4  247 ? 16.33715 50.50832  3.37502   1.000 79.39095  ? 235  HIS B O     1 
ATOM   6820 C  CB    . HIS D 4  247 ? 17.93151 50.35777  5.67340   1.000 86.92878  ? 235  HIS B CB    1 
ATOM   6821 C  CG    . HIS D 4  247 ? 18.90780 50.04183  6.76426   1.000 88.48826  ? 235  HIS B CG    1 
ATOM   6822 N  ND1   . HIS D 4  247 ? 18.51266 49.74362  8.05206   1.000 89.74620  ? 235  HIS B ND1   1 
ATOM   6823 C  CD2   . HIS D 4  247 ? 20.25830 49.93906  6.75220   1.000 87.31579  ? 235  HIS B CD2   1 
ATOM   6824 C  CE1   . HIS D 4  247 ? 19.57846 49.48587  8.78948   1.000 89.45591  ? 235  HIS B CE1   1 
ATOM   6825 N  NE2   . HIS D 4  247 ? 20.65025 49.59711  8.02468   1.000 88.96860  ? 235  HIS B NE2   1 
ATOM   6826 N  N     . PRO D 4  248 ? 15.17006 48.64866  3.84292   1.000 78.38350  ? 236  PRO B N     1 
ATOM   6827 C  CA    . PRO D 4  248 ? 14.28803 48.83925  2.67795   1.000 77.13973  ? 236  PRO B CA    1 
ATOM   6828 C  C     . PRO D 4  248 ? 13.47816 50.12606  2.69937   1.000 84.65926  ? 236  PRO B C     1 
ATOM   6829 O  O     . PRO D 4  248 ? 13.09156 50.59995  1.62471   1.000 78.99848  ? 236  PRO B O     1 
ATOM   6830 C  CB    . PRO D 4  248 ? 13.37184 47.60913  2.72275   1.000 68.60438  ? 236  PRO B CB    1 
ATOM   6831 C  CG    . PRO D 4  248 ? 13.42963 47.14394  4.14167   1.000 71.70842  ? 236  PRO B CG    1 
ATOM   6832 C  CD    . PRO D 4  248 ? 14.82215 47.43916  4.60761   1.000 68.28014  ? 236  PRO B CD    1 
ATOM   6833 N  N     . ASP D 4  249 ? 13.20828 50.71539  3.86028   1.000 89.29640  ? 237  ASP B N     1 
ATOM   6834 C  CA    . ASP D 4  249 ? 12.41204 51.94313  3.75669   1.000 99.52924  ? 237  ASP B CA    1 
ATOM   6835 C  C     . ASP D 4  249 ? 13.21937 53.13226  3.24402   1.000 101.11452 ? 237  ASP B C     1 
ATOM   6836 O  O     . ASP D 4  249 ? 12.70650 54.25968  3.24272   1.000 102.94235 ? 237  ASP B O     1 
ATOM   6837 C  CB    . ASP D 4  249 ? 11.76137 52.28502  5.10115   1.000 108.50852 ? 237  ASP B CB    1 
ATOM   6838 C  CG    . ASP D 4  249 ? 12.76798 52.67874  6.16463   1.000 113.31332 ? 237  ASP B CG    1 
ATOM   6839 O  OD1   . ASP D 4  249 ? 13.86694 52.08781  6.20242   1.000 111.31283 ? 237  ASP B OD1   1 
ATOM   6840 O  OD2   . ASP D 4  249 ? 12.45049 53.57931  6.97040   1.000 120.64301 ? 237  ASP B OD2   1 
ATOM   6841 N  N     . LYS D 4  250 ? 14.45444 52.90535  2.80209   1.000 99.17732  ? 238  LYS B N     1 
ATOM   6842 C  CA    . LYS D 4  250 ? 15.28068 53.94931  2.21680   1.000 105.43597 ? 238  LYS B CA    1 
ATOM   6843 C  C     . LYS D 4  250 ? 15.50808 53.76700  0.71835   1.000 102.88979 ? 238  LYS B C     1 
ATOM   6844 O  O     . LYS D 4  250 ? 16.12393 54.63831  0.09115   1.000 107.39099 ? 238  LYS B O     1 
ATOM   6845 C  CB    . LYS D 4  250 ? 16.63011 54.02178  2.94629   1.000 105.93157 ? 238  LYS B CB    1 
ATOM   6846 N  N     . TRP D 4  251 ? 15.03469 52.66764  0.12910   1.000 94.72738  ? 239  TRP B N     1 
ATOM   6847 C  CA    . TRP D 4  251 ? 15.10341 52.49859  -1.31815  1.000 91.02444  ? 239  TRP B CA    1 
ATOM   6848 C  C     . TRP D 4  251 ? 14.22351 53.53920  -2.00103  1.000 95.93326  ? 239  TRP B C     1 
ATOM   6849 O  O     . TRP D 4  251 ? 13.05485 53.71360  -1.63714  1.000 101.71050 ? 239  TRP B O     1 
ATOM   6850 C  CB    . TRP D 4  251 ? 14.65057 51.09270  -1.72437  1.000 86.09863  ? 239  TRP B CB    1 
ATOM   6851 C  CG    . TRP D 4  251 ? 15.40573 49.95524  -1.07475  1.000 78.93235  ? 239  TRP B CG    1 
ATOM   6852 C  CD1   . TRP D 4  251 ? 16.61776 50.02142  -0.45338  1.000 75.04846  ? 239  TRP B CD1   1 
ATOM   6853 C  CD2   . TRP D 4  251 ? 14.98656 48.58682  -0.98805  1.000 67.95713  ? 239  TRP B CD2   1 
ATOM   6854 N  NE1   . TRP D 4  251 ? 16.97882 48.77940  0.01472   1.000 68.38800  ? 239  TRP B NE1   1 
ATOM   6855 C  CE2   . TRP D 4  251 ? 15.99203 47.88320  -0.29618  1.000 65.06233  ? 239  TRP B CE2   1 
ATOM   6856 C  CE3   . TRP D 4  251 ? 13.85392 47.89125  -1.41912  1.000 72.11213  ? 239  TRP B CE3   1 
ATOM   6857 C  CZ2   . TRP D 4  251 ? 15.90427 46.50988  -0.03070  1.000 62.15795  ? 239  TRP B CZ2   1 
ATOM   6858 C  CZ3   . TRP D 4  251 ? 13.76355 46.52360  -1.15009  1.000 68.43928  ? 239  TRP B CZ3   1 
ATOM   6859 C  CH2   . TRP D 4  251 ? 14.78708 45.85057  -0.46801  1.000 61.56565  ? 239  TRP B CH2   1 
ATOM   6860 N  N     . THR D 4  252 ? 14.77913 54.22629  -2.99532  1.000 95.65602  ? 240  THR B N     1 
ATOM   6861 C  CA    . THR D 4  252 ? 14.06746 55.28325  -3.69491  1.000 103.45693 ? 240  THR B CA    1 
ATOM   6862 C  C     . THR D 4  252 ? 14.02937 54.99623  -5.19164  1.000 104.90627 ? 240  THR B C     1 
ATOM   6863 O  O     . THR D 4  252 ? 14.78526 54.16965  -5.71110  1.000 98.79882  ? 240  THR B O     1 
ATOM   6864 C  CB    . THR D 4  252 ? 14.70910 56.65861  -3.44394  1.000 106.09090 ? 240  THR B CB    1 
ATOM   6865 O  OG1   . THR D 4  252 ? 16.03876 56.67508  -3.98143  1.000 98.41519  ? 240  THR B OG1   1 
ATOM   6866 C  CG2   . THR D 4  252 ? 14.76385 56.96363  -1.95065  1.000 102.40361 ? 240  THR B CG2   1 
ATOM   6867 N  N     . VAL D 4  253 ? 13.13707 55.70686  -5.88107  1.000 70.99346  ? 241  VAL B N     1 
ATOM   6868 C  CA    . VAL D 4  253 ? 12.91152 55.54277  -7.31231  1.000 70.04769  ? 241  VAL B CA    1 
ATOM   6869 C  C     . VAL D 4  253 ? 13.68157 56.61837  -8.06352  1.000 70.91469  ? 241  VAL B C     1 
ATOM   6870 O  O     . VAL D 4  253 ? 13.76938 57.76613  -7.61294  1.000 72.57907  ? 241  VAL B O     1 
ATOM   6871 C  CB    . VAL D 4  253 ? 11.40918 55.60598  -7.63919  1.000 71.74796  ? 241  VAL B CB    1 
ATOM   6872 C  CG1   . VAL D 4  253 ? 11.18330 55.47140  -9.13624  1.000 72.84967  ? 241  VAL B CG1   1 
ATOM   6873 C  CG2   . VAL D 4  253 ? 10.67426 54.52002  -6.89770  1.000 73.95700  ? 241  VAL B CG2   1 
ATOM   6874 N  N     . GLN D 4  254 ? 14.24959 56.24444  -9.21078  1.000 71.09831  ? 242  GLN B N     1 
ATOM   6875 C  CA    . GLN D 4  254 ? 15.04879 57.14714  -10.02600 1.000 72.91493  ? 242  GLN B CA    1 
ATOM   6876 C  C     . GLN D 4  254 ? 14.21940 57.64738  -11.20756 1.000 68.71088  ? 242  GLN B C     1 
ATOM   6877 O  O     . GLN D 4  254 ? 14.03547 56.90840  -12.18585 1.000 61.10440  ? 242  GLN B O     1 
ATOM   6878 C  CB    . GLN D 4  254 ? 16.31536 56.43990  -10.51482 1.000 73.61855  ? 242  GLN B CB    1 
ATOM   6879 C  CG    . GLN D 4  254 ? 17.18879 57.30722  -11.39200 1.000 75.65128  ? 242  GLN B CG    1 
ATOM   6880 C  CD    . GLN D 4  254 ? 17.38025 58.70176  -10.82220 1.000 77.88674  ? 242  GLN B CD    1 
ATOM   6881 O  OE1   . GLN D 4  254 ? 17.87543 58.86996  -9.70544  1.000 77.01145  ? 242  GLN B OE1   1 
ATOM   6882 N  NE2   . GLN D 4  254 ? 16.97944 59.71301  -11.59045 1.000 79.77999  ? 242  GLN B NE2   1 
ATOM   6883 N  N     . PRO D 4  255 ? 13.70395 58.87386  -11.17353 1.000 69.42803  ? 243  PRO B N     1 
ATOM   6884 C  CA    . PRO D 4  255 ? 12.82920 59.34504  -12.25328 1.000 62.91918  ? 243  PRO B CA    1 
ATOM   6885 C  C     . PRO D 4  255 ? 13.59981 59.73145  -13.50221 1.000 59.28404  ? 243  PRO B C     1 
ATOM   6886 O  O     . PRO D 4  255 ? 14.81128 59.95645  -13.48263 1.000 56.70346  ? 243  PRO B O     1 
ATOM   6887 C  CB    . PRO D 4  255 ? 12.14833 60.57696  -11.64964 1.000 65.68451  ? 243  PRO B CB    1 
ATOM   6888 C  CG    . PRO D 4  255 ? 13.13126 61.07292  -10.63137 1.000 70.40278  ? 243  PRO B CG    1 
ATOM   6889 C  CD    . PRO D 4  255 ? 13.79264 59.84214  -10.06428 1.000 71.19123  ? 243  PRO B CD    1 
ATOM   6890 N  N     . ILE D 4  256 ? 12.85525 59.78929  -14.60802 1.000 61.10209  ? 244  ILE B N     1 
ATOM   6891 C  CA    . ILE D 4  256 ? 13.35379 60.40741  -15.83015 1.000 63.48647  ? 244  ILE B CA    1 
ATOM   6892 C  C     . ILE D 4  256 ? 13.43820 61.91123  -15.61305 1.000 63.33481  ? 244  ILE B C     1 
ATOM   6893 O  O     . ILE D 4  256 ? 12.49825 62.53247  -15.10256 1.000 63.60555  ? 244  ILE B O     1 
ATOM   6894 C  CB    . ILE D 4  256 ? 12.43539 60.07854  -17.01670 1.000 61.97778  ? 244  ILE B CB    1 
ATOM   6895 C  CG1   . ILE D 4  256 ? 12.11773 58.57927  -17.06968 1.000 63.12388  ? 244  ILE B CG1   1 
ATOM   6896 C  CG2   . ILE D 4  256 ? 13.06201 60.56411  -18.31347 1.000 55.39192  ? 244  ILE B CG2   1 
ATOM   6897 C  CD1   . ILE D 4  256 ? 13.13658 57.76065  -17.83614 1.000 63.90173  ? 244  ILE B CD1   1 
ATOM   6898 N  N     . VAL D 4  257 ? 14.55846 62.50692  -15.99522 1.000 63.39297  ? 245  VAL B N     1 
ATOM   6899 C  CA    . VAL D 4  257 ? 14.79445 63.91714  -15.71944 1.000 68.02574  ? 245  VAL B CA    1 
ATOM   6900 C  C     . VAL D 4  257 ? 15.19392 64.62354  -17.01114 1.000 62.02944  ? 245  VAL B C     1 
ATOM   6901 O  O     . VAL D 4  257 ? 15.81314 64.02883  -17.89810 1.000 61.04873  ? 245  VAL B O     1 
ATOM   6902 C  CB    . VAL D 4  257 ? 15.86325 64.08738  -14.61335 1.000 75.02526  ? 245  VAL B CB    1 
ATOM   6903 C  CG1   . VAL D 4  257 ? 17.23191 63.58604  -15.09731 1.000 74.58756  ? 245  VAL B CG1   1 
ATOM   6904 C  CG2   . VAL D 4  257 ? 15.91660 65.53238  -14.12820 1.000 79.70500  ? 245  VAL B CG2   1 
ATOM   6905 N  N     . LEU D 4  258 ? 14.80628 65.90741  -17.12981 1.000 58.61576  ? 246  LEU B N     1 
ATOM   6906 C  CA    . LEU D 4  258 ? 15.08062 66.67262  -18.34340 1.000 46.66180  ? 246  LEU B CA    1 
ATOM   6907 C  C     . LEU D 4  258 ? 16.10693 67.77751  -18.07962 1.000 50.02627  ? 246  LEU B C     1 
ATOM   6908 O  O     . LEU D 4  258 ? 16.11911 68.38284  -17.00151 1.000 54.90217  ? 246  LEU B O     1 
ATOM   6909 C  CB    . LEU D 4  258 ? 13.80092 67.30256  -18.91133 1.000 36.94713  ? 246  LEU B CB    1 
ATOM   6910 C  CG    . LEU D 4  258 ? 12.66780 66.36771  -19.33272 1.000 41.42477  ? 246  LEU B CG    1 
ATOM   6911 C  CD1   . LEU D 4  258 ? 11.44535 67.14405  -19.81053 1.000 32.54333  ? 246  LEU B CD1   1 
ATOM   6912 C  CD2   . LEU D 4  258 ? 13.14140 65.38613  -20.39632 1.000 41.18422  ? 246  LEU B CD2   1 
ATOM   6913 N  N     . PRO D 4  259 ? 16.95585 68.08873  -19.06362 1.000 49.87024  ? 247  PRO B N     1 
ATOM   6914 C  CA    . PRO D 4  259 ? 18.01857 69.07232  -18.83632 1.000 48.32052  ? 247  PRO B CA    1 
ATOM   6915 C  C     . PRO D 4  259 ? 17.46719 70.44894  -18.49226 1.000 47.62683  ? 247  PRO B C     1 
ATOM   6916 O  O     . PRO D 4  259 ? 16.36824 70.82807  -18.89876 1.000 45.47886  ? 247  PRO B O     1 
ATOM   6917 C  CB    . PRO D 4  259 ? 18.77173 69.09327  -20.17480 1.000 45.98389  ? 247  PRO B CB    1 
ATOM   6918 C  CG    . PRO D 4  259 ? 17.77289 68.66874  -21.18439 1.000 41.23742  ? 247  PRO B CG    1 
ATOM   6919 C  CD    . PRO D 4  259 ? 16.88983 67.67061  -20.47935 1.000 46.53879  ? 247  PRO B CD    1 
ATOM   6920 N  N     . GLU D 4  260 ? 18.25393 71.19432  -17.72714 1.000 52.13293  ? 248  GLU B N     1 
ATOM   6921 C  CA    . GLU D 4  260 ? 17.98156 72.58838  -17.40001 1.000 59.59421  ? 248  GLU B CA    1 
ATOM   6922 C  C     . GLU D 4  260 ? 18.98516 73.45341  -18.14848 1.000 58.63390  ? 248  GLU B C     1 
ATOM   6923 O  O     . GLU D 4  260 ? 20.19545 73.30337  -17.95321 1.000 61.98679  ? 248  GLU B O     1 
ATOM   6924 C  CB    . GLU D 4  260 ? 18.10959 72.82986  -15.89677 1.000 69.70401  ? 248  GLU B CB    1 
ATOM   6925 C  CG    . GLU D 4  260 ? 17.11669 72.08444  -15.03893 1.000 78.61475  ? 248  GLU B CG    1 
ATOM   6926 C  CD    . GLU D 4  260 ? 15.86805 72.89895  -14.77447 1.000 87.08862  ? 248  GLU B CD    1 
ATOM   6927 O  OE1   . GLU D 4  260 ? 15.71246 73.97361  -15.40841 1.000 90.63355  ? 248  GLU B OE1   1 
ATOM   6928 O  OE2   . GLU D 4  260 ? 15.05088 72.46894  -13.92629 1.000 88.22308  ? 248  GLU B OE2   1 
ATOM   6929 N  N     . LYS D 4  261 ? 18.49973 74.35697  -18.99297 1.000 55.79850  ? 249  LYS B N     1 
ATOM   6930 C  CA    . LYS D 4  261 ? 19.41211 75.22410  -19.72535 1.000 61.02197  ? 249  LYS B CA    1 
ATOM   6931 C  C     . LYS D 4  261 ? 18.84442 76.63166  -19.81188 1.000 66.96893  ? 249  LYS B C     1 
ATOM   6932 O  O     . LYS D 4  261 ? 17.62564 76.83128  -19.80428 1.000 69.42082  ? 249  LYS B O     1 
ATOM   6933 C  CB    . LYS D 4  261 ? 19.70422 74.69630  -21.14331 1.000 54.48300  ? 249  LYS B CB    1 
ATOM   6934 C  CG    . LYS D 4  261 ? 20.53294 73.42805  -21.17362 1.000 54.42734  ? 249  LYS B CG    1 
ATOM   6935 C  CD    . LYS D 4  261 ? 20.88003 73.01599  -22.59626 1.000 53.50890  ? 249  LYS B CD    1 
ATOM   6936 C  CE    . LYS D 4  261 ? 21.96175 71.94337  -22.61333 1.000 53.51611  ? 249  LYS B CE    1 
ATOM   6937 N  NZ    . LYS D 4  261 ? 21.47512 70.64452  -22.08665 1.000 51.92681  ? 249  LYS B NZ    1 
ATOM   6938 N  N     . ASP D 4  262 ? 19.74894 77.60791  -19.88715 1.000 67.77498  ? 250  ASP B N     1 
ATOM   6939 C  CA    . ASP D 4  262 ? 19.38873 78.97958  -20.21282 1.000 69.51003  ? 250  ASP B CA    1 
ATOM   6940 C  C     . ASP D 4  262 ? 19.66969 79.31465  -21.66492 1.000 61.43326  ? 250  ASP B C     1 
ATOM   6941 O  O     . ASP D 4  262 ? 19.38967 80.43376  -22.09811 1.000 68.06062  ? 250  ASP B O     1 
ATOM   6942 C  CB    . ASP D 4  262 ? 20.12059 79.95745  -19.29729 1.000 81.34314  ? 250  ASP B CB    1 
ATOM   6943 C  CG    . ASP D 4  262 ? 19.43757 80.10171  -17.95902 1.000 98.59923  ? 250  ASP B CG    1 
ATOM   6944 O  OD1   . ASP D 4  262 ? 18.23703 79.75342  -17.87131 1.000 100.97167 ? 250  ASP B OD1   1 
ATOM   6945 O  OD2   . ASP D 4  262 ? 20.08947 80.56287  -16.99644 1.000 109.63091 ? 250  ASP B OD2   1 
ATOM   6946 N  N     . SER D 4  263 ? 20.20577 78.36630  -22.41977 1.000 50.84797  ? 251  SER B N     1 
ATOM   6947 C  CA    . SER D 4  263 ? 20.46660 78.52875  -23.83903 1.000 44.61808  ? 251  SER B CA    1 
ATOM   6948 C  C     . SER D 4  263 ? 20.36551 77.15179  -24.47765 1.000 45.10257  ? 251  SER B C     1 
ATOM   6949 O  O     . SER D 4  263 ? 20.92764 76.18474  -23.95955 1.000 51.47528  ? 251  SER B O     1 
ATOM   6950 C  CB    . SER D 4  263 ? 21.84753 79.13993  -24.07254 1.000 44.70839  ? 251  SER B CB    1 
ATOM   6951 O  OG    . SER D 4  263 ? 22.10838 79.29701  -25.44969 1.000 49.03458  ? 251  SER B OG    1 
ATOM   6952 N  N     . TRP D 4  264 ? 19.64450 77.06106  -25.58420 1.000 38.56626  ? 252  TRP B N     1 
ATOM   6953 C  CA    . TRP D 4  264 ? 19.36041 75.78910  -26.22424 1.000 32.89699  ? 252  TRP B CA    1 
ATOM   6954 C  C     . TRP D 4  264 ? 19.80374 75.84538  -27.67581 1.000 37.72042  ? 252  TRP B C     1 
ATOM   6955 O  O     . TRP D 4  264 ? 19.46676 76.79230  -28.39279 1.000 42.94006  ? 252  TRP B O     1 
ATOM   6956 C  CB    . TRP D 4  264 ? 17.86655 75.46142  -26.13911 1.000 31.90538  ? 252  TRP B CB    1 
ATOM   6957 C  CG    . TRP D 4  264 ? 17.38694 75.22339  -24.73605 1.000 39.30187  ? 252  TRP B CG    1 
ATOM   6958 C  CD1   . TRP D 4  264 ? 17.07720 76.17491  -23.79626 1.000 39.84603  ? 252  TRP B CD1   1 
ATOM   6959 C  CD2   . TRP D 4  264 ? 17.13489 73.95043  -24.11392 1.000 39.42397  ? 252  TRP B CD2   1 
ATOM   6960 N  NE1   . TRP D 4  264 ? 16.65120 75.56864  -22.63196 1.000 39.23159  ? 252  TRP B NE1   1 
ATOM   6961 C  CE2   . TRP D 4  264 ? 16.67998 74.20857  -22.79820 1.000 38.88331  ? 252  TRP B CE2   1 
ATOM   6962 C  CE3   . TRP D 4  264 ? 17.24784 72.62125  -24.53990 1.000 40.13931  ? 252  TRP B CE3   1 
ATOM   6963 C  CZ2   . TRP D 4  264 ? 16.34960 73.18436  -21.90335 1.000 40.31237  ? 252  TRP B CZ2   1 
ATOM   6964 C  CZ3   . TRP D 4  264 ? 16.91488 71.60149  -23.64570 1.000 40.79751  ? 252  TRP B CZ3   1 
ATOM   6965 C  CH2   . TRP D 4  264 ? 16.47672 71.89375  -22.34095 1.000 39.39447  ? 252  TRP B CH2   1 
ATOM   6966 N  N     . THR D 4  265 ? 20.55720 74.84107  -28.10921 1.000 38.77927  ? 253  THR B N     1 
ATOM   6967 C  CA    . THR D 4  265 ? 20.89391 74.75083  -29.52053 1.000 35.81497  ? 253  THR B CA    1 
ATOM   6968 C  C     . THR D 4  265 ? 19.90523 73.84292  -30.24556 1.000 31.51021  ? 253  THR B C     1 
ATOM   6969 O  O     . THR D 4  265 ? 19.06954 73.17779  -29.63217 1.000 28.59281  ? 253  THR B O     1 
ATOM   6970 C  CB    . THR D 4  265 ? 22.32562 74.25003  -29.71377 1.000 36.31184  ? 253  THR B CB    1 
ATOM   6971 O  OG1   . THR D 4  265 ? 22.45557 72.90479  -29.21146 1.000 35.80208  ? 253  THR B OG1   1 
ATOM   6972 C  CG2   . THR D 4  265 ? 23.30116 75.18082  -29.00378 1.000 28.65616  ? 253  THR B CG2   1 
ATOM   6973 N  N     . VAL D 4  266 ? 19.98328 73.86807  -31.57958 1.000 28.12308  ? 254  VAL B N     1 
ATOM   6974 C  CA    . VAL D 4  266 ? 19.27183 72.89362  -32.39493 1.000 27.90236  ? 254  VAL B CA    1 
ATOM   6975 C  C     . VAL D 4  266 ? 19.60358 71.47818  -31.93383 1.000 31.78120  ? 254  VAL B C     1 
ATOM   6976 O  O     . VAL D 4  266 ? 18.71932 70.61780  -31.83288 1.000 32.97286  ? 254  VAL B O     1 
ATOM   6977 C  CB    . VAL D 4  266 ? 19.60845 73.09760  -33.88547 1.000 36.48473  ? 254  VAL B CB    1 
ATOM   6978 C  CG1   . VAL D 4  266 ? 19.07408 71.90889  -34.75285 1.000 26.01287  ? 254  VAL B CG1   1 
ATOM   6979 C  CG2   . VAL D 4  266 ? 19.06939 74.43884  -34.38157 1.000 25.88624  ? 254  VAL B CG2   1 
ATOM   6980 N  N     . ASN D 4  267 ? 20.87499 71.21806  -31.61681 1.000 32.03547  ? 255  ASN B N     1 
ATOM   6981 C  CA    . ASN D 4  267 ? 21.23785 69.89040  -31.12481 1.000 35.40325  ? 255  ASN B CA    1 
ATOM   6982 C  C     . ASN D 4  267 ? 20.56883 69.57319  -29.78578 1.000 36.86032  ? 255  ASN B C     1 
ATOM   6983 O  O     . ASN D 4  267 ? 20.03900 68.46951  -29.59538 1.000 38.30411  ? 255  ASN B O     1 
ATOM   6984 C  CB    . ASN D 4  267 ? 22.74914 69.75015  -30.99073 1.000 34.68734  ? 255  ASN B CB    1 
ATOM   6985 C  CG    . ASN D 4  267 ? 23.13722 68.38411  -30.46088 1.000 36.45697  ? 255  ASN B CG    1 
ATOM   6986 O  OD1   . ASN D 4  267 ? 22.94878 67.38326  -31.14406 1.000 43.37191  ? 255  ASN B OD1   1 
ATOM   6987 N  ND2   . ASN D 4  267 ? 23.63246 68.32992  -29.23088 1.000 32.80770  ? 255  ASN B ND2   1 
ATOM   6988 N  N     . ASP D 4  268 ? 20.62668 70.51401  -28.83086 1.000 36.38844  ? 256  ASP B N     1 
ATOM   6989 C  CA    . ASP D 4  268 ? 19.99301 70.30674  -27.52884 1.000 34.35065  ? 256  ASP B CA    1 
ATOM   6990 C  C     . ASP D 4  268 ? 18.52375 69.95989  -27.69072 1.000 37.66189  ? 256  ASP B C     1 
ATOM   6991 O  O     . ASP D 4  268 ? 18.02160 69.03264  -27.04342 1.000 38.92477  ? 256  ASP B O     1 
ATOM   6992 C  CB    . ASP D 4  268 ? 20.12069 71.55234  -26.64847 1.000 33.35127  ? 256  ASP B CB    1 
ATOM   6993 C  CG    . ASP D 4  268 ? 21.55251 71.86305  -26.25525 1.000 42.35028  ? 256  ASP B CG    1 
ATOM   6994 O  OD1   . ASP D 4  268 ? 22.38237 70.92905  -26.19157 1.000 41.72253  ? 256  ASP B OD1   1 
ATOM   6995 O  OD2   . ASP D 4  268 ? 21.84198 73.05996  -25.99557 1.000 47.64075  ? 256  ASP B OD2   1 
ATOM   6996 N  N     . ILE D 4  269 ? 17.82467 70.69356  -28.56181 1.000 38.32303  ? 257  ILE B N     1 
ATOM   6997 C  CA    . ILE D 4  269 ? 16.38489 70.52257  -28.71383 1.000 36.06096  ? 257  ILE B CA    1 
ATOM   6998 C  C     . ILE D 4  269 ? 16.07308 69.22411  -29.44263 1.000 35.48453  ? 257  ILE B C     1 
ATOM   6999 O  O     . ILE D 4  269 ? 15.11427 68.52813  -29.09849 1.000 40.52085  ? 257  ILE B O     1 
ATOM   7000 C  CB    . ILE D 4  269 ? 15.77003 71.73621  -29.43719 1.000 38.88888  ? 257  ILE B CB    1 
ATOM   7001 C  CG1   . ILE D 4  269 ? 15.90147 72.98628  -28.57887 1.000 39.42212  ? 257  ILE B CG1   1 
ATOM   7002 C  CG2   . ILE D 4  269 ? 14.30584 71.48560  -29.75292 1.000 25.60154  ? 257  ILE B CG2   1 
ATOM   7003 C  CD1   . ILE D 4  269 ? 15.74268 74.26315  -29.36324 1.000 40.34583  ? 257  ILE B CD1   1 
ATOM   7004 N  N     . GLN D 4  270 ? 16.84558 68.89327  -30.47873 1.000 31.88558  ? 258  GLN B N     1 
ATOM   7005 C  CA    . GLN D 4  270 ? 16.69359 67.58915  -31.11545 1.000 30.01331  ? 258  GLN B CA    1 
ATOM   7006 C  C     . GLN D 4  270 ? 16.82846 66.46317  -30.09243 1.000 30.08005  ? 258  GLN B C     1 
ATOM   7007 O  O     . GLN D 4  270 ? 16.00052 65.54266  -30.05261 1.000 31.19601  ? 258  GLN B O     1 
ATOM   7008 C  CB    . GLN D 4  270 ? 17.70760 67.43784  -32.24924 1.000 31.40181  ? 258  GLN B CB    1 
ATOM   7009 C  CG    . GLN D 4  270 ? 17.33096 68.25371  -33.49249 1.000 34.36602  ? 258  GLN B CG    1 
ATOM   7010 C  CD    . GLN D 4  270 ? 18.29298 68.08940  -34.64933 1.000 37.28395  ? 258  GLN B CD    1 
ATOM   7011 O  OE1   . GLN D 4  270 ? 19.32663 67.44789  -34.51895 1.000 39.67531  ? 258  GLN B OE1   1 
ATOM   7012 N  NE2   . GLN D 4  270 ? 17.94860 68.67297  -35.79732 1.000 44.39294  ? 258  GLN B NE2   1 
ATOM   7013 N  N     . LYS D 4  271 ? 17.85028 66.53961  -29.23256 1.000 31.60653  ? 259  LYS B N     1 
ATOM   7014 C  CA    . LYS D 4  271 ? 18.04813 65.50313  -28.21818 1.000 32.40329  ? 259  LYS B CA    1 
ATOM   7015 C  C     . LYS D 4  271 ? 16.85355 65.42855  -27.27420 1.000 38.63996  ? 259  LYS B C     1 
ATOM   7016 O  O     . LYS D 4  271 ? 16.30845 64.34369  -27.01749 1.000 42.98801  ? 259  LYS B O     1 
ATOM   7017 C  CB    . LYS D 4  271 ? 19.34944 65.75565  -27.44757 1.000 26.89473  ? 259  LYS B CB    1 
ATOM   7018 C  CG    . LYS D 4  271 ? 20.61299 65.44258  -28.27504 1.000 38.46123  ? 259  LYS B CG    1 
ATOM   7019 C  CD    . LYS D 4  271 ? 21.73959 64.79036  -27.44987 1.000 53.39314  ? 259  LYS B CD    1 
ATOM   7020 C  CE    . LYS D 4  271 ? 22.30835 65.72443  -26.35736 1.000 63.13040  ? 259  LYS B CE    1 
ATOM   7021 N  NZ    . LYS D 4  271 ? 23.78666 65.99052  -26.49951 1.000 67.60668  ? 259  LYS B NZ    1 
ATOM   7022 N  N     . LEU D 4  272 ? 16.42099 66.58444  -26.76927 1.000 38.40169  ? 260  LEU B N     1 
ATOM   7023 C  CA    . LEU D 4  272 ? 15.26602 66.63783  -25.88652 1.000 39.03146  ? 260  LEU B CA    1 
ATOM   7024 C  C     . LEU D 4  272 ? 14.01769 66.06819  -26.55938 1.000 43.98688  ? 260  LEU B C     1 
ATOM   7025 O  O     . LEU D 4  272 ? 13.23603 65.34577  -25.92386 1.000 48.11883  ? 260  LEU B O     1 
ATOM   7026 C  CB    . LEU D 4  272 ? 15.03966 68.08182  -25.44031 1.000 39.44663  ? 260  LEU B CB    1 
ATOM   7027 C  CG    . LEU D 4  272 ? 13.83107 68.38958  -24.56068 1.000 36.89363  ? 260  LEU B CG    1 
ATOM   7028 C  CD1   . LEU D 4  272 ? 13.97091 67.71357  -23.20499 1.000 31.26983  ? 260  LEU B CD1   1 
ATOM   7029 C  CD2   . LEU D 4  272 ? 13.66429 69.89618  -24.41728 1.000 37.57241  ? 260  LEU B CD2   1 
ATOM   7030 N  N     . VAL D 4  273 ? 13.81219 66.37337  -27.84353 1.000 39.80607  ? 261  VAL B N     1 
ATOM   7031 C  CA    . VAL D 4  273 ? 12.59406 65.92965  -28.51464 1.000 39.52880  ? 261  VAL B CA    1 
ATOM   7032 C  C     . VAL D 4  273 ? 12.60842 64.41794  -28.70534 1.000 40.29669  ? 261  VAL B C     1 
ATOM   7033 O  O     . VAL D 4  273 ? 11.58050 63.75498  -28.54222 1.000 40.11566  ? 261  VAL B O     1 
ATOM   7034 C  CB    . VAL D 4  273 ? 12.40469 66.67153  -29.84936 1.000 35.12707  ? 261  VAL B CB    1 
ATOM   7035 C  CG1   . VAL D 4  273 ? 11.40357 65.91958  -30.74498 1.000 30.52624  ? 261  VAL B CG1   1 
ATOM   7036 C  CG2   . VAL D 4  273 ? 11.93248 68.09427  -29.59616 1.000 34.14253  ? 261  VAL B CG2   1 
ATOM   7037 N  N     . GLY D 4  274 ? 13.77282 63.84280  -29.01799 1.000 37.69438  ? 262  GLY B N     1 
ATOM   7038 C  CA    . GLY D 4  274 ? 13.85955 62.38999  -29.10283 1.000 35.35445  ? 262  GLY B CA    1 
ATOM   7039 C  C     . GLY D 4  274 ? 13.64882 61.70627  -27.75896 1.000 35.54297  ? 262  GLY B C     1 
ATOM   7040 O  O     . GLY D 4  274 ? 12.95640 60.68181  -27.66884 1.000 32.78933  ? 262  GLY B O     1 
ATOM   7041 N  N     . LYS D 4  275 ? 14.22245 62.27450  -26.69123 1.000 36.34173  ? 263  LYS B N     1 
ATOM   7042 C  CA    . LYS D 4  275 ? 14.03896 61.68838  -25.36774 1.000 39.61240  ? 263  LYS B CA    1 
ATOM   7043 C  C     . LYS D 4  275 ? 12.58347 61.76308  -24.92058 1.000 44.21758  ? 263  LYS B C     1 
ATOM   7044 O  O     . LYS D 4  275 ? 12.05777 60.80855  -24.32935 1.000 46.22607  ? 263  LYS B O     1 
ATOM   7045 C  CB    . LYS D 4  275 ? 14.94590 62.38076  -24.35609 1.000 40.36703  ? 263  LYS B CB    1 
ATOM   7046 C  CG    . LYS D 4  275 ? 14.89535 61.74968  -22.97178 1.000 44.09899  ? 263  LYS B CG    1 
ATOM   7047 C  CD    . LYS D 4  275 ? 15.70746 62.57658  -21.99660 1.000 47.56931  ? 263  LYS B CD    1 
ATOM   7048 C  CE    . LYS D 4  275 ? 15.91215 61.87714  -20.66604 1.000 49.08113  ? 263  LYS B CE    1 
ATOM   7049 N  NZ    . LYS D 4  275 ? 17.29144 62.17433  -20.17926 1.000 51.53815  ? 263  LYS B NZ    1 
ATOM   7050 N  N     . LEU D 4  276 ? 11.91386 62.88746  -25.19745 1.000 41.81542  ? 264  LEU B N     1 
ATOM   7051 C  CA    . LEU D 4  276 ? 10.50693 63.02862  -24.83380 1.000 35.26921  ? 264  LEU B CA    1 
ATOM   7052 C  C     . LEU D 4  276 ? 9.62085  62.13502  -25.69067 1.000 32.94197  ? 264  LEU B C     1 
ATOM   7053 O  O     . LEU D 4  276 ? 8.61816  61.59328  -25.21074 1.000 33.14407  ? 264  LEU B O     1 
ATOM   7054 C  CB    . LEU D 4  276 ? 10.08240 64.48383  -24.97437 1.000 34.45597  ? 264  LEU B CB    1 
ATOM   7055 C  CG    . LEU D 4  276 ? 10.55122 65.48063  -23.92410 1.000 37.11659  ? 264  LEU B CG    1 
ATOM   7056 C  CD1   . LEU D 4  276 ? 10.41419 66.90830  -24.46754 1.000 37.62169  ? 264  LEU B CD1   1 
ATOM   7057 C  CD2   . LEU D 4  276 ? 9.73160  65.29285  -22.64885 1.000 36.99205  ? 264  LEU B CD2   1 
ATOM   7058 N  N     . ASN D 4  277 ? 9.97167  61.97440  -26.96538 1.000 33.25469  ? 265  ASN B N     1 
ATOM   7059 C  CA    . ASN D 4  277 ? 9.24312  61.05590  -27.82998 1.000 32.92226  ? 265  ASN B CA    1 
ATOM   7060 C  C     . ASN D 4  277 ? 9.32721  59.62799  -27.30952 1.000 38.00678  ? 265  ASN B C     1 
ATOM   7061 O  O     . ASN D 4  277 ? 8.32274  58.90201  -27.28678 1.000 38.80163  ? 265  ASN B O     1 
ATOM   7062 C  CB    . ASN D 4  277 ? 9.79873  61.15724  -29.24167 1.000 31.28635  ? 265  ASN B CB    1 
ATOM   7063 C  CG    . ASN D 4  277 ? 9.12563  60.22291  -30.19448 1.000 37.94326  ? 265  ASN B CG    1 
ATOM   7064 O  OD1   . ASN D 4  277 ? 7.93035  60.35511  -30.45619 1.000 36.76086  ? 265  ASN B OD1   1 
ATOM   7065 N  ND2   . ASN D 4  277 ? 9.89395  59.27260  -30.74593 1.000 40.55287  ? 265  ASN B ND2   1 
ATOM   7066 N  N     . TRP D 4  278 ? 10.51747 59.20954  -26.87409 1.000 38.87042  ? 266  TRP B N     1 
ATOM   7067 C  CA    . TRP D 4  278 ? 10.63990 57.89429  -26.25621 1.000 41.68465  ? 266  TRP B CA    1 
ATOM   7068 C  C     . TRP D 4  278 ? 9.80242  57.81257  -24.98173 1.000 41.08574  ? 266  TRP B C     1 
ATOM   7069 O  O     . TRP D 4  278 ? 9.03628  56.86136  -24.79238 1.000 41.92752  ? 266  TRP B O     1 
ATOM   7070 C  CB    . TRP D 4  278 ? 12.10846 57.57610  -25.96998 1.000 44.51772  ? 266  TRP B CB    1 
ATOM   7071 C  CG    . TRP D 4  278 ? 12.29443 56.40722  -25.04072 1.000 49.27717  ? 266  TRP B CG    1 
ATOM   7072 C  CD1   . TRP D 4  278 ? 12.31238 55.07934  -25.37634 1.000 51.78282  ? 266  TRP B CD1   1 
ATOM   7073 C  CD2   . TRP D 4  278 ? 12.49049 56.46440  -23.61911 1.000 51.07596  ? 266  TRP B CD2   1 
ATOM   7074 N  NE1   . TRP D 4  278 ? 12.51250 54.31053  -24.25063 1.000 53.05334  ? 266  TRP B NE1   1 
ATOM   7075 C  CE2   . TRP D 4  278 ? 12.62013 55.13494  -23.16061 1.000 52.08909  ? 266  TRP B CE2   1 
ATOM   7076 C  CE3   . TRP D 4  278 ? 12.57332 57.51192  -22.69095 1.000 53.79352  ? 266  TRP B CE3   1 
ATOM   7077 C  CZ2   . TRP D 4  278 ? 12.82229 54.82548  -21.81685 1.000 55.86864  ? 266  TRP B CZ2   1 
ATOM   7078 C  CZ3   . TRP D 4  278 ? 12.77830 57.20536  -21.35294 1.000 57.12317  ? 266  TRP B CZ3   1 
ATOM   7079 C  CH2   . TRP D 4  278 ? 12.90142 55.87091  -20.92860 1.000 59.15225  ? 266  TRP B CH2   1 
ATOM   7080 N  N     . ALA D 4  279 ? 9.91017  58.82566  -24.11241 1.000 35.64708  ? 267  ALA B N     1 
ATOM   7081 C  CA    . ALA D 4  279 ? 9.22540  58.79300  -22.82929 1.000 34.99118  ? 267  ALA B CA    1 
ATOM   7082 C  C     . ALA D 4  279 ? 7.71128  58.80796  -22.96671 1.000 39.81388  ? 267  ALA B C     1 
ATOM   7083 O  O     . ALA D 4  279 ? 7.01563  58.32434  -22.06541 1.000 47.08379  ? 267  ALA B O     1 
ATOM   7084 C  CB    . ALA D 4  279 ? 9.68388  59.96065  -21.95675 1.000 34.68502  ? 267  ALA B CB    1 
ATOM   7085 N  N     . SER D 4  280 ? 7.17889  59.33468  -24.06724 1.000 39.62626  ? 268  SER B N     1 
ATOM   7086 C  CA    . SER D 4  280 ? 5.72515  59.34409  -24.21425 1.000 43.68954  ? 268  SER B CA    1 
ATOM   7087 C  C     . SER D 4  280 ? 5.13110  57.93355  -24.25069 1.000 42.59834  ? 268  SER B C     1 
ATOM   7088 O  O     . SER D 4  280 ? 3.92880  57.77175  -24.00635 1.000 45.82582  ? 268  SER B O     1 
ATOM   7089 C  CB    . SER D 4  280 ? 5.32232  60.12528  -25.46834 1.000 41.68180  ? 268  SER B CB    1 
ATOM   7090 O  OG    . SER D 4  280 ? 5.95964  59.59186  -26.61639 1.000 40.53630  ? 268  SER B OG    1 
ATOM   7091 N  N     . GLN D 4  281 ? 5.93949  56.91546  -24.55197 1.000 39.68681  ? 269  GLN B N     1 
ATOM   7092 C  CA    . GLN D 4  281 ? 5.45046  55.54322  -24.48665 1.000 48.00450  ? 269  GLN B CA    1 
ATOM   7093 C  C     . GLN D 4  281 ? 5.21444  55.10450  -23.04794 1.000 51.40456  ? 269  GLN B C     1 
ATOM   7094 O  O     . GLN D 4  281 ? 4.38019  54.23070  -22.80116 1.000 54.41483  ? 269  GLN B O     1 
ATOM   7095 C  CB    . GLN D 4  281 ? 6.43645  54.58591  -25.15770 1.000 47.48186  ? 269  GLN B CB    1 
ATOM   7096 C  CG    . GLN D 4  281 ? 6.87844  54.98472  -26.54884 1.000 47.04931  ? 269  GLN B CG    1 
ATOM   7097 C  CD    . GLN D 4  281 ? 7.95692  54.05934  -27.07213 1.000 51.53519  ? 269  GLN B CD    1 
ATOM   7098 O  OE1   . GLN D 4  281 ? 9.12485  54.18999  -26.70655 1.000 54.76316  ? 269  GLN B OE1   1 
ATOM   7099 N  NE2   . GLN D 4  281 ? 7.56886  53.09965  -27.91145 1.000 53.87573  ? 269  GLN B NE2   1 
ATOM   7100 N  N     . ILE D 4  282 ? 5.95250  55.67435  -22.09736 1.000 50.60283  ? 270  ILE B N     1 
ATOM   7101 C  CA    . ILE D 4  282 ? 5.68691  55.44821  -20.67909 1.000 48.07520  ? 270  ILE B CA    1 
ATOM   7102 C  C     . ILE D 4  282 ? 4.65438  56.43520  -20.15171 1.000 47.82345  ? 270  ILE B C     1 
ATOM   7103 O  O     . ILE D 4  282 ? 3.79540  56.06984  -19.34930 1.000 47.69497  ? 270  ILE B O     1 
ATOM   7104 C  CB    . ILE D 4  282 ? 6.99496  55.53112  -19.86730 1.000 45.75270  ? 270  ILE B CB    1 
ATOM   7105 C  CG1   . ILE D 4  282 ? 8.01573  54.50954  -20.35628 1.000 42.46698  ? 270  ILE B CG1   1 
ATOM   7106 C  CG2   . ILE D 4  282 ? 6.72830  55.32378  -18.38857 1.000 47.75575  ? 270  ILE B CG2   1 
ATOM   7107 C  CD1   . ILE D 4  282 ? 9.39304  54.72387  -19.75093 1.000 39.28992  ? 270  ILE B CD1   1 
ATOM   7108 N  N     . TYR D 4  283 ? 4.71890  57.69157  -20.58766 1.000 49.70959  ? 271  TYR B N     1 
ATOM   7109 C  CA    . TYR D 4  283 ? 3.78462  58.72660  -20.14497 1.000 52.34125  ? 271  TYR B CA    1 
ATOM   7110 C  C     . TYR D 4  283 ? 3.09117  59.33724  -21.35002 1.000 55.32953  ? 271  TYR B C     1 
ATOM   7111 O  O     . TYR D 4  283 ? 3.65936  60.22328  -22.01509 1.000 55.77836  ? 271  TYR B O     1 
ATOM   7112 C  CB    . TYR D 4  283 ? 4.50318  59.81157  -19.34993 1.000 53.66208  ? 271  TYR B CB    1 
ATOM   7113 C  CG    . TYR D 4  283 ? 5.26096  59.30738  -18.15035 1.000 56.51583  ? 271  TYR B CG    1 
ATOM   7114 C  CD1   . TYR D 4  283 ? 6.62658  59.03761  -18.23210 1.000 53.71346  ? 271  TYR B CD1   1 
ATOM   7115 C  CD2   . TYR D 4  283 ? 4.61945  59.10752  -16.93401 1.000 61.84953  ? 271  TYR B CD2   1 
ATOM   7116 C  CE1   . TYR D 4  283 ? 7.33628  58.59163  -17.13822 1.000 54.18966  ? 271  TYR B CE1   1 
ATOM   7117 C  CE2   . TYR D 4  283 ? 5.31674  58.65065  -15.83297 1.000 66.30746  ? 271  TYR B CE2   1 
ATOM   7118 C  CZ    . TYR D 4  283 ? 6.67972  58.39606  -15.94130 1.000 64.95029  ? 271  TYR B CZ    1 
ATOM   7119 O  OH    . TYR D 4  283 ? 7.38594  57.93842  -14.84809 1.000 70.34093  ? 271  TYR B OH    1 
ATOM   7120 N  N     . PRO D 4  284 ? 1.85580  58.93453  -21.64825 1.000 54.88993  ? 272  PRO B N     1 
ATOM   7121 C  CA    . PRO D 4  284 ? 1.17762  59.46834  -22.83855 1.000 55.64656  ? 272  PRO B CA    1 
ATOM   7122 C  C     . PRO D 4  284 ? 0.94371  60.96385  -22.78385 1.000 60.69821  ? 272  PRO B C     1 
ATOM   7123 O  O     . PRO D 4  284 ? 0.68635  61.56745  -23.83210 1.000 67.36676  ? 272  PRO B O     1 
ATOM   7124 C  CB    . PRO D 4  284 ? -0.14876 58.69835  -22.86082 1.000 55.43089  ? 272  PRO B CB    1 
ATOM   7125 C  CG    . PRO D 4  284 ? 0.07271  57.50647  -21.96368 1.000 52.29985  ? 272  PRO B CG    1 
ATOM   7126 C  CD    . PRO D 4  284 ? 1.01399  57.98251  -20.91063 1.000 52.37482  ? 272  PRO B CD    1 
ATOM   7127 N  N     . GLY D 4  285 ? 1.03412  61.58443  -21.60373 1.000 59.73780  ? 273  GLY B N     1 
ATOM   7128 C  CA    . GLY D 4  285 ? 0.85317  63.02406  -21.49241 1.000 61.27430  ? 273  GLY B CA    1 
ATOM   7129 C  C     . GLY D 4  285 ? 1.95115  63.84897  -22.13883 1.000 60.92571  ? 273  GLY B C     1 
ATOM   7130 O  O     . GLY D 4  285 ? 1.70695  65.00675  -22.49742 1.000 63.86277  ? 273  GLY B O     1 
ATOM   7131 N  N     . ILE D 4  286 ? 3.15409  63.28168  -22.28337 1.000 56.20136  ? 274  ILE B N     1 
ATOM   7132 C  CA    . ILE D 4  286 ? 4.26780  63.97923  -22.91740 1.000 50.26981  ? 274  ILE B CA    1 
ATOM   7133 C  C     . ILE D 4  286 ? 3.86008  64.44270  -24.30875 1.000 50.25267  ? 274  ILE B C     1 
ATOM   7134 O  O     . ILE D 4  286 ? 3.24133  63.69265  -25.06894 1.000 52.90835  ? 274  ILE B O     1 
ATOM   7135 C  CB    . ILE D 4  286 ? 5.50042  63.05703  -22.97579 1.000 48.48704  ? 274  ILE B CB    1 
ATOM   7136 C  CG1   . ILE D 4  286 ? 5.94654  62.64451  -21.56783 1.000 48.00919  ? 274  ILE B CG1   1 
ATOM   7137 C  CG2   . ILE D 4  286 ? 6.63795  63.70238  -23.75972 1.000 46.32026  ? 274  ILE B CG2   1 
ATOM   7138 C  CD1   . ILE D 4  286 ? 6.18506  63.79217  -20.63734 1.000 45.94445  ? 274  ILE B CD1   1 
ATOM   7139 N  N     . LYS D 4  287 ? 4.19708  65.68731  -24.64491 1.000 47.08547  ? 275  LYS B N     1 
ATOM   7140 C  CA    . LYS D 4  287 ? 3.92220  66.22604  -25.96731 1.000 47.74210  ? 275  LYS B CA    1 
ATOM   7141 C  C     . LYS D 4  287 ? 5.12646  67.03471  -26.43481 1.000 50.92491  ? 275  LYS B C     1 
ATOM   7142 O  O     . LYS D 4  287 ? 5.71561  67.78532  -25.65261 1.000 52.68383  ? 275  LYS B O     1 
ATOM   7143 C  CB    . LYS D 4  287 ? 2.65008  67.08619  -25.95914 1.000 51.72513  ? 275  LYS B CB    1 
ATOM   7144 N  N     . VAL D 4  288 ? 5.50096  66.86326  -27.70525 1.000 51.44291  ? 276  VAL B N     1 
ATOM   7145 C  CA    . VAL D 4  288 ? 6.66151  67.52855  -28.28618 1.000 46.67780  ? 276  VAL B CA    1 
ATOM   7146 C  C     . VAL D 4  288 ? 6.26795  68.47210  -29.42780 1.000 50.33807  ? 276  VAL B C     1 
ATOM   7147 O  O     . VAL D 4  288 ? 7.11422  68.88069  -30.20043 1.000 46.76887  ? 276  VAL B O     1 
ATOM   7148 C  CB    . VAL D 4  288 ? 7.71656  66.50384  -28.75348 1.000 45.89497  ? 276  VAL B CB    1 
ATOM   7149 C  CG1   . VAL D 4  288 ? 8.19301  65.68193  -27.59692 1.000 46.20795  ? 276  VAL B CG1   1 
ATOM   7150 C  CG2   . VAL D 4  288 ? 7.16439  65.59995  -29.82336 1.000 29.79505  ? 276  VAL B CG2   1 
ATOM   7151 N  N     . ARG D 4  289 ? 4.98525  68.83962  -29.51735 1.000 58.68695  ? 277  ARG B N     1 
ATOM   7152 C  CA    . ARG D 4  289 ? 4.47736  69.66005  -30.61965 1.000 61.22108  ? 277  ARG B CA    1 
ATOM   7153 C  C     . ARG D 4  289 ? 5.26681  70.96002  -30.78443 1.000 53.73584  ? 277  ARG B C     1 
ATOM   7154 O  O     . ARG D 4  289 ? 5.82787  71.22768  -31.85040 1.000 53.70833  ? 277  ARG B O     1 
ATOM   7155 C  CB    . ARG D 4  289 ? 2.99121  69.96075  -30.38668 1.000 71.50909  ? 277  ARG B CB    1 
ATOM   7156 C  CG    . ARG D 4  289 ? 2.16843  70.25920  -31.63833 1.000 79.90498  ? 277  ARG B CG    1 
ATOM   7157 C  CD    . ARG D 4  289 ? 1.63796  68.97901  -32.27903 1.000 87.37556  ? 277  ARG B CD    1 
ATOM   7158 N  NE    . ARG D 4  289 ? 0.50862  69.22368  -33.17843 1.000 95.03917  ? 277  ARG B NE    1 
ATOM   7159 C  CZ    . ARG D 4  289 ? -0.04161 68.29464  -33.95878 1.000 97.75597  ? 277  ARG B CZ    1 
ATOM   7160 N  NH1   . ARG D 4  289 ? -1.06954 68.60133  -34.74567 1.000 100.36900 ? 277  ARG B NH1   1 
ATOM   7161 N  NH2   . ARG D 4  289 ? 0.44137  67.05722  -33.95609 1.000 95.73891  ? 277  ARG B NH2   1 
ATOM   7162 N  N     . GLN D 4  290 ? 5.32655  71.78012  -29.73083 1.000 51.30491  ? 278  GLN B N     1 
ATOM   7163 C  CA    . GLN D 4  290 ? 5.89131  73.12690  -29.84777 1.000 54.43577  ? 278  GLN B CA    1 
ATOM   7164 C  C     . GLN D 4  290 ? 7.41901  73.11904  -29.88749 1.000 55.55649  ? 278  GLN B C     1 
ATOM   7165 O  O     . GLN D 4  290 ? 8.04446  73.88609  -30.65011 1.000 56.73607  ? 278  GLN B O     1 
ATOM   7166 C  CB    . GLN D 4  290 ? 5.40403  73.98819  -28.68227 1.000 56.85736  ? 278  GLN B CB    1 
ATOM   7167 C  CG    . GLN D 4  290 ? 3.89412  74.04653  -28.56876 1.000 63.59408  ? 278  GLN B CG    1 
ATOM   7168 C  CD    . GLN D 4  290 ? 3.25071  74.75961  -29.74051 1.000 66.88156  ? 278  GLN B CD    1 
ATOM   7169 O  OE1   . GLN D 4  290 ? 3.68356  75.84137  -30.12760 1.000 67.17107  ? 278  GLN B OE1   1 
ATOM   7170 N  NE2   . GLN D 4  290 ? 2.21582  74.15240  -30.31689 1.000 69.55645  ? 278  GLN B NE2   1 
ATOM   7171 N  N     . LEU D 4  291 ? 8.03539  72.28587  -29.04511 1.000 51.29912  ? 279  LEU B N     1 
ATOM   7172 C  CA    . LEU D 4  291 ? 9.47941  72.13589  -29.10679 1.000 45.65457  ? 279  LEU B CA    1 
ATOM   7173 C  C     . LEU D 4  291 ? 9.89678  71.74683  -30.50651 1.000 41.22752  ? 279  LEU B C     1 
ATOM   7174 O  O     . LEU D 4  291 ? 10.83171 72.32508  -31.07180 1.000 45.91535  ? 279  LEU B O     1 
ATOM   7175 C  CB    . LEU D 4  291 ? 9.94322  71.09656  -28.08583 1.000 47.53331  ? 279  LEU B CB    1 
ATOM   7176 C  CG    . LEU D 4  291 ? 9.95933  71.60801  -26.64625 1.000 48.64530  ? 279  LEU B CG    1 
ATOM   7177 C  CD1   . LEU D 4  291 ? 9.68923  70.48904  -25.64950 1.000 52.32144  ? 279  LEU B CD1   1 
ATOM   7178 C  CD2   . LEU D 4  291 ? 11.29130 72.29177  -26.36397 1.000 45.20909  ? 279  LEU B CD2   1 
ATOM   7179 N  N     . SER D 4  292 ? 9.17662  70.79902  -31.09685 1.000 41.59126  ? 280  SER B N     1 
ATOM   7180 C  CA    . SER D 4  292 ? 9.48623  70.36010  -32.44854 1.000 49.37603  ? 280  SER B CA    1 
ATOM   7181 C  C     . SER D 4  292 ? 9.23275  71.47657  -33.44453 1.000 51.12540  ? 280  SER B C     1 
ATOM   7182 O  O     . SER D 4  292 ? 9.99536  71.64434  -34.40261 1.000 53.57188  ? 280  SER B O     1 
ATOM   7183 C  CB    . SER D 4  292 ? 8.66274  69.11771  -32.79236 1.000 56.12058  ? 280  SER B CB    1 
ATOM   7184 O  OG    . SER D 4  292 ? 9.02128  68.61071  -34.05794 1.000 65.65188  ? 280  SER B OG    1 
ATOM   7185 N  N     . LYS D 4  293 ? 8.17135  72.25596  -33.21843 1.000 51.95704  ? 281  LYS B N     1 
ATOM   7186 C  CA    . LYS D 4  293 ? 7.86563  73.40142  -34.07115 1.000 51.86190  ? 281  LYS B CA    1 
ATOM   7187 C  C     . LYS D 4  293 ? 9.07256  74.32297  -34.21183 1.000 48.20674  ? 281  LYS B C     1 
ATOM   7188 O  O     . LYS D 4  293 ? 9.33159  74.86125  -35.29547 1.000 45.79663  ? 281  LYS B O     1 
ATOM   7189 C  CB    . LYS D 4  293 ? 6.66387  74.15646  -33.49577 1.000 51.84162  ? 281  LYS B CB    1 
ATOM   7190 C  CG    . LYS D 4  293 ? 5.63031  74.58210  -34.51653 1.000 58.84974  ? 281  LYS B CG    1 
ATOM   7191 C  CD    . LYS D 4  293 ? 4.37846  75.12805  -33.83154 1.000 65.68276  ? 281  LYS B CD    1 
ATOM   7192 C  CE    . LYS D 4  293 ? 3.27008  75.49048  -34.83598 1.000 73.98731  ? 281  LYS B CE    1 
ATOM   7193 N  NZ    . LYS D 4  293 ? 3.54921  76.71919  -35.66015 1.000 75.15735  ? 281  LYS B NZ    1 
ATOM   7194 N  N     . LEU D 4  294 ? 9.82980  74.50212  -33.12299 1.000 47.74113  ? 282  LEU B N     1 
ATOM   7195 C  CA    . LEU D 4  294 ? 11.03558 75.34139  -33.17016 1.000 45.75345  ? 282  LEU B CA    1 
ATOM   7196 C  C     . LEU D 4  294 ? 12.10772 74.83096  -34.13038 1.000 51.07524  ? 282  LEU B C     1 
ATOM   7197 O  O     . LEU D 4  294 ? 13.05461 75.57194  -34.42049 1.000 48.39475  ? 282  LEU B O     1 
ATOM   7198 C  CB    . LEU D 4  294 ? 11.68858 75.45486  -31.79297 1.000 41.85458  ? 282  LEU B CB    1 
ATOM   7199 C  CG    . LEU D 4  294 ? 10.86186 75.85061  -30.57687 1.000 40.63675  ? 282  LEU B CG    1 
ATOM   7200 C  CD1   . LEU D 4  294 ? 11.60271 75.38373  -29.34102 1.000 42.02110  ? 282  LEU B CD1   1 
ATOM   7201 C  CD2   . LEU D 4  294 ? 10.63408 77.34245  -30.53565 1.000 34.17890  ? 282  LEU B CD2   1 
ATOM   7202 N  N     . LEU D 4  295 ? 12.01411 73.58601  -34.60010 1.000 56.57418  ? 283  LEU B N     1 
ATOM   7203 C  CA    . LEU D 4  295 ? 13.06733 72.97207  -35.40099 1.000 56.28529  ? 283  LEU B CA    1 
ATOM   7204 C  C     . LEU D 4  295 ? 12.77116 72.96205  -36.89897 1.000 62.43891  ? 283  LEU B C     1 
ATOM   7205 O  O     . LEU D 4  295 ? 13.45490 72.25272  -37.64091 1.000 67.57450  ? 283  LEU B O     1 
ATOM   7206 C  CB    . LEU D 4  295 ? 13.32355 71.54011  -34.92282 1.000 50.52515  ? 283  LEU B CB    1 
ATOM   7207 C  CG    . LEU D 4  295 ? 14.03332 71.42446  -33.57862 1.000 46.81656  ? 283  LEU B CG    1 
ATOM   7208 C  CD1   . LEU D 4  295 ? 14.10869 69.99319  -33.12409 1.000 42.69390  ? 283  LEU B CD1   1 
ATOM   7209 C  CD2   . LEU D 4  295 ? 15.41600 72.00808  -33.70069 1.000 48.31202  ? 283  LEU B CD2   1 
ATOM   7210 N  N     . ARG D 4  296 ? 11.78346 73.72303  -37.36752 1.000 60.41229  ? 284  ARG B N     1 
ATOM   7211 C  CA    . ARG D 4  296 ? 11.52155 73.75438  -38.79851 1.000 57.97042  ? 284  ARG B CA    1 
ATOM   7212 C  C     . ARG D 4  296 ? 12.70958 74.35026  -39.54819 1.000 55.98678  ? 284  ARG B C     1 
ATOM   7213 O  O     . ARG D 4  296 ? 13.51816 75.09904  -38.99720 1.000 59.33274  ? 284  ARG B O     1 
ATOM   7214 C  CB    . ARG D 4  296 ? 10.25821 74.54672  -39.10283 1.000 60.72717  ? 284  ARG B CB    1 
ATOM   7215 C  CG    . ARG D 4  296 ? 8.99694  73.89913  -38.59346 1.000 65.19687  ? 284  ARG B CG    1 
ATOM   7216 C  CD    . ARG D 4  296 ? 7.82162  74.31572  -39.44631 1.000 75.67215  ? 284  ARG B CD    1 
ATOM   7217 N  NE    . ARG D 4  296 ? 6.55469  73.85022  -38.89245 1.000 86.24718  ? 284  ARG B NE    1 
ATOM   7218 C  CZ    . ARG D 4  296 ? 5.78703  74.56909  -38.07891 1.000 92.74510  ? 284  ARG B CZ    1 
ATOM   7219 N  NH1   . ARG D 4  296 ? 6.15802  75.79391  -37.72537 1.000 95.89323  ? 284  ARG B NH1   1 
ATOM   7220 N  NH2   . ARG D 4  296 ? 4.64807  74.06517  -37.62029 1.000 94.42595  ? 284  ARG B NH2   1 
ATOM   7221 N  N     . GLY D 4  297 ? 12.81925 73.99324  -40.81767 1.000 53.49356  ? 285  GLY B N     1 
ATOM   7222 C  CA    . GLY D 4  297 ? 13.97360 74.38145  -41.60418 1.000 52.69775  ? 285  GLY B CA    1 
ATOM   7223 C  C     . GLY D 4  297 ? 15.05264 73.31648  -41.58972 1.000 48.57468  ? 285  GLY B C     1 
ATOM   7224 O  O     . GLY D 4  297 ? 14.86352 72.19427  -41.11698 1.000 46.09686  ? 285  GLY B O     1 
ATOM   7225 N  N     . THR D 4  298 ? 16.21591 73.68825  -42.12541 1.000 44.66975  ? 286  THR B N     1 
ATOM   7226 C  CA    . THR D 4  298 ? 17.38009 72.80766  -42.19855 1.000 43.36380  ? 286  THR B CA    1 
ATOM   7227 C  C     . THR D 4  298 ? 18.54154 73.56606  -41.57946 1.000 31.72649  ? 286  THR B C     1 
ATOM   7228 O  O     . THR D 4  298 ? 19.32962 74.17047  -42.30325 1.000 49.47154  ? 286  THR B O     1 
ATOM   7229 C  CB    . THR D 4  298 ? 17.69167 72.39543  -43.63518 1.000 45.96614  ? 286  THR B CB    1 
ATOM   7230 O  OG1   . THR D 4  298 ? 16.48290 72.01091  -44.29611 1.000 54.83289  ? 286  THR B OG1   1 
ATOM   7231 C  CG2   . THR D 4  298 ? 18.64447 71.21608  -43.64564 1.000 42.51521  ? 286  THR B CG2   1 
ATOM   7232 N  N     . LYS D 4  299 ? 18.66836 73.49283  -40.26087 1.000 32.48410  ? 287  LYS B N     1 
ATOM   7233 C  CA    . LYS D 4  299 ? 19.52980 74.36728  -39.47789 1.000 29.62737  ? 287  LYS B CA    1 
ATOM   7234 C  C     . LYS D 4  299 ? 20.83387 73.69387  -39.03815 1.000 36.23570  ? 287  LYS B C     1 
ATOM   7235 O  O     . LYS D 4  299 ? 20.94003 72.46667  -38.92266 1.000 35.40579  ? 287  LYS B O     1 
ATOM   7236 C  CB    . LYS D 4  299 ? 18.78552 74.85127  -38.23496 1.000 27.99361  ? 287  LYS B CB    1 
ATOM   7237 C  CG    . LYS D 4  299 ? 17.53137 75.67742  -38.49292 1.000 32.26267  ? 287  LYS B CG    1 
ATOM   7238 C  CD    . LYS D 4  299 ? 16.94178 76.13181  -37.14031 1.000 38.67980  ? 287  LYS B CD    1 
ATOM   7239 C  CE    . LYS D 4  299 ? 15.73862 77.05834  -37.28683 1.000 46.47653  ? 287  LYS B CE    1 
ATOM   7240 N  NZ    . LYS D 4  299 ? 16.05907 78.34848  -37.99076 1.000 46.15005  ? 287  LYS B NZ    1 
ATOM   7241 N  N     . ALA D 4  300 ? 21.82460 74.53676  -38.75753 1.000 35.96331  ? 288  ALA B N     1 
ATOM   7242 C  CA    . ALA D 4  300 ? 23.06415 74.08674  -38.14408 1.000 36.64174  ? 288  ALA B CA    1 
ATOM   7243 C  C     . ALA D 4  300 ? 22.81419 73.52360  -36.74562 1.000 33.96640  ? 288  ALA B C     1 
ATOM   7244 O  O     . ALA D 4  300 ? 21.97950 74.02816  -35.98837 1.000 38.32297  ? 288  ALA B O     1 
ATOM   7245 C  CB    . ALA D 4  300 ? 24.04991 75.25097  -38.06490 1.000 29.64431  ? 288  ALA B CB    1 
ATOM   7246 N  N     . LEU D 4  301 ? 23.56051 72.48019  -36.39347 1.000 33.81358  ? 289  LEU B N     1 
ATOM   7247 C  CA    . LEU D 4  301 ? 23.37373 71.85260  -35.08784 1.000 32.50638  ? 289  LEU B CA    1 
ATOM   7248 C  C     . LEU D 4  301 ? 23.68719 72.81115  -33.94279 1.000 36.65994  ? 289  LEU B C     1 
ATOM   7249 O  O     . LEU D 4  301 ? 23.07560 72.71750  -32.86795 1.000 27.36474  ? 289  LEU B O     1 
ATOM   7250 C  CB    . LEU D 4  301 ? 24.24268 70.60119  -34.97722 1.000 29.35934  ? 289  LEU B CB    1 
ATOM   7251 C  CG    . LEU D 4  301 ? 23.72721 69.33147  -35.65410 1.000 34.10540  ? 289  LEU B CG    1 
ATOM   7252 C  CD1   . LEU D 4  301 ? 24.46077 68.08964  -35.13981 1.000 30.83146  ? 289  LEU B CD1   1 
ATOM   7253 C  CD2   . LEU D 4  301 ? 22.27058 69.20573  -35.37501 1.000 33.42174  ? 289  LEU B CD2   1 
ATOM   7254 N  N     . THR D 4  302 ? 24.63225 73.73077  -34.14507 1.000 34.59507  ? 290  THR B N     1 
ATOM   7255 C  CA    . THR D 4  302 ? 25.07310 74.63277  -33.09157 1.000 35.22986  ? 290  THR B CA    1 
ATOM   7256 C  C     . THR D 4  302 ? 24.36274 75.97465  -33.12853 1.000 37.78316  ? 290  THR B C     1 
ATOM   7257 O  O     . THR D 4  302 ? 24.70941 76.86642  -32.35300 1.000 41.00703  ? 290  THR B O     1 
ATOM   7258 C  CB    . THR D 4  302 ? 26.57936 74.85433  -33.17418 1.000 39.28327  ? 290  THR B CB    1 
ATOM   7259 O  OG1   . THR D 4  302 ? 26.91231 75.41540  -34.45791 1.000 34.84383  ? 290  THR B OG1   1 
ATOM   7260 C  CG2   . THR D 4  302 ? 27.33949 73.53146  -32.93054 1.000 31.59354  ? 290  THR B CG2   1 
ATOM   7261 N  N     . GLU D 4  303 ? 23.37745 76.14381  -33.99830 1.000 36.63741  ? 291  GLU B N     1 
ATOM   7262 C  CA    . GLU D 4  303 ? 22.59386 77.37124  -33.97315 1.000 40.76519  ? 291  GLU B CA    1 
ATOM   7263 C  C     . GLU D 4  303 ? 21.77663 77.45220  -32.68621 1.000 39.57869  ? 291  GLU B C     1 
ATOM   7264 O  O     . GLU D 4  303 ? 21.17344 76.46321  -32.24818 1.000 34.82496  ? 291  GLU B O     1 
ATOM   7265 C  CB    . GLU D 4  303 ? 21.68572 77.43966  -35.19744 1.000 40.94471  ? 291  GLU B CB    1 
ATOM   7266 C  CG    . GLU D 4  303 ? 20.67212 78.56200  -35.20021 1.000 42.83508  ? 291  GLU B CG    1 
ATOM   7267 C  CD    . GLU D 4  303 ? 19.81809 78.52046  -36.45850 1.000 56.76171  ? 291  GLU B CD    1 
ATOM   7268 O  OE1   . GLU D 4  303 ? 18.65647 78.98510  -36.41389 1.000 58.27307  ? 291  GLU B OE1   1 
ATOM   7269 O  OE2   . GLU D 4  303 ? 20.31263 78.00080  -37.49655 1.000 65.08488  ? 291  GLU B OE2   1 
ATOM   7270 N  N     . VAL D 4  304 ? 21.78942 78.63265  -32.06712 1.000 36.29609  ? 292  VAL B N     1 
ATOM   7271 C  CA    . VAL D 4  304 ? 21.06332 78.86897  -30.82523 1.000 32.97660  ? 292  VAL B CA    1 
ATOM   7272 C  C     . VAL D 4  304 ? 19.60851 79.17805  -31.15650 1.000 40.59603  ? 292  VAL B C     1 
ATOM   7273 O  O     . VAL D 4  304 ? 19.31974 80.07682  -31.94936 1.000 46.17055  ? 292  VAL B O     1 
ATOM   7274 C  CB    . VAL D 4  304 ? 21.69751 80.01243  -30.02308 1.000 32.14155  ? 292  VAL B CB    1 
ATOM   7275 C  CG1   . VAL D 4  304 ? 20.84856 80.34030  -28.80805 1.000 32.30173  ? 292  VAL B CG1   1 
ATOM   7276 C  CG2   . VAL D 4  304 ? 23.08942 79.63280  -29.58211 1.000 36.34081  ? 292  VAL B CG2   1 
ATOM   7277 N  N     . ILE D 4  305 ? 18.69155 78.43388  -30.55558 1.000 43.39794  ? 293  ILE B N     1 
ATOM   7278 C  CA    . ILE D 4  305 ? 17.25907 78.60696  -30.76522 1.000 45.74676  ? 293  ILE B CA    1 
ATOM   7279 C  C     . ILE D 4  305 ? 16.65617 79.17970  -29.48903 1.000 49.83244  ? 293  ILE B C     1 
ATOM   7280 O  O     . ILE D 4  305 ? 16.77407 78.55898  -28.42515 1.000 50.25932  ? 293  ILE B O     1 
ATOM   7281 C  CB    . ILE D 4  305 ? 16.57429 77.28847  -31.13662 1.000 47.50166  ? 293  ILE B CB    1 
ATOM   7282 C  CG1   . ILE D 4  305 ? 17.06686 76.80911  -32.49803 1.000 48.51241  ? 293  ILE B CG1   1 
ATOM   7283 C  CG2   . ILE D 4  305 ? 15.05230 77.47252  -31.11814 1.000 48.71972  ? 293  ILE B CG2   1 
ATOM   7284 C  CD1   . ILE D 4  305 ? 16.62900 77.68966  -33.61723 1.000 49.71919  ? 293  ILE B CD1   1 
ATOM   7285 N  N     . PRO D 4  306 ? 16.01513 80.34592  -29.54110 1.000 52.05829  ? 294  PRO B N     1 
ATOM   7286 C  CA    . PRO D 4  306 ? 15.28602 80.84071  -28.37054 1.000 52.51390  ? 294  PRO B CA    1 
ATOM   7287 C  C     . PRO D 4  306 ? 13.95622 80.12055  -28.20731 1.000 52.53864  ? 294  PRO B C     1 
ATOM   7288 O  O     . PRO D 4  306 ? 13.21018 79.91600  -29.17244 1.000 49.28216  ? 294  PRO B O     1 
ATOM   7289 C  CB    . PRO D 4  306 ? 15.07676 82.32421  -28.69473 1.000 49.79333  ? 294  PRO B CB    1 
ATOM   7290 C  CG    . PRO D 4  306 ? 15.00753 82.34530  -30.17827 1.000 49.55541  ? 294  PRO B CG    1 
ATOM   7291 C  CD    . PRO D 4  306 ? 16.01879 81.33142  -30.63688 1.000 49.70415  ? 294  PRO B CD    1 
ATOM   7292 N  N     . LEU D 4  307 ? 13.66028 79.74242  -26.96408 1.000 49.68607  ? 295  LEU B N     1 
ATOM   7293 C  CA    . LEU D 4  307 ? 12.43791 79.00971  -26.67764 1.000 48.66243  ? 295  LEU B CA    1 
ATOM   7294 C  C     . LEU D 4  307 ? 11.25167 79.96436  -26.62089 1.000 51.66481  ? 295  LEU B C     1 
ATOM   7295 O  O     . LEU D 4  307 ? 11.26851 80.94616  -25.87389 1.000 52.99116  ? 295  LEU B O     1 
ATOM   7296 C  CB    . LEU D 4  307 ? 12.57262 78.24077  -25.36290 1.000 49.42154  ? 295  LEU B CB    1 
ATOM   7297 C  CG    . LEU D 4  307 ? 13.58034 77.08148  -25.32051 1.000 46.03577  ? 295  LEU B CG    1 
ATOM   7298 C  CD1   . LEU D 4  307 ? 13.42872 76.22815  -24.07533 1.000 36.95859  ? 295  LEU B CD1   1 
ATOM   7299 C  CD2   . LEU D 4  307 ? 13.44727 76.21992  -26.55417 1.000 49.01193  ? 295  LEU B CD2   1 
ATOM   7300 N  N     . THR D 4  308 ? 10.22084 79.67264  -27.41200 1.000 54.32568  ? 296  THR B N     1 
ATOM   7301 C  CA    . THR D 4  308 ? 8.98434  80.44297  -27.36623 1.000 54.25528  ? 296  THR B CA    1 
ATOM   7302 C  C     . THR D 4  308 ? 8.28705  80.24544  -26.02146 1.000 53.55673  ? 296  THR B C     1 
ATOM   7303 O  O     . THR D 4  308 ? 8.68478  79.41539  -25.19848 1.000 51.98663  ? 296  THR B O     1 
ATOM   7304 C  CB    . THR D 4  308 ? 8.03388  80.02819  -28.49711 1.000 53.66028  ? 296  THR B CB    1 
ATOM   7305 O  OG1   . THR D 4  308 ? 7.74795  78.62634  -28.39950 1.000 56.06877  ? 296  THR B OG1   1 
ATOM   7306 C  CG2   . THR D 4  308 ? 8.62998  80.32829  -29.87792 1.000 43.06868  ? 296  THR B CG2   1 
ATOM   7307 N  N     . GLU D 4  309 ? 7.22912  81.03218  -25.80345 1.000 55.40190  ? 297  GLU B N     1 
ATOM   7308 C  CA    . GLU D 4  309 ? 6.38055  80.83595  -24.63061 1.000 56.10646  ? 297  GLU B CA    1 
ATOM   7309 C  C     . GLU D 4  309 ? 5.71542  79.46490  -24.66803 1.000 61.09237  ? 297  GLU B C     1 
ATOM   7310 O  O     . GLU D 4  309 ? 5.75693  78.70999  -23.68792 1.000 63.52527  ? 297  GLU B O     1 
ATOM   7311 C  CB    . GLU D 4  309 ? 5.32460  81.94271  -24.55080 1.000 56.87033  ? 297  GLU B CB    1 
ATOM   7312 N  N     . GLU D 4  310 ? 5.09671  79.12836  -25.80182 1.000 61.67353  ? 298  GLU B N     1 
ATOM   7313 C  CA    . GLU D 4  310 ? 4.43849  77.83554  -25.94882 1.000 61.09506  ? 298  GLU B CA    1 
ATOM   7314 C  C     . GLU D 4  310 ? 5.40608  76.69512  -25.66490 1.000 59.60475  ? 298  GLU B C     1 
ATOM   7315 O  O     . GLU D 4  310 ? 5.08687  75.76263  -24.91450 1.000 58.32663  ? 298  GLU B O     1 
ATOM   7316 C  CB    . GLU D 4  310 ? 3.85560  77.69923  -27.35857 1.000 62.73353  ? 298  GLU B CB    1 
ATOM   7317 C  CG    . GLU D 4  310 ? 2.86007  78.78396  -27.75939 1.000 71.13876  ? 298  GLU B CG    1 
ATOM   7318 C  CD    . GLU D 4  310 ? 3.51622  80.11629  -28.09293 1.000 75.66230  ? 298  GLU B CD    1 
ATOM   7319 O  OE1   . GLU D 4  310 ? 4.72255  80.13320  -28.42129 1.000 73.58392  ? 298  GLU B OE1   1 
ATOM   7320 O  OE2   . GLU D 4  310 ? 2.82058  81.15062  -28.01577 1.000 81.63954  ? 298  GLU B OE2   1 
ATOM   7321 N  N     . ALA D 4  311 ? 6.59282  76.74785  -26.27475 1.000 58.60213  ? 299  ALA B N     1 
ATOM   7322 C  CA    . ALA D 4  311 ? 7.56774  75.67843  -26.09482 1.000 54.71567  ? 299  ALA B CA    1 
ATOM   7323 C  C     . ALA D 4  311 ? 8.02433  75.59546  -24.64485 1.000 53.73357  ? 299  ALA B C     1 
ATOM   7324 O  O     . ALA D 4  311 ? 8.19835  74.49873  -24.09744 1.000 54.60811  ? 299  ALA B O     1 
ATOM   7325 C  CB    . ALA D 4  311 ? 8.75479  75.89555  -27.02960 1.000 48.86360  ? 299  ALA B CB    1 
ATOM   7326 N  N     . GLU D 4  312 ? 8.20616  76.74653  -24.00302 1.000 52.83891  ? 300  GLU B N     1 
ATOM   7327 C  CA    . GLU D 4  312 ? 8.59889  76.74953  -22.60332 1.000 56.16102  ? 300  GLU B CA    1 
ATOM   7328 C  C     . GLU D 4  312 ? 7.53765  76.07910  -21.74579 1.000 56.85942  ? 300  GLU B C     1 
ATOM   7329 O  O     . GLU D 4  312 ? 7.85867  75.26748  -20.86843 1.000 56.31358  ? 300  GLU B O     1 
ATOM   7330 C  CB    . GLU D 4  312 ? 8.83893  78.18275  -22.13951 1.000 63.38627  ? 300  GLU B CB    1 
ATOM   7331 C  CG    . GLU D 4  312 ? 9.86826  78.32692  -21.04103 1.000 71.95221  ? 300  GLU B CG    1 
ATOM   7332 C  CD    . GLU D 4  312 ? 11.28864 78.28818  -21.57030 1.000 78.85518  ? 300  GLU B CD    1 
ATOM   7333 O  OE1   . GLU D 4  312 ? 11.94272 77.23311  -21.42778 1.000 84.22303  ? 300  GLU B OE1   1 
ATOM   7334 O  OE2   . GLU D 4  312 ? 11.74848 79.30833  -22.13398 1.000 78.33324  ? 300  GLU B OE2   1 
ATOM   7335 N  N     . LEU D 4  313 ? 6.26412  76.40713  -21.99045 1.000 58.44703  ? 301  LEU B N     1 
ATOM   7336 C  CA    . LEU D 4  313 ? 5.17576  75.81439  -21.21841 1.000 61.35898  ? 301  LEU B CA    1 
ATOM   7337 C  C     . LEU D 4  313 ? 5.07473  74.31585  -21.47223 1.000 62.53339  ? 301  LEU B C     1 
ATOM   7338 O  O     . LEU D 4  313 ? 4.82003  73.53776  -20.54474 1.000 62.44869  ? 301  LEU B O     1 
ATOM   7339 C  CB    . LEU D 4  313 ? 3.85513  76.50623  -21.55367 1.000 62.54173  ? 301  LEU B CB    1 
ATOM   7340 N  N     . GLU D 4  314 ? 5.27356  73.89785  -22.72463 1.000 59.47118  ? 302  GLU B N     1 
ATOM   7341 C  CA    . GLU D 4  314 ? 5.29644  72.47764  -23.04495 1.000 56.24438  ? 302  GLU B CA    1 
ATOM   7342 C  C     . GLU D 4  314 ? 6.39869  71.76557  -22.26968 1.000 55.21839  ? 302  GLU B C     1 
ATOM   7343 O  O     . GLU D 4  314 ? 6.19206  70.66626  -21.73727 1.000 57.56822  ? 302  GLU B O     1 
ATOM   7344 C  CB    . GLU D 4  314 ? 5.47546  72.30383  -24.55333 1.000 56.31692  ? 302  GLU B CB    1 
ATOM   7345 C  CG    . GLU D 4  314 ? 5.48796  70.85992  -25.04525 1.000 59.48964  ? 302  GLU B CG    1 
ATOM   7346 C  CD    . GLU D 4  314 ? 5.56164  70.76225  -26.56872 1.000 64.04133  ? 302  GLU B CD    1 
ATOM   7347 O  OE1   . GLU D 4  314 ? 6.67246  70.88680  -27.14177 1.000 62.97919  ? 302  GLU B OE1   1 
ATOM   7348 O  OE2   . GLU D 4  314 ? 4.49973  70.57246  -27.19957 1.000 67.70855  ? 302  GLU B OE2   1 
ATOM   7349 N  N     . LEU D 4  315 ? 7.56668  72.39967  -22.15974 1.000 52.50785  ? 303  LEU B N     1 
ATOM   7350 C  CA    . LEU D 4  315 ? 8.67022  71.78222  -21.43397 1.000 48.32002  ? 303  LEU B CA    1 
ATOM   7351 C  C     . LEU D 4  315 ? 8.37599  71.70490  -19.94064 1.000 49.94046  ? 303  LEU B C     1 
ATOM   7352 O  O     . LEU D 4  315 ? 8.65913  70.68899  -19.29607 1.000 52.98005  ? 303  LEU B O     1 
ATOM   7353 C  CB    . LEU D 4  315 ? 9.96572  72.55128  -21.70339 1.000 44.83379  ? 303  LEU B CB    1 
ATOM   7354 C  CG    . LEU D 4  315 ? 11.22037 72.12678  -20.92942 1.000 44.33699  ? 303  LEU B CG    1 
ATOM   7355 C  CD1   . LEU D 4  315 ? 11.36967 70.61366  -20.85629 1.000 40.88153  ? 303  LEU B CD1   1 
ATOM   7356 C  CD2   . LEU D 4  315 ? 12.45495 72.73598  -21.56623 1.000 42.21283  ? 303  LEU B CD2   1 
ATOM   7357 N  N     . ALA D 4  316 ? 7.81252  72.76244  -19.36840 1.000 50.23331  ? 304  ALA B N     1 
ATOM   7358 C  CA    . ALA D 4  316 ? 7.51252  72.72264  -17.94153 1.000 53.91140  ? 304  ALA B CA    1 
ATOM   7359 C  C     . ALA D 4  316 ? 6.41815  71.69583  -17.63794 1.000 63.81738  ? 304  ALA B C     1 
ATOM   7360 O  O     . ALA D 4  316 ? 6.46672  70.99587  -16.61110 1.000 63.65314  ? 304  ALA B O     1 
ATOM   7361 C  CB    . ALA D 4  316 ? 7.11972  74.11486  -17.46000 1.000 47.21292  ? 304  ALA B CB    1 
ATOM   7362 N  N     . GLU D 4  317 ? 5.43833  71.56824  -18.53946 1.000 64.19177  ? 305  GLU B N     1 
ATOM   7363 C  CA    . GLU D 4  317 ? 4.39002  70.57346  -18.35686 1.000 64.26923  ? 305  GLU B CA    1 
ATOM   7364 C  C     . GLU D 4  317 ? 4.95489  69.16344  -18.42924 1.000 62.47308  ? 305  GLU B C     1 
ATOM   7365 O  O     . GLU D 4  317 ? 4.57471  68.29442  -17.63212 1.000 62.48654  ? 305  GLU B O     1 
ATOM   7366 C  CB    . GLU D 4  317 ? 3.29455  70.76924  -19.40066 1.000 69.56966  ? 305  GLU B CB    1 
ATOM   7367 C  CG    . GLU D 4  317 ? 2.38275  71.94876  -19.11650 1.000 80.66092  ? 305  GLU B CG    1 
ATOM   7368 C  CD    . GLU D 4  317 ? 1.24804  72.06485  -20.11567 1.000 88.23936  ? 305  GLU B CD    1 
ATOM   7369 O  OE1   . GLU D 4  317 ? 1.44305  71.67612  -21.29097 1.000 87.38872  ? 305  GLU B OE1   1 
ATOM   7370 O  OE2   . GLU D 4  317 ? 0.16011  72.54067  -19.71904 1.000 93.79114  ? 305  GLU B OE2   1 
ATOM   7371 N  N     . ASN D 4  318 ? 5.86749  68.91712  -19.37666 1.000 56.69579  ? 306  ASN B N     1 
ATOM   7372 C  CA    . ASN D 4  318 ? 6.50959  67.60896  -19.44801 1.000 53.39028  ? 306  ASN B CA    1 
ATOM   7373 C  C     . ASN D 4  318 ? 7.33896  67.32695  -18.19980 1.000 56.72712  ? 306  ASN B C     1 
ATOM   7374 O  O     . ASN D 4  318 ? 7.36321  66.19119  -17.70805 1.000 58.28029  ? 306  ASN B O     1 
ATOM   7375 C  CB    . ASN D 4  318 ? 7.38119  67.51160  -20.69692 1.000 49.40938  ? 306  ASN B CB    1 
ATOM   7376 C  CG    . ASN D 4  318 ? 6.57447  67.51765  -21.96775 1.000 49.50344  ? 306  ASN B CG    1 
ATOM   7377 O  OD1   . ASN D 4  318 ? 5.40135  67.15232  -21.97846 1.000 52.50254  ? 306  ASN B OD1   1 
ATOM   7378 N  ND2   . ASN D 4  318 ? 7.19902  67.93714  -23.05191 1.000 49.20103  ? 306  ASN B ND2   1 
ATOM   7379 N  N     . ARG D 4  319 ? 8.04175  68.33828  -17.67921 1.000 56.92760  ? 307  ARG B N     1 
ATOM   7380 C  CA    . ARG D 4  319 ? 8.75773  68.14077  -16.42172 1.000 61.25595  ? 307  ARG B CA    1 
ATOM   7381 C  C     . ARG D 4  319 ? 7.79964  67.72367  -15.31621 1.000 69.14386  ? 307  ARG B C     1 
ATOM   7382 O  O     . ARG D 4  319 ? 8.13004  66.87032  -14.48321 1.000 70.43016  ? 307  ARG B O     1 
ATOM   7383 C  CB    . ARG D 4  319 ? 9.50625  69.40851  -16.01592 1.000 63.93279  ? 307  ARG B CB    1 
ATOM   7384 C  CG    . ARG D 4  319 ? 10.87773 69.53038  -16.62149 1.000 64.16486  ? 307  ARG B CG    1 
ATOM   7385 C  CD    . ARG D 4  319 ? 11.71692 70.60013  -15.94569 1.000 63.27433  ? 307  ARG B CD    1 
ATOM   7386 N  NE    . ARG D 4  319 ? 12.94930 70.81780  -16.69439 1.000 65.23680  ? 307  ARG B NE    1 
ATOM   7387 C  CZ    . ARG D 4  319 ? 13.11756 71.81362  -17.55943 1.000 72.70267  ? 307  ARG B CZ    1 
ATOM   7388 N  NH1   . ARG D 4  319 ? 12.13542 72.68783  -17.76073 1.000 75.42052  ? 307  ARG B NH1   1 
ATOM   7389 N  NH2   . ARG D 4  319 ? 14.26483 71.94437  -18.21768 1.000 72.12647  ? 307  ARG B NH2   1 
ATOM   7390 N  N     . GLU D 4  320 ? 6.60673  68.32094  -15.28831 1.000 71.31618  ? 308  GLU B N     1 
ATOM   7391 C  CA    . GLU D 4  320 ? 5.60855  67.89323  -14.31307 1.000 76.13894  ? 308  GLU B CA    1 
ATOM   7392 C  C     . GLU D 4  320 ? 5.20426  66.43448  -14.54288 1.000 73.80222  ? 308  GLU B C     1 
ATOM   7393 O  O     . GLU D 4  320 ? 5.27262  65.60957  -13.62709 1.000 77.87017  ? 308  GLU B O     1 
ATOM   7394 C  CB    . GLU D 4  320 ? 4.39377  68.82330  -14.36599 1.000 82.26207  ? 308  GLU B CB    1 
ATOM   7395 N  N     . ILE D 4  321 ? 4.81487  66.09225  -15.77415 1.000 68.62389  ? 309  ILE B N     1 
ATOM   7396 C  CA    . ILE D 4  321 ? 4.28816  64.76066  -16.08525 1.000 61.83704  ? 309  ILE B CA    1 
ATOM   7397 C  C     . ILE D 4  321 ? 5.28240  63.65832  -15.74104 1.000 61.31905  ? 309  ILE B C     1 
ATOM   7398 O  O     . ILE D 4  321 ? 4.88807  62.55771  -15.32681 1.000 62.59975  ? 309  ILE B O     1 
ATOM   7399 C  CB    . ILE D 4  321 ? 3.88360  64.70026  -17.57133 1.000 59.13920  ? 309  ILE B CB    1 
ATOM   7400 C  CG1   . ILE D 4  321 ? 2.68019  65.60842  -17.82603 1.000 61.34315  ? 309  ILE B CG1   1 
ATOM   7401 C  CG2   . ILE D 4  321 ? 3.61179  63.26622  -18.01326 1.000 58.77663  ? 309  ILE B CG2   1 
ATOM   7402 C  CD1   . ILE D 4  321 ? 2.29245  65.69498  -19.26671 1.000 60.89495  ? 309  ILE B CD1   1 
ATOM   7403 N  N     . LEU D 4  322 ? 6.57868  63.91902  -15.90426 1.000 58.19243  ? 310  LEU B N     1 
ATOM   7404 C  CA    . LEU D 4  322 ? 7.56777  62.91579  -15.53512 1.000 54.42804  ? 310  LEU B CA    1 
ATOM   7405 C  C     . LEU D 4  322 ? 7.65657  62.69332  -14.02975 1.000 65.16364  ? 310  LEU B C     1 
ATOM   7406 O  O     . LEU D 4  322 ? 8.40251  61.80422  -13.60266 1.000 66.57270  ? 310  LEU B O     1 
ATOM   7407 C  CB    . LEU D 4  322 ? 8.93878  63.30901  -16.07577 1.000 45.37133  ? 310  LEU B CB    1 
ATOM   7408 C  CG    . LEU D 4  322 ? 9.04053  63.30208  -17.59413 1.000 44.98603  ? 310  LEU B CG    1 
ATOM   7409 C  CD1   . LEU D 4  322 ? 10.40975 63.79752  -18.05370 1.000 43.17262  ? 310  LEU B CD1   1 
ATOM   7410 C  CD2   . LEU D 4  322 ? 8.73199  61.89747  -18.14626 1.000 44.72117  ? 310  LEU B CD2   1 
ATOM   7411 N  N     . LYS D 4  323 ? 6.93542  63.48025  -13.21996 1.000 71.24360  ? 311  LYS B N     1 
ATOM   7412 C  CA    . LYS D 4  323 ? 6.89793  63.24506  -11.77808 1.000 78.84382  ? 311  LYS B CA    1 
ATOM   7413 C  C     . LYS D 4  323 ? 5.85801  62.19124  -11.40556 1.000 84.74886  ? 311  LYS B C     1 
ATOM   7414 O  O     . LYS D 4  323 ? 6.10183  61.36280  -10.52098 1.000 88.72511  ? 311  LYS B O     1 
ATOM   7415 C  CB    . LYS D 4  323 ? 6.60852  64.54887  -11.02642 1.000 80.86411  ? 311  LYS B CB    1 
ATOM   7416 C  CG    . LYS D 4  323 ? 7.64341  65.66017  -11.19760 1.000 79.54803  ? 311  LYS B CG    1 
ATOM   7417 C  CD    . LYS D 4  323 ? 7.27360  66.86418  -10.32902 1.000 81.08780  ? 311  LYS B CD    1 
ATOM   7418 C  CE    . LYS D 4  323 ? 8.24185  68.02450  -10.48632 1.000 79.96379  ? 311  LYS B CE    1 
ATOM   7419 N  NZ    . LYS D 4  323 ? 7.85716  68.91776  -11.61656 1.000 81.91845  ? 311  LYS B NZ    1 
ATOM   7420 N  N     . GLU D 4  324 ? 4.70266  62.21237  -12.06874 1.000 84.58086  ? 312  GLU B N     1 
ATOM   7421 C  CA    . GLU D 4  324 ? 3.60800  61.31043  -11.74435 1.000 86.08694  ? 312  GLU B CA    1 
ATOM   7422 C  C     . GLU D 4  324 ? 4.04557  59.84865  -11.87505 1.000 83.56794  ? 312  GLU B C     1 
ATOM   7423 O  O     . GLU D 4  324 ? 4.86018  59.50964  -12.74160 1.000 81.59921  ? 312  GLU B O     1 
ATOM   7424 C  CB    . GLU D 4  324 ? 2.42321  61.58416  -12.66919 1.000 88.57874  ? 312  GLU B CB    1 
ATOM   7425 C  CG    . GLU D 4  324 ? 2.07706  63.06291  -12.80007 1.000 93.57812  ? 312  GLU B CG    1 
ATOM   7426 C  CD    . GLU D 4  324 ? 1.24474  63.37563  -14.03742 1.000 94.22513  ? 312  GLU B CD    1 
ATOM   7427 O  OE1   . GLU D 4  324 ? 1.14181  62.50181  -14.93307 1.000 91.17554  ? 312  GLU B OE1   1 
ATOM   7428 O  OE2   . GLU D 4  324 ? 0.70073  64.50294  -14.11222 1.000 95.29383  ? 312  GLU B OE2   1 
ATOM   7429 N  N     . PRO D 4  325 ? 3.53297  58.96371  -11.01637 1.000 80.50874  ? 313  PRO B N     1 
ATOM   7430 C  CA    . PRO D 4  325 ? 3.83637  57.53408  -11.16440 1.000 78.27724  ? 313  PRO B CA    1 
ATOM   7431 C  C     . PRO D 4  325 ? 3.22860  56.95315  -12.43732 1.000 76.45964  ? 313  PRO B C     1 
ATOM   7432 O  O     . PRO D 4  325 ? 2.19338  57.41230  -12.92967 1.000 77.35712  ? 313  PRO B O     1 
ATOM   7433 C  CB    . PRO D 4  325 ? 3.21191  56.90564  -9.91002  1.000 75.24588  ? 313  PRO B CB    1 
ATOM   7434 C  CG    . PRO D 4  325 ? 2.17478  57.88625  -9.46160  1.000 73.37445  ? 313  PRO B CG    1 
ATOM   7435 C  CD    . PRO D 4  325 ? 2.71200  59.23861  -9.82224  1.000 75.95584  ? 313  PRO B CD    1 
ATOM   7436 N  N     . VAL D 4  326 ? 3.89395  55.92602  -12.97372 1.000 73.29169  ? 314  VAL B N     1 
ATOM   7437 C  CA    . VAL D 4  326 ? 3.40689  55.27318  -14.18731 1.000 70.35669  ? 314  VAL B CA    1 
ATOM   7438 C  C     . VAL D 4  326 ? 2.06137  54.62338  -13.89582 1.000 73.67144  ? 314  VAL B C     1 
ATOM   7439 O  O     . VAL D 4  326 ? 1.92696  53.81033  -12.97236 1.000 73.93137  ? 314  VAL B O     1 
ATOM   7440 C  CB    . VAL D 4  326 ? 4.42856  54.25543  -14.71025 1.000 64.73907  ? 314  VAL B CB    1 
ATOM   7441 C  CG1   . VAL D 4  326 ? 3.93220  53.60748  -16.00361 1.000 58.85241  ? 314  VAL B CG1   1 
ATOM   7442 C  CG2   . VAL D 4  326 ? 5.77865  54.92592  -14.93081 1.000 63.02167  ? 314  VAL B CG2   1 
ATOM   7443 N  N     . HIS D 4  327 ? 1.05413  54.98362  -14.68089 1.000 75.11273  ? 315  HIS B N     1 
ATOM   7444 C  CA    . HIS D 4  327 ? -0.29862 54.52546  -14.41724 1.000 77.92441  ? 315  HIS B CA    1 
ATOM   7445 C  C     . HIS D 4  327 ? -0.51102 53.11971  -14.96448 1.000 75.07915  ? 315  HIS B C     1 
ATOM   7446 O  O     . HIS D 4  327 ? 0.01821  52.76136  -16.02129 1.000 75.46003  ? 315  HIS B O     1 
ATOM   7447 C  CB    . HIS D 4  327 ? -1.31908 55.48537  -15.03260 1.000 82.39475  ? 315  HIS B CB    1 
ATOM   7448 C  CG    . HIS D 4  327 ? -2.73933 55.07292  -14.80153 1.000 89.86298  ? 315  HIS B CG    1 
ATOM   7449 N  ND1   . HIS D 4  327 ? -3.55586 54.61153  -15.81273 1.000 90.73798  ? 315  HIS B ND1   1 
ATOM   7450 C  CD2   . HIS D 4  327 ? -3.47893 55.02346  -13.66758 1.000 93.25610  ? 315  HIS B CD2   1 
ATOM   7451 C  CE1   . HIS D 4  327 ? -4.74168 54.31150  -15.31405 1.000 93.42498  ? 315  HIS B CE1   1 
ATOM   7452 N  NE2   . HIS D 4  327 ? -4.72166 54.55342  -14.01501 1.000 95.12066  ? 315  HIS B NE2   1 
ATOM   7453 N  N     . GLY D 4  328 ? -1.28037 52.31910  -14.22537 1.000 71.97395  ? 316  GLY B N     1 
ATOM   7454 C  CA    . GLY D 4  328 ? -1.76289 51.04535  -14.71912 1.000 66.11645  ? 316  GLY B CA    1 
ATOM   7455 C  C     . GLY D 4  328 ? -0.72553 49.94583  -14.78255 1.000 62.93779  ? 316  GLY B C     1 
ATOM   7456 O  O     . GLY D 4  328 ? -0.64652 49.22025  -15.77846 1.000 61.12146  ? 316  GLY B O     1 
ATOM   7457 N  N     . VAL D 4  329 ? 0.06319  49.79409  -13.72475 1.000 59.24679  ? 317  VAL B N     1 
ATOM   7458 C  CA    . VAL D 4  329 ? 1.12864  48.80075  -13.67791 1.000 56.29960  ? 317  VAL B CA    1 
ATOM   7459 C  C     . VAL D 4  329 ? 0.87079  47.88251  -12.49210 1.000 55.27648  ? 317  VAL B C     1 
ATOM   7460 O  O     . VAL D 4  329 ? 1.12114  48.26375  -11.34243 1.000 58.86637  ? 317  VAL B O     1 
ATOM   7461 C  CB    . VAL D 4  329 ? 2.50838  49.45586  -13.57674 1.000 54.29598  ? 317  VAL B CB    1 
ATOM   7462 C  CG1   . VAL D 4  329 ? 3.59057  48.39305  -13.52711 1.000 53.54378  ? 317  VAL B CG1   1 
ATOM   7463 C  CG2   . VAL D 4  329 ? 2.71860  50.37760  -14.75336 1.000 53.33227  ? 317  VAL B CG2   1 
ATOM   7464 N  N     . TYR D 4  330 ? 0.39866  46.66748  -12.76491 1.000 50.97798  ? 318  TYR B N     1 
ATOM   7465 C  CA    . TYR D 4  330 ? 0.00093  45.72798  -11.72191 1.000 52.76830  ? 318  TYR B CA    1 
ATOM   7466 C  C     . TYR D 4  330 ? 0.87542  44.48599  -11.79929 1.000 54.34012  ? 318  TYR B C     1 
ATOM   7467 O  O     . TYR D 4  330 ? 0.99894  43.87619  -12.86554 1.000 53.14347  ? 318  TYR B O     1 
ATOM   7468 C  CB    . TYR D 4  330 ? -1.48315 45.35448  -11.84960 1.000 53.34926  ? 318  TYR B CB    1 
ATOM   7469 C  CG    . TYR D 4  330 ? -2.38947 46.56491  -11.84675 1.000 58.93663  ? 318  TYR B CG    1 
ATOM   7470 C  CD1   . TYR D 4  330 ? -2.68416 47.23663  -13.02837 1.000 63.09709  ? 318  TYR B CD1   1 
ATOM   7471 C  CD2   . TYR D 4  330 ? -2.92309 47.05829  -10.66293 1.000 62.35651  ? 318  TYR B CD2   1 
ATOM   7472 C  CE1   . TYR D 4  330 ? -3.49177 48.35865  -13.03665 1.000 64.47023  ? 318  TYR B CE1   1 
ATOM   7473 C  CE2   . TYR D 4  330 ? -3.73891 48.17276  -10.66013 1.000 66.54864  ? 318  TYR B CE2   1 
ATOM   7474 C  CZ    . TYR D 4  330 ? -4.01741 48.82046  -11.85404 1.000 70.47845  ? 318  TYR B CZ    1 
ATOM   7475 O  OH    . TYR D 4  330 ? -4.82114 49.93784  -11.87200 1.000 78.69856  ? 318  TYR B OH    1 
ATOM   7476 N  N     . TYR D 4  331 ? 1.47898  44.11996  -10.67028 1.000 52.24002  ? 319  TYR B N     1 
ATOM   7477 C  CA    . TYR D 4  331 ? 2.36628  42.96516  -10.62715 1.000 53.88922  ? 319  TYR B CA    1 
ATOM   7478 C  C     . TYR D 4  331 ? 1.61084  41.67984  -10.96504 1.000 57.47314  ? 319  TYR B C     1 
ATOM   7479 O  O     . TYR D 4  331 ? 0.53161  41.41129  -10.42765 1.000 54.90674  ? 319  TYR B O     1 
ATOM   7480 C  CB    . TYR D 4  331 ? 3.02575  42.86142  -9.24567  1.000 55.86335  ? 319  TYR B CB    1 
ATOM   7481 C  CG    . TYR D 4  331 ? 3.85200  41.61315  -9.05669  1.000 58.88648  ? 319  TYR B CG    1 
ATOM   7482 C  CD1   . TYR D 4  331 ? 5.00992  41.40791  -9.79576  1.000 60.67338  ? 319  TYR B CD1   1 
ATOM   7483 C  CD2   . TYR D 4  331 ? 3.46781  40.63123  -8.15392  1.000 61.96017  ? 319  TYR B CD2   1 
ATOM   7484 C  CE1   . TYR D 4  331 ? 5.76443  40.25824  -9.63929  1.000 62.39753  ? 319  TYR B CE1   1 
ATOM   7485 C  CE2   . TYR D 4  331 ? 4.21703  39.48064  -7.98854  1.000 64.92107  ? 319  TYR B CE2   1 
ATOM   7486 C  CZ    . TYR D 4  331 ? 5.36323  39.30230  -8.73552  1.000 64.23191  ? 319  TYR B CZ    1 
ATOM   7487 O  OH    . TYR D 4  331 ? 6.10911  38.16202  -8.58517  1.000 67.82741  ? 319  TYR B OH    1 
ATOM   7488 N  N     . ASP D 4  332 ? 2.19004  40.88879  -11.86698 1.000 54.77687  ? 320  ASP B N     1 
ATOM   7489 C  CA    . ASP D 4  332 ? 1.63036  39.60871  -12.28369 1.000 62.97340  ? 320  ASP B CA    1 
ATOM   7490 C  C     . ASP D 4  332 ? 2.47783  38.45664  -11.74125 1.000 61.07549  ? 320  ASP B C     1 
ATOM   7491 O  O     . ASP D 4  332 ? 3.58352  38.21226  -12.24661 1.000 55.87000  ? 320  ASP B O     1 
ATOM   7492 C  CB    . ASP D 4  332 ? 1.55384  39.55207  -13.81075 1.000 66.14264  ? 320  ASP B CB    1 
ATOM   7493 C  CG    . ASP D 4  332 ? 0.86137  38.29869  -14.32369 1.000 71.92982  ? 320  ASP B CG    1 
ATOM   7494 O  OD1   . ASP D 4  332 ? 0.53639  37.39337  -13.52090 1.000 72.30811  ? 320  ASP B OD1   1 
ATOM   7495 O  OD2   . ASP D 4  332 ? 0.64067  38.23000  -15.55157 1.000 74.56469  ? 320  ASP B OD2   1 
ATOM   7496 N  N     . PRO D 4  333 ? 2.01360  37.70989  -10.74561 1.000 62.62231  ? 321  PRO B N     1 
ATOM   7497 C  CA    . PRO D 4  333 ? 2.87005  36.64328  -10.19559 1.000 68.47730  ? 321  PRO B CA    1 
ATOM   7498 C  C     . PRO D 4  333 ? 3.23400  35.56534  -11.20794 1.000 72.84059  ? 321  PRO B C     1 
ATOM   7499 O  O     . PRO D 4  333 ? 4.36095  35.05826  -11.17402 1.000 77.97580  ? 321  PRO B O     1 
ATOM   7500 C  CB    . PRO D 4  333 ? 2.03098  36.08221  -9.04155  1.000 67.96698  ? 321  PRO B CB    1 
ATOM   7501 C  CG    . PRO D 4  333 ? 1.00635  37.14197  -8.75088  1.000 65.53833  ? 321  PRO B CG    1 
ATOM   7502 C  CD    . PRO D 4  333 ? 0.71954  37.80216  -10.05822 1.000 61.94619  ? 321  PRO B CD    1 
ATOM   7503 N  N     . SER D 4  334 ? 2.32474  35.21509  -12.12362 1.000 70.59947  ? 322  SER B N     1 
ATOM   7504 C  CA    . SER D 4  334 ? 2.58515  34.15776  -13.09870 1.000 67.19540  ? 322  SER B CA    1 
ATOM   7505 C  C     . SER D 4  334 ? 3.55355  34.57235  -14.20401 1.000 58.66472  ? 322  SER B C     1 
ATOM   7506 O  O     . SER D 4  334 ? 3.93442  33.72666  -15.01827 1.000 60.71184  ? 322  SER B O     1 
ATOM   7507 C  CB    . SER D 4  334 ? 1.27475  33.69085  -13.73352 1.000 70.22498  ? 322  SER B CB    1 
ATOM   7508 O  OG    . SER D 4  334 ? 0.79486  34.65677  -14.65795 1.000 75.22878  ? 322  SER B OG    1 
ATOM   7509 N  N     . LYS D 4  335 ? 3.95029  35.83201  -14.27361 1.000 54.61022  ? 323  LYS B N     1 
ATOM   7510 C  CA    . LYS D 4  335 ? 4.90633  36.27129  -15.27977 1.000 55.81793  ? 323  LYS B CA    1 
ATOM   7511 C  C     . LYS D 4  335 ? 6.28432  36.47587  -14.66509 1.000 56.41811  ? 323  LYS B C     1 
ATOM   7512 O  O     . LYS D 4  335 ? 6.45958  36.50886  -13.44602 1.000 59.75255  ? 323  LYS B O     1 
ATOM   7513 C  CB    . LYS D 4  335 ? 4.43759  37.55984  -15.95813 1.000 57.25035  ? 323  LYS B CB    1 
ATOM   7514 C  CG    . LYS D 4  335 ? 3.32183  37.34158  -16.95283 1.000 59.75521  ? 323  LYS B CG    1 
ATOM   7515 C  CD    . LYS D 4  335 ? 3.12864  38.55298  -17.83107 1.000 59.40134  ? 323  LYS B CD    1 
ATOM   7516 C  CE    . LYS D 4  335 ? 1.91288  38.37498  -18.71433 1.000 66.08334  ? 323  LYS B CE    1 
ATOM   7517 N  NZ    . LYS D 4  335 ? 1.64918  39.62532  -19.47631 1.000 71.81374  ? 323  LYS B NZ    1 
ATOM   7518 N  N     . ASP D 4  336 ? 7.27371  36.60999  -15.53393 1.000 56.97340  ? 324  ASP B N     1 
ATOM   7519 C  CA    . ASP D 4  336 ? 8.63572  36.84251  -15.09049 1.000 65.35826  ? 324  ASP B CA    1 
ATOM   7520 C  C     . ASP D 4  336 ? 8.88150  38.32757  -14.89933 1.000 65.75921  ? 324  ASP B C     1 
ATOM   7521 O  O     . ASP D 4  336 ? 8.39568  39.15850  -15.67408 1.000 62.83171  ? 324  ASP B O     1 
ATOM   7522 C  CB    . ASP D 4  336 ? 9.64635  36.28229  -16.09259 1.000 71.64801  ? 324  ASP B CB    1 
ATOM   7523 C  CG    . ASP D 4  336 ? 9.64607  34.76331  -16.13271 1.000 76.23492  ? 324  ASP B CG    1 
ATOM   7524 O  OD1   . ASP D 4  336 ? 9.34862  34.12847  -15.08818 1.000 74.91566  ? 324  ASP B OD1   1 
ATOM   7525 O  OD2   . ASP D 4  336 ? 9.94384  34.21190  -17.21537 1.000 77.80144  ? 324  ASP B OD2   1 
ATOM   7526 N  N     . LEU D 4  337 ? 9.61874  38.64944  -13.84274 1.000 45.83541  ? 325  LEU B N     1 
ATOM   7527 C  CA    . LEU D 4  337 ? 10.20767 39.96772  -13.69000 1.000 42.47429  ? 325  LEU B CA    1 
ATOM   7528 C  C     . LEU D 4  337 ? 11.39787 40.07671  -14.62847 1.000 39.28654  ? 325  LEU B C     1 
ATOM   7529 O  O     . LEU D 4  337 ? 12.25877 39.19372  -14.64806 1.000 40.36138  ? 325  LEU B O     1 
ATOM   7530 C  CB    . LEU D 4  337 ? 10.64531 40.19698  -12.24187 1.000 41.45438  ? 325  LEU B CB    1 
ATOM   7531 C  CG    . LEU D 4  337 ? 9.53815  40.35692  -11.20411 1.000 48.32361  ? 325  LEU B CG    1 
ATOM   7532 C  CD1   . LEU D 4  337 ? 10.13123 40.54550  -9.82913  1.000 52.79722  ? 325  LEU B CD1   1 
ATOM   7533 C  CD2   . LEU D 4  337 ? 8.64758  41.53488  -11.56288 1.000 50.36546  ? 325  LEU B CD2   1 
ATOM   7534 N  N     . ILE D 4  338 ? 11.42600 41.14034  -15.42376 1.000 38.61659  ? 326  ILE B N     1 
ATOM   7535 C  CA    . ILE D 4  338 ? 12.52085 41.46844  -16.32895 1.000 37.98181  ? 326  ILE B CA    1 
ATOM   7536 C  C     . ILE D 4  338 ? 13.26955 42.65499  -15.73121 1.000 42.40007  ? 326  ILE B C     1 
ATOM   7537 O  O     . ILE D 4  338 ? 12.66609 43.70448  -15.45684 1.000 43.21632  ? 326  ILE B O     1 
ATOM   7538 C  CB    . ILE D 4  338 ? 11.99486 41.82635  -17.72771 1.000 35.35946  ? 326  ILE B CB    1 
ATOM   7539 C  CG1   . ILE D 4  338 ? 10.88958 40.86291  -18.16575 1.000 31.16417  ? 326  ILE B CG1   1 
ATOM   7540 C  CG2   . ILE D 4  338 ? 13.12852 41.92199  -18.72882 1.000 37.95586  ? 326  ILE B CG2   1 
ATOM   7541 C  CD1   . ILE D 4  338 ? 11.36064 39.53550  -18.64139 1.000 30.23477  ? 326  ILE B CD1   1 
ATOM   7542 N  N     . ALA D 4  339 ? 14.57623 42.50359  -15.53427 1.000 39.43033  ? 327  ALA B N     1 
ATOM   7543 C  CA    . ALA D 4  339 ? 15.42859 43.61231  -15.12495 1.000 33.93803  ? 327  ALA B CA    1 
ATOM   7544 C  C     . ALA D 4  339 ? 16.35604 43.98009  -16.27343 1.000 41.34571  ? 327  ALA B C     1 
ATOM   7545 O  O     . ALA D 4  339 ? 17.05689 43.11347  -16.82137 1.000 46.10210  ? 327  ALA B O     1 
ATOM   7546 C  CB    . ALA D 4  339 ? 16.23890 43.26849  -13.87423 1.000 27.97976  ? 327  ALA B CB    1 
ATOM   7547 N  N     . GLU D 4  340 ? 16.33425 45.25258  -16.66208 1.000 37.17125  ? 328  GLU B N     1 
ATOM   7548 C  CA    . GLU D 4  340 ? 17.31107 45.77667  -17.60265 1.000 37.79081  ? 328  GLU B CA    1 
ATOM   7549 C  C     . GLU D 4  340 ? 18.27874 46.67066  -16.85240 1.000 37.48249  ? 328  GLU B C     1 
ATOM   7550 O  O     . GLU D 4  340 ? 17.86372 47.46812  -16.00314 1.000 43.16258  ? 328  GLU B O     1 
ATOM   7551 C  CB    . GLU D 4  340 ? 16.66121 46.56512  -18.73356 1.000 43.28026  ? 328  GLU B CB    1 
ATOM   7552 C  CG    . GLU D 4  340 ? 15.98554 45.71713  -19.78121 1.000 51.94631  ? 328  GLU B CG    1 
ATOM   7553 C  CD    . GLU D 4  340 ? 15.62396 46.53075  -21.00196 1.000 60.85171  ? 328  GLU B CD    1 
ATOM   7554 O  OE1   . GLU D 4  340 ? 16.37729 47.47671  -21.32796 1.000 62.62466  ? 328  GLU B OE1   1 
ATOM   7555 O  OE2   . GLU D 4  340 ? 14.58385 46.23433  -21.62331 1.000 65.71769  ? 328  GLU B OE2   1 
ATOM   7556 N  N     . ILE D 4  341 ? 19.56417 46.52860  -17.16504 1.000 34.64572  ? 329  ILE B N     1 
ATOM   7557 C  CA    . ILE D 4  341 ? 20.61028 47.38050  -16.61918 1.000 36.43928  ? 329  ILE B CA    1 
ATOM   7558 C  C     . ILE D 4  341 ? 21.29901 48.11225  -17.76170 1.000 35.84127  ? 329  ILE B C     1 
ATOM   7559 O  O     . ILE D 4  341 ? 21.54307 47.53025  -18.82472 1.000 39.78228  ? 329  ILE B O     1 
ATOM   7560 C  CB    . ILE D 4  341 ? 21.63660 46.57193  -15.80022 1.000 32.60561  ? 329  ILE B CB    1 
ATOM   7561 C  CG1   . ILE D 4  341 ? 20.92718 45.69587  -14.76294 1.000 35.43733  ? 329  ILE B CG1   1 
ATOM   7562 C  CG2   . ILE D 4  341 ? 22.62997 47.50852  -15.12336 1.000 22.50900  ? 329  ILE B CG2   1 
ATOM   7563 C  CD1   . ILE D 4  341 ? 21.90190 44.90042  -13.87619 1.000 33.62075  ? 329  ILE B CD1   1 
ATOM   7564 N  N     . GLN D 4  342 ? 21.62296 49.38266  -17.52925 1.000 33.70557  ? 330  GLN B N     1 
ATOM   7565 C  CA    . GLN D 4  342 ? 22.43605 50.19093  -18.42854 1.000 34.98756  ? 330  GLN B CA    1 
ATOM   7566 C  C     . GLN D 4  342 ? 23.64939 50.74712  -17.69386 1.000 41.42260  ? 330  GLN B C     1 
ATOM   7567 O  O     . GLN D 4  342 ? 23.52995 51.26757  -16.57065 1.000 43.49703  ? 330  GLN B O     1 
ATOM   7568 C  CB    . GLN D 4  342 ? 21.64446 51.36568  -19.01200 1.000 35.60953  ? 330  GLN B CB    1 
ATOM   7569 C  CG    . GLN D 4  342 ? 20.36100 51.00336  -19.72108 1.000 38.74150  ? 330  GLN B CG    1 
ATOM   7570 C  CD    . GLN D 4  342 ? 19.18911 50.89302  -18.77610 1.000 42.09944  ? 330  GLN B CD    1 
ATOM   7571 O  OE1   . GLN D 4  342 ? 19.09155 51.62897  -17.79004 1.000 44.27956  ? 330  GLN B OE1   1 
ATOM   7572 N  NE2   . GLN D 4  342 ? 18.29099 49.96142  -19.06606 1.000 42.76227  ? 330  GLN B NE2   1 
ATOM   7573 N  N     . LYS D 4  343 ? 24.81006 50.66199  -18.35109 1.000 42.51307  ? 331  LYS B N     1 
ATOM   7574 C  CA    . LYS D 4  343 ? 26.03516 51.29803  -17.87020 1.000 43.44580  ? 331  LYS B CA    1 
ATOM   7575 C  C     . LYS D 4  343 ? 26.01259 52.76875  -18.26256 1.000 48.39939  ? 331  LYS B C     1 
ATOM   7576 O  O     . LYS D 4  343 ? 26.11374 53.09830  -19.44741 1.000 56.56865  ? 331  LYS B O     1 
ATOM   7577 C  CB    . LYS D 4  343 ? 27.25926 50.60200  -18.45696 1.000 40.65371  ? 331  LYS B CB    1 
ATOM   7578 C  CG    . LYS D 4  343 ? 28.55677 51.39644  -18.36649 1.000 39.26853  ? 331  LYS B CG    1 
ATOM   7579 C  CD    . LYS D 4  343 ? 29.72380 50.57023  -18.86310 1.000 37.97496  ? 331  LYS B CD    1 
ATOM   7580 C  CE    . LYS D 4  343 ? 30.98508 51.40407  -19.00645 1.000 43.79392  ? 331  LYS B CE    1 
ATOM   7581 N  NZ    . LYS D 4  343 ? 32.03325 50.72312  -19.84470 1.000 45.10517  ? 331  LYS B NZ    1 
ATOM   7582 N  N     . GLN D 4  344 ? 25.86132 53.66407  -17.28987 1.000 47.26785  ? 332  GLN B N     1 
ATOM   7583 C  CA    . GLN D 4  344 ? 25.93814 55.08293  -17.60318 1.000 49.73525  ? 332  GLN B CA    1 
ATOM   7584 C  C     . GLN D 4  344 ? 27.36276 55.61625  -17.58737 1.000 55.04273  ? 332  GLN B C     1 
ATOM   7585 O  O     . GLN D 4  344 ? 27.58158 56.75107  -18.01898 1.000 57.75357  ? 332  GLN B O     1 
ATOM   7586 C  CB    . GLN D 4  344 ? 25.08859 55.89090  -16.62442 1.000 48.82505  ? 332  GLN B CB    1 
ATOM   7587 C  CG    . GLN D 4  344 ? 23.62785 55.47206  -16.58495 1.000 49.64054  ? 332  GLN B CG    1 
ATOM   7588 C  CD    . GLN D 4  344 ? 22.89180 55.71963  -17.89374 1.000 50.69371  ? 332  GLN B CD    1 
ATOM   7589 O  OE1   . GLN D 4  344 ? 23.35729 56.47188  -18.75126 1.000 54.38671  ? 332  GLN B OE1   1 
ATOM   7590 N  NE2   . GLN D 4  344 ? 21.72795 55.08139  -18.04994 1.000 47.16491  ? 332  GLN B NE2   1 
ATOM   7591 N  N     . GLY D 4  345 ? 28.32477 54.83110  -17.10660 1.000 56.73944  ? 333  GLY B N     1 
ATOM   7592 C  CA    . GLY D 4  345 ? 29.70765 55.24853  -17.00615 1.000 55.45873  ? 333  GLY B CA    1 
ATOM   7593 C  C     . GLY D 4  345 ? 30.02073 55.92912  -15.68275 1.000 59.21772  ? 333  GLY B C     1 
ATOM   7594 O  O     . GLY D 4  345 ? 29.13830 56.37031  -14.94821 1.000 58.72590  ? 333  GLY B O     1 
ATOM   7595 N  N     . GLN D 4  346 ? 31.32190 56.01037  -15.38359 1.000 62.25402  ? 334  GLN B N     1 
ATOM   7596 C  CA    . GLN D 4  346 ? 31.82374 56.67547  -14.17713 1.000 62.25742  ? 334  GLN B CA    1 
ATOM   7597 C  C     . GLN D 4  346 ? 31.21305 56.06640  -12.91211 1.000 60.83284  ? 334  GLN B C     1 
ATOM   7598 O  O     . GLN D 4  346 ? 30.78146 56.77515  -11.99534 1.000 60.74142  ? 334  GLN B O     1 
ATOM   7599 C  CB    . GLN D 4  346 ? 31.57355 58.18539  -14.23930 1.000 64.69910  ? 334  GLN B CB    1 
ATOM   7600 N  N     . GLY D 4  347 ? 31.17613 54.72984  -12.87376 1.000 56.53616  ? 335  GLY B N     1 
ATOM   7601 C  CA    . GLY D 4  347 ? 30.62086 53.98783  -11.75841 1.000 52.09444  ? 335  GLY B CA    1 
ATOM   7602 C  C     . GLY D 4  347 ? 29.11128 54.01442  -11.63083 1.000 52.48575  ? 335  GLY B C     1 
ATOM   7603 O  O     . GLY D 4  347 ? 28.58659 53.53736  -10.62013 1.000 47.54627  ? 335  GLY B O     1 
ATOM   7604 N  N     . GLN D 4  348 ? 28.39443 54.53982  -12.62606 1.000 56.28527  ? 336  GLN B N     1 
ATOM   7605 C  CA    . GLN D 4  348 ? 26.95057 54.73992  -12.55343 1.000 59.86611  ? 336  GLN B CA    1 
ATOM   7606 C  C     . GLN D 4  348 ? 26.22013 53.69297  -13.38026 1.000 54.87665  ? 336  GLN B C     1 
ATOM   7607 O  O     . GLN D 4  348 ? 26.62848 53.36688  -14.50016 1.000 56.35254  ? 336  GLN B O     1 
ATOM   7608 C  CB    . GLN D 4  348 ? 26.55887 56.13015  -13.05693 1.000 69.23277  ? 336  GLN B CB    1 
ATOM   7609 C  CG    . GLN D 4  348 ? 27.35000 57.25609  -12.44648 1.000 79.03504  ? 336  GLN B CG    1 
ATOM   7610 C  CD    . GLN D 4  348 ? 27.16295 57.32784  -10.95773 1.000 85.24417  ? 336  GLN B CD    1 
ATOM   7611 O  OE1   . GLN D 4  348 ? 26.03453 57.44700  -10.47632 1.000 87.67713  ? 336  GLN B OE1   1 
ATOM   7612 N  NE2   . GLN D 4  348 ? 28.26618 57.23870  -10.20971 1.000 86.21623  ? 336  GLN B NE2   1 
ATOM   7613 N  N     . TRP D 4  349 ? 25.11501 53.19757  -12.83707 1.000 50.44753  ? 337  TRP B N     1 
ATOM   7614 C  CA    . TRP D 4  349 ? 24.33235 52.15146  -13.47137 1.000 44.01048  ? 337  TRP B CA    1 
ATOM   7615 C  C     . TRP D 4  349 ? 22.86901 52.44702  -13.20351 1.000 43.62943  ? 337  TRP B C     1 
ATOM   7616 O  O     . TRP D 4  349 ? 22.50551 52.82347  -12.08855 1.000 47.02041  ? 337  TRP B O     1 
ATOM   7617 C  CB    . TRP D 4  349 ? 24.70598 50.76152  -12.92727 1.000 35.88684  ? 337  TRP B CB    1 
ATOM   7618 C  CG    . TRP D 4  349 ? 26.17408 50.45671  -13.01900 1.000 35.73810  ? 337  TRP B CG    1 
ATOM   7619 C  CD1   . TRP D 4  349 ? 27.16029 50.91834  -12.19376 1.000 39.21647  ? 337  TRP B CD1   1 
ATOM   7620 C  CD2   . TRP D 4  349 ? 26.82185 49.63521  -13.99486 1.000 35.42773  ? 337  TRP B CD2   1 
ATOM   7621 N  NE1   . TRP D 4  349 ? 28.37796 50.43519  -12.59462 1.000 40.87083  ? 337  TRP B NE1   1 
ATOM   7622 C  CE2   . TRP D 4  349 ? 28.19751 49.63528  -13.69219 1.000 37.21518  ? 337  TRP B CE2   1 
ATOM   7623 C  CE3   . TRP D 4  349 ? 26.37103 48.89045  -15.09153 1.000 35.42238  ? 337  TRP B CE3   1 
ATOM   7624 C  CZ2   . TRP D 4  349 ? 29.12761 48.92711  -14.44821 1.000 34.93924  ? 337  TRP B CZ2   1 
ATOM   7625 C  CZ3   . TRP D 4  349 ? 27.29223 48.18552  -15.83582 1.000 31.19523  ? 337  TRP B CZ3   1 
ATOM   7626 C  CH2   . TRP D 4  349 ? 28.65406 48.21356  -15.51575 1.000 34.11936  ? 337  TRP B CH2   1 
ATOM   7627 N  N     . THR D 4  350 ? 22.03824 52.30317  -14.22419 1.000 36.75122  ? 338  THR B N     1 
ATOM   7628 C  CA    . THR D 4  350 ? 20.60449 52.48492  -14.06781 1.000 31.51436  ? 338  THR B CA    1 
ATOM   7629 C  C     . THR D 4  350 ? 19.89627 51.16307  -14.33159 1.000 36.75295  ? 338  THR B C     1 
ATOM   7630 O  O     . THR D 4  350 ? 20.40541 50.30026  -15.06788 1.000 36.27655  ? 338  THR B O     1 
ATOM   7631 C  CB    . THR D 4  350 ? 20.09049 53.54521  -15.01967 1.000 32.42364  ? 338  THR B CB    1 
ATOM   7632 O  OG1   . THR D 4  350 ? 20.45391 53.19691  -16.36072 1.000 32.61061  ? 338  THR B OG1   1 
ATOM   7633 C  CG2   . THR D 4  350 ? 20.70237 54.89354  -14.67662 1.000 35.76711  ? 338  THR B CG2   1 
ATOM   7634 N  N     . TYR D 4  351 ? 18.71621 50.99317  -13.73819 1.000 31.50388  ? 339  TYR B N     1 
ATOM   7635 C  CA    . TYR D 4  351 ? 18.01109 49.74829  -13.99542 1.000 31.55339  ? 339  TYR B CA    1 
ATOM   7636 C  C     . TYR D 4  351 ? 16.50597 49.96799  -13.96724 1.000 31.75176  ? 339  TYR B C     1 
ATOM   7637 O  O     . TYR D 4  351 ? 15.99994 50.87941  -13.31071 1.000 30.42367  ? 339  TYR B O     1 
ATOM   7638 C  CB    . TYR D 4  351 ? 18.42899 48.65363  -12.99589 1.000 30.67349  ? 339  TYR B CB    1 
ATOM   7639 C  CG    . TYR D 4  351 ? 17.96264 48.91020  -11.57634 1.000 34.67778  ? 339  TYR B CG    1 
ATOM   7640 C  CD1   . TYR D 4  351 ? 16.76917 48.36257  -11.11275 1.000 36.98018  ? 339  TYR B CD1   1 
ATOM   7641 C  CD2   . TYR D 4  351 ? 18.70765 49.70435  -10.70222 1.000 35.20235  ? 339  TYR B CD2   1 
ATOM   7642 C  CE1   . TYR D 4  351 ? 16.32227 48.59511  -9.82180  1.000 41.54672  ? 339  TYR B CE1   1 
ATOM   7643 C  CE2   . TYR D 4  351 ? 18.27760 49.93551  -9.40532  1.000 41.77818  ? 339  TYR B CE2   1 
ATOM   7644 C  CZ    . TYR D 4  351 ? 17.07476 49.37649  -8.97242  1.000 45.40306  ? 339  TYR B CZ    1 
ATOM   7645 O  OH    . TYR D 4  351 ? 16.61417 49.58575  -7.69223  1.000 49.02418  ? 339  TYR B OH    1 
ATOM   7646 N  N     . GLN D 4  352 ? 15.79819 49.10060  -14.68670 1.000 35.48258  ? 340  GLN B N     1 
ATOM   7647 C  CA    . GLN D 4  352 ? 14.34323 49.08185  -14.68605 1.000 35.73192  ? 340  GLN B CA    1 
ATOM   7648 C  C     . GLN D 4  352 ? 13.84798 47.65444  -14.49852 1.000 41.06120  ? 340  GLN B C     1 
ATOM   7649 O  O     . GLN D 4  352 ? 14.34099 46.72175  -15.14108 1.000 48.49886  ? 340  GLN B O     1 
ATOM   7650 C  CB    . GLN D 4  352 ? 13.76257 49.66428  -15.98148 1.000 30.87472  ? 340  GLN B CB    1 
ATOM   7651 C  CG    . GLN D 4  352 ? 14.26817 51.05229  -16.31456 1.000 29.40062  ? 340  GLN B CG    1 
ATOM   7652 C  CD    . GLN D 4  352 ? 15.63200 51.00925  -16.94457 1.000 31.04419  ? 340  GLN B CD    1 
ATOM   7653 O  OE1   . GLN D 4  352 ? 15.85865 50.24441  -17.87590 1.000 40.57079  ? 340  GLN B OE1   1 
ATOM   7654 N  NE2   . GLN D 4  352 ? 16.56099 51.79496  -16.42213 1.000 28.64350  ? 340  GLN B NE2   1 
ATOM   7655 N  N     . ILE D 4  353 ? 12.86664 47.49243  -13.62085 1.000 38.76461  ? 341  ILE B N     1 
ATOM   7656 C  CA    . ILE D 4  353 ? 12.17379 46.22933  -13.41868 1.000 40.09464  ? 341  ILE B CA    1 
ATOM   7657 C  C     . ILE D 4  353 ? 10.75589 46.38751  -13.95121 1.000 42.70757  ? 341  ILE B C     1 
ATOM   7658 O  O     . ILE D 4  353 ? 10.00117 47.25335  -13.47806 1.000 49.46789  ? 341  ILE B O     1 
ATOM   7659 C  CB    . ILE D 4  353 ? 12.15386 45.82388  -11.93902 1.000 37.91609  ? 341  ILE B CB    1 
ATOM   7660 C  CG1   . ILE D 4  353 ? 13.57819 45.61190  -11.41236 1.000 38.88797  ? 341  ILE B CG1   1 
ATOM   7661 C  CG2   . ILE D 4  353 ? 11.26554 44.60059  -11.74384 1.000 35.13982  ? 341  ILE B CG2   1 
ATOM   7662 C  CD1   . ILE D 4  353 ? 13.63346 45.48615  -9.87837  1.000 42.77216  ? 341  ILE B CD1   1 
ATOM   7663 N  N     . TYR D 4  354 ? 10.39686 45.53777  -14.91596 1.000 38.50626  ? 342  TYR B N     1 
ATOM   7664 C  CA    . TYR D 4  354 ? 9.08266  45.54636  -15.54258 1.000 41.08572  ? 342  TYR B CA    1 
ATOM   7665 C  C     . TYR D 4  354 ? 8.67063  44.11285  -15.87141 1.000 48.95084  ? 342  TYR B C     1 
ATOM   7666 O  O     . TYR D 4  354 ? 9.42772  43.16047  -15.66780 1.000 54.05774  ? 342  TYR B O     1 
ATOM   7667 C  CB    . TYR D 4  354 ? 9.07965  46.39891  -16.80998 1.000 36.81398  ? 342  TYR B CB    1 
ATOM   7668 C  CG    . TYR D 4  354 ? 10.00516 45.88429  -17.90023 1.000 36.73147  ? 342  TYR B CG    1 
ATOM   7669 C  CD1   . TYR D 4  354 ? 9.53855  45.03479  -18.89527 1.000 38.31797  ? 342  TYR B CD1   1 
ATOM   7670 C  CD2   . TYR D 4  354 ? 11.34422 46.26067  -17.93825 1.000 35.10336  ? 342  TYR B CD2   1 
ATOM   7671 C  CE1   . TYR D 4  354 ? 10.38196 44.56527  -19.89355 1.000 38.92466  ? 342  TYR B CE1   1 
ATOM   7672 C  CE2   . TYR D 4  354 ? 12.19096 45.80231  -18.92988 1.000 39.46870  ? 342  TYR B CE2   1 
ATOM   7673 C  CZ    . TYR D 4  354 ? 11.70855 44.95106  -19.90821 1.000 41.92583  ? 342  TYR B CZ    1 
ATOM   7674 O  OH    . TYR D 4  354 ? 12.55726 44.48158  -20.89814 1.000 43.59131  ? 342  TYR B OH    1 
ATOM   7675 N  N     . GLN D 4  355 ? 7.44753  43.95518  -16.37746 1.000 46.30679  ? 343  GLN B N     1 
ATOM   7676 C  CA    . GLN D 4  355 ? 6.97147  42.65524  -16.84020 1.000 43.03421  ? 343  GLN B CA    1 
ATOM   7677 C  C     . GLN D 4  355 ? 6.44285  42.76769  -18.26170 1.000 47.94633  ? 343  GLN B C     1 
ATOM   7678 O  O     . GLN D 4  355 ? 6.48320  41.80346  -19.02720 1.000 48.09253  ? 343  GLN B O     1 
ATOM   7679 C  CB    . GLN D 4  355 ? 5.88508  42.10867  -15.91737 1.000 34.71275  ? 343  GLN B CB    1 
ATOM   7680 C  CG    . GLN D 4  355 ? 6.40073  41.63165  -14.59235 1.000 34.79663  ? 343  GLN B CG    1 
ATOM   7681 C  CD    . GLN D 4  355 ? 5.30109  41.03027  -13.74634 1.000 46.91465  ? 343  GLN B CD    1 
ATOM   7682 O  OE1   . GLN D 4  355 ? 5.32173  39.83559  -13.43563 1.000 51.23820  ? 343  GLN B OE1   1 
ATOM   7683 N  NE2   . GLN D 4  355 ? 4.32661  41.85182  -13.37542 1.000 48.08986  ? 343  GLN B NE2   1 
ATOM   7684 N  N     . GLU D 4  356 ? 5.92175  43.93910  -18.60382 1.000 52.67451  ? 344  GLU B N     1 
ATOM   7685 C  CA    . GLU D 4  356 ? 5.53181  44.34149  -19.93446 1.000 59.39751  ? 344  GLU B CA    1 
ATOM   7686 C  C     . GLU D 4  356 ? 6.31602  45.58559  -20.31460 1.000 59.92563  ? 344  GLU B C     1 
ATOM   7687 O  O     . GLU D 4  356 ? 6.51822  46.46373  -19.46954 1.000 59.05391  ? 344  GLU B O     1 
ATOM   7688 C  CB    . GLU D 4  356 ? 4.03130  44.65421  -20.01388 1.000 69.17833  ? 344  GLU B CB    1 
ATOM   7689 C  CG    . GLU D 4  356 ? 3.13224  43.50543  -19.64306 1.000 80.05775  ? 344  GLU B CG    1 
ATOM   7690 C  CD    . GLU D 4  356 ? 3.22755  42.36899  -20.63251 1.000 89.87041  ? 344  GLU B CD    1 
ATOM   7691 O  OE1   . GLU D 4  356 ? 3.42615  42.65013  -21.83538 1.000 94.39781  ? 344  GLU B OE1   1 
ATOM   7692 O  OE2   . GLU D 4  356 ? 3.11183  41.19790  -20.20840 1.000 92.62650  ? 344  GLU B OE2   1 
ATOM   7693 N  N     . PRO D 4  357 ? 6.75859  45.69737  -21.56186 1.000 62.83719  ? 345  PRO B N     1 
ATOM   7694 C  CA    . PRO D 4  357 ? 7.52608  46.88061  -21.97578 1.000 62.55077  ? 345  PRO B CA    1 
ATOM   7695 C  C     . PRO D 4  357 ? 6.80671  48.19307  -21.66209 1.000 57.50221  ? 345  PRO B C     1 
ATOM   7696 O  O     . PRO D 4  357 ? 5.63428  48.38589  -22.00637 1.000 49.80842  ? 345  PRO B O     1 
ATOM   7697 C  CB    . PRO D 4  357 ? 7.69076  46.67340  -23.48621 1.000 66.63046  ? 345  PRO B CB    1 
ATOM   7698 C  CG    . PRO D 4  357 ? 6.56588  45.73369  -23.86457 1.000 68.97328  ? 345  PRO B CG    1 
ATOM   7699 C  CD    . PRO D 4  357 ? 6.45481  44.80998  -22.69496 1.000 66.32408  ? 345  PRO B CD    1 
ATOM   7700 N  N     . PHE D 4  358 ? 7.53118  49.09687  -20.99689 1.000 56.56227  ? 346  PHE B N     1 
ATOM   7701 C  CA    . PHE D 4  358 ? 7.15570  50.46169  -20.62394 1.000 53.71743  ? 346  PHE B CA    1 
ATOM   7702 C  C     . PHE D 4  358 ? 6.23537  50.47415  -19.41662 1.000 49.40610  ? 346  PHE B C     1 
ATOM   7703 O  O     . PHE D 4  358 ? 5.81356  51.56999  -18.98303 1.000 50.65835  ? 346  PHE B O     1 
ATOM   7704 C  CB    . PHE D 4  358 ? 6.49520  51.24993  -21.77006 1.000 53.44404  ? 346  PHE B CB    1 
ATOM   7705 C  CG    . PHE D 4  358 ? 7.26853  51.19837  -23.05784 1.000 51.13334  ? 346  PHE B CG    1 
ATOM   7706 C  CD1   . PHE D 4  358 ? 8.56010  51.70020  -23.12615 1.000 51.50751  ? 346  PHE B CD1   1 
ATOM   7707 C  CD2   . PHE D 4  358 ? 6.71058  50.64444  -24.19608 1.000 51.24032  ? 346  PHE B CD2   1 
ATOM   7708 C  CE1   . PHE D 4  358 ? 9.28260  51.65381  -24.30659 1.000 51.51428  ? 346  PHE B CE1   1 
ATOM   7709 C  CE2   . PHE D 4  358 ? 7.42522  50.59265  -25.38092 1.000 52.69014  ? 346  PHE B CE2   1 
ATOM   7710 C  CZ    . PHE D 4  358 ? 8.71340  51.10021  -25.43514 1.000 52.27056  ? 346  PHE B CZ    1 
ATOM   7711 N  N     . LYS D 4  359 ? 5.87888  49.31216  -18.87639 1.000 45.33845  ? 347  LYS B N     1 
ATOM   7712 C  CA    . LYS D 4  359 ? 5.08798  49.23043  -17.65102 1.000 46.04654  ? 347  LYS B CA    1 
ATOM   7713 C  C     . LYS D 4  359 ? 6.01132  48.90166  -16.48017 1.000 45.37851  ? 347  LYS B C     1 
ATOM   7714 O  O     . LYS D 4  359 ? 5.94162  47.83669  -15.86153 1.000 48.53748  ? 347  LYS B O     1 
ATOM   7715 C  CB    . LYS D 4  359 ? 3.96735  48.20416  -17.80912 1.000 45.48353  ? 347  LYS B CB    1 
ATOM   7716 N  N     . ASN D 4  360 ? 6.90538  49.84205  -16.19228 1.000 42.22464  ? 348  ASN B N     1 
ATOM   7717 C  CA    . ASN D 4  360 ? 7.92744  49.59283  -15.18706 1.000 40.85138  ? 348  ASN B CA    1 
ATOM   7718 C  C     . ASN D 4  360 ? 7.30246  49.48851  -13.80657 1.000 43.52445  ? 348  ASN B C     1 
ATOM   7719 O  O     . ASN D 4  360 ? 6.44593  50.29306  -13.43273 1.000 45.60343  ? 348  ASN B O     1 
ATOM   7720 C  CB    . ASN D 4  360 ? 8.98560  50.68744  -15.20592 1.000 37.77069  ? 348  ASN B CB    1 
ATOM   7721 C  CG    . ASN D 4  360 ? 9.77220  50.69946  -16.49526 1.000 41.74754  ? 348  ASN B CG    1 
ATOM   7722 O  OD1   . ASN D 4  360 ? 10.05970 49.63926  -17.06812 1.000 38.79118  ? 348  ASN B OD1   1 
ATOM   7723 N  ND2   . ASN D 4  360 ? 10.11519 51.90073  -16.97569 1.000 40.48246  ? 348  ASN B ND2   1 
ATOM   7724 N  N     . LEU D 4  361 ? 7.70876  48.46239  -13.06789 1.000 43.85896  ? 349  LEU B N     1 
ATOM   7725 C  CA    . LEU D 4  361 ? 7.32474  48.34790  -11.67091 1.000 46.17350  ? 349  LEU B CA    1 
ATOM   7726 C  C     . LEU D 4  361 ? 8.27518  49.13426  -10.79454 1.000 44.86136  ? 349  LEU B C     1 
ATOM   7727 O  O     . LEU D 4  361 ? 7.87561  49.62304  -9.73108  1.000 44.44152  ? 349  LEU B O     1 
ATOM   7728 C  CB    . LEU D 4  361 ? 7.30316  46.87693  -11.24309 1.000 43.25107  ? 349  LEU B CB    1 
ATOM   7729 C  CG    . LEU D 4  361 ? 6.26223  46.02097  -11.96062 1.000 43.79056  ? 349  LEU B CG    1 
ATOM   7730 C  CD1   . LEU D 4  361 ? 6.73083  44.59411  -12.07396 1.000 43.20489  ? 349  LEU B CD1   1 
ATOM   7731 C  CD2   . LEU D 4  361 ? 4.94786  46.08069  -11.22381 1.000 49.35934  ? 349  LEU B CD2   1 
ATOM   7732 N  N     . LYS D 4  362 ? 9.53006  49.25231  -11.22167 1.000 42.97597  ? 350  LYS B N     1 
ATOM   7733 C  CA    . LYS D 4  362 ? 10.48638 50.05837  -10.47917 1.000 47.14375  ? 350  LYS B CA    1 
ATOM   7734 C  C     . LYS D 4  362 ? 11.56904 50.54192  -11.42358 1.000 44.14845  ? 350  LYS B C     1 
ATOM   7735 O  O     . LYS D 4  362 ? 11.88230 49.88976  -12.41997 1.000 47.25637  ? 350  LYS B O     1 
ATOM   7736 C  CB    . LYS D 4  362 ? 11.13202 49.29027  -9.31478  1.000 55.30809  ? 350  LYS B CB    1 
ATOM   7737 C  CG    . LYS D 4  362 ? 11.97896 50.17018  -8.37381  1.000 60.91816  ? 350  LYS B CG    1 
ATOM   7738 C  CD    . LYS D 4  362 ? 12.49602 49.37816  -7.18233  1.000 68.42547  ? 350  LYS B CD    1 
ATOM   7739 C  CE    . LYS D 4  362 ? 13.11975 50.28309  -6.12417  1.000 73.48496  ? 350  LYS B CE    1 
ATOM   7740 N  NZ    . LYS D 4  362 ? 14.28351 51.05412  -6.64681  1.000 72.53012  ? 350  LYS B NZ    1 
ATOM   7741 N  N     . THR D 4  363 ? 12.12679 51.69773  -11.10494 1.000 39.76056  ? 351  THR B N     1 
ATOM   7742 C  CA    . THR D 4  363 ? 13.31141 52.20452  -11.77101 1.000 42.82433  ? 351  THR B CA    1 
ATOM   7743 C  C     . THR D 4  363 ? 14.27311 52.69566  -10.70279 1.000 46.57634  ? 351  THR B C     1 
ATOM   7744 O  O     . THR D 4  363 ? 13.86255 53.35588  -9.74471  1.000 48.28882  ? 351  THR B O     1 
ATOM   7745 C  CB    . THR D 4  363 ? 12.98522 53.35291  -12.74323 1.000 40.66946  ? 351  THR B CB    1 
ATOM   7746 O  OG1   . THR D 4  363 ? 12.59617 54.50344  -11.99309 1.000 45.46139  ? 351  THR B OG1   1 
ATOM   7747 C  CG2   . THR D 4  363 ? 11.86276 52.97649  -13.70262 1.000 34.16517  ? 351  THR B CG2   1 
ATOM   7748 N  N     . GLY D 4  364 ? 15.54864 52.37714  -10.86361 1.000 43.97834  ? 352  GLY B N     1 
ATOM   7749 C  CA    . GLY D 4  364 ? 16.51154 52.81431  -9.87849  1.000 41.29221  ? 352  GLY B CA    1 
ATOM   7750 C  C     . GLY D 4  364 ? 17.88871 53.04057  -10.45102 1.000 43.62623  ? 352  GLY B C     1 
ATOM   7751 O  O     . GLY D 4  364 ? 18.09350 52.98761  -11.66669 1.000 41.41552  ? 352  GLY B O     1 
ATOM   7752 N  N     . LYS D 4  365 ? 18.84830 53.28573  -9.56796  1.000 54.62871  ? 353  LYS B N     1 
ATOM   7753 C  CA    . LYS D 4  365 ? 20.24096 53.42136  -9.95566  1.000 57.25613  ? 353  LYS B CA    1 
ATOM   7754 C  C     . LYS D 4  365 ? 21.11477 52.77897  -8.89086  1.000 55.88580  ? 353  LYS B C     1 
ATOM   7755 O  O     . LYS D 4  365 ? 20.75574 52.72852  -7.71284  1.000 61.52697  ? 353  LYS B O     1 
ATOM   7756 C  CB    . LYS D 4  365 ? 20.64509 54.90148  -10.16642 1.000 60.79725  ? 353  LYS B CB    1 
ATOM   7757 C  CG    . LYS D 4  365 ? 20.83664 55.69895  -8.89949  1.000 65.93011  ? 353  LYS B CG    1 
ATOM   7758 C  CD    . LYS D 4  365 ? 21.42015 57.07700  -9.19653  1.000 73.53739  ? 353  LYS B CD    1 
ATOM   7759 C  CE    . LYS D 4  365 ? 21.77565 57.82763  -7.91086  1.000 81.37423  ? 353  LYS B CE    1 
ATOM   7760 N  NZ    . LYS D 4  365 ? 22.51637 59.11092  -8.15231  1.000 84.93231  ? 353  LYS B NZ    1 
ATOM   7761 N  N     . TYR D 4  366 ? 22.25900 52.27588  -9.33183  1.000 52.96823  ? 354  TYR B N     1 
ATOM   7762 C  CA    . TYR D 4  366 ? 23.34035 51.82280  -8.46863  1.000 58.40024  ? 354  TYR B CA    1 
ATOM   7763 C  C     . TYR D 4  366 ? 24.56073 52.65099  -8.84547  1.000 58.59188  ? 354  TYR B C     1 
ATOM   7764 O  O     . TYR D 4  366 ? 24.96480 52.66339  -10.01185 1.000 58.10803  ? 354  TYR B O     1 
ATOM   7765 C  CB    . TYR D 4  366 ? 23.58396 50.31262  -8.64225  1.000 59.17212  ? 354  TYR B CB    1 
ATOM   7766 C  CG    . TYR D 4  366 ? 24.75921 49.74988  -7.86657  1.000 64.81786  ? 354  TYR B CG    1 
ATOM   7767 C  CD1   . TYR D 4  366 ? 24.69569 49.57448  -6.48248  1.000 67.70078  ? 354  TYR B CD1   1 
ATOM   7768 C  CD2   . TYR D 4  366 ? 25.93186 49.37645  -8.52082  1.000 63.85133  ? 354  TYR B CD2   1 
ATOM   7769 C  CE1   . TYR D 4  366 ? 25.77855 49.05798  -5.77251  1.000 67.16342  ? 354  TYR B CE1   1 
ATOM   7770 C  CE2   . TYR D 4  366 ? 27.01713 48.86321  -7.81998  1.000 63.60418  ? 354  TYR B CE2   1 
ATOM   7771 C  CZ    . TYR D 4  366 ? 26.93527 48.70557  -6.45076  1.000 67.30387  ? 354  TYR B CZ    1 
ATOM   7772 O  OH    . TYR D 4  366 ? 28.01449 48.19311  -5.76671  1.000 70.93599  ? 354  TYR B OH    1 
ATOM   7773 N  N     . ALA D 4  367 ? 25.13411 53.35660  -7.87158  1.000 61.69327  ? 355  ALA B N     1 
ATOM   7774 C  CA    . ALA D 4  367 ? 26.15079 54.38025  -8.13247  1.000 67.57739  ? 355  ALA B CA    1 
ATOM   7775 C  C     . ALA D 4  367 ? 27.39599 54.14342  -7.28280  1.000 77.32913  ? 355  ALA B C     1 
ATOM   7776 O  O     . ALA D 4  367 ? 27.50470 54.69921  -6.18713  1.000 85.98059  ? 355  ALA B O     1 
ATOM   7777 C  CB    . ALA D 4  367 ? 25.57700 55.76614  -7.86891  1.000 67.66916  ? 355  ALA B CB    1 
ATOM   7778 N  N     . ARG D 4  368 ? 28.34548 53.35936  -7.79556  1.000 77.12428  ? 356  ARG B N     1 
ATOM   7779 C  CA    . ARG D 4  368 ? 29.64380 53.24082  -7.14302  1.000 81.09514  ? 356  ARG B CA    1 
ATOM   7780 C  C     . ARG D 4  368 ? 30.39922 54.57934  -7.22549  1.000 86.83804  ? 356  ARG B C     1 
ATOM   7781 O  O     . ARG D 4  368 ? 29.91233 55.57269  -7.78036  1.000 85.80931  ? 356  ARG B O     1 
ATOM   7782 C  CB    . ARG D 4  368 ? 30.43899 52.09570  -7.76289  1.000 77.38821  ? 356  ARG B CB    1 
ATOM   7783 N  N     . MET D 4  369 ? 31.60330 54.62071  -6.65285  1.000 91.49198  ? 357  MET B N     1 
ATOM   7784 C  CA    . MET D 4  369 ? 32.34074 55.87406  -6.54829  1.000 96.00814  ? 357  MET B CA    1 
ATOM   7785 C  C     . MET D 4  369 ? 33.28521 56.05928  -7.73692  1.000 97.13232  ? 357  MET B C     1 
ATOM   7786 O  O     . MET D 4  369 ? 33.24108 55.31526  -8.71746  1.000 95.63949  ? 357  MET B O     1 
ATOM   7787 C  CB    . MET D 4  369 ? 33.10091 55.93772  -5.22790  1.000 99.78156  ? 357  MET B CB    1 
ATOM   7788 N  N     . ARG D 4  370 ? 34.17549 57.05084  -7.62160  1.000 104.13752 ? 358  ARG B N     1 
ATOM   7789 C  CA    . ARG D 4  370 ? 34.99651 57.56441  -8.71646  1.000 108.98337 ? 358  ARG B CA    1 
ATOM   7790 C  C     . ARG D 4  370 ? 35.57079 56.47412  -9.61347  1.000 112.43547 ? 358  ARG B C     1 
ATOM   7791 O  O     . ARG D 4  370 ? 35.34706 56.47597  -10.82843 1.000 114.79971 ? 358  ARG B O     1 
ATOM   7792 C  CB    . ARG D 4  370 ? 36.13053 58.42075  -8.14315  1.000 112.55981 ? 358  ARG B CB    1 
ATOM   7793 N  N     . GLY D 4  371 ? 36.31569 55.53460  -9.03698  1.000 113.27427 ? 359  GLY B N     1 
ATOM   7794 C  CA    . GLY D 4  371 ? 36.84002 54.43792  -9.82812  1.000 111.54015 ? 359  GLY B CA    1 
ATOM   7795 C  C     . GLY D 4  371 ? 38.26061 54.61393  -10.32481 1.000 113.34141 ? 359  GLY B C     1 
ATOM   7796 O  O     . GLY D 4  371 ? 38.51279 54.54865  -11.53146 1.000 111.59675 ? 359  GLY B O     1 
ATOM   7797 N  N     . ALA D 4  372 ? 39.19599 54.87187  -9.40797  1.000 115.80953 ? 360  ALA B N     1 
ATOM   7798 C  CA    . ALA D 4  372 ? 40.60972 54.85042  -9.77311  1.000 115.49714 ? 360  ALA B CA    1 
ATOM   7799 C  C     . ALA D 4  372 ? 41.00276 53.48671  -10.33424 1.000 109.44386 ? 360  ALA B C     1 
ATOM   7800 O  O     . ALA D 4  372 ? 41.68064 53.39902  -11.36374 1.000 110.70642 ? 360  ALA B O     1 
ATOM   7801 C  CB    . ALA D 4  372 ? 41.47663 55.22093  -8.56645  1.000 119.28996 ? 360  ALA B CB    1 
ATOM   7802 N  N     . HIS D 4  373 ? 40.57746 52.40331  -9.67094  1.000 102.30882 ? 361  HIS B N     1 
ATOM   7803 C  CA    . HIS D 4  373 ? 40.72415 51.04190  -10.19537 1.000 94.80592  ? 361  HIS B CA    1 
ATOM   7804 C  C     . HIS D 4  373 ? 39.34119 50.38828  -10.15975 1.000 89.13280  ? 361  HIS B C     1 
ATOM   7805 O  O     . HIS D 4  373 ? 39.02995 49.60469  -9.25858  1.000 92.38800  ? 361  HIS B O     1 
ATOM   7806 C  CB    . HIS D 4  373 ? 41.75814 50.25046  -9.38916  1.000 94.85431  ? 361  HIS B CB    1 
ATOM   7807 N  N     . THR D 4  374 ? 38.53182 50.67461  -11.17696 1.000 80.85105  ? 362  THR B N     1 
ATOM   7808 C  CA    . THR D 4  374 ? 37.14299 50.24051  -11.22868 1.000 70.71059  ? 362  THR B CA    1 
ATOM   7809 C  C     . THR D 4  374 ? 36.99901 48.99612  -12.09477 1.000 62.71414  ? 362  THR B C     1 
ATOM   7810 O  O     . THR D 4  374 ? 37.70572 48.81974  -13.09191 1.000 58.43523  ? 362  THR B O     1 
ATOM   7811 C  CB    . THR D 4  374 ? 36.23865 51.35844  -11.76832 1.000 69.62464  ? 362  THR B CB    1 
ATOM   7812 O  OG1   . THR D 4  374 ? 35.05889 50.79381  -12.35656 1.000 64.80835  ? 362  THR B OG1   1 
ATOM   7813 C  CG2   . THR D 4  374 ? 36.96638 52.18722  -12.81244 1.000 72.05242  ? 362  THR B CG2   1 
ATOM   7814 N  N     . ASN D 4  375 ? 36.05676 48.13811  -11.71043 1.000 58.96496  ? 363  ASN B N     1 
ATOM   7815 C  CA    . ASN D 4  375 ? 35.83685 46.85420  -12.37551 1.000 50.71952  ? 363  ASN B CA    1 
ATOM   7816 C  C     . ASN D 4  375 ? 34.37170 46.78281  -12.80172 1.000 46.42092  ? 363  ASN B C     1 
ATOM   7817 O  O     . ASN D 4  375 ? 33.49201 46.52531  -11.97439 1.000 48.88376  ? 363  ASN B O     1 
ATOM   7818 C  CB    . ASN D 4  375 ? 36.22122 45.70550  -11.45205 1.000 48.58110  ? 363  ASN B CB    1 
ATOM   7819 C  CG    . ASN D 4  375 ? 36.11673 44.34391  -12.12158 1.000 49.72774  ? 363  ASN B CG    1 
ATOM   7820 O  OD1   . ASN D 4  375 ? 35.28742 44.12742  -13.00796 1.000 44.73814  ? 363  ASN B OD1   1 
ATOM   7821 N  ND2   . ASN D 4  375 ? 36.95271 43.40529  -11.67653 1.000 50.45721  ? 363  ASN B ND2   1 
ATOM   7822 N  N     . ASP D 4  376 ? 34.12394 47.00223  -14.09744 1.000 39.98641  ? 364  ASP B N     1 
ATOM   7823 C  CA    . ASP D 4  376 ? 32.76461 46.98202  -14.62193 1.000 37.67122  ? 364  ASP B CA    1 
ATOM   7824 C  C     . ASP D 4  376 ? 32.04923 45.67924  -14.28398 1.000 34.30011  ? 364  ASP B C     1 
ATOM   7825 O  O     . ASP D 4  376 ? 30.87611 45.68680  -13.90370 1.000 33.60570  ? 364  ASP B O     1 
ATOM   7826 C  CB    . ASP D 4  376 ? 32.78665 47.17960  -16.14084 1.000 44.77426  ? 364  ASP B CB    1 
ATOM   7827 C  CG    . ASP D 4  376 ? 32.75955 48.63866  -16.55868 1.000 54.08553  ? 364  ASP B CG    1 
ATOM   7828 O  OD1   . ASP D 4  376 ? 32.75364 49.53723  -15.68409 1.000 59.52345  ? 364  ASP B OD1   1 
ATOM   7829 O  OD2   . ASP D 4  376 ? 32.73497 48.88259  -17.78538 1.000 54.29446  ? 364  ASP B OD2   1 
ATOM   7830 N  N     . VAL D 4  377 ? 32.72422 44.54420  -14.45503 1.000 35.27527  ? 365  VAL B N     1 
ATOM   7831 C  CA    . VAL D 4  377 ? 32.07580 43.25543  -14.21877 1.000 34.42831  ? 365  VAL B CA    1 
ATOM   7832 C  C     . VAL D 4  377 ? 31.76477 43.07458  -12.74046 1.000 36.67969  ? 365  VAL B C     1 
ATOM   7833 O  O     . VAL D 4  377 ? 30.66091 42.65751  -12.37445 1.000 35.12876  ? 365  VAL B O     1 
ATOM   7834 C  CB    . VAL D 4  377 ? 32.94472 42.10938  -14.75927 1.000 36.93493  ? 365  VAL B CB    1 
ATOM   7835 C  CG1   . VAL D 4  377 ? 32.45137 40.75341  -14.23758 1.000 35.09126  ? 365  VAL B CG1   1 
ATOM   7836 C  CG2   . VAL D 4  377 ? 32.92569 42.15243  -16.26489 1.000 40.33839  ? 365  VAL B CG2   1 
ATOM   7837 N  N     . LYS D 4  378 ? 32.72639 43.38672  -11.86598 1.000 37.07389  ? 366  LYS B N     1 
ATOM   7838 C  CA    . LYS D 4  378 ? 32.42060 43.39489  -10.44212 1.000 35.26312  ? 366  LYS B CA    1 
ATOM   7839 C  C     . LYS D 4  378 ? 31.20324 44.26571  -10.14325 1.000 37.29821  ? 366  LYS B C     1 
ATOM   7840 O  O     . LYS D 4  378 ? 30.24289 43.79899  -9.51858  1.000 43.40817  ? 366  LYS B O     1 
ATOM   7841 C  CB    . LYS D 4  378 ? 33.62814 43.86066  -9.63597  1.000 34.80003  ? 366  LYS B CB    1 
ATOM   7842 C  CG    . LYS D 4  378 ? 33.31830 44.07702  -8.16571  1.000 35.12712  ? 366  LYS B CG    1 
ATOM   7843 C  CD    . LYS D 4  378 ? 34.59152 44.12153  -7.32720  1.000 43.57882  ? 366  LYS B CD    1 
ATOM   7844 C  CE    . LYS D 4  378 ? 34.37999 44.94164  -6.05676  1.000 52.50739  ? 366  LYS B CE    1 
ATOM   7845 N  NZ    . LYS D 4  378 ? 33.61889 46.22102  -6.35927  1.000 57.05293  ? 366  LYS B NZ    1 
ATOM   7846 N  N     . GLN D 4  379 ? 31.21994 45.53182  -10.58815 1.000 34.48902  ? 367  GLN B N     1 
ATOM   7847 C  CA    . GLN D 4  379 ? 30.11479 46.43350  -10.26426 1.000 36.43785  ? 367  GLN B CA    1 
ATOM   7848 C  C     . GLN D 4  379 ? 28.79957 45.91306  -10.82181 1.000 34.84450  ? 367  GLN B C     1 
ATOM   7849 O  O     . GLN D 4  379 ? 27.75406 46.05129  -10.18252 1.000 38.96249  ? 367  GLN B O     1 
ATOM   7850 C  CB    . GLN D 4  379 ? 30.37227 47.85293  -10.78575 1.000 39.17580  ? 367  GLN B CB    1 
ATOM   7851 C  CG    . GLN D 4  379 ? 31.60457 48.52423  -10.23996 1.000 41.88946  ? 367  GLN B CG    1 
ATOM   7852 C  CD    . GLN D 4  379 ? 31.74328 49.96842  -10.71478 1.000 46.14918  ? 367  GLN B CD    1 
ATOM   7853 O  OE1   . GLN D 4  379 ? 31.26174 50.33054  -11.78709 1.000 48.74055  ? 367  GLN B OE1   1 
ATOM   7854 N  NE2   . GLN D 4  379 ? 32.40334 50.79728  -9.91008  1.000 47.92727  ? 367  GLN B NE2   1 
ATOM   7855 N  N     . LEU D 4  380 ? 28.82586 45.31083  -12.00890 1.000 32.94056  ? 368  LEU B N     1 
ATOM   7856 C  CA    . LEU D 4  380 ? 27.59938 44.76055  -12.57432 1.000 30.79883  ? 368  LEU B CA    1 
ATOM   7857 C  C     . LEU D 4  380 ? 27.09958 43.58750  -11.75480 1.000 30.61112  ? 368  LEU B C     1 
ATOM   7858 O  O     . LEU D 4  380 ? 25.88983 43.43137  -11.56473 1.000 31.81172  ? 368  LEU B O     1 
ATOM   7859 C  CB    . LEU D 4  380 ? 27.81631 44.32765  -14.01810 1.000 32.79718  ? 368  LEU B CB    1 
ATOM   7860 C  CG    . LEU D 4  380 ? 26.54247 43.81605  -14.69876 1.000 35.02740  ? 368  LEU B CG    1 
ATOM   7861 C  CD1   . LEU D 4  380 ? 25.45960 44.89764  -14.73730 1.000 32.28050  ? 368  LEU B CD1   1 
ATOM   7862 C  CD2   . LEU D 4  380 ? 26.85278 43.31607  -16.10200 1.000 39.47137  ? 368  LEU B CD2   1 
ATOM   7863 N  N     . THR D 4  381 ? 28.01539 42.74494  -11.27196 1.000 34.05286  ? 369  THR B N     1 
ATOM   7864 C  CA    . THR D 4  381 ? 27.61734 41.61017  -10.44101 1.000 39.00396  ? 369  THR B CA    1 
ATOM   7865 C  C     . THR D 4  381 ? 26.97667 42.09343  -9.15004  1.000 40.95695  ? 369  THR B C     1 
ATOM   7866 O  O     . THR D 4  381 ? 25.93121 41.57626  -8.72349  1.000 40.91037  ? 369  THR B O     1 
ATOM   7867 C  CB    . THR D 4  381 ? 28.83184 40.73291  -10.13793 1.000 42.27478  ? 369  THR B CB    1 
ATOM   7868 O  OG1   . THR D 4  381 ? 29.33311 40.16991  -11.35673 1.000 43.09442  ? 369  THR B OG1   1 
ATOM   7869 C  CG2   . THR D 4  381 ? 28.46228 39.62177  -9.18690  1.000 42.28989  ? 369  THR B CG2   1 
ATOM   7870 N  N     . GLU D 4  382 ? 27.58538 43.11254  -8.53662  1.000 39.89777  ? 370  GLU B N     1 
ATOM   7871 C  CA    . GLU D 4  382 ? 27.01523 43.74835  -7.35304  1.000 38.50091  ? 370  GLU B CA    1 
ATOM   7872 C  C     . GLU D 4  382 ? 25.64105 44.34242  -7.64144  1.000 39.36157  ? 370  GLU B C     1 
ATOM   7873 O  O     . GLU D 4  382 ? 24.70994 44.18492  -6.84140  1.000 43.25463  ? 370  GLU B O     1 
ATOM   7874 C  CB    . GLU D 4  382 ? 27.98556 44.80650  -6.83136  1.000 41.03607  ? 370  GLU B CB    1 
ATOM   7875 C  CG    . GLU D 4  382 ? 29.28891 44.17122  -6.35615  1.000 50.60205  ? 370  GLU B CG    1 
ATOM   7876 C  CD    . GLU D 4  382 ? 30.36112 45.17163  -5.95626  1.000 61.78410  ? 370  GLU B CD    1 
ATOM   7877 O  OE1   . GLU D 4  382 ? 30.22731 46.38740  -6.25886  1.000 60.73370  ? 370  GLU B OE1   1 
ATOM   7878 O  OE2   . GLU D 4  382 ? 31.35173 44.72009  -5.33177  1.000 67.30101  ? 370  GLU B OE2   1 
ATOM   7879 N  N     . ALA D 4  383 ? 25.48773 45.01761  -8.78238  1.000 38.62435  ? 371  ALA B N     1 
ATOM   7880 C  CA    . ALA D 4  383 ? 24.19087 45.59051  -9.13394  1.000 38.50379  ? 371  ALA B CA    1 
ATOM   7881 C  C     . ALA D 4  383 ? 23.13549 44.50554  -9.31064  1.000 34.58431  ? 371  ALA B C     1 
ATOM   7882 O  O     . ALA D 4  383 ? 21.98797 44.67753  -8.87760  1.000 31.26472  ? 371  ALA B O     1 
ATOM   7883 C  CB    . ALA D 4  383 ? 24.30585 46.42669  -10.41101 1.000 37.64924  ? 371  ALA B CB    1 
ATOM   7884 N  N     . VAL D 4  384 ? 23.49858 43.39436  -9.97240  1.000 31.19940  ? 372  VAL B N     1 
ATOM   7885 C  CA    . VAL D 4  384 ? 22.57251 42.26705  -10.13020 1.000 34.68217  ? 372  VAL B CA    1 
ATOM   7886 C  C     . VAL D 4  384 ? 22.14503 41.74157  -8.76714  1.000 36.64198  ? 372  VAL B C     1 
ATOM   7887 O  O     . VAL D 4  384 ? 20.95574 41.50042  -8.52595  1.000 42.39777  ? 372  VAL B O     1 
ATOM   7888 C  CB    . VAL D 4  384 ? 23.18420 41.13905  -10.99724 1.000 35.04041  ? 372  VAL B CB    1 
ATOM   7889 C  CG1   . VAL D 4  384 ? 22.38915 39.83679  -10.83347 1.000 33.56753  ? 372  VAL B CG1   1 
ATOM   7890 C  CG2   . VAL D 4  384 ? 23.20111 41.51635  -12.46822 1.000 26.60082  ? 372  VAL B CG2   1 
ATOM   7891 N  N     . GLN D 4  385 ? 23.09540 41.58625  -7.84357  1.000 34.26392  ? 373  GLN B N     1 
ATOM   7892 C  CA    . GLN D 4  385 ? 22.73089 41.06490  -6.52793  1.000 37.32333  ? 373  GLN B CA    1 
ATOM   7893 C  C     . GLN D 4  385 ? 21.83856 42.03541  -5.76653  1.000 43.32057  ? 373  GLN B C     1 
ATOM   7894 O  O     . GLN D 4  385 ? 20.86327 41.61631  -5.12797  1.000 52.06783  ? 373  GLN B O     1 
ATOM   7895 C  CB    . GLN D 4  385 ? 23.98305 40.72337  -5.72644  1.000 40.64214  ? 373  GLN B CB    1 
ATOM   7896 C  CG    . GLN D 4  385 ? 24.69770 39.50854  -6.30008  1.000 44.03140  ? 373  GLN B CG    1 
ATOM   7897 C  CD    . GLN D 4  385 ? 26.03513 39.23289  -5.64865  1.000 44.85222  ? 373  GLN B CD    1 
ATOM   7898 O  OE1   . GLN D 4  385 ? 26.10790 38.54200  -4.63231  1.000 49.58738  ? 373  GLN B OE1   1 
ATOM   7899 N  NE2   . GLN D 4  385 ? 27.10689 39.75275  -6.24573  1.000 37.06777  ? 373  GLN B NE2   1 
ATOM   7900 N  N     . LYS D 4  386 ? 22.13673 43.33412  -5.83455  1.000 39.96072  ? 374  LYS B N     1 
ATOM   7901 C  CA    . LYS D 4  386 ? 21.30678 44.31574  -5.14553  1.000 41.78362  ? 374  LYS B CA    1 
ATOM   7902 C  C     . LYS D 4  386 ? 19.89002 44.35051  -5.71948  1.000 42.25934  ? 374  LYS B C     1 
ATOM   7903 O  O     . LYS D 4  386 ? 18.90382 44.35349  -4.96877  1.000 44.42451  ? 374  LYS B O     1 
ATOM   7904 C  CB    . LYS D 4  386 ? 21.95705 45.69483  -5.22993  1.000 48.91374  ? 374  LYS B CB    1 
ATOM   7905 C  CG    . LYS D 4  386 ? 21.05058 46.81895  -4.75412  1.000 56.24359  ? 374  LYS B CG    1 
ATOM   7906 C  CD    . LYS D 4  386 ? 21.62903 48.17252  -5.10885  1.000 62.80598  ? 374  LYS B CD    1 
ATOM   7907 C  CE    . LYS D 4  386 ? 20.53290 49.20136  -5.36468  1.000 64.50556  ? 374  LYS B CE    1 
ATOM   7908 N  NZ    . LYS D 4  386 ? 21.09158 50.58842  -5.40953  1.000 66.46877  ? 374  LYS B NZ    1 
ATOM   7909 N  N     . ILE D 4  387 ? 19.76798 44.38442  -7.05502  1.000 37.99248  ? 375  ILE B N     1 
ATOM   7910 C  CA    . ILE D 4  387 ? 18.45115 44.40737  -7.68669  1.000 37.70875  ? 375  ILE B CA    1 
ATOM   7911 C  C     . ILE D 4  387 ? 17.66744 43.14875  -7.34006  1.000 41.26369  ? 375  ILE B C     1 
ATOM   7912 O  O     . ILE D 4  387 ? 16.46465 43.21098  -7.04902  1.000 45.47418  ? 375  ILE B O     1 
ATOM   7913 C  CB    . ILE D 4  387 ? 18.58607 44.57469  -9.21052  1.000 38.72987  ? 375  ILE B CB    1 
ATOM   7914 C  CG1   . ILE D 4  387 ? 19.12283 45.96900  -9.55758  1.000 40.46233  ? 375  ILE B CG1   1 
ATOM   7915 C  CG2   . ILE D 4  387 ? 17.24019 44.30904  -9.89794  1.000 31.01029  ? 375  ILE B CG2   1 
ATOM   7916 C  CD1   . ILE D 4  387 ? 19.91071 46.00479  -10.86128 1.000 34.08513  ? 375  ILE B CD1   1 
ATOM   7917 N  N     . THR D 4  388 ? 18.32986 41.98609  -7.37053  1.000 38.09583  ? 376  THR B N     1 
ATOM   7918 C  CA    . THR D 4  388 ? 17.65061 40.74436  -7.02295  1.000 38.85595  ? 376  THR B CA    1 
ATOM   7919 C  C     . THR D 4  388 ? 17.18611 40.76505  -5.57767  1.000 44.27203  ? 376  THR B C     1 
ATOM   7920 O  O     . THR D 4  388 ? 16.08544 40.29940  -5.26533  1.000 48.36648  ? 376  THR B O     1 
ATOM   7921 C  CB    . THR D 4  388 ? 18.57135 39.54692  -7.26963  1.000 34.85574  ? 376  THR B CB    1 
ATOM   7922 O  OG1   . THR D 4  388 ? 18.92483 39.50177  -8.65381  1.000 30.10365  ? 376  THR B OG1   1 
ATOM   7923 C  CG2   . THR D 4  388 ? 17.86583 38.25738  -6.90663  1.000 31.43247  ? 376  THR B CG2   1 
ATOM   7924 N  N     . THR D 4  389 ? 18.01928 41.29279  -4.68019  1.000 45.22965  ? 377  THR B N     1 
ATOM   7925 C  CA    . THR D 4  389 ? 17.62694 41.42378  -3.28288  1.000 45.66534  ? 377  THR B CA    1 
ATOM   7926 C  C     . THR D 4  389 ? 16.37908 42.27583  -3.14733  1.000 45.91973  ? 377  THR B C     1 
ATOM   7927 O  O     . THR D 4  389 ? 15.45256 41.93174  -2.39672  1.000 52.61499  ? 377  THR B O     1 
ATOM   7928 C  CB    . THR D 4  389 ? 18.77913 42.03355  -2.49454  1.000 42.81609  ? 377  THR B CB    1 
ATOM   7929 O  OG1   . THR D 4  389 ? 19.92174 41.18209  -2.62396  1.000 40.54604  ? 377  THR B OG1   1 
ATOM   7930 C  CG2   . THR D 4  389 ? 18.41448 42.21715  -1.02872  1.000 43.42519  ? 377  THR B CG2   1 
ATOM   7931 N  N     . GLU D 4  390 ? 16.33566 43.39017  -3.87547  1.000 43.95474  ? 378  GLU B N     1 
ATOM   7932 C  CA    . GLU D 4  390 ? 15.15607 44.24979  -3.82900  1.000 49.67736  ? 378  GLU B CA    1 
ATOM   7933 C  C     . GLU D 4  390 ? 13.92453 43.52863  -4.36575  1.000 47.13266  ? 378  GLU B C     1 
ATOM   7934 O  O     . GLU D 4  390 ? 12.84178 43.61839  -3.77070  1.000 47.27895  ? 378  GLU B O     1 
ATOM   7935 C  CB    . GLU D 4  390 ? 15.40543 45.53773  -4.60920  1.000 52.27630  ? 378  GLU B CB    1 
ATOM   7936 C  CG    . GLU D 4  390 ? 16.40223 46.47391  -3.96176  1.000 60.29683  ? 378  GLU B CG    1 
ATOM   7937 C  CD    . GLU D 4  390 ? 16.58077 47.76280  -4.75605  1.000 69.44857  ? 378  GLU B CD    1 
ATOM   7938 O  OE1   . GLU D 4  390 ? 16.00754 47.87370  -5.86721  1.000 69.66883  ? 378  GLU B OE1   1 
ATOM   7939 O  OE2   . GLU D 4  390 ? 17.28707 48.66844  -4.26406  1.000 74.22405  ? 378  GLU B OE2   1 
ATOM   7940 N  N     . SER D 4  391 ? 14.06876 42.82090  -5.49631  1.000 41.60131  ? 379  SER B N     1 
ATOM   7941 C  CA    . SER D 4  391 ? 12.94427 42.08140  -6.06564  1.000 40.97427  ? 379  SER B CA    1 
ATOM   7942 C  C     . SER D 4  391 ? 12.42580 41.03849  -5.09192  1.000 43.76930  ? 379  SER B C     1 
ATOM   7943 O  O     . SER D 4  391 ? 11.21427 40.89449  -4.91059  1.000 49.42847  ? 379  SER B O     1 
ATOM   7944 C  CB    . SER D 4  391 ? 13.33843 41.40678  -7.37417  1.000 45.77107  ? 379  SER B CB    1 
ATOM   7945 O  OG    . SER D 4  391 ? 13.43639 42.35083  -8.41476  1.000 56.17537  ? 379  SER B OG    1 
ATOM   7946 N  N     . ILE D 4  392 ? 13.32869 40.28416  -4.46522  1.000 42.10411  ? 380  ILE B N     1 
ATOM   7947 C  CA    . ILE D 4  392 ? 12.89273 39.28860  -3.49256  1.000 44.29321  ? 380  ILE B CA    1 
ATOM   7948 C  C     . ILE D 4  392 ? 12.11343 39.96045  -2.36961  1.000 46.45724  ? 380  ILE B C     1 
ATOM   7949 O  O     . ILE D 4  392 ? 11.01993 39.51587  -1.99849  1.000 50.06230  ? 380  ILE B O     1 
ATOM   7950 C  CB    . ILE D 4  392 ? 14.09275 38.48934  -2.95808  1.000 47.73150  ? 380  ILE B CB    1 
ATOM   7951 C  CG1   . ILE D 4  392 ? 14.77431 37.73475  -4.10328  1.000 46.26208  ? 380  ILE B CG1   1 
ATOM   7952 C  CG2   . ILE D 4  392 ? 13.65100 37.51839  -1.85063  1.000 49.00056  ? 380  ILE B CG2   1 
ATOM   7953 C  CD1   . ILE D 4  392 ? 16.12010 37.18058  -3.73442  1.000 45.53704  ? 380  ILE B CD1   1 
ATOM   7954 N  N     . VAL D 4  393 ? 12.64942 41.05947  -1.82995  1.000 47.25615  ? 381  VAL B N     1 
ATOM   7955 C  CA    . VAL D 4  393 ? 11.98632 41.72055  -0.71027  1.000 43.33745  ? 381  VAL B CA    1 
ATOM   7956 C  C     . VAL D 4  393 ? 10.59925 42.20413  -1.11855  1.000 50.96335  ? 381  VAL B C     1 
ATOM   7957 O  O     . VAL D 4  393 ? 9.61400  41.97098  -0.41347  1.000 54.66002  ? 381  VAL B O     1 
ATOM   7958 C  CB    . VAL D 4  393 ? 12.85940 42.86658  -0.17778  1.000 52.99752  ? 381  VAL B CB    1 
ATOM   7959 C  CG1   . VAL D 4  393 ? 12.07866 43.70522  0.81132   1.000 58.73487  ? 381  VAL B CG1   1 
ATOM   7960 C  CG2   . VAL D 4  393 ? 14.10640 42.30707  0.48161   1.000 51.55047  ? 381  VAL B CG2   1 
ATOM   7961 N  N     . ILE D 4  394 ? 10.49386 42.83117  -2.29214  1.000 50.12498  ? 382  ILE B N     1 
ATOM   7962 C  CA    . ILE D 4  394 ? 9.25974  43.50711  -2.68968  1.000 52.43187  ? 382  ILE B CA    1 
ATOM   7963 C  C     . ILE D 4  394 ? 8.21076  42.51453  -3.19074  1.000 54.40119  ? 382  ILE B C     1 
ATOM   7964 O  O     . ILE D 4  394 ? 7.05096  42.56583  -2.77212  1.000 56.74521  ? 382  ILE B O     1 
ATOM   7965 C  CB    . ILE D 4  394 ? 9.56626  44.57872  -3.75200  1.000 48.15983  ? 382  ILE B CB    1 
ATOM   7966 C  CG1   . ILE D 4  394 ? 10.44733 45.68885  -3.17504  1.000 49.05864  ? 382  ILE B CG1   1 
ATOM   7967 C  CG2   . ILE D 4  394 ? 8.28521  45.15241  -4.31313  1.000 45.53563  ? 382  ILE B CG2   1 
ATOM   7968 C  CD1   . ILE D 4  394 ? 11.19469 46.45894  -4.25178  1.000 36.50259  ? 382  ILE B CD1   1 
ATOM   7969 N  N     . TRP D 4  395 ? 8.58656  41.61315  -4.11189  1.000 55.20710  ? 383  TRP B N     1 
ATOM   7970 C  CA    . TRP D 4  395 ? 7.64397  40.71902  -4.78303  1.000 51.79430  ? 383  TRP B CA    1 
ATOM   7971 C  C     . TRP D 4  395 ? 7.83547  39.23785  -4.49194  1.000 56.06349  ? 383  TRP B C     1 
ATOM   7972 O  O     . TRP D 4  395 ? 6.92056  38.45524  -4.77397  1.000 60.30987  ? 383  TRP B O     1 
ATOM   7973 C  CB    . TRP D 4  395 ? 7.71250  40.90209  -6.30816  1.000 44.55936  ? 383  TRP B CB    1 
ATOM   7974 C  CG    . TRP D 4  395 ? 7.46052  42.29999  -6.73689  1.000 47.92539  ? 383  TRP B CG    1 
ATOM   7975 C  CD1   . TRP D 4  395 ? 6.26683  42.96829  -6.70551  1.000 49.06184  ? 383  TRP B CD1   1 
ATOM   7976 C  CD2   . TRP D 4  395 ? 8.42339  43.22062  -7.26066  1.000 45.31212  ? 383  TRP B CD2   1 
ATOM   7977 N  NE1   . TRP D 4  395 ? 6.43272  44.24844  -7.17331  1.000 47.60183  ? 383  TRP B NE1   1 
ATOM   7978 C  CE2   . TRP D 4  395 ? 7.74463  44.42691  -7.52770  1.000 44.21749  ? 383  TRP B CE2   1 
ATOM   7979 C  CE3   . TRP D 4  395 ? 9.79356  43.14319  -7.52598  1.000 44.54247  ? 383  TRP B CE3   1 
ATOM   7980 C  CZ2   . TRP D 4  395 ? 8.38880  45.54703  -8.04172  1.000 43.33019  ? 383  TRP B CZ2   1 
ATOM   7981 C  CZ3   . TRP D 4  395 ? 10.42963 44.25060  -8.05144  1.000 44.95241  ? 383  TRP B CZ3   1 
ATOM   7982 C  CH2   . TRP D 4  395 ? 9.72540  45.44133  -8.30121  1.000 45.55721  ? 383  TRP B CH2   1 
ATOM   7983 N  N     . GLY D 4  396 ? 8.98481  38.82373  -3.96529  1.000 56.55281  ? 384  GLY B N     1 
ATOM   7984 C  CA    . GLY D 4  396 ? 9.23217  37.42128  -3.69803  1.000 55.88281  ? 384  GLY B CA    1 
ATOM   7985 C  C     . GLY D 4  396 ? 9.75265  36.62194  -4.87133  1.000 53.37977  ? 384  GLY B C     1 
ATOM   7986 O  O     . GLY D 4  396 ? 9.92428  35.40675  -4.74339  1.000 57.94318  ? 384  GLY B O     1 
ATOM   7987 N  N     . LYS D 4  397 ? 9.99619  37.24970  -6.00908  1.000 51.14664  ? 385  LYS B N     1 
ATOM   7988 C  CA    . LYS D 4  397 ? 10.53020 36.57957  -7.18386  1.000 55.52360  ? 385  LYS B CA    1 
ATOM   7989 C  C     . LYS D 4  397 ? 11.93766 37.09333  -7.46486  1.000 53.90824  ? 385  LYS B C     1 
ATOM   7990 O  O     . LYS D 4  397 ? 12.33554 38.16754  -7.00075  1.000 52.87570  ? 385  LYS B O     1 
ATOM   7991 C  CB    . LYS D 4  397 ? 9.63360  36.83063  -8.40169  1.000 59.39518  ? 385  LYS B CB    1 
ATOM   7992 C  CG    . LYS D 4  397 ? 9.12625  35.60792  -9.13097  1.000 64.82721  ? 385  LYS B CG    1 
ATOM   7993 C  CD    . LYS D 4  397 ? 8.03073  36.01521  -10.13462 1.000 68.45819  ? 385  LYS B CD    1 
ATOM   7994 C  CE    . LYS D 4  397 ? 7.54310  34.83700  -10.98171 1.000 74.55828  ? 385  LYS B CE    1 
ATOM   7995 N  NZ    . LYS D 4  397 ? 8.53680  34.38525  -12.01842 1.000 74.30566  ? 385  LYS B NZ    1 
ATOM   7996 N  N     . THR D 4  398 ? 12.70586 36.29594  -8.22560  1.000 52.31215  ? 386  THR B N     1 
ATOM   7997 C  CA    . THR D 4  398 ? 13.89945 36.91843  -8.77940  1.000 47.08041  ? 386  THR B CA    1 
ATOM   7998 C  C     . THR D 4  398 ? 13.64912 37.31220  -10.22923 1.000 46.12084  ? 386  THR B C     1 
ATOM   7999 O  O     . THR D 4  398 ? 12.85287 36.67015  -10.92485 1.000 44.45101  ? 386  THR B O     1 
ATOM   8000 C  CB    . THR D 4  398 ? 15.11643 35.98733  -8.71956  1.000 43.09895  ? 386  THR B CB    1 
ATOM   8001 O  OG1   . THR D 4  398 ? 14.84797 34.79766  -9.47252  1.000 55.18451  ? 386  THR B OG1   1 
ATOM   8002 C  CG2   . THR D 4  398 ? 15.45622 35.63133  -7.28505  1.000 33.18284  ? 386  THR B CG2   1 
ATOM   8003 N  N     . PRO D 4  399 ? 14.28523 38.38195  -10.69730 1.000 43.55864  ? 387  PRO B N     1 
ATOM   8004 C  CA    . PRO D 4  399 ? 14.09160 38.81145  -12.08340 1.000 39.06446  ? 387  PRO B CA    1 
ATOM   8005 C  C     . PRO D 4  399 ? 14.98928 38.04747  -13.04592 1.000 36.51440  ? 387  PRO B C     1 
ATOM   8006 O  O     . PRO D 4  399 ? 16.04070 37.52269  -12.67913 1.000 41.41843  ? 387  PRO B O     1 
ATOM   8007 C  CB    . PRO D 4  399 ? 14.47217 40.29972  -12.05800 1.000 35.61059  ? 387  PRO B CB    1 
ATOM   8008 C  CG    . PRO D 4  399 ? 14.71063 40.64016  -10.63533 1.000 37.97742  ? 387  PRO B CG    1 
ATOM   8009 C  CD    . PRO D 4  399 ? 15.04513 39.37275  -9.92651  1.000 40.72577  ? 387  PRO B CD    1 
ATOM   8010 N  N     . LYS D 4  400 ? 14.53860 37.98222  -14.29831 1.000 32.18365  ? 388  LYS B N     1 
ATOM   8011 C  CA    . LYS D 4  400 ? 15.38922 37.58891  -15.41479 1.000 32.74829  ? 388  LYS B CA    1 
ATOM   8012 C  C     . LYS D 4  400 ? 16.12740 38.83284  -15.90844 1.000 38.71925  ? 388  LYS B C     1 
ATOM   8013 O  O     . LYS D 4  400 ? 15.49667 39.83489  -16.26243 1.000 44.13366  ? 388  LYS B O     1 
ATOM   8014 C  CB    . LYS D 4  400 ? 14.56522 36.95745  -16.53642 1.000 33.99418  ? 388  LYS B CB    1 
ATOM   8015 C  CG    . LYS D 4  400 ? 15.39876 36.72575  -17.80212 1.000 46.54000  ? 388  LYS B CG    1 
ATOM   8016 C  CD    . LYS D 4  400 ? 14.92135 35.55373  -18.66472 1.000 50.00586  ? 388  LYS B CD    1 
ATOM   8017 C  CE    . LYS D 4  400 ? 16.02253 35.14831  -19.65382 1.000 53.73146  ? 388  LYS B CE    1 
ATOM   8018 N  NZ    . LYS D 4  400 ? 15.54368 34.36575  -20.84541 1.000 59.64106  ? 388  LYS B NZ    1 
ATOM   8019 N  N     . PHE D 4  401 ? 17.45325 38.78155  -15.91280 1.000 38.84480  ? 389  PHE B N     1 
ATOM   8020 C  CA    . PHE D 4  401 ? 18.28184 39.94899  -16.19467 1.000 37.28168  ? 389  PHE B CA    1 
ATOM   8021 C  C     . PHE D 4  401 ? 18.68932 40.00598  -17.66039 1.000 42.12211  ? 389  PHE B C     1 
ATOM   8022 O  O     . PHE D 4  401 ? 19.20547 39.02438  -18.20880 1.000 46.08515  ? 389  PHE B O     1 
ATOM   8023 C  CB    . PHE D 4  401 ? 19.53726 39.93991  -15.32690 1.000 32.79565  ? 389  PHE B CB    1 
ATOM   8024 C  CG    . PHE D 4  401 ? 19.30234 40.41465  -13.93450 1.000 37.01159  ? 389  PHE B CG    1 
ATOM   8025 C  CD1   . PHE D 4  401 ? 19.48044 41.76047  -13.60472 1.000 34.14810  ? 389  PHE B CD1   1 
ATOM   8026 C  CD2   . PHE D 4  401 ? 18.90710 39.52896  -12.94549 1.000 34.95848  ? 389  PHE B CD2   1 
ATOM   8027 C  CE1   . PHE D 4  401 ? 19.27703 42.20752  -12.31383 1.000 30.24402  ? 389  PHE B CE1   1 
ATOM   8028 C  CE2   . PHE D 4  401 ? 18.69813 39.97445  -11.65473 1.000 37.02331  ? 389  PHE B CE2   1 
ATOM   8029 C  CZ    . PHE D 4  401 ? 18.88726 41.32288  -11.34024 1.000 35.19172  ? 389  PHE B CZ    1 
ATOM   8030 N  N     . LYS D 4  402 ? 18.46931 41.15750  -18.28859 1.000 42.57676  ? 390  LYS B N     1 
ATOM   8031 C  CA    . LYS D 4  402 ? 19.08289 41.44363  -19.58489 1.000 41.40283  ? 390  LYS B CA    1 
ATOM   8032 C  C     . LYS D 4  402 ? 20.37242 42.19433  -19.27997 1.000 38.14832  ? 390  LYS B C     1 
ATOM   8033 O  O     . LYS D 4  402 ? 20.34658 43.37987  -18.95098 1.000 39.82007  ? 390  LYS B O     1 
ATOM   8034 C  CB    . LYS D 4  402 ? 18.13930 42.23681  -20.47925 1.000 41.82374  ? 390  LYS B CB    1 
ATOM   8035 C  CG    . LYS D 4  402 ? 16.98614 41.40413  -20.99796 1.000 45.64739  ? 390  LYS B CG    1 
ATOM   8036 C  CD    . LYS D 4  402 ? 15.95978 42.22768  -21.71950 1.000 50.35867  ? 390  LYS B CD    1 
ATOM   8037 C  CE    . LYS D 4  402 ? 14.99553 41.31842  -22.44842 1.000 59.12550  ? 390  LYS B CE    1 
ATOM   8038 N  NZ    . LYS D 4  402 ? 13.95859 42.10475  -23.17886 1.000 67.68031  ? 390  LYS B NZ    1 
ATOM   8039 N  N     . LEU D 4  403 ? 21.50127 41.48610  -19.35123 1.000 35.93496  ? 391  LEU B N     1 
ATOM   8040 C  CA    . LEU D 4  403 ? 22.78317 42.01673  -18.91589 1.000 31.96036  ? 391  LEU B CA    1 
ATOM   8041 C  C     . LEU D 4  403 ? 23.50095 42.67864  -20.08356 1.000 35.43226  ? 391  LEU B C     1 
ATOM   8042 O  O     . LEU D 4  403 ? 23.67017 42.04066  -21.13374 1.000 39.51121  ? 391  LEU B O     1 
ATOM   8043 C  CB    . LEU D 4  403 ? 23.63810 40.91298  -18.33093 1.000 28.60328  ? 391  LEU B CB    1 
ATOM   8044 C  CG    . LEU D 4  403 ? 23.13586 40.30503  -17.02603 1.000 33.41861  ? 391  LEU B CG    1 
ATOM   8045 C  CD1   . LEU D 4  403 ? 24.08461 39.21779  -16.55575 1.000 40.73284  ? 391  LEU B CD1   1 
ATOM   8046 C  CD2   . LEU D 4  403 ? 22.96918 41.36548  -15.93779 1.000 31.26197  ? 391  LEU B CD2   1 
ATOM   8047 N  N     . PRO D 4  404 ? 23.94291 43.94038  -19.94862 1.000 31.40800  ? 392  PRO B N     1 
ATOM   8048 C  CA    . PRO D 4  404 ? 24.65518 44.65080  -21.03955 1.000 32.98997  ? 392  PRO B CA    1 
ATOM   8049 C  C     . PRO D 4  404 ? 26.14995 44.34715  -21.02129 1.000 39.01521  ? 392  PRO B C     1 
ATOM   8050 O  O     . PRO D 4  404 ? 27.00777 45.18882  -20.69843 1.000 42.38328  ? 392  PRO B O     1 
ATOM   8051 C  CB    . PRO D 4  404 ? 24.35542 46.11433  -20.72002 1.000 28.49507  ? 392  PRO B CB    1 
ATOM   8052 C  CG    . PRO D 4  404 ? 24.36953 46.13313  -19.22502 1.000 27.68905  ? 392  PRO B CG    1 
ATOM   8053 C  CD    . PRO D 4  404 ? 23.77987 44.80218  -18.76565 1.000 29.65748  ? 392  PRO B CD    1 
ATOM   8054 N  N     . ILE D 4  405 ? 26.48083 43.10561  -21.35307 1.000 35.59184  ? 393  ILE B N     1 
ATOM   8055 C  CA    . ILE D 4  405 ? 27.85651 42.63884  -21.31600 1.000 35.41936  ? 393  ILE B CA    1 
ATOM   8056 C  C     . ILE D 4  405 ? 27.96734 41.52087  -22.33840 1.000 42.88554  ? 393  ILE B C     1 
ATOM   8057 O  O     . ILE D 4  405 ? 26.96606 40.90029  -22.70614 1.000 47.03182  ? 393  ILE B O     1 
ATOM   8058 C  CB    . ILE D 4  405 ? 28.24362 42.17866  -19.88880 1.000 31.68811  ? 393  ILE B CB    1 
ATOM   8059 C  CG1   . ILE D 4  405 ? 29.70593 41.72573  -19.80855 1.000 30.44836  ? 393  ILE B CG1   1 
ATOM   8060 C  CG2   . ILE D 4  405 ? 27.31115 41.07326  -19.39875 1.000 27.28794  ? 393  ILE B CG2   1 
ATOM   8061 C  CD1   . ILE D 4  405 ? 30.12255 41.32107  -18.40723 1.000 28.82747  ? 393  ILE B CD1   1 
ATOM   8062 N  N     . GLN D 4  406 ? 29.17723 41.29947  -22.84691 1.000 48.02014  ? 394  GLN B N     1 
ATOM   8063 C  CA    . GLN D 4  406 ? 29.41191 40.11493  -23.66059 1.000 51.14672  ? 394  GLN B CA    1 
ATOM   8064 C  C     . GLN D 4  406 ? 29.30164 38.87593  -22.78144 1.000 50.01390  ? 394  GLN B C     1 
ATOM   8065 O  O     . GLN D 4  406 ? 29.85491 38.83879  -21.67470 1.000 49.96365  ? 394  GLN B O     1 
ATOM   8066 C  CB    . GLN D 4  406 ? 30.78156 40.17238  -24.33742 1.000 58.74326  ? 394  GLN B CB    1 
ATOM   8067 C  CG    . GLN D 4  406 ? 31.05633 38.97878  -25.26331 1.000 70.62539  ? 394  GLN B CG    1 
ATOM   8068 C  CD    . GLN D 4  406 ? 32.47654 38.97047  -25.84526 1.000 81.17096  ? 394  GLN B CD    1 
ATOM   8069 O  OE1   . GLN D 4  406 ? 33.47207 38.99787  -25.11127 1.000 80.10144  ? 394  GLN B OE1   1 
ATOM   8070 N  NE2   . GLN D 4  406 ? 32.56906 38.93078  -27.17509 1.000 87.71631  ? 394  GLN B NE2   1 
ATOM   8071 N  N     . LYS D 4  407 ? 28.55200 37.87995  -23.26910 1.000 48.90791  ? 395  LYS B N     1 
ATOM   8072 C  CA    . LYS D 4  407 ? 28.42164 36.59008  -22.59558 1.000 44.78128  ? 395  LYS B CA    1 
ATOM   8073 C  C     . LYS D 4  407 ? 29.74384 36.09616  -22.01183 1.000 43.89563  ? 395  LYS B C     1 
ATOM   8074 O  O     . LYS D 4  407 ? 29.80576 35.66948  -20.85183 1.000 40.54856  ? 395  LYS B O     1 
ATOM   8075 C  CB    . LYS D 4  407 ? 27.86697 35.56853  -23.59107 1.000 43.66814  ? 395  LYS B CB    1 
ATOM   8076 C  CG    . LYS D 4  407 ? 27.82436 34.14506  -23.09996 1.000 43.64688  ? 395  LYS B CG    1 
ATOM   8077 C  CD    . LYS D 4  407 ? 27.71940 33.20099  -24.28123 1.000 54.26864  ? 395  LYS B CD    1 
ATOM   8078 C  CE    . LYS D 4  407 ? 27.75900 31.73050  -23.87051 1.000 58.97193  ? 395  LYS B CE    1 
ATOM   8079 N  NZ    . LYS D 4  407 ? 26.55541 31.34266  -23.06762 1.000 55.38139  ? 395  LYS B NZ    1 
ATOM   8080 N  N     . GLU D 4  408 ? 30.82151 36.18456  -22.80070 1.000 45.38813  ? 396  GLU B N     1 
ATOM   8081 C  CA    . GLU D 4  408 ? 32.08351 35.55046  -22.43010 1.000 51.40365  ? 396  GLU B CA    1 
ATOM   8082 C  C     . GLU D 4  408 ? 32.78972 36.29336  -21.29712 1.000 51.13196  ? 396  GLU B C     1 
ATOM   8083 O  O     . GLU D 4  408 ? 33.31843 35.65745  -20.38047 1.000 52.74142  ? 396  GLU B O     1 
ATOM   8084 C  CB    . GLU D 4  408 ? 32.98240 35.44352  -23.65867 1.000 61.20523  ? 396  GLU B CB    1 
ATOM   8085 C  CG    . GLU D 4  408 ? 32.22520 35.19854  -24.96798 1.000 71.42543  ? 396  GLU B CG    1 
ATOM   8086 C  CD    . GLU D 4  408 ? 31.62823 33.80230  -25.08138 1.000 78.49289  ? 396  GLU B CD    1 
ATOM   8087 O  OE1   . GLU D 4  408 ? 30.96285 33.52661  -26.10265 1.000 80.25917  ? 396  GLU B OE1   1 
ATOM   8088 O  OE2   . GLU D 4  408 ? 31.81987 32.97792  -24.16040 1.000 81.63062  ? 396  GLU B OE2   1 
ATOM   8089 N  N     . THR D 4  409 ? 32.82679 37.62974  -21.35165 1.000 46.21632  ? 397  THR B N     1 
ATOM   8090 C  CA    . THR D 4  409 ? 33.28200 38.44208  -20.21889 1.000 47.13697  ? 397  THR B CA    1 
ATOM   8091 C  C     . THR D 4  409 ? 32.57009 38.04146  -18.92237 1.000 45.53954  ? 397  THR B C     1 
ATOM   8092 O  O     . THR D 4  409 ? 33.20815 37.75527  -17.88407 1.000 55.17099  ? 397  THR B O     1 
ATOM   8093 C  CB    . THR D 4  409 ? 33.02034 39.92821  -20.52412 1.000 49.80514  ? 397  THR B CB    1 
ATOM   8094 O  OG1   . THR D 4  409 ? 33.43438 40.24566  -21.86394 1.000 48.31755  ? 397  THR B OG1   1 
ATOM   8095 C  CG2   . THR D 4  409 ? 33.73467 40.83491  -19.53266 1.000 48.10054  ? 397  THR B CG2   1 
ATOM   8096 N  N     . TRP D 4  410 ? 31.23419 37.99749  -18.97889 1.000 34.52073  ? 398  TRP B N     1 
ATOM   8097 C  CA    . TRP D 4  410 ? 30.44966 37.68773  -17.78967 1.000 37.99841  ? 398  TRP B CA    1 
ATOM   8098 C  C     . TRP D 4  410 ? 30.79007 36.30785  -17.25774 1.000 39.92389  ? 398  TRP B C     1 
ATOM   8099 O  O     . TRP D 4  410 ? 31.01693 36.12796  -16.05891 1.000 45.27670  ? 398  TRP B O     1 
ATOM   8100 C  CB    . TRP D 4  410 ? 28.95971 37.77768  -18.10366 1.000 36.33006  ? 398  TRP B CB    1 
ATOM   8101 C  CG    . TRP D 4  410 ? 28.09898 37.46310  -16.93892 1.000 30.50650  ? 398  TRP B CG    1 
ATOM   8102 C  CD1   . TRP D 4  410 ? 27.46878 36.28085  -16.68060 1.000 34.20545  ? 398  TRP B CD1   1 
ATOM   8103 C  CD2   . TRP D 4  410 ? 27.76565 38.33845  -15.86352 1.000 26.98574  ? 398  TRP B CD2   1 
ATOM   8104 N  NE1   . TRP D 4  410 ? 26.74373 36.37079  -15.51522 1.000 31.18993  ? 398  TRP B NE1   1 
ATOM   8105 C  CE2   . TRP D 4  410 ? 26.91584 37.62083  -14.98627 1.000 28.55941  ? 398  TRP B CE2   1 
ATOM   8106 C  CE3   . TRP D 4  410 ? 28.08178 39.66541  -15.56223 1.000 29.22877  ? 398  TRP B CE3   1 
ATOM   8107 C  CZ2   . TRP D 4  410 ? 26.38894 38.18447  -13.81867 1.000 29.70002  ? 398  TRP B CZ2   1 
ATOM   8108 C  CZ3   . TRP D 4  410 ? 27.55816 40.23142  -14.38952 1.000 32.67058  ? 398  TRP B CZ3   1 
ATOM   8109 C  CH2   . TRP D 4  410 ? 26.72115 39.48919  -13.53643 1.000 32.07087  ? 398  TRP B CH2   1 
ATOM   8110 N  N     . GLU D 4  411 ? 30.82111 35.31354  -18.13924 1.000 42.60581  ? 399  GLU B N     1 
ATOM   8111 C  CA    . GLU D 4  411 ? 31.02429 33.95336  -17.67273 1.000 45.22916  ? 399  GLU B CA    1 
ATOM   8112 C  C     . GLU D 4  411 ? 32.45495 33.73056  -17.21905 1.000 42.69773  ? 399  GLU B C     1 
ATOM   8113 O  O     . GLU D 4  411 ? 32.69173 32.89625  -16.34264 1.000 39.96842  ? 399  GLU B O     1 
ATOM   8114 C  CB    . GLU D 4  411 ? 30.62241 32.96693  -18.76393 1.000 50.86843  ? 399  GLU B CB    1 
ATOM   8115 C  CG    . GLU D 4  411 ? 29.13324 32.99519  -19.04380 1.000 50.89888  ? 399  GLU B CG    1 
ATOM   8116 C  CD    . GLU D 4  411 ? 28.69258 31.92584  -20.01463 1.000 62.46102  ? 399  GLU B CD    1 
ATOM   8117 O  OE1   . GLU D 4  411 ? 29.54870 31.38452  -20.76105 1.000 67.20502  ? 399  GLU B OE1   1 
ATOM   8118 O  OE2   . GLU D 4  411 ? 27.47740 31.62719  -20.02756 1.000 67.74443  ? 399  GLU B OE2   1 
ATOM   8119 N  N     . THR D 4  412 ? 33.41092 34.48622  -17.76914 1.000 44.76016  ? 400  THR B N     1 
ATOM   8120 C  CA    . THR D 4  412 ? 34.78495 34.40334  -17.28407 1.000 53.76048  ? 400  THR B CA    1 
ATOM   8121 C  C     . THR D 4  412 ? 34.89754 34.87398  -15.83385 1.000 50.59914  ? 400  THR B C     1 
ATOM   8122 O  O     . THR D 4  412 ? 35.66621 34.29413  -15.05708 1.000 51.09872  ? 400  THR B O     1 
ATOM   8123 C  CB    . THR D 4  412 ? 35.73060 35.22503  -18.17904 1.000 64.40677  ? 400  THR B CB    1 
ATOM   8124 O  OG1   . THR D 4  412 ? 35.72090 34.72220  -19.52069 1.000 68.32347  ? 400  THR B OG1   1 
ATOM   8125 C  CG2   . THR D 4  412 ? 37.16519 35.15927  -17.66293 1.000 67.37560  ? 400  THR B CG2   1 
ATOM   8126 N  N     . TRP D 4  413 ? 34.14774 35.92817  -15.43605 1.000 44.31859  ? 401  TRP B N     1 
ATOM   8127 C  CA    . TRP D 4  413 ? 34.44883 36.51076  -14.12086 1.000 40.08516  ? 401  TRP B CA    1 
ATOM   8128 C  C     . TRP D 4  413 ? 33.34427 36.59072  -13.06693 1.000 39.12838  ? 401  TRP B C     1 
ATOM   8129 O  O     . TRP D 4  413 ? 33.67651 36.87098  -11.91096 1.000 41.69216  ? 401  TRP B O     1 
ATOM   8130 C  CB    . TRP D 4  413 ? 35.03269 37.92471  -14.27843 1.000 37.67694  ? 401  TRP B CB    1 
ATOM   8131 C  CG    . TRP D 4  413 ? 36.45493 37.84339  -14.73046 1.000 41.54826  ? 401  TRP B CG    1 
ATOM   8132 C  CD1   . TRP D 4  413 ? 37.51817 37.33023  -14.02954 1.000 45.75547  ? 401  TRP B CD1   1 
ATOM   8133 C  CD2   . TRP D 4  413 ? 36.96772 38.24607  -15.99609 1.000 38.91785  ? 401  TRP B CD2   1 
ATOM   8134 N  NE1   . TRP D 4  413 ? 38.67176 37.40523  -14.78685 1.000 45.90482  ? 401  TRP B NE1   1 
ATOM   8135 C  CE2   . TRP D 4  413 ? 38.35769 37.95587  -16.00022 1.000 43.46864  ? 401  TRP B CE2   1 
ATOM   8136 C  CE3   . TRP D 4  413 ? 36.39210 38.82681  -17.12943 1.000 38.68252  ? 401  TRP B CE3   1 
ATOM   8137 C  CZ2   . TRP D 4  413 ? 39.17128 38.22295  -17.09221 1.000 49.02273  ? 401  TRP B CZ2   1 
ATOM   8138 C  CZ3   . TRP D 4  413 ? 37.20717 39.10181  -18.21549 1.000 47.62204  ? 401  TRP B CZ3   1 
ATOM   8139 C  CH2   . TRP D 4  413 ? 38.58128 38.79772  -18.18883 1.000 53.23974  ? 401  TRP B CH2   1 
ATOM   8140 N  N     . TRP D 4  414 ? 32.06635 36.35427  -13.37864 1.000 35.36552  ? 402  TRP B N     1 
ATOM   8141 C  CA    . TRP D 4  414 ? 31.04522 36.75556  -12.40394 1.000 38.08129  ? 402  TRP B CA    1 
ATOM   8142 C  C     . TRP D 4  414 ? 31.12350 35.97128  -11.08828 1.000 43.55962  ? 402  TRP B C     1 
ATOM   8143 O  O     . TRP D 4  414 ? 30.83746 36.54185  -10.02626 1.000 45.57959  ? 402  TRP B O     1 
ATOM   8144 C  CB    . TRP D 4  414 ? 29.63928 36.64744  -13.00042 1.000 36.65460  ? 402  TRP B CB    1 
ATOM   8145 C  CG    . TRP D 4  414 ? 29.15500 35.23663  -13.20367 1.000 40.18965  ? 402  TRP B CG    1 
ATOM   8146 C  CD1   . TRP D 4  414 ? 29.35220 34.46481  -14.30561 1.000 43.63401  ? 402  TRP B CD1   1 
ATOM   8147 C  CD2   . TRP D 4  414 ? 28.37218 34.44505  -12.29256 1.000 38.84220  ? 402  TRP B CD2   1 
ATOM   8148 N  NE1   . TRP D 4  414 ? 28.75495 33.24313  -14.14133 1.000 49.50436  ? 402  TRP B NE1   1 
ATOM   8149 C  CE2   . TRP D 4  414 ? 28.14384 33.19903  -12.91726 1.000 44.45028  ? 402  TRP B CE2   1 
ATOM   8150 C  CE3   . TRP D 4  414 ? 27.85136 34.66430  -11.01305 1.000 35.22743  ? 402  TRP B CE3   1 
ATOM   8151 C  CZ2   . TRP D 4  414 ? 27.41768 32.16686  -12.30744 1.000 41.06739  ? 402  TRP B CZ2   1 
ATOM   8152 C  CZ3   . TRP D 4  414 ? 27.12207 33.63839  -10.40396 1.000 38.18957  ? 402  TRP B CZ3   1 
ATOM   8153 C  CH2   . TRP D 4  414 ? 26.91752 32.40416  -11.05452 1.000 40.73094  ? 402  TRP B CH2   1 
ATOM   8154 N  N     . THR D 4  415 ? 31.50124 34.68217  -11.11836 1.000 41.95036  ? 403  THR B N     1 
ATOM   8155 C  CA    . THR D 4  415 ? 31.53885 33.91878  -9.87220  1.000 40.35424  ? 403  THR B CA    1 
ATOM   8156 C  C     . THR D 4  415 ? 32.62019 34.40868  -8.92615  1.000 46.99100  ? 403  THR B C     1 
ATOM   8157 O  O     . THR D 4  415 ? 32.59016 34.04211  -7.74431  1.000 55.53712  ? 403  THR B O     1 
ATOM   8158 C  CB    . THR D 4  415 ? 31.73608 32.40764  -10.11220 1.000 40.51273  ? 403  THR B CB    1 
ATOM   8159 O  OG1   . THR D 4  415 ? 33.11382 32.10679  -10.39076 1.000 39.04443  ? 403  THR B OG1   1 
ATOM   8160 C  CG2   . THR D 4  415 ? 30.86691 31.92268  -11.25182 1.000 42.44667  ? 403  THR B CG2   1 
ATOM   8161 N  N     . GLU D 4  416 ? 33.56698 35.22203  -9.40572  1.000 43.86446  ? 404  GLU B N     1 
ATOM   8162 C  CA    . GLU D 4  416 ? 34.54553 35.81942  -8.50492  1.000 44.83108  ? 404  GLU B CA    1 
ATOM   8163 C  C     . GLU D 4  416 ? 33.95393 36.91848  -7.62737  1.000 44.27520  ? 404  GLU B C     1 
ATOM   8164 O  O     . GLU D 4  416 ? 34.59942 37.31812  -6.65533  1.000 47.28977  ? 404  GLU B O     1 
ATOM   8165 C  CB    . GLU D 4  416 ? 35.73414 36.37868  -9.29464  1.000 49.27771  ? 404  GLU B CB    1 
ATOM   8166 C  CG    . GLU D 4  416 ? 36.52029 35.33212  -10.08379 1.000 59.15179  ? 404  GLU B CG    1 
ATOM   8167 C  CD    . GLU D 4  416 ? 37.19740 34.27904  -9.20126  1.000 66.87500  ? 404  GLU B CD    1 
ATOM   8168 O  OE1   . GLU D 4  416 ? 38.06425 34.64171  -8.37889  1.000 68.46700  ? 404  GLU B OE1   1 
ATOM   8169 O  OE2   . GLU D 4  416 ? 36.86337 33.08097  -9.33894  1.000 70.90907  ? 404  GLU B OE2   1 
ATOM   8170 N  N     . TYR D 4  417 ? 32.75828 37.42546  -7.93447  1.000 42.93451  ? 405  TYR B N     1 
ATOM   8171 C  CA    . TYR D 4  417 ? 32.16804 38.50713  -7.15150  1.000 44.08238  ? 405  TYR B CA    1 
ATOM   8172 C  C     . TYR D 4  417 ? 30.82009 38.12470  -6.55856  1.000 49.61971  ? 405  TYR B C     1 
ATOM   8173 O  O     . TYR D 4  417 ? 30.17401 38.96460  -5.92338  1.000 56.08804  ? 405  TYR B O     1 
ATOM   8174 C  CB    . TYR D 4  417 ? 32.04305 39.77793  -8.00601  1.000 43.57563  ? 405  TYR B CB    1 
ATOM   8175 C  CG    . TYR D 4  417 ? 33.29221 40.02011  -8.81432  1.000 45.20516  ? 405  TYR B CG    1 
ATOM   8176 C  CD1   . TYR D 4  417 ? 34.51987 40.23965  -8.18351  1.000 41.89132  ? 405  TYR B CD1   1 
ATOM   8177 C  CD2   . TYR D 4  417 ? 33.26546 39.97061  -10.20436 1.000 45.04874  ? 405  TYR B CD2   1 
ATOM   8178 C  CE1   . TYR D 4  417 ? 35.67840 40.42842  -8.91622  1.000 41.22379  ? 405  TYR B CE1   1 
ATOM   8179 C  CE2   . TYR D 4  417 ? 34.42795 40.16155  -10.95108 1.000 45.22824  ? 405  TYR B CE2   1 
ATOM   8180 C  CZ    . TYR D 4  417 ? 35.62329 40.38826  -10.30075 1.000 47.10277  ? 405  TYR B CZ    1 
ATOM   8181 O  OH    . TYR D 4  417 ? 36.76445 40.57849  -11.03870 1.000 53.30698  ? 405  TYR B OH    1 
ATOM   8182 N  N     . TRP D 4  418 ? 30.39372 36.87512  -6.71875  1.000 50.24559  ? 406  TRP B N     1 
ATOM   8183 C  CA    . TRP D 4  418 ? 29.08844 36.45163  -6.23201  1.000 46.32830  ? 406  TRP B CA    1 
ATOM   8184 C  C     . TRP D 4  418 ? 29.11343 36.17239  -4.73066  1.000 43.09798  ? 406  TRP B C     1 
ATOM   8185 O  O     . TRP D 4  418 ? 30.04751 35.55433  -4.20722  1.000 44.77576  ? 406  TRP B O     1 
ATOM   8186 C  CB    . TRP D 4  418 ? 28.61857 35.20805  -6.99065  1.000 42.64692  ? 406  TRP B CB    1 
ATOM   8187 C  CG    . TRP D 4  418 ? 27.14553 35.06257  -6.96338  1.000 39.95698  ? 406  TRP B CG    1 
ATOM   8188 C  CD1   . TRP D 4  418 ? 26.42328 34.18760  -6.21645  1.000 40.25584  ? 406  TRP B CD1   1 
ATOM   8189 C  CD2   . TRP D 4  418 ? 26.19578 35.85152  -7.69244  1.000 40.88513  ? 406  TRP B CD2   1 
ATOM   8190 N  NE1   . TRP D 4  418 ? 25.07834 34.36550  -6.44559  1.000 43.85520  ? 406  TRP B NE1   1 
ATOM   8191 C  CE2   . TRP D 4  418 ? 24.91401 35.38183  -7.35074  1.000 43.12434  ? 406  TRP B CE2   1 
ATOM   8192 C  CE3   . TRP D 4  418 ? 26.30724 36.90002  -8.61155  1.000 43.90243  ? 406  TRP B CE3   1 
ATOM   8193 C  CZ2   . TRP D 4  418 ? 23.75244 35.92180  -7.89585  1.000 44.49251  ? 406  TRP B CZ2   1 
ATOM   8194 C  CZ3   . TRP D 4  418 ? 25.15146 37.44033  -9.15234  1.000 43.75436  ? 406  TRP B CZ3   1 
ATOM   8195 C  CH2   . TRP D 4  418 ? 23.89268 36.94929  -8.79356  1.000 45.28413  ? 406  TRP B CH2   1 
ATOM   8196 N  N     . GLN D 4  419 ? 28.05808 36.61197  -4.04066  1.000 40.71275  ? 407  GLN B N     1 
ATOM   8197 C  CA    . GLN D 4  419 ? 27.95270 36.41697  -2.60278  1.000 43.72588  ? 407  GLN B CA    1 
ATOM   8198 C  C     . GLN D 4  419 ? 26.58599 35.92835  -2.13485  1.000 45.63703  ? 407  GLN B C     1 
ATOM   8199 O  O     . GLN D 4  419 ? 26.42258 35.68207  -0.93602  1.000 50.48789  ? 407  GLN B O     1 
ATOM   8200 C  CB    . GLN D 4  419 ? 28.30664 37.71758  -1.86151  1.000 46.60979  ? 407  GLN B CB    1 
ATOM   8201 C  CG    . GLN D 4  419 ? 29.79509 37.88309  -1.57260  1.000 58.18848  ? 407  GLN B CG    1 
ATOM   8202 C  CD    . GLN D 4  419 ? 30.29596 36.95216  -0.46096  1.000 71.65923  ? 407  GLN B CD    1 
ATOM   8203 O  OE1   . GLN D 4  419 ? 30.81654 35.86804  -0.73373  1.000 77.64952  ? 407  GLN B OE1   1 
ATOM   8204 N  NE2   . GLN D 4  419 ? 30.14107 37.38048  0.79711   1.000 73.51477  ? 407  GLN B NE2   1 
ATOM   8205 N  N     . ALA D 4  420 ? 25.61098 35.76443  -3.02833  1.000 41.81210  ? 408  ALA B N     1 
ATOM   8206 C  CA    . ALA D 4  420 ? 24.30335 35.25815  -2.63461  1.000 40.22673  ? 408  ALA B CA    1 
ATOM   8207 C  C     . ALA D 4  420 ? 24.24426 33.72958  -2.74288  1.000 43.30242  ? 408  ALA B C     1 
ATOM   8208 O  O     . ALA D 4  420 ? 25.05531 33.09911  -3.42091  1.000 40.46498  ? 408  ALA B O     1 
ATOM   8209 C  CB    . ALA D 4  420 ? 23.21014 35.88734  -3.49219  1.000 35.42614  ? 408  ALA B CB    1 
ATOM   8210 N  N     . THR D 4  421 ? 23.27462 33.13039  -2.05061  1.000 41.03860  ? 409  THR B N     1 
ATOM   8211 C  CA    . THR D 4  421 ? 23.05254 31.69622  -2.19436  1.000 48.16756  ? 409  THR B CA    1 
ATOM   8212 C  C     . THR D 4  421 ? 22.07899 31.35897  -3.31811  1.000 48.05048  ? 409  THR B C     1 
ATOM   8213 O  O     . THR D 4  421 ? 21.85148 30.17604  -3.59163  1.000 42.24349  ? 409  THR B O     1 
ATOM   8214 C  CB    . THR D 4  421 ? 22.55346 31.09016  -0.87952  1.000 46.27567  ? 409  THR B CB    1 
ATOM   8215 O  OG1   . THR D 4  421 ? 21.21332 31.52829  -0.61538  1.000 47.10932  ? 409  THR B OG1   1 
ATOM   8216 C  CG2   . THR D 4  421 ? 23.46680 31.49597  0.26650   1.000 48.37373  ? 409  THR B CG2   1 
ATOM   8217 N  N     . TRP D 4  422 ? 21.49202 32.36189  -3.96317  1.000 47.89390  ? 410  TRP B N     1 
ATOM   8218 C  CA    . TRP D 4  422 ? 20.67245 32.16660  -5.14953  1.000 47.60467  ? 410  TRP B CA    1 
ATOM   8219 C  C     . TRP D 4  422 ? 21.39188 32.73157  -6.37034  1.000 43.26567  ? 410  TRP B C     1 
ATOM   8220 O  O     . TRP D 4  422 ? 22.32693 33.52987  -6.25220  1.000 38.22772  ? 410  TRP B O     1 
ATOM   8221 C  CB    . TRP D 4  422 ? 19.29625 32.82282  -4.98555  1.000 46.17877  ? 410  TRP B CB    1 
ATOM   8222 C  CG    . TRP D 4  422 ? 19.29897 34.11159  -4.17556  1.000 47.24263  ? 410  TRP B CG    1 
ATOM   8223 C  CD1   . TRP D 4  422 ? 18.78620 34.28037  -2.92860  1.000 48.80700  ? 410  TRP B CD1   1 
ATOM   8224 C  CD2   . TRP D 4  422 ? 19.81633 35.40061  -4.57094  1.000 41.19357  ? 410  TRP B CD2   1 
ATOM   8225 N  NE1   . TRP D 4  422 ? 18.95019 35.58069  -2.51605  1.000 42.43359  ? 410  TRP B NE1   1 
ATOM   8226 C  CE2   . TRP D 4  422 ? 19.59005 36.28675  -3.49748  1.000 37.48063  ? 410  TRP B CE2   1 
ATOM   8227 C  CE3   . TRP D 4  422 ? 20.45164 35.88453  -5.72136  1.000 41.78650  ? 410  TRP B CE3   1 
ATOM   8228 C  CZ2   . TRP D 4  422 ? 19.97386 37.63508  -3.53365  1.000 34.62042  ? 410  TRP B CZ2   1 
ATOM   8229 C  CZ3   . TRP D 4  422 ? 20.84149 37.22748  -5.75585  1.000 42.68847  ? 410  TRP B CZ3   1 
ATOM   8230 C  CH2   . TRP D 4  422 ? 20.59141 38.08742  -4.66595  1.000 38.20400  ? 410  TRP B CH2   1 
ATOM   8231 N  N     . ILE D 4  423 ? 20.96822 32.27866  -7.55373  1.000 42.15735  ? 411  ILE B N     1 
ATOM   8232 C  CA    . ILE D 4  423 ? 21.45364 32.80559  -8.82029  1.000 38.61720  ? 411  ILE B CA    1 
ATOM   8233 C  C     . ILE D 4  423 ? 20.24837 33.12453  -9.70032  1.000 39.19807  ? 411  ILE B C     1 
ATOM   8234 O  O     . ILE D 4  423 ? 19.44609 32.23076  -9.98714  1.000 43.92744  ? 411  ILE B O     1 
ATOM   8235 C  CB    . ILE D 4  423 ? 22.39015 31.83670  -9.56188  1.000 38.78692  ? 411  ILE B CB    1 
ATOM   8236 C  CG1   . ILE D 4  423 ? 23.42242 31.21116  -8.62577  1.000 37.95535  ? 411  ILE B CG1   1 
ATOM   8237 C  CG2   . ILE D 4  423 ? 23.09315 32.55646  -10.69450 1.000 41.92681  ? 411  ILE B CG2   1 
ATOM   8238 C  CD1   . ILE D 4  423 ? 24.19321 30.08709  -9.28417  1.000 34.48795  ? 411  ILE B CD1   1 
ATOM   8239 N  N     . PRO D 4  424 ? 20.08622 34.35322  -10.16778 1.000 35.91149  ? 412  PRO B N     1 
ATOM   8240 C  CA    . PRO D 4  424 ? 18.96346 34.66208  -11.04882 1.000 36.02587  ? 412  PRO B CA    1 
ATOM   8241 C  C     . PRO D 4  424 ? 19.24206 34.20294  -12.46853 1.000 38.35149  ? 412  PRO B C     1 
ATOM   8242 O  O     . PRO D 4  424 ? 20.39029 34.00672  -12.88155 1.000 36.91986  ? 412  PRO B O     1 
ATOM   8243 C  CB    . PRO D 4  424 ? 18.87205 36.19250  -10.98105 1.000 34.90237  ? 412  PRO B CB    1 
ATOM   8244 C  CG    . PRO D 4  424 ? 20.27346 36.62370  -10.75301 1.000 34.14361  ? 412  PRO B CG    1 
ATOM   8245 C  CD    . PRO D 4  424 ? 20.95853 35.52609  -9.96294  1.000 36.58010  ? 412  PRO B CD    1 
ATOM   8246 N  N     . GLU D 4  425 ? 18.15592 34.03302  -13.21574 1.000 35.60634  ? 413  GLU B N     1 
ATOM   8247 C  CA    . GLU D 4  425 ? 18.28741 33.83481  -14.64525 1.000 37.30870  ? 413  GLU B CA    1 
ATOM   8248 C  C     . GLU D 4  425 ? 18.75126 35.13190  -15.29912 1.000 36.55435  ? 413  GLU B C     1 
ATOM   8249 O  O     . GLU D 4  425 ? 18.52273 36.22946  -14.77561 1.000 35.16540  ? 413  GLU B O     1 
ATOM   8250 C  CB    . GLU D 4  425 ? 16.96612 33.36032  -15.22580 1.000 40.77602  ? 413  GLU B CB    1 
ATOM   8251 C  CG    . GLU D 4  425 ? 16.57360 32.00178  -14.68457 1.000 50.16592  ? 413  GLU B CG    1 
ATOM   8252 C  CD    . GLU D 4  425 ? 15.83792 31.16627  -15.69805 1.000 67.34491  ? 413  GLU B CD    1 
ATOM   8253 O  OE1   . GLU D 4  425 ? 16.09924 31.33731  -16.91283 1.000 73.80769  ? 413  GLU B OE1   1 
ATOM   8254 O  OE2   . GLU D 4  425 ? 14.99430 30.33820  -15.28260 1.000 75.87199  ? 413  GLU B OE2   1 
ATOM   8255 N  N     . TRP D 4  426 ? 19.45939 35.00338  -16.42467 1.000 34.04858  ? 414  TRP B N     1 
ATOM   8256 C  CA    . TRP D 4  426 ? 19.92622 36.18772  -17.13609 1.000 34.52043  ? 414  TRP B CA    1 
ATOM   8257 C  C     . TRP D 4  426 ? 20.11179 35.88062  -18.61172 1.000 34.98023  ? 414  TRP B C     1 
ATOM   8258 O  O     . TRP D 4  426 ? 20.05299 34.73510  -19.04725 1.000 37.20016  ? 414  TRP B O     1 
ATOM   8259 C  CB    . TRP D 4  426 ? 21.22929 36.74158  -16.54985 1.000 32.48632  ? 414  TRP B CB    1 
ATOM   8260 C  CG    . TRP D 4  426 ? 22.32535 35.74658  -16.43665 1.000 30.73478  ? 414  TRP B CG    1 
ATOM   8261 C  CD1   . TRP D 4  426 ? 22.85181 34.97677  -17.44339 1.000 31.10899  ? 414  TRP B CD1   1 
ATOM   8262 C  CD2   . TRP D 4  426 ? 23.06856 35.42934  -15.25736 1.000 30.05612  ? 414  TRP B CD2   1 
ATOM   8263 N  NE1   . TRP D 4  426 ? 23.86988 34.19778  -16.95454 1.000 30.69731  ? 414  TRP B NE1   1 
ATOM   8264 C  CE2   . TRP D 4  426 ? 24.02603 34.45440  -15.61709 1.000 31.02602  ? 414  TRP B CE2   1 
ATOM   8265 C  CE3   . TRP D 4  426 ? 23.01855 35.87421  -13.92927 1.000 32.10083  ? 414  TRP B CE3   1 
ATOM   8266 C  CZ2   . TRP D 4  426 ? 24.91655 33.90172  -14.69292 1.000 37.65701  ? 414  TRP B CZ2   1 
ATOM   8267 C  CZ3   . TRP D 4  426 ? 23.91202 35.34081  -13.01542 1.000 35.43661  ? 414  TRP B CZ3   1 
ATOM   8268 C  CH2   . TRP D 4  426 ? 24.84830 34.35819  -13.40157 1.000 40.61118  ? 414  TRP B CH2   1 
ATOM   8269 N  N     . GLU D 4  427 ? 20.30891 36.94263  -19.38286 1.000 38.35571  ? 415  GLU B N     1 
ATOM   8270 C  CA    . GLU D 4  427 ? 20.59388 36.83525  -20.80344 1.000 40.55976  ? 415  GLU B CA    1 
ATOM   8271 C  C     . GLU D 4  427 ? 21.37430 38.07369  -21.21206 1.000 38.48332  ? 415  GLU B C     1 
ATOM   8272 O  O     . GLU D 4  427 ? 21.33167 39.10354  -20.53239 1.000 40.71145  ? 415  GLU B O     1 
ATOM   8273 C  CB    . GLU D 4  427 ? 19.31685 36.67125  -21.62845 1.000 45.65093  ? 415  GLU B CB    1 
ATOM   8274 C  CG    . GLU D 4  427 ? 18.34678 37.81928  -21.51572 1.000 58.10767  ? 415  GLU B CG    1 
ATOM   8275 C  CD    . GLU D 4  427 ? 17.08143 37.56771  -22.31497 1.000 72.41238  ? 415  GLU B CD    1 
ATOM   8276 O  OE1   . GLU D 4  427 ? 17.12428 36.71299  -23.22512 1.000 78.60541  ? 415  GLU B OE1   1 
ATOM   8277 O  OE2   . GLU D 4  427 ? 16.04488 38.20888  -22.02745 1.000 76.75106  ? 415  GLU B OE2   1 
ATOM   8278 N  N     . PHE D 4  428 ? 22.10449 37.96266  -22.31822 1.000 38.01492  ? 416  PHE B N     1 
ATOM   8279 C  CA    . PHE D 4  428 ? 23.07460 38.97599  -22.71904 1.000 38.93556  ? 416  PHE B CA    1 
ATOM   8280 C  C     . PHE D 4  428 ? 22.52858 39.78761  -23.88408 1.000 44.96734  ? 416  PHE B C     1 
ATOM   8281 O  O     . PHE D 4  428 ? 22.04122 39.21965  -24.86784 1.000 53.19959  ? 416  PHE B O     1 
ATOM   8282 C  CB    . PHE D 4  428 ? 24.41513 38.31549  -23.04399 1.000 33.45469  ? 416  PHE B CB    1 
ATOM   8283 C  CG    . PHE D 4  428 ? 24.88043 37.41522  -21.93951 1.000 37.21672  ? 416  PHE B CG    1 
ATOM   8284 C  CD1   . PHE D 4  428 ? 25.37102 37.95334  -20.75849 1.000 33.24284  ? 416  PHE B CD1   1 
ATOM   8285 C  CD2   . PHE D 4  428 ? 24.73450 36.03125  -22.03359 1.000 39.76005  ? 416  PHE B CD2   1 
ATOM   8286 C  CE1   . PHE D 4  428 ? 25.75346 37.13056  -19.70672 1.000 34.06107  ? 416  PHE B CE1   1 
ATOM   8287 C  CE2   . PHE D 4  428 ? 25.13508 35.19761  -20.98944 1.000 33.91833  ? 416  PHE B CE2   1 
ATOM   8288 C  CZ    . PHE D 4  428 ? 25.63203 35.74843  -19.82577 1.000 34.83919  ? 416  PHE B CZ    1 
ATOM   8289 N  N     . VAL D 4  429 ? 22.57242 41.11703  -23.74462 1.000 42.54592  ? 417  VAL B N     1 
ATOM   8290 C  CA    . VAL D 4  429 ? 21.99736 42.03676  -24.71709 1.000 44.25510  ? 417  VAL B CA    1 
ATOM   8291 C  C     . VAL D 4  429 ? 23.05010 43.03631  -25.15702 1.000 51.51183  ? 417  VAL B C     1 
ATOM   8292 O  O     . VAL D 4  429 ? 23.92912 43.42047  -24.38337 1.000 50.54190  ? 417  VAL B O     1 
ATOM   8293 C  CB    . VAL D 4  429 ? 20.77538 42.78498  -24.15189 1.000 39.86308  ? 417  VAL B CB    1 
ATOM   8294 C  CG1   . VAL D 4  429 ? 19.57600 41.87001  -24.11345 1.000 43.22155  ? 417  VAL B CG1   1 
ATOM   8295 C  CG2   . VAL D 4  429 ? 21.07870 43.33381  -22.76199 1.000 34.79531  ? 417  VAL B CG2   1 
ATOM   8296 N  N     . ASN D 4  430 ? 22.95039 43.46258  -26.41407 1.000 64.89040  ? 418  ASN B N     1 
ATOM   8297 C  CA    . ASN D 4  430 ? 23.72391 44.59044  -26.94018 1.000 70.14670  ? 418  ASN B CA    1 
ATOM   8298 C  C     . ASN D 4  430 ? 22.80082 45.80282  -26.90854 1.000 69.80978  ? 418  ASN B C     1 
ATOM   8299 O  O     . ASN D 4  430 ? 22.04853 46.05875  -27.85135 1.000 71.04486  ? 418  ASN B O     1 
ATOM   8300 C  CB    . ASN D 4  430 ? 24.23347 44.29818  -28.34395 1.000 79.41124  ? 418  ASN B CB    1 
ATOM   8301 C  CG    . ASN D 4  430 ? 24.83052 42.91894  -28.45687 1.000 85.91655  ? 418  ASN B CG    1 
ATOM   8302 O  OD1   . ASN D 4  430 ? 26.01471 42.71936  -28.17871 1.000 86.27548  ? 418  ASN B OD1   1 
ATOM   8303 N  ND2   . ASN D 4  430 ? 24.00621 41.94577  -28.84270 1.000 89.05541  ? 418  ASN B ND2   1 
ATOM   8304 N  N     . THR D 4  431 ? 22.85106 46.53945  -25.79928 1.000 68.59866  ? 419  THR B N     1 
ATOM   8305 C  CA    . THR D 4  431 ? 21.94950 47.66350  -25.59499 1.000 69.21911  ? 419  THR B CA    1 
ATOM   8306 C  C     . THR D 4  431 ? 22.14896 48.72233  -26.67938 1.000 71.85948  ? 419  THR B C     1 
ATOM   8307 O  O     . THR D 4  431 ? 23.26108 48.93126  -27.17090 1.000 67.25415  ? 419  THR B O     1 
ATOM   8308 C  CB    . THR D 4  431 ? 22.17273 48.29008  -24.21669 1.000 63.76757  ? 419  THR B CB    1 
ATOM   8309 N  N     . PRO D 4  432 ? 21.08674 49.40187  -27.08014 1.000 78.39589  ? 420  PRO B N     1 
ATOM   8310 C  CA    . PRO D 4  432 ? 21.25239 50.58241  -27.92029 1.000 81.99983  ? 420  PRO B CA    1 
ATOM   8311 C  C     . PRO D 4  432 ? 21.66938 51.75808  -27.06028 1.000 83.43656  ? 420  PRO B C     1 
ATOM   8312 O  O     . PRO D 4  432 ? 21.04635 52.01591  -26.01915 1.000 81.73263  ? 420  PRO B O     1 
ATOM   8313 C  CB    . PRO D 4  432 ? 19.85407 50.79795  -28.52160 1.000 85.34063  ? 420  PRO B CB    1 
ATOM   8314 C  CG    . PRO D 4  432 ? 18.90752 49.88380  -27.72731 1.000 86.01386  ? 420  PRO B CG    1 
ATOM   8315 C  CD    . PRO D 4  432 ? 19.70006 49.24019  -26.61742 1.000 80.60046  ? 420  PRO B CD    1 
ATOM   8316 N  N     . PRO D 4  433 ? 22.72173 52.48575  -27.44149 1.000 84.29010  ? 421  PRO B N     1 
ATOM   8317 C  CA    . PRO D 4  433 ? 23.14156 53.64055  -26.62215 1.000 81.04954  ? 421  PRO B CA    1 
ATOM   8318 C  C     . PRO D 4  433 ? 22.02750 54.66661  -26.41519 1.000 74.77054  ? 421  PRO B C     1 
ATOM   8319 O  O     . PRO D 4  433 ? 22.11974 55.49805  -25.49491 1.000 74.51066  ? 421  PRO B O     1 
ATOM   8320 C  CB    . PRO D 4  433 ? 24.32421 54.22330  -27.41168 1.000 83.56912  ? 421  PRO B CB    1 
ATOM   8321 C  CG    . PRO D 4  433 ? 24.16122 53.69124  -28.81235 1.000 82.87852  ? 421  PRO B CG    1 
ATOM   8322 C  CD    . PRO D 4  433 ? 23.50777 52.35206  -28.68020 1.000 82.75371  ? 421  PRO B CD    1 
ATOM   8323 N  N     . LEU D 4  434 ? 20.95785 54.59365  -27.21630 1.000 70.84044  ? 422  LEU B N     1 
ATOM   8324 C  CA    . LEU D 4  434 ? 19.82370 55.49625  -27.05740 1.000 69.91923  ? 422  LEU B CA    1 
ATOM   8325 C  C     . LEU D 4  434 ? 19.14064 55.32102  -25.70369 1.000 72.31334  ? 422  LEU B C     1 
ATOM   8326 O  O     . LEU D 4  434 ? 18.83355 56.30797  -25.02881 1.000 73.44231  ? 422  LEU B O     1 
ATOM   8327 C  CB    . LEU D 4  434 ? 18.82758 55.28445  -28.19316 1.000 65.03854  ? 422  LEU B CB    1 
ATOM   8328 C  CG    . LEU D 4  434 ? 19.26365 55.95768  -29.49089 1.000 64.40804  ? 422  LEU B CG    1 
ATOM   8329 C  CD1   . LEU D 4  434 ? 18.15227 55.90642  -30.53949 1.000 60.73280  ? 422  LEU B CD1   1 
ATOM   8330 C  CD2   . LEU D 4  434 ? 19.72584 57.38767  -29.20819 1.000 62.73531  ? 422  LEU B CD2   1 
ATOM   8331 N  N     . VAL D 4  435 ? 18.87964 54.07636  -25.28725 1.000 71.92129  ? 423  VAL B N     1 
ATOM   8332 C  CA    . VAL D 4  435 ? 18.19325 53.88598  -24.00663 1.000 70.35506  ? 423  VAL B CA    1 
ATOM   8333 C  C     . VAL D 4  435 ? 19.09852 54.29226  -22.84114 1.000 65.39129  ? 423  VAL B C     1 
ATOM   8334 O  O     . VAL D 4  435 ? 18.62054 54.84215  -21.83025 1.000 65.18108  ? 423  VAL B O     1 
ATOM   8335 C  CB    . VAL D 4  435 ? 17.67686 52.43724  -23.87355 1.000 71.96207  ? 423  VAL B CB    1 
ATOM   8336 C  CG1   . VAL D 4  435 ? 18.81279 51.44678  -23.94974 1.000 75.01771  ? 423  VAL B CG1   1 
ATOM   8337 C  CG2   . VAL D 4  435 ? 16.89422 52.25304  -22.57840 1.000 68.75285  ? 423  VAL B CG2   1 
ATOM   8338 N  N     . LYS D 4  436 ? 20.41171 54.06209  -22.96654 1.000 62.05120  ? 424  LYS B N     1 
ATOM   8339 C  CA    . LYS D 4  436 ? 21.34469 54.59020  -21.97619 1.000 62.28229  ? 424  LYS B CA    1 
ATOM   8340 C  C     . LYS D 4  436 ? 21.19684 56.10174  -21.84232 1.000 64.10144  ? 424  LYS B C     1 
ATOM   8341 O  O     . LYS D 4  436 ? 21.13943 56.62771  -20.72536 1.000 65.38669  ? 424  LYS B O     1 
ATOM   8342 C  CB    . LYS D 4  436 ? 22.78292 54.21398  -22.34310 1.000 61.08100  ? 424  LYS B CB    1 
ATOM   8343 N  N     . LEU D 4  437 ? 21.09951 56.81728  -22.97158 1.000 64.41223  ? 425  LEU B N     1 
ATOM   8344 C  CA    . LEU D 4  437 ? 20.87638 58.26093  -22.89646 1.000 63.08994  ? 425  LEU B CA    1 
ATOM   8345 C  C     . LEU D 4  437 ? 19.51044 58.59674  -22.30130 1.000 61.12192  ? 425  LEU B C     1 
ATOM   8346 O  O     . LEU D 4  437 ? 19.36663 59.61438  -21.61643 1.000 66.38077  ? 425  LEU B O     1 
ATOM   8347 C  CB    . LEU D 4  437 ? 21.02488 58.88987  -24.28204 1.000 68.37398  ? 425  LEU B CB    1 
ATOM   8348 C  CG    . LEU D 4  437 ? 21.79392 60.21583  -24.33073 1.000 75.04382  ? 425  LEU B CG    1 
ATOM   8349 C  CD1   . LEU D 4  437 ? 23.17512 60.07330  -23.69302 1.000 74.33152  ? 425  LEU B CD1   1 
ATOM   8350 C  CD2   . LEU D 4  437 ? 21.91520 60.74789  -25.76268 1.000 81.64891  ? 425  LEU B CD2   1 
ATOM   8351 N  N     . TRP D 4  438 ? 18.50443 57.75605  -22.54292 1.000 58.38436  ? 426  TRP B N     1 
ATOM   8352 C  CA    . TRP D 4  438 ? 17.16052 58.03179  -22.03657 1.000 59.46670  ? 426  TRP B CA    1 
ATOM   8353 C  C     . TRP D 4  438 ? 17.10697 57.97581  -20.51670 1.000 59.50840  ? 426  TRP B C     1 
ATOM   8354 O  O     . TRP D 4  438 ? 16.44647 58.80668  -19.88524 1.000 59.68064  ? 426  TRP B O     1 
ATOM   8355 C  CB    . TRP D 4  438 ? 16.14549 57.03952  -22.61142 1.000 61.99382  ? 426  TRP B CB    1 
ATOM   8356 C  CG    . TRP D 4  438 ? 15.99602 56.98785  -24.13114 1.000 64.35973  ? 426  TRP B CG    1 
ATOM   8357 C  CD1   . TRP D 4  438 ? 15.54855 55.91813  -24.85785 1.000 65.23031  ? 426  TRP B CD1   1 
ATOM   8358 C  CD2   . TRP D 4  438 ? 16.27799 58.03057  -25.09308 1.000 59.99534  ? 426  TRP B CD2   1 
ATOM   8359 N  NE1   . TRP D 4  438 ? 15.53250 56.22649  -26.19892 1.000 66.01370  ? 426  TRP B NE1   1 
ATOM   8360 C  CE2   . TRP D 4  438 ? 15.97558 57.51139  -26.36880 1.000 63.31059  ? 426  TRP B CE2   1 
ATOM   8361 C  CE3   . TRP D 4  438 ? 16.76077 59.33638  -24.99990 1.000 58.05550  ? 426  TRP B CE3   1 
ATOM   8362 C  CZ2   . TRP D 4  438 ? 16.13364 58.25106  -27.52995 1.000 65.27968  ? 426  TRP B CZ2   1 
ATOM   8363 C  CZ3   . TRP D 4  438 ? 16.92175 60.06528  -26.15585 1.000 66.44488  ? 426  TRP B CZ3   1 
ATOM   8364 C  CH2   . TRP D 4  438 ? 16.60451 59.52557  -27.40364 1.000 69.35100  ? 426  TRP B CH2   1 
ATOM   8365 N  N     . TYR D 4  439 ? 17.75784 56.98388  -19.91060 1.000 60.15161  ? 427  TYR B N     1 
ATOM   8366 C  CA    . TYR D 4  439 ? 17.69606 56.85199  -18.45935 1.000 57.21193  ? 427  TYR B CA    1 
ATOM   8367 C  C     . TYR D 4  439 ? 18.81276 57.59622  -17.72798 1.000 59.95647  ? 427  TYR B C     1 
ATOM   8368 O  O     . TYR D 4  439 ? 18.74863 57.70457  -16.49763 1.000 57.99070  ? 427  TYR B O     1 
ATOM   8369 C  CB    . TYR D 4  439 ? 17.71042 55.36783  -18.05798 1.000 50.05499  ? 427  TYR B CB    1 
ATOM   8370 C  CG    . TYR D 4  439 ? 16.40583 54.64349  -18.33074 1.000 43.73888  ? 427  TYR B CG    1 
ATOM   8371 C  CD1   . TYR D 4  439 ? 15.29854 54.83722  -17.51526 1.000 45.47150  ? 427  TYR B CD1   1 
ATOM   8372 C  CD2   . TYR D 4  439 ? 16.28577 53.76211  -19.39558 1.000 43.81116  ? 427  TYR B CD2   1 
ATOM   8373 C  CE1   . TYR D 4  439 ? 14.09765 54.18126  -17.75423 1.000 48.69778  ? 427  TYR B CE1   1 
ATOM   8374 C  CE2   . TYR D 4  439 ? 15.09437 53.09787  -19.64809 1.000 46.48121  ? 427  TYR B CE2   1 
ATOM   8375 C  CZ    . TYR D 4  439 ? 14.00211 53.31285  -18.82471 1.000 53.61821  ? 427  TYR B CZ    1 
ATOM   8376 O  OH    . TYR D 4  439 ? 12.81274 52.65340  -19.06735 1.000 61.63182  ? 427  TYR B OH    1 
ATOM   8377 N  N     . GLN D 4  440 ? 19.81520 58.11409  -18.44474 1.000 63.01099  ? 428  GLN B N     1 
ATOM   8378 C  CA    . GLN D 4  440 ? 20.93184 58.80881  -17.81165 1.000 67.98156  ? 428  GLN B CA    1 
ATOM   8379 C  C     . GLN D 4  440 ? 20.42983 59.96687  -16.95318 1.000 74.78938  ? 428  GLN B C     1 
ATOM   8380 O  O     . GLN D 4  440 ? 19.38181 60.56229  -17.22406 1.000 73.07193  ? 428  GLN B O     1 
ATOM   8381 C  CB    . GLN D 4  440 ? 21.91499 59.32375  -18.86864 1.000 66.04114  ? 428  GLN B CB    1 
ATOM   8382 N  N     . LEU D 4  441 ? 21.19383 60.27974  -15.90469 1.000 78.57726  ? 429  LEU B N     1 
ATOM   8383 C  CA    . LEU D 4  441 ? 20.75724 61.22031  -14.86906 1.000 80.93460  ? 429  LEU B CA    1 
ATOM   8384 C  C     . LEU D 4  441 ? 21.35201 62.61894  -15.05027 1.000 81.83255  ? 429  LEU B C     1 
ATOM   8385 O  O     . LEU D 4  441 ? 22.10618 62.86846  -15.99063 1.000 78.58041  ? 429  LEU B O     1 
ATOM   8386 C  CB    . LEU D 4  441 ? 21.11736 60.67443  -13.48160 1.000 78.32820  ? 429  LEU B CB    1 
HETATM 8387 O  OP2   . D4M E 5  .   ? 48.06736 4.06379   -26.59461 1.000 48.57327  ? 901  D4M P OP2   1 
HETATM 8388 P  P     . D4M E 5  .   ? 48.25622 4.14416   -25.09097 1.000 49.09412  ? 901  D4M P P     1 
HETATM 8389 O  OP1   . D4M E 5  .   ? 48.65605 2.88989   -24.34818 1.000 40.43397  ? 901  D4M P OP1   1 
HETATM 8390 O  "O5'" . D4M E 5  .   ? 49.48067 5.15016   -24.74639 1.000 53.94250  ? 901  D4M P "O5'" 1 
HETATM 8391 C  "C5'" . D4M E 5  .   ? 50.51400 5.37847   -25.69239 1.000 58.55916  ? 901  D4M P "C5'" 1 
HETATM 8392 C  "C4'" . D4M E 5  .   ? 51.68256 4.49319   -25.28535 1.000 65.44132  ? 901  D4M P "C4'" 1 
HETATM 8393 O  "O4'" . D4M E 5  .   ? 52.50661 4.25942   -26.42951 1.000 71.75561  ? 901  D4M P "O4'" 1 
HETATM 8394 C  "C3'" . D4M E 5  .   ? 52.57787 5.17065   -24.27976 1.000 65.46589  ? 901  D4M P "C3'" 1 
HETATM 8395 C  "C2'" . D4M E 5  .   ? 53.80829 5.24341   -24.76747 1.000 68.45433  ? 901  D4M P "C2'" 1 
HETATM 8396 C  "C1'" . D4M E 5  .   ? 53.87667 4.39244   -26.01414 1.000 74.39179  ? 901  D4M P "C1'" 1 
HETATM 8397 N  N1    . D4M E 5  .   ? 54.76996 4.85902   -27.10156 1.000 80.12913  ? 901  D4M P N1    1 
HETATM 8398 C  C6    . D4M E 5  .   ? 55.90249 4.16038   -27.31880 1.000 80.33370  ? 901  D4M P C6    1 
HETATM 8399 C  C5    . D4M E 5  .   ? 56.78276 4.52966   -28.33171 1.000 80.35818  ? 901  D4M P C5    1 
HETATM 8400 C  C5M   . D4M E 5  .   ? 58.05686 3.74671   -28.55502 1.000 77.28578  ? 901  D4M P C5M   1 
HETATM 8401 C  C4    . D4M E 5  .   ? 56.42302 5.71019   -29.17258 1.000 79.82209  ? 901  D4M P C4    1 
HETATM 8402 O  O4    . D4M E 5  .   ? 57.17188 6.09645   -30.09684 1.000 75.75589  ? 901  D4M P O4    1 
HETATM 8403 N  N3    . D4M E 5  .   ? 55.27840 6.36501   -28.92051 1.000 81.29554  ? 901  D4M P N3    1 
HETATM 8404 C  C2    . D4M E 5  .   ? 54.45791 5.97688   -27.92721 1.000 82.46298  ? 901  D4M P C2    1 
HETATM 8405 O  O2    . D4M E 5  .   ? 53.40883 6.62655   -27.73674 1.000 84.83096  ? 901  D4M P O2    1 
HETATM 8406 S  S     . SO4 F 6  .   ? 32.82461 18.06871  -32.37254 1.000 124.07008 ? 902  SO4 P S     1 
HETATM 8407 O  O1    . SO4 F 6  .   ? 33.62449 19.26350  -32.10999 1.000 126.56366 ? 902  SO4 P O1    1 
HETATM 8408 O  O2    . SO4 F 6  .   ? 32.88488 17.73778  -33.79434 1.000 122.29420 ? 902  SO4 P O2    1 
HETATM 8409 O  O3    . SO4 F 6  .   ? 33.36293 16.95647  -31.59452 1.000 123.85291 ? 902  SO4 P O3    1 
HETATM 8410 O  O4    . SO4 F 6  .   ? 31.43691 18.32151  -31.98880 1.000 122.86439 ? 902  SO4 P O4    1 
HETATM 8411 MG MG    . MG  G 7  .   ? 47.09607 2.86009   -22.81718 1.000 43.26714  ? 903  MG  P MG    1 
HETATM 8412 S  S     . SO4 H 6  .   ? 35.51286 11.21854  -32.04806 1.000 109.06339 ? 801  SO4 T S     1 
HETATM 8413 O  O1    . SO4 H 6  .   ? 36.67150 11.32676  -32.93466 1.000 108.52316 ? 801  SO4 T O1    1 
HETATM 8414 O  O2    . SO4 H 6  .   ? 34.32335 11.75370  -32.70759 1.000 109.33165 ? 801  SO4 T O2    1 
HETATM 8415 O  O3    . SO4 H 6  .   ? 35.75561 11.97841  -30.82241 1.000 105.94339 ? 801  SO4 T O3    1 
HETATM 8416 O  O4    . SO4 H 6  .   ? 35.28067 9.80658   -31.73988 1.000 109.76137 ? 801  SO4 T O4    1 
HETATM 8417 MG MG    . MG  I 7  .   ? 15.30820 56.85222  -42.13718 1.000 24.71888  ? 601  MG  A MG    1 
HETATM 8418 MG MG    . MG  J 7  .   ? 46.83333 -0.29224  -21.94756 1.000 32.02568  ? 602  MG  A MG    1 
HETATM 8419 P  PC    . D4T K 8  .   ? 47.53273 -2.73097  -24.17611 1.000 45.18245  ? 603  D4T A PC    1 
HETATM 8420 O  O1C   . D4T K 8  .   ? 48.05742 -3.93635  -23.36973 1.000 43.78498  ? 603  D4T A O1C   1 
HETATM 8421 O  O2C   . D4T K 8  .   ? 47.95562 -1.42733  -23.46619 1.000 48.30376  ? 603  D4T A O2C   1 
HETATM 8422 O  O3C   . D4T K 8  .   ? 48.18793 -2.76927  -25.53428 1.000 44.23177  ? 603  D4T A O3C   1 
HETATM 8423 O  "O7'" . D4T K 8  .   ? 45.94800 -2.88311  -24.33962 1.000 49.91933  ? 603  D4T A "O7'" 1 
HETATM 8424 P  PB    . D4T K 8  .   ? 44.77209 -1.85627  -24.11878 1.000 50.05691  ? 603  D4T A PB    1 
HETATM 8425 O  O1B   . D4T K 8  .   ? 43.41830 -2.57244  -24.32470 1.000 51.54155  ? 603  D4T A O1B   1 
HETATM 8426 O  O2B   . D4T K 8  .   ? 44.82450 -1.32154  -22.70373 1.000 44.66752  ? 603  D4T A O2B   1 
HETATM 8427 O  "O6'" . D4T K 8  .   ? 44.84494 -0.68471  -25.22279 1.000 51.13939  ? 603  D4T A "O6'" 1 
HETATM 8428 P  PA    . D4T K 8  .   ? 45.40276 0.79430   -25.04039 1.000 45.46648  ? 603  D4T A PA    1 
HETATM 8429 O  O1A   . D4T K 8  .   ? 46.22061 1.14550   -26.28754 1.000 43.29421  ? 603  D4T A O1A   1 
HETATM 8430 O  O2A   . D4T K 8  .   ? 46.30568 0.87271   -23.81467 1.000 38.09780  ? 603  D4T A O2A   1 
HETATM 8431 O  "O5'" . D4T K 8  .   ? 44.13039 1.77277   -24.86912 1.000 44.41091  ? 603  D4T A "O5'" 1 
HETATM 8432 C  "C5'" . D4T K 8  .   ? 43.48918 1.74529   -23.61373 1.000 48.07343  ? 603  D4T A "C5'" 1 
HETATM 8433 C  "C4'" . D4T K 8  .   ? 42.00067 1.57991   -23.73597 1.000 52.58216  ? 603  D4T A "C4'" 1 
HETATM 8434 O  "O4'" . D4T K 8  .   ? 41.42083 2.78589   -24.58464 1.000 54.89708  ? 603  D4T A "O4'" 1 
HETATM 8435 C  "C1'" . D4T K 8  .   ? 40.57453 2.08979   -25.63443 1.000 51.74154  ? 603  D4T A "C1'" 1 
HETATM 8436 N  N1    . D4T K 8  .   ? 41.02874 2.50332   -26.96657 1.000 49.31132  ? 603  D4T A N1    1 
HETATM 8437 C  C6    . D4T K 8  .   ? 42.31347 2.87010   -27.20045 1.000 46.05511  ? 603  D4T A C6    1 
HETATM 8438 C  C2    . D4T K 8  .   ? 40.11429 2.49922   -27.98146 1.000 47.26936  ? 603  D4T A C2    1 
HETATM 8439 O  O2    . D4T K 8  .   ? 38.98524 2.17047   -27.75322 1.000 48.44218  ? 603  D4T A O2    1 
HETATM 8440 N  N3    . D4T K 8  .   ? 40.51248 2.86697   -29.24502 1.000 43.51043  ? 603  D4T A N3    1 
HETATM 8441 C  C4    . D4T K 8  .   ? 41.79449 3.23997   -29.49447 1.000 45.04204  ? 603  D4T A C4    1 
HETATM 8442 O  O4    . D4T K 8  .   ? 42.11974 3.56245   -30.61503 1.000 49.02021  ? 603  D4T A O4    1 
HETATM 8443 C  C5    . D4T K 8  .   ? 42.71171 3.24926   -28.47405 1.000 42.15824  ? 603  D4T A C5    1 
HETATM 8444 C  C5A   . D4T K 8  .   ? 44.17230 3.67332   -28.75623 1.000 32.01390  ? 603  D4T A C5A   1 
HETATM 8445 C  "C2'" . D4T K 8  .   ? 40.71083 0.80068   -25.41319 1.000 44.67149  ? 603  D4T A "C2'" 1 
HETATM 8446 C  "C3'" . D4T K 8  .   ? 41.69099 0.52001   -24.37373 1.000 46.29824  ? 603  D4T A "C3'" 1 
HETATM 8447 S  S     . SO4 L 6  .   ? 27.54105 76.62017  -40.37968 1.000 58.94110  ? 604  SO4 A S     1 
HETATM 8448 O  O1    . SO4 L 6  .   ? 27.58362 77.83796  -41.18715 1.000 61.91953  ? 604  SO4 A O1    1 
HETATM 8449 O  O2    . SO4 L 6  .   ? 28.00486 75.47340  -41.16710 1.000 52.38430  ? 604  SO4 A O2    1 
HETATM 8450 O  O3    . SO4 L 6  .   ? 26.17789 76.36997  -39.95864 1.000 61.35425  ? 604  SO4 A O3    1 
HETATM 8451 O  O4    . SO4 L 6  .   ? 28.34791 76.82171  -39.18762 1.000 58.55937  ? 604  SO4 A O4    1 
HETATM 8452 S  S     . SO4 M 6  .   ? 58.58566 16.18340  -14.92494 1.000 115.40478 ? 605  SO4 A S     1 
HETATM 8453 O  O1    . SO4 M 6  .   ? 57.40302 16.62263  -15.65788 1.000 114.09155 ? 605  SO4 A O1    1 
HETATM 8454 O  O2    . SO4 M 6  .   ? 59.75574 16.96565  -15.31238 1.000 115.67420 ? 605  SO4 A O2    1 
HETATM 8455 O  O3    . SO4 M 6  .   ? 58.36753 16.35389  -13.48404 1.000 113.92694 ? 605  SO4 A O3    1 
HETATM 8456 O  O4    . SO4 M 6  .   ? 58.83525 14.78583  -15.27550 1.000 116.29053 ? 605  SO4 A O4    1 
HETATM 8457 C  C1    . GOL N 9  .   ? 36.95896 22.56152  -17.17907 1.000 48.85538  ? 501  GOL B C1    1 
HETATM 8458 O  O1    . GOL N 9  .   ? 35.68035 22.19205  -16.75104 1.000 46.30611  ? 501  GOL B O1    1 
HETATM 8459 C  C2    . GOL N 9  .   ? 37.79736 21.25604  -17.28096 1.000 52.41629  ? 501  GOL B C2    1 
HETATM 8460 O  O2    . GOL N 9  .   ? 38.56496 21.14272  -18.51369 1.000 46.18782  ? 501  GOL B O2    1 
HETATM 8461 C  C3    . GOL N 9  .   ? 38.64136 21.21606  -15.94733 1.000 57.96260  ? 501  GOL B C3    1 
HETATM 8462 O  O3    . GOL N 9  .   ? 38.55076 19.89258  -15.39711 1.000 61.27346  ? 501  GOL B O3    1 
HETATM 8463 O  O     . HOH O 10 .   ? 37.66598 13.71948  -33.54639 1.000 47.11311  ? 1001 HOH P O     1 
HETATM 8464 O  O     . HOH O 10 .   ? 44.86392 16.00150  -27.09666 1.000 32.81726  ? 1002 HOH P O     1 
HETATM 8465 O  O     . HOH O 10 .   ? 28.42014 43.54200  -35.18079 1.000 46.03794  ? 1003 HOH P O     1 
HETATM 8466 O  O     . HOH O 10 .   ? 52.54759 9.66495   -26.10283 1.000 42.81105  ? 1004 HOH P O     1 
HETATM 8467 O  O     . HOH O 10 .   ? 26.80765 38.31459  -25.89512 1.000 41.12227  ? 1005 HOH P O     1 
HETATM 8468 O  O     . HOH O 10 .   ? 52.31623 1.48125   -27.56389 1.000 53.56525  ? 1006 HOH P O     1 
HETATM 8469 O  O     . HOH O 10 .   ? 27.24459 25.48145  -27.20316 1.000 59.69038  ? 1007 HOH P O     1 
HETATM 8470 O  O     . HOH P 10 .   ? 36.79067 3.40793   -26.74883 1.000 30.52152  ? 901  HOH T O     1 
HETATM 8471 O  O     . HOH P 10 .   ? 27.58951 6.59559   -30.15642 1.000 44.90285  ? 902  HOH T O     1 
HETATM 8472 O  O     . HOH P 10 .   ? 37.12218 10.07763  -23.44047 1.000 25.54854  ? 903  HOH T O     1 
HETATM 8473 O  O     . HOH P 10 .   ? 33.69851 19.19736  -27.38121 1.000 48.85225  ? 904  HOH T O     1 
HETATM 8474 O  O     . HOH P 10 .   ? 44.01500 18.77868  -27.43837 1.000 46.60409  ? 905  HOH T O     1 
HETATM 8475 O  O     . HOH P 10 .   ? 42.29038 21.20083  -24.62787 1.000 45.04939  ? 906  HOH T O     1 
HETATM 8476 O  O     . HOH Q 10 .   ? 9.60511  70.06550  -40.47547 1.000 37.84148  ? 701  HOH A O     1 
HETATM 8477 O  O     . HOH Q 10 .   ? 32.19908 -19.83457 -23.19250 1.000 46.06625  ? 702  HOH A O     1 
HETATM 8478 O  O     . HOH Q 10 .   ? 25.08760 46.91127  -24.24525 1.000 46.19193  ? 703  HOH A O     1 
HETATM 8479 O  O     . HOH Q 10 .   ? 28.69835 77.02851  -36.84436 1.000 31.08746  ? 704  HOH A O     1 
HETATM 8480 O  O     . HOH Q 10 .   ? 31.41131 4.03298   -12.03592 1.000 29.98506  ? 705  HOH A O     1 
HETATM 8481 O  O     . HOH Q 10 .   ? 32.73994 72.97822  -32.07750 1.000 43.00114  ? 706  HOH A O     1 
HETATM 8482 O  O     . HOH Q 10 .   ? 34.44511 1.96786   -27.00491 1.000 44.21400  ? 707  HOH A O     1 
HETATM 8483 O  O     . HOH Q 10 .   ? 48.20259 1.75685   -27.64971 1.000 36.38176  ? 708  HOH A O     1 
HETATM 8484 O  O     . HOH Q 10 .   ? 12.92333 58.23475  -42.66814 1.000 48.29372  ? 709  HOH A O     1 
HETATM 8485 O  O     . HOH Q 10 .   ? 42.87385 57.69819  -25.95458 1.000 37.49716  ? 710  HOH A O     1 
HETATM 8486 O  O     . HOH Q 10 .   ? 26.60182 73.19295  -38.84008 1.000 35.68827  ? 711  HOH A O     1 
HETATM 8487 O  O     . HOH Q 10 .   ? 31.63217 6.54599   -22.70998 1.000 30.45853  ? 712  HOH A O     1 
HETATM 8488 O  O     . HOH Q 10 .   ? 58.60177 30.44820  -17.31064 1.000 37.77283  ? 713  HOH A O     1 
HETATM 8489 O  O     . HOH Q 10 .   ? 47.67744 17.70586  -24.21842 1.000 28.00095  ? 714  HOH A O     1 
HETATM 8490 O  O     . HOH Q 10 .   ? 52.56611 8.14347   -0.04516  1.000 38.16412  ? 715  HOH A O     1 
HETATM 8491 O  O     . HOH Q 10 .   ? 41.06991 9.65700   -17.75475 1.000 25.02684  ? 716  HOH A O     1 
HETATM 8492 O  O     . HOH Q 10 .   ? 48.74552 27.76014  -8.46589  1.000 37.75870  ? 717  HOH A O     1 
HETATM 8493 O  O     . HOH Q 10 .   ? 40.71169 8.38829   -7.52743  1.000 25.88321  ? 718  HOH A O     1 
HETATM 8494 O  O     . HOH Q 10 .   ? 54.16606 14.80053  -5.17054  1.000 43.62185  ? 719  HOH A O     1 
HETATM 8495 O  O     . HOH Q 10 .   ? 57.93475 28.46604  -26.94029 1.000 38.37414  ? 720  HOH A O     1 
HETATM 8496 O  O     . HOH Q 10 .   ? 52.04440 7.83414   -22.29867 1.000 43.67768  ? 721  HOH A O     1 
HETATM 8497 O  O     . HOH Q 10 .   ? 57.35371 23.01011  -10.12541 1.000 39.27080  ? 722  HOH A O     1 
HETATM 8498 O  O     . HOH Q 10 .   ? 50.13997 19.22389  -11.93564 1.000 27.04587  ? 723  HOH A O     1 
HETATM 8499 O  O     . HOH Q 10 .   ? 52.74510 -0.81030  -17.55543 1.000 29.17741  ? 724  HOH A O     1 
HETATM 8500 O  O     . HOH Q 10 .   ? 31.80661 70.88122  -42.79427 1.000 40.83859  ? 725  HOH A O     1 
HETATM 8501 O  O     . HOH Q 10 .   ? 19.94583 64.47872  -31.69991 1.000 55.73166  ? 726  HOH A O     1 
HETATM 8502 O  O     . HOH Q 10 .   ? 63.48534 0.73694   -4.14724  1.000 41.15061  ? 727  HOH A O     1 
HETATM 8503 O  O     . HOH Q 10 .   ? 44.64669 -5.76331  -16.85007 1.000 32.13620  ? 728  HOH A O     1 
HETATM 8504 O  O     . HOH Q 10 .   ? 46.77830 -7.06225  -28.48690 1.000 44.38293  ? 729  HOH A O     1 
HETATM 8505 O  O     . HOH Q 10 .   ? 44.04657 20.46830  -18.93889 1.000 25.51726  ? 730  HOH A O     1 
HETATM 8506 O  O     . HOH Q 10 .   ? 47.51995 9.48663   -4.84602  1.000 41.48844  ? 731  HOH A O     1 
HETATM 8507 O  O     . HOH Q 10 .   ? 18.31821 62.82326  -40.82115 1.000 30.46301  ? 732  HOH A O     1 
HETATM 8508 O  O     . HOH Q 10 .   ? 34.10973 10.73780  -20.38384 1.000 33.20337  ? 733  HOH A O     1 
HETATM 8509 O  O     . HOH Q 10 .   ? 41.27564 -3.95064  -23.36852 1.000 24.95159  ? 734  HOH A O     1 
HETATM 8510 O  O     . HOH Q 10 .   ? 62.79329 9.78733   -0.38877  1.000 28.40588  ? 735  HOH A O     1 
HETATM 8511 O  O     . HOH Q 10 .   ? 49.28071 -3.67884  -11.94124 1.000 28.60923  ? 736  HOH A O     1 
HETATM 8512 O  O     . HOH Q 10 .   ? 55.62158 12.92897  -2.84477  1.000 39.59194  ? 737  HOH A O     1 
HETATM 8513 O  O     . HOH Q 10 .   ? 38.72730 -20.72445 -26.26003 1.000 47.80087  ? 738  HOH A O     1 
HETATM 8514 O  O     . HOH Q 10 .   ? 51.00785 30.21270  -31.75778 1.000 32.60201  ? 739  HOH A O     1 
HETATM 8515 O  O     . HOH Q 10 .   ? 51.76252 10.85412  -0.28558  1.000 40.38370  ? 740  HOH A O     1 
HETATM 8516 O  O     . HOH Q 10 .   ? 8.97140  58.16463  -45.40751 1.000 50.12478  ? 741  HOH A O     1 
HETATM 8517 O  O     . HOH Q 10 .   ? 34.39585 19.76743  -20.56538 1.000 46.31075  ? 742  HOH A O     1 
HETATM 8518 O  O     . HOH Q 10 .   ? 7.97957  48.84229  -49.78227 1.000 48.19831  ? 743  HOH A O     1 
HETATM 8519 O  O     . HOH Q 10 .   ? 36.34446 72.44745  -34.45806 1.000 47.34989  ? 744  HOH A O     1 
HETATM 8520 O  O     . HOH Q 10 .   ? 41.85535 -9.83760  -7.30688  1.000 44.32110  ? 745  HOH A O     1 
HETATM 8521 O  O     . HOH Q 10 .   ? 30.71263 -2.05860  -15.68159 1.000 35.57355  ? 746  HOH A O     1 
HETATM 8522 O  O     . HOH Q 10 .   ? 28.34747 4.96833   -32.26349 1.000 41.74699  ? 747  HOH A O     1 
HETATM 8523 O  O     . HOH Q 10 .   ? 19.18055 72.35502  -47.69899 1.000 46.85321  ? 748  HOH A O     1 
HETATM 8524 O  O     . HOH Q 10 .   ? 11.47098 63.30862  -38.05853 1.000 29.88114  ? 749  HOH A O     1 
HETATM 8525 O  O     . HOH Q 10 .   ? 22.61499 50.10068  -57.04130 1.000 53.40133  ? 750  HOH A O     1 
HETATM 8526 O  O     . HOH Q 10 .   ? 48.24848 10.20715  -17.82443 1.000 30.61407  ? 751  HOH A O     1 
HETATM 8527 O  O     . HOH Q 10 .   ? 28.80051 61.61347  -32.20932 1.000 45.03032  ? 752  HOH A O     1 
HETATM 8528 O  O     . HOH Q 10 .   ? 66.89070 6.46988   -3.44633  1.000 38.92481  ? 753  HOH A O     1 
HETATM 8529 O  O     . HOH Q 10 .   ? 28.95753 -2.15791  -17.33557 1.000 28.18906  ? 754  HOH A O     1 
HETATM 8530 O  O     . HOH Q 10 .   ? 38.87993 15.42847  -16.84115 1.000 24.51046  ? 755  HOH A O     1 
HETATM 8531 O  O     . HOH Q 10 .   ? 12.65262 67.76190  -49.63362 1.000 51.18551  ? 756  HOH A O     1 
HETATM 8532 O  O     . HOH Q 10 .   ? 62.20629 10.17207  -12.28629 1.000 50.51165  ? 757  HOH A O     1 
HETATM 8533 O  O     . HOH Q 10 .   ? 32.31163 -1.25140  -13.60770 1.000 35.65031  ? 758  HOH A O     1 
HETATM 8534 O  O     . HOH Q 10 .   ? 62.09754 2.85867   -19.12747 1.000 57.68707  ? 759  HOH A O     1 
HETATM 8535 O  O     . HOH Q 10 .   ? 41.12533 20.32617  -22.31862 1.000 31.03559  ? 760  HOH A O     1 
HETATM 8536 O  O     . HOH Q 10 .   ? 47.43478 15.42974  -25.85475 1.000 37.03573  ? 761  HOH A O     1 
HETATM 8537 O  O     . HOH Q 10 .   ? 32.61624 47.75438  -33.05157 1.000 28.31826  ? 762  HOH A O     1 
HETATM 8538 O  O     . HOH Q 10 .   ? 33.08324 1.82240   -11.52492 1.000 41.96083  ? 763  HOH A O     1 
HETATM 8539 O  O     . HOH Q 10 .   ? 46.87998 12.10678  -5.03902  1.000 41.92070  ? 764  HOH A O     1 
HETATM 8540 O  O     . HOH Q 10 .   ? 53.38972 4.14347   -20.62205 1.000 41.07342  ? 765  HOH A O     1 
HETATM 8541 O  O     . HOH Q 10 .   ? 59.25918 0.52394   -9.68663  1.000 40.48841  ? 766  HOH A O     1 
HETATM 8542 O  O     . HOH Q 10 .   ? 30.11105 48.15341  -34.52327 1.000 26.88168  ? 767  HOH A O     1 
HETATM 8543 O  O     . HOH Q 10 .   ? 43.12476 29.37934  -32.26474 1.000 43.81715  ? 768  HOH A O     1 
HETATM 8544 O  O     . HOH Q 10 .   ? 29.15509 36.30789  -34.19576 1.000 52.44320  ? 769  HOH A O     1 
HETATM 8545 O  O     . HOH Q 10 .   ? 32.98361 16.25039  -20.76720 1.000 51.36634  ? 770  HOH A O     1 
HETATM 8546 O  O     . HOH Q 10 .   ? 37.90843 70.52191  -44.82441 1.000 38.44942  ? 771  HOH A O     1 
HETATM 8547 O  O     . HOH Q 10 .   ? 59.39529 2.64378   -11.62997 1.000 53.54532  ? 772  HOH A O     1 
HETATM 8548 O  O     . HOH Q 10 .   ? 41.43548 11.49445  -3.02047  1.000 54.39802  ? 773  HOH A O     1 
HETATM 8549 O  O     . HOH Q 10 .   ? 61.09361 5.30204   -12.47165 1.000 58.61416  ? 774  HOH A O     1 
HETATM 8550 O  O     . HOH Q 10 .   ? 41.78069 -1.28122  -2.06282  1.000 26.51280  ? 775  HOH A O     1 
HETATM 8551 O  O     . HOH Q 10 .   ? 62.16315 2.11267   -0.27944  1.000 42.95077  ? 776  HOH A O     1 
HETATM 8552 O  O     . HOH Q 10 .   ? 44.30060 -8.14141  -27.07088 1.000 45.20720  ? 777  HOH A O     1 
HETATM 8553 O  O     . HOH Q 10 .   ? 43.57103 22.01036  -20.96370 1.000 35.29261  ? 778  HOH A O     1 
HETATM 8554 O  O     . HOH Q 10 .   ? 45.98049 1.30495   -1.22438  1.000 39.10964  ? 779  HOH A O     1 
HETATM 8555 O  O     . HOH Q 10 .   ? 57.031   -6.706    -14.424   1.000 34.77190  ? 780  HOH A O     1 
HETATM 8556 O  O     . HOH Q 10 .   ? 38.54978 49.05595  -16.53476 1.000 53.03575  ? 781  HOH A O     1 
HETATM 8557 O  O     . HOH Q 10 .   ? 28.25207 46.26648  -33.99573 1.000 45.44233  ? 782  HOH A O     1 
HETATM 8558 O  O     . HOH Q 10 .   ? 54.51554 10.52005  -0.78623  1.000 30.71998  ? 783  HOH A O     1 
HETATM 8559 O  O     . HOH Q 10 .   ? 43.65895 0.00000   -0.00000  0.500 41.25217  ? 784  HOH A O     1 
HETATM 8560 O  O     . HOH Q 10 .   ? 39.41854 -0.86733  -1.09898  1.000 40.51237  ? 785  HOH A O     1 
HETATM 8561 O  O     . HOH Q 10 .   ? 39.03128 10.37626  -6.25315  1.000 43.94357  ? 786  HOH A O     1 
HETATM 8562 O  O     . HOH R 10 .   ? 13.06642 50.47406  -19.94115 1.000 50.17490  ? 601  HOH B O     1 
HETATM 8563 O  O     . HOH R 10 .   ? 19.75896 38.87107  -25.55119 1.000 49.03637  ? 602  HOH B O     1 
HETATM 8564 O  O     . HOH R 10 .   ? 21.63167 24.82576  -13.83484 1.000 35.67646  ? 603  HOH B O     1 
HETATM 8565 O  O     . HOH R 10 .   ? 8.57200  20.03405  6.20422   1.000 56.13217  ? 604  HOH B O     1 
HETATM 8566 O  O     . HOH R 10 .   ? 27.05943 73.58109  -36.25164 1.000 34.89113  ? 605  HOH B O     1 
HETATM 8567 O  O     . HOH R 10 .   ? 18.08185 79.08310  -26.24589 1.000 37.84001  ? 606  HOH B O     1 
HETATM 8568 O  O     . HOH R 10 .   ? 33.40200 29.57590  -10.99217 1.000 31.85061  ? 607  HOH B O     1 
HETATM 8569 O  O     . HOH R 10 .   ? 42.37589 12.98579  -17.22696 1.000 27.38934  ? 608  HOH B O     1 
HETATM 8570 O  O     . HOH R 10 .   ? 10.61304 49.19140  -19.62119 1.000 39.98320  ? 609  HOH B O     1 
HETATM 8571 O  O     . HOH R 10 .   ? 27.46448 9.15312   1.60975   1.000 42.03473  ? 610  HOH B O     1 
HETATM 8572 O  O     . HOH R 10 .   ? 9.56929  31.78310  -0.77278  1.000 51.38946  ? 611  HOH B O     1 
HETATM 8573 O  O     . HOH R 10 .   ? 24.28367 71.18523  -28.05260 1.000 50.23167  ? 612  HOH B O     1 
HETATM 8574 O  O     . HOH R 10 .   ? 35.98308 47.84232  -15.84323 1.000 43.15819  ? 613  HOH B O     1 
HETATM 8575 O  O     . HOH R 10 .   ? 16.83549 72.38979  -38.62488 1.000 36.95432  ? 614  HOH B O     1 
HETATM 8576 O  O     . HOH R 10 .   ? 46.43427 11.77235  -8.09180  1.000 39.23397  ? 615  HOH B O     1 
HETATM 8577 O  O     . HOH R 10 .   ? 0.81443  60.68592  -19.05963 1.000 49.55162  ? 616  HOH B O     1 
HETATM 8578 O  O     . HOH R 10 .   ? 18.51268 68.13361  -24.53349 1.000 38.67253  ? 617  HOH B O     1 
HETATM 8579 O  O     . HOH R 10 .   ? 21.69825 35.87379  -24.00465 1.000 35.21866  ? 618  HOH B O     1 
HETATM 8580 O  O     . HOH R 10 .   ? 2.10884  56.45664  -16.71526 1.000 48.15195  ? 619  HOH B O     1 
HETATM 8581 O  O     . HOH R 10 .   ? 33.15683 52.50686  -5.86010  1.000 61.98512  ? 620  HOH B O     1 
HETATM 8582 O  O     . HOH R 10 .   ? 30.98361 18.94576  -17.66368 1.000 41.32246  ? 621  HOH B O     1 
HETATM 8583 O  O     . HOH R 10 .   ? 10.02634 27.03721  -3.49272  1.000 47.00129  ? 622  HOH B O     1 
HETATM 8584 O  O     . HOH R 10 .   ? 15.58184 80.12845  -24.98871 1.000 47.44984  ? 623  HOH B O     1 
HETATM 8585 O  O     . HOH R 10 .   ? 11.32022 71.72798  -41.43179 1.000 41.72343  ? 624  HOH B O     1 
HETATM 8586 O  O     . HOH R 10 .   ? 28.79029 19.64251  -12.33150 1.000 23.31368  ? 625  HOH B O     1 
HETATM 8587 O  O     . HOH R 10 .   ? 27.31417 78.07120  -35.29030 1.000 28.14192  ? 626  HOH B O     1 
HETATM 8588 O  O     . HOH R 10 .   ? 20.30917 22.43695  -12.69610 1.000 30.16519  ? 627  HOH B O     1 
HETATM 8589 O  O     . HOH R 10 .   ? 19.71728 20.79129  -19.28881 1.000 42.61980  ? 628  HOH B O     1 
HETATM 8590 O  O     . HOH R 10 .   ? 18.66850 30.91820  -1.72716  1.000 61.06764  ? 629  HOH B O     1 
HETATM 8591 O  O     . HOH R 10 .   ? 42.68606 19.22573  -8.70304  1.000 33.49128  ? 630  HOH B O     1 
HETATM 8592 O  O     . HOH R 10 .   ? 26.51869 22.93441  -20.96993 1.000 45.53102  ? 631  HOH B O     1 
HETATM 8593 O  O     . HOH R 10 .   ? 25.15068 63.67322  -27.69352 1.000 52.44236  ? 632  HOH B O     1 
HETATM 8594 O  O     . HOH R 10 .   ? 19.14581 29.91336  -7.49923  1.000 54.54213  ? 633  HOH B O     1 
HETATM 8595 O  O     . HOH R 10 .   ? 36.28133 29.31971  -10.79817 1.000 41.05610  ? 634  HOH B O     1 
HETATM 8596 O  O     . HOH R 10 .   ? 25.71797 40.95597  -25.45754 1.000 50.45178  ? 635  HOH B O     1 
HETATM 8597 O  O     . HOH R 10 .   ? 42.80179 29.78562  -7.04187  1.000 43.50802  ? 636  HOH B O     1 
HETATM 8598 O  O     . HOH R 10 .   ? 20.34026 27.80478  -7.34257  1.000 37.49108  ? 637  HOH B O     1 
HETATM 8599 O  O     . HOH R 10 .   ? 34.97208 48.29756  -8.41935  1.000 39.98088  ? 638  HOH B O     1 
HETATM 8600 O  O     . HOH R 10 .   ? 28.96222 3.96721   -11.26661 1.000 43.92401  ? 639  HOH B O     1 
HETATM 8601 O  O     . HOH R 10 .   ? 47.46522 14.60656  -6.11684  1.000 44.01616  ? 640  HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    O "O5'" . DG  A 4   ? 0.53369 0.58975 1.23369 -0.00708 0.23991  -0.14019 805 DG  P "O5'" 
2    C "C5'" . DG  A 4   ? 0.60027 0.73658 1.31799 -0.06584 0.25380  -0.17203 805 DG  P "C5'" 
3    C "C4'" . DG  A 4   ? 0.64941 0.91695 1.39551 -0.09676 0.20070  -0.14799 805 DG  P "C4'" 
4    O "O4'" . DG  A 4   ? 0.63021 0.92961 1.42474 -0.04791 0.16389  -0.09690 805 DG  P "O4'" 
5    C "C3'" . DG  A 4   ? 0.67816 0.96186 1.37286 -0.12396 0.17325  -0.14226 805 DG  P "C3'" 
6    O "O3'" . DG  A 4   ? 0.69983 1.04661 1.37470 -0.19578 0.18533  -0.18043 805 DG  P "O3'" 
7    C "C2'" . DG  A 4   ? 0.64127 0.99534 1.36375 -0.09855 0.11444  -0.08655 805 DG  P "C2'" 
8    C "C1'" . DG  A 4   ? 0.63337 0.97843 1.41510 -0.04496 0.11526  -0.05883 805 DG  P "C1'" 
9    N N9    . DG  A 4   ? 0.62247 0.87908 1.39183 0.01470  0.10695  -0.02491 805 DG  P N9    
10   C C8    . DG  A 4   ? 0.63493 0.79678 1.40928 0.05961  0.13541  -0.02637 805 DG  P C8    
11   N N7    . DG  A 4   ? 0.61460 0.71238 1.37060 0.10058  0.12208  0.00352  805 DG  P N7    
12   C C5    . DG  A 4   ? 0.60550 0.75533 1.34626 0.08518  0.08391  0.02829  805 DG  P C5    
13   C C6    . DG  A 4   ? 0.58733 0.69953 1.30441 0.11133  0.06039  0.06344  805 DG  P C6    
14   O O6    . DG  A 4   ? 0.52089 0.54561 1.22404 0.14977  0.06884  0.07651  805 DG  P O6    
15   N N1    . DG  A 4   ? 0.60610 0.79028 1.31110 0.08471  0.02714  0.08155  805 DG  P N1    
16   C C2    . DG  A 4   ? 0.58636 0.87101 1.29745 0.03599  0.01518  0.06668  805 DG  P C2    
17   N N2    . DG  A 4   ? 0.56703 0.90907 1.25737 0.01625  -0.01790 0.08944  805 DG  P N2    
18   N N3    . DG  A 4   ? 0.57158 0.89501 1.30345 0.00538  0.03714  0.02999  805 DG  P N3    
19   C C4    . DG  A 4   ? 0.58097 0.83052 1.32860 0.03396  0.07229  0.01305  805 DG  P C4    
20   P P     . DT  A 5   ? 0.71243 1.02120 1.31285 -0.23289 0.19584  -0.20143 806 DT  P P     
21   O OP1   . DT  A 5   ? 0.73960 1.12206 1.32133 -0.31242 0.20866  -0.24131 806 DT  P OP1   
22   O OP2   . DT  A 5   ? 0.71336 0.89002 1.27926 -0.19669 0.23936  -0.21329 806 DT  P OP2   
23   O "O5'" . DT  A 5   ? 0.70145 1.04309 1.29369 -0.20930 0.13622  -0.15072 806 DT  P "O5'" 
24   C "C5'" . DT  A 5   ? 0.67702 1.14345 1.28665 -0.23726 0.08765  -0.12678 806 DT  P "C5'" 
25   C "C4'" . DT  A 5   ? 0.64745 1.10811 1.21710 -0.22898 0.05268  -0.09471 806 DT  P "C4'" 
26   O "O4'" . DT  A 5   ? 0.58178 0.98883 1.17147 -0.16027 0.03351  -0.04966 806 DT  P "O4'" 
27   C "C3'" . DT  A 5   ? 0.67222 1.04944 1.17348 -0.25239 0.08385  -0.12495 806 DT  P "C3'" 
28   O "O3'" . DT  A 5   ? 0.72269 1.14547 1.18571 -0.28072 0.05268  -0.10952 806 DT  P "O3'" 
29   C "C2'" . DT  A 5   ? 0.63874 0.90451 1.13805 -0.18974 0.09577  -0.10821 806 DT  P "C2'" 
30   C "C1'" . DT  A 5   ? 0.59258 0.89221 1.13616 -0.14210 0.05160  -0.05620 806 DT  P "C1'" 
31   N N1    . DT  A 5   ? 0.54274 0.75765 1.10796 -0.08425 0.06690  -0.04598 806 DT  P N1    
32   C C2    . DT  A 5   ? 0.51387 0.68799 1.07756 -0.04076 0.04394  -0.00781 806 DT  P C2    
33   O O2    . DT  A 5   ? 0.50598 0.70773 1.05471 -0.04372 0.01299  0.02051  806 DT  P O2    
34   N N3    . DT  A 5   ? 0.53294 0.62867 1.10883 0.00419  0.06184  -0.00527 806 DT  P N3    
35   C C4    . DT  A 5   ? 0.55366 0.60909 1.14317 0.01410  0.09870  -0.03319 806 DT  P C4    
36   O O4    . DT  A 5   ? 0.60633 0.59163 1.20013 0.05475  0.11200  -0.02790 806 DT  P O4    
37   C C5    . DT  A 5   ? 0.51406 0.61213 1.10750 -0.02964 0.12386  -0.07058 806 DT  P C5    
38   C C7    . DT  A 5   ? 0.46664 0.51944 1.07275 -0.02249 0.17050  -0.10237 806 DT  P C7    
39   C C6    . DT  A 5   ? 0.52421 0.69888 1.10507 -0.07853 0.10749  -0.07689 806 DT  P C6    
40   P P     . DC  A 6   ? 0.77343 1.13199 1.16456 -0.31676 0.08417  -0.13975 807 DC  P P     
41   O OP1   . DC  A 6   ? 0.82212 1.27269 1.18055 -0.37912 0.06211  -0.14619 807 DC  P OP1   
42   O OP2   . DC  A 6   ? 0.75302 1.02156 1.13195 -0.31840 0.14753  -0.18263 807 DC  P OP2   
43   O "O5'" . DC  A 6   ? 0.72607 1.02056 1.10398 -0.26630 0.06372  -0.10042 807 DC  P "O5'" 
44   C "C5'" . DC  A 6   ? 0.69947 1.04210 1.09836 -0.23749 0.01223  -0.04976 807 DC  P "C5'" 
45   C "C4'" . DC  A 6   ? 0.67248 0.93529 1.05580 -0.19531 0.00641  -0.02361 807 DC  P "C4'" 
46   O "O4'" . DC  A 6   ? 0.63982 0.84265 1.05911 -0.14138 0.01437  -0.01330 807 DC  P "O4'" 
47   C "C3'" . DC  A 6   ? 0.67510 0.86681 1.00891 -0.21306 0.03956  -0.04943 807 DC  P "C3'" 
48   O "O3'" . DC  A 6   ? 0.62760 0.80433 0.93871 -0.20183 0.01563  -0.01882 807 DC  P "O3'" 
49   C "C2'" . DC  A 6   ? 0.67642 0.78493 1.02694 -0.17518 0.07392  -0.06432 807 DC  P "C2'" 
50   C "C1'" . DC  A 6   ? 0.65536 0.76686 1.04979 -0.12657 0.04404  -0.02973 807 DC  P "C1'" 
51   N N1    . DC  A 6   ? 0.66785 0.73108 1.09029 -0.09406 0.06982  -0.04328 807 DC  P N1    
52   C C2    . DC  A 6   ? 0.65159 0.66124 1.08873 -0.04529 0.06122  -0.02078 807 DC  P C2    
53   O O2    . DC  A 6   ? 0.66474 0.66514 1.09252 -0.03200 0.03516  0.00809  807 DC  P O2    
54   N N3    . DC  A 6   ? 0.61605 0.58144 1.07270 -0.01681 0.08521  -0.03310 807 DC  P N3    
55   C C4    . DC  A 6   ? 0.56234 0.53407 1.02735 -0.03308 0.11809  -0.06467 807 DC  P C4    
56   N N4    . DC  A 6   ? 0.53831 0.46208 1.01984 -0.00226 0.14318  -0.07422 807 DC  P N4    
57   C C5    . DC  A 6   ? 0.54593 0.56990 0.99822 -0.08493 0.13005  -0.08970 807 DC  P C5    
58   C C6    . DC  A 6   ? 0.61152 0.68075 1.04118 -0.11495 0.10435  -0.07873 807 DC  P C6    
59   P P     . DC  A 7   ? 0.64929 0.76974 0.91182 -0.22034 0.04163  -0.03378 808 DC  P P     
60   O OP1   . DC  A 7   ? 0.70001 0.85626 0.93275 -0.23887 0.01126  -0.00785 808 DC  P OP1   
61   O OP2   . DC  A 7   ? 0.67167 0.76836 0.91399 -0.25231 0.09176  -0.07942 808 DC  P OP2   
62   O "O5'" . DC  A 7   ? 0.59030 0.63518 0.86929 -0.16940 0.04626  -0.01892 808 DC  P "O5'" 
63   C "C5'" . DC  A 7   ? 0.53243 0.57464 0.83596 -0.13234 0.01303  0.01705  808 DC  P "C5'" 
64   C "C4'" . DC  A 7   ? 0.54130 0.51239 0.85411 -0.09525 0.02499  0.01848  808 DC  P "C4'" 
65   O "O4'" . DC  A 7   ? 0.52760 0.47848 0.86778 -0.07175 0.04231  0.00330  808 DC  P "O4'" 
66   C "C3'" . DC  A 7   ? 0.54383 0.47466 0.83061 -0.10425 0.05203  0.00284  808 DC  P "C3'" 
67   O "O3'" . DC  A 7   ? 0.53681 0.43728 0.82229 -0.08494 0.03576  0.02483  808 DC  P "O3'" 
68   C "C2'" . DC  A 7   ? 0.46713 0.36430 0.76579 -0.08770 0.08849  -0.02295 808 DC  P "C2'" 
69   C "C1'" . DC  A 7   ? 0.49681 0.39420 0.82827 -0.05822 0.07220  -0.01396 808 DC  P "C1'" 
70   N N1    . DC  A 7   ? 0.52476 0.41168 0.87177 -0.05056 0.10255  -0.03873 808 DC  P N1    
71   C C2    . DC  A 7   ? 0.56344 0.41277 0.93057 -0.01158 0.10601  -0.03561 808 DC  P C2    
72   O O2    . DC  A 7   ? 0.62156 0.44634 0.98996 0.01178  0.08495  -0.01537 808 DC  P O2    
73   N N3    . DC  A 7   ? 0.50565 0.34260 0.88610 -0.00356 0.13560  -0.05660 808 DC  P N3    
74   C C4    . DC  A 7   ? 0.52261 0.38303 0.89818 -0.03583 0.16250  -0.08197 808 DC  P C4    
75   N N4    . DC  A 7   ? 0.51301 0.35466 0.90137 -0.02837 0.19638  -0.10352 808 DC  P N4    
76   C C5    . DC  A 7   ? 0.51885 0.41877 0.87140 -0.08044 0.15934  -0.08837 808 DC  P C5    
77   C C6    . DC  A 7   ? 0.52514 0.43779 0.86380 -0.08469 0.12791  -0.06503 808 DC  P C6    
78   P P     . DC  A 8   ? 0.54694 0.58588 0.70051 0.03884  0.05207  0.07892  809 DC  P P     
79   O OP1   . DC  A 8   ? 0.64200 0.68013 0.79857 0.03613  0.07156  0.06503  809 DC  P OP1   
80   O OP2   . DC  A 8   ? 0.50939 0.53994 0.64774 0.02635  0.02458  0.07438  809 DC  P OP2   
81   O "O5'" . DC  A 8   ? 0.49819 0.53123 0.63851 0.05655  0.05640  0.05687  809 DC  P "O5'" 
82   C "C5'" . DC  A 8   ? 0.50729 0.53212 0.64467 0.07289  0.07876  0.06369  809 DC  P "C5'" 
83   C "C4'" . DC  A 8   ? 0.60895 0.62269 0.72829 0.08849  0.07458  0.05157  809 DC  P "C4'" 
84   O "O4'" . DC  A 8   ? 0.55580 0.58017 0.68686 0.09410  0.06662  0.08404  809 DC  P "O4'" 
85   C "C3'" . DC  A 8   ? 0.57727 0.58997 0.68426 0.08311  0.05501  0.01350  809 DC  P "C3'" 
86   O "O3'" . DC  A 8   ? 0.61483 0.60764 0.70118 0.09280  0.06147  -0.00932 809 DC  P "O3'" 
87   C "C2'" . DC  A 8   ? 0.54468 0.56362 0.65180 0.08610  0.03629  0.02495  809 DC  P "C2'" 
88   C "C1'" . DC  A 8   ? 0.57064 0.58960 0.68618 0.09965  0.05103  0.06327  809 DC  P "C1'" 
89   N N1    . DC  A 8   ? 0.62383 0.65593 0.75340 0.09831  0.03456  0.09434  809 DC  P N1    
90   C C2    . DC  A 8   ? 0.59776 0.62813 0.72610 0.11779  0.04213  0.11331  809 DC  P C2    
91   O O2    . DC  A 8   ? 0.58843 0.59885 0.69537 0.13701  0.06260  0.10118  809 DC  P O2    
92   N N3    . DC  A 8   ? 0.64479 0.69030 0.79102 0.11471  0.02525  0.14571  809 DC  P N3    
93   C C4    . DC  A 8   ? 0.63766 0.69185 0.79551 0.09121  -0.00161 0.15841  809 DC  P C4    
94   N N4    . DC  A 8   ? 0.58936 0.65396 0.76269 0.08533  -0.02285 0.19342  809 DC  P N4    
95   C C5    . DC  A 8   ? 0.61684 0.66399 0.76635 0.07267  -0.00899 0.13770  809 DC  P C5    
96   C C6    . DC  A 8   ? 0.64123 0.68152 0.78049 0.07801  0.01138  0.10678  809 DC  P C6    
97   P P     . DT  A 9   ? 0.58255 0.57622 0.66380 0.08529  0.04705  -0.04639 810 DT  P P     
98   O OP1   . DT  A 9   ? 0.57222 0.54701 0.64304 0.08201  0.05710  -0.05816 810 DT  P OP1   
99   O OP2   . DT  A 9   ? 0.51166 0.52811 0.60871 0.07445  0.03444  -0.05219 810 DT  P OP2   
100  O "O5'" . DT  A 9   ? 0.64089 0.62055 0.70218 0.09844  0.03676  -0.05525 810 DT  P "O5'" 
101  C "C5'" . DT  A 9   ? 0.66294 0.61063 0.69665 0.11484  0.04956  -0.04612 810 DT  P "C5'" 
102  C "C4'" . DT  A 9   ? 0.65405 0.59774 0.67681 0.12902  0.04180  -0.04073 810 DT  P "C4'" 
103  O "O4'" . DT  A 9   ? 0.65283 0.62086 0.69893 0.13029  0.04195  -0.01062 810 DT  P "O4'" 
104  C "C3'" . DT  A 9   ? 0.68601 0.63965 0.70974 0.12333  0.01792  -0.06712 810 DT  P "C3'" 
105  O "O3'" . DT  A 9   ? 0.75181 0.67318 0.74386 0.13131  0.01327  -0.08353 810 DT  P "O3'" 
106  C "C2'" . DT  A 9   ? 0.69971 0.67186 0.73453 0.12796  0.00823  -0.05165 810 DT  P "C2'" 
107  C "C1'" . DT  A 9   ? 0.73304 0.70588 0.77571 0.13574  0.02559  -0.01387 810 DT  P "C1'" 
108  N N1    . DT  A 9   ? 0.74004 0.73764 0.80621 0.12684  0.01253  0.00913  810 DT  P N1    
109  C C2    . DT  A 9   ? 0.74798 0.74956 0.81789 0.13672  0.00829  0.03449  810 DT  P C2    
110  O O2    . DT  A 9   ? 0.82186 0.80872 0.87678 0.15598  0.01965  0.03958  810 DT  P O2    
111  N N3    . DT  A 9   ? 0.71753 0.73586 0.80534 0.12335  -0.01052 0.05659  810 DT  P N3    
112  C C4    . DT  A 9   ? 0.72272 0.74570 0.81532 0.10313  -0.02479 0.05347  810 DT  P C4    
113  O O4    . DT  A 9   ? 0.73231 0.75786 0.82979 0.09042  -0.04586 0.07539  810 DT  P O4    
114  C C5    . DT  A 9   ? 0.67677 0.69597 0.76392 0.09763  -0.01478 0.02502  810 DT  P C5    
115  C C7    . DT  A 9   ? 0.51561 0.53442 0.60151 0.08015  -0.02506 0.02049  810 DT  P C7    
116  C C6    . DT  A 9   ? 0.73342 0.74409 0.81216 0.10851  0.00247  0.00522  810 DT  P C6    
117  P P     . DG  A 10  ? 0.78920 0.71976 0.78445 0.12382  -0.01171 -0.11051 811 DG  P P     
118  O OP1   . DG  A 10  ? 0.87605 0.77509 0.84869 0.11694  -0.01828 -0.12695 811 DG  P OP1   
119  O OP2   . DG  A 10  ? 0.77198 0.74393 0.80249 0.11270  -0.01942 -0.11362 811 DG  P OP2   
120  O "O5'" . DG  A 10  ? 0.73963 0.66156 0.71813 0.14001  -0.01816 -0.10636 811 DG  P "O5'" 
121  C "C5'" . DG  A 10  ? 0.74193 0.62562 0.68484 0.15946  -0.00383 -0.09250 811 DG  P "C5'" 
122  C "C4'" . DG  A 10  ? 0.73826 0.63121 0.68226 0.17325  -0.00776 -0.08001 811 DG  P "C4'" 
123  O "O4'" . DG  A 10  ? 0.73389 0.66124 0.71173 0.17051  -0.00268 -0.05282 811 DG  P "O4'" 
124  C "C3'" . DG  A 10  ? 0.75542 0.66362 0.70568 0.16737  -0.03332 -0.10241 811 DG  P "C3'" 
125  O "O3'" . DG  A 10  ? 0.83076 0.70966 0.74858 0.18310  -0.03694 -0.10577 811 DG  P "O3'" 
126  C "C2'" . DG  A 10  ? 0.76932 0.71598 0.75137 0.16207  -0.04057 -0.08941 811 DG  P "C2'" 
127  C "C1'" . DG  A 10  ? 0.77117 0.72030 0.76211 0.16804  -0.02201 -0.05404 811 DG  P "C1'" 
128  N N9    . DG  A 10  ? 0.77145 0.74891 0.79070 0.15338  -0.02899 -0.04008 811 DG  P N9    
129  C C8    . DG  A 10  ? 0.76794 0.75652 0.79991 0.13790  -0.02953 -0.04945 811 DG  P C8    
130  N N7    . DG  A 10  ? 0.72949 0.73163 0.77457 0.12736  -0.03861 -0.03350 811 DG  P N7    
131  C C5    . DG  A 10  ? 0.75089 0.75423 0.79637 0.13364  -0.04758 -0.01091 811 DG  P C5    
132  C C6    . DG  A 10  ? 0.75415 0.76400 0.80775 0.12369  -0.06517 0.01563  811 DG  P C6    
133  O O6    . DG  A 10  ? 0.76790 0.77702 0.82258 0.10774  -0.07653 0.02273  811 DG  P O6    
134  N N1    . DG  A 10  ? 0.75991 0.77195 0.81628 0.13314  -0.07138 0.03715  811 DG  P N1    
135  C C2    . DG  A 10  ? 0.78581 0.79168 0.83368 0.15313  -0.05858 0.03211  811 DG  P C2    
136  N N2    . DG  A 10  ? 0.79408 0.80468 0.84755 0.16160  -0.06517 0.05774  811 DG  P N2    
137  N N3    . DG  A 10  ? 0.80272 0.79379 0.83371 0.16318  -0.04276 0.00526  811 DG  P N3    
138  C C4    . DG  A 10  ? 0.77004 0.76191 0.80277 0.15106  -0.03968 -0.01437 811 DG  P C4    
139  P P     . DT  A 11  ? 0.89199 0.78072 0.81089 0.18035  -0.06263 -0.12753 812 DT  P P     
140  O OP1   . DT  A 11  ? 0.99843 0.83790 0.86977 0.19349  -0.06466 -0.13549 812 DT  P OP1   
141  O OP2   . DT  A 11  ? 0.84873 0.76793 0.79702 0.16175  -0.07771 -0.14575 812 DT  P OP2   
142  O "O5'" . DT  A 11  ? 0.86867 0.78406 0.80578 0.18772  -0.06486 -0.10911 812 DT  P "O5'" 
143  C "C5'" . DT  A 11  ? 0.89877 0.80255 0.82621 0.20511  -0.04854 -0.08008 812 DT  P "C5'" 
144  C "C4'" . DT  A 11  ? 0.84753 0.77302 0.78945 0.20869  -0.06111 -0.06711 812 DT  P "C4'" 
145  O "O4'" . DT  A 11  ? 0.80673 0.76287 0.78082 0.19513  -0.06581 -0.04725 812 DT  P "O4'" 
146  C "C3'" . DT  A 11  ? 0.82314 0.75424 0.76091 0.20404  -0.08526 -0.09532 812 DT  P "C3'" 
147  O "O3'" . DT  A 11  ? 0.83741 0.76497 0.76649 0.21740  -0.09070 -0.08451 812 DT  P "O3'" 
148  C "C2'" . DT  A 11  ? 0.79879 0.75963 0.76251 0.18696  -0.09778 -0.09898 812 DT  P "C2'" 
149  C "C1'" . DT  A 11  ? 0.81865 0.78967 0.79880 0.18407  -0.08942 -0.06371 812 DT  P "C1'" 
150  N N1    . DT  A 11  ? 0.84008 0.82494 0.83582 0.16690  -0.09248 -0.06264 812 DT  P N1    
151  C C2    . DT  A 11  ? 0.81581 0.80832 0.82048 0.15735  -0.10444 -0.03828 812 DT  P C2    
152  O O2    . DT  A 11  ? 0.81091 0.80474 0.81770 0.16044  -0.11427 -0.01535 812 DT  P O2    
153  N N3    . DT  A 11  ? 0.80356 0.79855 0.81212 0.14288  -0.10680 -0.03975 812 DT  P N3    
154  C C4    . DT  A 11  ? 0.78876 0.78607 0.79961 0.13859  -0.09571 -0.06113 812 DT  P C4    
155  O O4    . DT  A 11  ? 0.75854 0.75586 0.77029 0.12740  -0.09690 -0.05950 812 DT  P O4    
156  C C5    . DT  A 11  ? 0.74612 0.74144 0.75513 0.14712  -0.08480 -0.08322 812 DT  P C5    
157  C C7    . DT  A 11  ? 0.63587 0.63586 0.65225 0.14038  -0.07599 -0.10248 812 DT  P C7    
158  C C6    . DT  A 11  ? 0.81072 0.79633 0.80885 0.15996  -0.08519 -0.08355 812 DT  P C6    
159  P P     . DT  A 12  ? 1.37328 0.86433 0.73758 0.23123  0.00475  0.11845  813 DT  P P     
160  O OP1   . DT  A 12  ? 1.50137 0.96541 0.76627 0.20275  0.01002  0.12853  813 DT  P OP1   
161  O OP2   . DT  A 12  ? 1.38931 0.85283 0.79124 0.24902  -0.03860 0.11994  813 DT  P OP2   
162  O "O5'" . DT  A 12  ? 1.24332 0.75772 0.65516 0.21873  0.01220  0.13427  813 DT  P "O5'" 
163  C "C5'" . DT  A 12  ? 1.21614 0.78066 0.62822 0.20407  0.05414  0.13456  813 DT  P "C5'" 
164  C "C4'" . DT  A 12  ? 1.23018 0.80321 0.68452 0.18586  0.04998  0.14896  813 DT  P "C4'" 
165  O "O4'" . DT  A 12  ? 1.13866 0.75344 0.67495 0.20817  0.05127  0.13103  813 DT  P "O4'" 
166  C "C3'" . DT  A 12  ? 1.32667 0.82788 0.76705 0.17058  0.00837  0.17180  813 DT  P "C3'" 
167  O "O3'" . DT  A 12  ? 1.38399 0.88314 0.82636 0.13785  0.01566  0.18964  813 DT  P "O3'" 
168  C "C2'" . DT  A 12  ? 1.25219 0.74934 0.76347 0.20135  -0.01547 0.15489  813 DT  P "C2'" 
169  C "C1'" . DT  A 12  ? 1.15061 0.72522 0.71778 0.21015  0.01745  0.13346  813 DT  P "C1'" 
170  N N1    . DT  A 12  ? 1.12459 0.73095 0.75452 0.24262  0.00946  0.11321  813 DT  P N1    
171  C C2    . DT  A 12  ? 1.10963 0.76873 0.80001 0.24361  0.02013  0.10040  813 DT  P C2    
172  O O2    . DT  A 12  ? 1.14998 0.82509 0.84527 0.21850  0.03337  0.10230  813 DT  P O2    
173  N N3    . DT  A 12  ? 1.06177 0.75738 0.80444 0.27027  0.01295  0.08674  813 DT  P N3    
174  C C4    . DT  A 12  ? 1.08897 0.77120 0.83443 0.29494  -0.00447 0.08585  813 DT  P C4    
175  O O4    . DT  A 12  ? 1.08409 0.80699 0.88125 0.31414  -0.01038 0.07803  813 DT  P O4    
176  C C5    . DT  A 12  ? 1.08660 0.70819 0.76712 0.29151  -0.01651 0.09650  813 DT  P C5    
177  C C7    . DT  A 12  ? 0.99872 0.59951 0.67391 0.31059  -0.03925 0.09512  813 DT  P C7    
178  C C6    . DT  A 12  ? 1.14488 0.73378 0.76859 0.26597  -0.00835 0.10909  813 DT  P C6    
179  P P     . DC  A 13  ? 1.48826 0.90649 0.90735 0.11192  -0.02115 0.22357  814 DC  P P     
180  O OP1   . DC  A 13  ? 1.56887 0.98910 0.92089 0.07069  -0.00615 0.25426  814 DC  P OP1   
181  O OP2   . DC  A 13  ? 1.50408 0.86774 0.92570 0.13598  -0.06259 0.22867  814 DC  P OP2   
182  O "O5'" . DC  A 13  ? 1.41134 0.82612 0.89700 0.10461  -0.02242 0.21323  814 DC  P "O5'" 
183  C "C5'" . DC  A 13  ? 1.29923 0.78714 0.83428 0.11169  0.00666  0.18414  814 DC  P "C5'" 
184  C "C4'" . DC  A 13  ? 1.29499 0.76396 0.89205 0.11911  -0.00848 0.16255  814 DC  P "C4'" 
185  O "O4'" . DC  A 13  ? 1.25138 0.75954 0.89433 0.15908  -0.00911 0.13361  814 DC  P "O4'" 
186  C "C3'" . DC  A 13  ? 1.38580 0.75736 0.98570 0.11824  -0.04599 0.17632  814 DC  P "C3'" 
187  O "O3'" . DC  A 13  ? 1.42025 0.77156 1.06027 0.10282  -0.04685 0.15855  814 DC  P "O3'" 
188  C "C2'" . DC  A 13  ? 1.36172 0.72629 0.99022 0.16414  -0.06637 0.16201  814 DC  P "C2'" 
189  C "C1'" . DC  A 13  ? 1.26947 0.72015 0.94090 0.18103  -0.04034 0.12666  814 DC  P "C1'" 
190  N N1    . DC  A 13  ? 1.23650 0.71684 0.92982 0.21997  -0.04787 0.11490  814 DC  P N1    
191  C C2    . DC  A 13  ? 1.21392 0.75228 0.96558 0.24075  -0.03963 0.08555  814 DC  P C2    
192  O O2    . DC  A 13  ? 1.19651 0.75983 0.97539 0.22630  -0.02637 0.06633  814 DC  P O2    
193  N N3    . DC  A 13  ? 1.17658 0.74412 0.95039 0.27150  -0.04792 0.08048  814 DC  P N3    
194  C C4    . DC  A 13  ? 1.19991 0.73610 0.93832 0.28065  -0.06465 0.09914  814 DC  P C4    
195  N N4    . DC  A 13  ? 1.16703 0.74821 0.94069 0.29390  -0.07207 0.09096  814 DC  P N4    
196  C C5    . DC  A 13  ? 1.20883 0.68743 0.88182 0.25915  -0.07278 0.12488  814 DC  P C5    
197  C C6    . DC  A 13  ? 1.22083 0.67600 0.87434 0.22983  -0.06342 0.13395  814 DC  P C6    
198  P P     . DG  A 14  ? 1.55294 0.79879 1.19128 0.07874  -0.07473 0.18054  815 DG  P P     
199  O OP1   . DG  A 14  ? 1.61582 0.86641 1.21536 0.02542  -0.06135 0.20840  815 DG  P OP1   
200  O OP2   . DG  A 14  ? 1.59372 0.77291 1.22552 0.10428  -0.10937 0.20631  815 DG  P OP2   
201  O "O5'" . DG  A 14  ? 1.53167 0.76332 1.23254 0.08841  -0.07454 0.13375  815 DG  P "O5'" 
202  C "C5'" . DG  A 14  ? 1.44374 0.76292 1.16666 0.08314  -0.04626 0.09679  815 DG  P "C5'" 
203  C "C4'" . DG  A 14  ? 1.41647 0.74220 1.19362 0.11724  -0.04877 0.04943  815 DG  P "C4'" 
204  O "O4'" . DG  A 14  ? 1.35761 0.73978 1.14878 0.16037  -0.04747 0.04527  815 DG  P "O4'" 
205  C "C3'" . DG  A 14  ? 1.48629 0.70635 1.29304 0.13410  -0.07439 0.03993  815 DG  P "C3'" 
206  O "O3'" . DG  A 14  ? 1.53334 0.75782 1.37765 0.13364  -0.06399 -0.01322 815 DG  P "O3'" 
207  C "C2'" . DG  A 14  ? 1.44628 0.66657 1.27119 0.18528  -0.09119 0.05002  815 DG  P "C2'" 
208  C "C1'" . DG  A 14  ? 1.37237 0.70676 1.20149 0.19884  -0.06818 0.03156  815 DG  P "C1'" 
209  N N9    . DG  A 14  ? 1.34825 0.70562 1.17267 0.23126  -0.07954 0.05240  815 DG  P N9    
210  C C8    . DG  A 14  ? 1.39179 0.71418 1.17210 0.22803  -0.09632 0.09470  815 DG  P C8    
211  N N7    . DG  A 14  ? 1.37184 0.72401 1.15447 0.25618  -0.10544 0.10118  815 DG  P N7    
212  C C5    . DG  A 14  ? 1.28328 0.69690 1.11906 0.28039  -0.09364 0.06534  815 DG  P C5    
213  C C6    . DG  A 14  ? 1.21230 0.70199 1.08664 0.29928  -0.09318 0.05795  815 DG  P C6    
214  O O6    . DG  A 14  ? 1.20092 0.71783 1.07296 0.29420  -0.10252 0.07685  815 DG  P O6    
215  N N1    . DG  A 14  ? 1.15304 0.69733 1.07363 0.31457  -0.07876 0.02387  815 DG  P N1    
216  C C2    . DG  A 14  ? 1.14704 0.68497 1.07653 0.30731  -0.06385 -0.00718 815 DG  P C2    
217  N N2    . DG  A 14  ? 1.07074 0.68042 1.04179 0.31901  -0.04970 -0.04005 815 DG  P N2    
218  N N3    . DG  A 14  ? 1.18973 0.67027 1.09257 0.27691  -0.06126 -0.00529 815 DG  P N3    
219  C C4    . DG  A 14  ? 1.26005 0.68109 1.11915 0.26552  -0.07667 0.03422  815 DG  P C4    
220  P P     . DG  A 15  ? 1.70629 0.81258 1.58296 0.13611  -0.08089 -0.03622 816 DG  P P     
221  O OP1   . DG  A 15  ? 1.81301 0.91231 1.67904 0.08497  -0.06785 -0.06509 816 DG  P OP1   
222  O OP2   . DG  A 15  ? 1.76813 0.77873 1.63963 0.14575  -0.11164 0.01516  816 DG  P OP2   
223  O "O5'" . DG  A 15  ? 1.64180 0.77488 1.57324 0.18921  -0.07518 -0.08616 816 DG  P "O5'" 
224  C "C5'" . DG  A 15  ? 1.56599 0.80538 1.50565 0.18934  -0.04922 -0.12974 816 DG  P "C5'" 
225  C "C4'" . DG  A 15  ? 1.55697 0.83535 1.54299 0.24477  -0.04793 -0.15276 816 DG  P "C4'" 
226  O "O4'" . DG  A 15  ? 1.46620 0.80120 1.44263 0.26512  -0.05515 -0.11028 816 DG  P "O4'" 
227  C "C3'" . DG  A 15  ? 1.73148 0.90959 1.76304 0.28391  -0.06655 -0.15888 816 DG  P "C3'" 
228  O "O3'" . DG  A 15  ? 2.00313 1.16877 2.06796 0.29135  -0.04918 -0.22353 816 DG  P "O3'" 
229  C "C2'" . DG  A 15  ? 1.60755 0.86127 1.66873 0.31941  -0.06763 -0.12696 816 DG  P "C2'" 
230  C "C1'" . DG  A 15  ? 1.47271 0.79905 1.49399 0.31561  -0.06857 -0.11011 816 DG  P "C1'" 
231  N N9    . DG  A 15  ? 1.41660 0.75192 1.42169 0.31624  -0.08501 -0.05122 816 DG  P N9    
232  C C8    . DG  A 15  ? 1.46092 0.72932 1.42473 0.29459  -0.10334 -0.00631 816 DG  P C8    
233  N N7    . DG  A 15  ? 1.44343 0.75038 1.39743 0.29568  -0.11286 0.03320  816 DG  P N7    
234  C C5    . DG  A 15  ? 1.32515 0.72360 1.31958 0.31613  -0.10156 0.01641  816 DG  P C5    
235  C C6    . DG  A 15  ? 1.12572 0.59032 1.13002 0.31909  -0.10637 0.03998  816 DG  P C6    
236  O O6    . DG  A 15  ? 1.05295 0.50991 1.02892 0.30752  -0.12122 0.07490  816 DG  P O6    
237  N N1    . DG  A 15  ? 1.06876 0.61212 1.11746 0.33373  -0.09271 0.01738  816 DG  P N1    
238  C C2    . DG  A 15  ? 1.09570 0.65968 1.17143 0.34711  -0.07518 -0.02496 816 DG  P C2    
239  N N2    . DG  A 15  ? 1.00389 0.65061 1.11642 0.35752  -0.06435 -0.03706 816 DG  P N2    
240  N N3    . DG  A 15  ? 1.24652 0.75193 1.31101 0.34652  -0.06937 -0.05543 816 DG  P N3    
241  C C4    . DG  A 15  ? 1.33882 0.75871 1.36433 0.32950  -0.08405 -0.03156 816 DG  P C4    
267  P P     . DC  A 17  ? 1.41486 0.84363 0.76968 0.17993  -0.33418 0.06270  818 DC  P P     
268  O OP1   . DC  A 17  ? 1.58552 0.93631 0.85458 0.18317  -0.37351 0.02214  818 DC  P OP1   
269  O OP2   . DC  A 17  ? 1.23529 0.75493 0.73273 0.14658  -0.35645 0.08928  818 DC  P OP2   
270  O "O5'" . DC  A 17  ? 1.26641 0.67187 0.58394 0.19634  -0.24339 0.05851  818 DC  P "O5'" 
271  C "C5'" . DC  A 17  ? 1.35697 0.69910 0.56357 0.23231  -0.19308 0.05540  818 DC  P "C5'" 
272  C "C4'" . DC  A 17  ? 1.30688 0.67418 0.55519 0.23027  -0.10319 0.06534  818 DC  P "C4'" 
273  O "O4'" . DC  A 17  ? 1.27654 0.69696 0.59593 0.22946  -0.09743 0.09949  818 DC  P "O4'" 
274  C "C3'" . DC  A 17  ? 1.18373 0.59611 0.51695 0.19797  -0.07221 0.04707  818 DC  P "C3'" 
275  O "O3'" . DC  A 17  ? 1.22807 0.59524 0.50346 0.20397  -0.04571 0.01822  818 DC  P "O3'" 
276  C "C2'" . DC  A 17  ? 1.10906 0.55194 0.49098 0.19514  -0.00572 0.06377  818 DC  P "C2'" 
277  C "C1'" . DC  A 17  ? 1.16744 0.63007 0.56534 0.20953  -0.03726 0.09750  818 DC  P "C1'" 
278  N N1    . DC  A 17  ? 1.08986 0.63622 0.60230 0.18651  -0.06726 0.11211  818 DC  P N1    
279  C C2    . DC  A 17  ? 0.99671 0.58769 0.57868 0.17656  -0.01670 0.11716  818 DC  P C2    
280  O O2    . DC  A 17  ? 1.01615 0.57343 0.57028 0.18142  0.04565  0.10727  818 DC  P O2    
281  N N3    . DC  A 17  ? 0.86701 0.53457 0.54331 0.16240  -0.03768 0.13357  818 DC  P N3    
282  C C4    . DC  A 17  ? 0.84312 0.54731 0.56058 0.15282  -0.10463 0.14912  818 DC  P C4    
283  N N4    . DC  A 17  ? 0.80430 0.58946 0.62140 0.14051  -0.11615 0.17291  818 DC  P N4    
284  C C5    . DC  A 17  ? 0.90041 0.55705 0.55682 0.15569  -0.16342 0.14120  818 DC  P C5    
285  C C6    . DC  A 17  ? 1.02419 0.60054 0.57164 0.17514  -0.14263 0.12033  818 DC  P C6    
286  P P     . DG  A 18  ? 1.15458 0.56308 0.50502 0.17537  -0.03361 -0.00337 819 DG  P P     
287  O OP1   . DG  A 18  ? 1.23753 0.59128 0.51230 0.19468  -0.00663 -0.02748 819 DG  P OP1   
288  O OP2   . DG  A 18  ? 1.07124 0.52229 0.49525 0.15072  -0.10000 0.00020  819 DG  P OP2   
289  O "O5'" . DG  A 18  ? 1.08316 0.54966 0.51401 0.15685  0.03008  0.00638  819 DG  P "O5'" 
290  C "C5'" . DG  A 18  ? 1.10962 0.54981 0.50783 0.16708  0.10019  0.00695  819 DG  P "C5'" 
291  C "C4'" . DG  A 18  ? 1.01852 0.51415 0.50463 0.13972  0.14268  0.00623  819 DG  P "C4'" 
292  O "O4'" . DG  A 18  ? 1.02659 0.54726 0.55008 0.13734  0.12991  0.02520  819 DG  P "O4'" 
293  C "C3'" . DG  A 18  ? 0.91431 0.47196 0.47652 0.11305  0.13042  -0.01066 819 DG  P "C3'" 
294  O "O3'" . DG  A 18  ? 0.96167 0.51603 0.51986 0.11062  0.16828  -0.02642 819 DG  P "O3'" 
295  C "C2'" . DG  A 18  ? 0.85588 0.46505 0.48923 0.09310  0.14756  -0.00582 819 DG  P "C2'" 
296  C "C1'" . DG  A 18  ? 0.96230 0.55008 0.57216 0.11133  0.13124  0.01837  819 DG  P "C1'" 
297  N N9    . DG  A 18  ? 0.98538 0.61632 0.63654 0.10945  0.07574  0.03408  819 DG  P N9    
298  C C8    . DG  A 18  ? 1.02057 0.63570 0.64657 0.11946  0.01862  0.04500  819 DG  P C8    
299  N N7    . DG  A 18  ? 1.00094 0.67095 0.69276 0.11022  -0.02195 0.06436  819 DG  P N7    
300  C C5    . DG  A 18  ? 0.91323 0.63675 0.66610 0.09954  0.01473  0.06622  819 DG  P C5    
301  C C6    . DG  A 18  ? 0.78500 0.58210 0.61718 0.09243  0.00304  0.08780  819 DG  P C6    
302  O O6    . DG  A 18  ? 0.69074 0.52809 0.57161 0.08998  -0.04237 0.11518  819 DG  P O6    
303  N N1    . DG  A 18  ? 0.78573 0.60978 0.64019 0.08811  0.05082  0.07641  819 DG  P N1    
304  C C2    . DG  A 18  ? 0.80062 0.58664 0.61828 0.08367  0.09808  0.04725  819 DG  P C2    
305  N N2    . DG  A 18  ? 0.66218 0.47626 0.50505 0.07666  0.13154  0.03441  819 DG  P N2    
306  N N3    . DG  A 18  ? 0.91408 0.63897 0.67432 0.08623  0.11135  0.03289  819 DG  P N3    
307  C C4    . DG  A 18  ? 0.93743 0.63377 0.66277 0.09751  0.07069  0.04395  819 DG  P C4    
308  P P     . DC  A 19  ? 0.91989 0.51017 0.51531 0.10165  0.14655  -0.04271 820 DC  P P     
309  O OP1   . DC  A 19  ? 0.90416 0.49120 0.49319 0.10671  0.19734  -0.05156 820 DC  P OP1   
310  O OP2   . DC  A 19  ? 0.96473 0.52275 0.52257 0.11457  0.08614  -0.04282 820 DC  P OP2   
311  O "O5'" . DC  A 19  ? 0.80602 0.47733 0.49744 0.07144  0.13638  -0.04219 820 DC  P "O5'" 
312  C "C5'" . DC  A 19  ? 0.73504 0.44446 0.47297 0.05167  0.17866  -0.04953 820 DC  P "C5'" 
313  C "C4'" . DC  A 19  ? 0.67756 0.45384 0.48145 0.03208  0.16048  -0.04937 820 DC  P "C4'" 
314  O "O4'" . DC  A 19  ? 0.69906 0.46660 0.49559 0.03927  0.14431  -0.03269 820 DC  P "O4'" 
315  C "C3'" . DC  A 19  ? 0.61135 0.43459 0.45445 0.02822  0.12102  -0.04628 820 DC  P "C3'" 
316  O "O3'" . DC  A 19  ? 0.59481 0.45513 0.46999 0.01952  0.13620  -0.05979 820 DC  P "O3'" 
317  C "C2'" . DC  A 19  ? 0.60736 0.48136 0.49310 0.01884  0.10942  -0.03555 820 DC  P "C2'" 
318  C "C1'" . DC  A 19  ? 0.70295 0.53232 0.55231 0.03145  0.11452  -0.02342 820 DC  P "C1'" 
319  N N1    . DC  A 19  ? 0.76516 0.58604 0.61080 0.04259  0.06954  0.00037  820 DC  P N1    
320  C C2    . DC  A 19  ? 0.70205 0.57872 0.60048 0.03978  0.04748  0.02301  820 DC  P C2    
321  O O2    . DC  A 19  ? 0.61374 0.53962 0.54545 0.03330  0.06824  0.01978  820 DC  P O2    
322  N N3    . DC  A 19  ? 0.65977 0.53661 0.57172 0.04463  0.00318  0.04899  820 DC  P N3    
323  C C4    . DC  A 19  ? 0.66182 0.47898 0.52528 0.05205  -0.02464 0.04601  820 DC  P C4    
324  N N4    . DC  A 19  ? 0.54094 0.36167 0.42483 0.05168  -0.07634 0.06980  820 DC  P N4    
325  C C5    . DC  A 19  ? 0.70053 0.45349 0.49226 0.06109  -0.00072 0.01999  820 DC  P C5    
326  C C6    . DC  A 19  ? 0.76660 0.52746 0.55795 0.05587  0.04893  0.00115  820 DC  P C6    
327  P P     . DC  A 20  ? 0.56711 0.45416 0.46854 0.02434  0.10398  -0.05574 821 DC  P P     
328  O OP1   . DC  A 20  ? 0.57934 0.50595 0.51262 0.01990  0.13077  -0.06793 821 DC  P OP1   
329  O OP2   . DC  A 20  ? 0.63895 0.45872 0.48863 0.04311  0.07502  -0.05074 821 DC  P OP2   
330  O "O5'" . DC  A 20  ? 0.51448 0.46235 0.46735 0.01269  0.07497  -0.03966 821 DC  P "O5'" 
331  C "C5'" . DC  A 20  ? 0.45419 0.46493 0.44403 -0.00181 0.09185  -0.04563 821 DC  P "C5'" 
332  C "C4'" . DC  A 20  ? 0.44720 0.50957 0.47235 -0.00256 0.06599  -0.02313 821 DC  P "C4'" 
333  O "O4'" . DC  A 20  ? 0.47181 0.51081 0.48413 0.00370  0.05651  -0.00533 821 DC  P "O4'" 
334  C "C3'" . DC  A 20  ? 0.49252 0.56844 0.54537 0.00212  0.03302  -0.00294 821 DC  P "C3'" 
335  O "O3'" . DC  A 20  ? 0.55745 0.68625 0.64045 -0.00014 0.03777  -0.00764 821 DC  P "O3'" 
336  C "C2'" . DC  A 20  ? 0.47191 0.57755 0.55392 0.00229  0.01099  0.02973  821 DC  P "C2'" 
337  C "C1'" . DC  A 20  ? 0.49020 0.56209 0.54146 0.00559  0.02333  0.02696  821 DC  P "C1'" 
338  N N1    . DC  A 20  ? 0.53859 0.55929 0.57643 0.00981  -0.00661 0.04214  821 DC  P N1    
339  C C2    . DC  A 20  ? 0.54838 0.59833 0.62991 0.00875  -0.03490 0.07865  821 DC  P C2    
340  O O2    . DC  A 20  ? 0.57564 0.69233 0.70144 0.00849  -0.02757 0.10019  821 DC  P O2    
341  N N3    . DC  A 20  ? 0.57059 0.57813 0.64546 0.00871  -0.07061 0.09130  821 DC  P N3    
342  C C4    . DC  A 20  ? 0.58997 0.52251 0.60095 0.01457  -0.07658 0.06630  821 DC  P C4    
343  N N4    . DC  A 20  ? 0.62369 0.51497 0.62077 0.01532  -0.11893 0.07655  821 DC  P N4    
344  C C5    . DC  A 20  ? 0.57218 0.47243 0.53201 0.02070  -0.03991 0.03200  821 DC  P C5    
345  C C6    . DC  A 20  ? 0.56445 0.51349 0.54767 0.01560  -0.00654 0.02223  821 DC  P C6    
390  P P     . DG  B 4   ? 2.62609 1.91181 1.66091 -0.49686 0.35005  -0.17590 704 DG  T P     
391  O OP1   . DG  B 4   ? 2.72159 1.94121 1.60442 -0.54215 0.30834  -0.13560 704 DG  T OP1   
392  O OP2   . DG  B 4   ? 2.47555 1.84962 1.69782 -0.44489 0.39857  -0.19981 704 DG  T OP2   
393  O "O5'" . DG  B 4   ? 2.39507 1.69744 1.47474 -0.44393 0.26603  -0.13779 704 DG  T "O5'" 
394  C "C5'" . DG  B 4   ? 2.31713 1.54600 1.25453 -0.47556 0.19957  -0.11208 704 DG  T "C5'" 
395  C "C4'" . DG  B 4   ? 2.05028 1.31059 1.05972 -0.43087 0.15242  -0.10349 704 DG  T "C4'" 
396  O "O4'" . DG  B 4   ? 2.01635 1.26161 1.02330 -0.45176 0.20750  -0.15194 704 DG  T "O4'" 
397  C "C3'" . DG  B 4   ? 1.76262 1.12128 0.95502 -0.35620 0.13719  -0.08760 704 DG  T "C3'" 
398  O "O3'" . DG  B 4   ? 1.62538 1.00795 0.83244 -0.32671 0.05892  -0.03982 704 DG  T "O3'" 
399  C "C2'" . DG  B 4   ? 1.72391 1.09738 0.96832 -0.33919 0.13446  -0.10626 704 DG  T "C2'" 
400  C "C1'" . DG  B 4   ? 1.87830 1.17583 1.00028 -0.39968 0.17978  -0.14740 704 DG  T "C1'" 
401  N N9    . DG  B 4   ? 1.84410 1.16218 1.05017 -0.39543 0.24980  -0.19981 704 DG  T N9    
402  C C8    . DG  B 4   ? 1.77352 1.14058 1.10495 -0.37273 0.30751  -0.22979 704 DG  T C8    
403  N N7    . DG  B 4   ? 1.78529 1.15696 1.18427 -0.37180 0.35407  -0.28190 704 DG  T N7    
404  C C5    . DG  B 4   ? 1.85120 1.17496 1.15584 -0.39672 0.32983  -0.28345 704 DG  T C5    
405  C C6    . DG  B 4   ? 1.91060 1.21557 1.23170 -0.40682 0.35701  -0.32960 704 DG  T C6    
406  O O6    . DG  B 4   ? 1.91705 1.24426 1.35052 -0.39368 0.40594  -0.38276 704 DG  T O6    
407  N N1    . DG  B 4   ? 1.97471 1.22777 1.17289 -0.43386 0.31615  -0.31265 704 DG  T N1    
408  C C2    . DG  B 4   ? 1.95918 1.18160 1.04350 -0.44738 0.25145  -0.26082 704 DG  T C2    
409  N N2    . DG  B 4   ? 2.01700 1.18837 1.00081 -0.47232 0.21421  -0.25501 704 DG  T N2    
410  N N3    . DG  B 4   ? 1.91359 1.15249 0.99033 -0.43610 0.22084  -0.22053 704 DG  T N3    
411  C C4    . DG  B 4   ? 1.87337 1.16362 1.05888 -0.41171 0.26556  -0.23318 704 DG  T C4    
412  P P     . DA  B 5   ? 1.54550 0.94016 0.75985 -0.30461 -0.02708 -0.01761 705 DA  T P     
413  O OP1   . DA  B 5   ? 1.69733 1.01779 0.79405 -0.34639 -0.03934 -0.03363 705 DA  T OP1   
414  O OP2   . DA  B 5   ? 1.53084 0.93706 0.74512 -0.28849 -0.09463 0.01747  705 DA  T OP2   
415  O "O5'" . DA  B 5   ? 1.29810 0.78329 0.67409 -0.25365 -0.01620 -0.02174 705 DA  T "O5'" 
416  C "C5'" . DA  B 5   ? 1.25032 0.74958 0.64768 -0.24606 -0.04684 -0.02751 705 DA  T "C5'" 
417  C "C4'" . DA  B 5   ? 1.14671 0.73323 0.68257 -0.20406 -0.06130 -0.01586 705 DA  T "C4'" 
418  O "O4'" . DA  B 5   ? 1.09502 0.69666 0.70974 -0.19235 -0.00524 -0.03172 705 DA  T "O4'" 
419  C "C3'" . DA  B 5   ? 1.04926 0.69212 0.64917 -0.17650 -0.08724 0.01056  705 DA  T "C3'" 
420  O "O3'" . DA  B 5   ? 1.00405 0.66391 0.58965 -0.17305 -0.15758 0.02121  705 DA  T "O3'" 
421  C "C2'" . DA  B 5   ? 0.91240 0.62022 0.63546 -0.14956 -0.07017 0.01351  705 DA  T "C2'" 
422  C "C1'" . DA  B 5   ? 0.96973 0.63587 0.69296 -0.15951 -0.00973 -0.01144 705 DA  T "C1'" 
423  N N9    . DA  B 5   ? 1.01300 0.67237 0.75789 -0.15458 0.03818  -0.01646 705 DA  T N9    
424  C C8    . DA  B 5   ? 1.08647 0.69292 0.75192 -0.18313 0.08108  -0.03773 705 DA  T C8    
425  N N7    . DA  B 5   ? 1.06664 0.68753 0.78081 -0.17461 0.12227  -0.04334 705 DA  T N7    
426  C C5    . DA  B 5   ? 0.98362 0.66626 0.81622 -0.13436 0.09991  -0.01989 705 DA  T C5    
427  C C6    . DA  B 5   ? 0.93406 0.65587 0.86630 -0.10718 0.11843  -0.01198 705 DA  T C6    
428  N N6    . DA  B 5   ? 0.79181 0.50345 0.73031 -0.11417 0.16931  -0.03178 705 DA  T N6    
429  N N1    . DA  B 5   ? 0.77950 0.55056 0.80144 -0.07801 0.08307  0.01476  705 DA  T N1    
430  C C2    . DA  B 5   ? 0.73647 0.52244 0.74988 -0.07985 0.03829  0.02817  705 DA  T C2    
431  N N3    . DA  B 5   ? 0.84556 0.60591 0.78083 -0.10131 0.01925  0.01915  705 DA  T N3    
432  C C4    . DA  B 5   ? 0.96299 0.66884 0.80963 -0.12568 0.04949  -0.00314 705 DA  T C4    
433  P P     . DC  B 6   ? 0.93793 0.63697 0.56154 -0.15152 -0.19760 0.04309  706 DC  T P     
434  O OP1   . DC  B 6   ? 0.88782 0.60335 0.51239 -0.14849 -0.27508 0.03909  706 DC  T OP1   
435  O OP2   . DC  B 6   ? 1.05388 0.69460 0.60493 -0.16720 -0.16850 0.05256  706 DC  T OP2   
436  O "O5'" . DC  B 6   ? 0.82729 0.61609 0.58388 -0.12034 -0.17503 0.05110  706 DC  T "O5'" 
437  C "C5'" . DC  B 6   ? 0.66350 0.52056 0.49527 -0.11217 -0.20026 0.04433  706 DC  T "C5'" 
438  C "C4'" . DC  B 6   ? 0.78471 0.70534 0.71548 -0.09359 -0.17750 0.05749  706 DC  T "C4'" 
439  O "O4'" . DC  B 6   ? 0.79050 0.67410 0.72609 -0.09149 -0.12179 0.06186  706 DC  T "O4'" 
440  C "C3'" . DC  B 6   ? 0.64420 0.60846 0.61990 -0.07256 -0.19580 0.07332  706 DC  T "C3'" 
441  O "O3'" . DC  B 6   ? 0.51949 0.55140 0.54429 -0.06908 -0.24619 0.06141  706 DC  T "O3'" 
442  C "C2'" . DC  B 6   ? 0.59171 0.58258 0.63822 -0.06043 -0.15534 0.08855  706 DC  T "C2'" 
443  C "C1'" . DC  B 6   ? 0.67444 0.59703 0.68171 -0.07035 -0.10864 0.08048  706 DC  T "C1'" 
444  N N1    . DC  B 6   ? 0.69380 0.57187 0.66784 -0.06687 -0.07176 0.08252  706 DC  T N1    
445  C C2    . DC  B 6   ? 0.59154 0.49202 0.63465 -0.04723 -0.04496 0.09517  706 DC  T C2    
446  O O2    . DC  B 6   ? 0.48096 0.43058 0.60335 -0.03359 -0.05711 0.10874  706 DC  T O2    
447  N N3    . DC  B 6   ? 0.65043 0.51597 0.66668 -0.04939 -0.00627 0.09025  706 DC  T N3    
448  C C4    . DC  B 6   ? 0.74010 0.54600 0.65283 -0.07663 0.00708  0.07494  706 DC  T C4    
449  N N4    . DC  B 6   ? 0.68608 0.46097 0.56764 -0.08871 0.05069  0.06621  706 DC  T N4    
450  C C5    . DC  B 6   ? 0.73500 0.50813 0.56694 -0.09842 -0.02405 0.06616  706 DC  T C5    
451  C C6    . DC  B 6   ? 0.64983 0.46308 0.52206 -0.08916 -0.06349 0.06978  706 DC  T C6    
452  P P     . DG  B 7   ? 0.51276 0.55219 0.53752 -0.05040 -0.27930 0.05725  707 DG  T P     
453  O OP1   . DG  B 7   ? 0.45299 0.54123 0.51197 -0.04359 -0.28191 0.02233  707 DG  T OP1   
454  O OP2   . DG  B 7   ? 0.71391 0.65976 0.63411 -0.06277 -0.29759 0.07422  707 DG  T OP2   
455  O "O5'" . DG  B 7   ? 0.38210 0.46989 0.47220 -0.02768 -0.24526 0.06874  707 DG  T "O5'" 
456  C "C5'" . DG  B 7   ? 0.33950 0.49170 0.48849 -0.02359 -0.21517 0.05326  707 DG  T "C5'" 
457  C "C4'" . DG  B 7   ? 0.31902 0.48051 0.49587 -0.01039 -0.18311 0.06884  707 DG  T "C4'" 
458  O "O4'" . DG  B 7   ? 0.34788 0.48293 0.53874 -0.01809 -0.17712 0.10511  707 DG  T "O4'" 
459  C "C3'" . DG  B 7   ? 0.39200 0.53922 0.55221 0.00845  -0.17977 0.07118  707 DG  T "C3'" 
460  O "O3'" . DG  B 7   ? 0.25971 0.44107 0.43521 0.01470  -0.18165 0.04737  707 DG  T "O3'" 
461  C "C2'" . DG  B 7   ? 0.31105 0.45156 0.49314 0.01265  -0.14773 0.09074  707 DG  T "C2'" 
462  C "C1'" . DG  B 7   ? 0.33415 0.45889 0.53543 -0.00117 -0.15204 0.12008  707 DG  T "C1'" 
463  N N9    . DG  B 7   ? 0.38601 0.45850 0.54906 -0.00014 -0.15454 0.14343  707 DG  T N9    
464  C C8    . DG  B 7   ? 0.47506 0.48776 0.54833 -0.01734 -0.16509 0.13033  707 DG  T C8    
465  N N7    . DG  B 7   ? 0.51622 0.46560 0.52750 -0.02595 -0.13121 0.13315  707 DG  T N7    
466  C C5    . DG  B 7   ? 0.49014 0.46398 0.56554 -0.00835 -0.09692 0.14673  707 DG  T C5    
467  C C6    . DG  B 7   ? 0.55361 0.49189 0.61388 -0.01058 -0.04870 0.14763  707 DG  T C6    
468  O O6    . DG  B 7   ? 0.60777 0.48427 0.58439 -0.03525 -0.02118 0.13482  707 DG  T O6    
469  N N1    . DG  B 7   ? 0.54017 0.52264 0.69396 0.01363  -0.03108 0.16139  707 DG  T N1    
470  C C2    . DG  B 7   ? 0.41677 0.46271 0.65360 0.03192  -0.05730 0.17589  707 DG  T C2    
471  N N2    . DG  B 7   ? 0.41672 0.48504 0.70118 0.03913  -0.03204 0.17097  707 DG  T N2    
472  N N3    . DG  B 7   ? 0.35080 0.42954 0.58739 0.02456  -0.09316 0.16710  707 DG  T N3    
473  C C4    . DG  B 7   ? 0.40214 0.44739 0.56890 0.00902  -0.11442 0.15639  707 DG  T C4    
474  P P     . DG  B 8   ? 0.64653 0.41846 0.38899 -0.02787 -0.16200 0.00088  708 DG  T P     
475  O OP1   . DG  B 8   ? 0.59312 0.39646 0.38140 -0.03058 -0.16748 -0.00693 708 DG  T OP1   
476  O OP2   . DG  B 8   ? 0.64554 0.38475 0.35947 -0.03101 -0.17459 0.00620  708 DG  T OP2   
477  O "O5'" . DG  B 8   ? 0.62804 0.40949 0.36634 -0.01954 -0.14555 0.00244  708 DG  T "O5'" 
478  C "C5'" . DG  B 8   ? 0.62490 0.44169 0.38627 -0.01970 -0.13265 -0.00102 708 DG  T "C5'" 
479  C "C4'" . DG  B 8   ? 0.63348 0.45645 0.38616 -0.01343 -0.11916 0.00283  708 DG  T "C4'" 
480  O "O4'" . DG  B 8   ? 0.62195 0.41985 0.34170 -0.00975 -0.11084 0.01349  708 DG  T "O4'" 
481  C "C3'" . DG  B 8   ? 0.64125 0.45546 0.39539 -0.00751 -0.12372 0.00073  708 DG  T "C3'" 
482  O "O3'" . DG  B 8   ? 0.63243 0.47796 0.42582 -0.00975 -0.12253 -0.00980 708 DG  T "O3'" 
483  C "C2'" . DG  B 8   ? 0.65483 0.46294 0.38503 -0.00134 -0.10981 0.00852  708 DG  T "C2'" 
484  C "C1'" . DG  B 8   ? 0.66214 0.44743 0.36598 -0.00242 -0.10577 0.01692  708 DG  T "C1'" 
485  N N9    . DG  B 8   ? 0.74100 0.48510 0.41351 -0.00147 -0.11251 0.01900  708 DG  T N9    
486  C C8    . DG  B 8   ? 0.76541 0.49006 0.42895 -0.00825 -0.12617 0.01622  708 DG  T C8    
487  N N7    . DG  B 8   ? 0.74259 0.43355 0.37310 -0.01017 -0.12882 0.01823  708 DG  T N7    
488  C C5    . DG  B 8   ? 0.79872 0.48477 0.41728 -0.00231 -0.11560 0.02217  708 DG  T C5    
489  C C6    . DG  B 8   ? 0.80708 0.46233 0.39186 -0.00154 -0.11051 0.02437  708 DG  T C6    
490  O O6    . DG  B 8   ? 0.80060 0.42720 0.35639 -0.00997 -0.11660 0.02250  708 DG  T O6    
491  N N1    . DG  B 8   ? 0.79938 0.46132 0.38513 0.00805  -0.09647 0.02889  708 DG  T N1    
492  C C2    . DG  B 8   ? 0.80724 0.50333 0.42101 0.01391  -0.08896 0.03169  708 DG  T C2    
493  N N2    . DG  B 8   ? 0.88976 0.58882 0.49918 0.02124  -0.07637 0.03752  708 DG  T N2    
494  N N3    . DG  B 8   ? 0.74989 0.47663 0.39298 0.01063  -0.09303 0.02874  708 DG  T N3    
495  C C4    . DG  B 8   ? 0.77278 0.49157 0.41739 0.00352  -0.10611 0.02366  708 DG  T C4    
496  P P     . DC  B 9   ? 0.64973 0.49122 0.47208 -0.00821 -0.13610 -0.01470 709 DC  T P     
497  O OP1   . DC  B 9   ? 0.59325 0.47069 0.46325 -0.01434 -0.13031 -0.02878 709 DC  T OP1   
498  O OP2   . DC  B 9   ? 0.56981 0.38048 0.37483 -0.00925 -0.15428 -0.00640 709 DC  T OP2   
499  O "O5'" . DC  B 9   ? 0.58812 0.42439 0.40354 -0.00047 -0.13035 -0.01238 709 DC  T "O5'" 
500  C "C5'" . DC  B 9   ? 0.55290 0.41373 0.37169 -0.00014 -0.11238 -0.01718 709 DC  T "C5'" 
501  C "C4'" . DC  B 9   ? 0.59985 0.44229 0.38925 0.00822  -0.10801 -0.00879 709 DC  T "C4'" 
502  O "O4'" . DC  B 9   ? 0.60254 0.41751 0.34933 0.01059  -0.10801 0.00286  709 DC  T "O4'" 
503  C "C3'" . DC  B 9   ? 0.65004 0.47172 0.44349 0.01385  -0.12031 -0.00575 709 DC  T "C3'" 
504  O "O3'" . DC  B 9   ? 0.59132 0.43554 0.42482 0.01448  -0.11511 -0.01541 709 DC  T "O3'" 
505  C "C2'" . DC  B 9   ? 0.67831 0.47500 0.42703 0.02027  -0.11579 0.00465  709 DC  T "C2'" 
506  C "C1'" . DC  B 9   ? 0.64869 0.43473 0.36903 0.01724  -0.11152 0.00979  709 DC  T "C1'" 
507  N N1    . DC  B 9   ? 0.71961 0.47317 0.41541 0.01419  -0.12479 0.01486  709 DC  T N1    
508  C C2    . DC  B 9   ? 0.79820 0.51946 0.45565 0.01636  -0.12531 0.02176  709 DC  T C2    
509  O O2    . DC  B 9   ? 0.80575 0.52553 0.45264 0.02304  -0.11502 0.02442  709 DC  T O2    
510  N N3    . DC  B 9   ? 0.84760 0.54127 0.47974 0.00907  -0.13631 0.02453  709 DC  T N3    
511  C C4    . DC  B 9   ? 0.84627 0.54375 0.49111 0.00138  -0.14770 0.02229  709 DC  T C4    
512  N N4    . DC  B 9   ? 0.85168 0.52336 0.46862 -0.00851 -0.15827 0.02499  709 DC  T N4    
513  C C5    . DC  B 9   ? 0.80642 0.53556 0.49257 0.00144  -0.14804 0.01629  709 DC  T C5    
514  C C6    . DC  B 9   ? 0.70981 0.46609 0.41973 0.00722  -0.13584 0.01194  709 DC  T C6    
515  P P     . DG  B 10  ? 0.63548 0.46992 0.50094 0.01773  -0.12978 -0.01305 710 DG  T P     
516  O OP1   . DG  B 10  ? 0.62623 0.48829 0.53695 0.01769  -0.11627 -0.02669 710 DG  T OP1   
517  O OP2   . DG  B 10  ? 0.55510 0.38068 0.43400 0.01302  -0.14768 -0.00846 710 DG  T OP2   
518  O "O5'" . DG  B 10  ? 0.63650 0.44062 0.45965 0.02456  -0.13571 0.00080  710 DG  T "O5'" 
519  C "C5'" . DG  B 10  ? 0.59985 0.40757 0.40761 0.03030  -0.12119 -0.00032 710 DG  T "C5'" 
520  C "C4'" . DG  B 10  ? 0.58745 0.36350 0.35476 0.03534  -0.12871 0.01283  710 DG  T "C4'" 
521  O "O4'" . DG  B 10  ? 0.63147 0.38445 0.35392 0.03248  -0.13072 0.01930  710 DG  T "O4'" 
522  C "C3'" . DG  B 10  ? 0.58874 0.35135 0.37170 0.03459  -0.14881 0.02188  710 DG  T "C3'" 
523  O "O3'" . DG  B 10  ? 0.62438 0.39771 0.43680 0.04018  -0.14488 0.02013  710 DG  T "O3'" 
524  C "C2'" . DG  B 10  ? 0.60523 0.33464 0.33153 0.03280  -0.15626 0.03372  710 DG  T "C2'" 
525  C "C1'" . DG  B 10  ? 0.64538 0.36915 0.34055 0.03035  -0.14532 0.02957  710 DG  T "C1'" 
526  N N9    . DG  B 10  ? 0.73990 0.45243 0.42592 0.02118  -0.15782 0.03194  710 DG  T N9    
527  C C8    . DG  B 10  ? 0.75043 0.47880 0.46077 0.01704  -0.15917 0.02587  710 DG  T C8    
528  N N7    . DG  B 10  ? 0.79461 0.50666 0.48680 0.00818  -0.17130 0.02999  710 DG  T N7    
529  C C5    . DG  B 10  ? 0.80749 0.49214 0.45958 0.00442  -0.17755 0.03837  710 DG  T C5    
530  C C6    . DG  B 10  ? 0.86010 0.52020 0.47597 -0.00853 -0.18948 0.04411  710 DG  T C6    
531  O O6    . DG  B 10  ? 0.91024 0.56690 0.52268 -0.01831 -0.19778 0.04366  710 DG  T O6    
532  N N1    . DG  B 10  ? 0.87636 0.51538 0.45579 -0.01181 -0.19066 0.05004  710 DG  T N1    
533  C C2    . DG  B 10  ? 0.90389 0.54434 0.48340 -0.00164 -0.18225 0.05136  710 DG  T C2    
534  N N2    . DG  B 10  ? 0.99096 0.61100 0.53414 -0.00771 -0.18378 0.05658  710 DG  T N2    
535  N N3    . DG  B 10  ? 0.85670 0.51948 0.47052 0.01149  -0.17156 0.04664  710 DG  T N3    
536  C C4    . DG  B 10  ? 0.80490 0.48936 0.45316 0.01285  -0.16949 0.03983  710 DG  T C4    
537  P P     . DC  B 11  ? 0.74339 0.51870 0.60462 0.03972  -0.16222 0.02808  711 DC  T P     
538  O OP1   . DC  B 11  ? 0.73718 0.52511 0.62640 0.04659  -0.15018 0.02234  711 DC  T OP1   
539  O OP2   . DC  B 11  ? 0.70557 0.49417 0.61070 0.03377  -0.17074 0.02513  711 DC  T OP2   
540  O "O5'" . DC  B 11  ? 0.74153 0.48674 0.55885 0.03604  -0.18211 0.04764  711 DC  T "O5'" 
541  C "C5'" . DC  B 11  ? 0.69347 0.42147 0.46686 0.04004  -0.17712 0.05263  711 DC  T "C5'" 
542  C "C4'" . DC  B 11  ? 0.76317 0.46673 0.49998 0.03101  -0.19718 0.06942  711 DC  T "C4'" 
543  O "O4'" . DC  B 11  ? 0.82996 0.52021 0.53030 0.02203  -0.19966 0.06790  711 DC  T "O4'" 
544  C "C3'" . DC  B 11  ? 0.73857 0.44945 0.51937 0.02496  -0.22111 0.08514  711 DC  T "C3'" 
545  O "O3'" . DC  B 11  ? 0.82207 0.52607 0.59720 0.02614  -0.22795 0.09742  711 DC  T "O3'" 
546  C "C2'" . DC  B 11  ? 0.74446 0.44295 0.49799 0.00958  -0.23993 0.09527  711 DC  T "C2'" 
547  C "C1'" . DC  B 11  ? 0.81257 0.49494 0.50967 0.00848  -0.22373 0.08216  711 DC  T "C1'" 
548  N N1    . DC  B 11  ? 0.81395 0.50033 0.51672 0.00204  -0.22676 0.07691  711 DC  T N1    
549  C C2    . DC  B 11  ? 0.85620 0.52583 0.52189 -0.01397 -0.24079 0.08434  711 DC  T C2    
550  O O2    . DC  B 11  ? 0.90332 0.55830 0.53414 -0.02434 -0.24834 0.09371  711 DC  T O2    
551  N N3    . DC  B 11  ? 0.89446 0.56765 0.56558 -0.01966 -0.24311 0.07922  711 DC  T N3    
552  C C4    . DC  B 11  ? 0.85126 0.54434 0.56252 -0.01003 -0.23221 0.06756  711 DC  T C4    
553  N N4    . DC  B 11  ? 0.81021 0.50656 0.52557 -0.01620 -0.23517 0.06318  711 DC  T N4    
554  C C5    . DC  B 11  ? 0.78767 0.49949 0.53567 0.00415  -0.21726 0.05911  711 DC  T C5    
555  C C6    . DC  B 11  ? 0.74734 0.45473 0.48969 0.00980  -0.21486 0.06392  711 DC  T C6    
556  P P     . DC  B 12  ? 1.00950 0.74220 0.67395 0.25104  -0.15904 0.08218  712 DC  T P     
557  O OP1   . DC  B 12  ? 1.03722 0.82211 0.75681 0.27041  -0.15967 0.09282  712 DC  T OP1   
558  O OP2   . DC  B 12  ? 0.90833 0.62343 0.56860 0.22231  -0.15016 0.09154  712 DC  T OP2   
559  O "O5'" . DC  B 12  ? 1.00723 0.74957 0.64238 0.25532  -0.14873 0.08052  712 DC  T "O5'" 
560  C "C5'" . DC  B 12  ? 1.03904 0.81312 0.66556 0.29010  -0.15113 0.06964  712 DC  T "C5'" 
561  C "C4'" . DC  B 12  ? 1.07655 0.85158 0.66856 0.29461  -0.14808 0.06136  712 DC  T "C4'" 
562  O "O4'" . DC  B 12  ? 1.15202 0.85320 0.70871 0.29013  -0.17010 0.04101  712 DC  T "O4'" 
563  C "C3'" . DC  B 12  ? 1.02240 0.82259 0.62911 0.26580  -0.12793 0.08459  712 DC  T "C3'" 
564  O "O3'" . DC  B 12  ? 1.09626 0.96027 0.70273 0.28686  -0.11332 0.09117  712 DC  T "O3'" 
565  C "C2'" . DC  B 12  ? 1.04212 0.78657 0.61947 0.25047  -0.13916 0.07358  712 DC  T "C2'" 
566  C "C1'" . DC  B 12  ? 1.10577 0.79559 0.64927 0.27500  -0.16714 0.04499  712 DC  T "C1'" 
567  N N1    . DC  B 12  ? 1.06098 0.67276 0.58660 0.25339  -0.17895 0.04609  712 DC  T N1    
568  C C2    . DC  B 12  ? 1.03868 0.59354 0.53802 0.26252  -0.20546 0.03032  712 DC  T C2    
569  O O2    . DC  B 12  ? 1.02692 0.60021 0.51654 0.29252  -0.22446 0.00567  712 DC  T O2    
570  N N3    . DC  B 12  ? 1.04108 0.52569 0.53153 0.24052  -0.21091 0.04269  712 DC  T N3    
571  C C4    . DC  B 12  ? 1.05103 0.53241 0.54660 0.21664  -0.18900 0.06452  712 DC  T C4    
572  N N4    . DC  B 12  ? 1.09761 0.52189 0.58264 0.19921  -0.18733 0.08191  712 DC  T N4    
573  C C5    . DC  B 12  ? 0.99605 0.53477 0.51330 0.21297  -0.16979 0.06989  712 DC  T C5    
574  C C6    . DC  B 12  ? 0.97715 0.57471 0.51404 0.22879  -0.16651 0.06269  712 DC  T C6    
575  P P     . DC  B 13  ? 1.07755 0.97874 0.70359 0.26374  -0.09368 0.11577  713 DC  T P     
576  O OP1   . DC  B 13  ? 1.06190 1.03601 0.70038 0.28998  -0.07102 0.13514  713 DC  T OP1   
577  O OP2   . DC  B 13  ? 1.02103 0.89282 0.67750 0.22290  -0.09306 0.13041  713 DC  T OP2   
578  O "O5'" . DC  B 13  ? 1.13661 1.02038 0.72488 0.27031  -0.10727 0.09318  713 DC  T "O5'" 
579  C "C5'" . DC  B 13  ? 1.18396 1.06926 0.73211 0.31199  -0.12529 0.05946  713 DC  T "C5'" 
580  C "C4'" . DC  B 13  ? 1.20178 1.05396 0.72608 0.31297  -0.15020 0.03588  713 DC  T "C4'" 
581  O "O4'" . DC  B 13  ? 1.23390 1.00043 0.75075 0.29580  -0.17325 0.02782  713 DC  T "O4'" 
582  C "C3'" . DC  B 13  ? 1.19297 1.06692 0.73494 0.28740  -0.13838 0.05681  713 DC  T "C3'" 
583  O "O3'" . DC  B 13  ? 1.26154 1.16049 0.78080 0.31475  -0.15584 0.03097  713 DC  T "O3'" 
584  C "C2'" . DC  B 13  ? 1.17760 0.98366 0.72837 0.25260  -0.14676 0.06583  713 DC  T "C2'" 
585  C "C1'" . DC  B 13  ? 1.20866 0.94693 0.73086 0.26969  -0.17720 0.03871  713 DC  T "C1'" 
586  N N1    . DC  B 13  ? 1.16166 0.83084 0.68839 0.23929  -0.17432 0.05610  713 DC  T N1    
587  C C2    . DC  B 13  ? 1.22686 0.81129 0.73672 0.23751  -0.20322 0.04787  713 DC  T C2    
588  O O2    . DC  B 13  ? 1.25366 0.81872 0.75483 0.26353  -0.24251 0.01882  713 DC  T O2    
589  N N3    . DC  B 13  ? 1.27641 0.80658 0.78999 0.20855  -0.18921 0.07063  713 DC  T N3    
590  C C4    . DC  B 13  ? 1.20128 0.76643 0.73067 0.18925  -0.15741 0.08890  713 DC  T C4    
591  N N4    . DC  B 13  ? 1.16394 0.69037 0.69161 0.16885  -0.14505 0.10537  713 DC  T N4    
592  C C5    . DC  B 13  ? 1.15695 0.79956 0.71128 0.19266  -0.14030 0.09110  713 DC  T C5    
593  C C6    . DC  B 13  ? 1.14046 0.82977 0.69392 0.21476  -0.14596 0.07988  713 DC  T C6    
594  P P     . DG  B 14  ? 1.22519 1.16442 0.75880 0.30195  -0.14534 0.04922  714 DG  T P     
595  O OP1   . DG  B 14  ? 1.32372 1.33109 0.83850 0.33920  -0.13389 0.04380  714 DG  T OP1   
596  O OP2   . DG  B 14  ? 1.11530 1.04546 0.68848 0.25741  -0.12258 0.08900  714 DG  T OP2   
597  O "O5'" . DG  B 14  ? 1.21068 1.10734 0.73394 0.30522  -0.18671 0.01770  714 DG  T "O5'" 
598  C "C5'" . DG  B 14  ? 1.26085 1.14156 0.76123 0.34208  -0.22843 -0.03492 714 DG  T "C5'" 
599  C "C4'" . DG  B 14  ? 1.31912 1.13298 0.83459 0.33053  -0.27581 -0.05707 714 DG  T "C4'" 
600  O "O4'" . DG  B 14  ? 1.36456 1.10442 0.88838 0.29807  -0.26726 -0.02773 714 DG  T "O4'" 
601  C "C3'" . DG  B 14  ? 1.28730 1.11774 0.82667 0.31375  -0.28034 -0.04508 714 DG  T "C3'" 
602  O "O3'" . DG  B 14  ? 1.35947 1.16178 0.94655 0.31305  -0.32687 -0.09419 714 DG  T "O3'" 
603  C "C2'" . DG  B 14  ? 1.23330 1.02265 0.79142 0.26812  -0.24656 0.00630  714 DG  T "C2'" 
604  C "C1'" . DG  B 14  ? 1.30277 1.02159 0.86749 0.25496  -0.24937 -0.00079 714 DG  T "C1'" 
605  N N9    . DG  B 14  ? 1.23771 0.92048 0.79264 0.22713  -0.21431 0.04496  714 DG  T N9    
606  C C8    . DG  B 14  ? 1.17493 0.90521 0.73022 0.21685  -0.17501 0.07510  714 DG  T C8    
607  N N7    . DG  B 14  ? 1.15016 0.84670 0.71541 0.18958  -0.15244 0.09754  714 DG  T N7    
608  C C5    . DG  B 14  ? 1.21297 0.82063 0.76195 0.18502  -0.17369 0.09547  714 DG  T C5    
609  C C6    . DG  B 14  ? 1.21243 0.76061 0.76317 0.15891  -0.15521 0.11589  714 DG  T C6    
610  O O6    . DG  B 14  ? 1.20021 0.77224 0.76137 0.14208  -0.12503 0.13010  714 DG  T O6    
611  N N1    . DG  B 14  ? 1.23046 0.71014 0.80206 0.14776  -0.17098 0.10929  714 DG  T N1    
612  C C2    . DG  B 14  ? 1.26384 0.75414 0.88324 0.15283  -0.20082 0.07026  714 DG  T C2    
613  N N2    . DG  B 14  ? 1.31817 0.74798 0.98937 0.13197  -0.20958 0.06495  714 DG  T N2    
614  N N3    . DG  B 14  ? 1.25514 0.81067 0.87330 0.17976  -0.22236 0.03881  714 DG  T N3    
615  C C4    . DG  B 14  ? 1.23780 0.84720 0.81105 0.19605  -0.20491 0.05876  714 DG  T C4    
616  P P     . DA  B 15  ? 1.35186 1.18878 0.97854 0.31070  -0.34691 -0.10935 715 DA  T P     
617  O OP1   . DA  B 15  ? 1.38836 1.28124 0.97807 0.36586  -0.37976 -0.15593 715 DA  T OP1   
618  O OP2   . DA  B 15  ? 1.29710 1.15020 0.92615 0.28102  -0.30439 -0.05172 715 DA  T OP2   
619  O "O5'" . DA  B 15  ? 1.36178 1.13573 1.09358 0.27090  -0.36972 -0.13971 715 DA  T "O5'" 
620  C "C5'" . DA  B 15  ? 1.32467 1.03349 1.08571 0.26132  -0.38309 -0.15974 715 DA  T "C5'" 
621  C "C4'" . DA  B 15  ? 1.29800 0.94277 1.15647 0.20318  -0.36675 -0.14079 715 DA  T "C4'" 
622  O "O4'" . DA  B 15  ? 1.24646 0.85559 1.07021 0.17220  -0.31171 -0.07746 715 DA  T "O4'" 
623  C "C3'" . DA  B 15  ? 1.29352 0.96393 1.22861 0.17760  -0.36518 -0.14120 715 DA  T "C3'" 
624  O "O3'" . DA  B 15  ? 1.35548 0.97695 1.41125 0.14417  -0.38154 -0.16187 715 DA  T "O3'" 
625  C "C2'" . DA  B 15  ? 1.19107 0.86663 1.09437 0.14674  -0.30273 -0.07371 715 DA  T "C2'" 
626  C "C1'" . DA  B 15  ? 1.17056 0.78637 1.03163 0.13430  -0.27427 -0.04008 715 DA  T "C1'" 
627  N N9    . DA  B 15  ? 1.13164 0.76125 0.91581 0.13375  -0.23194 0.00909  715 DA  T N9    
628  C C8    . DA  B 15  ? 1.09737 0.78525 0.81845 0.16283  -0.22897 0.01771  715 DA  T C8    
629  N N7    . DA  B 15  ? 1.06677 0.75097 0.74603 0.15428  -0.19315 0.06067  715 DA  T N7    
630  C C5    . DA  B 15  ? 1.08301 0.70358 0.78198 0.12246  -0.17136 0.08022  715 DA  T C5    
631  C C6    . DA  B 15  ? 1.11433 0.70156 0.77932 0.10728  -0.13637 0.11988  715 DA  T C6    
632  N N6    . DA  B 15  ? 1.07766 0.69167 0.69753 0.11915  -0.12195 0.14155  715 DA  T N6    
633  N N1    . DA  B 15  ? 1.13893 0.66384 0.82143 0.08210  -0.11832 0.13681  715 DA  T N1    
634  C C2    . DA  B 15  ? 1.10675 0.60331 0.85572 0.06691  -0.13298 0.11811  715 DA  T C2    
635  N N3    . DA  B 15  ? 1.11841 0.64015 0.92047 0.07644  -0.17154 0.07412  715 DA  T N3    
636  C C4    . DA  B 15  ? 1.11533 0.70089 0.87956 0.10755  -0.19031 0.05492  715 DA  T C4    
637  P P     . DA  B 16  ? 1.38897 1.03588 1.56304 0.11786  -0.39087 -0.17805 716 DA  T P     
638  O OP1   . DA  B 16  ? 1.47642 1.08668 1.77266 0.11175  -0.44222 -0.23290 716 DA  T OP1   
639  O OP2   . DA  B 16  ? 1.32192 1.04480 1.44398 0.15010  -0.40377 -0.18864 716 DA  T OP2   
640  O "O5'" . DA  B 16  ? 1.34941 0.96818 1.55605 0.06174  -0.31779 -0.10779 716 DA  T "O5'" 
641  C "C5'" . DA  B 16  ? 1.34546 0.89223 1.61208 0.02347  -0.29130 -0.07936 716 DA  T "C5'" 
642  C "C4'" . DA  B 16  ? 1.29054 0.82724 1.54552 -0.01394 -0.21681 -0.01019 716 DA  T "C4'" 
643  O "O4'" . DA  B 16  ? 1.19775 0.74856 1.31434 0.00761  -0.19144 0.02130  716 DA  T "O4'" 
644  C "C3'" . DA  B 16  ? 1.30299 0.89206 1.63777 -0.03577 -0.19601 -0.00737 716 DA  T "C3'" 
645  O "O3'" . DA  B 16  ? 1.47975 1.03837 1.89429 -0.08149 -0.13962 0.03768  716 DA  T "O3'" 
646  C "C2'" . DA  B 16  ? 1.16331 0.79866 1.38518 -0.01494 -0.17363 0.01529  716 DA  T "C2'" 
647  C "C1'" . DA  B 16  ? 1.11106 0.69921 1.22269 -0.00734 -0.14897 0.05233  716 DA  T "C1'" 
648  N N9    . DA  B 16  ? 1.00396 0.62683 1.00552 0.02186  -0.14549 0.06378  716 DA  T N9    
649  C C8    . DA  B 16  ? 0.93971 0.61606 0.90494 0.05656  -0.18105 0.03612  716 DA  T C8    
650  N N7    . DA  B 16  ? 0.88829 0.58544 0.77014 0.07331  -0.16398 0.06254  716 DA  T N7    
651  C C5    . DA  B 16  ? 0.90144 0.55635 0.75995 0.05110  -0.12067 0.10191  716 DA  T C5    
652  C C6    . DA  B 16  ? 0.84532 0.49614 0.63309 0.05664  -0.09293 0.13554  716 DA  T C6    
653  N N6    . DA  B 16  ? 0.78368 0.47435 0.52599 0.08073  -0.10107 0.14017  716 DA  T N6    
654  N N1    . DA  B 16  ? 0.89127 0.49535 0.66126 0.03865  -0.05751 0.16508  716 DA  T N1    
655  C C2    . DA  B 16  ? 0.92749 0.49151 0.74855 0.01346  -0.04255 0.17099  716 DA  T C2    
656  N N3    . DA  B 16  ? 0.97954 0.54182 0.88684 -0.00019 -0.06262 0.14586  716 DA  T N3    
657  C C4    . DA  B 16  ? 0.96321 0.57270 0.88498 0.02123  -0.10591 0.10647  716 DA  T C4    
658  P P     . DC  B 17  ? 1.59830 1.20308 2.15523 -0.11243 -0.11981 0.03278  717 DC  T P     
659  O OP1   . DC  B 17  ? 1.68064 1.24772 2.29814 -0.15507 -0.05009 0.09148  717 DC  T OP1   
660  O OP2   . DC  B 17  ? 1.66283 1.28869 2.33283 -0.10294 -0.19178 -0.03701 717 DC  T OP2   
661  O "O5'" . DC  B 17  ? 1.45433 1.12560 1.93334 -0.09330 -0.10361 0.03869  717 DC  T "O5'" 
662  C "C5'" . DC  B 17  ? 1.33413 1.02448 1.81485 -0.11453 -0.03582 0.08345  717 DC  T "C5'" 
663  C "C4'" . DC  B 17  ? 1.25800 0.90277 1.61440 -0.11280 0.01358  0.13793  717 DC  T "C4'" 
664  O "O4'" . DC  B 17  ? 1.22874 0.85722 1.46436 -0.07858 -0.02377 0.12675  717 DC  T "O4'" 
665  C "C3'" . DC  B 17  ? 1.17370 0.84925 1.47881 -0.11211 0.06762  0.17023  717 DC  T "C3'" 
666  O "O3'" . DC  B 17  ? 1.19512 0.86208 1.56633 -0.14263 0.13059  0.20729  717 DC  T "O3'" 
667  C "C2'" . DC  B 17  ? 1.17692 0.81634 1.33045 -0.08754 0.07293  0.19474  717 DC  T "C2'" 
668  C "C1'" . DC  B 17  ? 1.18684 0.81223 1.30812 -0.06550 0.01014  0.16140  717 DC  T "C1'" 
669  N N1    . DC  B 17  ? 1.11206 0.78405 1.17341 -0.03370 -0.02416 0.13915  717 DC  T N1    
670  C C2    . DC  B 17  ? 1.07234 0.74997 1.04020 -0.01702 -0.00556 0.16252  717 DC  T C2    
671  O O2    . DC  B 17  ? 1.16969 0.81570 1.09392 -0.02384 0.03518  0.19480  717 DC  T O2    
672  N N3    . DC  B 17  ? 0.92310 0.64080 0.85418 0.00869  -0.03422 0.14980  717 DC  T N3    
673  C C4    . DC  B 17  ? 0.87470 0.62670 0.83820 0.02262  -0.07678 0.11819  717 DC  T C4    
674  N N4    . DC  B 17  ? 0.81027 0.60078 0.73081 0.04969  -0.09750 0.11731  717 DC  T N4    
675  C C5    . DC  B 17  ? 0.93370 0.68171 0.97842 0.01218  -0.10186 0.08642  717 DC  T C5    
676  C C6    . DC  B 17  ? 1.03559 0.74275 1.13603 -0.01815 -0.07574 0.09684  717 DC  T C6    
677  P P     . DA  B 18  ? 1.21411 0.93916 1.61160 -0.14747 0.18392  0.22047  718 DA  T P     
678  O OP1   . DA  B 18  ? 1.28185 0.98962 1.73234 -0.17582 0.25740  0.26900  718 DA  T OP1   
679  O OP2   . DA  B 18  ? 1.18508 0.97343 1.67292 -0.14377 0.14156  0.17120  718 DA  T OP2   
680  O "O5'" . DA  B 18  ? 1.15637 0.88005 1.39660 -0.11368 0.19026  0.23258  718 DA  T "O5'" 
681  C "C5'" . DA  B 18  ? 1.18465 0.85589 1.31086 -0.10407 0.22459  0.27385  718 DA  T "C5'" 
682  C "C4'" . DA  B 18  ? 1.16041 0.85287 1.18577 -0.07424 0.23600  0.27499  718 DA  T "C4'" 
683  O "O4'" . DA  B 18  ? 1.09431 0.79469 1.07082 -0.05110 0.17715  0.24586  718 DA  T "O4'" 
684  C "C3'" . DA  B 18  ? 1.14181 0.89945 1.22743 -0.07511 0.26629  0.26372  718 DA  T "C3'" 
685  O "O3'" . DA  B 18  ? 1.21327 0.97095 1.20672 -0.05134 0.30355  0.28032  718 DA  T "O3'" 
686  C "C2'" . DA  B 18  ? 1.04478 0.84451 1.16242 -0.06318 0.20710  0.22100  718 DA  T "C2'" 
687  C "C1'" . DA  B 18  ? 1.03007 0.79018 1.04501 -0.04199 0.16426  0.22049  718 DA  T "C1'" 
688  N N9    . DA  B 18  ? 0.97126 0.74987 1.01502 -0.03586 0.10565  0.19169  718 DA  T N9    
689  C C8    . DA  B 18  ? 0.96643 0.75200 1.09028 -0.04946 0.07716  0.17042  718 DA  T C8    
690  N N7    . DA  B 18  ? 0.93818 0.74363 1.05168 -0.03030 0.02488  0.14619  718 DA  T N7    
691  C C5    . DA  B 18  ? 0.88153 0.69235 0.91434 -0.00812 0.02338  0.15865  718 DA  T C5    
692  C C6    . DA  B 18  ? 0.78769 0.61878 0.77847 0.01748  -0.01338 0.15394  718 DA  T C6    
693  N N6    . DA  B 18  ? 0.75198 0.60515 0.75687 0.03118  -0.05606 0.13408  718 DA  T N6    
694  N N1    . DA  B 18  ? 0.77906 0.60838 0.71525 0.03148  -0.00471 0.17107  718 DA  T N1    
695  C C2    . DA  B 18  ? 0.83192 0.64076 0.74407 0.02618  0.03223  0.18398  718 DA  T C2    
696  N N3    . DA  B 18  ? 0.88591 0.67688 0.81340 0.00838  0.07161  0.19106  718 DA  T N3    
697  C C4    . DA  B 18  ? 0.89966 0.69264 0.89360 -0.01118 0.06793  0.18162  718 DA  T C4    
698  P P     . DG  B 19  ? 1.27783 1.09667 1.32209 -0.04883 0.35653  0.27738  719 DG  T P     
699  O OP1   . DG  B 19  ? 1.39938 1.19997 1.32893 -0.02202 0.40537  0.30459  719 DG  T OP1   
700  O OP2   . DG  B 19  ? 1.33631 1.18723 1.52906 -0.08483 0.37924  0.27835  719 DG  T OP2   
701  O "O5'" . DG  B 19  ? 1.10001 0.96470 1.15903 -0.02817 0.30890  0.23281  719 DG  T "O5'" 
702  C "C5'" . DG  B 19  ? 1.10720 0.98692 1.09785 0.00460  0.31923  0.22284  719 DG  T "C5'" 
703  C "C4'" . DG  B 19  ? 1.02179 0.90098 0.98486 0.02515  0.25476  0.19567  719 DG  T "C4'" 
704  O "O4'" . DG  B 19  ? 0.97789 0.84211 0.97087 0.00866  0.20809  0.19365  719 DG  T "O4'" 
705  C "C3'" . DG  B 19  ? 0.98493 0.92105 1.01814 0.03707  0.23971  0.16264  719 DG  T "C3'" 
706  O "O3'" . DG  B 19  ? 1.04030 0.97369 1.00780 0.07115  0.23467  0.14889  719 DG  T "O3'" 
707  C "C2'" . DG  B 19  ? 0.90024 0.84460 0.98531 0.02957  0.17836  0.14946  719 DG  T "C2'" 
708  C "C1'" . DG  B 19  ? 0.90301 0.79637 0.92719 0.02088  0.16022  0.17004  719 DG  T "C1'" 
709  N N9    . DG  B 19  ? 0.84808 0.74919 0.92787 0.00601  0.12277  0.16294  719 DG  T N9    
710  C C8    . DG  B 19  ? 0.86361 0.76619 1.00989 -0.01884 0.12988  0.16139  719 DG  T C8    
711  N N7    . DG  B 19  ? 0.81871 0.72837 0.99385 -0.01861 0.08191  0.14600  719 DG  T N7    
712  C C5    . DG  B 19  ? 0.78994 0.70458 0.91089 0.00618  0.04874  0.14616  719 DG  T C5    
713  C C6    . DG  B 19  ? 0.74248 0.66927 0.85418 0.02202  -0.00105 0.13967  719 DG  T C6    
714  O O6    . DG  B 19  ? 0.73515 0.67158 0.87551 0.02230  -0.03241 0.12421  719 DG  T O6    
715  N N1    . DG  B 19  ? 0.71882 0.64740 0.78412 0.04251  -0.01401 0.15279  719 DG  T N1    
716  C C2    . DG  B 19  ? 0.74053 0.65843 0.77837 0.04859  0.00843  0.16068  719 DG  T C2    
717  N N2    . DG  B 19  ? 0.74559 0.66565 0.76294 0.06708  -0.01385 0.17074  719 DG  T N2    
718  N N3    . DG  B 19  ? 0.74387 0.65120 0.77715 0.04022  0.04952  0.15892  719 DG  T N3    
719  C C4    . DG  B 19  ? 0.78293 0.69034 0.85552 0.01854  0.07174  0.15606  719 DG  T C4    
720  P P     . DG  B 20  ? 1.08431 1.07334 1.10240 0.09217  0.25254  0.11741  720 DG  T P     
721  O OP1   . DG  B 20  ? 1.21872 1.19346