data_6WPJ
# 
_entry.id   6WPJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WPJ         
WWPDB D_1000248783 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WPJ 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bertoletti, N.' 1 0000-0001-5167-402X 
'Anderson, K.S.' 2 0000-0003-3433-0780 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Molecules 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1420-3049 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Post-Catalytic Complexes with Emtricitabine or Stavudine and HIV-1 Reverse Transcriptase Reveal New Mechanistic Insights for Nucleotide Incorporation and Drug Resistance.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/molecules25204868 
_citation.pdbx_database_id_PubMed   33096918 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bertoletti, N.' 1 0000-0001-5167-402X 
primary 'Chan, A.H.'     2 ?                   
primary 'Schinazi, R.F.' 3 ?                   
primary 'Anderson, K.S.' 4 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WPJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     167.588 
_cell.length_a_esd                 ? 
_cell.length_b                     170.061 
_cell.length_b_esd                 ? 
_cell.length_c                     102.459 
_cell.length_c_esd                 ? 
_cell.volume                       2920100.236 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WPJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Reverse transcriptase/ribonuclease H'                64653.090 1 2.7.7.49,2.7.7.7,3.1.26.13 'C280S, Q258C' ? ? 
2 polymer     man 'p51 RT'                                              52748.418 1 2.7.7.-,3.1.-.-            C280S          ? ? 
3 polymer     syn 'DNA Primer 21-mer'                                   6460.241  1 ?                          ?              ? ? 
4 polymer     syn 'DNA template 27-mer'                                 8392.398  1 ?                          ?              ? ? 
5 non-polymer syn 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
464.153   1 ?                          ?              ? ? 
6 non-polymer syn 'MAGNESIUM ION'                                       24.305    2 ?                          ?              ? ? 
7 non-polymer syn 'SULFATE ION'                                         96.063    1 ?                          ?              ? ? 
8 water       nat water                                                 18.015    6 ?                          ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
;MPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW
TVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYY
DPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE
TWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTEL
QAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
L
;
A ? 
2 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(G47)(DC)(DG)(DC)
(DC)(DDG)
;
ACAGTCCCTGTTCGGGCGCCG P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DA)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGACGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ILE n 
1 4   SER n 
1 5   PRO n 
1 6   ILE n 
1 7   GLU n 
1 8   THR n 
1 9   VAL n 
1 10  PRO n 
1 11  VAL n 
1 12  LYS n 
1 13  LEU n 
1 14  LYS n 
1 15  PRO n 
1 16  GLY n 
1 17  MET n 
1 18  ASP n 
1 19  GLY n 
1 20  PRO n 
1 21  LYS n 
1 22  VAL n 
1 23  LYS n 
1 24  GLN n 
1 25  TRP n 
1 26  PRO n 
1 27  LEU n 
1 28  THR n 
1 29  GLU n 
1 30  GLU n 
1 31  LYS n 
1 32  ILE n 
1 33  LYS n 
1 34  ALA n 
1 35  LEU n 
1 36  VAL n 
1 37  GLU n 
1 38  ILE n 
1 39  CYS n 
1 40  THR n 
1 41  GLU n 
1 42  MET n 
1 43  GLU n 
1 44  LYS n 
1 45  GLU n 
1 46  GLY n 
1 47  LYS n 
1 48  ILE n 
1 49  SER n 
1 50  LYS n 
1 51  ILE n 
1 52  GLY n 
1 53  PRO n 
1 54  GLU n 
1 55  ASN n 
1 56  PRO n 
1 57  TYR n 
1 58  ASN n 
1 59  THR n 
1 60  PRO n 
1 61  VAL n 
1 62  PHE n 
1 63  ALA n 
1 64  ILE n 
1 65  LYS n 
1 66  LYS n 
1 67  LYS n 
1 68  ASP n 
1 69  SER n 
1 70  THR n 
1 71  LYS n 
1 72  TRP n 
1 73  ARG n 
1 74  LYS n 
1 75  LEU n 
1 76  VAL n 
1 77  ASP n 
1 78  PHE n 
1 79  ARG n 
1 80  GLU n 
1 81  LEU n 
1 82  ASN n 
1 83  LYS n 
1 84  ARG n 
1 85  THR n 
1 86  GLN n 
1 87  ASP n 
1 88  PHE n 
1 89  TRP n 
1 90  GLU n 
1 91  VAL n 
1 92  GLN n 
1 93  LEU n 
1 94  GLY n 
1 95  ILE n 
1 96  PRO n 
1 97  HIS n 
1 98  PRO n 
1 99  ALA n 
1 100 GLY n 
1 101 LEU n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 LYS n 
1 106 SER n 
1 107 VAL n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 ASP n 
1 112 VAL n 
1 113 GLY n 
1 114 ASP n 
1 115 ALA n 
1 116 TYR n 
1 117 PHE n 
1 118 SER n 
1 119 VAL n 
1 120 PRO n 
1 121 LEU n 
1 122 ASP n 
1 123 GLU n 
1 124 ASP n 
1 125 PHE n 
1 126 ARG n 
1 127 LYS n 
1 128 TYR n 
1 129 THR n 
1 130 ALA n 
1 131 PHE n 
1 132 THR n 
1 133 ILE n 
1 134 PRO n 
1 135 SER n 
1 136 ILE n 
1 137 ASN n 
1 138 ASN n 
1 139 GLU n 
1 140 THR n 
1 141 PRO n 
1 142 GLY n 
1 143 ILE n 
1 144 ARG n 
1 145 TYR n 
1 146 GLN n 
1 147 TYR n 
1 148 ASN n 
1 149 VAL n 
1 150 LEU n 
1 151 PRO n 
1 152 GLN n 
1 153 GLY n 
1 154 TRP n 
1 155 LYS n 
1 156 GLY n 
1 157 SER n 
1 158 PRO n 
1 159 ALA n 
1 160 ILE n 
1 161 PHE n 
1 162 GLN n 
1 163 SER n 
1 164 SER n 
1 165 MET n 
1 166 THR n 
1 167 LYS n 
1 168 ILE n 
1 169 LEU n 
1 170 GLU n 
1 171 PRO n 
1 172 PHE n 
1 173 ARG n 
1 174 LYS n 
1 175 GLN n 
1 176 ASN n 
1 177 PRO n 
1 178 ASP n 
1 179 ILE n 
1 180 VAL n 
1 181 ILE n 
1 182 TYR n 
1 183 GLN n 
1 184 TYR n 
1 185 MET n 
1 186 ASP n 
1 187 ASP n 
1 188 LEU n 
1 189 TYR n 
1 190 VAL n 
1 191 GLY n 
1 192 SER n 
1 193 ASP n 
1 194 LEU n 
1 195 GLU n 
1 196 ILE n 
1 197 GLY n 
1 198 GLN n 
1 199 HIS n 
1 200 ARG n 
1 201 THR n 
1 202 LYS n 
1 203 ILE n 
1 204 GLU n 
1 205 GLU n 
1 206 LEU n 
1 207 ARG n 
1 208 GLN n 
1 209 HIS n 
1 210 LEU n 
1 211 LEU n 
1 212 ARG n 
1 213 TRP n 
1 214 GLY n 
1 215 LEU n 
1 216 THR n 
1 217 THR n 
1 218 PRO n 
1 219 ASP n 
1 220 LYS n 
1 221 LYS n 
1 222 HIS n 
1 223 GLN n 
1 224 LYS n 
1 225 GLU n 
1 226 PRO n 
1 227 PRO n 
1 228 PHE n 
1 229 LEU n 
1 230 TRP n 
1 231 MET n 
1 232 GLY n 
1 233 TYR n 
1 234 GLU n 
1 235 LEU n 
1 236 HIS n 
1 237 PRO n 
1 238 ASP n 
1 239 LYS n 
1 240 TRP n 
1 241 THR n 
1 242 VAL n 
1 243 GLN n 
1 244 PRO n 
1 245 ILE n 
1 246 VAL n 
1 247 LEU n 
1 248 PRO n 
1 249 GLU n 
1 250 LYS n 
1 251 ASP n 
1 252 SER n 
1 253 TRP n 
1 254 THR n 
1 255 VAL n 
1 256 ASN n 
1 257 ASP n 
1 258 ILE n 
1 259 CYS n 
1 260 LYS n 
1 261 LEU n 
1 262 VAL n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 ASN n 
1 267 TRP n 
1 268 ALA n 
1 269 SER n 
1 270 GLN n 
1 271 ILE n 
1 272 TYR n 
1 273 PRO n 
1 274 GLY n 
1 275 ILE n 
1 276 LYS n 
1 277 VAL n 
1 278 ARG n 
1 279 GLN n 
1 280 LEU n 
1 281 SER n 
1 282 LYS n 
1 283 LEU n 
1 284 LEU n 
1 285 ARG n 
1 286 GLY n 
1 287 THR n 
1 288 LYS n 
1 289 ALA n 
1 290 LEU n 
1 291 THR n 
1 292 GLU n 
1 293 VAL n 
1 294 ILE n 
1 295 PRO n 
1 296 LEU n 
1 297 THR n 
1 298 GLU n 
1 299 GLU n 
1 300 ALA n 
1 301 GLU n 
1 302 LEU n 
1 303 GLU n 
1 304 LEU n 
1 305 ALA n 
1 306 GLU n 
1 307 ASN n 
1 308 ARG n 
1 309 GLU n 
1 310 ILE n 
1 311 LEU n 
1 312 LYS n 
1 313 GLU n 
1 314 PRO n 
1 315 VAL n 
1 316 HIS n 
1 317 GLY n 
1 318 VAL n 
1 319 TYR n 
1 320 TYR n 
1 321 ASP n 
1 322 PRO n 
1 323 SER n 
1 324 LYS n 
1 325 ASP n 
1 326 LEU n 
1 327 ILE n 
1 328 ALA n 
1 329 GLU n 
1 330 ILE n 
1 331 GLN n 
1 332 LYS n 
1 333 GLN n 
1 334 GLY n 
1 335 GLN n 
1 336 GLY n 
1 337 GLN n 
1 338 TRP n 
1 339 THR n 
1 340 TYR n 
1 341 GLN n 
1 342 ILE n 
1 343 TYR n 
1 344 GLN n 
1 345 GLU n 
1 346 PRO n 
1 347 PHE n 
1 348 LYS n 
1 349 ASN n 
1 350 LEU n 
1 351 LYS n 
1 352 THR n 
1 353 GLY n 
1 354 LYS n 
1 355 TYR n 
1 356 ALA n 
1 357 ARG n 
1 358 MET n 
1 359 ARG n 
1 360 GLY n 
1 361 ALA n 
1 362 HIS n 
1 363 THR n 
1 364 ASN n 
1 365 ASP n 
1 366 VAL n 
1 367 LYS n 
1 368 GLN n 
1 369 LEU n 
1 370 THR n 
1 371 GLU n 
1 372 ALA n 
1 373 VAL n 
1 374 GLN n 
1 375 LYS n 
1 376 ILE n 
1 377 THR n 
1 378 THR n 
1 379 GLU n 
1 380 SER n 
1 381 ILE n 
1 382 VAL n 
1 383 ILE n 
1 384 TRP n 
1 385 GLY n 
1 386 LYS n 
1 387 THR n 
1 388 PRO n 
1 389 LYS n 
1 390 PHE n 
1 391 LYS n 
1 392 LEU n 
1 393 PRO n 
1 394 ILE n 
1 395 GLN n 
1 396 LYS n 
1 397 GLU n 
1 398 THR n 
1 399 TRP n 
1 400 GLU n 
1 401 THR n 
1 402 TRP n 
1 403 TRP n 
1 404 THR n 
1 405 GLU n 
1 406 TYR n 
1 407 TRP n 
1 408 GLN n 
1 409 ALA n 
1 410 THR n 
1 411 TRP n 
1 412 ILE n 
1 413 PRO n 
1 414 GLU n 
1 415 TRP n 
1 416 GLU n 
1 417 PHE n 
1 418 VAL n 
1 419 ASN n 
1 420 THR n 
1 421 PRO n 
1 422 PRO n 
1 423 LEU n 
1 424 VAL n 
1 425 LYS n 
1 426 LEU n 
1 427 TRP n 
1 428 TYR n 
1 429 GLN n 
1 430 LEU n 
1 431 GLU n 
1 432 LYS n 
1 433 GLU n 
1 434 PRO n 
1 435 ILE n 
1 436 VAL n 
1 437 GLY n 
1 438 ALA n 
1 439 GLU n 
1 440 THR n 
1 441 PHE n 
1 442 TYR n 
1 443 VAL n 
1 444 ASP n 
1 445 GLY n 
1 446 ALA n 
1 447 ALA n 
1 448 ASN n 
1 449 ARG n 
1 450 GLU n 
1 451 THR n 
1 452 LYS n 
1 453 LEU n 
1 454 GLY n 
1 455 LYS n 
1 456 ALA n 
1 457 GLY n 
1 458 TYR n 
1 459 VAL n 
1 460 THR n 
1 461 ASN n 
1 462 ARG n 
1 463 GLY n 
1 464 ARG n 
1 465 GLN n 
1 466 LYS n 
1 467 VAL n 
1 468 VAL n 
1 469 THR n 
1 470 LEU n 
1 471 THR n 
1 472 ASP n 
1 473 THR n 
1 474 THR n 
1 475 ASN n 
1 476 GLN n 
1 477 LYS n 
1 478 THR n 
1 479 GLU n 
1 480 LEU n 
1 481 GLN n 
1 482 ALA n 
1 483 ILE n 
1 484 TYR n 
1 485 LEU n 
1 486 ALA n 
1 487 LEU n 
1 488 GLN n 
1 489 ASP n 
1 490 SER n 
1 491 GLY n 
1 492 LEU n 
1 493 GLU n 
1 494 VAL n 
1 495 ASN n 
1 496 ILE n 
1 497 VAL n 
1 498 THR n 
1 499 ASP n 
1 500 SER n 
1 501 GLN n 
1 502 TYR n 
1 503 ALA n 
1 504 LEU n 
1 505 GLY n 
1 506 ILE n 
1 507 ILE n 
1 508 GLN n 
1 509 ALA n 
1 510 GLN n 
1 511 PRO n 
1 512 ASP n 
1 513 GLN n 
1 514 SER n 
1 515 GLU n 
1 516 SER n 
1 517 GLU n 
1 518 LEU n 
1 519 VAL n 
1 520 ASN n 
1 521 GLN n 
1 522 ILE n 
1 523 ILE n 
1 524 GLU n 
1 525 GLN n 
1 526 LEU n 
1 527 ILE n 
1 528 LYS n 
1 529 LYS n 
1 530 GLU n 
1 531 LYS n 
1 532 VAL n 
1 533 TYR n 
1 534 LEU n 
1 535 ALA n 
1 536 TRP n 
1 537 VAL n 
1 538 PRO n 
1 539 ALA n 
1 540 HIS n 
1 541 LYS n 
1 542 GLY n 
1 543 ILE n 
1 544 GLY n 
1 545 GLY n 
1 546 ASN n 
1 547 GLU n 
1 548 GLN n 
1 549 VAL n 
1 550 ASP n 
1 551 LYS n 
1 552 LEU n 
1 553 VAL n 
1 554 SER n 
1 555 ALA n 
1 556 GLY n 
1 557 ILE n 
1 558 ARG n 
1 559 LYS n 
1 560 VAL n 
1 561 LEU n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  SER n 
2 13  PRO n 
2 14  ILE n 
2 15  SER n 
2 16  PRO n 
2 17  ILE n 
2 18  GLU n 
2 19  THR n 
2 20  VAL n 
2 21  PRO n 
2 22  VAL n 
2 23  LYS n 
2 24  LEU n 
2 25  LYS n 
2 26  PRO n 
2 27  GLY n 
2 28  MET n 
2 29  ASP n 
2 30  GLY n 
2 31  PRO n 
2 32  LYS n 
2 33  VAL n 
2 34  LYS n 
2 35  GLN n 
2 36  TRP n 
2 37  PRO n 
2 38  LEU n 
2 39  THR n 
2 40  GLU n 
2 41  GLU n 
2 42  LYS n 
2 43  ILE n 
2 44  LYS n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  GLU n 
2 49  ILE n 
2 50  CYS n 
2 51  THR n 
2 52  GLU n 
2 53  MET n 
2 54  GLU n 
2 55  LYS n 
2 56  GLU n 
2 57  GLY n 
2 58  LYS n 
2 59  ILE n 
2 60  SER n 
2 61  LYS n 
2 62  ILE n 
2 63  GLY n 
2 64  PRO n 
2 65  GLU n 
2 66  ASN n 
2 67  PRO n 
2 68  TYR n 
2 69  ASN n 
2 70  THR n 
2 71  PRO n 
2 72  VAL n 
2 73  PHE n 
2 74  ALA n 
2 75  ILE n 
2 76  LYS n 
2 77  LYS n 
2 78  LYS n 
2 79  ASP n 
2 80  SER n 
2 81  THR n 
2 82  LYS n 
2 83  TRP n 
2 84  ARG n 
2 85  LYS n 
2 86  LEU n 
2 87  VAL n 
2 88  ASP n 
2 89  PHE n 
2 90  ARG n 
2 91  GLU n 
2 92  LEU n 
2 93  ASN n 
2 94  LYS n 
2 95  ARG n 
2 96  THR n 
2 97  GLN n 
2 98  ASP n 
2 99  PHE n 
2 100 TRP n 
2 101 GLU n 
2 102 VAL n 
2 103 GLN n 
2 104 LEU n 
2 105 GLY n 
2 106 ILE n 
2 107 PRO n 
2 108 HIS n 
2 109 PRO n 
2 110 ALA n 
2 111 GLY n 
2 112 LEU n 
2 113 LYS n 
2 114 LYS n 
2 115 LYS n 
2 116 LYS n 
2 117 SER n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 LEU n 
2 122 ASP n 
2 123 VAL n 
2 124 GLY n 
2 125 ASP n 
2 126 ALA n 
2 127 TYR n 
2 128 PHE n 
2 129 SER n 
2 130 VAL n 
2 131 PRO n 
2 132 LEU n 
2 133 ASP n 
2 134 GLU n 
2 135 ASP n 
2 136 PHE n 
2 137 ARG n 
2 138 LYS n 
2 139 TYR n 
2 140 THR n 
2 141 ALA n 
2 142 PHE n 
2 143 THR n 
2 144 ILE n 
2 145 PRO n 
2 146 SER n 
2 147 ILE n 
2 148 ASN n 
2 149 ASN n 
2 150 GLU n 
2 151 THR n 
2 152 PRO n 
2 153 GLY n 
2 154 ILE n 
2 155 ARG n 
2 156 TYR n 
2 157 GLN n 
2 158 TYR n 
2 159 ASN n 
2 160 VAL n 
2 161 LEU n 
2 162 PRO n 
2 163 GLN n 
2 164 GLY n 
2 165 TRP n 
2 166 LYS n 
2 167 GLY n 
2 168 SER n 
2 169 PRO n 
2 170 ALA n 
2 171 ILE n 
2 172 PHE n 
2 173 GLN n 
2 174 SER n 
2 175 SER n 
2 176 MET n 
2 177 THR n 
2 178 LYS n 
2 179 ILE n 
2 180 LEU n 
2 181 GLU n 
2 182 PRO n 
2 183 PHE n 
2 184 ARG n 
2 185 LYS n 
2 186 GLN n 
2 187 ASN n 
2 188 PRO n 
2 189 ASP n 
2 190 ILE n 
2 191 VAL n 
2 192 ILE n 
2 193 TYR n 
2 194 GLN n 
2 195 TYR n 
2 196 MET n 
2 197 ASP n 
2 198 ASP n 
2 199 LEU n 
2 200 TYR n 
2 201 VAL n 
2 202 GLY n 
2 203 SER n 
2 204 ASP n 
2 205 LEU n 
2 206 GLU n 
2 207 ILE n 
2 208 GLY n 
2 209 GLN n 
2 210 HIS n 
2 211 ARG n 
2 212 THR n 
2 213 LYS n 
2 214 ILE n 
2 215 GLU n 
2 216 GLU n 
2 217 LEU n 
2 218 ARG n 
2 219 GLN n 
2 220 HIS n 
2 221 LEU n 
2 222 LEU n 
2 223 ARG n 
2 224 TRP n 
2 225 GLY n 
2 226 LEU n 
2 227 THR n 
2 228 THR n 
2 229 PRO n 
2 230 ASP n 
2 231 LYS n 
2 232 LYS n 
2 233 HIS n 
2 234 GLN n 
2 235 LYS n 
2 236 GLU n 
2 237 PRO n 
2 238 PRO n 
2 239 PHE n 
2 240 LEU n 
2 241 TRP n 
2 242 MET n 
2 243 GLY n 
2 244 TYR n 
2 245 GLU n 
2 246 LEU n 
2 247 HIS n 
2 248 PRO n 
2 249 ASP n 
2 250 LYS n 
2 251 TRP n 
2 252 THR n 
2 253 VAL n 
2 254 GLN n 
2 255 PRO n 
2 256 ILE n 
2 257 VAL n 
2 258 LEU n 
2 259 PRO n 
2 260 GLU n 
2 261 LYS n 
2 262 ASP n 
2 263 SER n 
2 264 TRP n 
2 265 THR n 
2 266 VAL n 
2 267 ASN n 
2 268 ASP n 
2 269 ILE n 
2 270 GLN n 
2 271 LYS n 
2 272 LEU n 
2 273 VAL n 
2 274 GLY n 
2 275 LYS n 
2 276 LEU n 
2 277 ASN n 
2 278 TRP n 
2 279 ALA n 
2 280 SER n 
2 281 GLN n 
2 282 ILE n 
2 283 TYR n 
2 284 PRO n 
2 285 GLY n 
2 286 ILE n 
2 287 LYS n 
2 288 VAL n 
2 289 ARG n 
2 290 GLN n 
2 291 LEU n 
2 292 SER n 
2 293 LYS n 
2 294 LEU n 
2 295 LEU n 
2 296 ARG n 
2 297 GLY n 
2 298 THR n 
2 299 LYS n 
2 300 ALA n 
2 301 LEU n 
2 302 THR n 
2 303 GLU n 
2 304 VAL n 
2 305 ILE n 
2 306 PRO n 
2 307 LEU n 
2 308 THR n 
2 309 GLU n 
2 310 GLU n 
2 311 ALA n 
2 312 GLU n 
2 313 LEU n 
2 314 GLU n 
2 315 LEU n 
2 316 ALA n 
2 317 GLU n 
2 318 ASN n 
2 319 ARG n 
2 320 GLU n 
2 321 ILE n 
2 322 LEU n 
2 323 LYS n 
2 324 GLU n 
2 325 PRO n 
2 326 VAL n 
2 327 HIS n 
2 328 GLY n 
2 329 VAL n 
2 330 TYR n 
2 331 TYR n 
2 332 ASP n 
2 333 PRO n 
2 334 SER n 
2 335 LYS n 
2 336 ASP n 
2 337 LEU n 
2 338 ILE n 
2 339 ALA n 
2 340 GLU n 
2 341 ILE n 
2 342 GLN n 
2 343 LYS n 
2 344 GLN n 
2 345 GLY n 
2 346 GLN n 
2 347 GLY n 
2 348 GLN n 
2 349 TRP n 
2 350 THR n 
2 351 TYR n 
2 352 GLN n 
2 353 ILE n 
2 354 TYR n 
2 355 GLN n 
2 356 GLU n 
2 357 PRO n 
2 358 PHE n 
2 359 LYS n 
2 360 ASN n 
2 361 LEU n 
2 362 LYS n 
2 363 THR n 
2 364 GLY n 
2 365 LYS n 
2 366 TYR n 
2 367 ALA n 
2 368 ARG n 
2 369 MET n 
2 370 ARG n 
2 371 GLY n 
2 372 ALA n 
2 373 HIS n 
2 374 THR n 
2 375 ASN n 
2 376 ASP n 
2 377 VAL n 
2 378 LYS n 
2 379 GLN n 
2 380 LEU n 
2 381 THR n 
2 382 GLU n 
2 383 ALA n 
2 384 VAL n 
2 385 GLN n 
2 386 LYS n 
2 387 ILE n 
2 388 THR n 
2 389 THR n 
2 390 GLU n 
2 391 SER n 
2 392 ILE n 
2 393 VAL n 
2 394 ILE n 
2 395 TRP n 
2 396 GLY n 
2 397 LYS n 
2 398 THR n 
2 399 PRO n 
2 400 LYS n 
2 401 PHE n 
2 402 LYS n 
2 403 LEU n 
2 404 PRO n 
2 405 ILE n 
2 406 GLN n 
2 407 LYS n 
2 408 GLU n 
2 409 THR n 
2 410 TRP n 
2 411 GLU n 
2 412 THR n 
2 413 TRP n 
2 414 TRP n 
2 415 THR n 
2 416 GLU n 
2 417 TYR n 
2 418 TRP n 
2 419 GLN n 
2 420 ALA n 
2 421 THR n 
2 422 TRP n 
2 423 ILE n 
2 424 PRO n 
2 425 GLU n 
2 426 TRP n 
2 427 GLU n 
2 428 PHE n 
2 429 VAL n 
2 430 ASN n 
2 431 THR n 
2 432 PRO n 
2 433 PRO n 
2 434 LEU n 
2 435 VAL n 
2 436 LYS n 
2 437 LEU n 
2 438 TRP n 
2 439 TYR n 
2 440 GLN n 
2 441 LEU n 
2 442 GLU n 
2 443 LYS n 
2 444 GLU n 
2 445 PRO n 
2 446 ILE n 
2 447 VAL n 
2 448 GLY n 
2 449 ALA n 
2 450 GLU n 
2 451 THR n 
2 452 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  G47 n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DDG n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DA  n 
4 6   DC  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 561 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 452 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 6WPJ      6WPJ   ? 3 ? 1   
4 PDB 6WPJ      6WPJ   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WPJ A 2  ? 561 ? P04585 588 ? 1147 ? 1   560 
2 2 6WPJ B 13 ? 452 ? P04585 588 ? 1027 ? 1   440 
3 3 6WPJ P 1  ? 21  ? 6WPJ   802 ? 822  ? 802 822 
4 4 6WPJ T 1  ? 27  ? 6WPJ   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WPJ MET A 1   ? UNP P04585 ?   ?   'expression tag'      0   1  
1 6WPJ CYS A 259 ? UNP P04585 GLN 845 'engineered mutation' 258 2  
1 6WPJ SER A 281 ? UNP P04585 CYS 867 'engineered mutation' 280 3  
2 6WPJ MET B 1   ? UNP P04585 ?   ?   'expression tag'      -11 4  
2 6WPJ GLY B 2   ? UNP P04585 ?   ?   'expression tag'      -10 5  
2 6WPJ SER B 3   ? UNP P04585 ?   ?   'expression tag'      -9  6  
2 6WPJ SER B 4   ? UNP P04585 ?   ?   'expression tag'      -8  7  
2 6WPJ HIS B 5   ? UNP P04585 ?   ?   'expression tag'      -7  8  
2 6WPJ HIS B 6   ? UNP P04585 ?   ?   'expression tag'      -6  9  
2 6WPJ HIS B 7   ? UNP P04585 ?   ?   'expression tag'      -5  10 
2 6WPJ HIS B 8   ? UNP P04585 ?   ?   'expression tag'      -4  11 
2 6WPJ HIS B 9   ? UNP P04585 ?   ?   'expression tag'      -3  12 
2 6WPJ HIS B 10  ? UNP P04585 ?   ?   'expression tag'      -2  13 
2 6WPJ SER B 11  ? UNP P04585 ?   ?   'expression tag'      -1  14 
2 6WPJ SER B 12  ? UNP P04585 ?   ?   'expression tag'      0   15 
2 6WPJ SER B 292 ? UNP P04585 CYS 867 'engineered mutation' 280 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                              ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ? 'C3 H7 N O2 S'      121.158 
D4T non-polymer         . 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
? 'C10 H15 N2 O13 P3' 464.153 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H14 N3 O7 P'    307.197 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE"            ? 'C10 H14 N5 O6 P'   331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ? 'C10 H15 N2 O8 P'   322.208 
G47 'DNA linking'       n "N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE"  ? 'C12 H18 N5 O7 P S' 407.339 
GLN 'L-peptide linking' y GLUTAMINE                                             ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                               ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                 ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                               ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                            ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                               ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                         ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                             ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                              ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WPJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.74 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.21 
_exptl_crystal.description                 'thin plates' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '6-10% (w/v) PEG 8000, 15 mM magnesium sulfate, and 50 mM MES adjusted at pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-03-11 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            62.72 
_reflns.entry_id                         6WPJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.73 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       38882 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.153 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.46 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_CC_star                     0.996 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.73 
_reflns_shell.d_res_low                   2.90 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.56 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5942 
_reflns_shell.percent_possible_all        94.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.69 
_reflns_shell.pdbx_Rsym_value             1.257 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.673 
_reflns_shell.pdbx_CC_star                0.673 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               54.58 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WPJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.73 
_refine.ls_d_res_low                             47.56 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     38860 
_refine.ls_number_reflns_R_free                  1943 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.07 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2059 
_refine.ls_R_factor_R_free                       0.2567 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2033 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6OR7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.0110 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4529 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.73 
_refine_hist.d_res_low                        47.56 
_refine_hist.number_atoms_solvent             6 
_refine_hist.number_atoms_total               8423 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7538 
_refine_hist.pdbx_number_atoms_nucleic_acid   844 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0072  ? 8721  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9319  ? 12063 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0512  ? 1334  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0060  ? 1379  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 17.8060 ? 5040  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.73 2.80  . . 123 2341 88.32  . . . 0.4919 . 0.4609 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.80 2.87  . . 136 2591 99.67  . . . 0.4129 . 0.3557 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.87 2.96  . . 138 2637 99.93  . . . 0.3266 . 0.2911 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.96 3.05  . . 140 2652 99.96  . . . 0.3206 . 0.2555 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.05 3.16  . . 139 2634 99.93  . . . 0.3000 . 0.2624 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.16 3.29  . . 138 2624 99.96  . . . 0.3429 . 0.2560 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.29 3.44  . . 138 2630 99.96  . . . 0.2861 . 0.2074 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.44 3.62  . . 139 2644 99.78  . . . 0.2604 . 0.1980 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.62 3.85  . . 141 2665 100.00 . . . 0.2443 . 0.1867 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.85 4.15  . . 139 2647 99.96  . . . 0.2342 . 0.1785 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.15 4.56  . . 140 2657 99.93  . . . 0.2575 . 0.1673 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.56 5.22  . . 141 2684 99.96  . . . 0.2035 . 0.1650 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.22 6.58  . . 143 2711 100.00 . . . 0.2413 . 0.1915 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.58 47.56 . . 148 2800 99.63  . . . 0.1945 . 0.1779 . . . . . . . . . . . 
# 
_struct.entry_id                     6WPJ 
_struct.title                        'Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and d4T' 
_struct.pdbx_descriptor              'Reverse transcriptase/ribonuclease H, p51 RT/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WPJ 
_struct_keywords.text            
'Reverse Transcriptase, ternary complex, d4T, chain terminator, stereochemistry, TRANSFERASE, TRANSFERASE-DNA complex, Stavudine' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 28  ? GLU A 45  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 78  ? THR A 85  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 97  ? LEU A 101 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 115 ? VAL A 119 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 122 ? ALA A 130 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P6  AA6 GLY A 156 ? ASN A 176 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 195 ? TRP A 213 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 218 ? HIS A 222 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P9  AA9 THR A 254 ? SER A 269 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 277 ? LEU A 283 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P11 AB2 THR A 297 ? LYS A 312 ? THR A 296 LYS A 311 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 364 ? GLY A 385 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 395 ? TYR A 406 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 474 ? SER A 490 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P15 AB6 SER A 500 ? ALA A 509 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 516 ? LYS A 529 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 ILE A 543 ? ALA A 555 ? ILE A 542 ALA A 554 1 ? 13 
HELX_P HELX_P18 AB9 THR B 39  ? GLU B 56  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 89  ? THR B 96  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 PRO B 109 ? LYS B 115 ? PRO B 97  LYS B 103 5 ? 7  
HELX_P HELX_P21 AC3 GLY B 124 ? VAL B 130 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 ASP B 133 ? LYS B 138 ? ASP B 121 LYS B 126 1 ? 6  
HELX_P HELX_P23 AC5 TYR B 139 ? ALA B 141 ? TYR B 127 ALA B 129 5 ? 3  
HELX_P HELX_P24 AC6 SER B 146 ? GLU B 150 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS B 166 ? ASN B 187 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P26 AC8 GLU B 206 ? LEU B 221 ? GLU B 194 LEU B 209 1 ? 16 
HELX_P HELX_P27 AC9 HIS B 247 ? TRP B 251 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 VAL B 266 ? SER B 280 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P29 AD2 VAL B 288 ? LEU B 294 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P30 AD3 THR B 308 ? LEU B 322 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P31 AD4 ASN B 375 ? GLY B 396 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN B 406 ? TRP B 414 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P33 AD6 THR B 415 ? TYR B 417 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P34 AD7 PRO B 432 ? GLN B 440 ? PRO B 420 GLN B 428 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale none ? A CYS 259 SG    ? ? ? 1_555 C G47 16 SG ? ? A CYS 258 P G47 817 1_555 ? ? ? ? ? ? ?            2.034 ? ? 
covale2  covale both ? C DG  15  "O3'" ? ? ? 1_555 C G47 16 P  ? ? P DG  816 P G47 817 1_555 ? ? ? ? ? ? ?            1.607 ? ? 
covale3  covale one  ? C G47 16  "O3'" ? ? ? 1_555 C DC  17 P  ? ? P G47 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.598 ? ? 
covale4  covale both ? C DC  20  "O3'" ? ? ? 1_555 C DDG 21 P  ? ? P DC  821 P DDG 822 1_555 ? ? ? ? ? ? ?            1.557 ? ? 
metalc1  metalc ?    ? A ASP 111 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 110 A MG  602 1_555 ? ? ? ? ? ? ?            1.939 ? ? 
metalc2  metalc ?    ? A VAL 112 O     ? ? ? 1_555 F MG  .  MG ? ? A VAL 111 A MG  602 1_555 ? ? ? ? ? ? ?            1.978 ? ? 
metalc3  metalc ?    ? A ASP 186 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 185 A MG  602 1_555 ? ? ? ? ? ? ?            2.459 ? ? 
metalc4  metalc ?    ? A ASP 444 OD1   ? ? ? 1_555 G MG  .  MG ? ? A ASP 443 A MG  603 1_555 ? ? ? ? ? ? ?            1.825 ? ? 
metalc5  metalc ?    ? A GLU 479 OE2   ? ? ? 1_555 G MG  .  MG ? ? A GLU 478 A MG  603 1_555 ? ? ? ? ? ? ?            1.909 ? ? 
metalc6  metalc ?    ? A ASP 499 OD1   ? ? ? 1_555 G MG  .  MG ? ? A ASP 498 A MG  603 1_555 ? ? ? ? ? ? ?            2.036 ? ? 
metalc7  metalc ?    ? A ASP 499 OD2   ? ? ? 1_555 G MG  .  MG ? ? A ASP 498 A MG  603 1_555 ? ? ? ? ? ? ?            2.048 ? ? 
metalc8  metalc ?    ? E D4T .   O2C   ? ? ? 1_555 F MG  .  MG ? ? A D4T 601 A MG  602 1_555 ? ? ? ? ? ? ?            2.145 ? ? 
metalc9  metalc ?    ? E D4T .   O2B   ? ? ? 1_555 F MG  .  MG ? ? A D4T 601 A MG  602 1_555 ? ? ? ? ? ? ?            2.434 ? ? 
metalc10 metalc ?    ? E D4T .   O2A   ? ? ? 1_555 F MG  .  MG ? ? A D4T 601 A MG  602 1_555 ? ? ? ? ? ? ?            2.142 ? ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ?    ? C G47 16  N1    ? ? ? 1_555 D DC  11 N3 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ?    ? C G47 16  N2    ? ? ? 1_555 D DC  11 O2 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ?    ? C G47 16  O6    ? ? ? 1_555 D DC  11 N4 ? ? P G47 817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ?    ? C DDG 21  N1    ? ? ? 1_555 D DC  6  N3 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ?    ? C DDG 21  N2    ? ? ? 1_555 D DC  6  O2 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ?    ? C DDG 21  O6    ? ? ? 1_555 D DC  6  N4 ? ? P DDG 822 T DC  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 226 A . ? PRO 225 A PRO 227 A ? PRO 226 A 1 2.92  
2 PRO 421 A . ? PRO 420 A PRO 422 A ? PRO 421 A 1 -2.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 48  ? LYS A 50  ? ILE A 47  LYS A 49  
AA1 2 ARG A 144 ? TYR A 147 ? ARG A 143 TYR A 146 
AA1 3 PHE A 131 ? THR A 132 ? PHE A 130 THR A 131 
AA2 1 VAL A 61  ? LYS A 65  ? VAL A 60  LYS A 64  
AA2 2 TRP A 72  ? VAL A 76  ? TRP A 71  VAL A 75  
AA3 1 SER A 106 ? ASP A 111 ? SER A 105 ASP A 110 
AA3 2 ASP A 187 ? SER A 192 ? ASP A 186 SER A 191 
AA3 3 VAL A 180 ? TYR A 184 ? VAL A 179 TYR A 183 
AA4 1 PHE A 228 ? TRP A 230 ? PHE A 227 TRP A 229 
AA4 2 TYR A 233 ? LEU A 235 ? TYR A 232 LEU A 234 
AA4 3 TRP A 240 ? VAL A 242 ? TRP A 239 VAL A 241 
AA5 1 LYS A 348 ? TYR A 355 ? LYS A 347 TYR A 354 
AA5 2 GLN A 337 ? GLU A 345 ? GLN A 336 GLU A 344 
AA5 3 ILE A 327 ? GLN A 333 ? ILE A 326 GLN A 332 
AA5 4 LYS A 389 ? LEU A 392 ? LYS A 388 LEU A 391 
AA5 5 TRP A 415 ? PHE A 417 ? TRP A 414 PHE A 416 
AA6 1 HIS A 362 ? THR A 363 ? HIS A 361 THR A 362 
AA6 2 GLN A 513 ? SER A 514 ? GLN A 512 SER A 513 
AA7 1 GLN A 465 ? LEU A 470 ? GLN A 464 LEU A 469 
AA7 2 GLY A 454 ? THR A 460 ? GLY A 453 THR A 459 
AA7 3 GLU A 439 ? ALA A 447 ? GLU A 438 ALA A 446 
AA7 4 GLU A 493 ? THR A 498 ? GLU A 492 THR A 497 
AA7 5 LYS A 531 ? TRP A 536 ? LYS A 530 TRP A 535 
AA8 1 ILE B 59  ? LYS B 61  ? ILE B 47  LYS B 49  
AA8 2 ILE B 154 ? TYR B 158 ? ILE B 142 TYR B 146 
AA8 3 PHE B 142 ? ILE B 144 ? PHE B 130 ILE B 132 
AA9 1 VAL B 72  ? LYS B 76  ? VAL B 60  LYS B 64  
AA9 2 TRP B 83  ? VAL B 87  ? TRP B 71  VAL B 75  
AB1 1 SER B 117 ? ASP B 122 ? SER B 105 ASP B 110 
AB1 2 ASP B 198 ? SER B 203 ? ASP B 186 SER B 191 
AB1 3 VAL B 191 ? TYR B 195 ? VAL B 179 TYR B 183 
AB2 1 TRP B 264 ? THR B 265 ? TRP B 252 THR B 253 
AB2 2 VAL B 304 ? ILE B 305 ? VAL B 292 ILE B 293 
AB3 1 ASN B 360 ? ALA B 367 ? ASN B 348 ALA B 355 
AB3 2 GLN B 348 ? TYR B 354 ? GLN B 336 TYR B 342 
AB3 3 LEU B 337 ? GLY B 345 ? LEU B 325 GLY B 333 
AB3 4 PRO B 399 ? LEU B 403 ? PRO B 387 LEU B 391 
AB3 5 TRP B 426 ? PHE B 428 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 49  ? N SER A 48  O GLN A 146 ? O GLN A 145 
AA1 2 3 O TYR A 145 ? O TYR A 144 N PHE A 131 ? N PHE A 130 
AA2 1 2 N PHE A 62  ? N PHE A 61  O LEU A 75  ? O LEU A 74  
AA3 1 2 N THR A 108 ? N THR A 107 O VAL A 190 ? O VAL A 189 
AA3 2 3 O GLY A 191 ? O GLY A 190 N VAL A 180 ? N VAL A 179 
AA4 1 2 N PHE A 228 ? N PHE A 227 O LEU A 235 ? O LEU A 234 
AA4 2 3 N GLU A 234 ? N GLU A 233 O THR A 241 ? O THR A 240 
AA5 1 2 O LEU A 350 ? O LEU A 349 N ILE A 342 ? N ILE A 341 
AA5 2 3 O TYR A 343 ? O TYR A 342 N ILE A 327 ? N ILE A 326 
AA5 3 4 N ALA A 328 ? N ALA A 327 O LYS A 389 ? O LYS A 388 
AA5 4 5 N LEU A 392 ? N LEU A 391 O GLU A 416 ? O GLU A 415 
AA6 1 2 N THR A 363 ? N THR A 362 O GLN A 513 ? O GLN A 512 
AA7 1 2 O VAL A 468 ? O VAL A 467 N ALA A 456 ? N ALA A 455 
AA7 2 3 O VAL A 459 ? O VAL A 458 N TYR A 442 ? N TYR A 441 
AA7 3 4 N PHE A 441 ? N PHE A 440 O ASN A 495 ? O ASN A 494 
AA7 4 5 N ILE A 496 ? N ILE A 495 O TYR A 533 ? O TYR A 532 
AA8 1 2 N SER B 60  ? N SER B 48  O GLN B 157 ? O GLN B 145 
AA8 2 3 O ILE B 154 ? O ILE B 142 N ILE B 144 ? N ILE B 132 
AA9 1 2 N ILE B 75  ? N ILE B 63  O ARG B 84  ? O ARG B 72  
AB1 1 2 N THR B 119 ? N THR B 107 O VAL B 201 ? O VAL B 189 
AB1 2 3 O TYR B 200 ? O TYR B 188 N TYR B 193 ? N TYR B 181 
AB2 1 2 N TRP B 264 ? N TRP B 252 O ILE B 305 ? O ILE B 293 
AB3 1 2 O GLY B 364 ? O GLY B 352 N TYR B 351 ? N TYR B 339 
AB3 2 3 O TYR B 354 ? O TYR B 342 N ILE B 338 ? N ILE B 326 
AB3 3 4 N LEU B 337 ? N LEU B 325 O LYS B 400 ? O LYS B 388 
AB3 4 5 N LEU B 403 ? N LEU B 391 O GLU B 427 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A D4T 601 ? 15 'binding site for residue D4T A 601' 
AC2 Software A MG  602 ? 4  'binding site for residue MG A 602'  
AC3 Software A MG  603 ? 3  'binding site for residue MG A 603'  
AC4 Software A SO4 604 ? 6  'binding site for residue SO4 A 604' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LYS A 66  ? LYS A 65  . ? 1_555 ? 
2  AC1 15 ARG A 73  ? ARG A 72  . ? 1_555 ? 
3  AC1 15 ASP A 111 ? ASP A 110 . ? 1_555 ? 
4  AC1 15 VAL A 112 ? VAL A 111 . ? 1_555 ? 
5  AC1 15 GLY A 113 ? GLY A 112 . ? 1_555 ? 
6  AC1 15 ASP A 114 ? ASP A 113 . ? 1_555 ? 
7  AC1 15 ALA A 115 ? ALA A 114 . ? 1_555 ? 
8  AC1 15 TYR A 116 ? TYR A 115 . ? 1_555 ? 
9  AC1 15 GLN A 152 ? GLN A 151 . ? 1_555 ? 
10 AC1 15 ASP A 186 ? ASP A 185 . ? 1_555 ? 
11 AC1 15 LYS A 221 ? LYS A 220 . ? 1_555 ? 
12 AC1 15 MG  F .   ? MG  A 602 . ? 1_555 ? 
13 AC1 15 HOH I .   ? HOH A 705 . ? 1_555 ? 
14 AC1 15 DDG C 21  ? DDG P 822 . ? 1_555 ? 
15 AC1 15 DA  D 5   ? DA  T 705 . ? 1_555 ? 
16 AC2 4  ASP A 111 ? ASP A 110 . ? 1_555 ? 
17 AC2 4  VAL A 112 ? VAL A 111 . ? 1_555 ? 
18 AC2 4  ASP A 186 ? ASP A 185 . ? 1_555 ? 
19 AC2 4  D4T E .   ? D4T A 601 . ? 1_555 ? 
20 AC3 3  ASP A 444 ? ASP A 443 . ? 1_555 ? 
21 AC3 3  GLU A 479 ? GLU A 478 . ? 1_555 ? 
22 AC3 3  ASP A 499 ? ASP A 498 . ? 1_555 ? 
23 AC4 6  ARG A 207 ? ARG A 206 . ? 7_554 ? 
24 AC4 6  GLY A 437 ? GLY A 436 . ? 1_555 ? 
25 AC4 6  ASN A 461 ? ASN A 460 . ? 1_555 ? 
26 AC4 6  ARG A 462 ? ARG A 461 . ? 1_555 ? 
27 AC4 6  HOH I .   ? HOH A 702 . ? 1_555 ? 
28 AC4 6  ALA B 300 ? ALA B 288 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6WPJ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005967 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005880 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009760 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153 2.53737 ? ? 2.59044  63.03566 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527 ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 2   ? 44.33607 -10.79895 -15.81348 1.000 44.99568  ? 1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 2   ? 43.19679 -11.16118 -14.96581 1.000 48.93212  ? 1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 2   ? 42.05402 -10.17264 -15.12419 1.000 44.66331  ? 1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 2   ? 42.19212 -9.22792  -15.89703 1.000 46.69955  ? 1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 2   ? 43.77817 -11.11881 -13.53817 1.000 44.64326  ? 1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 2   ? 45.23621 -10.67249 -13.68940 1.000 46.06212  ? 1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 2   ? 45.32890 -10.03401 -15.04687 1.000 50.41028  ? 1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 3   ? 40.94644 -10.39938 -14.42088 1.000 43.29917  ? 2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 3   ? 39.76427 -9.54659  -14.48840 1.000 37.84948  ? 2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 3   ? 39.57298 -8.89462  -13.12625 1.000 37.88356  ? 2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 3   ? 39.63383 -9.56791  -12.09177 1.000 41.76268  ? 2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 3   ? 38.52183 -10.34859 -14.91374 1.000 39.77402  ? 2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 3   ? 38.72229 -10.90720 -16.33214 1.000 44.72710  ? 2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 3   ? 37.28923 -9.49130  -14.84433 1.000 36.18794  ? 2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 3   ? 37.60786 -11.80109 -16.85255 1.000 33.41532  ? 2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 4   ? 39.36022 -7.58687  -13.12765 1.000 40.86108  ? 3   SER A N     1 
ATOM   17   C  CA    . SER A 1 4   ? 39.24140 -6.83408  -11.88772 1.000 39.76658  ? 3   SER A CA    1 
ATOM   18   C  C     . SER A 1 4   ? 38.09262 -7.37948  -11.03702 1.000 40.77902  ? 3   SER A C     1 
ATOM   19   O  O     . SER A 1 4   ? 37.01799 -7.69052  -11.56682 1.000 40.14476  ? 3   SER A O     1 
ATOM   20   C  CB    . SER A 1 4   ? 39.00148 -5.35480  -12.20334 1.000 35.57073  ? 3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 4   ? 39.06145 -4.55769  -11.03939 1.000 34.04525  ? 3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 5   ? 38.27941 -7.50863  -9.71543  1.000 38.73741  ? 4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 5   ? 37.15489 -7.86358  -8.84847  1.000 31.49382  ? 4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 5   ? 36.28660 -6.66287  -8.51354  1.000 34.01726  ? 4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 5   ? 35.52652 -6.71565  -7.54386  1.000 37.78713  ? 4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 5   ? 37.84430 -8.42359  -7.59852  1.000 25.53335  ? 4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 5   ? 39.11634 -7.71012  -7.52634  1.000 29.77573  ? 4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 5   ? 39.54170 -7.42161  -8.95754  1.000 40.08206  ? 4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 6   ? 36.39608 -5.56942  -9.27278  1.000 35.76033  ? 5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 6   ? 35.58900 -4.38448  -8.97363  1.000 40.14856  ? 5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 6   ? 34.12881 -4.64851  -9.34056  1.000 36.02469  ? 5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 6   ? 33.81953 -5.45879  -10.22570 1.000 32.80048  ? 5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 6   ? 36.13538 -3.13156  -9.69196  1.000 35.82762  ? 5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 6   ? 35.47314 -1.86794  -9.15358  1.000 35.87945  ? 5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 6   ? 35.93544 -3.20784  -11.19443 1.000 34.56879  ? 5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 6   ? 36.05688 -0.56189  -9.72061  1.000 42.88487  ? 5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 7   ? 33.21683 -4.00043  -8.61831  1.000 33.92986  ? 6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 7   ? 31.80772 -4.11960  -8.96161  1.000 35.46980  ? 6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 7   ? 31.58453 -3.54117  -10.35879 1.000 34.56989  ? 6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 7   ? 32.25862 -2.58771  -10.76265 1.000 36.90269  ? 6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 7   ? 30.94474 -3.40933  -7.90506  1.000 28.90703  ? 6   GLU A CB    1 
ATOM   42   N  N     . THR A 1 8   ? 30.68094 -4.15870  -11.12229 1.000 29.74787  ? 7   THR A N     1 
ATOM   43   C  CA    . THR A 1 8   ? 30.35246 -3.65043  -12.44083 1.000 30.28759  ? 7   THR A CA    1 
ATOM   44   C  C     . THR A 1 8   ? 29.50202 -2.39576  -12.31094 1.000 35.55900  ? 7   THR A C     1 
ATOM   45   O  O     . THR A 1 8   ? 28.97733 -2.08832  -11.24217 1.000 42.90162  ? 7   THR A O     1 
ATOM   46   C  CB    . THR A 1 8   ? 29.60142 -4.68947  -13.28109 1.000 36.79564  ? 7   THR A CB    1 
ATOM   47   O  OG1   . THR A 1 8   ? 28.42724 -5.12826  -12.59450 1.000 35.84633  ? 7   THR A OG1   1 
ATOM   48   C  CG2   . THR A 1 8   ? 30.48984 -5.87189  -13.63571 1.000 36.00934  ? 7   THR A CG2   1 
ATOM   49   N  N     . VAL A 1 9   ? 29.37153 -1.66606  -13.41414 1.000 35.41533  ? 8   VAL A N     1 
ATOM   50   C  CA    . VAL A 1 9   ? 28.52312 -0.47827  -13.49487 1.000 35.91980  ? 8   VAL A CA    1 
ATOM   51   C  C     . VAL A 1 9   ? 27.22876 -0.85609  -14.20936 1.000 40.11275  ? 8   VAL A C     1 
ATOM   52   O  O     . VAL A 1 9   ? 27.28397 -1.29749  -15.36888 1.000 43.38311  ? 8   VAL A O     1 
ATOM   53   C  CB    . VAL A 1 9   ? 29.22877 0.65960   -14.23791 1.000 38.71927  ? 8   VAL A CB    1 
ATOM   54   C  CG1   . VAL A 1 9   ? 28.24540 1.77725   -14.54088 1.000 39.12488  ? 8   VAL A CG1   1 
ATOM   55   C  CG2   . VAL A 1 9   ? 30.41973 1.14468   -13.44034 1.000 39.69061  ? 8   VAL A CG2   1 
ATOM   56   N  N     . PRO A 1 10  ? 26.06264 -0.68825  -13.58640 1.000 41.56198  ? 9   PRO A N     1 
ATOM   57   C  CA    . PRO A 1 10  ? 24.81501 -1.09714  -14.24932 1.000 42.99381  ? 9   PRO A CA    1 
ATOM   58   C  C     . PRO A 1 10  ? 24.48479 -0.18408  -15.41066 1.000 46.95209  ? 9   PRO A C     1 
ATOM   59   O  O     . PRO A 1 10  ? 24.59780 1.04149   -15.31568 1.000 50.65592  ? 9   PRO A O     1 
ATOM   60   C  CB    . PRO A 1 10  ? 23.76281 -0.98374  -13.14274 1.000 34.73912  ? 9   PRO A CB    1 
ATOM   61   C  CG    . PRO A 1 10  ? 24.33353 0.02555   -12.20441 1.000 39.69909  ? 9   PRO A CG    1 
ATOM   62   C  CD    . PRO A 1 10  ? 25.82250 -0.19187  -12.22369 1.000 40.47666  ? 9   PRO A CD    1 
ATOM   63   N  N     . VAL A 1 11  ? 24.06424 -0.79820  -16.51419 1.000 45.06134  ? 10  VAL A N     1 
ATOM   64   C  CA    . VAL A 1 11  ? 23.71491 -0.07847  -17.72894 1.000 46.51429  ? 10  VAL A CA    1 
ATOM   65   C  C     . VAL A 1 11  ? 22.44081 -0.67681  -18.30105 1.000 47.47973  ? 10  VAL A C     1 
ATOM   66   O  O     . VAL A 1 11  ? 22.00014 -1.75309  -17.89886 1.000 53.84646  ? 10  VAL A O     1 
ATOM   67   C  CB    . VAL A 1 11  ? 24.85815 -0.10981  -18.75899 1.000 49.99396  ? 10  VAL A CB    1 
ATOM   68   C  CG1   . VAL A 1 11  ? 25.94383 0.85849   -18.32448 1.000 53.52562  ? 10  VAL A CG1   1 
ATOM   69   C  CG2   . VAL A 1 11  ? 25.43282 -1.50112  -18.87347 1.000 40.78157  ? 10  VAL A CG2   1 
ATOM   70   N  N     . LYS A 1 12  ? 21.82778 0.05550   -19.22596 1.000 50.25379  ? 11  LYS A N     1 
ATOM   71   C  CA    . LYS A 1 12  ? 20.51817 -0.31149  -19.74591 1.000 49.56515  ? 11  LYS A CA    1 
ATOM   72   C  C     . LYS A 1 12  ? 20.41142 0.17785   -21.17641 1.000 49.88565  ? 11  LYS A C     1 
ATOM   73   O  O     . LYS A 1 12  ? 21.06130 1.15659   -21.55193 1.000 51.85474  ? 11  LYS A O     1 
ATOM   74   C  CB    . LYS A 1 12  ? 19.38112 0.28659   -18.90263 1.000 38.35614  ? 11  LYS A CB    1 
ATOM   75   N  N     . LEU A 1 13  ? 19.60553 -0.51981  -21.97803 1.000 52.03880  ? 12  LEU A N     1 
ATOM   76   C  CA    . LEU A 1 13  ? 19.22715 0.01370   -23.28219 1.000 54.56089  ? 12  LEU A CA    1 
ATOM   77   C  C     . LEU A 1 13  ? 18.27768 1.19818   -23.10216 1.000 53.49729  ? 12  LEU A C     1 
ATOM   78   O  O     . LEU A 1 13  ? 17.67272 1.38014   -22.04161 1.000 52.94737  ? 12  LEU A O     1 
ATOM   79   C  CB    . LEU A 1 13  ? 18.56608 -1.06478  -24.14349 1.000 49.74285  ? 12  LEU A CB    1 
ATOM   80   C  CG    . LEU A 1 13  ? 19.47244 -2.19042  -24.63739 1.000 55.45704  ? 12  LEU A CG    1 
ATOM   81   C  CD1   . LEU A 1 13  ? 18.79166 -3.06192  -25.69628 1.000 54.09881  ? 12  LEU A CD1   1 
ATOM   82   C  CD2   . LEU A 1 13  ? 20.76996 -1.61210  -25.17556 1.000 56.60236  ? 12  LEU A CD2   1 
ATOM   83   N  N     . LYS A 1 14  ? 18.17374 2.03026   -24.13741 1.000 52.78031  ? 13  LYS A N     1 
ATOM   84   C  CA    . LYS A 1 14  ? 17.13617 3.05363   -24.12610 1.000 59.94394  ? 13  LYS A CA    1 
ATOM   85   C  C     . LYS A 1 14  ? 15.75873 2.38639   -24.21222 1.000 64.11188  ? 13  LYS A C     1 
ATOM   86   O  O     . LYS A 1 14  ? 15.61492 1.32038   -24.82295 1.000 59.69194  ? 13  LYS A O     1 
ATOM   87   C  CB    . LYS A 1 14  ? 17.31827 4.04141   -25.27921 1.000 58.96864  ? 13  LYS A CB    1 
ATOM   88   C  CG    . LYS A 1 14  ? 18.42297 5.08347   -25.07854 1.000 58.15870  ? 13  LYS A CG    1 
ATOM   89   C  CD    . LYS A 1 14  ? 18.62227 5.92881   -26.33913 1.000 56.07524  ? 13  LYS A CD    1 
ATOM   90   C  CE    . LYS A 1 14  ? 19.84082 6.83913   -26.24337 1.000 58.99938  ? 13  LYS A CE    1 
ATOM   91   N  NZ    . LYS A 1 14  ? 19.50176 8.27510   -26.01524 1.000 59.51961  ? 13  LYS A NZ    1 
ATOM   92   N  N     . PRO A 1 15  ? 14.73781 2.97920   -23.58586 1.000 63.16461  ? 14  PRO A N     1 
ATOM   93   C  CA    . PRO A 1 15  ? 13.42800 2.30979   -23.49602 1.000 66.41182  ? 14  PRO A CA    1 
ATOM   94   C  C     . PRO A 1 15  ? 12.84427 1.92528   -24.85224 1.000 65.35951  ? 14  PRO A C     1 
ATOM   95   O  O     . PRO A 1 15  ? 12.99449 2.63544   -25.84965 1.000 60.58097  ? 14  PRO A O     1 
ATOM   96   C  CB    . PRO A 1 15  ? 12.54540 3.34200   -22.78211 1.000 58.80134  ? 14  PRO A CB    1 
ATOM   97   C  CG    . PRO A 1 15  ? 13.43437 4.53427   -22.48838 1.000 66.92826  ? 14  PRO A CG    1 
ATOM   98   C  CD    . PRO A 1 15  ? 14.85087 4.08216   -22.62334 1.000 62.18427  ? 14  PRO A CD    1 
ATOM   99   N  N     . GLY A 1 16  ? 12.18151 0.76899   -24.87073 1.000 65.68084  ? 15  GLY A N     1 
ATOM   100  C  CA    . GLY A 1 16  ? 11.56028 0.25458   -26.07368 1.000 69.90406  ? 15  GLY A CA    1 
ATOM   101  C  C     . GLY A 1 16  ? 12.51685 -0.15431  -27.17051 1.000 74.31957  ? 15  GLY A C     1 
ATOM   102  O  O     . GLY A 1 16  ? 12.11563 -0.23081  -28.33640 1.000 75.96897  ? 15  GLY A O     1 
ATOM   103  N  N     . MET A 1 17  ? 13.77172 -0.42996  -26.83753 1.000 71.15776  ? 16  MET A N     1 
ATOM   104  C  CA    . MET A 1 17  ? 14.77705 -0.76513  -27.83209 1.000 70.11238  ? 16  MET A CA    1 
ATOM   105  C  C     . MET A 1 17  ? 15.33432 -2.15247  -27.55226 1.000 65.49150  ? 16  MET A C     1 
ATOM   106  O  O     . MET A 1 17  ? 15.23855 -2.66344  -26.43457 1.000 62.17774  ? 16  MET A O     1 
ATOM   107  C  CB    . MET A 1 17  ? 15.91048 0.26171   -27.83117 1.000 70.45001  ? 16  MET A CB    1 
ATOM   108  C  CG    . MET A 1 17  ? 15.47069 1.67677   -28.08540 1.000 64.84422  ? 16  MET A CG    1 
ATOM   109  S  SD    . MET A 1 17  ? 15.86508 2.15189   -29.77068 1.000 84.92849  ? 16  MET A SD    1 
ATOM   110  C  CE    . MET A 1 17  ? 15.99506 3.94146   -29.58283 1.000 84.78062  ? 16  MET A CE    1 
ATOM   111  N  N     . ASP A 1 18  ? 15.93062 -2.75308  -28.58105 1.000 67.29622  ? 17  ASP A N     1 
ATOM   112  C  CA    . ASP A 1 18  ? 16.43138 -4.11866  -28.51277 1.000 65.06338  ? 17  ASP A CA    1 
ATOM   113  C  C     . ASP A 1 18  ? 17.87261 -4.16430  -29.00519 1.000 66.36559  ? 17  ASP A C     1 
ATOM   114  O  O     . ASP A 1 18  ? 18.39875 -3.19018  -29.54719 1.000 70.18401  ? 17  ASP A O     1 
ATOM   115  C  CB    . ASP A 1 18  ? 15.54598 -5.07114  -29.33025 1.000 66.93757  ? 17  ASP A CB    1 
ATOM   116  C  CG    . ASP A 1 18  ? 15.89466 -6.53558  -29.10643 1.000 73.11976  ? 17  ASP A CG    1 
ATOM   117  O  OD1   . ASP A 1 18  ? 16.16860 -6.90972  -27.93680 1.000 66.50953  ? 17  ASP A OD1   1 
ATOM   118  O  OD2   . ASP A 1 18  ? 15.88970 -7.30392  -30.10214 1.000 71.43714  ? 17  ASP A OD2   1 
ATOM   119  N  N     . GLY A 1 19  ? 18.51284 -5.31706  -28.80872 1.000 67.67178  ? 18  GLY A N     1 
ATOM   120  C  CA    . GLY A 1 19  ? 19.89302 -5.50774  -29.18443 1.000 61.07550  ? 18  GLY A CA    1 
ATOM   121  C  C     . GLY A 1 19  ? 20.07652 -5.54647  -30.68474 1.000 62.30368  ? 18  GLY A C     1 
ATOM   122  O  O     . GLY A 1 19  ? 19.13035 -5.76741  -31.44953 1.000 62.84519  ? 18  GLY A O     1 
ATOM   123  N  N     . PRO A 1 20  ? 21.31074 -5.33767  -31.13280 1.000 61.27716  ? 19  PRO A N     1 
ATOM   124  C  CA    . PRO A 1 20  ? 21.56710 -5.24829  -32.57367 1.000 61.15033  ? 19  PRO A CA    1 
ATOM   125  C  C     . PRO A 1 20  ? 21.47886 -6.60553  -33.25240 1.000 62.64063  ? 19  PRO A C     1 
ATOM   126  O  O     . PRO A 1 20  ? 21.75932 -7.64728  -32.65208 1.000 64.03876  ? 19  PRO A O     1 
ATOM   127  C  CB    . PRO A 1 20  ? 22.99138 -4.69105  -32.64066 1.000 55.76712  ? 19  PRO A CB    1 
ATOM   128  C  CG    . PRO A 1 20  ? 23.63184 -5.17229  -31.36990 1.000 53.57463  ? 19  PRO A CG    1 
ATOM   129  C  CD    . PRO A 1 20  ? 22.54028 -5.19018  -30.33243 1.000 55.68358  ? 19  PRO A CD    1 
ATOM   130  N  N     . LYS A 1 21  ? 21.08007 -6.58298  -34.52695 1.000 60.68995  ? 20  LYS A N     1 
ATOM   131  C  CA    . LYS A 1 21  ? 21.07250 -7.77407  -35.38230 1.000 60.25131  ? 20  LYS A CA    1 
ATOM   132  C  C     . LYS A 1 21  ? 21.69360 -7.38242  -36.72433 1.000 62.26317  ? 20  LYS A C     1 
ATOM   133  O  O     . LYS A 1 21  ? 20.98601 -6.93753  -37.63339 1.000 62.95095  ? 20  LYS A O     1 
ATOM   134  C  CB    . LYS A 1 21  ? 19.65253 -8.33434  -35.53324 1.000 57.65835  ? 20  LYS A CB    1 
ATOM   135  C  CG    . LYS A 1 21  ? 19.08210 -8.87855  -34.21857 1.000 59.03307  ? 20  LYS A CG    1 
ATOM   136  C  CD    . LYS A 1 21  ? 17.66106 -9.39654  -34.33710 1.000 59.84873  ? 20  LYS A CD    1 
ATOM   137  C  CE    . LYS A 1 21  ? 16.68864 -8.55175  -33.50770 1.000 66.34202  ? 20  LYS A CE    1 
ATOM   138  N  NZ    . LYS A 1 21  ? 16.01041 -9.31409  -32.41018 1.000 59.32162  ? 20  LYS A NZ    1 
ATOM   139  N  N     . VAL A 1 22  ? 23.01568 -7.55042  -36.84156 1.000 56.41219  ? 21  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 22  ? 23.79131 -7.02940  -37.96405 1.000 54.30290  ? 21  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 22  ? 24.78576 -8.08697  -38.43274 1.000 59.64606  ? 21  VAL A C     1 
ATOM   142  O  O     . VAL A 1 22  ? 25.52504 -8.65821  -37.62131 1.000 55.91650  ? 21  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 22  ? 24.52544 -5.73041  -37.57818 1.000 54.75717  ? 21  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 22  ? 25.45078 -5.27397  -38.70050 1.000 45.77601  ? 21  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 22  ? 23.51641 -4.65122  -37.23363 1.000 56.18307  ? 21  VAL A CG2   1 
ATOM   146  N  N     . LYS A 1 23  ? 24.82374 -8.31980  -39.74963 1.000 66.17000  ? 22  LYS A N     1 
ATOM   147  C  CA    . LYS A 1 23  ? 25.64987 -9.37636  -40.33043 1.000 63.73503  ? 22  LYS A CA    1 
ATOM   148  C  C     . LYS A 1 23  ? 27.13353 -9.07258  -40.17203 1.000 59.18487  ? 22  LYS A C     1 
ATOM   149  O  O     . LYS A 1 23  ? 27.58188 -7.96037  -40.45063 1.000 62.66793  ? 22  LYS A O     1 
ATOM   150  C  CB    . LYS A 1 23  ? 25.32121 -9.55299  -41.81634 1.000 54.15256  ? 22  LYS A CB    1 
ATOM   151  N  N     . GLN A 1 24  ? 27.89871 -10.06623 -39.73226 1.000 59.08200  ? 23  GLN A N     1 
ATOM   152  C  CA    . GLN A 1 24  ? 29.34312 -9.96208  -39.83274 1.000 60.99529  ? 23  GLN A CA    1 
ATOM   153  C  C     . GLN A 1 24  ? 29.72600 -9.73254  -41.28428 1.000 64.60453  ? 23  GLN A C     1 
ATOM   154  O  O     . GLN A 1 24  ? 29.18615 -10.37097 -42.19352 1.000 71.37921  ? 23  GLN A O     1 
ATOM   155  C  CB    . GLN A 1 24  ? 30.02292 -11.23010 -39.32530 1.000 58.24132  ? 23  GLN A CB    1 
ATOM   156  C  CG    . GLN A 1 24  ? 31.54752 -11.11961 -39.31153 1.000 60.74307  ? 23  GLN A CG    1 
ATOM   157  C  CD    . GLN A 1 24  ? 32.03209 -10.10651 -38.27730 1.000 63.49322  ? 23  GLN A CD    1 
ATOM   158  O  OE1   . GLN A 1 24  ? 31.56636 -10.09918 -37.12272 1.000 60.37722  ? 23  GLN A OE1   1 
ATOM   159  N  NE2   . GLN A 1 24  ? 32.95115 -9.23309  -38.68878 1.000 56.95583  ? 23  GLN A NE2   1 
ATOM   160  N  N     . TRP A 1 25  ? 30.64250 -8.81022  -41.50968 1.000 64.45344  ? 24  TRP A N     1 
ATOM   161  C  CA    . TRP A 1 25  ? 31.14052 -8.58542  -42.85771 1.000 73.37343  ? 24  TRP A CA    1 
ATOM   162  C  C     . TRP A 1 25  ? 32.36731 -9.44772  -43.10780 1.000 73.93135  ? 24  TRP A C     1 
ATOM   163  O  O     . TRP A 1 25  ? 32.82748 -10.16616 -42.21840 1.000 75.36865  ? 24  TRP A O     1 
ATOM   164  C  CB    . TRP A 1 25  ? 31.41190 -7.09486  -43.07740 1.000 74.61105  ? 24  TRP A CB    1 
ATOM   165  C  CG    . TRP A 1 25  ? 32.32749 -6.38949  -42.12694 1.000 75.14187  ? 24  TRP A CG    1 
ATOM   166  C  CD1   . TRP A 1 25  ? 33.61800 -6.72053  -41.80784 1.000 73.29665  ? 24  TRP A CD1   1 
ATOM   167  C  CD2   . TRP A 1 25  ? 32.03755 -5.17349  -41.42392 1.000 69.38626  ? 24  TRP A CD2   1 
ATOM   168  N  NE1   . TRP A 1 25  ? 34.13587 -5.79489  -40.92366 1.000 69.92409  ? 24  TRP A NE1   1 
ATOM   169  C  CE2   . TRP A 1 25  ? 33.18540 -4.83924  -40.67098 1.000 66.94975  ? 24  TRP A CE2   1 
ATOM   170  C  CE3   . TRP A 1 25  ? 30.91356 -4.34579  -41.34794 1.000 64.27962  ? 24  TRP A CE3   1 
ATOM   171  C  CZ2   . TRP A 1 25  ? 33.24365 -3.70640  -39.85889 1.000 66.73068  ? 24  TRP A CZ2   1 
ATOM   172  C  CZ3   . TRP A 1 25  ? 30.97204 -3.21952  -40.54094 1.000 73.10488  ? 24  TRP A CZ3   1 
ATOM   173  C  CH2   . TRP A 1 25  ? 32.13131 -2.90873  -39.80726 1.000 66.43583  ? 24  TRP A CH2   1 
ATOM   174  N  N     . PRO A 1 26  ? 32.88416 -9.46756  -44.34007 1.000 76.83253  ? 25  PRO A N     1 
ATOM   175  C  CA    . PRO A 1 26  ? 34.08913 -10.26402 -44.60938 1.000 78.09977  ? 25  PRO A CA    1 
ATOM   176  C  C     . PRO A 1 26  ? 35.35793 -9.52555  -44.19930 1.000 77.86832  ? 25  PRO A C     1 
ATOM   177  O  O     . PRO A 1 26  ? 35.56800 -8.36358  -44.55884 1.000 78.74545  ? 25  PRO A O     1 
ATOM   178  C  CB    . PRO A 1 26  ? 34.03395 -10.48604 -46.12559 1.000 73.31000  ? 25  PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 26  ? 33.27049 -9.31874  -46.63401 1.000 70.07743  ? 25  PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 26  ? 32.22394 -9.05757  -45.59636 1.000 73.34430  ? 25  PRO A CD    1 
ATOM   181  N  N     . LEU A 1 27  ? 36.20303 -10.21221 -43.44163 1.000 78.09456  ? 26  LEU A N     1 
ATOM   182  C  CA    . LEU A 1 27  ? 37.51794 -9.71398  -43.07319 1.000 80.39353  ? 26  LEU A CA    1 
ATOM   183  C  C     . LEU A 1 27  ? 38.58983 -10.45803 -43.86436 1.000 75.09816  ? 26  LEU A C     1 
ATOM   184  O  O     . LEU A 1 27  ? 38.36439 -11.55987 -44.37225 1.000 72.33261  ? 26  LEU A O     1 
ATOM   185  C  CB    . LEU A 1 27  ? 37.75482 -9.87133  -41.56323 1.000 76.60015  ? 26  LEU A CB    1 
ATOM   186  N  N     . THR A 1 28  ? 39.76152 -9.83339  -43.97622 1.000 71.16260  ? 27  THR A N     1 
ATOM   187  C  CA    . THR A 1 28  ? 40.89709 -10.50047 -44.59194 1.000 70.45051  ? 27  THR A CA    1 
ATOM   188  C  C     . THR A 1 28  ? 41.33096 -11.69948 -43.75517 1.000 77.01443  ? 27  THR A C     1 
ATOM   189  O  O     . THR A 1 28  ? 41.01690 -11.81226 -42.56962 1.000 81.94435  ? 27  THR A O     1 
ATOM   190  C  CB    . THR A 1 28  ? 42.07804 -9.54529  -44.75389 1.000 74.13758  ? 27  THR A CB    1 
ATOM   191  O  OG1   . THR A 1 28  ? 43.28746 -10.30295 -44.90609 1.000 83.71800  ? 27  THR A OG1   1 
ATOM   192  C  CG2   . THR A 1 28  ? 42.21294 -8.68991  -43.55221 1.000 73.98730  ? 27  THR A CG2   1 
ATOM   193  N  N     . GLU A 1 29  ? 42.07832 -12.60146 -44.38950 1.000 77.20242  ? 28  GLU A N     1 
ATOM   194  C  CA    . GLU A 1 29  ? 42.52458 -13.79982 -43.69004 1.000 76.83460  ? 28  GLU A CA    1 
ATOM   195  C  C     . GLU A 1 29  ? 43.48416 -13.45193 -42.55528 1.000 74.36883  ? 28  GLU A C     1 
ATOM   196  O  O     . GLU A 1 29  ? 43.43194 -14.06117 -41.48049 1.000 72.36349  ? 28  GLU A O     1 
ATOM   197  C  CB    . GLU A 1 29  ? 43.16392 -14.76499 -44.68976 1.000 81.57515  ? 28  GLU A CB    1 
ATOM   198  C  CG    . GLU A 1 29  ? 43.61728 -16.08723 -44.10759 1.000 79.24778  ? 28  GLU A CG    1 
ATOM   199  C  CD    . GLU A 1 29  ? 45.13574 -16.18929 -44.02017 1.000 94.35528  ? 28  GLU A CD    1 
ATOM   200  O  OE1   . GLU A 1 29  ? 45.83411 -15.31829 -44.59529 1.000 89.64159  ? 28  GLU A OE1   1 
ATOM   201  O  OE2   . GLU A 1 29  ? 45.63056 -17.14379 -43.37546 1.000 97.31390  ? 28  GLU A OE2   1 
ATOM   202  N  N     . GLU A 1 30  ? 44.35770 -12.46683 -42.77104 1.000 77.30566  ? 29  GLU A N     1 
ATOM   203  C  CA    . GLU A 1 30  ? 45.30400 -12.06417 -41.73282 1.000 77.67743  ? 29  GLU A CA    1 
ATOM   204  C  C     . GLU A 1 30  ? 44.57529 -11.60938 -40.47547 1.000 74.22136  ? 29  GLU A C     1 
ATOM   205  O  O     . GLU A 1 30  ? 44.90489 -12.03188 -39.35597 1.000 71.41728  ? 29  GLU A O     1 
ATOM   206  C  CB    . GLU A 1 30  ? 46.20607 -10.94592 -42.26062 1.000 74.96868  ? 29  GLU A CB    1 
ATOM   207  C  CG    . GLU A 1 30  ? 47.41729 -10.65779 -41.39602 1.000 77.01274  ? 29  GLU A CG    1 
ATOM   208  C  CD    . GLU A 1 30  ? 48.15617 -9.40941  -41.83923 1.000 76.24673  ? 29  GLU A CD    1 
ATOM   209  O  OE1   . GLU A 1 30  ? 47.56205 -8.61797  -42.60200 1.000 69.73953  ? 29  GLU A OE1   1 
ATOM   210  O  OE2   . GLU A 1 30  ? 49.32326 -9.22223  -41.42374 1.000 78.18570  ? 29  GLU A OE2   1 
ATOM   211  N  N     . LYS A 1 31  ? 43.57355 -10.74276 -40.64682 1.000 70.79637  ? 30  LYS A N     1 
ATOM   212  C  CA    . LYS A 1 31  ? 42.80866 -10.27207 -39.50420 1.000 69.57185  ? 30  LYS A CA    1 
ATOM   213  C  C     . LYS A 1 31  ? 42.00916 -11.40234 -38.87283 1.000 69.92119  ? 30  LYS A C     1 
ATOM   214  O  O     . LYS A 1 31  ? 41.76453 -11.38119 -37.66209 1.000 67.95244  ? 30  LYS A O     1 
ATOM   215  C  CB    . LYS A 1 31  ? 41.90218 -9.11085  -39.92126 1.000 71.01798  ? 30  LYS A CB    1 
ATOM   216  C  CG    . LYS A 1 31  ? 42.66000 -7.79783  -40.18583 1.000 67.19183  ? 30  LYS A CG    1 
ATOM   217  C  CD    . LYS A 1 31  ? 41.72969 -6.71219  -40.71616 1.000 67.54689  ? 30  LYS A CD    1 
ATOM   218  C  CE    . LYS A 1 31  ? 42.51060 -5.54933  -41.32449 1.000 75.49891  ? 30  LYS A CE    1 
ATOM   219  N  NZ    . LYS A 1 31  ? 41.62240 -4.39835  -41.71167 1.000 74.11640  ? 30  LYS A NZ    1 
ATOM   220  N  N     . ILE A 1 32  ? 41.64032 -12.41781 -39.65600 1.000 70.83185  ? 31  ILE A N     1 
ATOM   221  C  CA    . ILE A 1 32  ? 40.91834 -13.55430 -39.09267 1.000 67.18294  ? 31  ILE A CA    1 
ATOM   222  C  C     . ILE A 1 32  ? 41.84006 -14.40266 -38.22114 1.000 64.06021  ? 31  ILE A C     1 
ATOM   223  O  O     . ILE A 1 32  ? 41.43129 -14.89480 -37.16506 1.000 63.95931  ? 31  ILE A O     1 
ATOM   224  C  CB    . ILE A 1 32  ? 40.26337 -14.37041 -40.21655 1.000 68.88723  ? 31  ILE A CB    1 
ATOM   225  C  CG1   . ILE A 1 32  ? 39.18246 -13.52556 -40.88963 1.000 72.31677  ? 31  ILE A CG1   1 
ATOM   226  C  CG2   . ILE A 1 32  ? 39.67115 -15.65530 -39.67099 1.000 69.69477  ? 31  ILE A CG2   1 
ATOM   227  C  CD1   . ILE A 1 32  ? 38.49592 -14.20911 -42.03915 1.000 78.15226  ? 31  ILE A CD1   1 
ATOM   228  N  N     . LYS A 1 33  ? 43.10471 -14.55400 -38.61668 1.000 62.47994  ? 32  LYS A N     1 
ATOM   229  C  CA    . LYS A 1 33  ? 44.05584 -15.23896 -37.74286 1.000 64.08671  ? 32  LYS A CA    1 
ATOM   230  C  C     . LYS A 1 33  ? 44.31906 -14.43122 -36.47452 1.000 59.38005  ? 32  LYS A C     1 
ATOM   231  O  O     . LYS A 1 33  ? 44.39267 -14.99289 -35.36817 1.000 57.16434  ? 32  LYS A O     1 
ATOM   232  C  CB    . LYS A 1 33  ? 45.36524 -15.51676 -38.48943 1.000 64.71100  ? 32  LYS A CB    1 
ATOM   233  N  N     . ALA A 1 34  ? 44.46512 -13.11225 -36.61224 1.000 60.29961  ? 33  ALA A N     1 
ATOM   234  C  CA    . ALA A 1 34  ? 44.70214 -12.28551 -35.43277 1.000 57.50353  ? 33  ALA A CA    1 
ATOM   235  C  C     . ALA A 1 34  ? 43.53636 -12.39546 -34.46409 1.000 58.10495  ? 33  ALA A C     1 
ATOM   236  O  O     . ALA A 1 34  ? 43.72556 -12.62173 -33.25733 1.000 57.95688  ? 33  ALA A O     1 
ATOM   237  C  CB    . ALA A 1 34  ? 44.92780 -10.83260 -35.83925 1.000 59.17695  ? 33  ALA A CB    1 
ATOM   238  N  N     . LEU A 1 35  ? 42.31571 -12.25715 -34.99043 1.000 56.99475  ? 34  LEU A N     1 
ATOM   239  C  CA    . LEU A 1 35  ? 41.12315 -12.36868 -34.16819 1.000 50.96395  ? 34  LEU A CA    1 
ATOM   240  C  C     . LEU A 1 35  ? 41.02929 -13.73550 -33.52498 1.000 52.92813  ? 34  LEU A C     1 
ATOM   241  O  O     . LEU A 1 35  ? 40.65939 -13.84139 -32.35617 1.000 54.05024  ? 34  LEU A O     1 
ATOM   242  C  CB    . LEU A 1 35  ? 39.88026 -12.08187 -35.00394 1.000 53.14639  ? 34  LEU A CB    1 
ATOM   243  C  CG    . LEU A 1 35  ? 39.74553 -10.61655 -35.43840 1.000 59.98692  ? 34  LEU A CG    1 
ATOM   244  C  CD1   . LEU A 1 35  ? 38.50982 -10.39312 -36.30474 1.000 54.02195  ? 34  LEU A CD1   1 
ATOM   245  C  CD2   . LEU A 1 35  ? 39.72635 -9.67897  -34.22117 1.000 54.80990  ? 34  LEU A CD2   1 
ATOM   246  N  N     . VAL A 1 36  ? 41.36253 -14.79611 -34.26341 1.000 56.78621  ? 35  VAL A N     1 
ATOM   247  C  CA    . VAL A 1 36  ? 41.23774 -16.14385 -33.71419 1.000 54.53793  ? 35  VAL A CA    1 
ATOM   248  C  C     . VAL A 1 36  ? 42.16943 -16.31738 -32.52558 1.000 53.48415  ? 35  VAL A C     1 
ATOM   249  O  O     . VAL A 1 36  ? 41.76679 -16.82280 -31.46781 1.000 54.68174  ? 35  VAL A O     1 
ATOM   250  C  CB    . VAL A 1 36  ? 41.50219 -17.19844 -34.80533 1.000 57.28171  ? 35  VAL A CB    1 
ATOM   251  C  CG1   . VAL A 1 36  ? 42.04348 -18.49163 -34.20139 1.000 51.30813  ? 35  VAL A CG1   1 
ATOM   252  C  CG2   . VAL A 1 36  ? 40.22679 -17.47783 -35.56670 1.000 63.32960  ? 35  VAL A CG2   1 
ATOM   253  N  N     . GLU A 1 37  ? 43.43140 -15.90621 -32.67715 1.000 50.54660  ? 36  GLU A N     1 
ATOM   254  C  CA    . GLU A 1 37  ? 44.35649 -16.04339 -31.55771 1.000 53.69199  ? 36  GLU A CA    1 
ATOM   255  C  C     . GLU A 1 37  ? 43.86030 -15.25564 -30.34554 1.000 56.75673  ? 36  GLU A C     1 
ATOM   256  O  O     . GLU A 1 37  ? 43.75708 -15.79653 -29.22550 1.000 48.39543  ? 36  GLU A O     1 
ATOM   257  C  CB    . GLU A 1 37  ? 45.75396 -15.59155 -31.96609 1.000 50.04129  ? 36  GLU A CB    1 
ATOM   258  C  CG    . GLU A 1 37  ? 46.78670 -15.95591 -30.91606 1.000 61.67240  ? 36  GLU A CG    1 
ATOM   259  C  CD    . GLU A 1 37  ? 48.11833 -15.25150 -31.10287 1.000 75.80213  ? 36  GLU A CD    1 
ATOM   260  O  OE1   . GLU A 1 37  ? 48.43623 -14.84403 -32.24960 1.000 77.55970  ? 36  GLU A OE1   1 
ATOM   261  O  OE2   . GLU A 1 37  ? 48.84480 -15.10565 -30.08929 1.000 75.37389  ? 36  GLU A OE2   1 
ATOM   262  N  N     . ILE A 1 38  ? 43.51571 -13.97621 -30.56841 1.000 53.89969  ? 37  ILE A N     1 
ATOM   263  C  CA    . ILE A 1 38  ? 42.99569 -13.12918 -29.49694 1.000 50.46859  ? 37  ILE A CA    1 
ATOM   264  C  C     . ILE A 1 38  ? 41.79730 -13.78636 -28.82265 1.000 49.86607  ? 37  ILE A C     1 
ATOM   265  O  O     . ILE A 1 38  ? 41.69679 -13.83058 -27.59192 1.000 48.67453  ? 37  ILE A O     1 
ATOM   266  C  CB    . ILE A 1 38  ? 42.63445 -11.73944 -30.04591 1.000 47.74659  ? 37  ILE A CB    1 
ATOM   267  C  CG1   . ILE A 1 38  ? 43.90059 -10.97533 -30.41037 1.000 50.45292  ? 37  ILE A CG1   1 
ATOM   268  C  CG2   . ILE A 1 38  ? 41.81277 -10.95576 -29.03515 1.000 46.72116  ? 37  ILE A CG2   1 
ATOM   269  C  CD1   . ILE A 1 38  ? 43.66651 -9.84918  -31.39985 1.000 49.18902  ? 37  ILE A CD1   1 
ATOM   270  N  N     . CYS A 1 39  ? 40.87850 -14.32020 -29.61830 1.000 49.27648  ? 38  CYS A N     1 
ATOM   271  C  CA    . CYS A 1 39  ? 39.61414 -14.78352 -29.06715 1.000 51.49678  ? 38  CYS A CA    1 
ATOM   272  C  C     . CYS A 1 39  ? 39.77339 -16.07886 -28.28242 1.000 50.80757  ? 38  CYS A C     1 
ATOM   273  O  O     . CYS A 1 39  ? 39.16068 -16.24074 -27.22119 1.000 47.73698  ? 38  CYS A O     1 
ATOM   274  C  CB    . CYS A 1 39  ? 38.58642 -14.95108 -30.18244 1.000 53.17432  ? 38  CYS A CB    1 
ATOM   275  S  SG    . CYS A 1 39  ? 37.54171 -13.51190 -30.38347 1.000 58.57900  ? 38  CYS A SG    1 
ATOM   276  N  N     . THR A 1 40  ? 40.57010 -17.02635 -28.77137 1.000 49.95124  ? 39  THR A N     1 
ATOM   277  C  CA    . THR A 1 40  ? 40.68563 -18.23552 -27.96474 1.000 50.78688  ? 39  THR A CA    1 
ATOM   278  C  C     . THR A 1 40  ? 41.44898 -17.94770 -26.68320 1.000 48.22937  ? 39  THR A C     1 
ATOM   279  O  O     . THR A 1 40  ? 41.11146 -18.50887 -25.62896 1.000 50.51588  ? 39  THR A O     1 
ATOM   280  C  CB    . THR A 1 40  ? 41.30022 -19.39421 -28.75942 1.000 51.70595  ? 39  THR A CB    1 
ATOM   281  O  OG1   . THR A 1 40  ? 42.68227 -19.15317 -29.02122 1.000 57.28498  ? 39  THR A OG1   1 
ATOM   282  C  CG2   . THR A 1 40  ? 40.54967 -19.59141 -30.09070 1.000 53.06102  ? 39  THR A CG2   1 
ATOM   283  N  N     . GLU A 1 41  ? 42.40617 -17.00607 -26.72125 1.000 52.66701  ? 40  GLU A N     1 
ATOM   284  C  CA    . GLU A 1 41  ? 43.09262 -16.64662 -25.48128 1.000 52.86209  ? 40  GLU A CA    1 
ATOM   285  C  C     . GLU A 1 41  ? 42.15725 -15.93693 -24.51118 1.000 49.60749  ? 40  GLU A C     1 
ATOM   286  O  O     . GLU A 1 41  ? 42.15782 -16.23759 -23.31226 1.000 53.42047  ? 40  GLU A O     1 
ATOM   287  C  CB    . GLU A 1 41  ? 44.32159 -15.78073 -25.76943 1.000 56.87755  ? 40  GLU A CB    1 
ATOM   288  C  CG    . GLU A 1 41  ? 45.31925 -15.74364 -24.60989 1.000 60.24363  ? 40  GLU A CG    1 
ATOM   289  C  CD    . GLU A 1 41  ? 45.44789 -17.10668 -23.89837 1.000 73.32264  ? 40  GLU A CD    1 
ATOM   290  O  OE1   . GLU A 1 41  ? 45.29275 -17.14854 -22.64762 1.000 69.02010  ? 40  GLU A OE1   1 
ATOM   291  O  OE2   . GLU A 1 41  ? 45.69380 -18.13239 -24.59203 1.000 70.27706  ? 40  GLU A OE2   1 
ATOM   292  N  N     . MET A 1 42  ? 41.34602 -15.00484 -25.00710 1.000 44.58862  ? 41  MET A N     1 
ATOM   293  C  CA    . MET A 1 42  ? 40.40137 -14.31330 -24.14139 1.000 46.15954  ? 41  MET A CA    1 
ATOM   294  C  C     . MET A 1 42  ? 39.36414 -15.26699 -23.57546 1.000 47.80204  ? 41  MET A C     1 
ATOM   295  O  O     . MET A 1 42  ? 38.95893 -15.13693 -22.41497 1.000 47.77498  ? 41  MET A O     1 
ATOM   296  C  CB    . MET A 1 42  ? 39.72174 -13.18487 -24.91045 1.000 44.72484  ? 41  MET A CB    1 
ATOM   297  C  CG    . MET A 1 42  ? 40.55199 -11.93521 -24.96947 1.000 45.74315  ? 41  MET A CG    1 
ATOM   298  S  SD    . MET A 1 42  ? 39.79355 -10.68116 -25.99001 1.000 58.76185  ? 41  MET A SD    1 
ATOM   299  C  CE    . MET A 1 42  ? 38.65856 -9.86101  -24.84911 1.000 41.82776  ? 41  MET A CE    1 
ATOM   300  N  N     . GLU A 1 43  ? 38.92435 -16.22988 -24.38003 1.000 50.07465  ? 42  GLU A N     1 
ATOM   301  C  CA    . GLU A 1 43  ? 37.97144 -17.21846 -23.90128 1.000 51.00395  ? 42  GLU A CA    1 
ATOM   302  C  C     . GLU A 1 43  ? 38.55836 -18.04965 -22.77168 1.000 49.26514  ? 42  GLU A C     1 
ATOM   303  O  O     . GLU A 1 43  ? 37.87809 -18.31442 -21.77523 1.000 51.38406  ? 42  GLU A O     1 
ATOM   304  C  CB    . GLU A 1 43  ? 37.53108 -18.10685 -25.05914 1.000 53.20056  ? 42  GLU A CB    1 
ATOM   305  C  CG    . GLU A 1 43  ? 36.16051 -18.70526 -24.87073 1.000 55.92297  ? 42  GLU A CG    1 
ATOM   306  C  CD    . GLU A 1 43  ? 36.22340 -20.03957 -24.18177 1.000 60.37936  ? 42  GLU A CD    1 
ATOM   307  O  OE1   . GLU A 1 43  ? 37.29639 -20.67836 -24.29515 1.000 61.25113  ? 42  GLU A OE1   1 
ATOM   308  O  OE2   . GLU A 1 43  ? 35.21474 -20.43683 -23.53613 1.000 59.79065  ? 42  GLU A OE2   1 
ATOM   309  N  N     . LYS A 1 44  ? 39.82193 -18.45955 -22.89225 1.000 48.25077  ? 43  LYS A N     1 
ATOM   310  C  CA    . LYS A 1 44  ? 40.42092 -19.21321 -21.79280 1.000 50.22607  ? 43  LYS A CA    1 
ATOM   311  C  C     . LYS A 1 44  ? 40.37772 -18.42116 -20.49234 1.000 49.23696  ? 43  LYS A C     1 
ATOM   312  O  O     . LYS A 1 44  ? 40.18001 -18.99033 -19.41465 1.000 53.74928  ? 43  LYS A O     1 
ATOM   313  C  CB    . LYS A 1 44  ? 41.85545 -19.62347 -22.13782 1.000 56.30575  ? 43  LYS A CB    1 
ATOM   314  C  CG    . LYS A 1 44  ? 41.94493 -20.82929 -23.07572 1.000 53.04778  ? 43  LYS A CG    1 
ATOM   315  C  CD    . LYS A 1 44  ? 43.38178 -21.30556 -23.26225 1.000 61.84747  ? 43  LYS A CD    1 
ATOM   316  C  CE    . LYS A 1 44  ? 43.44369 -22.64536 -24.01739 1.000 78.65010  ? 43  LYS A CE    1 
ATOM   317  N  NZ    . LYS A 1 44  ? 43.37417 -23.88317 -23.14495 1.000 80.11787  ? 43  LYS A NZ    1 
ATOM   318  N  N     . GLU A 1 45  ? 40.53391 -17.10528 -20.57212 1.000 54.85225  ? 44  GLU A N     1 
ATOM   319  C  CA    . GLU A 1 45  ? 40.56031 -16.25228 -19.39149 1.000 48.36228  ? 44  GLU A CA    1 
ATOM   320  C  C     . GLU A 1 45  ? 39.18354 -15.75095 -18.98399 1.000 47.87647  ? 44  GLU A C     1 
ATOM   321  O  O     . GLU A 1 45  ? 39.09472 -14.89125 -18.10307 1.000 52.23981  ? 44  GLU A O     1 
ATOM   322  C  CB    . GLU A 1 45  ? 41.48091 -15.05403 -19.62179 1.000 49.73412  ? 44  GLU A CB    1 
ATOM   323  C  CG    . GLU A 1 45  ? 42.90298 -15.41837 -20.00169 1.000 52.17909  ? 44  GLU A CG    1 
ATOM   324  C  CD    . GLU A 1 45  ? 43.65583 -14.22153 -20.51967 1.000 58.37123  ? 44  GLU A CD    1 
ATOM   325  O  OE1   . GLU A 1 45  ? 44.65131 -13.81520 -19.88078 1.000 62.42512  ? 44  GLU A OE1   1 
ATOM   326  O  OE2   . GLU A 1 45  ? 43.22444 -13.66521 -21.55779 1.000 62.17603  ? 44  GLU A OE2   1 
ATOM   327  N  N     . GLY A 1 46  ? 38.11435 -16.25363 -19.59626 1.000 45.64417  ? 45  GLY A N     1 
ATOM   328  C  CA    . GLY A 1 46  ? 36.78666 -15.84889 -19.18873 1.000 36.57304  ? 45  GLY A CA    1 
ATOM   329  C  C     . GLY A 1 46  ? 36.42327 -14.42723 -19.53484 1.000 43.80555  ? 45  GLY A C     1 
ATOM   330  O  O     . GLY A 1 46  ? 35.44121 -13.90224 -19.00276 1.000 45.83319  ? 45  GLY A O     1 
ATOM   331  N  N     . LYS A 1 47  ? 37.18283 -13.78257 -20.42145 1.000 42.85312  ? 46  LYS A N     1 
ATOM   332  C  CA    . LYS A 1 47  ? 36.82423 -12.43540 -20.83628 1.000 42.90104  ? 46  LYS A CA    1 
ATOM   333  C  C     . LYS A 1 47  ? 35.71331 -12.44649 -21.88030 1.000 46.98984  ? 46  LYS A C     1 
ATOM   334  O  O     . LYS A 1 47  ? 34.92850 -11.48909 -21.96440 1.000 44.80774  ? 46  LYS A O     1 
ATOM   335  C  CB    . LYS A 1 47  ? 38.07212 -11.71046 -21.34219 1.000 40.70487  ? 46  LYS A CB    1 
ATOM   336  C  CG    . LYS A 1 47  ? 39.04755 -11.38462 -20.21255 1.000 41.76044  ? 46  LYS A CG    1 
ATOM   337  C  CD    . LYS A 1 47  ? 40.43044 -11.00687 -20.70564 1.000 39.72447  ? 46  LYS A CD    1 
ATOM   338  C  CE    . LYS A 1 47  ? 41.37089 -10.71750 -19.53815 1.000 39.12981  ? 46  LYS A CE    1 
ATOM   339  N  NZ    . LYS A 1 47  ? 42.79905 -10.63992 -19.95509 1.000 38.96502  ? 46  LYS A NZ    1 
ATOM   340  N  N     . ILE A 1 48  ? 35.62307 -13.51695 -22.66717 1.000 46.61988  ? 47  ILE A N     1 
ATOM   341  C  CA    . ILE A 1 48  ? 34.52656 -13.72285 -23.60362 1.000 46.09694  ? 47  ILE A CA    1 
ATOM   342  C  C     . ILE A 1 48  ? 34.02294 -15.15073 -23.44091 1.000 45.50423  ? 47  ILE A C     1 
ATOM   343  O  O     . ILE A 1 48  ? 34.77605 -16.06174 -23.08017 1.000 45.07551  ? 47  ILE A O     1 
ATOM   344  C  CB    . ILE A 1 48  ? 34.94031 -13.44175 -25.07262 1.000 45.95235  ? 47  ILE A CB    1 
ATOM   345  C  CG1   . ILE A 1 48  ? 35.96372 -14.44633 -25.57945 1.000 42.19534  ? 47  ILE A CG1   1 
ATOM   346  C  CG2   . ILE A 1 48  ? 35.54836 -12.06091 -25.21452 1.000 47.93247  ? 47  ILE A CG2   1 
ATOM   347  C  CD1   . ILE A 1 48  ? 36.28193 -14.25188 -27.03436 1.000 39.85644  ? 47  ILE A CD1   1 
ATOM   348  N  N     . SER A 1 49  ? 32.73195 -15.34234 -23.69305 1.000 49.11102  ? 48  SER A N     1 
ATOM   349  C  CA    . SER A 1 49  ? 32.09744 -16.65013 -23.54588 1.000 45.24498  ? 48  SER A CA    1 
ATOM   350  C  C     . SER A 1 49  ? 31.43559 -17.04782 -24.85188 1.000 44.37404  ? 48  SER A C     1 
ATOM   351  O  O     . SER A 1 49  ? 30.71141 -16.24261 -25.44947 1.000 46.21415  ? 48  SER A O     1 
ATOM   352  C  CB    . SER A 1 49  ? 31.04836 -16.65928 -22.43337 1.000 38.43822  ? 48  SER A CB    1 
ATOM   353  O  OG    . SER A 1 49  ? 31.56244 -16.15510 -21.22578 1.000 38.48162  ? 48  SER A OG    1 
ATOM   354  N  N     . LYS A 1 50  ? 31.68943 -18.28428 -25.29181 1.000 46.87888  ? 49  LYS A N     1 
ATOM   355  C  CA    . LYS A 1 50  ? 30.92232 -18.85821 -26.38865 1.000 43.17540  ? 49  LYS A CA    1 
ATOM   356  C  C     . LYS A 1 50  ? 29.44344 -18.77033 -26.05923 1.000 40.94733  ? 49  LYS A C     1 
ATOM   357  O  O     . LYS A 1 50  ? 29.04238 -18.97724 -24.91163 1.000 41.27407  ? 49  LYS A O     1 
ATOM   358  C  CB    . LYS A 1 50  ? 31.30372 -20.31959 -26.62293 1.000 42.23505  ? 49  LYS A CB    1 
ATOM   359  C  CG    . LYS A 1 50  ? 32.76620 -20.61300 -26.87903 1.000 44.70356  ? 49  LYS A CG    1 
ATOM   360  C  CD    . LYS A 1 50  ? 32.97233 -22.14774 -26.92285 1.000 54.88313  ? 49  LYS A CD    1 
ATOM   361  C  CE    . LYS A 1 50  ? 34.35756 -22.61314 -26.43499 1.000 56.25918  ? 49  LYS A CE    1 
ATOM   362  N  NZ    . LYS A 1 50  ? 35.41088 -22.55531 -27.50761 1.000 57.93385  ? 49  LYS A NZ    1 
ATOM   363  N  N     . ILE A 1 51  ? 28.63670 -18.42750 -27.06268 1.000 44.79810  ? 50  ILE A N     1 
ATOM   364  C  CA    . ILE A 1 51  ? 27.18562 -18.37872 -26.92468 1.000 49.80016  ? 50  ILE A CA    1 
ATOM   365  C  C     . ILE A 1 51  ? 26.56776 -19.32945 -27.94404 1.000 52.61341  ? 50  ILE A C     1 
ATOM   366  O  O     . ILE A 1 51  ? 27.22670 -19.79465 -28.87339 1.000 48.65160  ? 50  ILE A O     1 
ATOM   367  C  CB    . ILE A 1 51  ? 26.61369 -16.95778 -27.10136 1.000 51.95198  ? 50  ILE A CB    1 
ATOM   368  C  CG1   . ILE A 1 51  ? 26.96023 -16.40092 -28.48901 1.000 51.62576  ? 50  ILE A CG1   1 
ATOM   369  C  CG2   . ILE A 1 51  ? 27.11666 -16.03467 -26.00212 1.000 55.71462  ? 50  ILE A CG2   1 
ATOM   370  C  CD1   . ILE A 1 51  ? 26.43011 -15.01123 -28.72977 1.000 50.59301  ? 50  ILE A CD1   1 
ATOM   371  N  N     . GLY A 1 52  ? 25.27984 -19.60767 -27.75680 1.000 55.80856  ? 51  GLY A N     1 
ATOM   372  C  CA    . GLY A 1 52  ? 24.55127 -20.48108 -28.64620 1.000 65.70945  ? 51  GLY A CA    1 
ATOM   373  C  C     . GLY A 1 52  ? 23.49044 -19.76709 -29.46538 1.000 68.09316  ? 51  GLY A C     1 
ATOM   374  O  O     . GLY A 1 52  ? 23.60781 -18.58221 -29.79583 1.000 63.56111  ? 51  GLY A O     1 
ATOM   375  N  N     . PRO A 1 53  ? 22.43063 -20.49236 -29.83084 1.000 71.72503  ? 52  PRO A N     1 
ATOM   376  C  CA    . PRO A 1 53  ? 21.34445 -19.88464 -30.60622 1.000 71.94978  ? 52  PRO A CA    1 
ATOM   377  C  C     . PRO A 1 53  ? 20.26501 -19.24353 -29.75055 1.000 66.87926  ? 52  PRO A C     1 
ATOM   378  O  O     . PRO A 1 53  ? 19.33981 -18.63816 -30.31122 1.000 63.43877  ? 52  PRO A O     1 
ATOM   379  C  CB    . PRO A 1 53  ? 20.77739 -21.07958 -31.40101 1.000 72.03603  ? 52  PRO A CB    1 
ATOM   380  C  CG    . PRO A 1 53  ? 21.48577 -22.32932 -30.84597 1.000 76.99817  ? 52  PRO A CG    1 
ATOM   381  C  CD    . PRO A 1 53  ? 22.18652 -21.92021 -29.59033 1.000 73.30797  ? 52  PRO A CD    1 
ATOM   382  N  N     . GLU A 1 54  ? 20.34738 -19.37883 -28.42260 1.000 63.93187  ? 53  GLU A N     1 
ATOM   383  C  CA    . GLU A 1 54  ? 19.48632 -18.60170 -27.53925 1.000 63.87684  ? 53  GLU A CA    1 
ATOM   384  C  C     . GLU A 1 54  ? 19.77914 -17.10801 -27.65556 1.000 67.61011  ? 53  GLU A C     1 
ATOM   385  O  O     . GLU A 1 54  ? 18.89847 -16.27532 -27.40950 1.000 66.85924  ? 53  GLU A O     1 
ATOM   386  C  CB    . GLU A 1 54  ? 19.66913 -19.07429 -26.09191 1.000 68.82534  ? 53  GLU A CB    1 
ATOM   387  C  CG    . GLU A 1 54  ? 21.00134 -18.67661 -25.43488 1.000 71.25881  ? 53  GLU A CG    1 
ATOM   388  C  CD    . GLU A 1 54  ? 22.20240 -19.49345 -25.92588 1.000 70.74973  ? 53  GLU A CD    1 
ATOM   389  O  OE1   . GLU A 1 54  ? 22.01204 -20.44007 -26.72445 1.000 64.78865  ? 53  GLU A OE1   1 
ATOM   390  O  OE2   . GLU A 1 54  ? 23.34166 -19.18018 -25.50500 1.000 66.58773  ? 53  GLU A OE2   1 
ATOM   391  N  N     . ASN A 1 55  ? 21.00346 -16.75363 -28.04346 1.000 63.77362  ? 54  ASN A N     1 
ATOM   392  C  CA    . ASN A 1 55  ? 21.37300 -15.36722 -28.26665 1.000 62.36072  ? 54  ASN A CA    1 
ATOM   393  C  C     . ASN A 1 55  ? 21.03686 -14.98412 -29.70321 1.000 62.96908  ? 54  ASN A C     1 
ATOM   394  O  O     . ASN A 1 55  ? 21.65179 -15.52503 -30.63984 1.000 61.50864  ? 54  ASN A O     1 
ATOM   395  C  CB    . ASN A 1 55  ? 22.85370 -15.16843 -27.98461 1.000 62.76581  ? 54  ASN A CB    1 
ATOM   396  C  CG    . ASN A 1 55  ? 23.22540 -13.71808 -27.85800 1.000 56.80211  ? 54  ASN A CG    1 
ATOM   397  O  OD1   . ASN A 1 55  ? 22.84632 -12.90854 -28.69587 1.000 60.79720  ? 54  ASN A OD1   1 
ATOM   398  N  ND2   . ASN A 1 55  ? 23.94458 -13.37207 -26.79414 1.000 55.99379  ? 54  ASN A ND2   1 
ATOM   399  N  N     . PRO A 1 56  ? 20.08538 -14.07418 -29.92989 1.000 59.50355  ? 55  PRO A N     1 
ATOM   400  C  CA    . PRO A 1 56  ? 19.70159 -13.71001 -31.29880 1.000 60.80524  ? 55  PRO A CA    1 
ATOM   401  C  C     . PRO A 1 56  ? 20.53750 -12.61556 -31.94127 1.000 63.94950  ? 55  PRO A C     1 
ATOM   402  O  O     . PRO A 1 56  ? 20.38666 -12.37917 -33.14901 1.000 63.25990  ? 55  PRO A O     1 
ATOM   403  C  CB    . PRO A 1 56  ? 18.25420 -13.23303 -31.11763 1.000 58.24060  ? 55  PRO A CB    1 
ATOM   404  C  CG    . PRO A 1 56  ? 18.23873 -12.65897 -29.73337 1.000 54.78800  ? 55  PRO A CG    1 
ATOM   405  C  CD    . PRO A 1 56  ? 19.18778 -13.48672 -28.92032 1.000 54.48778  ? 55  PRO A CD    1 
ATOM   406  N  N     . TYR A 1 57  ? 21.41022 -11.95843 -31.18392 1.000 65.09952  ? 56  TYR A N     1 
ATOM   407  C  CA    . TYR A 1 57  ? 22.06823 -10.73300 -31.61584 1.000 58.95691  ? 56  TYR A CA    1 
ATOM   408  C  C     . TYR A 1 57  ? 23.40544 -11.01015 -32.28913 1.000 54.24922  ? 56  TYR A C     1 
ATOM   409  O  O     . TYR A 1 57  ? 23.96882 -12.10281 -32.20701 1.000 57.25931  ? 56  TYR A O     1 
ATOM   410  C  CB    . TYR A 1 57  ? 22.27803 -9.80044  -30.42776 1.000 54.54235  ? 56  TYR A CB    1 
ATOM   411  C  CG    . TYR A 1 57  ? 21.01860 -9.58930  -29.63942 1.000 59.05486  ? 56  TYR A CG    1 
ATOM   412  C  CD1   . TYR A 1 57  ? 19.94185 -8.91733  -30.19973 1.000 63.27917  ? 56  TYR A CD1   1 
ATOM   413  C  CD2   . TYR A 1 57  ? 20.89323 -10.06497 -28.33930 1.000 53.10129  ? 56  TYR A CD2   1 
ATOM   414  C  CE1   . TYR A 1 57  ? 18.77136 -8.71259  -29.48663 1.000 61.19833  ? 56  TYR A CE1   1 
ATOM   415  C  CE2   . TYR A 1 57  ? 19.72498 -9.86519  -27.62064 1.000 55.55682  ? 56  TYR A CE2   1 
ATOM   416  C  CZ    . TYR A 1 57  ? 18.66997 -9.18491  -28.20512 1.000 57.45768  ? 56  TYR A CZ    1 
ATOM   417  O  OH    . TYR A 1 57  ? 17.51005 -8.96561  -27.51339 1.000 61.01513  ? 56  TYR A OH    1 
ATOM   418  N  N     . ASN A 1 58  ? 23.90782 -9.98650  -32.96885 1.000 54.18409  ? 57  ASN A N     1 
ATOM   419  C  CA    . ASN A 1 58  ? 25.24547 -9.99737  -33.53884 1.000 51.37253  ? 57  ASN A CA    1 
ATOM   420  C  C     . ASN A 1 58  ? 25.57188 -8.58362  -33.98602 1.000 57.71313  ? 57  ASN A C     1 
ATOM   421  O  O     . ASN A 1 58  ? 24.66671 -7.78406  -34.26338 1.000 54.34143  ? 57  ASN A O     1 
ATOM   422  C  CB    . ASN A 1 58  ? 25.36385 -10.96507 -34.71443 1.000 43.34931  ? 57  ASN A CB    1 
ATOM   423  C  CG    . ASN A 1 58  ? 26.77905 -11.08333 -35.22310 1.000 52.06525  ? 57  ASN A CG    1 
ATOM   424  O  OD1   . ASN A 1 58  ? 27.53963 -11.94333 -34.77377 1.000 57.45571  ? 57  ASN A OD1   1 
ATOM   425  N  ND2   . ASN A 1 58  ? 27.14547 -10.22740 -36.17190 1.000 52.61183  ? 57  ASN A ND2   1 
ATOM   426  N  N     . THR A 1 59  ? 26.86947 -8.27650  -34.01454 1.000 51.32209  ? 58  THR A N     1 
ATOM   427  C  CA    . THR A 1 59  ? 27.36324 -7.01835  -34.54755 1.000 54.22904  ? 58  THR A CA    1 
ATOM   428  C  C     . THR A 1 59  ? 28.77402 -7.23658  -35.08276 1.000 51.53038  ? 58  THR A C     1 
ATOM   429  O  O     . THR A 1 59  ? 29.51745 -8.05675  -34.53782 1.000 51.77485  ? 58  THR A O     1 
ATOM   430  C  CB    . THR A 1 59  ? 27.32306 -5.89587  -33.48748 1.000 54.39465  ? 58  THR A CB    1 
ATOM   431  O  OG1   . THR A 1 59  ? 28.55363 -5.16290  -33.50244 1.000 55.81665  ? 58  THR A OG1   1 
ATOM   432  C  CG2   . THR A 1 59  ? 27.02800 -6.44056  -32.08393 1.000 47.09737  ? 58  THR A CG2   1 
ATOM   433  N  N     . PRO A 1 60  ? 29.16427 -6.53181  -36.14836 1.000 59.26362  ? 59  PRO A N     1 
ATOM   434  C  CA    . PRO A 1 60  ? 30.42988 -6.84227  -36.83443 1.000 55.94848  ? 59  PRO A CA    1 
ATOM   435  C  C     . PRO A 1 60  ? 31.66606 -6.56325  -35.98859 1.000 56.38630  ? 59  PRO A C     1 
ATOM   436  O  O     . PRO A 1 60  ? 31.66439 -5.73577  -35.07343 1.000 58.35672  ? 59  PRO A O     1 
ATOM   437  C  CB    . PRO A 1 60  ? 30.40517 -5.92176  -38.06650 1.000 58.15103  ? 59  PRO A CB    1 
ATOM   438  C  CG    . PRO A 1 60  ? 28.97677 -5.48355  -38.22255 1.000 55.25331  ? 59  PRO A CG    1 
ATOM   439  C  CD    . PRO A 1 60  ? 28.42143 -5.45291  -36.82937 1.000 59.08229  ? 59  PRO A CD    1 
ATOM   440  N  N     . VAL A 1 61  ? 32.75541 -7.24052  -36.36067 1.000 52.12025  ? 60  VAL A N     1 
ATOM   441  C  CA    . VAL A 1 61  ? 34.02670 -7.19263  -35.65117 1.000 49.80468  ? 60  VAL A CA    1 
ATOM   442  C  C     . VAL A 1 61  ? 35.16143 -7.03045  -36.65865 1.000 52.27379  ? 60  VAL A C     1 
ATOM   443  O  O     . VAL A 1 61  ? 35.08840 -7.54213  -37.77787 1.000 59.68924  ? 60  VAL A O     1 
ATOM   444  C  CB    . VAL A 1 61  ? 34.19871 -8.47036  -34.79935 1.000 48.90494  ? 60  VAL A CB    1 
ATOM   445  C  CG1   . VAL A 1 61  ? 35.65062 -8.77712  -34.54683 1.000 52.79380  ? 60  VAL A CG1   1 
ATOM   446  C  CG2   . VAL A 1 61  ? 33.46830 -8.31385  -33.48809 1.000 48.34445  ? 60  VAL A CG2   1 
ATOM   447  N  N     . PHE A 1 62  ? 36.20995 -6.30252  -36.27312 1.000 50.12603  ? 61  PHE A N     1 
ATOM   448  C  CA    . PHE A 1 62  ? 37.41655 -6.20578  -37.10039 1.000 51.68357  ? 61  PHE A CA    1 
ATOM   449  C  C     . PHE A 1 62  ? 38.63314 -5.98718  -36.19839 1.000 50.81142  ? 61  PHE A C     1 
ATOM   450  O  O     . PHE A 1 62  ? 38.57054 -6.16785  -34.97799 1.000 49.39968  ? 61  PHE A O     1 
ATOM   451  C  CB    . PHE A 1 62  ? 37.27427 -5.11465  -38.17394 1.000 58.47624  ? 61  PHE A CB    1 
ATOM   452  C  CG    . PHE A 1 62  ? 37.03317 -3.72522  -37.63803 1.000 58.86584  ? 61  PHE A CG    1 
ATOM   453  C  CD1   . PHE A 1 62  ? 35.79081 -3.35485  -37.13660 1.000 56.64364  ? 61  PHE A CD1   1 
ATOM   454  C  CD2   . PHE A 1 62  ? 38.03563 -2.77241  -37.68680 1.000 61.51546  ? 61  PHE A CD2   1 
ATOM   455  C  CE1   . PHE A 1 62  ? 35.56434 -2.06948  -36.66278 1.000 52.87806  ? 61  PHE A CE1   1 
ATOM   456  C  CE2   . PHE A 1 62  ? 37.81246 -1.48243  -37.21622 1.000 59.69244  ? 61  PHE A CE2   1 
ATOM   457  C  CZ    . PHE A 1 62  ? 36.57287 -1.13621  -36.70425 1.000 54.46073  ? 61  PHE A CZ    1 
ATOM   458  N  N     . ALA A 1 63  ? 39.75505 -5.60548  -36.80296 1.000 49.50457  ? 62  ALA A N     1 
ATOM   459  C  CA    . ALA A 1 63  ? 40.99193 -5.47003  -36.04387 1.000 57.52845  ? 62  ALA A CA    1 
ATOM   460  C  C     . ALA A 1 63  ? 41.94493 -4.53938  -36.78183 1.000 61.42661  ? 62  ALA A C     1 
ATOM   461  O  O     . ALA A 1 63  ? 41.90263 -4.43624  -38.00993 1.000 65.95045  ? 62  ALA A O     1 
ATOM   462  C  CB    . ALA A 1 63  ? 41.65770 -6.83242  -35.80504 1.000 55.95889  ? 62  ALA A CB    1 
ATOM   463  N  N     . ILE A 1 64  ? 42.80369 -3.85662  -36.01757 1.000 55.75988  ? 63  ILE A N     1 
ATOM   464  C  CA    . ILE A 1 64  ? 43.80600 -2.96246  -36.59244 1.000 54.45132  ? 63  ILE A CA    1 
ATOM   465  C  C     . ILE A 1 64  ? 45.12359 -3.14266  -35.85592 1.000 55.31444  ? 63  ILE A C     1 
ATOM   466  O  O     . ILE A 1 64  ? 45.17046 -3.62304  -34.72625 1.000 57.75770  ? 63  ILE A O     1 
ATOM   467  C  CB    . ILE A 1 64  ? 43.39872 -1.47073  -36.54028 1.000 51.17996  ? 63  ILE A CB    1 
ATOM   468  C  CG1   . ILE A 1 64  ? 43.50417 -0.94521  -35.11498 1.000 54.95629  ? 63  ILE A CG1   1 
ATOM   469  C  CG2   . ILE A 1 64  ? 41.99847 -1.25799  -37.07982 1.000 54.99402  ? 63  ILE A CG2   1 
ATOM   470  C  CD1   . ILE A 1 64  ? 42.80845 0.37669   -34.90366 1.000 58.03557  ? 63  ILE A CD1   1 
ATOM   471  N  N     . LYS A 1 65  ? 46.20675 -2.72543  -36.49617 1.000 56.87967  ? 64  LYS A N     1 
ATOM   472  C  CA    . LYS A 1 65  ? 47.48582 -2.73600  -35.80573 1.000 57.24689  ? 64  LYS A CA    1 
ATOM   473  C  C     . LYS A 1 65  ? 47.52977 -1.63416  -34.74266 1.000 61.26166  ? 64  LYS A C     1 
ATOM   474  O  O     . LYS A 1 65  ? 46.82671 -0.61961  -34.82615 1.000 63.93862  ? 64  LYS A O     1 
ATOM   475  C  CB    . LYS A 1 65  ? 48.62837 -2.57199  -36.80878 1.000 57.08290  ? 64  LYS A CB    1 
ATOM   476  N  N     . LYS A 1 66  ? 48.35626 -1.85175  -33.72319 1.000 60.36411  ? 65  LYS A N     1 
ATOM   477  C  CA    . LYS A 1 66  ? 48.52692 -0.90533  -32.63157 1.000 56.45741  ? 65  LYS A CA    1 
ATOM   478  C  C     . LYS A 1 66  ? 49.69873 0.03976   -32.91324 1.000 65.36860  ? 65  LYS A C     1 
ATOM   479  O  O     . LYS A 1 66  ? 50.38059 -0.05927  -33.93886 1.000 58.45266  ? 65  LYS A O     1 
ATOM   480  C  CB    . LYS A 1 66  ? 48.74868 -1.65163  -31.31560 1.000 48.79276  ? 65  LYS A CB    1 
ATOM   481  C  CG    . LYS A 1 66  ? 47.48958 -2.19792  -30.66519 1.000 48.30888  ? 65  LYS A CG    1 
ATOM   482  C  CD    . LYS A 1 66  ? 47.83076 -3.21979  -29.58414 1.000 49.83864  ? 65  LYS A CD    1 
ATOM   483  C  CE    . LYS A 1 66  ? 46.69902 -3.36439  -28.58311 1.000 49.80064  ? 65  LYS A CE    1 
ATOM   484  N  NZ    . LYS A 1 66  ? 46.93138 -4.40812  -27.54011 1.000 54.08458  ? 65  LYS A NZ    1 
ATOM   485  N  N     . LYS A 1 67  ? 49.92210 0.97773   -31.98060 1.000 69.01610  ? 66  LYS A N     1 
ATOM   486  C  CA    . LYS A 1 67  ? 51.13158 1.80192   -31.96985 1.000 65.78409  ? 66  LYS A CA    1 
ATOM   487  C  C     . LYS A 1 67  ? 52.38333 0.93211   -32.09263 1.000 65.38671  ? 66  LYS A C     1 
ATOM   488  O  O     . LYS A 1 67  ? 53.22367 1.13574   -32.97664 1.000 59.42852  ? 66  LYS A O     1 
ATOM   489  C  CB    . LYS A 1 67  ? 51.16748 2.63776   -30.68231 1.000 65.64170  ? 66  LYS A CB    1 
ATOM   490  C  CG    . LYS A 1 67  ? 51.85078 4.01401   -30.78200 1.000 64.84544  ? 66  LYS A CG    1 
ATOM   491  C  CD    . LYS A 1 67  ? 50.89784 5.08329   -31.33837 1.000 64.36919  ? 66  LYS A CD    1 
ATOM   492  C  CE    . LYS A 1 67  ? 51.37233 6.52159   -31.03415 1.000 66.06376  ? 66  LYS A CE    1 
ATOM   493  N  NZ    . LYS A 1 67  ? 51.27010 6.92248   -29.59023 1.000 52.14326  ? 66  LYS A NZ    1 
ATOM   494  N  N     . ASP A 1 68  ? 52.52426 -0.04246  -31.19239 1.000 73.78809  ? 67  ASP A N     1 
ATOM   495  C  CA    . ASP A 1 68  ? 53.43388 -1.16367  -31.40222 1.000 68.57102  ? 67  ASP A CA    1 
ATOM   496  C  C     . ASP A 1 68  ? 52.89900 -1.94969  -32.59256 1.000 69.58128  ? 67  ASP A C     1 
ATOM   497  O  O     . ASP A 1 68  ? 51.86092 -2.61033  -32.48475 1.000 70.55568  ? 67  ASP A O     1 
ATOM   498  C  CB    . ASP A 1 68  ? 53.52065 -2.01934  -30.12602 1.000 70.56188  ? 67  ASP A CB    1 
ATOM   499  C  CG    . ASP A 1 68  ? 54.31314 -3.32326  -30.30977 1.000 78.76846  ? 67  ASP A CG    1 
ATOM   500  O  OD1   . ASP A 1 68  ? 54.72325 -3.64691  -31.44820 1.000 76.84813  ? 67  ASP A OD1   1 
ATOM   501  O  OD2   . ASP A 1 68  ? 54.52536 -4.03521  -29.29382 1.000 73.18544  ? 67  ASP A OD2   1 
ATOM   502  N  N     . SER A 1 69  ? 53.58656 -1.87410  -33.73614 1.000 74.12834  ? 68  SER A N     1 
ATOM   503  C  CA    . SER A 1 69  ? 53.06504 -2.45744  -34.97092 1.000 70.92739  ? 68  SER A CA    1 
ATOM   504  C  C     . SER A 1 69  ? 53.07324 -3.98633  -34.96590 1.000 74.91606  ? 68  SER A C     1 
ATOM   505  O  O     . SER A 1 69  ? 52.43882 -4.59112  -35.83960 1.000 74.55858  ? 68  SER A O     1 
ATOM   506  C  CB    . SER A 1 69  ? 53.84854 -1.92586  -36.17959 1.000 59.35186  ? 68  SER A CB    1 
ATOM   507  N  N     . THR A 1 70  ? 53.75717 -4.62950  -34.01584 1.000 68.76649  ? 69  THR A N     1 
ATOM   508  C  CA    . THR A 1 70  ? 53.62204 -6.07713  -33.87578 1.000 68.27136  ? 69  THR A CA    1 
ATOM   509  C  C     . THR A 1 70  ? 52.18986 -6.45784  -33.49940 1.000 70.66652  ? 69  THR A C     1 
ATOM   510  O  O     . THR A 1 70  ? 51.53078 -7.22910  -34.20430 1.000 66.30588  ? 69  THR A O     1 
ATOM   511  C  CB    . THR A 1 70  ? 54.60874 -6.60546  -32.82964 1.000 66.74987  ? 69  THR A CB    1 
ATOM   512  N  N     . LYS A 1 71  ? 51.67808 -5.88696  -32.40930 1.000 67.63507  ? 70  LYS A N     1 
ATOM   513  C  CA    . LYS A 1 71  ? 50.46779 -6.37486  -31.76533 1.000 59.24435  ? 70  LYS A CA    1 
ATOM   514  C  C     . LYS A 1 71  ? 49.20245 -5.84301  -32.43762 1.000 56.52484  ? 70  LYS A C     1 
ATOM   515  O  O     . LYS A 1 71  ? 49.18557 -4.74929  -33.00556 1.000 60.26711  ? 70  LYS A O     1 
ATOM   516  C  CB    . LYS A 1 71  ? 50.50247 -5.98949  -30.28538 1.000 66.58204  ? 70  LYS A CB    1 
ATOM   517  C  CG    . LYS A 1 71  ? 51.74413 -6.52912  -29.54689 1.000 67.43186  ? 70  LYS A CG    1 
ATOM   518  C  CD    . LYS A 1 71  ? 51.83556 -6.05089  -28.09643 1.000 69.66250  ? 70  LYS A CD    1 
ATOM   519  C  CE    . LYS A 1 71  ? 50.56387 -6.36750  -27.29467 1.000 68.37542  ? 70  LYS A CE    1 
ATOM   520  N  NZ    . LYS A 1 71  ? 50.76413 -7.45042  -26.29246 1.000 60.62400  ? 70  LYS A NZ    1 
ATOM   521  N  N     . TRP A 1 72  ? 48.13628 -6.63892  -32.36865 1.000 53.73342  ? 71  TRP A N     1 
ATOM   522  C  CA    . TRP A 1 72  ? 46.83242 -6.32055  -32.94307 1.000 54.83588  ? 71  TRP A CA    1 
ATOM   523  C  C     . TRP A 1 72  ? 45.85634 -5.81442  -31.88346 1.000 51.53214  ? 71  TRP A C     1 
ATOM   524  O  O     . TRP A 1 72  ? 45.99533 -6.08123  -30.68760 1.000 55.07176  ? 71  TRP A O     1 
ATOM   525  C  CB    . TRP A 1 72  ? 46.20951 -7.54599  -33.61924 1.000 59.89059  ? 71  TRP A CB    1 
ATOM   526  C  CG    . TRP A 1 72  ? 46.80294 -7.91735  -34.94655 1.000 62.89311  ? 71  TRP A CG    1 
ATOM   527  C  CD1   . TRP A 1 72  ? 47.79687 -8.82387  -35.17593 1.000 55.83991  ? 71  TRP A CD1   1 
ATOM   528  C  CD2   . TRP A 1 72  ? 46.41925 -7.40810  -36.23276 1.000 64.65203  ? 71  TRP A CD2   1 
ATOM   529  N  NE1   . TRP A 1 72  ? 48.06481 -8.90176  -36.52064 1.000 54.62558  ? 71  TRP A NE1   1 
ATOM   530  C  CE2   . TRP A 1 72  ? 47.23387 -8.04555  -37.19295 1.000 62.83746  ? 71  TRP A CE2   1 
ATOM   531  C  CE3   . TRP A 1 72  ? 45.47365 -6.46794  -36.66371 1.000 64.06043  ? 71  TRP A CE3   1 
ATOM   532  C  CZ2   . TRP A 1 72  ? 47.13701 -7.77184  -38.55681 1.000 66.23558  ? 71  TRP A CZ2   1 
ATOM   533  C  CZ3   . TRP A 1 72  ? 45.37324 -6.20211  -38.02194 1.000 67.71515  ? 71  TRP A CZ3   1 
ATOM   534  C  CH2   . TRP A 1 72  ? 46.20328 -6.85047  -38.95110 1.000 68.22552  ? 71  TRP A CH2   1 
ATOM   535  N  N     . ARG A 1 73  ? 44.83291 -5.10874  -32.34903 1.000 44.80535  ? 72  ARG A N     1 
ATOM   536  C  CA    . ARG A 1 73  ? 43.78184 -4.57659  -31.49774 1.000 47.35113  ? 72  ARG A CA    1 
ATOM   537  C  C     . ARG A 1 73  ? 42.43519 -4.99352  -32.07639 1.000 47.52374  ? 72  ARG A C     1 
ATOM   538  O  O     . ARG A 1 73  ? 42.12607 -4.67881  -33.23304 1.000 49.07575  ? 72  ARG A O     1 
ATOM   539  C  CB    . ARG A 1 73  ? 43.87838 -3.04896  -31.38463 1.000 46.55003  ? 72  ARG A CB    1 
ATOM   540  C  CG    . ARG A 1 73  ? 42.70298 -2.40227  -30.64998 1.000 40.43216  ? 72  ARG A CG    1 
ATOM   541  C  CD    . ARG A 1 73  ? 42.74961 -0.90084  -30.72424 1.000 45.85294  ? 72  ARG A CD    1 
ATOM   542  N  NE    . ARG A 1 73  ? 44.02734 -0.36071  -30.25993 1.000 50.16586  ? 72  ARG A NE    1 
ATOM   543  C  CZ    . ARG A 1 73  ? 44.32620 -0.11733  -28.98586 1.000 44.77786  ? 72  ARG A CZ    1 
ATOM   544  N  NH1   . ARG A 1 73  ? 45.51904 0.36783   -28.66533 1.000 41.11938  ? 72  ARG A NH1   1 
ATOM   545  N  NH2   . ARG A 1 73  ? 43.44160 -0.37469  -28.02981 1.000 44.26572  ? 72  ARG A NH2   1 
ATOM   546  N  N     . LYS A 1 74  ? 41.64606 -5.69706  -31.26931 1.000 42.18341  ? 73  LYS A N     1 
ATOM   547  C  CA    . LYS A 1 74  ? 40.32743 -6.15880  -31.66702 1.000 45.18949  ? 73  LYS A CA    1 
ATOM   548  C  C     . LYS A 1 74  ? 39.30300 -5.05509  -31.42489 1.000 45.36588  ? 73  LYS A C     1 
ATOM   549  O  O     . LYS A 1 74  ? 39.22210 -4.50806  -30.32216 1.000 46.73904  ? 73  LYS A O     1 
ATOM   550  C  CB    . LYS A 1 74  ? 39.98468 -7.43269  -30.88792 1.000 40.53371  ? 73  LYS A CB    1 
ATOM   551  C  CG    . LYS A 1 74  ? 38.50256 -7.75237  -30.70946 1.000 43.09880  ? 73  LYS A CG    1 
ATOM   552  C  CD    . LYS A 1 74  ? 38.32973 -9.27594  -30.62515 1.000 54.07208  ? 73  LYS A CD    1 
ATOM   553  C  CE    . LYS A 1 74  ? 37.01480 -9.72229  -29.98986 1.000 46.62687  ? 73  LYS A CE    1 
ATOM   554  N  NZ    . LYS A 1 74  ? 35.79491 -9.20363  -30.66915 1.000 43.44524  ? 73  LYS A NZ    1 
ATOM   555  N  N     . LEU A 1 75  ? 38.53056 -4.71301  -32.45738 1.000 45.50138  ? 74  LEU A N     1 
ATOM   556  C  CA    . LEU A 1 75  ? 37.54474 -3.64242  -32.38259 1.000 46.05723  ? 74  LEU A CA    1 
ATOM   557  C  C     . LEU A 1 75  ? 36.19641 -4.16357  -32.84860 1.000 49.73454  ? 74  LEU A C     1 
ATOM   558  O  O     . LEU A 1 75  ? 36.10956 -5.13357  -33.60176 1.000 55.11478  ? 74  LEU A O     1 
ATOM   559  C  CB    . LEU A 1 75  ? 37.93358 -2.44261  -33.24878 1.000 47.07036  ? 74  LEU A CB    1 
ATOM   560  C  CG    . LEU A 1 75  ? 39.24077 -1.72932  -32.92656 1.000 48.41508  ? 74  LEU A CG    1 
ATOM   561  C  CD1   . LEU A 1 75  ? 39.66607 -0.92333  -34.12657 1.000 51.61401  ? 74  LEU A CD1   1 
ATOM   562  C  CD2   . LEU A 1 75  ? 39.05877 -0.82265  -31.72064 1.000 46.80208  ? 74  LEU A CD2   1 
ATOM   563  N  N     . VAL A 1 76  ? 35.13705 -3.49812  -32.40755 1.000 47.33264  ? 75  VAL A N     1 
ATOM   564  C  CA    . VAL A 1 76  ? 33.77431 -3.88538  -32.74398 1.000 48.12976  ? 75  VAL A CA    1 
ATOM   565  C  C     . VAL A 1 76  ? 33.03494 -2.63589  -33.18805 1.000 50.00172  ? 75  VAL A C     1 
ATOM   566  O  O     . VAL A 1 76  ? 32.93710 -1.66976  -32.42521 1.000 47.20886  ? 75  VAL A O     1 
ATOM   567  C  CB    . VAL A 1 76  ? 33.04610 -4.53426  -31.55379 1.000 48.85548  ? 75  VAL A CB    1 
ATOM   568  C  CG1   . VAL A 1 76  ? 31.64552 -4.96278  -31.95172 1.000 45.22516  ? 75  VAL A CG1   1 
ATOM   569  C  CG2   . VAL A 1 76  ? 33.84140 -5.69862  -30.99784 1.000 42.68136  ? 75  VAL A CG2   1 
ATOM   570  N  N     . ASP A 1 77  ? 32.49584 -2.65745  -34.40373 1.000 55.46809  ? 76  ASP A N     1 
ATOM   571  C  CA    . ASP A 1 77  ? 31.62607 -1.57497  -34.86285 1.000 54.61122  ? 76  ASP A CA    1 
ATOM   572  C  C     . ASP A 1 77  ? 30.27871 -1.69877  -34.16359 1.000 52.72504  ? 76  ASP A C     1 
ATOM   573  O  O     . ASP A 1 77  ? 29.33540 -2.25962  -34.70885 1.000 57.71673  ? 76  ASP A O     1 
ATOM   574  C  CB    . ASP A 1 77  ? 31.47625 -1.60906  -36.37797 1.000 53.40312  ? 76  ASP A CB    1 
ATOM   575  C  CG    . ASP A 1 77  ? 30.62132 -0.46412  -36.91023 1.000 59.49705  ? 76  ASP A CG    1 
ATOM   576  O  OD1   . ASP A 1 77  ? 30.15386 0.36677   -36.09243 1.000 52.87553  ? 76  ASP A OD1   1 
ATOM   577  O  OD2   . ASP A 1 77  ? 30.41052 -0.40153  -38.14670 1.000 61.00265  ? 76  ASP A OD2   1 
ATOM   578  N  N     . PHE A 1 78  ? 30.18366 -1.13889  -32.94940 1.000 47.68375  ? 77  PHE A N     1 
ATOM   579  C  CA    . PHE A 1 78  ? 28.95516 -1.13351  -32.15637 1.000 51.05397  ? 77  PHE A CA    1 
ATOM   580  C  C     . PHE A 1 78  ? 28.05423 0.06378   -32.45606 1.000 50.48605  ? 77  PHE A C     1 
ATOM   581  O  O     . PHE A 1 78  ? 27.33464 0.51768   -31.55572 1.000 47.71515  ? 77  PHE A O     1 
ATOM   582  C  CB    . PHE A 1 78  ? 29.26982 -1.13129  -30.65579 1.000 48.00842  ? 77  PHE A CB    1 
ATOM   583  C  CG    . PHE A 1 78  ? 29.44140 -2.48858  -30.04358 1.000 47.72031  ? 77  PHE A CG    1 
ATOM   584  C  CD1   . PHE A 1 78  ? 28.43396 -3.43969  -30.10887 1.000 52.85400  ? 77  PHE A CD1   1 
ATOM   585  C  CD2   . PHE A 1 78  ? 30.60173 -2.80031  -29.34404 1.000 49.36059  ? 77  PHE A CD2   1 
ATOM   586  C  CE1   . PHE A 1 78  ? 28.60106 -4.70599  -29.51588 1.000 51.13475  ? 77  PHE A CE1   1 
ATOM   587  C  CE2   . PHE A 1 78  ? 30.77206 -4.06097  -28.75142 1.000 50.68190  ? 77  PHE A CE2   1 
ATOM   588  C  CZ    . PHE A 1 78  ? 29.76984 -5.01243  -28.84329 1.000 45.50574  ? 77  PHE A CZ    1 
ATOM   589  N  N     . ARG A 1 79  ? 28.08812 0.61167   -33.67471 1.000 54.46524  ? 78  ARG A N     1 
ATOM   590  C  CA    . ARG A 1 79  ? 27.36645 1.85934   -33.93156 1.000 52.09682  ? 78  ARG A CA    1 
ATOM   591  C  C     . ARG A 1 79  ? 25.87414 1.69898   -33.69190 1.000 52.14899  ? 78  ARG A C     1 
ATOM   592  O  O     . ARG A 1 79  ? 25.21607 2.61586   -33.18843 1.000 58.96599  ? 78  ARG A O     1 
ATOM   593  C  CB    . ARG A 1 79  ? 27.63244 2.34871   -35.35084 1.000 51.23965  ? 78  ARG A CB    1 
ATOM   594  C  CG    . ARG A 1 79  ? 28.88688 3.19230   -35.48099 1.000 51.95422  ? 78  ARG A CG    1 
ATOM   595  C  CD    . ARG A 1 79  ? 29.11080 3.61992   -36.91516 1.000 56.16672  ? 78  ARG A CD    1 
ATOM   596  N  NE    . ARG A 1 79  ? 29.67981 2.54951   -37.72939 1.000 65.53099  ? 78  ARG A NE    1 
ATOM   597  C  CZ    . ARG A 1 79  ? 30.07616 2.70160   -38.99070 1.000 67.71639  ? 78  ARG A CZ    1 
ATOM   598  N  NH1   . ARG A 1 79  ? 29.96092 3.88379   -39.58423 1.000 69.30967  ? 78  ARG A NH1   1 
ATOM   599  N  NH2   . ARG A 1 79  ? 30.58839 1.67489   -39.65816 1.000 61.93521  ? 78  ARG A NH2   1 
ATOM   600  N  N     . GLU A 1 80  ? 25.32954 0.53163   -34.01838 1.000 52.35687  ? 79  GLU A N     1 
ATOM   601  C  CA    . GLU A 1 80  ? 23.91613 0.27694   -33.78615 1.000 53.20888  ? 79  GLU A CA    1 
ATOM   602  C  C     . GLU A 1 80  ? 23.61183 0.23646   -32.29628 1.000 53.15295  ? 79  GLU A C     1 
ATOM   603  O  O     . GLU A 1 80  ? 22.81966 1.03636   -31.77950 1.000 57.45894  ? 79  GLU A O     1 
ATOM   604  C  CB    . GLU A 1 80  ? 23.52852 -1.04405  -34.45168 1.000 66.97112  ? 79  GLU A CB    1 
ATOM   605  C  CG    . GLU A 1 80  ? 22.03992 -1.21960  -34.64258 1.000 68.69167  ? 79  GLU A CG    1 
ATOM   606  C  CD    . GLU A 1 80  ? 21.44392 -0.07238  -35.42014 1.000 66.96595  ? 79  GLU A CD    1 
ATOM   607  O  OE1   . GLU A 1 80  ? 22.02792 0.28416   -36.47447 1.000 68.85296  ? 79  GLU A OE1   1 
ATOM   608  O  OE2   . GLU A 1 80  ? 20.41676 0.48000   -34.96327 1.000 63.69882  ? 79  GLU A OE2   1 
ATOM   609  N  N     . LEU A 1 81  ? 24.23450 -0.70406  -31.58936 1.000 53.46396  ? 80  LEU A N     1 
ATOM   610  C  CA    . LEU A 1 81  ? 24.07321 -0.77866  -30.14333 1.000 53.11480  ? 80  LEU A CA    1 
ATOM   611  C  C     . LEU A 1 81  ? 24.34848 0.56569   -29.47357 1.000 54.69757  ? 80  LEU A C     1 
ATOM   612  O  O     . LEU A 1 81  ? 23.62971 0.95993   -28.54695 1.000 53.94009  ? 80  LEU A O     1 
ATOM   613  C  CB    . LEU A 1 81  ? 24.99236 -1.85511  -29.57900 1.000 46.63653  ? 80  LEU A CB    1 
ATOM   614  C  CG    . LEU A 1 81  ? 24.97277 -1.91462  -28.06058 1.000 47.81950  ? 80  LEU A CG    1 
ATOM   615  C  CD1   . LEU A 1 81  ? 23.55184 -2.15696  -27.53679 1.000 44.07984  ? 80  LEU A CD1   1 
ATOM   616  C  CD2   . LEU A 1 81  ? 25.94828 -2.98713  -27.60027 1.000 51.27683  ? 80  LEU A CD2   1 
ATOM   617  N  N     . ASN A 1 82  ? 25.37749 1.29047   -29.93276 1.000 50.66596  ? 81  ASN A N     1 
ATOM   618  C  CA    . ASN A 1 82  ? 25.64050 2.61790   -29.38168 1.000 50.63408  ? 81  ASN A CA    1 
ATOM   619  C  C     . ASN A 1 82  ? 24.42424 3.53227   -29.54173 1.000 57.82613  ? 81  ASN A C     1 
ATOM   620  O  O     . ASN A 1 82  ? 24.02368 4.21855   -28.58966 1.000 57.68048  ? 81  ASN A O     1 
ATOM   621  C  CB    . ASN A 1 82  ? 26.88397 3.22896   -30.03134 1.000 45.46695  ? 81  ASN A CB    1 
ATOM   622  C  CG    . ASN A 1 82  ? 28.18048 2.60063   -29.52120 1.000 51.04087  ? 81  ASN A CG    1 
ATOM   623  O  OD1   . ASN A 1 82  ? 28.22251 2.06505   -28.41526 1.000 49.39520  ? 81  ASN A OD1   1 
ATOM   624  N  ND2   . ASN A 1 82  ? 29.24570 2.67057   -30.32584 1.000 47.62843  ? 81  ASN A ND2   1 
ATOM   625  N  N     . LYS A 1 83  ? 23.81571 3.55278   -30.73956 1.000 58.31040  ? 82  LYS A N     1 
ATOM   626  C  CA    . LYS A 1 83  ? 22.57219 4.30424   -30.91426 1.000 55.20233  ? 82  LYS A CA    1 
ATOM   627  C  C     . LYS A 1 83  ? 21.53115 3.89410   -29.88634 1.000 53.95279  ? 82  LYS A C     1 
ATOM   628  O  O     . LYS A 1 83  ? 20.84133 4.74657   -29.31845 1.000 57.39862  ? 82  LYS A O     1 
ATOM   629  C  CB    . LYS A 1 83  ? 21.99773 4.10260   -32.31497 1.000 58.78121  ? 82  LYS A CB    1 
ATOM   630  C  CG    . LYS A 1 83  ? 22.68856 4.86058   -33.42607 1.000 67.05043  ? 82  LYS A CG    1 
ATOM   631  C  CD    . LYS A 1 83  ? 21.99690 4.59368   -34.76461 1.000 61.96715  ? 82  LYS A CD    1 
ATOM   632  C  CE    . LYS A 1 83  ? 22.89033 4.96891   -35.94256 1.000 67.39872  ? 82  LYS A CE    1 
ATOM   633  N  NZ    . LYS A 1 83  ? 23.47238 3.75714   -36.61658 1.000 70.43064  ? 82  LYS A NZ    1 
ATOM   634  N  N     . ARG A 1 84  ? 21.40731 2.59431   -29.62666 1.000 53.33755  ? 83  ARG A N     1 
ATOM   635  C  CA    . ARG A 1 84  ? 20.32351 2.08819   -28.78735 1.000 56.00967  ? 83  ARG A CA    1 
ATOM   636  C  C     . ARG A 1 84  ? 20.67115 2.01189   -27.29727 1.000 56.27437  ? 83  ARG A C     1 
ATOM   637  O  O     . ARG A 1 84  ? 19.85871 1.49190   -26.52010 1.000 50.73713  ? 83  ARG A O     1 
ATOM   638  C  CB    . ARG A 1 84  ? 19.87712 0.70474   -29.27309 1.000 60.45566  ? 83  ARG A CB    1 
ATOM   639  C  CG    . ARG A 1 84  ? 19.87096 0.53948   -30.79377 1.000 62.70401  ? 83  ARG A CG    1 
ATOM   640  C  CD    . ARG A 1 84  ? 18.51613 0.09292   -31.31855 1.000 69.20369  ? 83  ARG A CD    1 
ATOM   641  N  NE    . ARG A 1 84  ? 18.60198 -0.40878  -32.68966 1.000 71.57103  ? 83  ARG A NE    1 
ATOM   642  C  CZ    . ARG A 1 84  ? 18.68164 -1.70184  -33.00473 1.000 77.32690  ? 83  ARG A CZ    1 
ATOM   643  N  NH1   . ARG A 1 84  ? 18.76306 -2.08385  -34.27611 1.000 75.42528  ? 83  ARG A NH1   1 
ATOM   644  N  NH2   . ARG A 1 84  ? 18.68275 -2.62018  -32.04425 1.000 75.46264  ? 83  ARG A NH2   1 
ATOM   645  N  N     . THR A 1 85  ? 21.83831 2.52444   -26.88042 1.000 57.42400  ? 84  THR A N     1 
ATOM   646  C  CA    . THR A 1 85  ? 22.31221 2.43794   -25.50177 1.000 50.97861  ? 84  THR A CA    1 
ATOM   647  C  C     . THR A 1 85  ? 22.00563 3.73039   -24.76289 1.000 49.27000  ? 84  THR A C     1 
ATOM   648  O  O     . THR A 1 85  ? 22.03030 4.81140   -25.34906 1.000 57.29900  ? 84  THR A O     1 
ATOM   649  C  CB    . THR A 1 85  ? 23.82255 2.15160   -25.45489 1.000 50.01523  ? 84  THR A CB    1 
ATOM   650  O  OG1   . THR A 1 85  ? 24.07591 0.85495   -25.99047 1.000 47.96911  ? 84  THR A OG1   1 
ATOM   651  C  CG2   . THR A 1 85  ? 24.36559 2.16796   -24.03244 1.000 45.98707  ? 84  THR A CG2   1 
ATOM   652  N  N     . GLN A 1 86  ? 21.73161 3.61335   -23.46232 1.000 48.13816  ? 85  GLN A N     1 
ATOM   653  C  CA    . GLN A 1 86  ? 21.46225 4.76713   -22.60284 1.000 52.86544  ? 85  GLN A CA    1 
ATOM   654  C  C     . GLN A 1 86  ? 22.55024 5.84225   -22.67035 1.000 53.93628  ? 85  GLN A C     1 
ATOM   655  O  O     . GLN A 1 86  ? 23.66654 5.59042   -23.14174 1.000 54.24753  ? 85  GLN A O     1 
ATOM   656  C  CB    . GLN A 1 86  ? 21.33578 4.31954   -21.15087 1.000 49.32932  ? 85  GLN A CB    1 
ATOM   657  C  CG    . GLN A 1 86  ? 22.64601 3.75859   -20.61972 1.000 50.56898  ? 85  GLN A CG    1 
ATOM   658  C  CD    . GLN A 1 86  ? 22.71277 3.72367   -19.11112 1.000 52.27059  ? 85  GLN A CD    1 
ATOM   659  O  OE1   . GLN A 1 86  ? 22.24050 2.76902   -18.47658 1.000 49.25047  ? 85  GLN A OE1   1 
ATOM   660  N  NE2   . GLN A 1 86  ? 23.31094 4.76512   -18.51842 1.000 46.00548  ? 85  GLN A NE2   1 
ATOM   661  N  N     . ASP A 1 87  ? 22.24154 7.04556   -22.19923 1.000 51.00613  ? 86  ASP A N     1 
ATOM   662  C  CA    . ASP A 1 87  ? 23.24843 8.09351   -22.13946 1.000 49.68634  ? 86  ASP A CA    1 
ATOM   663  C  C     . ASP A 1 87  ? 24.10559 7.95058   -20.88966 1.000 51.79541  ? 86  ASP A C     1 
ATOM   664  O  O     . ASP A 1 87  ? 23.67056 7.42573   -19.85704 1.000 50.76347  ? 86  ASP A O     1 
ATOM   665  C  CB    . ASP A 1 87  ? 22.60850 9.48036   -22.13300 1.000 48.36615  ? 86  ASP A CB    1 
ATOM   666  C  CG    . ASP A 1 87  ? 21.93754 9.82151   -23.43889 1.000 58.32809  ? 86  ASP A CG    1 
ATOM   667  O  OD1   . ASP A 1 87  ? 22.49605 9.47916   -24.51282 1.000 62.61707  ? 86  ASP A OD1   1 
ATOM   668  O  OD2   . ASP A 1 87  ? 20.85099 10.42902  -23.38712 1.000 63.00526  ? 86  ASP A OD2   1 
ATOM   669  N  N     . PHE A 1 88  ? 25.33008 8.45112   -20.99009 1.000 50.47985  ? 87  PHE A N     1 
ATOM   670  C  CA    . PHE A 1 88  ? 26.25719 8.54775   -19.87808 1.000 41.98465  ? 87  PHE A CA    1 
ATOM   671  C  C     . PHE A 1 88  ? 26.63414 10.00658  -19.67928 1.000 44.58116  ? 87  PHE A C     1 
ATOM   672  O  O     . PHE A 1 88  ? 26.49168 10.83235  -20.58393 1.000 47.66795  ? 87  PHE A O     1 
ATOM   673  C  CB    . PHE A 1 88  ? 27.53386 7.74503   -20.13799 1.000 39.65997  ? 87  PHE A CB    1 
ATOM   674  C  CG    . PHE A 1 88  ? 27.30068 6.30541   -20.40791 1.000 42.20414  ? 87  PHE A CG    1 
ATOM   675  C  CD1   . PHE A 1 88  ? 26.97891 5.87197   -21.67625 1.000 46.89483  ? 87  PHE A CD1   1 
ATOM   676  C  CD2   . PHE A 1 88  ? 27.42235 5.37457   -19.39717 1.000 45.18468  ? 87  PHE A CD2   1 
ATOM   677  C  CE1   . PHE A 1 88  ? 26.77347 4.53963   -21.93312 1.000 46.99173  ? 87  PHE A CE1   1 
ATOM   678  C  CE2   . PHE A 1 88  ? 27.21272 4.03136   -19.64451 1.000 48.15501  ? 87  PHE A CE2   1 
ATOM   679  C  CZ    . PHE A 1 88  ? 26.89030 3.61283   -20.91233 1.000 49.52983  ? 87  PHE A CZ    1 
ATOM   680  N  N     . TRP A 1 89  ? 27.14482 10.32450  -18.49611 1.000 46.30860  ? 88  TRP A N     1 
ATOM   681  C  CA    . TRP A 1 89  ? 27.79361 11.60939  -18.27201 1.000 41.68904  ? 88  TRP A CA    1 
ATOM   682  C  C     . TRP A 1 89  ? 29.29435 11.38436  -18.35831 1.000 36.27471  ? 88  TRP A C     1 
ATOM   683  O  O     . TRP A 1 89  ? 29.85468 10.63119  -17.55880 1.000 39.04843  ? 88  TRP A O     1 
ATOM   684  C  CB    . TRP A 1 89  ? 27.40939 12.22464  -16.92526 1.000 39.99777  ? 88  TRP A CB    1 
ATOM   685  C  CG    . TRP A 1 89  ? 27.97981 13.60436  -16.78450 1.000 40.86840  ? 88  TRP A CG    1 
ATOM   686  C  CD1   . TRP A 1 89  ? 29.09139 13.96095  -16.08768 1.000 38.79132  ? 88  TRP A CD1   1 
ATOM   687  C  CD2   . TRP A 1 89  ? 27.49817 14.80011  -17.40912 1.000 38.04337  ? 88  TRP A CD2   1 
ATOM   688  N  NE1   . TRP A 1 89  ? 29.31692 15.29790  -16.21863 1.000 35.95062  ? 88  TRP A NE1   1 
ATOM   689  C  CE2   . TRP A 1 89  ? 28.36070 15.83717  -17.03609 1.000 36.59665  ? 88  TRP A CE2   1 
ATOM   690  C  CE3   . TRP A 1 89  ? 26.41491 15.09139  -18.24387 1.000 41.56035  ? 88  TRP A CE3   1 
ATOM   691  C  CZ2   . TRP A 1 89  ? 28.17604 17.15798  -17.46488 1.000 42.30532  ? 88  TRP A CZ2   1 
ATOM   692  C  CZ3   . TRP A 1 89  ? 26.22899 16.40042  -18.66869 1.000 38.14615  ? 88  TRP A CZ3   1 
ATOM   693  C  CH2   . TRP A 1 89  ? 27.10641 17.41509  -18.27580 1.000 40.57103  ? 88  TRP A CH2   1 
ATOM   694  N  N     . GLU A 1 90  ? 29.93214 11.99560  -19.34869 1.000 35.32422  ? 89  GLU A N     1 
ATOM   695  C  CA    . GLU A 1 90  ? 31.37031 11.83547  -19.50245 1.000 34.57099  ? 89  GLU A CA    1 
ATOM   696  C  C     . GLU A 1 90  ? 32.10083 12.43771  -18.31035 1.000 37.50580  ? 89  GLU A C     1 
ATOM   697  O  O     . GLU A 1 90  ? 31.72463 13.50018  -17.79704 1.000 38.86345  ? 89  GLU A O     1 
ATOM   698  C  CB    . GLU A 1 90  ? 31.84235 12.48273  -20.79957 1.000 31.96240  ? 89  GLU A CB    1 
ATOM   699  C  CG    . GLU A 1 90  ? 31.18282 11.94235  -22.04548 1.000 32.76872  ? 89  GLU A CG    1 
ATOM   700  C  CD    . GLU A 1 90  ? 31.33432 10.43252  -22.19719 1.000 44.99115  ? 89  GLU A CD    1 
ATOM   701  O  OE1   . GLU A 1 90  ? 32.41145 9.90028   -21.82849 1.000 46.84485  ? 89  GLU A OE1   1 
ATOM   702  O  OE2   . GLU A 1 90  ? 30.37419 9.78094   -22.68798 1.000 46.92134  ? 89  GLU A OE2   1 
ATOM   703  N  N     . VAL A 1 91  ? 33.14054 11.74158  -17.84900 1.000 34.94677  ? 90  VAL A N     1 
ATOM   704  C  CA    . VAL A 1 91  ? 33.89292 12.18955  -16.68311 1.000 32.27632  ? 90  VAL A CA    1 
ATOM   705  C  C     . VAL A 1 91  ? 35.26464 12.72888  -17.03414 1.000 33.11804  ? 90  VAL A C     1 
ATOM   706  O  O     . VAL A 1 91  ? 35.93045 13.29319  -16.15446 1.000 33.74732  ? 90  VAL A O     1 
ATOM   707  C  CB    . VAL A 1 91  ? 34.02235 11.07529  -15.62832 1.000 29.68631  ? 90  VAL A CB    1 
ATOM   708  C  CG1   . VAL A 1 91  ? 32.67350 10.70975  -15.12674 1.000 28.79873  ? 90  VAL A CG1   1 
ATOM   709  C  CG2   . VAL A 1 91  ? 34.71387 9.86550   -16.23826 1.000 34.27047  ? 90  VAL A CG2   1 
ATOM   710  N  N     . GLN A 1 92  ? 35.71025 12.58275  -18.27201 1.000 34.21659  ? 91  GLN A N     1 
ATOM   711  C  CA    . GLN A 1 92  ? 37.00283 13.11015  -18.70090 1.000 36.33089  ? 91  GLN A CA    1 
ATOM   712  C  C     . GLN A 1 92  ? 36.78996 14.55384  -19.16510 1.000 37.39633  ? 91  GLN A C     1 
ATOM   713  O  O     . GLN A 1 92  ? 36.35449 14.79649  -20.29311 1.000 42.82625  ? 91  GLN A O     1 
ATOM   714  C  CB    . GLN A 1 92  ? 37.58329 12.23161  -19.80478 1.000 35.10511  ? 91  GLN A CB    1 
ATOM   715  C  CG    . GLN A 1 92  ? 38.97623 12.60536  -20.19919 1.000 37.32272  ? 91  GLN A CG    1 
ATOM   716  C  CD    . GLN A 1 92  ? 39.97022 12.09543  -19.20728 1.000 37.48688  ? 91  GLN A CD    1 
ATOM   717  O  OE1   . GLN A 1 92  ? 39.85952 10.95716  -18.74656 1.000 39.68953  ? 91  GLN A OE1   1 
ATOM   718  N  NE2   . GLN A 1 92  ? 40.95557 12.92313  -18.86274 1.000 33.28015  ? 91  GLN A NE2   1 
ATOM   719  N  N     . LEU A 1 93  ? 37.09916 15.52077  -18.30283 1.000 33.62848  ? 92  LEU A N     1 
ATOM   720  C  CA    . LEU A 1 93  ? 36.70663 16.90434  -18.54725 1.000 34.47987  ? 92  LEU A CA    1 
ATOM   721  C  C     . LEU A 1 93  ? 37.70435 17.68347  -19.41006 1.000 36.85806  ? 92  LEU A C     1 
ATOM   722  O  O     . LEU A 1 93  ? 37.40416 18.81946  -19.79793 1.000 39.30191  ? 92  LEU A O     1 
ATOM   723  C  CB    . LEU A 1 93  ? 36.48461 17.63402  -17.21062 1.000 29.06897  ? 92  LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 93  ? 35.65209 16.94693  -16.10965 1.000 32.17558  ? 92  LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 93  ? 35.35629 17.87783  -14.93039 1.000 27.51110  ? 92  LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 93  ? 34.35875 16.34466  -16.63135 1.000 29.90010  ? 92  LEU A CD2   1 
ATOM   727  N  N     . GLY A 1 94  ? 38.84226 17.09318  -19.75711 1.000 33.88576  ? 93  GLY A N     1 
ATOM   728  C  CA    . GLY A 1 94  ? 39.89113 17.81926  -20.44448 1.000 31.27237  ? 93  GLY A CA    1 
ATOM   729  C  C     . GLY A 1 94  ? 41.12342 16.95023  -20.62021 1.000 40.27564  ? 93  GLY A C     1 
ATOM   730  O  O     . GLY A 1 94  ? 41.09411 15.73277  -20.39777 1.000 35.96770  ? 93  GLY A O     1 
ATOM   731  N  N     . ILE A 1 95  ? 42.22096 17.59371  -21.03789 1.000 38.56420  ? 94  ILE A N     1 
ATOM   732  C  CA    . ILE A 1 95  ? 43.43152 16.90555  -21.44679 1.000 32.38224  ? 94  ILE A CA    1 
ATOM   733  C  C     . ILE A 1 95  ? 44.59460 17.46050  -20.63496 1.000 30.59593  ? 94  ILE A C     1 
ATOM   734  O  O     . ILE A 1 95  ? 44.86123 18.66304  -20.68899 1.000 30.01761  ? 94  ILE A O     1 
ATOM   735  C  CB    . ILE A 1 95  ? 43.72144 17.07076  -22.95267 1.000 34.18622  ? 94  ILE A CB    1 
ATOM   736  C  CG1   . ILE A 1 95  ? 42.47939 16.75826  -23.79357 1.000 34.11957  ? 94  ILE A CG1   1 
ATOM   737  C  CG2   . ILE A 1 95  ? 44.86876 16.18209  -23.39208 1.000 29.13773  ? 94  ILE A CG2   1 
ATOM   738  C  CD1   . ILE A 1 95  ? 41.86718 15.41648  -23.48146 1.000 36.06757  ? 94  ILE A CD1   1 
ATOM   739  N  N     . PRO A 1 96  ? 45.32953 16.64423  -19.89081 1.000 35.34600  ? 95  PRO A N     1 
ATOM   740  C  CA    . PRO A 1 96  ? 46.40609 17.21085  -19.07088 1.000 33.49942  ? 95  PRO A CA    1 
ATOM   741  C  C     . PRO A 1 96  ? 47.47380 17.77334  -19.98073 1.000 34.89492  ? 95  PRO A C     1 
ATOM   742  O  O     . PRO A 1 96  ? 47.64640 17.32600  -21.11722 1.000 30.92753  ? 95  PRO A O     1 
ATOM   743  C  CB    . PRO A 1 96  ? 46.91531 16.02675  -18.24068 1.000 32.08232  ? 95  PRO A CB    1 
ATOM   744  C  CG    . PRO A 1 96  ? 46.41169 14.79260  -18.92820 1.000 30.29305  ? 95  PRO A CG    1 
ATOM   745  C  CD    . PRO A 1 96  ? 45.26016 15.17288  -19.82032 1.000 31.45891  ? 95  PRO A CD    1 
ATOM   746  N  N     . HIS A 1 97  ? 48.14553 18.81527  -19.49563 1.000 39.47947  ? 96  HIS A N     1 
ATOM   747  C  CA    . HIS A 1 97  ? 49.12388 19.50380  -20.31027 1.000 35.43545  ? 96  HIS A CA    1 
ATOM   748  C  C     . HIS A 1 97  ? 50.47165 19.56201  -19.60487 1.000 35.04975  ? 96  HIS A C     1 
ATOM   749  O  O     . HIS A 1 97  ? 50.52780 19.91491  -18.41448 1.000 36.14485  ? 96  HIS A O     1 
ATOM   750  C  CB    . HIS A 1 97  ? 48.66033 20.92407  -20.65593 1.000 36.79367  ? 96  HIS A CB    1 
ATOM   751  C  CG    . HIS A 1 97  ? 49.50582 21.55023  -21.70783 1.000 35.24392  ? 96  HIS A CG    1 
ATOM   752  N  ND1   . HIS A 1 97  ? 50.74032 22.09703  -21.42948 1.000 34.33029  ? 96  HIS A ND1   1 
ATOM   753  C  CD2   . HIS A 1 97  ? 49.35371 21.61142  -23.05080 1.000 33.12693  ? 96  HIS A CD2   1 
ATOM   754  C  CE1   . HIS A 1 97  ? 51.29148 22.51160  -22.55513 1.000 38.76463  ? 96  HIS A CE1   1 
ATOM   755  N  NE2   . HIS A 1 97  ? 50.47045 22.23024  -23.55325 1.000 38.66838  ? 96  HIS A NE2   1 
ATOM   756  N  N     . PRO A 1 98  ? 51.57361 19.24301  -20.29544 1.000 34.07780  ? 97  PRO A N     1 
ATOM   757  C  CA    . PRO A 1 98  ? 52.88930 19.22938  -19.61926 1.000 36.45813  ? 97  PRO A CA    1 
ATOM   758  C  C     . PRO A 1 98  ? 53.22793 20.53502  -18.91096 1.000 38.86005  ? 97  PRO A C     1 
ATOM   759  O  O     . PRO A 1 98  ? 53.80826 20.48751  -17.82112 1.000 40.57649  ? 97  PRO A O     1 
ATOM   760  C  CB    . PRO A 1 98  ? 53.88172 18.92005  -20.75556 1.000 32.50612  ? 97  PRO A CB    1 
ATOM   761  C  CG    . PRO A 1 98  ? 53.16811 19.22433  -22.01711 1.000 35.24492  ? 97  PRO A CG    1 
ATOM   762  C  CD    . PRO A 1 98  ? 51.68557 18.99478  -21.73722 1.000 36.07469  ? 97  PRO A CD    1 
ATOM   763  N  N     . ALA A 1 99  ? 52.85778 21.69557  -19.46871 1.000 35.68867  ? 98  ALA A N     1 
ATOM   764  C  CA    . ALA A 1 99  ? 53.15610 22.96021  -18.79517 1.000 37.21203  ? 98  ALA A CA    1 
ATOM   765  C  C     . ALA A 1 99  ? 52.54112 23.06037  -17.40325 1.000 38.74466  ? 98  ALA A C     1 
ATOM   766  O  O     . ALA A 1 99  ? 52.93470 23.94661  -16.63336 1.000 34.31899  ? 98  ALA A O     1 
ATOM   767  C  CB    . ALA A 1 99  ? 52.66821 24.14359  -19.62682 1.000 38.13514  ? 98  ALA A CB    1 
ATOM   768  N  N     . GLY A 1 100 ? 51.57426 22.19716  -17.07235 1.000 34.90430  ? 99  GLY A N     1 
ATOM   769  C  CA    . GLY A 1 100 ? 50.97711 22.20607  -15.75996 1.000 28.15965  ? 99  GLY A CA    1 
ATOM   770  C  C     . GLY A 1 100 ? 51.67375 21.33832  -14.75174 1.000 31.43180  ? 99  GLY A C     1 
ATOM   771  O  O     . GLY A 1 100 ? 51.36210 21.42143  -13.56900 1.000 36.30231  ? 99  GLY A O     1 
ATOM   772  N  N     . LEU A 1 101 ? 52.61419 20.50825  -15.18712 1.000 31.97118  ? 100 LEU A N     1 
ATOM   773  C  CA    . LEU A 1 101 ? 53.39336 19.67996  -14.28233 1.000 26.08192  ? 100 LEU A CA    1 
ATOM   774  C  C     . LEU A 1 101 ? 54.41707 20.50000  -13.50577 1.000 29.73151  ? 100 LEU A C     1 
ATOM   775  O  O     . LEU A 1 101 ? 55.00237 21.45771  -14.01320 1.000 37.23217  ? 100 LEU A O     1 
ATOM   776  C  CB    . LEU A 1 101 ? 54.11632 18.60024  -15.07376 1.000 30.15527  ? 100 LEU A CB    1 
ATOM   777  C  CG    . LEU A 1 101 ? 53.22637 17.72979  -15.95897 1.000 33.21262  ? 100 LEU A CG    1 
ATOM   778  C  CD1   . LEU A 1 101 ? 54.08832 16.93116  -16.89452 1.000 34.42638  ? 100 LEU A CD1   1 
ATOM   779  C  CD2   . LEU A 1 101 ? 52.33579 16.80556  -15.11387 1.000 30.83833  ? 100 LEU A CD2   1 
ATOM   780  N  N     . LYS A 1 102 ? 54.64985 20.09919  -12.26846 1.000 33.89940  ? 101 LYS A N     1 
ATOM   781  C  CA    . LYS A 1 102 ? 55.65158 20.70277  -11.40150 1.000 34.20095  ? 101 LYS A CA    1 
ATOM   782  C  C     . LYS A 1 102 ? 56.92050 19.85618  -11.39340 1.000 38.64324  ? 101 LYS A C     1 
ATOM   783  O  O     . LYS A 1 102 ? 56.87157 18.64322  -11.60205 1.000 44.81987  ? 101 LYS A O     1 
ATOM   784  C  CB    . LYS A 1 102 ? 55.09605 20.83055  -9.98630  1.000 35.91224  ? 101 LYS A CB    1 
ATOM   785  C  CG    . LYS A 1 102 ? 53.78269 21.60130  -9.92248  1.000 38.73460  ? 101 LYS A CG    1 
ATOM   786  C  CD    . LYS A 1 102 ? 53.03917 21.36106  -8.62443  1.000 39.39181  ? 101 LYS A CD    1 
ATOM   787  C  CE    . LYS A 1 102 ? 51.90333 22.35356  -8.47381  1.000 41.93152  ? 101 LYS A CE    1 
ATOM   788  N  NZ    . LYS A 1 102 ? 51.68217 22.73620  -7.03970  1.000 47.70988  ? 101 LYS A NZ    1 
ATOM   789  N  N     . LYS A 1 103 ? 58.06372 20.50145  -11.17012 1.000 40.32545  ? 102 LYS A N     1 
ATOM   790  C  CA    . LYS A 1 103 ? 59.31805 19.76083  -11.10610 1.000 39.49888  ? 102 LYS A CA    1 
ATOM   791  C  C     . LYS A 1 103 ? 59.22422 18.67069  -10.04252 1.000 46.25879  ? 102 LYS A C     1 
ATOM   792  O  O     . LYS A 1 103 ? 58.64550 18.87063  -8.97035  1.000 44.74122  ? 102 LYS A O     1 
ATOM   793  C  CB    . LYS A 1 103 ? 60.48797 20.69872  -10.80789 1.000 31.18735  ? 102 LYS A CB    1 
ATOM   794  N  N     . LYS A 1 104 ? 59.76399 17.49531  -10.35972 1.000 46.83870  ? 103 LYS A N     1 
ATOM   795  C  CA    . LYS A 1 104 ? 59.67676 16.33412  -9.48516  1.000 42.71154  ? 103 LYS A CA    1 
ATOM   796  C  C     . LYS A 1 104 ? 61.03918 15.67713  -9.38914  1.000 42.13852  ? 103 LYS A C     1 
ATOM   797  O  O     . LYS A 1 104 ? 61.77246 15.60998  -10.37757 1.000 40.25534  ? 103 LYS A O     1 
ATOM   798  C  CB    . LYS A 1 104 ? 58.65329 15.31315  -10.00981 1.000 40.07300  ? 103 LYS A CB    1 
ATOM   799  C  CG    . LYS A 1 104 ? 57.20954 15.72624  -9.80326  1.000 41.12461  ? 103 LYS A CG    1 
ATOM   800  C  CD    . LYS A 1 104 ? 56.87219 15.69517  -8.32811  1.000 43.71676  ? 103 LYS A CD    1 
ATOM   801  C  CE    . LYS A 1 104 ? 55.69315 16.57810  -8.00638  1.000 41.56547  ? 103 LYS A CE    1 
ATOM   802  N  NZ    . LYS A 1 104 ? 55.71243 16.92814  -6.57010  1.000 51.05397  ? 103 LYS A NZ    1 
ATOM   803  N  N     . LYS A 1 105 ? 61.37282 15.16424  -8.20729  1.000 46.01014  ? 104 LYS A N     1 
ATOM   804  C  CA    . LYS A 1 105 ? 62.66795 14.50591  -8.07901  1.000 42.95428  ? 104 LYS A CA    1 
ATOM   805  C  C     . LYS A 1 105 ? 62.70865 13.20754  -8.87628  1.000 38.90823  ? 104 LYS A C     1 
ATOM   806  O  O     . LYS A 1 105 ? 63.70222 12.92659  -9.55595  1.000 38.61927  ? 104 LYS A O     1 
ATOM   807  C  CB    . LYS A 1 105 ? 63.00567 14.25863  -6.61504  1.000 40.04536  ? 104 LYS A CB    1 
ATOM   808  C  CG    . LYS A 1 105 ? 64.49191 14.03570  -6.41769  1.000 48.47169  ? 104 LYS A CG    1 
ATOM   809  C  CD    . LYS A 1 105 ? 64.84669 13.78193  -4.95111  1.000 56.15632  ? 104 LYS A CD    1 
ATOM   810  C  CE    . LYS A 1 105 ? 66.34943 13.66427  -4.77889  1.000 54.67562  ? 104 LYS A CE    1 
ATOM   811  N  NZ    . LYS A 1 105 ? 67.04003 14.75495  -5.53173  1.000 57.58776  ? 104 LYS A NZ    1 
ATOM   812  N  N     . SER A 1 106 ? 61.62946 12.42376  -8.84304  1.000 38.54787  ? 105 SER A N     1 
ATOM   813  C  CA    . SER A 1 106 ? 61.58928 11.14352  -9.53410  1.000 34.56108  ? 105 SER A CA    1 
ATOM   814  C  C     . SER A 1 106 ? 60.27864 10.96932  -10.28897 1.000 35.33854  ? 105 SER A C     1 
ATOM   815  O  O     . SER A 1 106 ? 59.20996 11.35581  -9.80032  1.000 37.81999  ? 105 SER A O     1 
ATOM   816  C  CB    . SER A 1 106 ? 61.75462 10.00244  -8.55348  1.000 39.29383  ? 105 SER A CB    1 
ATOM   817  O  OG    . SER A 1 106 ? 62.91728 10.13815  -7.76776  1.000 42.69398  ? 105 SER A OG    1 
ATOM   818  N  N     . VAL A 1 107 ? 60.36444 10.33120  -11.45402 1.000 30.93001  ? 106 VAL A N     1 
ATOM   819  C  CA    . VAL A 1 107 ? 59.25673 10.23479  -12.39866 1.000 34.23308  ? 106 VAL A CA    1 
ATOM   820  C  C     . VAL A 1 107 ? 59.19491 8.83160   -12.99601 1.000 36.09727  ? 106 VAL A C     1 
ATOM   821  O  O     . VAL A 1 107 ? 60.22607 8.22732   -13.31468 1.000 33.65030  ? 106 VAL A O     1 
ATOM   822  C  CB    . VAL A 1 107 ? 59.40533 11.27452  -13.52913 1.000 40.25922  ? 106 VAL A CB    1 
ATOM   823  C  CG1   . VAL A 1 107 ? 58.53406 10.88656  -14.74197 1.000 36.06714  ? 106 VAL A CG1   1 
ATOM   824  C  CG2   . VAL A 1 107 ? 59.10397 12.69338  -13.02014 1.000 32.94536  ? 106 VAL A CG2   1 
ATOM   825  N  N     . THR A 1 108 ? 57.97686 8.32741   -13.17702 1.000 35.40903  ? 107 THR A N     1 
ATOM   826  C  CA    . THR A 1 108 ? 57.74412 7.06388   -13.85927 1.000 34.69471  ? 107 THR A CA    1 
ATOM   827  C  C     . THR A 1 108 ? 56.50177 7.18228   -14.72105 1.000 36.89671  ? 107 THR A C     1 
ATOM   828  O  O     . THR A 1 108 ? 55.50211 7.74783   -14.28604 1.000 38.24580  ? 107 THR A O     1 
ATOM   829  C  CB    . THR A 1 108 ? 57.55420 5.91264   -12.87964 1.000 32.73843  ? 107 THR A CB    1 
ATOM   830  O  OG1   . THR A 1 108 ? 58.59244 5.94777   -11.89878 1.000 34.82171  ? 107 THR A OG1   1 
ATOM   831  C  CG2   . THR A 1 108 ? 57.61961 4.59310   -13.62155 1.000 35.85566  ? 107 THR A CG2   1 
ATOM   832  N  N     . VAL A 1 109 ? 56.55566 6.65330   -15.93885 1.000 36.52037  ? 108 VAL A N     1 
ATOM   833  C  CA    . VAL A 1 109 ? 55.37535 6.53309   -16.78712 1.000 33.52379  ? 108 VAL A CA    1 
ATOM   834  C  C     . VAL A 1 109 ? 55.11693 5.05579   -17.00188 1.000 37.38536  ? 108 VAL A C     1 
ATOM   835  O  O     . VAL A 1 109 ? 56.05249 4.28014   -17.22483 1.000 38.51058  ? 108 VAL A O     1 
ATOM   836  C  CB    . VAL A 1 109 ? 55.53677 7.25340   -18.13591 1.000 34.98639  ? 108 VAL A CB    1 
ATOM   837  C  CG1   . VAL A 1 109 ? 54.32753 7.00166   -18.99623 1.000 36.14226  ? 108 VAL A CG1   1 
ATOM   838  C  CG2   . VAL A 1 109 ? 55.73036 8.75796   -17.92685 1.000 35.76958  ? 108 VAL A CG2   1 
ATOM   839  N  N     . LEU A 1 110 ? 53.85425 4.65462   -16.90767 1.000 40.74931  ? 109 LEU A N     1 
ATOM   840  C  CA    . LEU A 1 110 ? 53.54527 3.25654   -17.16087 1.000 35.06493  ? 109 LEU A CA    1 
ATOM   841  C  C     . LEU A 1 110 ? 52.11432 3.12198   -17.66625 1.000 39.67578  ? 109 LEU A C     1 
ATOM   842  O  O     . LEU A 1 110 ? 51.28984 4.02671   -17.52055 1.000 38.66118  ? 109 LEU A O     1 
ATOM   843  C  CB    . LEU A 1 110 ? 53.82200 2.39985   -15.92258 1.000 34.92405  ? 109 LEU A CB    1 
ATOM   844  C  CG    . LEU A 1 110 ? 53.27070 2.71297   -14.54006 1.000 35.17668  ? 109 LEU A CG    1 
ATOM   845  C  CD1   . LEU A 1 110 ? 51.81991 2.36129   -14.49472 1.000 40.53666  ? 109 LEU A CD1   1 
ATOM   846  C  CD2   . LEU A 1 110 ? 54.01924 1.92618   -13.49120 1.000 33.26037  ? 109 LEU A CD2   1 
ATOM   847  N  N     . ASP A 1 111 ? 51.85120 1.98957   -18.32218 1.000 39.81679  ? 110 ASP A N     1 
ATOM   848  C  CA    . ASP A 1 111 ? 50.60923 1.74697   -19.04113 1.000 37.42619  ? 110 ASP A CA    1 
ATOM   849  C  C     . ASP A 1 111 ? 50.06754 0.40355   -18.59453 1.000 39.13168  ? 110 ASP A C     1 
ATOM   850  O  O     . ASP A 1 111 ? 50.83826 -0.51492  -18.30499 1.000 41.43847  ? 110 ASP A O     1 
ATOM   851  C  CB    . ASP A 1 111 ? 50.83378 1.74665   -20.57889 1.000 38.29880  ? 110 ASP A CB    1 
ATOM   852  C  CG    . ASP A 1 111 ? 49.52942 1.72018   -21.37739 1.000 42.06319  ? 110 ASP A CG    1 
ATOM   853  O  OD1   . ASP A 1 111 ? 48.75692 2.70275   -21.31196 1.000 52.35746  ? 110 ASP A OD1   1 
ATOM   854  O  OD2   . ASP A 1 111 ? 49.27188 0.73817   -22.09719 1.000 41.16161  ? 110 ASP A OD2   1 
ATOM   855  N  N     . VAL A 1 112 ? 48.74686 0.29041   -18.53069 1.000 39.90093  ? 111 VAL A N     1 
ATOM   856  C  CA    . VAL A 1 112 ? 48.10232 -0.96654  -18.15297 1.000 40.52291  ? 111 VAL A CA    1 
ATOM   857  C  C     . VAL A 1 112 ? 47.93208 -1.84097  -19.39000 1.000 41.18882  ? 111 VAL A C     1 
ATOM   858  O  O     . VAL A 1 112 ? 47.62960 -1.34402  -20.48789 1.000 42.19064  ? 111 VAL A O     1 
ATOM   859  C  CB    . VAL A 1 112 ? 46.74985 -0.70255  -17.47336 1.000 43.48438  ? 111 VAL A CB    1 
ATOM   860  C  CG1   . VAL A 1 112 ? 46.02074 -1.99065  -17.22229 1.000 37.40133  ? 111 VAL A CG1   1 
ATOM   861  C  CG2   . VAL A 1 112 ? 46.95676 0.04118   -16.16429 1.000 47.65408  ? 111 VAL A CG2   1 
ATOM   862  N  N     . GLY A 1 113 ? 48.14434 -3.14530  -19.22116 1.000 36.26751  ? 112 GLY A N     1 
ATOM   863  C  CA    . GLY A 1 113 ? 48.03558 -4.08062  -20.32006 1.000 32.10808  ? 112 GLY A CA    1 
ATOM   864  C  C     . GLY A 1 113 ? 46.60530 -4.55105  -20.45864 1.000 38.50384  ? 112 GLY A C     1 
ATOM   865  O  O     . GLY A 1 113 ? 45.95942 -4.90414  -19.46579 1.000 40.19742  ? 112 GLY A O     1 
ATOM   866  N  N     . ASP A 1 114 ? 46.10890 -4.53644  -21.69454 1.000 38.83242  ? 113 ASP A N     1 
ATOM   867  C  CA    . ASP A 1 114 ? 44.74209 -4.94014  -22.02038 1.000 40.30157  ? 113 ASP A CA    1 
ATOM   868  C  C     . ASP A 1 114 ? 43.73474 -4.32163  -21.05473 1.000 39.87954  ? 113 ASP A C     1 
ATOM   869  O  O     . ASP A 1 114 ? 42.84640 -4.98958  -20.51981 1.000 40.52464  ? 113 ASP A O     1 
ATOM   870  C  CB    . ASP A 1 114 ? 44.63052 -6.46312  -22.05213 1.000 39.73389  ? 113 ASP A CB    1 
ATOM   871  C  CG    . ASP A 1 114 ? 45.26621 -7.04912  -23.29286 1.000 50.87950  ? 113 ASP A CG    1 
ATOM   872  O  OD1   . ASP A 1 114 ? 44.95306 -6.52695  -24.39837 1.000 48.33955  ? 113 ASP A OD1   1 
ATOM   873  O  OD2   . ASP A 1 114 ? 46.10254 -7.98637  -23.16536 1.000 50.73611  ? 113 ASP A OD2   1 
ATOM   874  N  N     . ALA A 1 115 ? 43.87491 -3.00745  -20.86817 1.000 37.17421  ? 114 ALA A N     1 
ATOM   875  C  CA    . ALA A 1 115 ? 43.13004 -2.27486  -19.84843 1.000 38.82495  ? 114 ALA A CA    1 
ATOM   876  C  C     . ALA A 1 115 ? 41.63774 -2.60700  -19.86001 1.000 38.58314  ? 114 ALA A C     1 
ATOM   877  O  O     . ALA A 1 115 ? 41.08687 -3.06016  -18.84998 1.000 34.71191  ? 114 ALA A O     1 
ATOM   878  C  CB    . ALA A 1 115 ? 43.34722 -0.77381  -20.04292 1.000 37.99920  ? 114 ALA A CB    1 
ATOM   879  N  N     . TYR A 1 116 ? 40.96480 -2.36409  -20.99387 1.000 37.52352  ? 115 TYR A N     1 
ATOM   880  C  CA    . TYR A 1 116 ? 39.53047 -2.62621  -21.08079 1.000 34.35938  ? 115 TYR A CA    1 
ATOM   881  C  C     . TYR A 1 116 ? 39.21932 -4.07670  -20.74460 1.000 40.43392  ? 115 TYR A C     1 
ATOM   882  O  O     . TYR A 1 116 ? 38.21537 -4.38120  -20.08315 1.000 37.65857  ? 115 TYR A O     1 
ATOM   883  C  CB    . TYR A 1 116 ? 39.00834 -2.32235  -22.47840 1.000 30.47045  ? 115 TYR A CB    1 
ATOM   884  C  CG    . TYR A 1 116 ? 38.71139 -0.87389  -22.78594 1.000 39.11640  ? 115 TYR A CG    1 
ATOM   885  C  CD1   . TYR A 1 116 ? 39.28989 0.15947   -22.06458 1.000 40.78891  ? 115 TYR A CD1   1 
ATOM   886  C  CD2   . TYR A 1 116 ? 37.84037 -0.53875  -23.81588 1.000 42.85927  ? 115 TYR A CD2   1 
ATOM   887  C  CE1   . TYR A 1 116 ? 39.01013 1.48672   -22.36834 1.000 41.24984  ? 115 TYR A CE1   1 
ATOM   888  C  CE2   . TYR A 1 116 ? 37.56253 0.76951   -24.11980 1.000 43.36896  ? 115 TYR A CE2   1 
ATOM   889  C  CZ    . TYR A 1 116 ? 38.14475 1.78153   -23.39781 1.000 41.91303  ? 115 TYR A CZ    1 
ATOM   890  O  OH    . TYR A 1 116 ? 37.85025 3.08720   -23.72199 1.000 40.94490  ? 115 TYR A OH    1 
ATOM   891  N  N     . PHE A 1 117 ? 40.06592 -4.98763  -21.18960 1.000 37.58261  ? 116 PHE A N     1 
ATOM   892  C  CA    . PHE A 1 117 ? 39.72975 -6.38689  -21.05596 1.000 36.33982  ? 116 PHE A CA    1 
ATOM   893  C  C     . PHE A 1 117 ? 39.92655 -6.87924  -19.64050 1.000 40.65185  ? 116 PHE A C     1 
ATOM   894  O  O     . PHE A 1 117 ? 39.79365 -8.08832  -19.39898 1.000 40.01331  ? 116 PHE A O     1 
ATOM   895  C  CB    . PHE A 1 117 ? 40.54523 -7.20367  -22.05908 1.000 36.05406  ? 116 PHE A CB    1 
ATOM   896  C  CG    . PHE A 1 117 ? 40.22606 -6.87791  -23.49965 1.000 37.57112  ? 116 PHE A CG    1 
ATOM   897  C  CD1   . PHE A 1 117 ? 39.04440 -6.23150  -23.83648 1.000 37.07307  ? 116 PHE A CD1   1 
ATOM   898  C  CD2   . PHE A 1 117 ? 41.09872 -7.21952  -24.51408 1.000 36.16719  ? 116 PHE A CD2   1 
ATOM   899  C  CE1   . PHE A 1 117 ? 38.74985 -5.94333  -25.15133 1.000 38.49897  ? 116 PHE A CE1   1 
ATOM   900  C  CE2   . PHE A 1 117 ? 40.80159 -6.93271  -25.82465 1.000 30.50866  ? 116 PHE A CE2   1 
ATOM   901  C  CZ    . PHE A 1 117 ? 39.63050 -6.29985  -26.14354 1.000 35.41965  ? 116 PHE A CZ    1 
ATOM   902  N  N     . SER A 1 118 ? 40.22289 -5.96566  -18.70753 1.000 34.61179  ? 117 SER A N     1 
ATOM   903  C  CA    . SER A 1 118 ? 40.36371 -6.29529  -17.29407 1.000 34.76617  ? 117 SER A CA    1 
ATOM   904  C  C     . SER A 1 118 ? 39.22104 -5.75991  -16.45652 1.000 32.38125  ? 117 SER A C     1 
ATOM   905  O  O     . SER A 1 118 ? 39.25724 -5.87841  -15.23340 1.000 36.60735  ? 117 SER A O     1 
ATOM   906  C  CB    . SER A 1 118 ? 41.68213 -5.76200  -16.72390 1.000 33.48809  ? 117 SER A CB    1 
ATOM   907  O  OG    . SER A 1 118 ? 42.80527 -6.43889  -17.26518 1.000 41.76526  ? 117 SER A OG    1 
ATOM   908  N  N     . VAL A 1 119 ? 38.20693 -5.17351  -17.06575 1.000 30.07622  ? 118 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 119 ? 37.15336 -4.52948  -16.30054 1.000 35.48824  ? 118 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 119 ? 35.83084 -5.19767  -16.64468 1.000 37.11855  ? 118 VAL A C     1 
ATOM   911  O  O     . VAL A 1 119 ? 35.41344 -5.18580  -17.80700 1.000 39.47775  ? 118 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 119 ? 37.10087 -3.01643  -16.55895 1.000 38.02897  ? 118 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 119 ? 35.86757 -2.42149  -15.88595 1.000 36.12617  ? 118 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 119 ? 38.39017 -2.38232  -16.05329 1.000 25.92650  ? 118 VAL A CG2   1 
ATOM   915  N  N     . PRO A 1 120 ? 35.15092 -5.80186  -15.67761 1.000 41.07106  ? 119 PRO A N     1 
ATOM   916  C  CA    . PRO A 1 120 ? 33.97623 -6.61487  -16.00234 1.000 36.91716  ? 119 PRO A CA    1 
ATOM   917  C  C     . PRO A 1 120 ? 32.85385 -5.73929  -16.52806 1.000 35.10540  ? 119 PRO A C     1 
ATOM   918  O  O     . PRO A 1 120 ? 32.71212 -4.57696  -16.14454 1.000 31.57881  ? 119 PRO A O     1 
ATOM   919  C  CB    . PRO A 1 120 ? 33.61372 -7.25480  -14.65741 1.000 33.41158  ? 119 PRO A CB    1 
ATOM   920  C  CG    . PRO A 1 120 ? 34.08023 -6.25265  -13.63977 1.000 34.85642  ? 119 PRO A CG    1 
ATOM   921  C  CD    . PRO A 1 120 ? 35.33135 -5.62718  -14.22222 1.000 37.35747  ? 119 PRO A CD    1 
ATOM   922  N  N     . LEU A 1 121 ? 32.07889 -6.31022  -17.44028 1.000 38.75108  ? 120 LEU A N     1 
ATOM   923  C  CA    . LEU A 1 121 ? 30.87518 -5.69986  -17.97838 1.000 35.42022  ? 120 LEU A CA    1 
ATOM   924  C  C     . LEU A 1 121 ? 29.66286 -6.26683  -17.25375 1.000 40.13000  ? 120 LEU A C     1 
ATOM   925  O  O     . LEU A 1 121 ? 29.63413 -7.45243  -16.91705 1.000 42.08396  ? 120 LEU A O     1 
ATOM   926  C  CB    . LEU A 1 121 ? 30.75212 -5.96140  -19.47940 1.000 38.74925  ? 120 LEU A CB    1 
ATOM   927  C  CG    . LEU A 1 121 ? 29.46857 -5.48732  -20.17359 1.000 42.44873  ? 120 LEU A CG    1 
ATOM   928  C  CD1   . LEU A 1 121 ? 29.42192 -3.96751  -20.29123 1.000 37.87405  ? 120 LEU A CD1   1 
ATOM   929  C  CD2   . LEU A 1 121 ? 29.32818 -6.12277  -21.53170 1.000 39.73409  ? 120 LEU A CD2   1 
ATOM   930  N  N     . ASP A 1 122 ? 28.67884 -5.40136  -17.00248 1.000 43.35453  ? 121 ASP A N     1 
ATOM   931  C  CA    . ASP A 1 122 ? 27.41217 -5.77445  -16.37958 1.000 43.83304  ? 121 ASP A CA    1 
ATOM   932  C  C     . ASP A 1 122 ? 26.82483 -7.01469  -17.03135 1.000 43.24025  ? 121 ASP A C     1 
ATOM   933  O  O     . ASP A 1 122 ? 26.66102 -7.05884  -18.25002 1.000 47.01484  ? 121 ASP A O     1 
ATOM   934  C  CB    . ASP A 1 122 ? 26.44640 -4.59472  -16.51324 1.000 45.76574  ? 121 ASP A CB    1 
ATOM   935  C  CG    . ASP A 1 122 ? 25.02771 -4.91661  -16.08782 1.000 49.10683  ? 121 ASP A CG    1 
ATOM   936  O  OD1   . ASP A 1 122 ? 24.71029 -6.05442  -15.69582 1.000 54.27359  ? 121 ASP A OD1   1 
ATOM   937  O  OD2   . ASP A 1 122 ? 24.20026 -3.99347  -16.13654 1.000 54.62240  ? 121 ASP A OD2   1 
ATOM   938  N  N     . GLU A 1 123 ? 26.46354 -8.00238  -16.20101 1.000 42.92165  ? 122 GLU A N     1 
ATOM   939  C  CA    . GLU A 1 123 ? 25.96873 -9.28514  -16.71224 1.000 48.21425  ? 122 GLU A CA    1 
ATOM   940  C  C     . GLU A 1 123 ? 24.69242 -9.12704  -17.53443 1.000 50.03919  ? 122 GLU A C     1 
ATOM   941  O  O     . GLU A 1 123 ? 24.52983 -9.78488  -18.57119 1.000 47.46609  ? 122 GLU A O     1 
ATOM   942  C  CB    . GLU A 1 123 ? 25.71705 -10.25610 -15.56156 1.000 46.50602  ? 122 GLU A CB    1 
ATOM   943  C  CG    . GLU A 1 123 ? 26.94097 -10.54967 -14.72409 1.000 60.01793  ? 122 GLU A CG    1 
ATOM   944  C  CD    . GLU A 1 123 ? 26.63426 -11.48682 -13.56361 1.000 79.82099  ? 122 GLU A CD    1 
ATOM   945  O  OE1   . GLU A 1 123 ? 25.59713 -12.19059 -13.63461 1.000 80.79806  ? 122 GLU A OE1   1 
ATOM   946  O  OE2   . GLU A 1 123 ? 27.42247 -11.51455 -12.58293 1.000 81.37787  ? 122 GLU A OE2   1 
ATOM   947  N  N     . ASP A 1 124 ? 23.76781 -8.27093  -17.08240 1.000 50.53883  ? 123 ASP A N     1 
ATOM   948  C  CA    . ASP A 1 124 ? 22.49007 -8.12426  -17.77351 1.000 47.38507  ? 123 ASP A CA    1 
ATOM   949  C  C     . ASP A 1 124 ? 22.67231 -7.62348  -19.19204 1.000 46.64934  ? 123 ASP A C     1 
ATOM   950  O  O     . ASP A 1 124 ? 21.84726 -7.90908  -20.06547 1.000 50.02373  ? 123 ASP A O     1 
ATOM   951  C  CB    . ASP A 1 124 ? 21.57598 -7.17045  -17.01009 1.000 52.75329  ? 123 ASP A CB    1 
ATOM   952  C  CG    . ASP A 1 124 ? 20.98763 -7.79732  -15.76340 1.000 62.24726  ? 123 ASP A CG    1 
ATOM   953  O  OD1   . ASP A 1 124 ? 20.77071 -9.03721  -15.75443 1.000 60.01321  ? 123 ASP A OD1   1 
ATOM   954  O  OD2   . ASP A 1 124 ? 20.73737 -7.03983  -14.79495 1.000 61.51593  ? 123 ASP A OD2   1 
ATOM   955  N  N     . PHE A 1 125 ? 23.73543 -6.87906  -19.43860 1.000 46.26457  ? 124 PHE A N     1 
ATOM   956  C  CA    . PHE A 1 125 ? 23.96954 -6.25686  -20.72722 1.000 43.92650  ? 124 PHE A CA    1 
ATOM   957  C  C     . PHE A 1 125 ? 24.82964 -7.12130  -21.63840 1.000 41.72209  ? 124 PHE A C     1 
ATOM   958  O  O     . PHE A 1 125 ? 24.86341 -6.87500  -22.84466 1.000 47.70332  ? 124 PHE A O     1 
ATOM   959  C  CB    . PHE A 1 125 ? 24.61409 -4.87956  -20.48495 1.000 42.22460  ? 124 PHE A CB    1 
ATOM   960  C  CG    . PHE A 1 125 ? 24.56509 -3.94968  -21.64817 1.000 37.18799  ? 124 PHE A CG    1 
ATOM   961  C  CD1   . PHE A 1 125 ? 23.53358 -3.03640  -21.77744 1.000 47.37098  ? 124 PHE A CD1   1 
ATOM   962  C  CD2   . PHE A 1 125 ? 25.58188 -3.93536  -22.58322 1.000 41.98901  ? 124 PHE A CD2   1 
ATOM   963  C  CE1   . PHE A 1 125 ? 23.49387 -2.14210  -22.83741 1.000 42.84008  ? 124 PHE A CE1   1 
ATOM   964  C  CE2   . PHE A 1 125 ? 25.54886 -3.04750  -23.65042 1.000 45.75177  ? 124 PHE A CE2   1 
ATOM   965  C  CZ    . PHE A 1 125 ? 24.49890 -2.14859  -23.77375 1.000 43.25988  ? 124 PHE A CZ    1 
ATOM   966  N  N     . ARG A 1 126 ? 25.47519 -8.15886  -21.10496 1.000 39.76255  ? 125 ARG A N     1 
ATOM   967  C  CA    . ARG A 1 126 ? 26.47511 -8.89532  -21.87790 1.000 44.81485  ? 125 ARG A CA    1 
ATOM   968  C  C     . ARG A 1 126 ? 25.91718 -9.46607  -23.17103 1.000 46.07702  ? 125 ARG A C     1 
ATOM   969  O  O     . ARG A 1 126 ? 26.65633 -9.60037  -24.15358 1.000 47.42048  ? 125 ARG A O     1 
ATOM   970  C  CB    . ARG A 1 126 ? 27.07544 -10.01735 -21.03120 1.000 42.64707  ? 125 ARG A CB    1 
ATOM   971  C  CG    . ARG A 1 126 ? 27.88070 -9.48182  -19.87245 1.000 45.29724  ? 125 ARG A CG    1 
ATOM   972  C  CD    . ARG A 1 126 ? 28.55083 -10.55117 -19.08330 1.000 44.95290  ? 125 ARG A CD    1 
ATOM   973  N  NE    . ARG A 1 126 ? 29.03746 -10.03096 -17.81280 1.000 46.35199  ? 125 ARG A NE    1 
ATOM   974  C  CZ    . ARG A 1 126 ? 29.81032 -10.72344 -16.98841 1.000 45.53375  ? 125 ARG A CZ    1 
ATOM   975  N  NH1   . ARG A 1 126 ? 30.17719 -11.94981 -17.32004 1.000 44.43302  ? 125 ARG A NH1   1 
ATOM   976  N  NH2   . ARG A 1 126 ? 30.22145 -10.19444 -15.84848 1.000 42.66280  ? 125 ARG A NH2   1 
ATOM   977  N  N     . LYS A 1 127 ? 24.62447 -9.79816  -23.20224 1.000 48.25217  ? 126 LYS A N     1 
ATOM   978  C  CA    . LYS A 1 127 ? 24.09085 -10.49346 -24.36790 1.000 48.34742  ? 126 LYS A CA    1 
ATOM   979  C  C     . LYS A 1 127 ? 24.06059 -9.59965  -25.59763 1.000 51.84362  ? 126 LYS A C     1 
ATOM   980  O  O     . LYS A 1 127 ? 24.17356 -10.09820 -26.72341 1.000 54.00423  ? 126 LYS A O     1 
ATOM   981  C  CB    . LYS A 1 127 ? 22.69351 -11.03943 -24.07626 1.000 54.31225  ? 126 LYS A CB    1 
ATOM   982  C  CG    . LYS A 1 127 ? 21.77746 -10.10931 -23.31463 1.000 51.19200  ? 126 LYS A CG    1 
ATOM   983  C  CD    . LYS A 1 127 ? 20.39102 -10.73042 -23.15874 1.000 47.41598  ? 126 LYS A CD    1 
ATOM   984  C  CE    . LYS A 1 127 ? 19.57641 -9.97424  -22.12044 1.000 56.61451  ? 126 LYS A CE    1 
ATOM   985  N  NZ    . LYS A 1 127 ? 18.16347 -10.43715 -22.04145 1.000 65.12716  ? 126 LYS A NZ    1 
ATOM   986  N  N     . TYR A 1 128 ? 23.92499 -8.28709  -25.41310 1.000 48.39641  ? 127 TYR A N     1 
ATOM   987  C  CA    . TYR A 1 128 ? 23.90991 -7.38926  -26.56072 1.000 50.42489  ? 127 TYR A CA    1 
ATOM   988  C  C     . TYR A 1 128 ? 25.25090 -7.29666  -27.26400 1.000 45.67809  ? 127 TYR A C     1 
ATOM   989  O  O     . TYR A 1 128 ? 25.29658 -6.76589  -28.37723 1.000 50.49534  ? 127 TYR A O     1 
ATOM   990  C  CB    . TYR A 1 128 ? 23.44752 -6.00189  -26.12794 1.000 44.54643  ? 127 TYR A CB    1 
ATOM   991  C  CG    . TYR A 1 128 ? 22.12490 -6.06823  -25.41062 1.000 48.08416  ? 127 TYR A CG    1 
ATOM   992  C  CD1   . TYR A 1 128 ? 21.07793 -6.80884  -25.93095 1.000 47.67743  ? 127 TYR A CD1   1 
ATOM   993  C  CD2   . TYR A 1 128 ? 21.93663 -5.42896  -24.19218 1.000 50.58939  ? 127 TYR A CD2   1 
ATOM   994  C  CE1   . TYR A 1 128 ? 19.87897 -6.89693  -25.27606 1.000 50.65129  ? 127 TYR A CE1   1 
ATOM   995  C  CE2   . TYR A 1 128 ? 20.73188 -5.50885  -23.52663 1.000 51.65542  ? 127 TYR A CE2   1 
ATOM   996  C  CZ    . TYR A 1 128 ? 19.70728 -6.24684  -24.07277 1.000 52.77343  ? 127 TYR A CZ    1 
ATOM   997  O  OH    . TYR A 1 128 ? 18.50584 -6.33342  -23.41071 1.000 52.81876  ? 127 TYR A OH    1 
ATOM   998  N  N     . THR A 1 129 ? 26.32764 -7.79691  -26.66584 1.000 41.09924  ? 128 THR A N     1 
ATOM   999  C  CA    . THR A 1 129 ? 27.64383 -7.67058  -27.27699 1.000 50.10093  ? 128 THR A CA    1 
ATOM   1000 C  C     . THR A 1 129 ? 27.97282 -8.83629  -28.19406 1.000 48.96801  ? 128 THR A C     1 
ATOM   1001 O  O     . THR A 1 129 ? 29.13684 -8.99158  -28.58547 1.000 45.71489  ? 128 THR A O     1 
ATOM   1002 C  CB    . THR A 1 129 ? 28.74355 -7.53782  -26.21492 1.000 48.50542  ? 128 THR A CB    1 
ATOM   1003 O  OG1   . THR A 1 129 ? 28.85364 -8.76513  -25.48237 1.000 50.52448  ? 128 THR A OG1   1 
ATOM   1004 C  CG2   . THR A 1 129 ? 28.45663 -6.36926  -25.26021 1.000 40.14679  ? 128 THR A CG2   1 
ATOM   1005 N  N     . ALA A 1 130 ? 26.97379 -9.64001  -28.55267 1.000 50.33099  ? 129 ALA A N     1 
ATOM   1006 C  CA    . ALA A 1 130 ? 27.20229 -10.84586 -29.33636 1.000 47.20065  ? 129 ALA A CA    1 
ATOM   1007 C  C     . ALA A 1 130 ? 27.95140 -10.52412 -30.62012 1.000 47.26639  ? 129 ALA A C     1 
ATOM   1008 O  O     . ALA A 1 130 ? 27.61190 -9.56912  -31.32458 1.000 52.74671  ? 129 ALA A O     1 
ATOM   1009 C  CB    . ALA A 1 130 ? 25.86156 -11.50494 -29.65573 1.000 47.33968  ? 129 ALA A CB    1 
ATOM   1010 N  N     . PHE A 1 131 ? 28.98169 -11.31182 -30.91866 1.000 41.01520  ? 130 PHE A N     1 
ATOM   1011 C  CA    . PHE A 1 131 ? 29.70553 -11.17135 -32.17442 1.000 45.18497  ? 130 PHE A CA    1 
ATOM   1012 C  C     . PHE A 1 131 ? 30.13181 -12.54597 -32.66470 1.000 53.60546  ? 130 PHE A C     1 
ATOM   1013 O  O     . PHE A 1 131 ? 30.08836 -13.53399 -31.92627 1.000 52.24443  ? 130 PHE A O     1 
ATOM   1014 C  CB    . PHE A 1 131 ? 30.92483 -10.25130 -32.04603 1.000 47.42961  ? 130 PHE A CB    1 
ATOM   1015 C  CG    . PHE A 1 131 ? 32.03714 -10.82154 -31.21767 1.000 44.18977  ? 130 PHE A CG    1 
ATOM   1016 C  CD1   . PHE A 1 131 ? 32.00194 -10.73214 -29.83630 1.000 39.26794  ? 130 PHE A CD1   1 
ATOM   1017 C  CD2   . PHE A 1 131 ? 33.11853 -11.44794 -31.82013 1.000 48.64697  ? 130 PHE A CD2   1 
ATOM   1018 C  CE1   . PHE A 1 131 ? 33.01655 -11.25657 -29.07184 1.000 41.30695  ? 130 PHE A CE1   1 
ATOM   1019 C  CE2   . PHE A 1 131 ? 34.14835 -11.98649 -31.05198 1.000 47.56258  ? 130 PHE A CE2   1 
ATOM   1020 C  CZ    . PHE A 1 131 ? 34.09330 -11.88455 -29.67646 1.000 43.97484  ? 130 PHE A CZ    1 
ATOM   1021 N  N     . THR A 1 132 ? 30.56384 -12.58752 -33.92894 1.000 57.02770  ? 131 THR A N     1 
ATOM   1022 C  CA    . THR A 1 132 ? 30.86348 -13.81878 -34.64739 1.000 53.87410  ? 131 THR A CA    1 
ATOM   1023 C  C     . THR A 1 132 ? 32.23077 -13.69893 -35.29232 1.000 57.53271  ? 131 THR A C     1 
ATOM   1024 O  O     . THR A 1 132 ? 32.50682 -12.71077 -35.97474 1.000 67.85075  ? 131 THR A O     1 
ATOM   1025 C  CB    . THR A 1 132 ? 29.81080 -14.08906 -35.74049 1.000 53.13669  ? 131 THR A CB    1 
ATOM   1026 O  OG1   . THR A 1 132 ? 28.49904 -14.04576 -35.17099 1.000 51.00967  ? 131 THR A OG1   1 
ATOM   1027 C  CG2   . THR A 1 132 ? 30.03148 -15.44342 -36.38556 1.000 54.23233  ? 131 THR A CG2   1 
ATOM   1028 N  N     . ILE A 1 133 ? 33.07734 -14.70626 -35.11493 1.000 60.01833  ? 132 ILE A N     1 
ATOM   1029 C  CA    . ILE A 1 133 ? 34.34590 -14.77732 -35.83451 1.000 64.77972  ? 132 ILE A CA    1 
ATOM   1030 C  C     . ILE A 1 133 ? 34.12907 -15.64757 -37.06693 1.000 73.13015  ? 132 ILE A C     1 
ATOM   1031 O  O     . ILE A 1 133 ? 33.80236 -16.83880 -36.91972 1.000 74.61266  ? 132 ILE A O     1 
ATOM   1032 C  CB    . ILE A 1 133 ? 35.47879 -15.32707 -34.96195 1.000 64.29485  ? 132 ILE A CB    1 
ATOM   1033 C  CG1   . ILE A 1 133 ? 35.91840 -14.28107 -33.94029 1.000 65.92961  ? 132 ILE A CG1   1 
ATOM   1034 C  CG2   . ILE A 1 133 ? 36.66580 -15.72842 -35.82672 1.000 67.22637  ? 132 ILE A CG2   1 
ATOM   1035 C  CD1   . ILE A 1 133 ? 37.38877 -14.35945 -33.66924 1.000 66.96773  ? 132 ILE A CD1   1 
ATOM   1036 N  N     . PRO A 1 134 ? 34.25883 -15.10725 -38.28269 1.000 76.69447  ? 133 PRO A N     1 
ATOM   1037 C  CA    . PRO A 1 134 ? 33.96743 -15.89277 -39.48604 1.000 74.06992  ? 133 PRO A CA    1 
ATOM   1038 C  C     . PRO A 1 134 ? 34.91679 -17.06883 -39.64270 1.000 77.18127  ? 133 PRO A C     1 
ATOM   1039 O  O     . PRO A 1 134 ? 36.01020 -17.10485 -39.07039 1.000 72.99520  ? 133 PRO A O     1 
ATOM   1040 C  CB    . PRO A 1 134 ? 34.14061 -14.88064 -40.62638 1.000 76.06465  ? 133 PRO A CB    1 
ATOM   1041 C  CG    . PRO A 1 134 ? 34.97915 -13.79680 -40.05535 1.000 76.83624  ? 133 PRO A CG    1 
ATOM   1042 C  CD    . PRO A 1 134 ? 34.57284 -13.70734 -38.60959 1.000 73.11071  ? 133 PRO A CD    1 
ATOM   1043 N  N     . SER A 1 135 ? 34.45982 -18.04407 -40.43389 1.000 81.23037  ? 134 SER A N     1 
ATOM   1044 C  CA    . SER A 1 135 ? 35.20284 -19.27444 -40.67937 1.000 79.73554  ? 134 SER A CA    1 
ATOM   1045 C  C     . SER A 1 135 ? 36.53365 -18.97364 -41.35905 1.000 75.91201  ? 134 SER A C     1 
ATOM   1046 O  O     . SER A 1 135 ? 36.57333 -18.31266 -42.40446 1.000 76.06201  ? 134 SER A O     1 
ATOM   1047 C  CB    . SER A 1 135 ? 34.36659 -20.21451 -41.54884 1.000 79.32632  ? 134 SER A CB    1 
ATOM   1048 N  N     . ILE A 1 136 ? 37.62765 -19.45141 -40.75573 1.000 73.10499  ? 135 ILE A N     1 
ATOM   1049 C  CA    . ILE A 1 136 ? 38.93800 -19.32823 -41.38818 1.000 74.46631  ? 135 ILE A CA    1 
ATOM   1050 C  C     . ILE A 1 136 ? 39.14512 -20.36413 -42.48172 1.000 83.49642  ? 135 ILE A C     1 
ATOM   1051 O  O     . ILE A 1 136 ? 40.13185 -20.27919 -43.22425 1.000 77.87162  ? 135 ILE A O     1 
ATOM   1052 C  CB    . ILE A 1 136 ? 40.05842 -19.44357 -40.33728 1.000 69.55507  ? 135 ILE A CB    1 
ATOM   1053 N  N     . ASN A 1 137 ? 38.23066 -21.32983 -42.61401 1.000 86.68923  ? 136 ASN A N     1 
ATOM   1054 C  CA    . ASN A 1 137 ? 38.38314 -22.45670 -43.52422 1.000 82.59216  ? 136 ASN A CA    1 
ATOM   1055 C  C     . ASN A 1 137 ? 37.04540 -22.79242 -44.16157 1.000 81.90715  ? 136 ASN A C     1 
ATOM   1056 O  O     . ASN A 1 137 ? 35.99385 -22.28063 -43.77223 1.000 79.50748  ? 136 ASN A O     1 
ATOM   1057 C  CB    . ASN A 1 137 ? 38.92880 -23.69577 -42.80009 1.000 84.59022  ? 136 ASN A CB    1 
ATOM   1058 C  CG    . ASN A 1 137 ? 40.41712 -23.87148 -42.98790 1.000 84.21439  ? 136 ASN A CG    1 
ATOM   1059 O  OD1   . ASN A 1 137 ? 41.12102 -22.93439 -43.35823 1.000 81.48950  ? 136 ASN A OD1   1 
ATOM   1060 N  ND2   . ASN A 1 137 ? 40.90738 -25.08364 -42.73736 1.000 88.14791  ? 136 ASN A ND2   1 
ATOM   1061 N  N     . ASN A 1 138 ? 37.09719 -23.66134 -45.16829 1.000 85.21764  ? 137 ASN A N     1 
ATOM   1062 C  CA    . ASN A 1 138 ? 35.88531 -24.36952 -45.55087 1.000 89.97743  ? 137 ASN A CA    1 
ATOM   1063 C  C     . ASN A 1 138 ? 35.62103 -25.51122 -44.57099 1.000 92.61190  ? 137 ASN A C     1 
ATOM   1064 O  O     . ASN A 1 138 ? 34.46334 -25.84058 -44.28563 1.000 90.06925  ? 137 ASN A O     1 
ATOM   1065 C  CB    . ASN A 1 138 ? 35.99572 -24.88575 -46.98833 1.000 79.37686  ? 137 ASN A CB    1 
ATOM   1066 N  N     . GLU A 1 139 ? 36.69302 -26.10150 -44.01501 1.000 90.78353  ? 138 GLU A N     1 
ATOM   1067 C  CA    . GLU A 1 139 ? 36.61062 -27.24189 -43.10415 1.000 93.36390  ? 138 GLU A CA    1 
ATOM   1068 C  C     . GLU A 1 139 ? 36.40664 -26.83790 -41.64552 1.000 95.51784  ? 138 GLU A C     1 
ATOM   1069 O  O     . GLU A 1 139 ? 36.19262 -27.71760 -40.80415 1.000 96.39278  ? 138 GLU A O     1 
ATOM   1070 C  CB    . GLU A 1 139 ? 37.87624 -28.10560 -43.22253 1.000 87.93470  ? 138 GLU A CB    1 
ATOM   1071 N  N     . THR A 1 140 ? 36.47348 -25.54550 -41.31858 1.000 91.82299  ? 139 THR A N     1 
ATOM   1072 C  CA    . THR A 1 140 ? 36.24601 -25.07686 -39.95768 1.000 88.04559  ? 139 THR A CA    1 
ATOM   1073 C  C     . THR A 1 140 ? 35.14728 -24.01919 -39.98002 1.000 87.30335  ? 139 THR A C     1 
ATOM   1074 O  O     . THR A 1 140 ? 35.20938 -23.08383 -40.79475 1.000 87.24909  ? 139 THR A O     1 
ATOM   1075 C  CB    . THR A 1 140 ? 37.53229 -24.51088 -39.34411 1.000 81.84604  ? 139 THR A CB    1 
ATOM   1076 N  N     . PRO A 1 141 ? 34.11549 -24.13076 -39.11711 1.000 86.13792  ? 140 PRO A N     1 
ATOM   1077 C  CA    . PRO A 1 141 ? 33.09435 -23.07354 -39.03937 1.000 81.58581  ? 140 PRO A CA    1 
ATOM   1078 C  C     . PRO A 1 141 ? 33.47742 -21.96257 -38.07115 1.000 77.79416  ? 140 PRO A C     1 
ATOM   1079 O  O     . PRO A 1 141 ? 34.55418 -21.99795 -37.46313 1.000 71.79831  ? 140 PRO A O     1 
ATOM   1080 C  CB    . PRO A 1 141 ? 31.85371 -23.83000 -38.55987 1.000 75.09560  ? 140 PRO A CB    1 
ATOM   1081 C  CG    . PRO A 1 141 ? 32.40973 -24.91433 -37.70784 1.000 77.59732  ? 140 PRO A CG    1 
ATOM   1082 C  CD    . PRO A 1 141 ? 33.74704 -25.30975 -38.31135 1.000 86.00054  ? 140 PRO A CD    1 
ATOM   1083 N  N     . GLY A 1 142 ? 32.59177 -20.98268 -37.90593 1.000 73.70767  ? 141 GLY A N     1 
ATOM   1084 C  CA    . GLY A 1 142 ? 32.90190 -19.75040 -37.18956 1.000 75.57574  ? 141 GLY A CA    1 
ATOM   1085 C  C     . GLY A 1 142 ? 32.26739 -19.69703 -35.80678 1.000 68.08232  ? 141 GLY A C     1 
ATOM   1086 O  O     . GLY A 1 142 ? 31.07494 -19.97691 -35.64851 1.000 68.45591  ? 141 GLY A O     1 
ATOM   1087 N  N     . ILE A 1 143 ? 33.08122 -19.27671 -34.81183 1.000 59.81428  ? 142 ILE A N     1 
ATOM   1088 C  CA    . ILE A 1 143 ? 32.67858 -19.26880 -33.40744 1.000 56.56561  ? 142 ILE A CA    1 
ATOM   1089 C  C     . ILE A 1 143 ? 31.99770 -17.94894 -33.05904 1.000 58.15492  ? 142 ILE A C     1 
ATOM   1090 O  O     . ILE A 1 143 ? 32.40728 -16.87845 -33.52073 1.000 58.48587  ? 142 ILE A O     1 
ATOM   1091 C  CB    . ILE A 1 143 ? 33.88900 -19.51914 -32.49065 1.000 53.81450  ? 142 ILE A CB    1 
ATOM   1092 C  CG1   . ILE A 1 143 ? 34.90852 -20.44372 -33.17256 1.000 58.65776  ? 142 ILE A CG1   1 
ATOM   1093 C  CG2   . ILE A 1 143 ? 33.41904 -20.08816 -31.14381 1.000 50.16419  ? 142 ILE A CG2   1 
ATOM   1094 C  CD1   . ILE A 1 143 ? 34.90050 -21.89177 -32.67893 1.000 56.58192  ? 142 ILE A CD1   1 
ATOM   1095 N  N     . ARG A 1 144 ? 30.96304 -18.02995 -32.22002 1.000 59.41484  ? 143 ARG A N     1 
ATOM   1096 C  CA    . ARG A 1 144 ? 30.17777 -16.88518 -31.76526 1.000 50.55943  ? 143 ARG A CA    1 
ATOM   1097 C  C     . ARG A 1 144 ? 30.43379 -16.63817 -30.28362 1.000 51.71202  ? 143 ARG A C     1 
ATOM   1098 O  O     . ARG A 1 144 ? 30.33601 -17.56140 -29.46941 1.000 53.21691  ? 143 ARG A O     1 
ATOM   1099 C  CB    . ARG A 1 144 ? 28.67941 -17.12447 -31.97224 1.000 48.73706  ? 143 ARG A CB    1 
ATOM   1100 C  CG    . ARG A 1 144 ? 28.28181 -17.43614 -33.38008 1.000 47.56861  ? 143 ARG A CG    1 
ATOM   1101 C  CD    . ARG A 1 144 ? 27.06054 -16.64642 -33.76513 1.000 45.21983  ? 143 ARG A CD    1 
ATOM   1102 N  NE    . ARG A 1 144 ? 25.95967 -16.81054 -32.82487 1.000 47.75286  ? 143 ARG A NE    1 
ATOM   1103 C  CZ    . ARG A 1 144 ? 25.19201 -15.80452 -32.41204 1.000 58.79401  ? 143 ARG A CZ    1 
ATOM   1104 N  NH1   . ARG A 1 144 ? 24.19396 -16.02536 -31.56378 1.000 58.63100  ? 143 ARG A NH1   1 
ATOM   1105 N  NH2   . ARG A 1 144 ? 25.44124 -14.56466 -32.83271 1.000 58.06447  ? 143 ARG A NH2   1 
ATOM   1106 N  N     . TYR A 1 145 ? 30.71546 -15.39496 -29.92023 1.000 50.22938  ? 144 TYR A N     1 
ATOM   1107 C  CA    . TYR A 1 145 ? 31.00089 -15.08956 -28.53126 1.000 48.15200  ? 144 TYR A CA    1 
ATOM   1108 C  C     . TYR A 1 145 ? 30.19404 -13.88338 -28.06356 1.000 48.61062  ? 144 TYR A C     1 
ATOM   1109 O  O     . TYR A 1 145 ? 29.67362 -13.10198 -28.86406 1.000 50.45075  ? 144 TYR A O     1 
ATOM   1110 C  CB    . TYR A 1 145 ? 32.48286 -14.79759 -28.31649 1.000 43.46896  ? 144 TYR A CB    1 
ATOM   1111 C  CG    . TYR A 1 145 ? 33.49972 -15.83438 -28.75155 1.000 43.65846  ? 144 TYR A CG    1 
ATOM   1112 C  CD1   . TYR A 1 145 ? 33.90713 -16.84796 -27.89360 1.000 46.49996  ? 144 TYR A CD1   1 
ATOM   1113 C  CD2   . TYR A 1 145 ? 34.13422 -15.73393 -29.97971 1.000 46.98629  ? 144 TYR A CD2   1 
ATOM   1114 C  CE1   . TYR A 1 145 ? 34.89325 -17.76491 -28.27154 1.000 46.99803  ? 144 TYR A CE1   1 
ATOM   1115 C  CE2   . TYR A 1 145 ? 35.12148 -16.63624 -30.36244 1.000 49.02501  ? 144 TYR A CE2   1 
ATOM   1116 C  CZ    . TYR A 1 145 ? 35.49490 -17.64660 -29.50711 1.000 47.22033  ? 144 TYR A CZ    1 
ATOM   1117 O  OH    . TYR A 1 145 ? 36.46419 -18.53775 -29.90107 1.000 48.28002  ? 144 TYR A OH    1 
ATOM   1118 N  N     . GLN A 1 146 ? 30.11027 -13.73710 -26.74466 1.000 44.53060  ? 145 GLN A N     1 
ATOM   1119 C  CA    . GLN A 1 146 ? 29.72177 -12.49018 -26.11293 1.000 42.76789  ? 145 GLN A CA    1 
ATOM   1120 C  C     . GLN A 1 146 ? 30.84959 -12.02404 -25.19825 1.000 47.28271  ? 145 GLN A C     1 
ATOM   1121 O  O     . GLN A 1 146 ? 31.74053 -12.80010 -24.82857 1.000 47.73573  ? 145 GLN A O     1 
ATOM   1122 C  CB    . GLN A 1 146 ? 28.42206 -12.63168 -25.31476 1.000 45.66367  ? 145 GLN A CB    1 
ATOM   1123 C  CG    . GLN A 1 146 ? 28.60653 -13.17122 -23.90285 1.000 47.26272  ? 145 GLN A CG    1 
ATOM   1124 C  CD    . GLN A 1 146 ? 27.28296 -13.44512 -23.18219 1.000 53.93325  ? 145 GLN A CD    1 
ATOM   1125 O  OE1   . GLN A 1 146 ? 26.21951 -13.57327 -23.81254 1.000 55.60881  ? 145 GLN A OE1   1 
ATOM   1126 N  NE2   . GLN A 1 146 ? 27.34580 -13.54529 -21.85299 1.000 50.20459  ? 145 GLN A NE2   1 
ATOM   1127 N  N     . TYR A 1 147 ? 30.79015 -10.73840 -24.83517 1.000 47.37310  ? 146 TYR A N     1 
ATOM   1128 C  CA    . TYR A 1 147 ? 31.77397 -10.08627 -23.97661 1.000 45.12521  ? 146 TYR A CA    1 
ATOM   1129 C  C     . TYR A 1 147 ? 31.37433 -10.18033 -22.50584 1.000 46.49056  ? 146 TYR A C     1 
ATOM   1130 O  O     . TYR A 1 147 ? 30.21397 -9.95016  -22.15264 1.000 49.27208  ? 146 TYR A O     1 
ATOM   1131 C  CB    . TYR A 1 147 ? 31.91084 -8.60974  -24.36610 1.000 47.34085  ? 146 TYR A CB    1 
ATOM   1132 C  CG    . TYR A 1 147 ? 32.98135 -8.32009  -25.39147 1.000 45.67770  ? 146 TYR A CG    1 
ATOM   1133 C  CD1   . TYR A 1 147 ? 32.70966 -8.36851  -26.75826 1.000 44.80039  ? 146 TYR A CD1   1 
ATOM   1134 C  CD2   . TYR A 1 147 ? 34.26270 -7.99368  -24.99282 1.000 41.46645  ? 146 TYR A CD2   1 
ATOM   1135 C  CE1   . TYR A 1 147 ? 33.70660 -8.10332  -27.70197 1.000 42.64081  ? 146 TYR A CE1   1 
ATOM   1136 C  CE2   . TYR A 1 147 ? 35.26105 -7.73574  -25.91760 1.000 42.62588  ? 146 TYR A CE2   1 
ATOM   1137 C  CZ    . TYR A 1 147 ? 34.98647 -7.79053  -27.26873 1.000 45.04482  ? 146 TYR A CZ    1 
ATOM   1138 O  OH    . TYR A 1 147 ? 36.00587 -7.51883  -28.16905 1.000 44.31741  ? 146 TYR A OH    1 
ATOM   1139 N  N     . ASN A 1 148 ? 32.34193 -10.50985 -21.64559 1.000 45.54513  ? 147 ASN A N     1 
ATOM   1140 C  CA    . ASN A 1 148 ? 32.17351 -10.37265 -20.20009 1.000 44.46207  ? 147 ASN A CA    1 
ATOM   1141 C  C     . ASN A 1 148 ? 32.90024 -9.16476  -19.64468 1.000 40.28881  ? 147 ASN A C     1 
ATOM   1142 O  O     . ASN A 1 148 ? 32.74488 -8.86199  -18.45502 1.000 38.91460  ? 147 ASN A O     1 
ATOM   1143 C  CB    . ASN A 1 148 ? 32.69282 -11.60571 -19.45182 1.000 44.56798  ? 147 ASN A CB    1 
ATOM   1144 C  CG    . ASN A 1 148 ? 32.25915 -12.88086 -20.07374 1.000 43.32956  ? 147 ASN A CG    1 
ATOM   1145 O  OD1   . ASN A 1 148 ? 31.09928 -13.03616 -20.43440 1.000 48.79583  ? 147 ASN A OD1   1 
ATOM   1146 N  ND2   . ASN A 1 148 ? 33.19289 -13.81343 -20.22227 1.000 41.50239  ? 147 ASN A ND2   1 
ATOM   1147 N  N     . VAL A 1 149 ? 33.72650 -8.51368  -20.46428 1.000 42.66757  ? 148 VAL A N     1 
ATOM   1148 C  CA    . VAL A 1 149 ? 34.49571 -7.33281  -20.09309 1.000 40.45180  ? 148 VAL A CA    1 
ATOM   1149 C  C     . VAL A 1 149 ? 34.20792 -6.25624  -21.12187 1.000 38.12216  ? 148 VAL A C     1 
ATOM   1150 O  O     . VAL A 1 149 ? 33.55649 -6.50741  -22.13181 1.000 47.24817  ? 148 VAL A O     1 
ATOM   1151 C  CB    . VAL A 1 149 ? 36.01010 -7.60069  -20.03423 1.000 37.58592  ? 148 VAL A CB    1 
ATOM   1152 C  CG1   . VAL A 1 149 ? 36.34741 -8.48375  -18.87786 1.000 36.16403  ? 148 VAL A CG1   1 
ATOM   1153 C  CG2   . VAL A 1 149 ? 36.49068 -8.17942  -21.35314 1.000 35.54891  ? 148 VAL A CG2   1 
ATOM   1154 N  N     . LEU A 1 150 ? 34.74955 -5.06371  -20.88072 1.000 34.21821  ? 149 LEU A N     1 
ATOM   1155 C  CA    . LEU A 1 150 ? 34.48220 -3.92070  -21.75029 1.000 35.98372  ? 149 LEU A CA    1 
ATOM   1156 C  C     . LEU A 1 150 ? 35.03247 -4.13856  -23.15578 1.000 38.68528  ? 149 LEU A C     1 
ATOM   1157 O  O     . LEU A 1 150 ? 36.20742 -4.51921  -23.31369 1.000 37.85268  ? 149 LEU A O     1 
ATOM   1158 C  CB    . LEU A 1 150 ? 35.08735 -2.64803  -21.17703 1.000 37.64822  ? 149 LEU A CB    1 
ATOM   1159 C  CG    . LEU A 1 150 ? 34.57235 -2.21064  -19.81514 1.000 35.45343  ? 149 LEU A CG    1 
ATOM   1160 C  CD1   . LEU A 1 150 ? 35.30393 -0.94208  -19.38699 1.000 36.88885  ? 149 LEU A CD1   1 
ATOM   1161 C  CD2   . LEU A 1 150 ? 33.05392 -2.04008  -19.81063 1.000 29.39502  ? 149 LEU A CD2   1 
ATOM   1162 N  N     . PRO A 1 151 ? 34.22361 -3.91658  -24.18752 1.000 39.70705  ? 150 PRO A N     1 
ATOM   1163 C  CA    . PRO A 1 151 ? 34.70357 -3.96926  -25.57099 1.000 38.92159  ? 150 PRO A CA    1 
ATOM   1164 C  C     . PRO A 1 151 ? 35.04699 -2.59337  -26.12428 1.000 35.97019  ? 150 PRO A C     1 
ATOM   1165 O  O     . PRO A 1 151 ? 34.44289 -1.57076  -25.79042 1.000 38.45554  ? 150 PRO A O     1 
ATOM   1166 C  CB    . PRO A 1 151 ? 33.49676 -4.54749  -26.31570 1.000 40.24903  ? 150 PRO A CB    1 
ATOM   1167 C  CG    . PRO A 1 151 ? 32.32250 -3.99559  -25.55897 1.000 39.85556  ? 150 PRO A CG    1 
ATOM   1168 C  CD    . PRO A 1 151 ? 32.74692 -3.83713  -24.10233 1.000 35.09158  ? 150 PRO A CD    1 
ATOM   1169 N  N     . GLN A 1 152 ? 36.03260 -2.59726  -27.01680 1.000 39.88861  ? 151 GLN A N     1 
ATOM   1170 C  CA    . GLN A 1 152 ? 36.47867 -1.39455  -27.71044 1.000 42.89894  ? 151 GLN A CA    1 
ATOM   1171 C  C     . GLN A 1 152 ? 35.55298 -1.10575  -28.88192 1.000 44.93087  ? 151 GLN A C     1 
ATOM   1172 O  O     . GLN A 1 152 ? 35.31252 -1.97445  -29.72460 1.000 49.93850  ? 151 GLN A O     1 
ATOM   1173 C  CB    . GLN A 1 152 ? 37.92250 -1.56391  -28.18484 1.000 36.67055  ? 151 GLN A CB    1 
ATOM   1174 C  CG    . GLN A 1 152 ? 38.89053 -1.58006  -27.03824 1.000 36.97793  ? 151 GLN A CG    1 
ATOM   1175 C  CD    . GLN A 1 152 ? 40.22489 -2.19402  -27.39003 1.000 41.46575  ? 151 GLN A CD    1 
ATOM   1176 O  OE1   . GLN A 1 152 ? 41.11468 -1.51941  -27.88815 1.000 43.33229  ? 151 GLN A OE1   1 
ATOM   1177 N  NE2   . GLN A 1 152 ? 40.37482 -3.48678  -27.12025 1.000 42.31192  ? 151 GLN A NE2   1 
ATOM   1178 N  N     . GLY A 1 153 ? 35.03379 0.11128   -28.93928 1.000 40.63069  ? 152 GLY A N     1 
ATOM   1179 C  CA    . GLY A 1 153 ? 34.01471 0.45332   -29.91189 1.000 40.22024  ? 152 GLY A CA    1 
ATOM   1180 C  C     . GLY A 1 153 ? 32.64594 0.68604   -29.30993 1.000 43.68253  ? 152 GLY A C     1 
ATOM   1181 O  O     . GLY A 1 153 ? 31.77347 1.26438   -29.97815 1.000 47.68795  ? 152 GLY A O     1 
ATOM   1182 N  N     . TRP A 1 154 ? 32.43360 0.26596   -28.06722 1.000 43.09423  ? 153 TRP A N     1 
ATOM   1183 C  CA    . TRP A 1 154 ? 31.21487 0.59884   -27.34160 1.000 43.07608  ? 153 TRP A CA    1 
ATOM   1184 C  C     . TRP A 1 154 ? 31.30617 2.01837   -26.79438 1.000 43.15798  ? 153 TRP A C     1 
ATOM   1185 O  O     . TRP A 1 154 ? 32.36760 2.45099   -26.33419 1.000 41.37873  ? 153 TRP A O     1 
ATOM   1186 C  CB    . TRP A 1 154 ? 30.99656 -0.38687  -26.19211 1.000 39.47633  ? 153 TRP A CB    1 
ATOM   1187 C  CG    . TRP A 1 154 ? 29.69563 -0.23565  -25.47322 1.000 38.31992  ? 153 TRP A CG    1 
ATOM   1188 C  CD1   . TRP A 1 154 ? 28.47429 0.01843   -26.02698 1.000 38.84552  ? 153 TRP A CD1   1 
ATOM   1189 C  CD2   . TRP A 1 154 ? 29.48381 -0.33414  -24.06071 1.000 40.63036  ? 153 TRP A CD2   1 
ATOM   1190 N  NE1   . TRP A 1 154 ? 27.51461 0.08521   -25.04824 1.000 39.29935  ? 153 TRP A NE1   1 
ATOM   1191 C  CE2   . TRP A 1 154 ? 28.10646 -0.13094  -23.83063 1.000 41.09038  ? 153 TRP A CE2   1 
ATOM   1192 C  CE3   . TRP A 1 154 ? 30.32754 -0.56568  -22.96455 1.000 39.89312  ? 153 TRP A CE3   1 
ATOM   1193 C  CZ2   . TRP A 1 154 ? 27.54909 -0.16364  -22.54915 1.000 42.77492  ? 153 TRP A CZ2   1 
ATOM   1194 C  CZ3   . TRP A 1 154 ? 29.77488 -0.59847  -21.68736 1.000 37.73416  ? 153 TRP A CZ3   1 
ATOM   1195 C  CH2   . TRP A 1 154 ? 28.39825 -0.39641  -21.49350 1.000 45.74794  ? 153 TRP A CH2   1 
ATOM   1196 N  N     . LYS A 1 155 ? 30.17854 2.73486   -26.82567 1.000 41.96222  ? 154 LYS A N     1 
ATOM   1197 C  CA    . LYS A 1 155 ? 30.16897 4.12595   -26.39448 1.000 42.25837  ? 154 LYS A CA    1 
ATOM   1198 C  C     . LYS A 1 155 ? 30.26418 4.27726   -24.88597 1.000 45.31695  ? 154 LYS A C     1 
ATOM   1199 O  O     . LYS A 1 155 ? 30.64937 5.35271   -24.41413 1.000 46.83679  ? 154 LYS A O     1 
ATOM   1200 C  CB    . LYS A 1 155 ? 28.91184 4.84368   -26.89551 1.000 44.08956  ? 154 LYS A CB    1 
ATOM   1201 C  CG    . LYS A 1 155 ? 27.83685 5.03892   -25.84850 1.000 48.54246  ? 154 LYS A CG    1 
ATOM   1202 C  CD    . LYS A 1 155 ? 26.83424 6.11946   -26.23617 1.000 43.19483  ? 154 LYS A CD    1 
ATOM   1203 C  CE    . LYS A 1 155 ? 25.41693 5.68809   -25.88012 1.000 42.69383  ? 154 LYS A CE    1 
ATOM   1204 N  NZ    . LYS A 1 155 ? 24.44445 6.79953   -25.91958 1.000 53.21137  ? 154 LYS A NZ    1 
ATOM   1205 N  N     . GLY A 1 156 ? 29.93585 3.23387   -24.12299 1.000 43.72196  ? 155 GLY A N     1 
ATOM   1206 C  CA    . GLY A 1 156 ? 30.04393 3.27276   -22.67743 1.000 41.31302  ? 155 GLY A CA    1 
ATOM   1207 C  C     . GLY A 1 156 ? 31.40297 2.91128   -22.10877 1.000 42.75094  ? 155 GLY A C     1 
ATOM   1208 O  O     . GLY A 1 156 ? 31.62339 3.05961   -20.90176 1.000 41.13515  ? 155 GLY A O     1 
ATOM   1209 N  N     . SER A 1 157 ? 32.34295 2.45022   -22.93847 1.000 42.15496  ? 156 SER A N     1 
ATOM   1210 C  CA    . SER A 1 157 ? 33.59312 1.94640   -22.37151 1.000 40.97619  ? 156 SER A CA    1 
ATOM   1211 C  C     . SER A 1 157 ? 34.50085 3.05568   -21.85833 1.000 40.26504  ? 156 SER A C     1 
ATOM   1212 O  O     . SER A 1 157 ? 35.00819 2.92614   -20.73326 1.000 40.43202  ? 156 SER A O     1 
ATOM   1213 C  CB    . SER A 1 157 ? 34.30140 1.04654   -23.38174 1.000 37.33879  ? 156 SER A CB    1 
ATOM   1214 O  OG    . SER A 1 157 ? 33.47991 -0.05705  -23.67156 1.000 40.28334  ? 156 SER A OG    1 
ATOM   1215 N  N     . PRO A 1 158 ? 34.78720 4.12809   -22.60416 1.000 41.35848  ? 157 PRO A N     1 
ATOM   1216 C  CA    . PRO A 1 158 ? 35.69204 5.15348   -22.04540 1.000 37.23270  ? 157 PRO A CA    1 
ATOM   1217 C  C     . PRO A 1 158 ? 35.27829 5.64103   -20.66367 1.000 36.02575  ? 157 PRO A C     1 
ATOM   1218 O  O     . PRO A 1 158 ? 36.10632 5.65256   -19.74835 1.000 34.58263  ? 157 PRO A O     1 
ATOM   1219 C  CB    . PRO A 1 158 ? 35.64443 6.26060   -23.10937 1.000 37.88172  ? 157 PRO A CB    1 
ATOM   1220 C  CG    . PRO A 1 158 ? 35.47299 5.49804   -24.39307 1.000 39.68883  ? 157 PRO A CG    1 
ATOM   1221 C  CD    . PRO A 1 158 ? 34.53000 4.35876   -24.04147 1.000 38.77561  ? 157 PRO A CD    1 
ATOM   1222 N  N     . ALA A 1 159 ? 34.00790 5.99880   -20.46925 1.000 39.32264  ? 158 ALA A N     1 
ATOM   1223 C  CA    . ALA A 1 159 ? 33.59244 6.54000   -19.17794 1.000 34.18712  ? 158 ALA A CA    1 
ATOM   1224 C  C     . ALA A 1 159 ? 33.65285 5.48100   -18.08729 1.000 38.47754  ? 158 ALA A C     1 
ATOM   1225 O  O     . ALA A 1 159 ? 34.12925 5.75192   -16.97770 1.000 39.03074  ? 158 ALA A O     1 
ATOM   1226 C  CB    . ALA A 1 159 ? 32.18402 7.12269   -19.27102 1.000 30.14089  ? 158 ALA A CB    1 
ATOM   1227 N  N     . ILE A 1 160 ? 33.13940 4.27819   -18.36814 1.000 33.35254  ? 159 ILE A N     1 
ATOM   1228 C  CA    . ILE A 1 160 ? 33.15410 3.22400   -17.35870 1.000 34.52271  ? 159 ILE A CA    1 
ATOM   1229 C  C     . ILE A 1 160 ? 34.58560 2.89384   -16.95821 1.000 32.81439  ? 159 ILE A C     1 
ATOM   1230 O  O     . ILE A 1 160 ? 34.87820 2.67836   -15.78072 1.000 35.80762  ? 159 ILE A O     1 
ATOM   1231 C  CB    . ILE A 1 160 ? 32.40472 1.97525   -17.86288 1.000 38.74701  ? 159 ILE A CB    1 
ATOM   1232 C  CG1   . ILE A 1 160 ? 30.90062 2.20602   -17.83420 1.000 39.47333  ? 159 ILE A CG1   1 
ATOM   1233 C  CG2   . ILE A 1 160 ? 32.73388 0.78139   -17.01980 1.000 32.60725  ? 159 ILE A CG2   1 
ATOM   1234 C  CD1   . ILE A 1 160 ? 30.11067 1.10825   -18.51826 1.000 39.44469  ? 159 ILE A CD1   1 
ATOM   1235 N  N     . PHE A 1 161 ? 35.50991 2.87506   -17.91490 1.000 33.64166  ? 160 PHE A N     1 
ATOM   1236 C  CA    . PHE A 1 161 ? 36.89034 2.59380   -17.53738 1.000 34.27590  ? 160 PHE A CA    1 
ATOM   1237 C  C     . PHE A 1 161 ? 37.49149 3.74362   -16.74749 1.000 33.09476  ? 160 PHE A C     1 
ATOM   1238 O  O     . PHE A 1 161 ? 38.21697 3.51657   -15.77752 1.000 34.13051  ? 160 PHE A O     1 
ATOM   1239 C  CB    . PHE A 1 161 ? 37.76729 2.29005   -18.75070 1.000 32.31275  ? 160 PHE A CB    1 
ATOM   1240 C  CG    . PHE A 1 161 ? 39.16653 1.89391   -18.37464 1.000 32.37513  ? 160 PHE A CG    1 
ATOM   1241 C  CD1   . PHE A 1 161 ? 39.47076 0.57220   -18.09632 1.000 32.45676  ? 160 PHE A CD1   1 
ATOM   1242 C  CD2   . PHE A 1 161 ? 40.17374 2.83878   -18.24621 1.000 31.01086  ? 160 PHE A CD2   1 
ATOM   1243 C  CE1   . PHE A 1 161 ? 40.75040 0.19274   -17.72837 1.000 26.91930  ? 160 PHE A CE1   1 
ATOM   1244 C  CE2   . PHE A 1 161 ? 41.45330 2.44604   -17.86867 1.000 28.99584  ? 160 PHE A CE2   1 
ATOM   1245 C  CZ    . PHE A 1 161 ? 41.73655 1.13297   -17.61214 1.000 29.76268  ? 160 PHE A CZ    1 
ATOM   1246 N  N     . GLN A 1 162 ? 37.22380 4.98465   -17.15081 1.000 34.89117  ? 161 GLN A N     1 
ATOM   1247 C  CA    . GLN A 1 162 ? 37.81651 6.11167   -16.44437 1.000 29.91192  ? 161 GLN A CA    1 
ATOM   1248 C  C     . GLN A 1 162 ? 37.31619 6.16995   -15.01126 1.000 29.75837  ? 161 GLN A C     1 
ATOM   1249 O  O     . GLN A 1 162 ? 38.10129 6.34077   -14.07132 1.000 33.80006  ? 161 GLN A O     1 
ATOM   1250 C  CB    . GLN A 1 162 ? 37.52501 7.39473   -17.21724 1.000 32.74687  ? 161 GLN A CB    1 
ATOM   1251 C  CG    . GLN A 1 162 ? 38.36043 7.46396   -18.50478 1.000 32.33453  ? 161 GLN A CG    1 
ATOM   1252 C  CD    . GLN A 1 162 ? 37.75706 8.33375   -19.56370 1.000 32.86343  ? 161 GLN A CD    1 
ATOM   1253 O  OE1   . GLN A 1 162 ? 36.67945 8.88907   -19.37342 1.000 42.56980  ? 161 GLN A OE1   1 
ATOM   1254 N  NE2   . GLN A 1 162 ? 38.42788 8.44381   -20.70137 1.000 30.40905  ? 161 GLN A NE2   1 
ATOM   1255 N  N     . SER A 1 163 ? 36.02111 5.94809   -14.82162 1.000 34.81504  ? 162 SER A N     1 
ATOM   1256 C  CA    . SER A 1 163 ? 35.44777 5.88565   -13.48389 1.000 33.45499  ? 162 SER A CA    1 
ATOM   1257 C  C     . SER A 1 163 ? 36.02330 4.72110   -12.67803 1.000 30.47522  ? 162 SER A C     1 
ATOM   1258 O  O     . SER A 1 163 ? 36.40380 4.88211   -11.50948 1.000 31.50928  ? 162 SER A O     1 
ATOM   1259 C  CB    . SER A 1 163 ? 33.93011 5.77449   -13.60096 1.000 31.72399  ? 162 SER A CB    1 
ATOM   1260 O  OG    . SER A 1 163 ? 33.33005 5.92658   -12.33416 1.000 40.70317  ? 162 SER A OG    1 
ATOM   1261 N  N     . SER A 1 164 ? 36.08373 3.53250   -13.27300 1.000 29.08684  ? 163 SER A N     1 
ATOM   1262 C  CA    . SER A 1 164 ? 36.61707 2.39597   -12.53201 1.000 36.46591  ? 163 SER A CA    1 
ATOM   1263 C  C     . SER A 1 164 ? 38.06072 2.64330   -12.11853 1.000 33.00533  ? 163 SER A C     1 
ATOM   1264 O  O     . SER A 1 164 ? 38.45258 2.32430   -10.99035 1.000 31.16523  ? 163 SER A O     1 
ATOM   1265 C  CB    . SER A 1 164 ? 36.49950 1.11667   -13.36343 1.000 37.14708  ? 163 SER A CB    1 
ATOM   1266 O  OG    . SER A 1 164 ? 35.15915 0.91426   -13.80107 1.000 41.07651  ? 163 SER A OG    1 
ATOM   1267 N  N     . MET A 1 165 ? 38.85949 3.23613   -13.00931 1.000 32.50153  ? 164 MET A N     1 
ATOM   1268 C  CA    . MET A 1 165 ? 40.24883 3.53133   -12.67706 1.000 31.30677  ? 164 MET A CA    1 
ATOM   1269 C  C     . MET A 1 165 ? 40.35133 4.52201   -11.52923 1.000 33.76945  ? 164 MET A C     1 
ATOM   1270 O  O     . MET A 1 165 ? 41.19016 4.34441   -10.63439 1.000 33.34118  ? 164 MET A O     1 
ATOM   1271 C  CB    . MET A 1 165 ? 40.98451 4.07738   -13.89139 1.000 31.37224  ? 164 MET A CB    1 
ATOM   1272 C  CG    . MET A 1 165 ? 42.47777 4.25275   -13.63137 1.000 35.69564  ? 164 MET A CG    1 
ATOM   1273 S  SD    . MET A 1 165 ? 43.28274 2.69876   -13.96756 1.000 35.94989  ? 164 MET A SD    1 
ATOM   1274 C  CE    . MET A 1 165 ? 44.94912 2.95789   -13.41734 1.000 33.91802  ? 164 MET A CE    1 
ATOM   1275 N  N     . THR A 1 166 ? 39.53150 5.59131   -11.55412 1.000 30.10652  ? 165 THR A N     1 
ATOM   1276 C  CA    . THR A 1 166 ? 39.51453 6.52978   -10.43373 1.000 27.69684  ? 165 THR A CA    1 
ATOM   1277 C  C     . THR A 1 166 ? 39.18128 5.81998   -9.11853  1.000 32.41238  ? 165 THR A C     1 
ATOM   1278 O  O     . THR A 1 166 ? 39.84025 6.05355   -8.09179  1.000 36.33158  ? 165 THR A O     1 
ATOM   1279 C  CB    . THR A 1 166 ? 38.53013 7.67392   -10.70561 1.000 27.98732  ? 165 THR A CB    1 
ATOM   1280 O  OG1   . THR A 1 166 ? 38.88094 8.34656   -11.91884 1.000 31.54340  ? 165 THR A OG1   1 
ATOM   1281 C  CG2   . THR A 1 166 ? 38.57292 8.69488   -9.60847  1.000 23.67551  ? 165 THR A CG2   1 
ATOM   1282 N  N     . LYS A 1 167 ? 38.17624 4.93670   -9.12185  1.000 32.13949  ? 166 LYS A N     1 
ATOM   1283 C  CA    . LYS A 1 167 ? 37.86675 4.19878   -7.89002  1.000 32.63805  ? 166 LYS A CA    1 
ATOM   1284 C  C     . LYS A 1 167 ? 39.05471 3.34794   -7.44705  1.000 32.48871  ? 166 LYS A C     1 
ATOM   1285 O  O     . LYS A 1 167 ? 39.44049 3.35659   -6.27321  1.000 34.29567  ? 166 LYS A O     1 
ATOM   1286 C  CB    . LYS A 1 167 ? 36.61401 3.32529   -8.06260  1.000 34.75501  ? 166 LYS A CB    1 
ATOM   1287 C  CG    . LYS A 1 167 ? 35.30924 4.13018   -8.07691  1.000 44.37143  ? 166 LYS A CG    1 
ATOM   1288 C  CD    . LYS A 1 167 ? 34.05471 3.26575   -8.23962  1.000 46.87041  ? 166 LYS A CD    1 
ATOM   1289 C  CE    . LYS A 1 167 ? 32.86814 4.08206   -8.80261  1.000 48.79703  ? 166 LYS A CE    1 
ATOM   1290 N  NZ    . LYS A 1 167 ? 32.24024 5.07191   -7.84317  1.000 42.78755  ? 166 LYS A NZ    1 
ATOM   1291 N  N     . ILE A 1 168 ? 39.65783 2.61888   -8.38733  1.000 34.41604  ? 167 ILE A N     1 
ATOM   1292 C  CA    . ILE A 1 168 ? 40.77886 1.73673   -8.07639  1.000 30.54112  ? 167 ILE A CA    1 
ATOM   1293 C  C     . ILE A 1 168 ? 41.93947 2.53082   -7.48486  1.000 33.65618  ? 167 ILE A C     1 
ATOM   1294 O  O     . ILE A 1 168 ? 42.57835 2.09992   -6.51679  1.000 37.36924  ? 167 ILE A O     1 
ATOM   1295 C  CB    . ILE A 1 168 ? 41.18478 0.95481   -9.34176  1.000 30.75259  ? 167 ILE A CB    1 
ATOM   1296 C  CG1   . ILE A 1 168 ? 40.16974 -0.16528  -9.61854  1.000 33.15090  ? 167 ILE A CG1   1 
ATOM   1297 C  CG2   . ILE A 1 168 ? 42.59292 0.41589   -9.22864  1.000 31.09011  ? 167 ILE A CG2   1 
ATOM   1298 C  CD1   . ILE A 1 168 ? 40.30090 -0.80682  -10.97843 1.000 26.85579  ? 167 ILE A CD1   1 
ATOM   1299 N  N     . LEU A 1 169 ? 42.20601 3.71666   -8.01840  1.000 30.32174  ? 168 LEU A N     1 
ATOM   1300 C  CA    . LEU A 1 169 ? 43.31743 4.50040   -7.49650  1.000 31.97752  ? 168 LEU A CA    1 
ATOM   1301 C  C     . LEU A 1 169 ? 42.97039 5.29572   -6.24437  1.000 34.85809  ? 168 LEU A C     1 
ATOM   1302 O  O     . LEU A 1 169 ? 43.87679 5.88487   -5.64579  1.000 36.11922  ? 168 LEU A O     1 
ATOM   1303 C  CB    . LEU A 1 169 ? 43.84558 5.46063   -8.56907  1.000 29.73629  ? 168 LEU A CB    1 
ATOM   1304 C  CG    . LEU A 1 169 ? 44.59371 4.87128   -9.76232  1.000 26.65171  ? 168 LEU A CG    1 
ATOM   1305 C  CD1   . LEU A 1 169 ? 44.61500 5.88524   -10.84391 1.000 26.24418  ? 168 LEU A CD1   1 
ATOM   1306 C  CD2   . LEU A 1 169 ? 46.01288 4.44791   -9.38624  1.000 23.71294  ? 168 LEU A CD2   1 
ATOM   1307 N  N     . GLU A 1 170 ? 41.69533 5.38513   -5.85343  1.000 37.61536  ? 169 GLU A N     1 
ATOM   1308 C  CA    . GLU A 1 170 ? 41.38232 6.21123   -4.68665  1.000 36.60513  ? 169 GLU A CA    1 
ATOM   1309 C  C     . GLU A 1 170 ? 42.11860 5.76755   -3.42689  1.000 37.09484  ? 169 GLU A C     1 
ATOM   1310 O  O     . GLU A 1 170 ? 42.77053 6.61735   -2.79369  1.000 39.78924  ? 169 GLU A O     1 
ATOM   1311 C  CB    . GLU A 1 170 ? 39.86927 6.26102   -4.47095  1.000 34.88795  ? 169 GLU A CB    1 
ATOM   1312 C  CG    . GLU A 1 170 ? 39.44059 7.39041   -3.54747  1.000 42.92365  ? 169 GLU A CG    1 
ATOM   1313 C  CD    . GLU A 1 170 ? 39.25352 6.95289   -2.11575  1.000 51.11086  ? 169 GLU A CD    1 
ATOM   1314 O  OE1   . GLU A 1 170 ? 38.97854 7.84632   -1.28578  1.000 54.88852  ? 169 GLU A OE1   1 
ATOM   1315 O  OE2   . GLU A 1 170 ? 39.36806 5.73093   -1.82051  1.000 47.19607  ? 169 GLU A OE2   1 
ATOM   1316 N  N     . PRO A 1 171 ? 42.06835 4.49315   -3.00838  1.000 38.87214  ? 170 PRO A N     1 
ATOM   1317 C  CA    . PRO A 1 171 ? 42.82859 4.08152   -1.81257  1.000 37.77442  ? 170 PRO A CA    1 
ATOM   1318 C  C     . PRO A 1 171 ? 44.31122 4.41783   -1.85048  1.000 35.26853  ? 170 PRO A C     1 
ATOM   1319 O  O     . PRO A 1 171 ? 44.86612 4.91223   -0.85339  1.000 36.18049  ? 170 PRO A O     1 
ATOM   1320 C  CB    . PRO A 1 171 ? 42.60829 2.56747   -1.78019  1.000 31.25621  ? 170 PRO A CB    1 
ATOM   1321 C  CG    . PRO A 1 171 ? 41.39402 2.34513   -2.49851  1.000 33.87449  ? 170 PRO A CG    1 
ATOM   1322 C  CD    . PRO A 1 171 ? 41.32780 3.35725   -3.58128  1.000 36.18947  ? 170 PRO A CD    1 
ATOM   1323 N  N     . PHE A 1 172 ? 44.98133 4.13391   -2.96677  1.000 34.15729  ? 171 PHE A N     1 
ATOM   1324 C  CA    . PHE A 1 172 ? 46.40204 4.46056   -3.05106  1.000 38.50353  ? 171 PHE A CA    1 
ATOM   1325 C  C     . PHE A 1 172 ? 46.62918 5.95347   -2.87965  1.000 36.78002  ? 171 PHE A C     1 
ATOM   1326 O  O     . PHE A 1 172 ? 47.61300 6.36543   -2.25218  1.000 36.25031  ? 171 PHE A O     1 
ATOM   1327 C  CB    . PHE A 1 172 ? 46.99894 3.98528   -4.37240  1.000 31.88825  ? 171 PHE A CB    1 
ATOM   1328 C  CG    . PHE A 1 172 ? 48.48171 4.20258   -4.47712  1.000 34.38659  ? 171 PHE A CG    1 
ATOM   1329 C  CD1   . PHE A 1 172 ? 48.99146 5.41658   -4.93679  1.000 35.48255  ? 171 PHE A CD1   1 
ATOM   1330 C  CD2   . PHE A 1 172 ? 49.37107 3.18679   -4.14727  1.000 30.17386  ? 171 PHE A CD2   1 
ATOM   1331 C  CE1   . PHE A 1 172 ? 50.36173 5.60933   -5.05075  1.000 32.15365  ? 171 PHE A CE1   1 
ATOM   1332 C  CE2   . PHE A 1 172 ? 50.73478 3.37165   -4.25190  1.000 31.59830  ? 171 PHE A CE2   1 
ATOM   1333 C  CZ    . PHE A 1 172 ? 51.23191 4.57855   -4.69835  1.000 35.75807  ? 171 PHE A CZ    1 
ATOM   1334 N  N     . ARG A 1 173 ? 45.72045 6.77966   -3.41271  1.000 34.26928  ? 172 ARG A N     1 
ATOM   1335 C  CA    . ARG A 1 173 ? 45.91126 8.22146   -3.31379  1.000 34.17611  ? 172 ARG A CA    1 
ATOM   1336 C  C     . ARG A 1 173 ? 45.74413 8.69241   -1.88637  1.000 35.56261  ? 172 ARG A C     1 
ATOM   1337 O  O     . ARG A 1 173 ? 46.56968 9.46678   -1.38824  1.000 37.78250  ? 172 ARG A O     1 
ATOM   1338 C  CB    . ARG A 1 173 ? 44.95300 8.96735   -4.23658  1.000 35.85445  ? 172 ARG A CB    1 
ATOM   1339 C  CG    . ARG A 1 173 ? 45.52298 9.26204   -5.62519  1.000 31.07113  ? 172 ARG A CG    1 
ATOM   1340 C  CD    . ARG A 1 173 ? 44.46452 9.87590   -6.50198  1.000 26.42183  ? 172 ARG A CD    1 
ATOM   1341 N  NE    . ARG A 1 173 ? 44.88122 9.99834   -7.89465  1.000 30.44934  ? 172 ARG A NE    1 
ATOM   1342 C  CZ    . ARG A 1 173 ? 44.17679 9.52534   -8.90835  1.000 30.43315  ? 172 ARG A CZ    1 
ATOM   1343 N  NH1   . ARG A 1 173 ? 43.02272 8.89984   -8.66011  1.000 36.01337  ? 172 ARG A NH1   1 
ATOM   1344 N  NH2   . ARG A 1 173 ? 44.61257 9.67495   -10.14984 1.000 25.93407  ? 172 ARG A NH2   1 
ATOM   1345 N  N     . LYS A 1 174 ? 44.68167 8.23659   -1.21192  1.000 37.09413  ? 173 LYS A N     1 
ATOM   1346 C  CA    . LYS A 1 174 ? 44.49459 8.59338   0.19353   1.000 38.85741  ? 173 LYS A CA    1 
ATOM   1347 C  C     . LYS A 1 174 ? 45.72760 8.23619   1.01076   1.000 39.61318  ? 173 LYS A C     1 
ATOM   1348 O  O     . LYS A 1 174 ? 46.23351 9.04814   1.79168   1.000 43.42098  ? 173 LYS A O     1 
ATOM   1349 C  CB    . LYS A 1 174 ? 43.26867 7.89033   0.77110   1.000 43.02379  ? 173 LYS A CB    1 
ATOM   1350 C  CG    . LYS A 1 174 ? 41.92596 8.43386   0.30675   1.000 51.51222  ? 173 LYS A CG    1 
ATOM   1351 C  CD    . LYS A 1 174 ? 41.56132 9.74474   1.00161   1.000 51.61118  ? 173 LYS A CD    1 
ATOM   1352 C  CE    . LYS A 1 174 ? 40.24223 10.25155  0.47532   1.000 49.29850  ? 173 LYS A CE    1 
ATOM   1353 N  NZ    . LYS A 1 174 ? 40.22408 10.11941  -1.01668  1.000 57.13117  ? 173 LYS A NZ    1 
ATOM   1354 N  N     . GLN A 1 175 ? 46.24284 7.02539   0.81886   1.000 40.45089  ? 174 GLN A N     1 
ATOM   1355 C  CA    . GLN A 1 175 ? 47.40482 6.60273   1.58744   1.000 39.07765  ? 174 GLN A CA    1 
ATOM   1356 C  C     . GLN A 1 175 ? 48.66489 7.35207   1.17687   1.000 36.96428  ? 174 GLN A C     1 
ATOM   1357 O  O     . GLN A 1 175 ? 49.59508 7.48693   1.97538   1.000 34.95922  ? 174 GLN A O     1 
ATOM   1358 C  CB    . GLN A 1 175 ? 47.60789 5.10221   1.41404   1.000 39.71098  ? 174 GLN A CB    1 
ATOM   1359 C  CG    . GLN A 1 175 ? 48.83580 4.57248   2.06282   1.000 39.51531  ? 174 GLN A CG    1 
ATOM   1360 C  CD    . GLN A 1 175 ? 48.83579 3.09474   2.06120   1.000 47.38793  ? 174 GLN A CD    1 
ATOM   1361 O  OE1   . GLN A 1 175 ? 47.76528 2.47112   2.13731   1.000 48.70756  ? 174 GLN A OE1   1 
ATOM   1362 N  NE2   . GLN A 1 175 ? 50.02726 2.49596   1.94893   1.000 50.07307  ? 174 GLN A NE2   1 
ATOM   1363 N  N     . ASN A 1 176 ? 48.72623 7.83011   -0.05340  1.000 34.73748  ? 175 ASN A N     1 
ATOM   1364 C  CA    . ASN A 1 176 ? 49.93627 8.44274   -0.59006  1.000 36.83534  ? 175 ASN A CA    1 
ATOM   1365 C  C     . ASN A 1 176 ? 49.61501 9.82084   -1.16175  1.000 40.39637  ? 175 ASN A C     1 
ATOM   1366 O  O     . ASN A 1 176 ? 49.80846 10.08883  -2.35150  1.000 41.93004  ? 175 ASN A O     1 
ATOM   1367 C  CB    . ASN A 1 176 ? 50.56349 7.51366   -1.62578  1.000 34.05257  ? 175 ASN A CB    1 
ATOM   1368 C  CG    . ASN A 1 176 ? 51.21018 6.31584   -0.98601  1.000 39.71581  ? 175 ASN A CG    1 
ATOM   1369 O  OD1   . ASN A 1 176 ? 52.27080 6.43052   -0.38234  1.000 44.77751  ? 175 ASN A OD1   1 
ATOM   1370 N  ND2   . ASN A 1 176 ? 50.56996 5.15315   -1.09350  1.000 45.40769  ? 175 ASN A ND2   1 
ATOM   1371 N  N     . PRO A 1 177 ? 49.13416 10.73707  -0.31973  1.000 46.01509  ? 176 PRO A N     1 
ATOM   1372 C  CA    . PRO A 1 177 ? 48.63229 12.01526  -0.84502  1.000 40.31539  ? 176 PRO A CA    1 
ATOM   1373 C  C     . PRO A 1 177 ? 49.68976 12.83628  -1.52611  1.000 43.62505  ? 176 PRO A C     1 
ATOM   1374 O  O     . PRO A 1 177 ? 49.35772 13.64337  -2.40128  1.000 50.56808  ? 176 PRO A O     1 
ATOM   1375 C  CB    . PRO A 1 177 ? 48.09988 12.72178  0.40291   1.000 37.30383  ? 176 PRO A CB    1 
ATOM   1376 C  CG    . PRO A 1 177 ? 48.86554 12.11610  1.52439   1.000 38.56322  ? 176 PRO A CG    1 
ATOM   1377 C  CD    . PRO A 1 177 ? 49.12228 10.70204  1.15582   1.000 41.79598  ? 176 PRO A CD    1 
ATOM   1378 N  N     . ASP A 1 178 ? 50.95908 12.64534  -1.18873  1.000 43.22997  ? 177 ASP A N     1 
ATOM   1379 C  CA    . ASP A 1 178 ? 52.00857 13.48100  -1.74514  1.000 43.27599  ? 177 ASP A CA    1 
ATOM   1380 C  C     . ASP A 1 178 ? 52.79836 12.78415  -2.84672  1.000 40.14262  ? 177 ASP A C     1 
ATOM   1381 O  O     . ASP A 1 178 ? 53.91617 13.19384  -3.16033  1.000 43.15881  ? 177 ASP A O     1 
ATOM   1382 C  CB    . ASP A 1 178 ? 52.89682 13.98595  -0.61222  1.000 46.34322  ? 177 ASP A CB    1 
ATOM   1383 C  CG    . ASP A 1 178 ? 52.18300 15.05966  0.22491   1.000 56.78143  ? 177 ASP A CG    1 
ATOM   1384 O  OD1   . ASP A 1 178 ? 51.99962 16.19437  -0.30686  1.000 61.56547  ? 177 ASP A OD1   1 
ATOM   1385 O  OD2   . ASP A 1 178 ? 51.75492 14.76053  1.37349   1.000 48.27656  ? 177 ASP A OD2   1 
ATOM   1386 N  N     . ILE A 1 179 ? 52.22360 11.75799  -3.45899  1.000 40.62675  ? 178 ILE A N     1 
ATOM   1387 C  CA    . ILE A 1 179 ? 52.69202 11.21812  -4.72702  1.000 38.98293  ? 178 ILE A CA    1 
ATOM   1388 C  C     . ILE A 1 179 ? 51.63839 11.54731  -5.77349  1.000 38.63150  ? 178 ILE A C     1 
ATOM   1389 O  O     . ILE A 1 179 ? 50.43954 11.36582  -5.53078  1.000 40.73891  ? 178 ILE A O     1 
ATOM   1390 C  CB    . ILE A 1 179 ? 52.94640 9.70671   -4.62215  1.000 39.56229  ? 178 ILE A CB    1 
ATOM   1391 C  CG1   . ILE A 1 179 ? 54.35467 9.48618   -4.09759  1.000 41.08960  ? 178 ILE A CG1   1 
ATOM   1392 C  CG2   . ILE A 1 179 ? 52.76935 9.00613   -5.96093  1.000 34.47248  ? 178 ILE A CG2   1 
ATOM   1393 C  CD1   . ILE A 1 179 ? 54.52482 8.16428   -3.49190  1.000 44.68412  ? 178 ILE A CD1   1 
ATOM   1394 N  N     . VAL A 1 180 ? 52.07107 12.06637  -6.91314  1.000 31.87333  ? 179 VAL A N     1 
ATOM   1395 C  CA    . VAL A 1 180 ? 51.15223 12.62393  -7.89344  1.000 36.80642  ? 179 VAL A CA    1 
ATOM   1396 C  C     . VAL A 1 180 ? 51.03511 11.65032  -9.05591  1.000 35.83016  ? 179 VAL A C     1 
ATOM   1397 O  O     . VAL A 1 180 ? 52.04438 11.18012  -9.59387  1.000 36.22578  ? 179 VAL A O     1 
ATOM   1398 C  CB    . VAL A 1 180 ? 51.58969 14.03688  -8.34993  1.000 34.09245  ? 179 VAL A CB    1 
ATOM   1399 C  CG1   . VAL A 1 180 ? 52.99028 14.04655  -8.89061  1.000 34.50921  ? 179 VAL A CG1   1 
ATOM   1400 C  CG2   . VAL A 1 180 ? 50.64721 14.56726  -9.40375  1.000 35.96331  ? 179 VAL A CG2   1 
ATOM   1401 N  N     . ILE A 1 181 ? 49.79669 11.33036  -9.42268  1.000 37.02473  ? 180 ILE A N     1 
ATOM   1402 C  CA    . ILE A 1 181 ? 49.47297 10.32039  -10.42651 1.000 33.54250  ? 180 ILE A CA    1 
ATOM   1403 C  C     . ILE A 1 181 ? 48.53648 10.99325  -11.41686 1.000 34.62774  ? 180 ILE A C     1 
ATOM   1404 O  O     . ILE A 1 181 ? 47.34384 11.15494  -11.13422 1.000 35.19489  ? 180 ILE A O     1 
ATOM   1405 C  CB    . ILE A 1 181 ? 48.80421 9.08250   -9.81322  1.000 37.23473  ? 180 ILE A CB    1 
ATOM   1406 C  CG1   . ILE A 1 181 ? 49.63245 8.52829   -8.65529  1.000 33.92039  ? 180 ILE A CG1   1 
ATOM   1407 C  CG2   . ILE A 1 181 ? 48.47184 8.02194   -10.87970 1.000 26.66080  ? 180 ILE A CG2   1 
ATOM   1408 C  CD1   . ILE A 1 181 ? 48.94474 7.38391   -7.96980  1.000 35.57873  ? 180 ILE A CD1   1 
ATOM   1409 N  N     . TYR A 1 182 ? 49.06765 11.40501  -12.56413 1.000 34.67036  ? 181 TYR A N     1 
ATOM   1410 C  CA    . TYR A 1 182 ? 48.23952 11.87036  -13.66953 1.000 34.52980  ? 181 TYR A CA    1 
ATOM   1411 C  C     . TYR A 1 182 ? 47.71532 10.65020  -14.41959 1.000 35.81136  ? 181 TYR A C     1 
ATOM   1412 O  O     . TYR A 1 182 ? 48.50537 9.82219   -14.89303 1.000 37.43510  ? 181 TYR A O     1 
ATOM   1413 C  CB    . TYR A 1 182 ? 49.03716 12.78178  -14.59900 1.000 32.27778  ? 181 TYR A CB    1 
ATOM   1414 C  CG    . TYR A 1 182 ? 49.00465 14.25858  -14.28365 1.000 34.28147  ? 181 TYR A CG    1 
ATOM   1415 C  CD1   . TYR A 1 182 ? 49.71430 14.78560  -13.21232 1.000 35.89975  ? 181 TYR A CD1   1 
ATOM   1416 C  CD2   . TYR A 1 182 ? 48.29002 15.14095  -15.09054 1.000 36.96044  ? 181 TYR A CD2   1 
ATOM   1417 C  CE1   . TYR A 1 182 ? 49.69049 16.14673  -12.93751 1.000 32.10438  ? 181 TYR A CE1   1 
ATOM   1418 C  CE2   . TYR A 1 182 ? 48.26206 16.50174  -14.83535 1.000 29.06782  ? 181 TYR A CE2   1 
ATOM   1419 C  CZ    . TYR A 1 182 ? 48.96553 17.00494  -13.76209 1.000 35.53070  ? 181 TYR A CZ    1 
ATOM   1420 O  OH    . TYR A 1 182 ? 48.95484 18.37801  -13.51566 1.000 39.28319  ? 181 TYR A OH    1 
ATOM   1421 N  N     . GLN A 1 183 ? 46.38885 10.55983  -14.54958 1.000 33.54837  ? 182 GLN A N     1 
ATOM   1422 C  CA    . GLN A 1 183 ? 45.66336 9.34794   -14.93264 1.000 28.93169  ? 182 GLN A CA    1 
ATOM   1423 C  C     . GLN A 1 183 ? 44.92878 9.57718   -16.25716 1.000 34.16640  ? 182 GLN A C     1 
ATOM   1424 O  O     . GLN A 1 183 ? 43.74089 9.90427   -16.25542 1.000 38.84312  ? 182 GLN A O     1 
ATOM   1425 C  CB    . GLN A 1 183 ? 44.70593 8.98819   -13.78876 1.000 31.36001  ? 182 GLN A CB    1 
ATOM   1426 C  CG    . GLN A 1 183 ? 43.78722 7.77692   -13.98785 1.000 32.36961  ? 182 GLN A CG    1 
ATOM   1427 C  CD    . GLN A 1 183 ? 42.56314 7.86516   -13.08494 1.000 32.87168  ? 182 GLN A CD    1 
ATOM   1428 O  OE1   . GLN A 1 183 ? 42.65205 8.27766   -11.91627 1.000 27.52992  ? 182 GLN A OE1   1 
ATOM   1429 N  NE2   . GLN A 1 183 ? 41.40484 7.50833   -13.63211 1.000 33.32511  ? 182 GLN A NE2   1 
ATOM   1430 N  N     . TYR A 1 184 ? 45.61049 9.39813   -17.40114 1.000 36.26039  ? 183 TYR A N     1 
ATOM   1431 C  CA    . TYR A 1 184 ? 44.94607 9.62679   -18.69038 1.000 32.18009  ? 183 TYR A CA    1 
ATOM   1432 C  C     . TYR A 1 184 ? 44.60870 8.28150   -19.31414 1.000 37.99074  ? 183 TYR A C     1 
ATOM   1433 O  O     . TYR A 1 184 ? 45.41535 7.63296   -19.98691 1.000 41.61855  ? 183 TYR A O     1 
ATOM   1434 C  CB    . TYR A 1 184 ? 45.73588 10.49824  -19.64745 1.000 31.53382  ? 183 TYR A CB    1 
ATOM   1435 C  CG    . TYR A 1 184 ? 44.86021 10.91497  -20.82326 1.000 29.88005  ? 183 TYR A CG    1 
ATOM   1436 C  CD1   . TYR A 1 184 ? 43.92724 11.93900  -20.69381 1.000 27.14290  ? 183 TYR A CD1   1 
ATOM   1437 C  CD2   . TYR A 1 184 ? 44.92300 10.24125  -22.03212 1.000 31.15763  ? 183 TYR A CD2   1 
ATOM   1438 C  CE1   . TYR A 1 184 ? 43.11932 12.29861  -21.74664 1.000 31.88256  ? 183 TYR A CE1   1 
ATOM   1439 C  CE2   . TYR A 1 184 ? 44.11871 10.58633  -23.09829 1.000 31.42709  ? 183 TYR A CE2   1 
ATOM   1440 C  CZ    . TYR A 1 184 ? 43.21511 11.61794  -22.95795 1.000 36.36923  ? 183 TYR A CZ    1 
ATOM   1441 O  OH    . TYR A 1 184 ? 42.40806 11.97323  -24.03114 1.000 36.85220  ? 183 TYR A OH    1 
ATOM   1442 N  N     . MET A 1 185 ? 43.40615 7.84864   -18.98519 1.000 43.62084  ? 184 MET A N     1 
ATOM   1443 C  CA    . MET A 1 185 ? 42.68341 6.64255   -19.35832 1.000 37.78251  ? 184 MET A CA    1 
ATOM   1444 C  C     . MET A 1 185 ? 43.32060 5.37140   -18.83023 1.000 36.43669  ? 184 MET A C     1 
ATOM   1445 O  O     . MET A 1 185 ? 42.77383 4.78611   -17.91267 1.000 45.86017  ? 184 MET A O     1 
ATOM   1446 C  CB    . MET A 1 185 ? 42.59610 6.55206   -20.88072 1.000 33.33212  ? 184 MET A CB    1 
ATOM   1447 C  CG    . MET A 1 185 ? 41.95008 5.27219   -21.39291 1.000 42.50618  ? 184 MET A CG    1 
ATOM   1448 S  SD    . MET A 1 185 ? 40.17717 5.47289   -21.67486 1.000 43.53259  ? 184 MET A SD    1 
ATOM   1449 C  CE    . MET A 1 185 ? 40.25427 6.92866   -22.72360 1.000 39.83562  ? 184 MET A CE    1 
ATOM   1450 N  N     . ASP A 1 186 ? 44.56930 5.11520   -19.10627 1.000 37.76445  ? 185 ASP A N     1 
ATOM   1451 C  CA    . ASP A 1 186 ? 45.23048 4.01192   -18.42365 1.000 41.07654  ? 185 ASP A CA    1 
ATOM   1452 C  C     . ASP A 1 186 ? 46.72325 4.29775   -18.41864 1.000 44.16576  ? 185 ASP A C     1 
ATOM   1453 O  O     . ASP A 1 186 ? 47.52428 3.48849   -17.94544 1.000 40.08576  ? 185 ASP A O     1 
ATOM   1454 C  CB    . ASP A 1 186 ? 44.86906 2.64935   -19.05664 1.000 38.64820  ? 185 ASP A CB    1 
ATOM   1455 C  CG    . ASP A 1 186 ? 45.72202 2.30170   -20.27097 1.000 41.95044  ? 185 ASP A CG    1 
ATOM   1456 O  OD1   . ASP A 1 186 ? 46.02855 3.23091   -21.07905 1.000 46.88699  ? 185 ASP A OD1   1 
ATOM   1457 O  OD2   . ASP A 1 186 ? 46.08705 1.12168   -20.42312 1.000 35.90575  ? 185 ASP A OD2   1 
ATOM   1458 N  N     . ASP A 1 187 ? 47.07952 5.44004   -18.99382 1.000 40.82581  ? 186 ASP A N     1 
ATOM   1459 C  CA    . ASP A 1 187 ? 48.41749 5.98141   -18.89919 1.000 41.57785  ? 186 ASP A CA    1 
ATOM   1460 C  C     . ASP A 1 187 ? 48.55881 6.59059   -17.52249 1.000 39.45151  ? 186 ASP A C     1 
ATOM   1461 O  O     . ASP A 1 187 ? 47.66872 7.31958   -17.07636 1.000 43.82500  ? 186 ASP A O     1 
ATOM   1462 C  CB    . ASP A 1 187 ? 48.62477 7.05709   -19.96360 1.000 44.82862  ? 186 ASP A CB    1 
ATOM   1463 C  CG    . ASP A 1 187 ? 49.94781 6.95370   -20.66171 1.000 48.63631  ? 186 ASP A CG    1 
ATOM   1464 O  OD1   . ASP A 1 187 ? 50.62446 5.89076   -20.58970 1.000 52.25134  ? 186 ASP A OD1   1 
ATOM   1465 O  OD2   . ASP A 1 187 ? 50.29954 7.96092   -21.31212 1.000 51.98186  ? 186 ASP A OD2   1 
ATOM   1466 N  N     . LEU A 1 188 ? 49.65478 6.28723   -16.84110 1.000 37.73030  ? 187 LEU A N     1 
ATOM   1467 C  CA    . LEU A 1 188 ? 49.94547 6.86246   -15.53869 1.000 37.15198  ? 187 LEU A CA    1 
ATOM   1468 C  C     . LEU A 1 188 ? 51.30099 7.56336   -15.58954 1.000 40.60462  ? 187 LEU A C     1 
ATOM   1469 O  O     . LEU A 1 188 ? 52.33115 6.92420   -15.85483 1.000 40.19251  ? 187 LEU A O     1 
ATOM   1470 C  CB    . LEU A 1 188 ? 49.91949 5.78280   -14.46189 1.000 33.41307  ? 187 LEU A CB    1 
ATOM   1471 C  CG    . LEU A 1 188 ? 48.60611 5.00560   -14.40406 1.000 37.86071  ? 187 LEU A CG    1 
ATOM   1472 C  CD1   . LEU A 1 188 ? 48.64592 3.90582   -13.35276 1.000 35.10870  ? 187 LEU A CD1   1 
ATOM   1473 C  CD2   . LEU A 1 188 ? 47.43816 5.93693   -14.15622 1.000 36.08184  ? 187 LEU A CD2   1 
ATOM   1474 N  N     . TYR A 1 189 ? 51.29037 8.87619   -15.35945 1.000 32.14206  ? 188 TYR A N     1 
ATOM   1475 C  CA    . TYR A 1 189 ? 52.49509 9.60081   -14.99341 1.000 32.63362  ? 188 TYR A CA    1 
ATOM   1476 C  C     . TYR A 1 189 ? 52.54599 9.67635   -13.47208 1.000 32.89534  ? 188 TYR A C     1 
ATOM   1477 O  O     . TYR A 1 189 ? 51.57710 10.10382  -12.84518 1.000 34.18256  ? 188 TYR A O     1 
ATOM   1478 C  CB    . TYR A 1 189 ? 52.47628 10.99186  -15.62945 1.000 36.51656  ? 188 TYR A CB    1 
ATOM   1479 C  CG    . TYR A 1 189 ? 53.46611 11.98933  -15.07123 1.000 32.73571  ? 188 TYR A CG    1 
ATOM   1480 C  CD1   . TYR A 1 189 ? 53.18558 12.70374  -13.91389 1.000 30.94952  ? 188 TYR A CD1   1 
ATOM   1481 C  CD2   . TYR A 1 189 ? 54.66180 12.23917  -15.71962 1.000 34.03156  ? 188 TYR A CD2   1 
ATOM   1482 C  CE1   . TYR A 1 189 ? 54.07401 13.60378  -13.39930 1.000 35.58250  ? 188 TYR A CE1   1 
ATOM   1483 C  CE2   . TYR A 1 189 ? 55.56676 13.14707  -15.21382 1.000 40.30075  ? 188 TYR A CE2   1 
ATOM   1484 C  CZ    . TYR A 1 189 ? 55.26586 13.83817  -14.05271 1.000 42.51638  ? 188 TYR A CZ    1 
ATOM   1485 O  OH    . TYR A 1 189 ? 56.16030 14.75870  -13.53504 1.000 46.11022  ? 188 TYR A OH    1 
ATOM   1486 N  N     . VAL A 1 190 ? 53.65340 9.24321   -12.87192 1.000 32.34511  ? 189 VAL A N     1 
ATOM   1487 C  CA    . VAL A 1 190 ? 53.78484 9.16855   -11.41745 1.000 34.23029  ? 189 VAL A CA    1 
ATOM   1488 C  C     . VAL A 1 190 ? 55.00848 9.96906   -10.99378 1.000 38.41922  ? 189 VAL A C     1 
ATOM   1489 O  O     . VAL A 1 190 ? 56.13602 9.65456   -11.39918 1.000 37.58988  ? 189 VAL A O     1 
ATOM   1490 C  CB    . VAL A 1 190 ? 53.91322 7.72464   -10.91610 1.000 33.60745  ? 189 VAL A CB    1 
ATOM   1491 C  CG1   . VAL A 1 190 ? 53.79983 7.70982   -9.40026  1.000 34.75157  ? 189 VAL A CG1   1 
ATOM   1492 C  CG2   . VAL A 1 190 ? 52.85418 6.83195   -11.54522 1.000 35.51483  ? 189 VAL A CG2   1 
ATOM   1493 N  N     . GLY A 1 191 ? 54.79099 10.96255  -10.15019 1.000 35.26637  ? 190 GLY A N     1 
ATOM   1494 C  CA    . GLY A 1 191 ? 55.86951 11.84094  -9.72016  1.000 35.46355  ? 190 GLY A CA    1 
ATOM   1495 C  C     . GLY A 1 191 ? 55.96848 11.89819  -8.21827  1.000 33.34362  ? 190 GLY A C     1 
ATOM   1496 O  O     . GLY A 1 191 ? 54.96670 11.88849  -7.51911  1.000 36.90590  ? 190 GLY A O     1 
ATOM   1497 N  N     . SER A 1 192 ? 57.19416 11.91495  -7.73116  1.000 34.68639  ? 191 SER A N     1 
ATOM   1498 C  CA    . SER A 1 192 ? 57.40957 12.05979  -6.30553  1.000 39.53341  ? 191 SER A CA    1 
ATOM   1499 C  C     . SER A 1 192 ? 58.63166 12.92246  -6.06674  1.000 44.18571  ? 191 SER A C     1 
ATOM   1500 O  O     . SER A 1 192 ? 59.46395 13.12219  -6.95651  1.000 46.67964  ? 191 SER A O     1 
ATOM   1501 C  CB    . SER A 1 192 ? 57.57290 10.70743  -5.58844  1.000 41.26208  ? 191 SER A CB    1 
ATOM   1502 O  OG    . SER A 1 192 ? 58.83984 10.12577  -5.83426  1.000 39.96468  ? 191 SER A OG    1 
ATOM   1503 N  N     . ASP A 1 193 ? 58.71379 13.43843  -4.84330  1.000 42.22306  ? 192 ASP A N     1 
ATOM   1504 C  CA    . ASP A 1 193 ? 59.87363 14.17858  -4.37968  1.000 45.03936  ? 192 ASP A CA    1 
ATOM   1505 C  C     . ASP A 1 193 ? 60.81627 13.30386  -3.56977  1.000 44.19223  ? 192 ASP A C     1 
ATOM   1506 O  O     . ASP A 1 193 ? 61.42269 13.77836  -2.60585  1.000 45.52443  ? 192 ASP A O     1 
ATOM   1507 C  CB    . ASP A 1 193 ? 59.41950 15.37807  -3.55731  1.000 48.32047  ? 192 ASP A CB    1 
ATOM   1508 C  CG    . ASP A 1 193 ? 58.77464 16.44817  -4.40797  1.000 55.05407  ? 192 ASP A CG    1 
ATOM   1509 O  OD1   . ASP A 1 193 ? 59.41348 16.88184  -5.39852  1.000 52.32974  ? 192 ASP A OD1   1 
ATOM   1510 O  OD2   . ASP A 1 193 ? 57.62639 16.84054  -4.08392  1.000 55.39192  ? 192 ASP A OD2   1 
ATOM   1511 N  N     . LEU A 1 194 ? 60.91009 12.02376  -3.91842  1.000 43.07151  ? 193 LEU A N     1 
ATOM   1512 C  CA    . LEU A 1 194 ? 61.71719 11.04391  -3.20736  1.000 38.53830  ? 193 LEU A CA    1 
ATOM   1513 C  C     . LEU A 1 194 ? 62.99052 10.76002  -3.98453  1.000 37.62099  ? 193 LEU A C     1 
ATOM   1514 O  O     . LEU A 1 194 ? 63.07101 10.98781  -5.19018  1.000 39.68265  ? 193 LEU A O     1 
ATOM   1515 C  CB    . LEU A 1 194 ? 60.92764 9.75002   -3.00349  1.000 36.94405  ? 193 LEU A CB    1 
ATOM   1516 C  CG    . LEU A 1 194 ? 59.53496 9.94761   -2.37701  1.000 38.98431  ? 193 LEU A CG    1 
ATOM   1517 C  CD1   . LEU A 1 194 ? 58.64032 8.74932   -2.60100  1.000 37.07934  ? 193 LEU A CD1   1 
ATOM   1518 C  CD2   . LEU A 1 194 ? 59.62150 10.25213  -0.89002  1.000 35.06984  ? 193 LEU A CD2   1 
ATOM   1519 N  N     . GLU A 1 195 ? 64.00011 10.26896  -3.28053  1.000 41.79764  ? 194 GLU A N     1 
ATOM   1520 C  CA    . GLU A 1 195 ? 65.18588 9.79103   -3.97781  1.000 41.06893  ? 194 GLU A CA    1 
ATOM   1521 C  C     . GLU A 1 195 ? 64.83515 8.53571   -4.78200  1.000 37.19858  ? 194 GLU A C     1 
ATOM   1522 O  O     . GLU A 1 195 ? 63.91922 7.78587   -4.43624  1.000 38.32163  ? 194 GLU A O     1 
ATOM   1523 C  CB    . GLU A 1 195 ? 66.32191 9.52633   -2.98091  1.000 35.10698  ? 194 GLU A CB    1 
ATOM   1524 N  N     . ILE A 1 196 ? 65.57694 8.31389   -5.86805  1.000 37.07352  ? 195 ILE A N     1 
ATOM   1525 C  CA    . ILE A 1 196 ? 65.21123 7.29705   -6.86217  1.000 39.88314  ? 195 ILE A CA    1 
ATOM   1526 C  C     . ILE A 1 196 ? 64.89212 5.94274   -6.21579  1.000 41.53271  ? 195 ILE A C     1 
ATOM   1527 O  O     . ILE A 1 196 ? 63.94095 5.25965   -6.61460  1.000 40.42068  ? 195 ILE A O     1 
ATOM   1528 C  CB    . ILE A 1 196 ? 66.32400 7.17574   -7.92507  1.000 31.98333  ? 195 ILE A CB    1 
ATOM   1529 C  CG1   . ILE A 1 196 ? 65.87776 6.30867   -9.10044  1.000 40.31087  ? 195 ILE A CG1   1 
ATOM   1530 C  CG2   . ILE A 1 196 ? 67.58354 6.64845   -7.31970  1.000 27.95076  ? 195 ILE A CG2   1 
ATOM   1531 C  CD1   . ILE A 1 196 ? 64.62302 6.80896   -9.78106  1.000 41.98755  ? 195 ILE A CD1   1 
ATOM   1532 N  N     . GLY A 1 197 ? 65.65109 5.53712   -5.20449  1.000 37.30597  ? 196 GLY A N     1 
ATOM   1533 C  CA    . GLY A 1 197 ? 65.35730 4.25558   -4.59021  1.000 37.33864  ? 196 GLY A CA    1 
ATOM   1534 C  C     . GLY A 1 197 ? 63.99411 4.17903   -3.92622  1.000 41.55094  ? 196 GLY A C     1 
ATOM   1535 O  O     . GLY A 1 197 ? 63.17231 3.30314   -4.24011  1.000 45.91566  ? 196 GLY A O     1 
ATOM   1536 N  N     . GLN A 1 198 ? 63.74902 5.08867   -2.98539  1.000 41.39235  ? 197 GLN A N     1 
ATOM   1537 C  CA    . GLN A 1 198 ? 62.45536 5.12124   -2.31388  1.000 41.96972  ? 197 GLN A CA    1 
ATOM   1538 C  C     . GLN A 1 198 ? 61.31999 5.30028   -3.31462  1.000 44.43887  ? 197 GLN A C     1 
ATOM   1539 O  O     . GLN A 1 198 ? 60.22652 4.73739   -3.14886  1.000 46.69834  ? 197 GLN A O     1 
ATOM   1540 C  CB    . GLN A 1 198 ? 62.44848 6.24122   -1.28649  1.000 37.54830  ? 197 GLN A CB    1 
ATOM   1541 C  CG    . GLN A 1 198 ? 61.37622 6.10845   -0.25818  1.000 41.73113  ? 197 GLN A CG    1 
ATOM   1542 C  CD    . GLN A 1 198 ? 61.43184 7.23391   0.73223   1.000 48.40880  ? 197 GLN A CD    1 
ATOM   1543 O  OE1   . GLN A 1 198 ? 62.43097 7.95381   0.80337   1.000 51.84065  ? 197 GLN A OE1   1 
ATOM   1544 N  NE2   . GLN A 1 198 ? 60.35557 7.41321   1.49565   1.000 48.39069  ? 197 GLN A NE2   1 
ATOM   1545 N  N     . HIS A 1 199 ? 61.57040 6.06357   -4.37619  1.000 41.56088  ? 198 HIS A N     1 
ATOM   1546 C  CA    . HIS A 1 199 ? 60.55606 6.24271   -5.40031  1.000 37.06491  ? 198 HIS A CA    1 
ATOM   1547 C  C     . HIS A 1 199 ? 60.21131 4.90733   -6.04352  1.000 38.72285  ? 198 HIS A C     1 
ATOM   1548 O  O     . HIS A 1 199 ? 59.03420 4.54364   -6.13293  1.000 36.98127  ? 198 HIS A O     1 
ATOM   1549 C  CB    . HIS A 1 199 ? 61.04290 7.27690   -6.42271  1.000 35.43821  ? 198 HIS A CB    1 
ATOM   1550 C  CG    . HIS A 1 199 ? 60.19270 7.38089   -7.64693  1.000 33.36502  ? 198 HIS A CG    1 
ATOM   1551 N  ND1   . HIS A 1 199 ? 59.03279 8.12123   -7.68671  1.000 35.94489  ? 198 HIS A ND1   1 
ATOM   1552 C  CD2   . HIS A 1 199 ? 60.34372 6.84812   -8.88325  1.000 32.95019  ? 198 HIS A CD2   1 
ATOM   1553 C  CE1   . HIS A 1 199 ? 58.49808 8.02702   -8.89292  1.000 37.57884  ? 198 HIS A CE1   1 
ATOM   1554 N  NE2   . HIS A 1 199 ? 59.27545 7.26099   -9.63776  1.000 31.74225  ? 198 HIS A NE2   1 
ATOM   1555 N  N     . ARG A 1 200 ? 61.23345 4.15028   -6.47111  1.000 42.11428  ? 199 ARG A N     1 
ATOM   1556 C  CA    . ARG A 1 200 ? 60.99644 2.85756   -7.11918  1.000 42.14222  ? 199 ARG A CA    1 
ATOM   1557 C  C     . ARG A 1 200 ? 60.26184 1.90190   -6.19192  1.000 39.88497  ? 199 ARG A C     1 
ATOM   1558 O  O     . ARG A 1 200 ? 59.40239 1.12933   -6.62534  1.000 39.31595  ? 199 ARG A O     1 
ATOM   1559 C  CB    . ARG A 1 200 ? 62.32088 2.25145   -7.56421  1.000 38.43835  ? 199 ARG A CB    1 
ATOM   1560 C  CG    . ARG A 1 200 ? 63.07174 3.13729   -8.54804  1.000 46.71474  ? 199 ARG A CG    1 
ATOM   1561 C  CD    . ARG A 1 200 ? 63.10584 2.52619   -9.92972  1.000 55.06459  ? 199 ARG A CD    1 
ATOM   1562 N  NE    . ARG A 1 200 ? 63.83089 3.34710   -10.89383 1.000 56.31224  ? 199 ARG A NE    1 
ATOM   1563 C  CZ    . ARG A 1 200 ? 65.14869 3.29752   -11.07221 1.000 63.21486  ? 199 ARG A CZ    1 
ATOM   1564 N  NH1   . ARG A 1 200 ? 65.89521 2.47195   -10.33526 1.000 60.22919  ? 199 ARG A NH1   1 
ATOM   1565 N  NH2   . ARG A 1 200 ? 65.71965 4.07559   -11.98708 1.000 60.18239  ? 199 ARG A NH2   1 
ATOM   1566 N  N     . THR A 1 201 ? 60.56693 1.96148   -4.90438  1.000 39.40111  ? 200 THR A N     1 
ATOM   1567 C  CA    . THR A 1 201 ? 59.80422 1.17060   -3.94690  1.000 42.29502  ? 200 THR A CA    1 
ATOM   1568 C  C     . THR A 1 201 ? 58.32150 1.56528   -3.94064  1.000 44.26424  ? 200 THR A C     1 
ATOM   1569 O  O     . THR A 1 201 ? 57.43352 0.69803   -3.94106  1.000 42.61203  ? 200 THR A O     1 
ATOM   1570 C  CB    . THR A 1 201 ? 60.45087 1.32141   -2.57344  1.000 41.12903  ? 200 THR A CB    1 
ATOM   1571 O  OG1   . THR A 1 201 ? 61.42255 0.28282   -2.42350  1.000 41.59207  ? 200 THR A OG1   1 
ATOM   1572 C  CG2   . THR A 1 201 ? 59.43013 1.24911   -1.44614  1.000 45.72361  ? 200 THR A CG2   1 
ATOM   1573 N  N     . LYS A 1 202 ? 58.03259 2.86988   -3.94437  1.000 40.47082  ? 201 LYS A N     1 
ATOM   1574 C  CA    . LYS A 1 202 ? 56.64067 3.30393   -3.98026  1.000 37.26373  ? 201 LYS A CA    1 
ATOM   1575 C  C     . LYS A 1 202 ? 55.95703 2.88697   -5.27662  1.000 41.04198  ? 201 LYS A C     1 
ATOM   1576 O  O     . LYS A 1 202 ? 54.76674 2.54876   -5.28450  1.000 41.48045  ? 201 LYS A O     1 
ATOM   1577 C  CB    . LYS A 1 202 ? 56.55604 4.81681   -3.80142  1.000 37.24302  ? 201 LYS A CB    1 
ATOM   1578 C  CG    . LYS A 1 202 ? 55.75511 5.21430   -2.57606  1.000 40.93565  ? 201 LYS A CG    1 
ATOM   1579 C  CD    . LYS A 1 202 ? 56.55424 5.07088   -1.29318  1.000 42.89788  ? 201 LYS A CD    1 
ATOM   1580 C  CE    . LYS A 1 202 ? 55.68355 5.37153   -0.10187  1.000 43.33307  ? 201 LYS A CE    1 
ATOM   1581 N  NZ    . LYS A 1 202 ? 54.50245 4.47936   -0.15041  1.000 45.21133  ? 201 LYS A NZ    1 
ATOM   1582 N  N     . ILE A 1 203 ? 56.69059 2.91826   -6.38678  1.000 41.49141  ? 202 ILE A N     1 
ATOM   1583 C  CA    . ILE A 1 203 ? 56.12343 2.47599   -7.65542  1.000 37.49923  ? 202 ILE A CA    1 
ATOM   1584 C  C     . ILE A 1 203 ? 55.79434 0.99477   -7.59953  1.000 38.15174  ? 202 ILE A C     1 
ATOM   1585 O  O     . ILE A 1 203 ? 54.80129 0.54525   -8.17698  1.000 41.16088  ? 202 ILE A O     1 
ATOM   1586 C  CB    . ILE A 1 203 ? 57.07712 2.78985   -8.81709  1.000 37.20056  ? 202 ILE A CB    1 
ATOM   1587 C  CG1   . ILE A 1 203 ? 57.21290 4.29954   -8.97833  1.000 41.99664  ? 202 ILE A CG1   1 
ATOM   1588 C  CG2   . ILE A 1 203 ? 56.55715 2.19127   -10.09666 1.000 32.56454  ? 202 ILE A CG2   1 
ATOM   1589 C  CD1   . ILE A 1 203 ? 55.87831 4.99085   -9.04045  1.000 38.02240  ? 202 ILE A CD1   1 
ATOM   1590 N  N     . GLU A 1 204 ? 56.62206 0.20625   -6.92243  1.000 37.06395  ? 203 GLU A N     1 
ATOM   1591 C  CA    . GLU A 1 204 ? 56.28259 -1.20669  -6.80449  1.000 41.87000  ? 203 GLU A CA    1 
ATOM   1592 C  C     . GLU A 1 204 ? 55.02250 -1.39079  -5.97220  1.000 39.03902  ? 203 GLU A C     1 
ATOM   1593 O  O     . GLU A 1 204 ? 54.16748 -2.22426  -6.30407  1.000 40.94776  ? 203 GLU A O     1 
ATOM   1594 C  CB    . GLU A 1 204 ? 57.44854 -2.00123  -6.21900  1.000 41.64348  ? 203 GLU A CB    1 
ATOM   1595 C  CG    . GLU A 1 204 ? 58.56028 -2.25534  -7.21811  1.000 44.92653  ? 203 GLU A CG    1 
ATOM   1596 C  CD    . GLU A 1 204 ? 58.02837 -2.78790  -8.53632  1.000 54.18395  ? 203 GLU A CD    1 
ATOM   1597 O  OE1   . GLU A 1 204 ? 57.24798 -3.78330  -8.50420  1.000 51.43382  ? 203 GLU A OE1   1 
ATOM   1598 O  OE2   . GLU A 1 204 ? 58.37675 -2.19341  -9.59314  1.000 50.34902  ? 203 GLU A OE2   1 
ATOM   1599 N  N     . GLU A 1 205 ? 54.89965 -0.62251  -4.88844  1.000 36.97934  ? 204 GLU A N     1 
ATOM   1600 C  CA    . GLU A 1 205 ? 53.64908 -0.59018  -4.13872  1.000 34.84662  ? 204 GLU A CA    1 
ATOM   1601 C  C     . GLU A 1 205 ? 52.47490 -0.31903  -5.06685  1.000 38.18308  ? 204 GLU A C     1 
ATOM   1602 O  O     . GLU A 1 205 ? 51.44063 -0.98492  -4.99105  1.000 41.17656  ? 204 GLU A O     1 
ATOM   1603 C  CB    . GLU A 1 205 ? 53.70536 0.47519   -3.04480  1.000 36.76133  ? 204 GLU A CB    1 
ATOM   1604 C  CG    . GLU A 1 205 ? 52.95056 0.08939   -1.80100  1.000 42.69798  ? 204 GLU A CG    1 
ATOM   1605 C  CD    . GLU A 1 205 ? 52.17129 1.23323   -1.15786  1.000 46.90798  ? 204 GLU A CD    1 
ATOM   1606 O  OE1   . GLU A 1 205 ? 50.93891 1.31057   -1.37426  1.000 50.07882  ? 204 GLU A OE1   1 
ATOM   1607 O  OE2   . GLU A 1 205 ? 52.77825 2.03582   -0.41880  1.000 46.13140  ? 204 GLU A OE2   1 
ATOM   1608 N  N     . LEU A 1 206 ? 52.62490 0.65774   -5.96403  1.000 39.53470  ? 205 LEU A N     1 
ATOM   1609 C  CA    . LEU A 1 206 ? 51.51715 1.01767   -6.84066  1.000 33.26940  ? 205 LEU A CA    1 
ATOM   1610 C  C     . LEU A 1 206 ? 51.21547 -0.09622  -7.82880  1.000 36.16451  ? 205 LEU A C     1 
ATOM   1611 O  O     . LEU A 1 206 ? 50.04585 -0.38603  -8.11775  1.000 37.28127  ? 205 LEU A O     1 
ATOM   1612 C  CB    . LEU A 1 206 ? 51.81949 2.31989   -7.57012  1.000 32.98752  ? 205 LEU A CB    1 
ATOM   1613 C  CG    . LEU A 1 206 ? 50.81256 2.76686   -8.63934  1.000 30.79992  ? 205 LEU A CG    1 
ATOM   1614 C  CD1   . LEU A 1 206 ? 49.43799 2.94285   -8.07792  1.000 25.38002  ? 205 LEU A CD1   1 
ATOM   1615 C  CD2   . LEU A 1 206 ? 51.28722 4.05975   -9.27333  1.000 34.61510  ? 205 LEU A CD2   1 
ATOM   1616 N  N     . ARG A 1 207 ? 52.25176 -0.72883  -8.36709  1.000 36.90596  ? 206 ARG A N     1 
ATOM   1617 C  CA    . ARG A 1 207 ? 52.00725 -1.80628  -9.31104  1.000 37.02080  ? 206 ARG A CA    1 
ATOM   1618 C  C     . ARG A 1 207 ? 51.26431 -2.93830  -8.63936  1.000 38.33250  ? 206 ARG A C     1 
ATOM   1619 O  O     . ARG A 1 207 ? 50.33166 -3.51075  -9.21526  1.000 41.56045  ? 206 ARG A O     1 
ATOM   1620 C  CB    . ARG A 1 207 ? 53.31158 -2.31038  -9.89272  1.000 40.90095  ? 206 ARG A CB    1 
ATOM   1621 C  CG    . ARG A 1 207 ? 53.96012 -1.36092  -10.83463 1.000 42.72770  ? 206 ARG A CG    1 
ATOM   1622 C  CD    . ARG A 1 207 ? 55.37154 -1.80509  -11.04038 1.000 41.97701  ? 206 ARG A CD    1 
ATOM   1623 N  NE    . ARG A 1 207 ? 55.57447 -2.26633  -12.39268 1.000 48.01536  ? 206 ARG A NE    1 
ATOM   1624 C  CZ    . ARG A 1 207 ? 55.55437 -3.53873  -12.76996 1.000 50.47840  ? 206 ARG A CZ    1 
ATOM   1625 N  NH1   . ARG A 1 207 ? 55.77217 -3.82063  -14.05455 1.000 47.67701  ? 206 ARG A NH1   1 
ATOM   1626 N  NH2   . ARG A 1 207 ? 55.32747 -4.50766  -11.88281 1.000 36.28583  ? 206 ARG A NH2   1 
ATOM   1627 N  N     . GLN A 1 208 ? 51.65144 -3.26584  -7.41186  1.000 36.86570  ? 207 GLN A N     1 
ATOM   1628 C  CA    . GLN A 1 208 ? 50.96758 -4.34524  -6.72434  1.000 38.38143  ? 207 GLN A CA    1 
ATOM   1629 C  C     . GLN A 1 208 ? 49.55544 -3.94102  -6.34406  1.000 42.83037  ? 207 GLN A C     1 
ATOM   1630 O  O     . GLN A 1 208 ? 48.63674 -4.76925  -6.41597  1.000 37.47825  ? 207 GLN A O     1 
ATOM   1631 C  CB    . GLN A 1 208 ? 51.76105 -4.78535  -5.50334  1.000 42.78099  ? 207 GLN A CB    1 
ATOM   1632 C  CG    . GLN A 1 208 ? 52.61222 -5.99646  -5.80110  1.000 52.88153  ? 207 GLN A CG    1 
ATOM   1633 C  CD    . GLN A 1 208 ? 53.15940 -6.62628  -4.54801  1.000 72.59429  ? 207 GLN A CD    1 
ATOM   1634 O  OE1   . GLN A 1 208 ? 52.40061 -6.97290  -3.63333  1.000 71.62114  ? 207 GLN A OE1   1 
ATOM   1635 N  NE2   . GLN A 1 208 ? 54.49083 -6.76766  -4.48118  1.000 74.55167  ? 207 GLN A NE2   1 
ATOM   1636 N  N     . HIS A 1 209 ? 49.35829 -2.67137  -5.95041  1.000 41.07449  ? 208 HIS A N     1 
ATOM   1637 C  CA    . HIS A 1 209 ? 48.01069 -2.16940  -5.70565  1.000 32.31939  ? 208 HIS A CA    1 
ATOM   1638 C  C     . HIS A 1 209 ? 47.12378 -2.38835  -6.92074  1.000 34.63798  ? 208 HIS A C     1 
ATOM   1639 O  O     . HIS A 1 209 ? 45.99684 -2.88031  -6.80393  1.000 36.70936  ? 208 HIS A O     1 
ATOM   1640 C  CB    . HIS A 1 209 ? 48.03802 -0.68821  -5.34230  1.000 33.36780  ? 208 HIS A CB    1 
ATOM   1641 C  CG    . HIS A 1 209 ? 46.67042 -0.11086  -5.13817  1.000 35.65046  ? 208 HIS A CG    1 
ATOM   1642 N  ND1   . HIS A 1 209 ? 46.02926 -0.12528  -3.91632  1.000 36.02661  ? 208 HIS A ND1   1 
ATOM   1643 C  CD2   . HIS A 1 209 ? 45.79666 0.44017   -6.01255  1.000 31.93426  ? 208 HIS A CD2   1 
ATOM   1644 C  CE1   . HIS A 1 209 ? 44.83100 0.41389   -4.04140  1.000 33.68106  ? 208 HIS A CE1   1 
ATOM   1645 N  NE2   . HIS A 1 209 ? 44.66105 0.75621   -5.30522  1.000 35.26465  ? 208 HIS A NE2   1 
ATOM   1646 N  N     . LEU A 1 210 ? 47.62253 -2.02473  -8.10372  1.000 36.31707  ? 209 LEU A N     1 
ATOM   1647 C  CA    . LEU A 1 210 ? 46.83877 -2.19351  -9.32557  1.000 35.41613  ? 209 LEU A CA    1 
ATOM   1648 C  C     . LEU A 1 210 ? 46.60623 -3.66567  -9.64205  1.000 38.75221  ? 209 LEU A C     1 
ATOM   1649 O  O     . LEU A 1 210 ? 45.53993 -4.03779  -10.14995 1.000 36.02149  ? 209 LEU A O     1 
ATOM   1650 C  CB    . LEU A 1 210 ? 47.53966 -1.50894  -10.49526 1.000 33.78966  ? 209 LEU A CB    1 
ATOM   1651 C  CG    . LEU A 1 210 ? 47.49590 0.00878   -10.45915 1.000 35.33650  ? 209 LEU A CG    1 
ATOM   1652 C  CD1   . LEU A 1 210 ? 48.51075 0.59118   -11.44812 1.000 33.69246  ? 209 LEU A CD1   1 
ATOM   1653 C  CD2   . LEU A 1 210 ? 46.07944 0.46095   -10.78631 1.000 34.69410  ? 209 LEU A CD2   1 
ATOM   1654 N  N     . LEU A 1 211 ? 47.60892 -4.51108  -9.37527  1.000 39.67325  ? 210 LEU A N     1 
ATOM   1655 C  CA    . LEU A 1 211 ? 47.50195 -5.92974  -9.68879  1.000 33.83068  ? 210 LEU A CA    1 
ATOM   1656 C  C     . LEU A 1 211 ? 46.46326 -6.59885  -8.80531  1.000 38.69151  ? 210 LEU A C     1 
ATOM   1657 O  O     . LEU A 1 211 ? 45.71286 -7.47303  -9.26148  1.000 35.30583  ? 210 LEU A O     1 
ATOM   1658 C  CB    . LEU A 1 211 ? 48.86259 -6.57726  -9.50547  1.000 36.42924  ? 210 LEU A CB    1 
ATOM   1659 C  CG    . LEU A 1 211 ? 49.12624 -8.01424  -9.91463  1.000 34.24231  ? 210 LEU A CG    1 
ATOM   1660 C  CD1   . LEU A 1 211 ? 49.26280 -8.12277  -11.42202 1.000 29.95032  ? 210 LEU A CD1   1 
ATOM   1661 C  CD2   . LEU A 1 211 ? 50.39062 -8.43235  -9.22801  1.000 38.96904  ? 210 LEU A CD2   1 
ATOM   1662 N  N     . ARG A 1 212 ? 46.39879 -6.18471  -7.53747  1.000 37.05195  ? 211 ARG A N     1 
ATOM   1663 C  CA    . ARG A 1 212 ? 45.32219 -6.62935  -6.66370  1.000 37.35371  ? 211 ARG A CA    1 
ATOM   1664 C  C     . ARG A 1 212 ? 43.95550 -6.30377  -7.25721  1.000 38.26529  ? 211 ARG A C     1 
ATOM   1665 O  O     . ARG A 1 212 ? 42.99994 -7.05944  -7.05861  1.000 37.19619  ? 211 ARG A O     1 
ATOM   1666 C  CB    . ARG A 1 212 ? 45.49046 -5.99192  -5.28296  1.000 36.44390  ? 211 ARG A CB    1 
ATOM   1667 C  CG    . ARG A 1 212 ? 44.36244 -6.25852  -4.31140  1.000 35.93564  ? 211 ARG A CG    1 
ATOM   1668 C  CD    . ARG A 1 212 ? 43.34494 -5.15961  -4.35934  1.000 35.80002  ? 211 ARG A CD    1 
ATOM   1669 N  NE    . ARG A 1 212 ? 42.25130 -5.37920  -3.42756  1.000 40.03162  ? 211 ARG A NE    1 
ATOM   1670 C  CZ    . ARG A 1 212 ? 41.22259 -6.18796  -3.66206  1.000 42.71468  ? 211 ARG A CZ    1 
ATOM   1671 N  NH1   . ARG A 1 212 ? 41.15171 -6.86660  -4.80001  1.000 37.23924  ? 211 ARG A NH1   1 
ATOM   1672 N  NH2   . ARG A 1 212 ? 40.27010 -6.32915  -2.74877  1.000 46.00254  ? 211 ARG A NH2   1 
ATOM   1673 N  N     . TRP A 1 213 ? 43.83533 -5.18857  -7.98263  1.000 37.76617  ? 212 TRP A N     1 
ATOM   1674 C  CA    . TRP A 1 213 ? 42.57766 -4.83958  -8.63259  1.000 39.22772  ? 212 TRP A CA    1 
ATOM   1675 C  C     . TRP A 1 213 ? 42.51467 -5.29897  -10.07971 1.000 37.50237  ? 212 TRP A C     1 
ATOM   1676 O  O     . TRP A 1 213 ? 41.70280 -4.76751  -10.84578 1.000 39.95504  ? 212 TRP A O     1 
ATOM   1677 C  CB    . TRP A 1 213 ? 42.31651 -3.33015  -8.55010  1.000 34.19995  ? 212 TRP A CB    1 
ATOM   1678 C  CG    . TRP A 1 213 ? 41.94626 -2.91837  -7.17381  1.000 34.05960  ? 212 TRP A CG    1 
ATOM   1679 C  CD1   . TRP A 1 213 ? 42.73175 -2.26001  -6.28309  1.000 36.29334  ? 212 TRP A CD1   1 
ATOM   1680 C  CD2   . TRP A 1 213 ? 40.71382 -3.20299  -6.49190  1.000 35.27766  ? 212 TRP A CD2   1 
ATOM   1681 N  NE1   . TRP A 1 213 ? 42.05701 -2.09345  -5.09369  1.000 39.68675  ? 212 TRP A NE1   1 
ATOM   1682 C  CE2   . TRP A 1 213 ? 40.81917 -2.67131  -5.20092  1.000 34.28866  ? 212 TRP A CE2   1 
ATOM   1683 C  CE3   . TRP A 1 213 ? 39.53100 -3.84710  -6.85518  1.000 36.83105  ? 212 TRP A CE3   1 
ATOM   1684 C  CZ2   . TRP A 1 213 ? 39.78902 -2.74740  -4.28592  1.000 31.52458  ? 212 TRP A CZ2   1 
ATOM   1685 C  CZ3   . TRP A 1 213 ? 38.51607 -3.92039  -5.94469  1.000 32.57898  ? 212 TRP A CZ3   1 
ATOM   1686 C  CH2   . TRP A 1 213 ? 38.64705 -3.36956  -4.67849  1.000 31.24911  ? 212 TRP A CH2   1 
ATOM   1687 N  N     . GLY A 1 214 ? 43.35704 -6.25594  -10.46814 1.000 32.41747  ? 213 GLY A N     1 
ATOM   1688 C  CA    . GLY A 1 214 ? 43.27603 -6.89484  -11.76649 1.000 34.60975  ? 213 GLY A CA    1 
ATOM   1689 C  C     . GLY A 1 214 ? 43.97421 -6.20002  -12.91372 1.000 35.46402  ? 213 GLY A C     1 
ATOM   1690 O  O     . GLY A 1 214 ? 43.81518 -6.63082  -14.05952 1.000 37.07990  ? 213 GLY A O     1 
ATOM   1691 N  N     . LEU A 1 215 ? 44.74839 -5.15409  -12.66356 1.000 33.21914  ? 214 LEU A N     1 
ATOM   1692 C  CA    . LEU A 1 215 ? 45.38913 -4.41803  -13.73984 1.000 32.37974  ? 214 LEU A CA    1 
ATOM   1693 C  C     . LEU A 1 215 ? 46.88605 -4.69779  -13.72099 1.000 34.38316  ? 214 LEU A C     1 
ATOM   1694 O  O     . LEU A 1 215 ? 47.56020 -4.43612  -12.71948 1.000 37.65031  ? 214 LEU A O     1 
ATOM   1695 C  CB    . LEU A 1 215 ? 45.10062 -2.92573  -13.61989 1.000 38.18868  ? 214 LEU A CB    1 
ATOM   1696 C  CG    . LEU A 1 215 ? 43.60692 -2.58219  -13.53280 1.000 35.67911  ? 214 LEU A CG    1 
ATOM   1697 C  CD1   . LEU A 1 215 ? 43.37078 -1.09072  -13.47282 1.000 31.69882  ? 214 LEU A CD1   1 
ATOM   1698 C  CD2   . LEU A 1 215 ? 42.87585 -3.17146  -14.69976 1.000 33.67953  ? 214 LEU A CD2   1 
ATOM   1699 N  N     . THR A 1 216 ? 47.39254 -5.24202  -14.82418 1.000 34.53319  ? 215 THR A N     1 
ATOM   1700 C  CA    . THR A 1 216 ? 48.80489 -5.53803  -14.98963 1.000 34.54625  ? 215 THR A CA    1 
ATOM   1701 C  C     . THR A 1 216 ? 49.53349 -4.32365  -15.55528 1.000 38.01969  ? 215 THR A C     1 
ATOM   1702 O  O     . THR A 1 216 ? 48.95568 -3.50368  -16.27873 1.000 39.91912  ? 215 THR A O     1 
ATOM   1703 C  CB    . THR A 1 216 ? 48.99834 -6.74976  -15.91331 1.000 32.44481  ? 215 THR A CB    1 
ATOM   1704 O  OG1   . THR A 1 216 ? 48.50357 -6.44300  -17.22059 1.000 38.05198  ? 215 THR A OG1   1 
ATOM   1705 C  CG2   . THR A 1 216 ? 48.22314 -7.91538  -15.40008 1.000 27.51577  ? 215 THR A CG2   1 
ATOM   1706 N  N     . THR A 1 217 ? 50.81212 -4.19962  -15.19612 1.000 35.50335  ? 216 THR A N     1 
ATOM   1707 C  CA    . THR A 1 217 ? 51.67625 -3.13865  -15.70004 1.000 34.30496  ? 216 THR A CA    1 
ATOM   1708 C  C     . THR A 1 217 ? 52.89085 -3.78232  -16.34709 1.000 36.75937  ? 216 THR A C     1 
ATOM   1709 O  O     . THR A 1 217 ? 53.97975 -3.82958  -15.75289 1.000 38.55641  ? 216 THR A O     1 
ATOM   1710 C  CB    . THR A 1 217 ? 52.09863 -2.15873  -14.60994 1.000 36.28832  ? 216 THR A CB    1 
ATOM   1711 O  OG1   . THR A 1 217 ? 52.44735 -2.87083  -13.41924 1.000 35.57082  ? 216 THR A OG1   1 
ATOM   1712 C  CG2   . THR A 1 217 ? 50.97927 -1.16560  -14.33677 1.000 33.67280  ? 216 THR A CG2   1 
ATOM   1713 N  N     . PRO A 1 218 ? 52.74915 -4.24026  -17.58360 1.000 33.10449  ? 217 PRO A N     1 
ATOM   1714 C  CA    . PRO A 1 218 ? 53.85571 -4.92239  -18.25941 1.000 35.36441  ? 217 PRO A CA    1 
ATOM   1715 C  C     . PRO A 1 218 ? 55.08938 -4.03979  -18.37093 1.000 42.94330  ? 217 PRO A C     1 
ATOM   1716 O  O     . PRO A 1 218 ? 55.00422 -2.86401  -18.74300 1.000 41.09671  ? 217 PRO A O     1 
ATOM   1717 C  CB    . PRO A 1 218 ? 53.27483 -5.24291  -19.63745 1.000 33.85421  ? 217 PRO A CB    1 
ATOM   1718 C  CG    . PRO A 1 218 ? 52.13374 -4.27712  -19.80169 1.000 30.75256  ? 217 PRO A CG    1 
ATOM   1719 C  CD    . PRO A 1 218 ? 51.57724 -4.06184  -18.45227 1.000 31.12742  ? 217 PRO A CD    1 
ATOM   1720 N  N     . ASP A 1 219 ? 56.24683 -4.63966  -18.05864 1.000 41.52336  ? 218 ASP A N     1 
ATOM   1721 C  CA    . ASP A 1 219 ? 57.51706 -3.91674  -18.07672 1.000 44.26362  ? 218 ASP A CA    1 
ATOM   1722 C  C     . ASP A 1 219 ? 57.78356 -3.25189  -19.42556 1.000 43.03287  ? 218 ASP A C     1 
ATOM   1723 O  O     . ASP A 1 219 ? 58.39137 -2.17762  -19.47422 1.000 43.72726  ? 218 ASP A O     1 
ATOM   1724 C  CB    . ASP A 1 219 ? 58.65518 -4.87374  -17.71265 1.000 43.51786  ? 218 ASP A CB    1 
ATOM   1725 C  CG    . ASP A 1 219 ? 59.95275 -4.15474  -17.42674 1.000 45.98603  ? 218 ASP A CG    1 
ATOM   1726 O  OD1   . ASP A 1 219 ? 60.01137 -3.37172  -16.45402 1.000 53.78873  ? 218 ASP A OD1   1 
ATOM   1727 O  OD2   . ASP A 1 219 ? 60.92531 -4.36756  -18.17059 1.000 49.41097  ? 218 ASP A OD2   1 
ATOM   1728 N  N     . LYS A 1 220 ? 57.29789 -3.85007  -20.51844 1.000 42.68415  ? 219 LYS A N     1 
ATOM   1729 C  CA    . LYS A 1 220 ? 57.48437 -3.30393  -21.85718 1.000 41.83797  ? 219 LYS A CA    1 
ATOM   1730 C  C     . LYS A 1 220 ? 57.05418 -1.84515  -21.96818 1.000 44.11889  ? 219 LYS A C     1 
ATOM   1731 O  O     . LYS A 1 220 ? 57.49371 -1.15135  -22.89070 1.000 46.60299  ? 219 LYS A O     1 
ATOM   1732 C  CB    . LYS A 1 220 ? 56.69754 -4.14424  -22.87007 1.000 42.03228  ? 219 LYS A CB    1 
ATOM   1733 C  CG    . LYS A 1 220 ? 57.43129 -4.49037  -24.15914 1.000 53.47113  ? 219 LYS A CG    1 
ATOM   1734 C  CD    . LYS A 1 220 ? 57.47328 -3.32979  -25.15757 1.000 59.88402  ? 219 LYS A CD    1 
ATOM   1735 C  CE    . LYS A 1 220 ? 58.34114 -3.65272  -26.39903 1.000 66.75186  ? 219 LYS A CE    1 
ATOM   1736 N  NZ    . LYS A 1 220 ? 57.76180 -4.70237  -27.31079 1.000 67.14755  ? 219 LYS A NZ    1 
ATOM   1737 N  N     . LYS A 1 221 ? 56.19394 -1.36464  -21.06777 1.000 40.71913  ? 220 LYS A N     1 
ATOM   1738 C  CA    . LYS A 1 221 ? 55.66830 -0.00455  -21.14353 1.000 38.25176  ? 220 LYS A CA    1 
ATOM   1739 C  C     . LYS A 1 221 ? 55.87538 0.73575   -19.82735 1.000 37.95506  ? 220 LYS A C     1 
ATOM   1740 O  O     . LYS A 1 221 ? 55.16108 1.69009   -19.51549 1.000 35.72818  ? 220 LYS A O     1 
ATOM   1741 C  CB    . LYS A 1 221 ? 54.19708 -0.01622  -21.55893 1.000 35.12991  ? 220 LYS A CB    1 
ATOM   1742 C  CG    . LYS A 1 221 ? 54.01001 -0.65180  -22.92394 1.000 42.14249  ? 220 LYS A CG    1 
ATOM   1743 C  CD    . LYS A 1 221 ? 52.55409 -0.87939  -23.27784 1.000 46.48639  ? 220 LYS A CD    1 
ATOM   1744 C  CE    . LYS A 1 221 ? 51.92023 0.34796   -23.89473 1.000 48.85585  ? 220 LYS A CE    1 
ATOM   1745 N  NZ    . LYS A 1 221 ? 50.56386 -0.00148  -24.40609 1.000 46.61345  ? 220 LYS A NZ    1 
ATOM   1746 N  N     . HIS A 1 222 ? 56.87637 0.31114   -19.06505 1.000 39.40159  ? 221 HIS A N     1 
ATOM   1747 C  CA    . HIS A 1 222 ? 57.25521 0.91872   -17.79290 1.000 37.82787  ? 221 HIS A CA    1 
ATOM   1748 C  C     . HIS A 1 222 ? 58.51222 1.75000   -18.05311 1.000 35.52032  ? 221 HIS A C     1 
ATOM   1749 O  O     . HIS A 1 222 ? 59.62998 1.24664   -18.02912 1.000 38.38386  ? 221 HIS A O     1 
ATOM   1750 C  CB    . HIS A 1 222 ? 57.46421 -0.18762  -16.75825 1.000 38.72495  ? 221 HIS A CB    1 
ATOM   1751 C  CG    . HIS A 1 222 ? 57.86192 0.29307   -15.39606 1.000 39.98674  ? 221 HIS A CG    1 
ATOM   1752 N  ND1   . HIS A 1 222 ? 57.77389 -0.50698  -14.28089 1.000 40.08685  ? 221 HIS A ND1   1 
ATOM   1753 C  CD2   . HIS A 1 222 ? 58.36954 1.47356   -14.96843 1.000 44.04091  ? 221 HIS A CD2   1 
ATOM   1754 C  CE1   . HIS A 1 222 ? 58.19777 0.16056   -13.22325 1.000 38.44010  ? 221 HIS A CE1   1 
ATOM   1755 N  NE2   . HIS A 1 222 ? 58.57689 1.36203   -13.61459 1.000 38.63803  ? 221 HIS A NE2   1 
ATOM   1756 N  N     . GLN A 1 223 ? 58.32751 3.02962   -18.33031 1.000 37.96436  ? 222 GLN A N     1 
ATOM   1757 C  CA    . GLN A 1 223 ? 59.46095 3.91094   -18.58648 1.000 38.65852  ? 222 GLN A CA    1 
ATOM   1758 C  C     . GLN A 1 223 ? 60.10071 4.33631   -17.27000 1.000 42.62755  ? 222 GLN A C     1 
ATOM   1759 O  O     . GLN A 1 223 ? 59.41446 4.85185   -16.38169 1.000 41.82003  ? 222 GLN A O     1 
ATOM   1760 C  CB    . GLN A 1 223 ? 59.01658 5.14202   -19.36769 1.000 31.58582  ? 222 GLN A CB    1 
ATOM   1761 C  CG    . GLN A 1 223 ? 58.11913 4.84741   -20.53096 1.000 32.34543  ? 222 GLN A CG    1 
ATOM   1762 C  CD    . GLN A 1 223 ? 57.92132 6.05823   -21.40682 1.000 37.51689  ? 222 GLN A CD    1 
ATOM   1763 O  OE1   . GLN A 1 223 ? 58.88574 6.74205   -21.75904 1.000 41.04914  ? 222 GLN A OE1   1 
ATOM   1764 N  NE2   . GLN A 1 223 ? 56.67195 6.33973   -21.76161 1.000 35.11868  ? 222 GLN A NE2   1 
ATOM   1765 N  N     . LYS A 1 224 ? 61.42181 4.13695   -17.15009 1.000 45.08209  ? 223 LYS A N     1 
ATOM   1766 C  CA    . LYS A 1 224 ? 62.13752 4.42881   -15.91546 1.000 40.75427  ? 223 LYS A CA    1 
ATOM   1767 C  C     . LYS A 1 224 ? 63.21222 5.50728   -16.02967 1.000 49.02706  ? 223 LYS A C     1 
ATOM   1768 O  O     . LYS A 1 224 ? 63.71937 5.94582   -14.99131 1.000 51.36066  ? 223 LYS A O     1 
ATOM   1769 C  CB    . LYS A 1 224 ? 62.78060 3.14642   -15.36714 1.000 44.94276  ? 223 LYS A CB    1 
ATOM   1770 C  CG    . LYS A 1 224 ? 61.83049 1.96618   -15.38757 1.000 45.51763  ? 223 LYS A CG    1 
ATOM   1771 C  CD    . LYS A 1 224 ? 62.21863 0.85887   -14.42114 1.000 45.33964  ? 223 LYS A CD    1 
ATOM   1772 C  CE    . LYS A 1 224 ? 61.37139 -0.39612  -14.67861 1.000 48.32593  ? 223 LYS A CE    1 
ATOM   1773 N  NZ    . LYS A 1 224 ? 61.39259 -0.85529  -16.12004 1.000 44.75499  ? 223 LYS A NZ    1 
ATOM   1774 N  N     . GLU A 1 225 ? 63.57472 5.94896   -17.23674 1.000 50.51444  ? 224 GLU A N     1 
ATOM   1775 C  CA    . GLU A 1 225 ? 64.64377 6.91607   -17.45976 1.000 48.90314  ? 224 GLU A CA    1 
ATOM   1776 C  C     . GLU A 1 225 ? 64.17388 8.02228   -18.39004 1.000 51.56088  ? 224 GLU A C     1 
ATOM   1777 O  O     . GLU A 1 225 ? 63.41176 7.76121   -19.32485 1.000 52.88570  ? 224 GLU A O     1 
ATOM   1778 C  CB    . GLU A 1 225 ? 65.88494 6.25833   -18.08557 1.000 52.49968  ? 224 GLU A CB    1 
ATOM   1779 C  CG    . GLU A 1 225 ? 66.59051 5.24148   -17.21129 1.000 61.74695  ? 224 GLU A CG    1 
ATOM   1780 C  CD    . GLU A 1 225 ? 67.16673 5.85719   -15.94888 1.000 71.55508  ? 224 GLU A CD    1 
ATOM   1781 O  OE1   . GLU A 1 225 ? 67.34282 7.09791   -15.91435 1.000 79.56994  ? 224 GLU A OE1   1 
ATOM   1782 O  OE2   . GLU A 1 225 ? 67.44277 5.10345   -14.98597 1.000 73.26182  ? 224 GLU A OE2   1 
ATOM   1783 N  N     . PRO A 1 226 ? 64.64032 9.25886   -18.19400 1.000 50.23069  ? 225 PRO A N     1 
ATOM   1784 C  CA    . PRO A 1 226 ? 64.29236 10.31256  -19.13650 1.000 48.66930  ? 225 PRO A CA    1 
ATOM   1785 C  C     . PRO A 1 226 ? 65.02398 10.09434  -20.44442 1.000 46.18852  ? 225 PRO A C     1 
ATOM   1786 O  O     . PRO A 1 226 ? 66.12995 9.52690   -20.46352 1.000 47.18639  ? 225 PRO A O     1 
ATOM   1787 C  CB    . PRO A 1 226 ? 64.77227 11.59600  -18.43174 1.000 44.48579  ? 225 PRO A CB    1 
ATOM   1788 C  CG    . PRO A 1 226 ? 65.26725 11.15535  -17.07077 1.000 45.00871  ? 225 PRO A CG    1 
ATOM   1789 C  CD    . PRO A 1 226 ? 65.63962 9.72607   -17.22434 1.000 47.36514  ? 225 PRO A CD    1 
ATOM   1790 N  N     . PRO A 1 227 ? 64.46035 10.54383  -21.57087 1.000 45.26843  ? 226 PRO A N     1 
ATOM   1791 C  CA    . PRO A 1 227 ? 63.20513 11.29794  -21.68905 1.000 49.43537  ? 226 PRO A CA    1 
ATOM   1792 C  C     . PRO A 1 227 ? 61.94743 10.43139  -21.70265 1.000 44.84003  ? 226 PRO A C     1 
ATOM   1793 O  O     . PRO A 1 227 ? 61.91187 9.40497   -22.38892 1.000 47.34842  ? 226 PRO A O     1 
ATOM   1794 C  CB    . PRO A 1 227 ? 63.36613 12.01525  -23.03203 1.000 47.27018  ? 226 PRO A CB    1 
ATOM   1795 C  CG    . PRO A 1 227 ? 64.22144 11.09615  -23.82353 1.000 47.29015  ? 226 PRO A CG    1 
ATOM   1796 C  CD    . PRO A 1 227 ? 65.16668 10.44637  -22.85670 1.000 41.05119  ? 226 PRO A CD    1 
ATOM   1797 N  N     . PHE A 1 228 ? 60.92156 10.85347  -20.97137 1.000 39.51316  ? 227 PHE A N     1 
ATOM   1798 C  CA    . PHE A 1 228 ? 59.68369 10.09128  -20.91915 1.000 43.29394  ? 227 PHE A CA    1 
ATOM   1799 C  C     . PHE A 1 228 ? 58.79029 10.42206  -22.11053 1.000 39.65603  ? 227 PHE A C     1 
ATOM   1800 O  O     . PHE A 1 228 ? 58.71212 11.57105  -22.54847 1.000 43.89965  ? 227 PHE A O     1 
ATOM   1801 C  CB    . PHE A 1 228 ? 58.97587 10.35306  -19.59126 1.000 37.23250  ? 227 PHE A CB    1 
ATOM   1802 C  CG    . PHE A 1 228 ? 59.79604 9.93592   -18.40506 1.000 39.35489  ? 227 PHE A CG    1 
ATOM   1803 C  CD1   . PHE A 1 228 ? 60.64545 10.82849  -17.78066 1.000 36.68512  ? 227 PHE A CD1   1 
ATOM   1804 C  CD2   . PHE A 1 228 ? 59.76057 8.62034   -17.94812 1.000 40.66289  ? 227 PHE A CD2   1 
ATOM   1805 C  CE1   . PHE A 1 228 ? 61.42802 10.43294  -16.69563 1.000 37.76776  ? 227 PHE A CE1   1 
ATOM   1806 C  CE2   . PHE A 1 228 ? 60.54158 8.21390   -16.86049 1.000 38.99996  ? 227 PHE A CE2   1 
ATOM   1807 C  CZ    . PHE A 1 228 ? 61.37160 9.12578   -16.23643 1.000 42.09626  ? 227 PHE A CZ    1 
ATOM   1808 N  N     . LEU A 1 229 ? 58.14795 9.40141   -22.66277 1.000 31.12100  ? 228 LEU A N     1 
ATOM   1809 C  CA    . LEU A 1 229 ? 57.20464 9.57707   -23.75888 1.000 35.93651  ? 228 LEU A CA    1 
ATOM   1810 C  C     . LEU A 1 229 ? 55.79710 9.55479   -23.16774 1.000 36.99388  ? 228 LEU A C     1 
ATOM   1811 O  O     . LEU A 1 229 ? 55.34626 8.52350   -22.65176 1.000 38.90136  ? 228 LEU A O     1 
ATOM   1812 C  CB    . LEU A 1 229 ? 57.39860 8.49774   -24.82222 1.000 44.56156  ? 228 LEU A CB    1 
ATOM   1813 C  CG    . LEU A 1 229 ? 58.80344 8.43117   -25.46160 1.000 50.51033  ? 228 LEU A CG    1 
ATOM   1814 C  CD1   . LEU A 1 229 ? 59.01222 7.18874   -26.35347 1.000 38.09029  ? 228 LEU A CD1   1 
ATOM   1815 C  CD2   . LEU A 1 229 ? 59.12585 9.69695   -26.24220 1.000 42.44973  ? 228 LEU A CD2   1 
ATOM   1816 N  N     . TRP A 1 230 ? 55.10343 10.69175  -23.23836 1.000 34.89705  ? 229 TRP A N     1 
ATOM   1817 C  CA    . TRP A 1 230 ? 53.85503 10.85120  -22.49322 1.000 35.28644  ? 229 TRP A CA    1 
ATOM   1818 C  C     . TRP A 1 230 ? 52.92729 11.84142  -23.18181 1.000 35.08190  ? 229 TRP A C     1 
ATOM   1819 O  O     . TRP A 1 230 ? 53.28878 13.00095  -23.37413 1.000 33.97140  ? 229 TRP A O     1 
ATOM   1820 C  CB    . TRP A 1 230 ? 54.15220 11.30985  -21.06783 1.000 37.07416  ? 229 TRP A CB    1 
ATOM   1821 C  CG    . TRP A 1 230 ? 52.94074 11.60261  -20.22798 1.000 38.54075  ? 229 TRP A CG    1 
ATOM   1822 C  CD1   . TRP A 1 230 ? 52.15100 10.70017  -19.58269 1.000 35.75421  ? 229 TRP A CD1   1 
ATOM   1823 C  CD2   . TRP A 1 230 ? 52.40642 12.89377  -19.91545 1.000 36.48624  ? 229 TRP A CD2   1 
ATOM   1824 N  NE1   . TRP A 1 230 ? 51.15229 11.34997  -18.89528 1.000 32.36477  ? 229 TRP A NE1   1 
ATOM   1825 C  CE2   . TRP A 1 230 ? 51.29074 12.69648  -19.08306 1.000 33.97749  ? 229 TRP A CE2   1 
ATOM   1826 C  CE3   . TRP A 1 230 ? 52.76220 14.19509  -20.26189 1.000 38.00489  ? 229 TRP A CE3   1 
ATOM   1827 C  CZ2   . TRP A 1 230 ? 50.52444 13.75070  -18.60070 1.000 34.86702  ? 229 TRP A CZ2   1 
ATOM   1828 C  CZ3   . TRP A 1 230 ? 52.00002 15.24367  -19.77727 1.000 39.43440  ? 229 TRP A CZ3   1 
ATOM   1829 C  CH2   . TRP A 1 230 ? 50.89499 15.01511  -18.95337 1.000 34.45327  ? 229 TRP A CH2   1 
ATOM   1830 N  N     . MET A 1 231 ? 51.73247 11.37765  -23.53748 1.000 38.75818  ? 230 MET A N     1 
ATOM   1831 C  CA    . MET A 1 231 ? 50.63770 12.22503  -24.01574 1.000 38.41567  ? 230 MET A CA    1 
ATOM   1832 C  C     . MET A 1 231 ? 51.00679 13.00288  -25.27802 1.000 41.63288  ? 230 MET A C     1 
ATOM   1833 O  O     . MET A 1 231 ? 50.47462 14.10064  -25.52778 1.000 41.39608  ? 230 MET A O     1 
ATOM   1834 C  CB    . MET A 1 231 ? 50.15808 13.17272  -22.91514 1.000 32.38462  ? 230 MET A CB    1 
ATOM   1835 C  CG    . MET A 1 231 ? 49.40475 12.46292  -21.82291 1.000 32.92023  ? 230 MET A CG    1 
ATOM   1836 S  SD    . MET A 1 231 ? 47.83915 11.78688  -22.43026 1.000 40.72675  ? 230 MET A SD    1 
ATOM   1837 C  CE    . MET A 1 231 ? 46.87680 13.27241  -22.62772 1.000 29.84234  ? 230 MET A CE    1 
ATOM   1838 N  N     . GLY A 1 232 ? 51.90153 12.43506  -26.08721 1.000 37.73046  ? 231 GLY A N     1 
ATOM   1839 C  CA    . GLY A 1 232 ? 52.39629 13.10433  -27.27685 1.000 40.37598  ? 231 GLY A CA    1 
ATOM   1840 C  C     . GLY A 1 232 ? 53.63015 13.96503  -27.08661 1.000 38.72839  ? 231 GLY A C     1 
ATOM   1841 O  O     . GLY A 1 232 ? 54.00217 14.69458  -28.01308 1.000 40.13116  ? 231 GLY A O     1 
ATOM   1842 N  N     . TYR A 1 233 ? 54.27991 13.90390  -25.92634 1.000 37.54306  ? 232 TYR A N     1 
ATOM   1843 C  CA    . TYR A 1 233 ? 55.41984 14.75330  -25.62645 1.000 40.67844  ? 232 TYR A CA    1 
ATOM   1844 C  C     . TYR A 1 233 ? 56.61534 13.91713  -25.20562 1.000 43.31603  ? 232 TYR A C     1 
ATOM   1845 O  O     . TYR A 1 233 ? 56.50871 12.72267  -24.89570 1.000 41.52864  ? 232 TYR A O     1 
ATOM   1846 C  CB    . TYR A 1 233 ? 55.12563 15.73813  -24.49585 1.000 37.13262  ? 232 TYR A CB    1 
ATOM   1847 C  CG    . TYR A 1 233 ? 53.85474 16.52823  -24.64479 1.000 39.12170  ? 232 TYR A CG    1 
ATOM   1848 C  CD1   . TYR A 1 233 ? 53.84590 17.77400  -25.28314 1.000 36.50355  ? 232 TYR A CD1   1 
ATOM   1849 C  CD2   . TYR A 1 233 ? 52.65931 16.03857  -24.13376 1.000 36.02241  ? 232 TYR A CD2   1 
ATOM   1850 C  CE1   . TYR A 1 233 ? 52.66268 18.50298  -25.40902 1.000 39.49853  ? 232 TYR A CE1   1 
ATOM   1851 C  CE2   . TYR A 1 233 ? 51.48146 16.74621  -24.25661 1.000 35.02808  ? 232 TYR A CE2   1 
ATOM   1852 C  CZ    . TYR A 1 233 ? 51.47886 17.98226  -24.88850 1.000 38.15732  ? 232 TYR A CZ    1 
ATOM   1853 O  OH    . TYR A 1 233 ? 50.29148 18.67807  -24.98778 1.000 33.95066  ? 232 TYR A OH    1 
ATOM   1854 N  N     . GLU A 1 234 ? 57.75462 14.59858  -25.14658 1.000 46.61850  ? 233 GLU A N     1 
ATOM   1855 C  CA    . GLU A 1 234 ? 58.96370 14.09854  -24.50539 1.000 46.59966  ? 233 GLU A CA    1 
ATOM   1856 C  C     . GLU A 1 234 ? 59.21530 14.94386  -23.26943 1.000 43.59843  ? 233 GLU A C     1 
ATOM   1857 O  O     . GLU A 1 234 ? 59.31267 16.17342  -23.37018 1.000 49.13077  ? 233 GLU A O     1 
ATOM   1858 C  CB    . GLU A 1 234 ? 60.15953 14.16252  -25.45232 1.000 48.78072  ? 233 GLU A CB    1 
ATOM   1859 C  CG    . GLU A 1 234 ? 60.09252 13.16275  -26.59917 1.000 55.06574  ? 233 GLU A CG    1 
ATOM   1860 C  CD    . GLU A 1 234 ? 61.14565 13.43226  -27.66557 1.000 70.55985  ? 233 GLU A CD    1 
ATOM   1861 O  OE1   . GLU A 1 234 ? 62.18706 12.72317  -27.66543 1.000 58.54310  ? 233 GLU A OE1   1 
ATOM   1862 O  OE2   . GLU A 1 234 ? 60.92274 14.36921  -28.48879 1.000 68.85104  ? 233 GLU A OE2   1 
ATOM   1863 N  N     . LEU A 1 235 ? 59.30112 14.28900  -22.11362 1.000 40.32283  ? 234 LEU A N     1 
ATOM   1864 C  CA    . LEU A 1 235 ? 59.53931 14.94784  -20.83384 1.000 41.08068  ? 234 LEU A CA    1 
ATOM   1865 C  C     . LEU A 1 235 ? 60.99524 14.71862  -20.42293 1.000 44.04364  ? 234 LEU A C     1 
ATOM   1866 O  O     . LEU A 1 235 ? 61.38488 13.59515  -20.08901 1.000 45.17767  ? 234 LEU A O     1 
ATOM   1867 C  CB    . LEU A 1 235 ? 58.58605 14.42034  -19.76505 1.000 37.00634  ? 234 LEU A CB    1 
ATOM   1868 C  CG    . LEU A 1 235 ? 57.09905 14.23877  -20.07471 1.000 40.22668  ? 234 LEU A CG    1 
ATOM   1869 C  CD1   . LEU A 1 235 ? 56.37147 13.75492  -18.81420 1.000 35.40820  ? 234 LEU A CD1   1 
ATOM   1870 C  CD2   . LEU A 1 235 ? 56.46846 15.52386  -20.60172 1.000 36.80797  ? 234 LEU A CD2   1 
ATOM   1871 N  N     . HIS A 1 236 ? 61.79782 15.77019  -20.46858 1.000 42.04287  ? 235 HIS A N     1 
ATOM   1872 C  CA    . HIS A 1 236 ? 63.14665 15.74521  -19.92828 1.000 39.19625  ? 235 HIS A CA    1 
ATOM   1873 C  C     . HIS A 1 236 ? 63.11992 16.26926  -18.50028 1.000 44.56131  ? 235 HIS A C     1 
ATOM   1874 O  O     . HIS A 1 236 ? 62.07947 16.71747  -18.00703 1.000 46.45898  ? 235 HIS A O     1 
ATOM   1875 C  CB    . HIS A 1 236 ? 64.06899 16.57167  -20.81756 1.000 47.11694  ? 235 HIS A CB    1 
ATOM   1876 C  CG    . HIS A 1 236 ? 64.16022 16.08417  -22.23058 1.000 44.92380  ? 235 HIS A CG    1 
ATOM   1877 N  ND1   . HIS A 1 236 ? 63.18437 16.33881  -23.17198 1.000 47.92332  ? 235 HIS A ND1   1 
ATOM   1878 C  CD2   . HIS A 1 236 ? 65.12680 15.38660  -22.87070 1.000 39.38186  ? 235 HIS A CD2   1 
ATOM   1879 C  CE1   . HIS A 1 236 ? 63.53615 15.80103  -24.32673 1.000 45.88317  ? 235 HIS A CE1   1 
ATOM   1880 N  NE2   . HIS A 1 236 ? 64.71165 15.21901  -24.16992 1.000 48.57969  ? 235 HIS A NE2   1 
ATOM   1881 N  N     . PRO A 1 237 ? 64.23674 16.20242  -17.77088 1.000 44.89590  ? 236 PRO A N     1 
ATOM   1882 C  CA    . PRO A 1 237 ? 64.16549 16.58538  -16.35081 1.000 47.35731  ? 236 PRO A CA    1 
ATOM   1883 C  C     . PRO A 1 237 ? 63.77910 18.03668  -16.12783 1.000 52.80943  ? 236 PRO A C     1 
ATOM   1884 O  O     . PRO A 1 237 ? 63.12338 18.33665  -15.12143 1.000 54.51255  ? 236 PRO A O     1 
ATOM   1885 C  CB    . PRO A 1 237 ? 65.57860 16.28364  -15.83078 1.000 45.19680  ? 236 PRO A CB    1 
ATOM   1886 C  CG    . PRO A 1 237 ? 66.08581 15.21601  -16.73486 1.000 44.76215  ? 236 PRO A CG    1 
ATOM   1887 C  CD    . PRO A 1 237 ? 65.52492 15.55523  -18.09230 1.000 46.24714  ? 236 PRO A CD    1 
ATOM   1888 N  N     . ASP A 1 238 ? 64.14215 18.94680  -17.04050 1.000 51.24385  ? 237 ASP A N     1 
ATOM   1889 C  CA    . ASP A 1 238 ? 63.88806 20.36966  -16.84634 1.000 51.79324  ? 237 ASP A CA    1 
ATOM   1890 C  C     . ASP A 1 238 ? 63.18484 21.04094  -18.01842 1.000 53.27803  ? 237 ASP A C     1 
ATOM   1891 O  O     . ASP A 1 238 ? 62.93946 22.25242  -17.95694 1.000 48.70195  ? 237 ASP A O     1 
ATOM   1892 C  CB    . ASP A 1 238 ? 65.20354 21.11906  -16.56896 1.000 57.98499  ? 237 ASP A CB    1 
ATOM   1893 C  CG    . ASP A 1 238 ? 65.69922 20.92212  -15.14314 1.000 74.67635  ? 237 ASP A CG    1 
ATOM   1894 O  OD1   . ASP A 1 238 ? 64.94041 21.25390  -14.19023 1.000 74.81370  ? 237 ASP A OD1   1 
ATOM   1895 O  OD2   . ASP A 1 238 ? 66.84005 20.42093  -14.97759 1.000 76.16198  ? 237 ASP A OD2   1 
ATOM   1896 N  N     . LYS A 1 239 ? 62.85604 20.30319  -19.07634 1.000 47.76753  ? 238 LYS A N     1 
ATOM   1897 C  CA    . LYS A 1 239 ? 62.21409 20.88916  -20.23997 1.000 43.65498  ? 238 LYS A CA    1 
ATOM   1898 C  C     . LYS A 1 239 ? 61.37754 19.80832  -20.91519 1.000 48.68508  ? 238 LYS A C     1 
ATOM   1899 O  O     . LYS A 1 239 ? 61.63683 18.60765  -20.75186 1.000 43.68128  ? 238 LYS A O     1 
ATOM   1900 C  CB    . LYS A 1 239 ? 63.24897 21.49185  -21.20602 1.000 45.16272  ? 238 LYS A CB    1 
ATOM   1901 C  CG    . LYS A 1 239 ? 64.08999 20.45604  -21.97422 1.000 53.98836  ? 238 LYS A CG    1 
ATOM   1902 C  CD    . LYS A 1 239 ? 65.29226 21.08945  -22.70934 1.000 58.03716  ? 238 LYS A CD    1 
ATOM   1903 C  CE    . LYS A 1 239 ? 66.11993 20.02750  -23.49607 1.000 64.00729  ? 238 LYS A CE    1 
ATOM   1904 N  NZ    . LYS A 1 239 ? 65.56788 19.62735  -24.84913 1.000 55.32016  ? 238 LYS A NZ    1 
ATOM   1905 N  N     . TRP A 1 240 ? 60.35001 20.23529  -21.65344 1.000 39.78729  ? 239 TRP A N     1 
ATOM   1906 C  CA    . TRP A 1 240 ? 59.55584 19.29332  -22.42310 1.000 42.46257  ? 239 TRP A CA    1 
ATOM   1907 C  C     . TRP A 1 240 ? 59.50000 19.76019  -23.85965 1.000 42.54837  ? 239 TRP A C     1 
ATOM   1908 O  O     . TRP A 1 240 ? 59.71088 20.93918  -24.15016 1.000 42.10919  ? 239 TRP A O     1 
ATOM   1909 C  CB    . TRP A 1 240 ? 58.12843 19.12774  -21.87333 1.000 43.98392  ? 239 TRP A CB    1 
ATOM   1910 C  CG    . TRP A 1 240 ? 57.34183 20.40777  -21.77310 1.000 42.89985  ? 239 TRP A CG    1 
ATOM   1911 C  CD1   . TRP A 1 240 ? 57.27916 21.24361  -20.70330 1.000 39.06113  ? 239 TRP A CD1   1 
ATOM   1912 C  CD2   . TRP A 1 240 ? 56.49942 20.97835  -22.77553 1.000 36.97864  ? 239 TRP A CD2   1 
ATOM   1913 N  NE1   . TRP A 1 240 ? 56.45381 22.28876  -20.97237 1.000 34.27766  ? 239 TRP A NE1   1 
ATOM   1914 C  CE2   . TRP A 1 240 ? 55.96678 22.15583  -22.24528 1.000 36.06263  ? 239 TRP A CE2   1 
ATOM   1915 C  CE3   . TRP A 1 240 ? 56.14354 20.60300  -24.07408 1.000 40.91837  ? 239 TRP A CE3   1 
ATOM   1916 C  CZ2   . TRP A 1 240 ? 55.08429 22.97127  -22.96772 1.000 41.48981  ? 239 TRP A CZ2   1 
ATOM   1917 C  CZ3   . TRP A 1 240 ? 55.27429 21.40982  -24.78783 1.000 38.01697  ? 239 TRP A CZ3   1 
ATOM   1918 C  CH2   . TRP A 1 240 ? 54.75451 22.57908  -24.23526 1.000 38.17683  ? 239 TRP A CH2   1 
ATOM   1919 N  N     . THR A 1 241 ? 59.24510 18.80943  -24.76032 1.000 40.31014  ? 240 THR A N     1 
ATOM   1920 C  CA    . THR A 1 241 ? 58.98528 19.14732  -26.15327 1.000 46.67155  ? 240 THR A CA    1 
ATOM   1921 C  C     . THR A 1 241 ? 57.84169 18.29655  -26.68390 1.000 47.25787  ? 240 THR A C     1 
ATOM   1922 O  O     . THR A 1 241 ? 57.39532 17.33618  -26.05375 1.000 47.81127  ? 240 THR A O     1 
ATOM   1923 C  CB    . THR A 1 241 ? 60.20020 18.96002  -27.08156 1.000 46.56905  ? 240 THR A CB    1 
ATOM   1924 O  OG1   . THR A 1 241 ? 60.38412 17.56635  -27.36474 1.000 49.46219  ? 240 THR A OG1   1 
ATOM   1925 C  CG2   . THR A 1 241 ? 61.47298 19.56627  -26.49682 1.000 46.90179  ? 240 THR A CG2   1 
ATOM   1926 N  N     . VAL A 1 242 ? 57.38088 18.66699  -27.86200 1.000 49.20902  ? 241 VAL A N     1 
ATOM   1927 C  CA    . VAL A 1 242 ? 56.35489 17.93515  -28.58432 1.000 43.28535  ? 241 VAL A CA    1 
ATOM   1928 C  C     . VAL A 1 242 ? 57.06073 16.96410  -29.50522 1.000 47.01602  ? 241 VAL A C     1 
ATOM   1929 O  O     . VAL A 1 242 ? 58.15319 17.23574  -30.01768 1.000 48.03862  ? 241 VAL A O     1 
ATOM   1930 C  CB    . VAL A 1 242 ? 55.42461 18.89521  -29.36093 1.000 42.76047  ? 241 VAL A CB    1 
ATOM   1931 C  CG1   . VAL A 1 242 ? 56.10747 19.43080  -30.59977 1.000 38.39532  ? 241 VAL A CG1   1 
ATOM   1932 C  CG2   . VAL A 1 242 ? 54.14410 18.20999  -29.73579 1.000 46.87902  ? 241 VAL A CG2   1 
ATOM   1933 N  N     . GLN A 1 243 ? 56.45523 15.80270  -29.68743 1.000 52.62456  ? 242 GLN A N     1 
ATOM   1934 C  CA    . GLN A 1 243 ? 56.99714 14.85499  -30.63777 1.000 50.58358  ? 242 GLN A CA    1 
ATOM   1935 C  C     . GLN A 1 243 ? 56.76501 15.39001  -32.04872 1.000 54.57893  ? 242 GLN A C     1 
ATOM   1936 O  O     . GLN A 1 243 ? 55.68802 15.92384  -32.33628 1.000 59.54446  ? 242 GLN A O     1 
ATOM   1937 C  CB    . GLN A 1 243 ? 56.35402 13.48874  -30.43998 1.000 48.46564  ? 242 GLN A CB    1 
ATOM   1938 C  CG    . GLN A 1 243 ? 56.55361 12.95439  -29.02958 1.000 50.75110  ? 242 GLN A CG    1 
ATOM   1939 C  CD    . GLN A 1 243 ? 55.91673 11.59124  -28.80585 1.000 52.07022  ? 242 GLN A CD    1 
ATOM   1940 O  OE1   . GLN A 1 243 ? 55.26767 11.03464  -29.69945 1.000 53.26124  ? 242 GLN A OE1   1 
ATOM   1941 N  NE2   . GLN A 1 243 ? 56.09905 11.04800  -27.60461 1.000 49.80477  ? 242 GLN A NE2   1 
ATOM   1942 N  N     . PRO A 1 244 ? 57.73586 15.23879  -32.95048 1.000 59.79041  ? 243 PRO A N     1 
ATOM   1943 C  CA    . PRO A 1 244 ? 57.85376 16.17778  -34.07387 1.000 62.28419  ? 243 PRO A CA    1 
ATOM   1944 C  C     . PRO A 1 244 ? 56.59718 16.23584  -34.92804 1.000 67.67401  ? 243 PRO A C     1 
ATOM   1945 O  O     . PRO A 1 244 ? 55.86590 15.25113  -35.07331 1.000 65.69883  ? 243 PRO A O     1 
ATOM   1946 C  CB    . PRO A 1 244 ? 59.04342 15.62962  -34.87372 1.000 61.49581  ? 243 PRO A CB    1 
ATOM   1947 C  CG    . PRO A 1 244 ? 59.72047 14.64291  -33.96004 1.000 59.39365  ? 243 PRO A CG    1 
ATOM   1948 C  CD    . PRO A 1 244 ? 58.63296 14.08228  -33.10967 1.000 56.72459  ? 243 PRO A CD    1 
ATOM   1949 N  N     . ILE A 1 245 ? 56.35027 17.42359  -35.48227 1.000 67.41355  ? 244 ILE A N     1 
ATOM   1950 C  CA    . ILE A 1 245 ? 55.23522 17.66796  -36.38770 1.000 60.58086  ? 244 ILE A CA    1 
ATOM   1951 C  C     . ILE A 1 245 ? 55.75274 17.53452  -37.81083 1.000 62.74450  ? 244 ILE A C     1 
ATOM   1952 O  O     . ILE A 1 245 ? 56.83314 18.04223  -38.13928 1.000 67.26068  ? 244 ILE A O     1 
ATOM   1953 C  CB    . ILE A 1 245 ? 54.61591 19.05835  -36.15535 1.000 62.40540  ? 244 ILE A CB    1 
ATOM   1954 C  CG1   . ILE A 1 245 ? 53.78117 19.08391  -34.88105 1.000 56.50494  ? 244 ILE A CG1   1 
ATOM   1955 C  CG2   . ILE A 1 245 ? 53.74483 19.47940  -37.32171 1.000 62.02608  ? 244 ILE A CG2   1 
ATOM   1956 C  CD1   . ILE A 1 245 ? 54.58340 19.27809  -33.65649 1.000 57.34237  ? 244 ILE A CD1   1 
ATOM   1957 N  N     . VAL A 1 246 ? 54.99893 16.83237  -38.64800 1.000 63.44881  ? 245 VAL A N     1 
ATOM   1958 C  CA    . VAL A 1 246 ? 55.31171 16.68959  -40.06103 1.000 64.99105  ? 245 VAL A CA    1 
ATOM   1959 C  C     . VAL A 1 246 ? 54.13701 17.28725  -40.81685 1.000 63.49193  ? 245 VAL A C     1 
ATOM   1960 O  O     . VAL A 1 246 ? 53.05766 16.68555  -40.87174 1.000 66.03788  ? 245 VAL A O     1 
ATOM   1961 C  CB    . VAL A 1 246 ? 55.55183 15.23035  -40.46906 1.000 59.64640  ? 245 VAL A CB    1 
ATOM   1962 C  CG1   . VAL A 1 246 ? 56.29956 15.18056  -41.79232 1.000 59.76426  ? 245 VAL A CG1   1 
ATOM   1963 C  CG2   . VAL A 1 246 ? 56.32051 14.47706  -39.38356 1.000 50.54298  ? 245 VAL A CG2   1 
ATOM   1964 N  N     . LEU A 1 247 ? 54.33000 18.47558  -41.37879 1.000 62.77827  ? 246 LEU A N     1 
ATOM   1965 C  CA    . LEU A 1 247 ? 53.32172 19.03251  -42.26207 1.000 64.94786  ? 246 LEU A CA    1 
ATOM   1966 C  C     . LEU A 1 247 ? 53.39241 18.34255  -43.62143 1.000 72.37887  ? 246 LEU A C     1 
ATOM   1967 O  O     . LEU A 1 247 ? 54.48891 18.10743  -44.14193 1.000 75.61933  ? 246 LEU A O     1 
ATOM   1968 C  CB    . LEU A 1 247 ? 53.52257 20.53405  -42.44268 1.000 67.11679  ? 246 LEU A CB    1 
ATOM   1969 C  CG    . LEU A 1 247 ? 53.37577 21.44904  -41.22796 1.000 70.23897  ? 246 LEU A CG    1 
ATOM   1970 C  CD1   . LEU A 1 247 ? 53.33664 22.91935  -41.66176 1.000 69.39278  ? 246 LEU A CD1   1 
ATOM   1971 C  CD2   . LEU A 1 247 ? 52.12649 21.08943  -40.44508 1.000 66.17199  ? 246 LEU A CD2   1 
ATOM   1972 N  N     . PRO A 1 248 ? 52.25106 17.99611  -44.21549 1.000 74.36121  ? 247 PRO A N     1 
ATOM   1973 C  CA    . PRO A 1 248 ? 52.26758 17.46045  -45.58421 1.000 76.27154  ? 247 PRO A CA    1 
ATOM   1974 C  C     . PRO A 1 248 ? 52.89126 18.44815  -46.56481 1.000 76.28312  ? 247 PRO A C     1 
ATOM   1975 O  O     . PRO A 1 248 ? 52.97378 19.65034  -46.30884 1.000 78.41426  ? 247 PRO A O     1 
ATOM   1976 C  CB    . PRO A 1 248 ? 50.78087 17.21018  -45.89400 1.000 72.66015  ? 247 PRO A CB    1 
ATOM   1977 C  CG    . PRO A 1 248 ? 50.01197 17.94638  -44.81781 1.000 70.98292  ? 247 PRO A CG    1 
ATOM   1978 C  CD    . PRO A 1 248 ? 50.90444 17.97191  -43.61910 1.000 68.66588  ? 247 PRO A CD    1 
ATOM   1979 N  N     . GLU A 1 249 ? 53.37016 17.91636  -47.69382 1.000 81.01654  ? 248 GLU A N     1 
ATOM   1980 C  CA    . GLU A 1 249 ? 54.02928 18.71236  -48.72836 1.000 82.37173  ? 248 GLU A CA    1 
ATOM   1981 C  C     . GLU A 1 249 ? 53.34707 18.54132  -50.08130 1.000 84.51373  ? 248 GLU A C     1 
ATOM   1982 O  O     . GLU A 1 249 ? 54.00510 18.59403  -51.12242 1.000 87.63810  ? 248 GLU A O     1 
ATOM   1983 C  CB    . GLU A 1 249 ? 55.51339 18.35745  -48.85107 1.000 81.67296  ? 248 GLU A CB    1 
ATOM   1984 C  CG    . GLU A 1 249 ? 56.40274 18.86065  -47.72569 1.000 83.52855  ? 248 GLU A CG    1 
ATOM   1985 C  CD    . GLU A 1 249 ? 57.79662 18.25502  -47.76491 1.000 91.10854  ? 248 GLU A CD    1 
ATOM   1986 O  OE1   . GLU A 1 249 ? 58.07363 17.45258  -48.68670 1.000 93.97029  ? 248 GLU A OE1   1 
ATOM   1987 O  OE2   . GLU A 1 249 ? 58.61262 18.57655  -46.87066 1.000 88.18981  ? 248 GLU A OE2   1 
ATOM   1988 N  N     . LYS A 1 250 ? 52.02808 18.34455  -50.08112 1.000 83.29734  ? 249 LYS A N     1 
ATOM   1989 C  CA    . LYS A 1 250 ? 51.28898 18.14286  -51.32232 1.000 80.92367  ? 249 LYS A CA    1 
ATOM   1990 C  C     . LYS A 1 250 ? 51.40356 19.35531  -52.24740 1.000 88.46337  ? 249 LYS A C     1 
ATOM   1991 O  O     . LYS A 1 250 ? 51.77775 20.46138  -51.83914 1.000 86.87023  ? 249 LYS A O     1 
ATOM   1992 C  CB    . LYS A 1 250 ? 49.81855 17.85180  -51.02758 1.000 73.98306  ? 249 LYS A CB    1 
ATOM   1993 N  N     . ASP A 1 251 ? 51.07799 19.12693  -53.51904 1.000 88.69771  ? 250 ASP A N     1 
ATOM   1994 C  CA    . ASP A 1 251 ? 51.02394 20.17939  -54.52761 1.000 85.71609  ? 250 ASP A CA    1 
ATOM   1995 C  C     . ASP A 1 251 ? 49.60599 20.55660  -54.90455 1.000 85.71306  ? 250 ASP A C     1 
ATOM   1996 O  O     . ASP A 1 251 ? 49.30388 21.74241  -55.06429 1.000 92.35508  ? 250 ASP A O     1 
ATOM   1997 C  CB    . ASP A 1 251 ? 51.78212 19.75418  -55.78551 1.000 85.08181  ? 250 ASP A CB    1 
ATOM   1998 C  CG    . ASP A 1 251 ? 53.28248 19.84129  -55.61070 1.000 95.73011  ? 250 ASP A CG    1 
ATOM   1999 O  OD1   . ASP A 1 251 ? 53.74164 20.12271  -54.47557 1.000 95.37292  ? 250 ASP A OD1   1 
ATOM   2000 O  OD2   . ASP A 1 251 ? 54.00191 19.63728  -56.61064 1.000 95.62589  ? 250 ASP A OD2   1 
ATOM   2001 N  N     . SER A 1 252 ? 48.73361 19.57433  -55.06205 1.000 79.31073  ? 251 SER A N     1 
ATOM   2002 C  CA    . SER A 1 252 ? 47.30504 19.81959  -55.07900 1.000 80.29574  ? 251 SER A CA    1 
ATOM   2003 C  C     . SER A 1 252 ? 46.77583 19.64262  -53.66180 1.000 82.49635  ? 251 SER A C     1 
ATOM   2004 O  O     . SER A 1 252 ? 47.19529 18.73009  -52.94361 1.000 86.31800  ? 251 SER A O     1 
ATOM   2005 C  CB    . SER A 1 252 ? 46.60712 18.86576  -56.04693 1.000 77.17319  ? 251 SER A CB    1 
ATOM   2006 O  OG    . SER A 1 252 ? 45.20400 18.95466  -55.91359 1.000 80.03622  ? 251 SER A OG    1 
ATOM   2007 N  N     . TRP A 1 253 ? 45.87880 20.53526  -53.24878 1.000 78.78098  ? 252 TRP A N     1 
ATOM   2008 C  CA    . TRP A 1 253 ? 45.34611 20.53894  -51.89207 1.000 73.29964  ? 252 TRP A CA    1 
ATOM   2009 C  C     . TRP A 1 253 ? 43.83304 20.42420  -51.93860 1.000 70.81843  ? 252 TRP A C     1 
ATOM   2010 O  O     . TRP A 1 253 ? 43.17015 21.22224  -52.60585 1.000 76.04349  ? 252 TRP A O     1 
ATOM   2011 C  CB    . TRP A 1 253 ? 45.73054 21.81461  -51.13604 1.000 71.45830  ? 252 TRP A CB    1 
ATOM   2012 C  CG    . TRP A 1 253 ? 47.19676 21.99643  -50.86898 1.000 70.95591  ? 252 TRP A CG    1 
ATOM   2013 C  CD1   . TRP A 1 253 ? 48.10307 22.62021  -51.67188 1.000 69.73192  ? 252 TRP A CD1   1 
ATOM   2014 C  CD2   . TRP A 1 253 ? 47.91472 21.58293  -49.69964 1.000 72.21460  ? 252 TRP A CD2   1 
ATOM   2015 N  NE1   . TRP A 1 253 ? 49.34410 22.61382  -51.08339 1.000 72.16166  ? 252 TRP A NE1   1 
ATOM   2016 C  CE2   . TRP A 1 253 ? 49.25840 21.97976  -49.87350 1.000 72.09778  ? 252 TRP A CE2   1 
ATOM   2017 C  CE3   . TRP A 1 253 ? 47.55460 20.90969  -48.52673 1.000 66.46277  ? 252 TRP A CE3   1 
ATOM   2018 C  CZ2   . TRP A 1 253 ? 50.24323 21.72272  -48.92285 1.000 71.89570  ? 252 TRP A CZ2   1 
ATOM   2019 C  CZ3   . TRP A 1 253 ? 48.53296 20.65776  -47.58274 1.000 69.39670  ? 252 TRP A CZ3   1 
ATOM   2020 C  CH2   . TRP A 1 253 ? 49.86222 21.06275  -47.78632 1.000 71.17483  ? 252 TRP A CH2   1 
ATOM   2021 N  N     . THR A 1 254 ? 43.29302 19.44878  -51.22199 1.000 67.55793  ? 253 THR A N     1 
ATOM   2022 C  CA    . THR A 1 254 ? 41.85701 19.30821  -51.04599 1.000 68.91977  ? 253 THR A CA    1 
ATOM   2023 C  C     . THR A 1 254 ? 41.44346 19.83788  -49.68117 1.000 67.57022  ? 253 THR A C     1 
ATOM   2024 O  O     . THR A 1 254 ? 42.27614 20.13438  -48.82582 1.000 73.61389  ? 253 THR A O     1 
ATOM   2025 C  CB    . THR A 1 254 ? 41.43637 17.84664  -51.17003 1.000 73.30337  ? 253 THR A CB    1 
ATOM   2026 O  OG1   . THR A 1 254 ? 41.80759 17.15079  -49.97354 1.000 72.18431  ? 253 THR A OG1   1 
ATOM   2027 C  CG2   . THR A 1 254 ? 42.12300 17.20441  -52.35521 1.000 76.51759  ? 253 THR A CG2   1 
ATOM   2028 N  N     . VAL A 1 255 ? 40.12933 19.93000  -49.47600 1.000 64.37693  ? 254 VAL A N     1 
ATOM   2029 C  CA    . VAL A 1 255 ? 39.60475 20.30596  -48.16608 1.000 65.77437  ? 254 VAL A CA    1 
ATOM   2030 C  C     . VAL A 1 255 ? 40.18782 19.41488  -47.07825 1.000 69.12116  ? 254 VAL A C     1 
ATOM   2031 O  O     . VAL A 1 255 ? 40.61112 19.89898  -46.02475 1.000 71.25860  ? 254 VAL A O     1 
ATOM   2032 C  CB    . VAL A 1 255 ? 38.06606 20.25798  -48.16921 1.000 65.32711  ? 254 VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1 255 ? 37.53387 20.19916  -46.74639 1.000 60.07267  ? 254 VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1 255 ? 37.50152 21.46272  -48.90750 1.000 64.69983  ? 254 VAL A CG2   1 
ATOM   2035 N  N     . ASN A 1 256 ? 40.23319 18.10294  -47.31825 1.000 68.98727  ? 255 ASN A N     1 
ATOM   2036 C  CA    . ASN A 1 256 ? 40.76108 17.18877  -46.31172 1.000 66.64194  ? 255 ASN A CA    1 
ATOM   2037 C  C     . ASN A 1 256 ? 42.23436 17.46697  -46.04369 1.000 67.93520  ? 255 ASN A C     1 
ATOM   2038 O  O     . ASN A 1 256 ? 42.67479 17.48151  -44.88461 1.000 68.08820  ? 255 ASN A O     1 
ATOM   2039 C  CB    . ASN A 1 256 ? 40.55852 15.74448  -46.77009 1.000 74.78037  ? 255 ASN A CB    1 
ATOM   2040 C  CG    . ASN A 1 256 ? 40.45979 14.76238  -45.61017 1.000 74.78998  ? 255 ASN A CG    1 
ATOM   2041 O  OD1   . ASN A 1 256 ? 41.44076 14.10261  -45.24430 1.000 64.60498  ? 255 ASN A OD1   1 
ATOM   2042 N  ND2   . ASN A 1 256 ? 39.26086 14.65191  -45.03345 1.000 76.36468  ? 255 ASN A ND2   1 
ATOM   2043 N  N     . ASP A 1 257 ? 43.01303 17.68803  -47.10735 1.000 69.35478  ? 256 ASP A N     1 
ATOM   2044 C  CA    . ASP A 1 257 ? 44.40390 18.09458  -46.93765 1.000 68.78022  ? 256 ASP A CA    1 
ATOM   2045 C  C     . ASP A 1 257 ? 44.50366 19.34814  -46.07558 1.000 67.78782  ? 256 ASP A C     1 
ATOM   2046 O  O     . ASP A 1 257 ? 45.35878 19.43346  -45.17928 1.000 67.28449  ? 256 ASP A O     1 
ATOM   2047 C  CB    . ASP A 1 257 ? 45.05332 18.32439  -48.30661 1.000 69.91144  ? 256 ASP A CB    1 
ATOM   2048 C  CG    . ASP A 1 257 ? 45.40760 17.01858  -49.02656 1.000 76.92242  ? 256 ASP A CG    1 
ATOM   2049 O  OD1   . ASP A 1 257 ? 45.50614 15.96256  -48.36025 1.000 71.71995  ? 256 ASP A OD1   1 
ATOM   2050 O  OD2   . ASP A 1 257 ? 45.60653 17.05253  -50.26289 1.000 79.47590  ? 256 ASP A OD2   1 
ATOM   2051 N  N     . ILE A 1 258 ? 43.60974 20.31592  -46.30856 1.000 64.99209  ? 257 ILE A N     1 
ATOM   2052 C  CA    . ILE A 1 258 ? 43.65061 21.57515  -45.56997 1.000 62.89347  ? 257 ILE A CA    1 
ATOM   2053 C  C     . ILE A 1 258 ? 43.32102 21.34914  -44.09826 1.000 63.05452  ? 257 ILE A C     1 
ATOM   2054 O  O     . ILE A 1 258 ? 44.00028 21.88122  -43.21302 1.000 57.97944  ? 257 ILE A O     1 
ATOM   2055 C  CB    . ILE A 1 258 ? 42.69865 22.60590  -46.20339 1.000 65.97612  ? 257 ILE A CB    1 
ATOM   2056 C  CG1   . ILE A 1 258 ? 43.13453 22.94215  -47.62561 1.000 61.96515  ? 257 ILE A CG1   1 
ATOM   2057 C  CG2   . ILE A 1 258 ? 42.66485 23.88924  -45.36988 1.000 63.23874  ? 257 ILE A CG2   1 
ATOM   2058 C  CD1   . ILE A 1 258 ? 44.44880 23.67434  -47.68366 1.000 67.90777  ? 257 ILE A CD1   1 
ATOM   2059 N  N     . CYS A 1 259 ? 42.24941 20.59727  -43.81652 1.000 60.65113  ? 258 CYS A N     1 
ATOM   2060 C  CA    . CYS A 1 259 ? 41.90600 20.29033  -42.43238 1.000 55.39218  ? 258 CYS A CA    1 
ATOM   2061 C  C     . CYS A 1 259 ? 43.06427 19.60002  -41.72188 1.000 58.45302  ? 258 CYS A C     1 
ATOM   2062 O  O     . CYS A 1 259 ? 43.33698 19.89325  -40.55317 1.000 61.86588  ? 258 CYS A O     1 
ATOM   2063 C  CB    . CYS A 1 259 ? 40.64934 19.42533  -42.35666 1.000 53.83498  ? 258 CYS A CB    1 
ATOM   2064 S  SG    . CYS A 1 259 ? 39.08081 20.21327  -42.80391 1.000 64.78218  ? 258 CYS A SG    1 
ATOM   2065 N  N     . LYS A 1 260 ? 43.77787 18.69865  -42.41067 1.000 56.47805  ? 259 LYS A N     1 
ATOM   2066 C  CA    . LYS A 1 260 ? 44.94727 18.07810  -41.78406 1.000 55.17830  ? 259 LYS A CA    1 
ATOM   2067 C  C     . LYS A 1 260 ? 46.00203 19.12289  -41.45444 1.000 53.83378  ? 259 LYS A C     1 
ATOM   2068 O  O     . LYS A 1 260 ? 46.58457 19.12114  -40.35821 1.000 50.42417  ? 259 LYS A O     1 
ATOM   2069 C  CB    . LYS A 1 260 ? 45.55188 17.00820  -42.69276 1.000 56.74021  ? 259 LYS A CB    1 
ATOM   2070 C  CG    . LYS A 1 260 ? 44.80182 15.70816  -42.73158 1.000 59.20768  ? 259 LYS A CG    1 
ATOM   2071 C  CD    . LYS A 1 260 ? 45.66374 14.61013  -43.35227 1.000 71.59679  ? 259 LYS A CD    1 
ATOM   2072 C  CE    . LYS A 1 260 ? 44.93399 13.25438  -43.36924 1.000 74.18618  ? 259 LYS A CE    1 
ATOM   2073 N  NZ    . LYS A 1 260 ? 45.68923 12.20922  -44.12842 1.000 79.44724  ? 259 LYS A NZ    1 
ATOM   2074 N  N     . LEU A 1 261 ? 46.25519 20.02841  -42.39988 1.000 58.39514  ? 260 LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 261 ? 47.28090 21.04398  -42.20037 1.000 56.01765  ? 260 LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 261 ? 46.91981 21.96667  -41.04888 1.000 53.58841  ? 260 LEU A C     1 
ATOM   2077 O  O     . LEU A 1 261 ? 47.75991 22.27555  -40.18813 1.000 52.48918  ? 260 LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 261 ? 47.45693 21.84000  -43.48393 1.000 54.95812  ? 260 LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 261 ? 48.62529 22.80565  -43.47399 1.000 55.19158  ? 260 LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 261 ? 49.95353 22.05087  -43.34486 1.000 55.94396  ? 260 LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 261 ? 48.54751 23.62795  -44.73996 1.000 56.53583  ? 260 LEU A CD2   1 
ATOM   2082 N  N     . VAL A 1 262 ? 45.66487 22.40478  -41.01547 1.000 50.14317  ? 261 VAL A N     1 
ATOM   2083 C  CA    . VAL A 1 262 ? 45.21363 23.32345  -39.98018 1.000 53.05073  ? 261 VAL A CA    1 
ATOM   2084 C  C     . VAL A 1 262 ? 45.24464 22.64477  -38.61800 1.000 52.87785  ? 261 VAL A C     1 
ATOM   2085 O  O     . VAL A 1 262 ? 45.63095 23.25821  -37.61235 1.000 48.29406  ? 261 VAL A O     1 
ATOM   2086 C  CB    . VAL A 1 262 ? 43.80927 23.85157  -40.32741 1.000 56.05268  ? 261 VAL A CB    1 
ATOM   2087 C  CG1   . VAL A 1 262 ? 43.22479 24.65400  -39.16305 1.000 51.91390  ? 261 VAL A CG1   1 
ATOM   2088 C  CG2   . VAL A 1 262 ? 43.86131 24.68308  -41.61034 1.000 53.89209  ? 261 VAL A CG2   1 
ATOM   2089 N  N     . GLY A 1 263 ? 44.85378 21.36608  -38.56565 1.000 49.20095  ? 262 GLY A N     1 
ATOM   2090 C  CA    . GLY A 1 263 ? 44.90210 20.64089  -37.31282 1.000 45.07429  ? 262 GLY A CA    1 
ATOM   2091 C  C     . GLY A 1 263 ? 46.30892 20.52888  -36.76556 1.000 48.36406  ? 262 GLY A C     1 
ATOM   2092 O  O     . GLY A 1 263 ? 46.54614 20.77176  -35.57751 1.000 48.04754  ? 262 GLY A O     1 
ATOM   2093 N  N     . LYS A 1 264 ? 47.26847 20.16266  -37.62437 1.000 47.96039  ? 263 LYS A N     1 
ATOM   2094 C  CA    . LYS A 1 264 ? 48.64232 20.04339  -37.14119 1.000 44.62350  ? 263 LYS A CA    1 
ATOM   2095 C  C     . LYS A 1 264 ? 49.20112 21.39910  -36.72328 1.000 45.33142  ? 263 LYS A C     1 
ATOM   2096 O  O     . LYS A 1 264 ? 49.95506 21.49637  -35.74937 1.000 42.16415  ? 263 LYS A O     1 
ATOM   2097 C  CB    . LYS A 1 264 ? 49.53204 19.38594  -38.19516 1.000 46.86993  ? 263 LYS A CB    1 
ATOM   2098 C  CG    . LYS A 1 264 ? 49.14690 17.95227  -38.49403 1.000 46.87795  ? 263 LYS A CG    1 
ATOM   2099 C  CD    . LYS A 1 264 ? 50.26919 17.21272  -39.18087 1.000 51.27109  ? 263 LYS A CD    1 
ATOM   2100 C  CE    . LYS A 1 264 ? 50.18842 15.70747  -38.94068 1.000 46.69256  ? 263 LYS A CE    1 
ATOM   2101 N  NZ    . LYS A 1 264 ? 51.56206 15.14568  -38.83096 1.000 51.20059  ? 263 LYS A NZ    1 
ATOM   2102 N  N     . LEU A 1 265 ? 48.82838 22.46711  -37.42386 1.000 46.72644  ? 264 LEU A N     1 
ATOM   2103 C  CA    . LEU A 1 265 ? 49.33212 23.77363  -37.01811 1.000 44.35109  ? 264 LEU A CA    1 
ATOM   2104 C  C     . LEU A 1 265 ? 48.74458 24.20422  -35.67270 1.000 47.37263  ? 264 LEU A C     1 
ATOM   2105 O  O     . LEU A 1 265 ? 49.45930 24.76426  -34.82554 1.000 42.79606  ? 264 LEU A O     1 
ATOM   2106 C  CB    . LEU A 1 265 ? 49.05273 24.79238  -38.12082 1.000 47.40254  ? 264 LEU A CB    1 
ATOM   2107 C  CG    . LEU A 1 265 ? 50.00216 24.66561  -39.32232 1.000 49.69183  ? 264 LEU A CG    1 
ATOM   2108 C  CD1   . LEU A 1 265 ? 49.41593 25.28950  -40.57409 1.000 47.71957  ? 264 LEU A CD1   1 
ATOM   2109 C  CD2   . LEU A 1 265 ? 51.36851 25.26907  -39.01891 1.000 48.57849  ? 264 LEU A CD2   1 
ATOM   2110 N  N     . ASN A 1 266 ? 47.45304 23.92673  -35.44321 1.000 49.29393  ? 265 ASN A N     1 
ATOM   2111 C  CA    . ASN A 1 266 ? 46.85057 24.23310  -34.14485 1.000 47.30068  ? 265 ASN A CA    1 
ATOM   2112 C  C     . ASN A 1 266 ? 47.49931 23.42401  -33.03217 1.000 46.38595  ? 265 ASN A C     1 
ATOM   2113 O  O     . ASN A 1 266 ? 47.75890 23.94251  -31.94113 1.000 49.82324  ? 265 ASN A O     1 
ATOM   2114 C  CB    . ASN A 1 266 ? 45.34537 23.98188  -34.18531 1.000 43.76609  ? 265 ASN A CB    1 
ATOM   2115 C  CG    . ASN A 1 266 ? 44.59700 25.08016  -34.93614 1.000 54.37200  ? 265 ASN A CG    1 
ATOM   2116 O  OD1   . ASN A 1 266 ? 45.02388 26.24491  -34.95758 1.000 50.40972  ? 265 ASN A OD1   1 
ATOM   2117 N  ND2   . ASN A 1 266 ? 43.48017 24.71510  -35.56021 1.000 55.76294  ? 265 ASN A ND2   1 
ATOM   2118 N  N     . TRP A 1 267 ? 47.77402 22.15006  -33.29092 1.000 46.88152  ? 266 TRP A N     1 
ATOM   2119 C  CA    . TRP A 1 267 ? 48.55836 21.36197  -32.34601 1.000 43.32298  ? 266 TRP A CA    1 
ATOM   2120 C  C     . TRP A 1 267 ? 49.91630 22.00235  -32.08372 1.000 39.52772  ? 266 TRP A C     1 
ATOM   2121 O  O     . TRP A 1 267 ? 50.34960 22.09722  -30.93393 1.000 41.19233  ? 266 TRP A O     1 
ATOM   2122 C  CB    . TRP A 1 267 ? 48.71223 19.93894  -32.87702 1.000 39.76600  ? 266 TRP A CB    1 
ATOM   2123 C  CG    . TRP A 1 267 ? 49.55345 19.06837  -32.05629 1.000 40.33867  ? 266 TRP A CG    1 
ATOM   2124 C  CD1   . TRP A 1 267 ? 50.77863 18.55770  -32.38674 1.000 41.30992  ? 266 TRP A CD1   1 
ATOM   2125 C  CD2   . TRP A 1 267 ? 49.24445 18.56381  -30.75788 1.000 45.33104  ? 266 TRP A CD2   1 
ATOM   2126 N  NE1   . TRP A 1 267 ? 51.25326 17.77059  -31.36856 1.000 39.86713  ? 266 TRP A NE1   1 
ATOM   2127 C  CE2   . TRP A 1 267 ? 50.32776 17.75216  -30.35715 1.000 45.43599  ? 266 TRP A CE2   1 
ATOM   2128 C  CE3   . TRP A 1 267 ? 48.15079 18.70744  -29.89401 1.000 43.40314  ? 266 TRP A CE3   1 
ATOM   2129 C  CZ2   . TRP A 1 267 ? 50.34799 17.09460  -29.12873 1.000 42.16649  ? 266 TRP A CZ2   1 
ATOM   2130 C  CZ3   . TRP A 1 267 ? 48.18094 18.06351  -28.67531 1.000 36.23079  ? 266 TRP A CZ3   1 
ATOM   2131 C  CH2   . TRP A 1 267 ? 49.26558 17.26820  -28.30563 1.000 39.98145  ? 266 TRP A CH2   1 
ATOM   2132 N  N     . ALA A 1 268 ? 50.59620 22.46323  -33.13572 1.000 43.00884  ? 267 ALA A N     1 
ATOM   2133 C  CA    . ALA A 1 268 ? 51.94996 22.99110  -32.97619 1.000 45.11067  ? 267 ALA A CA    1 
ATOM   2134 C  C     . ALA A 1 268 ? 51.97014 24.31975  -32.22901 1.000 44.71753  ? 267 ALA A C     1 
ATOM   2135 O  O     . ALA A 1 268 ? 52.97265 24.65304  -31.58027 1.000 41.70597  ? 267 ALA A O     1 
ATOM   2136 C  CB    . ALA A 1 268 ? 52.61122 23.16033  -34.34209 1.000 45.90174  ? 267 ALA A CB    1 
ATOM   2137 N  N     . SER A 1 269 ? 50.89140 25.09841  -32.31699 1.000 42.19411  ? 268 SER A N     1 
ATOM   2138 C  CA    . SER A 1 269 ? 50.94495 26.43256  -31.73189 1.000 43.26048  ? 268 SER A CA    1 
ATOM   2139 C  C     . SER A 1 269 ? 51.03672 26.41370  -30.21279 1.000 41.82859  ? 268 SER A C     1 
ATOM   2140 O  O     . SER A 1 269 ? 51.28884 27.46406  -29.61623 1.000 43.36089  ? 268 SER A O     1 
ATOM   2141 C  CB    . SER A 1 269 ? 49.73167 27.26064  -32.15147 1.000 42.39039  ? 268 SER A CB    1 
ATOM   2142 O  OG    . SER A 1 269 ? 48.61078 26.93905  -31.35598 1.000 40.35345  ? 268 SER A OG    1 
ATOM   2143 N  N     . GLN A 1 270 ? 50.83917 25.26608  -29.56752 1.000 39.87272  ? 269 GLN A N     1 
ATOM   2144 C  CA    . GLN A 1 270 ? 50.95608 25.23371  -28.11623 1.000 37.27029  ? 269 GLN A CA    1 
ATOM   2145 C  C     . GLN A 1 270 ? 52.37331 25.53006  -27.63487 1.000 38.98128  ? 269 GLN A C     1 
ATOM   2146 O  O     . GLN A 1 270 ? 52.54985 25.91580  -26.47676 1.000 41.41226  ? 269 GLN A O     1 
ATOM   2147 C  CB    . GLN A 1 270 ? 50.50994 23.87814  -27.58018 1.000 31.53700  ? 269 GLN A CB    1 
ATOM   2148 C  CG    . GLN A 1 270 ? 51.46239 22.76761  -27.91514 1.000 33.89356  ? 269 GLN A CG    1 
ATOM   2149 C  CD    . GLN A 1 270 ? 50.97066 21.43624  -27.43934 1.000 40.21839  ? 269 GLN A CD    1 
ATOM   2150 O  OE1   . GLN A 1 270 ? 51.01106 21.14457  -26.24311 1.000 41.45132  ? 269 GLN A OE1   1 
ATOM   2151 N  NE2   . GLN A 1 270 ? 50.48164 20.61291  -28.36783 1.000 39.36948  ? 269 GLN A NE2   1 
ATOM   2152 N  N     . ILE A 1 271 ? 53.38901 25.32786  -28.47112 1.000 39.37052  ? 270 ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 271 ? 54.76664 25.58781  -28.06073 1.000 40.64820  ? 270 ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 271 ? 55.56194 26.35857  -29.10801 1.000 42.13853  ? 270 ILE A C     1 
ATOM   2155 O  O     . ILE A 1 271 ? 56.57442 26.99116  -28.76130 1.000 41.64940  ? 270 ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 271 ? 55.47602 24.25036  -27.68777 1.000 41.88058  ? 270 ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 271 ? 56.84951 24.46864  -27.05967 1.000 40.30611  ? 270 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 271 ? 55.61334 23.34503  -28.88584 1.000 39.09397  ? 270 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 271 ? 56.81003 25.25264  -25.78474 1.000 42.64393  ? 270 ILE A CD1   1 
ATOM   2160 N  N     . TYR A 1 272 ? 55.11455 26.40016  -30.37401 1.000 44.80195  ? 271 TYR A N     1 
ATOM   2161 C  CA    . TYR A 1 272 ? 55.72159 27.23209  -31.41647 1.000 45.09766  ? 271 TYR A CA    1 
ATOM   2162 C  C     . TYR A 1 272 ? 55.04003 28.60371  -31.47793 1.000 44.23343  ? 271 TYR A C     1 
ATOM   2163 O  O     . TYR A 1 272 ? 53.84556 28.67233  -31.79148 1.000 42.55571  ? 271 TYR A O     1 
ATOM   2164 C  CB    . TYR A 1 272 ? 55.59395 26.55750  -32.77689 1.000 47.72727  ? 271 TYR A CB    1 
ATOM   2165 C  CG    . TYR A 1 272 ? 56.52498 25.38973  -33.03834 1.000 51.45186  ? 271 TYR A CG    1 
ATOM   2166 C  CD1   . TYR A 1 272 ? 56.12803 24.08123  -32.78021 1.000 53.03299  ? 271 TYR A CD1   1 
ATOM   2167 C  CD2   . TYR A 1 272 ? 57.79056 25.59326  -33.57511 1.000 55.59265  ? 271 TYR A CD2   1 
ATOM   2168 C  CE1   . TYR A 1 272 ? 56.98343 23.00765  -33.02688 1.000 53.16085  ? 271 TYR A CE1   1 
ATOM   2169 C  CE2   . TYR A 1 272 ? 58.65072 24.53536  -33.82538 1.000 58.23774  ? 271 TYR A CE2   1 
ATOM   2170 C  CZ    . TYR A 1 272 ? 58.24475 23.24771  -33.55210 1.000 60.47393  ? 271 TYR A CZ    1 
ATOM   2171 O  OH    . TYR A 1 272 ? 59.11536 22.21617  -33.81029 1.000 56.87954  ? 271 TYR A OH    1 
ATOM   2172 N  N     . PRO A 1 273 ? 55.75101 29.70821  -31.24869 1.000 40.49991  ? 272 PRO A N     1 
ATOM   2173 C  CA    . PRO A 1 273 ? 55.12259 31.02843  -31.36154 1.000 40.23412  ? 272 PRO A CA    1 
ATOM   2174 C  C     . PRO A 1 273 ? 54.98536 31.50140  -32.79965 1.000 45.25783  ? 272 PRO A C     1 
ATOM   2175 O  O     . PRO A 1 273 ? 55.90766 31.36902  -33.60944 1.000 53.51531  ? 272 PRO A O     1 
ATOM   2176 C  CB    . PRO A 1 273 ? 56.08720 31.94100  -30.59670 1.000 40.09253  ? 272 PRO A CB    1 
ATOM   2177 C  CG    . PRO A 1 273 ? 57.31894 31.13062  -30.36412 1.000 38.19763  ? 272 PRO A CG    1 
ATOM   2178 C  CD    . PRO A 1 273 ? 57.19247 29.82442  -31.01421 1.000 43.91706  ? 272 PRO A CD    1 
ATOM   2179 N  N     . GLY A 1 274 ? 53.83040 32.09333  -33.10572 1.000 40.23187  ? 273 GLY A N     1 
ATOM   2180 C  CA    . GLY A 1 274 ? 53.63472 32.77745  -34.36479 1.000 38.39170  ? 273 GLY A CA    1 
ATOM   2181 C  C     . GLY A 1 274 ? 52.79367 32.05196  -35.38729 1.000 45.61816  ? 273 GLY A C     1 
ATOM   2182 O  O     . GLY A 1 274 ? 52.67701 32.54255  -36.52394 1.000 47.06600  ? 273 GLY A O     1 
ATOM   2183 N  N     . ILE A 1 275 ? 52.21034 30.90040  -35.03511 1.000 44.29036  ? 274 ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 275 ? 51.42094 30.14858  -36.00065 1.000 44.21470  ? 274 ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 275 ? 50.18685 30.95249  -36.38595 1.000 45.85038  ? 274 ILE A C     1 
ATOM   2186 O  O     . ILE A 1 275 ? 49.51220 31.53966  -35.52760 1.000 44.30715  ? 274 ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 275 ? 51.04595 28.77927  -35.42101 1.000 47.62110  ? 274 ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 275 ? 52.29455 28.06007  -34.90854 1.000 46.82130  ? 274 ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 275 ? 50.29619 27.94099  -36.46896 1.000 43.95511  ? 274 ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 275 ? 53.18013 27.52960  -36.00064 1.000 48.48461  ? 274 ILE A CD1   1 
ATOM   2191 N  N     . LYS A 1 276 ? 49.89202 30.98680  -37.68842 1.000 48.88798  ? 275 LYS A N     1 
ATOM   2192 C  CA    . LYS A 1 276 ? 48.75148 31.71486  -38.23133 1.000 52.11288  ? 275 LYS A CA    1 
ATOM   2193 C  C     . LYS A 1 276 ? 48.00333 30.80831  -39.19112 1.000 52.41326  ? 275 LYS A C     1 
ATOM   2194 O  O     . LYS A 1 276 ? 48.62145 30.14654  -40.03047 1.000 50.95566  ? 275 LYS A O     1 
ATOM   2195 C  CB    . LYS A 1 276 ? 49.17513 32.99636  -38.96094 1.000 53.30068  ? 275 LYS A CB    1 
ATOM   2196 C  CG    . LYS A 1 276 ? 49.68384 34.09798  -38.05457 1.000 55.21201  ? 275 LYS A CG    1 
ATOM   2197 C  CD    . LYS A 1 276 ? 49.97897 35.35144  -38.85104 1.000 59.28369  ? 275 LYS A CD    1 
ATOM   2198 C  CE    . LYS A 1 276 ? 51.38313 35.33905  -39.41487 1.000 65.91491  ? 275 LYS A CE    1 
ATOM   2199 N  NZ    . LYS A 1 276 ? 51.81404 36.71564  -39.79096 1.000 69.86517  ? 275 LYS A NZ    1 
ATOM   2200 N  N     . VAL A 1 277 ? 46.67441 30.78465  -39.07353 1.000 53.06790  ? 276 VAL A N     1 
ATOM   2201 C  CA    . VAL A 1 277 ? 45.86659 29.90207  -39.90178 1.000 53.84019  ? 276 VAL A CA    1 
ATOM   2202 C  C     . VAL A 1 277 ? 44.69563 30.65165  -40.51783 1.000 54.36275  ? 276 VAL A C     1 
ATOM   2203 O  O     . VAL A 1 277 ? 43.79202 30.03121  -41.08265 1.000 57.44085  ? 276 VAL A O     1 
ATOM   2204 C  CB    . VAL A 1 277 ? 45.37107 28.69586  -39.08280 1.000 56.00805  ? 276 VAL A CB    1 
ATOM   2205 C  CG1   . VAL A 1 277 ? 46.55072 28.00533  -38.38879 1.000 50.10083  ? 276 VAL A CG1   1 
ATOM   2206 C  CG2   . VAL A 1 277 ? 44.31562 29.12797  -38.07845 1.000 52.29841  ? 276 VAL A CG2   1 
ATOM   2207 N  N     . ARG A 1 278 ? 44.70172 31.98262  -40.42698 1.000 54.67369  ? 277 ARG A N     1 
ATOM   2208 C  CA    . ARG A 1 278 ? 43.55711 32.76089  -40.90002 1.000 57.79231  ? 277 ARG A CA    1 
ATOM   2209 C  C     . ARG A 1 278 ? 43.26779 32.48554  -42.36656 1.000 61.32618  ? 277 ARG A C     1 
ATOM   2210 O  O     . ARG A 1 278 ? 42.12678 32.19511  -42.74173 1.000 65.48364  ? 277 ARG A O     1 
ATOM   2211 C  CB    . ARG A 1 278 ? 43.80216 34.25555  -40.68385 1.000 59.65562  ? 277 ARG A CB    1 
ATOM   2212 C  CG    . ARG A 1 278 ? 43.02644 35.19995  -41.61836 1.000 64.38849  ? 277 ARG A CG    1 
ATOM   2213 C  CD    . ARG A 1 278 ? 41.51656 35.24039  -41.35056 1.000 63.41534  ? 277 ARG A CD    1 
ATOM   2214 N  NE    . ARG A 1 278 ? 41.19653 35.81450  -40.04918 1.000 61.67148  ? 277 ARG A NE    1 
ATOM   2215 C  CZ    . ARG A 1 278 ? 40.89439 35.09700  -38.97085 1.000 62.16070  ? 277 ARG A CZ    1 
ATOM   2216 N  NH1   . ARG A 1 278 ? 40.62868 35.70900  -37.82753 1.000 65.92062  ? 277 ARG A NH1   1 
ATOM   2217 N  NH2   . ARG A 1 278 ? 40.85553 33.76994  -39.03137 1.000 63.46820  ? 277 ARG A NH2   1 
ATOM   2218 N  N     . GLN A 1 279 ? 44.29383 32.57430  -43.21121 1.000 57.05851  ? 278 GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 279 ? 44.09121 32.45487  -44.64965 1.000 61.70767  ? 278 GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 279 ? 43.78823 31.01286  -45.04622 1.000 65.05438  ? 278 GLN A C     1 
ATOM   2221 O  O     . GLN A 1 279 ? 42.82590 30.73826  -45.79233 1.000 65.34140  ? 278 GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 279 ? 45.33165 32.97622  -45.37096 1.000 67.53724  ? 278 GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 279 ? 45.67052 34.41280  -45.01908 1.000 63.73691  ? 278 GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 279 ? 44.56153 35.36214  -45.41301 1.000 68.70673  ? 278 GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 279 ? 43.98661 35.23514  -46.49545 1.000 69.75890  ? 278 GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 279 ? 44.24268 36.31339  -44.53275 1.000 65.63129  ? 278 GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 280 ? 44.61364 30.08060  -44.55674 1.000 61.88380  ? 279 LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 280 ? 44.33874 28.65971  -44.72565 1.000 56.69872  ? 279 LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 280 ? 42.92002 28.31103  -44.30461 1.000 56.87608  ? 279 LEU A C     1 
ATOM   2230 O  O     . LEU A 1 280 ? 42.22169 27.57362  -45.00570 1.000 57.24013  ? 279 LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 280 ? 45.35518 27.85447  -43.93217 1.000 46.75963  ? 279 LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 280 ? 46.74684 28.04754  -44.51419 1.000 51.49279  ? 279 LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 280 ? 47.82622 27.59807  -43.55190 1.000 58.49657  ? 279 LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 280 ? 46.85432 27.28663  -45.82019 1.000 56.87596  ? 279 LEU A CD2   1 
ATOM   2235 N  N     . SER A 1 281 ? 42.45999 28.85629  -43.18043 1.000 58.12057  ? 280 SER A N     1 
ATOM   2236 C  CA    . SER A 1 281 ? 41.12121 28.51229  -42.71725 1.000 59.47581  ? 280 SER A CA    1 
ATOM   2237 C  C     . SER A 1 281 ? 40.04559 29.13006  -43.60028 1.000 63.55250  ? 280 SER A C     1 
ATOM   2238 O  O     . SER A 1 281 ? 39.06992 28.45354  -43.94806 1.000 65.27859  ? 280 SER A O     1 
ATOM   2239 C  CB    . SER A 1 281 ? 40.93606 28.93083  -41.26040 1.000 60.94930  ? 280 SER A CB    1 
ATOM   2240 O  OG    . SER A 1 281 ? 41.52404 27.97711  -40.38580 1.000 62.50706  ? 280 SER A OG    1 
ATOM   2241 N  N     . LYS A 1 282 ? 40.20294 30.40692  -43.97845 1.000 67.08382  ? 281 LYS A N     1 
ATOM   2242 C  CA    . LYS A 1 282 ? 39.23202 31.04053  -44.87225 1.000 64.73629  ? 281 LYS A CA    1 
ATOM   2243 C  C     . LYS A 1 282 ? 39.06148 30.24197  -46.15364 1.000 66.86428  ? 281 LYS A C     1 
ATOM   2244 O  O     . LYS A 1 282 ? 37.95350 30.18426  -46.70154 1.000 69.40132  ? 281 LYS A O     1 
ATOM   2245 C  CB    . LYS A 1 282 ? 39.64598 32.47807  -45.20129 1.000 58.31060  ? 281 LYS A CB    1 
ATOM   2246 N  N     . LEU A 1 283 ? 40.13683 29.58748  -46.61639 1.000 65.76951  ? 282 LEU A N     1 
ATOM   2247 C  CA    . LEU A 1 283 ? 40.06628 28.70538  -47.78641 1.000 64.78907  ? 282 LEU A CA    1 
ATOM   2248 C  C     . LEU A 1 283 ? 38.93455 27.67285  -47.72593 1.000 66.79287  ? 282 LEU A C     1 
ATOM   2249 O  O     . LEU A 1 283 ? 38.55695 27.12287  -48.76561 1.000 64.13404  ? 282 LEU A O     1 
ATOM   2250 C  CB    . LEU A 1 283 ? 41.39215 27.95614  -47.95145 1.000 62.48645  ? 282 LEU A CB    1 
ATOM   2251 C  CG    . LEU A 1 283 ? 42.25725 28.17234  -49.18453 1.000 62.75617  ? 282 LEU A CG    1 
ATOM   2252 C  CD1   . LEU A 1 283 ? 42.19849 29.61281  -49.63841 1.000 71.06926  ? 282 LEU A CD1   1 
ATOM   2253 C  CD2   . LEU A 1 283 ? 43.67069 27.79885  -48.83346 1.000 57.99557  ? 282 LEU A CD2   1 
ATOM   2254 N  N     . LEU A 1 284 ? 38.39372 27.37536  -46.54766 1.000 66.23759  ? 283 LEU A N     1 
ATOM   2255 C  CA    . LEU A 1 284 ? 37.39634 26.31979  -46.41691 1.000 66.65896  ? 283 LEU A CA    1 
ATOM   2256 C  C     . LEU A 1 284 ? 35.97033 26.81260  -46.55711 1.000 70.64665  ? 283 LEU A C     1 
ATOM   2257 O  O     . LEU A 1 284 ? 35.04130 26.01250  -46.39663 1.000 71.25811  ? 283 LEU A O     1 
ATOM   2258 C  CB    . LEU A 1 284 ? 37.52319 25.62885  -45.06232 1.000 67.97954  ? 283 LEU A CB    1 
ATOM   2259 C  CG    . LEU A 1 284 ? 38.88456 25.01298  -44.78041 1.000 70.16456  ? 283 LEU A CG    1 
ATOM   2260 C  CD1   . LEU A 1 284 ? 39.13000 25.00929  -43.28212 1.000 67.50686  ? 283 LEU A CD1   1 
ATOM   2261 C  CD2   . LEU A 1 284 ? 38.94900 23.61839  -45.36400 1.000 66.53503  ? 283 LEU A CD2   1 
ATOM   2262 N  N     . ARG A 1 285 ? 35.76955 28.09768  -46.82798 1.000 71.81814  ? 284 ARG A N     1 
ATOM   2263 C  CA    . ARG A 1 285 ? 34.43210 28.66406  -46.75019 1.000 71.67122  ? 284 ARG A CA    1 
ATOM   2264 C  C     . ARG A 1 285 ? 33.55999 28.13402  -47.88397 1.000 71.94475  ? 284 ARG A C     1 
ATOM   2265 O  O     . ARG A 1 285 ? 33.96311 28.13540  -49.05195 1.000 63.48808  ? 284 ARG A O     1 
ATOM   2266 C  CB    . ARG A 1 285 ? 34.50329 30.19116  -46.77620 1.000 68.11321  ? 284 ARG A CB    1 
ATOM   2267 N  N     . GLY A 1 286 ? 32.36917 27.65605  -47.52372 1.000 73.97449  ? 285 GLY A N     1 
ATOM   2268 C  CA    . GLY A 1 286 ? 31.37345 27.22902  -48.48574 1.000 75.00687  ? 285 GLY A CA    1 
ATOM   2269 C  C     . GLY A 1 286 ? 31.76132 26.00861  -49.29732 1.000 78.91687  ? 285 GLY A C     1 
ATOM   2270 O  O     . GLY A 1 286 ? 31.05666 25.64447  -50.24393 1.000 79.32958  ? 285 GLY A O     1 
ATOM   2271 N  N     . THR A 1 287 ? 32.87510 25.37023  -48.93353 1.000 80.06148  ? 286 THR A N     1 
ATOM   2272 C  CA    . THR A 1 287 ? 33.34061 24.19319  -49.65035 1.000 75.23470  ? 286 THR A CA    1 
ATOM   2273 C  C     . THR A 1 287 ? 32.28690 23.09036  -49.58524 1.000 79.37255  ? 286 THR A C     1 
ATOM   2274 O  O     . THR A 1 287 ? 31.42846 23.05897  -48.70165 1.000 83.87562  ? 286 THR A O     1 
ATOM   2275 C  CB    . THR A 1 287 ? 34.66920 23.69492  -49.07427 1.000 68.87692  ? 286 THR A CB    1 
ATOM   2276 N  N     . LYS A 1 288 ? 32.35287 22.18238  -50.55327 1.000 81.36446  ? 287 LYS A N     1 
ATOM   2277 C  CA    . LYS A 1 288 ? 31.30166 21.19111  -50.74788 1.000 78.13931  ? 287 LYS A CA    1 
ATOM   2278 C  C     . LYS A 1 288 ? 31.52777 19.95760  -49.88042 1.000 76.96832  ? 287 LYS A C     1 
ATOM   2279 O  O     . LYS A 1 288 ? 30.65180 19.56730  -49.10132 1.000 76.14322  ? 287 LYS A O     1 
ATOM   2280 C  CB    . LYS A 1 288 ? 31.21911 20.80681  -52.23160 1.000 79.48944  ? 287 LYS A CB    1 
ATOM   2281 N  N     . ALA A 1 289 ? 32.69704 19.33799  -50.00598 1.000 76.13483  ? 288 ALA A N     1 
ATOM   2282 C  CA    . ALA A 1 289 ? 32.96418 18.07672  -49.32621 1.000 74.52566  ? 288 ALA A CA    1 
ATOM   2283 C  C     . ALA A 1 289 ? 34.47155 17.86974  -49.23948 1.000 72.74328  ? 288 ALA A C     1 
ATOM   2284 O  O     . ALA A 1 289 ? 35.25653 18.63691  -49.80135 1.000 71.39282  ? 288 ALA A O     1 
ATOM   2285 C  CB    . ALA A 1 289 ? 32.28455 16.90438  -50.03762 1.000 69.43805  ? 288 ALA A CB    1 
ATOM   2286 N  N     . LEU A 1 290 ? 34.86595 16.80808  -48.52628 1.000 74.15656  ? 289 LEU A N     1 
ATOM   2287 C  CA    . LEU A 1 290 ? 36.27738 16.60289  -48.20897 1.000 77.54919  ? 289 LEU A CA    1 
ATOM   2288 C  C     . LEU A 1 290 ? 37.13811 16.49184  -49.46155 1.000 76.21685  ? 289 LEU A C     1 
ATOM   2289 O  O     . LEU A 1 290 ? 38.33375 16.79982  -49.42457 1.000 71.94320  ? 289 LEU A O     1 
ATOM   2290 C  CB    . LEU A 1 290 ? 36.43635 15.34455  -47.35063 1.000 75.74076  ? 289 LEU A CB    1 
ATOM   2291 C  CG    . LEU A 1 290 ? 35.55046 15.32149  -46.10258 1.000 77.68703  ? 289 LEU A CG    1 
ATOM   2292 C  CD1   . LEU A 1 290 ? 35.67611 13.99353  -45.36087 1.000 74.76822  ? 289 LEU A CD1   1 
ATOM   2293 C  CD2   . LEU A 1 290 ? 35.89411 16.49685  -45.20038 1.000 73.25067  ? 289 LEU A CD2   1 
ATOM   2294 N  N     . THR A 1 291 ? 36.55504 16.06414  -50.57661 1.000 81.38309  ? 290 THR A N     1 
ATOM   2295 C  CA    . THR A 1 291 ? 37.34047 15.81781  -51.77407 1.000 80.57128  ? 290 THR A CA    1 
ATOM   2296 C  C     . THR A 1 291 ? 37.61900 17.08058  -52.57753 1.000 82.08270  ? 290 THR A C     1 
ATOM   2297 O  O     . THR A 1 291 ? 38.59584 17.09895  -53.33524 1.000 81.43377  ? 290 THR A O     1 
ATOM   2298 C  CB    . THR A 1 291 ? 36.61595 14.80311  -52.65371 1.000 86.41644  ? 290 THR A CB    1 
ATOM   2299 O  OG1   . THR A 1 291 ? 35.33218 15.33207  -53.02490 1.000 86.69737  ? 290 THR A OG1   1 
ATOM   2300 C  CG2   . THR A 1 291 ? 36.43633 13.47856  -51.90033 1.000 76.20271  ? 290 THR A CG2   1 
ATOM   2301 N  N     . GLU A 1 292 ? 36.79633 18.12525  -52.42621 1.000 77.69936  ? 291 GLU A N     1 
ATOM   2302 C  CA    . GLU A 1 292 ? 36.91098 19.32318  -53.25165 1.000 71.99235  ? 291 GLU A CA    1 
ATOM   2303 C  C     . GLU A 1 292 ? 38.32104 19.88044  -53.19277 1.000 71.44255  ? 291 GLU A C     1 
ATOM   2304 O  O     . GLU A 1 292 ? 38.84656 20.15195  -52.11510 1.000 76.48655  ? 291 GLU A O     1 
ATOM   2305 C  CB    . GLU A 1 292 ? 35.89871 20.38226  -52.79822 1.000 72.17598  ? 291 GLU A CB    1 
ATOM   2306 N  N     . VAL A 1 293 ? 38.94828 20.01368  -54.35414 1.000 74.71748  ? 292 VAL A N     1 
ATOM   2307 C  CA    . VAL A 1 293 ? 40.25653 20.65013  -54.44317 1.000 75.03492  ? 292 VAL A CA    1 
ATOM   2308 C  C     . VAL A 1 293 ? 40.05399 22.15828  -54.43754 1.000 77.66896  ? 292 VAL A C     1 
ATOM   2309 O  O     . VAL A 1 293 ? 39.31615 22.69816  -55.26726 1.000 81.18848  ? 292 VAL A O     1 
ATOM   2310 C  CB    . VAL A 1 293 ? 41.01247 20.20295  -55.70161 1.000 74.84160  ? 292 VAL A CB    1 
ATOM   2311 C  CG1   . VAL A 1 293 ? 42.28079 21.03041  -55.88049 1.000 73.40653  ? 292 VAL A CG1   1 
ATOM   2312 C  CG2   . VAL A 1 293 ? 41.34800 18.73211  -55.61849 1.000 74.26962  ? 292 VAL A CG2   1 
ATOM   2313 N  N     . ILE A 1 294 ? 40.69596 22.83890  -53.49597 1.000 78.09782  ? 293 ILE A N     1 
ATOM   2314 C  CA    . ILE A 1 294 ? 40.70089 24.29669  -53.48238 1.000 75.70963  ? 293 ILE A CA    1 
ATOM   2315 C  C     . ILE A 1 294 ? 42.10821 24.74604  -53.86116 1.000 82.06512  ? 293 ILE A C     1 
ATOM   2316 O  O     . ILE A 1 294 ? 43.09420 24.13692  -53.41755 1.000 78.31275  ? 293 ILE A O     1 
ATOM   2317 C  CB    . ILE A 1 294 ? 40.25544 24.84558  -52.11706 1.000 71.42977  ? 293 ILE A CB    1 
ATOM   2318 N  N     . PRO A 1 295 ? 42.25643 25.75998  -54.71456 1.000 88.11643  ? 294 PRO A N     1 
ATOM   2319 C  CA    . PRO A 1 295 ? 43.59743 26.27464  -55.02400 1.000 84.01676  ? 294 PRO A CA    1 
ATOM   2320 C  C     . PRO A 1 295 ? 44.03727 27.32881  -54.01799 1.000 80.54801  ? 294 PRO A C     1 
ATOM   2321 O  O     . PRO A 1 295 ? 43.25709 28.18289  -53.59069 1.000 73.67619  ? 294 PRO A O     1 
ATOM   2322 C  CB    . PRO A 1 295 ? 43.41868 26.87511  -56.42615 1.000 84.70990  ? 294 PRO A CB    1 
ATOM   2323 C  CG    . PRO A 1 295 ? 41.98121 27.30514  -56.45457 1.000 87.03767  ? 294 PRO A CG    1 
ATOM   2324 C  CD    . PRO A 1 295 ? 41.21807 26.33451  -55.59001 1.000 82.80694  ? 294 PRO A CD    1 
ATOM   2325 N  N     . LEU A 1 296 ? 45.30721 27.25307  -53.61917 1.000 80.30120  ? 295 LEU A N     1 
ATOM   2326 C  CA    . LEU A 1 296 ? 45.81729 28.17879  -52.61582 1.000 78.45890  ? 295 LEU A CA    1 
ATOM   2327 C  C     . LEU A 1 296 ? 45.78067 29.60502  -53.14373 1.000 82.99813  ? 295 LEU A C     1 
ATOM   2328 O  O     . LEU A 1 296 ? 46.20049 29.87100  -54.27441 1.000 87.03141  ? 295 LEU A O     1 
ATOM   2329 C  CB    . LEU A 1 296 ? 47.24908 27.81390  -52.21540 1.000 76.11973  ? 295 LEU A CB    1 
ATOM   2330 C  CG    . LEU A 1 296 ? 47.53026 26.52030  -51.44679 1.000 73.58509  ? 295 LEU A CG    1 
ATOM   2331 C  CD1   . LEU A 1 296 ? 48.88345 26.59376  -50.74420 1.000 70.57463  ? 295 LEU A CD1   1 
ATOM   2332 C  CD2   . LEU A 1 296 ? 46.43202 26.22266  -50.45463 1.000 72.10394  ? 295 LEU A CD2   1 
ATOM   2333 N  N     . THR A 1 297 ? 45.26215 30.52088  -52.32709 1.000 79.33058  ? 296 THR A N     1 
ATOM   2334 C  CA    . THR A 1 297 ? 45.45085 31.93606  -52.59422 1.000 74.59114  ? 296 THR A CA    1 
ATOM   2335 C  C     . THR A 1 297 ? 46.92083 32.29919  -52.38944 1.000 75.35992  ? 296 THR A C     1 
ATOM   2336 O  O     . THR A 1 297 ? 47.71372 31.51070  -51.86947 1.000 73.72017  ? 296 THR A O     1 
ATOM   2337 C  CB    . THR A 1 297 ? 44.55604 32.77813  -51.68743 1.000 74.32844  ? 296 THR A CB    1 
ATOM   2338 O  OG1   . THR A 1 297 ? 44.99711 32.65152  -50.33185 1.000 74.39283  ? 296 THR A OG1   1 
ATOM   2339 C  CG2   . THR A 1 297 ? 43.10344 32.31010  -51.78767 1.000 63.35582  ? 296 THR A CG2   1 
ATOM   2340 N  N     . GLU A 1 298 ? 47.29591 33.50434  -52.82625 1.000 80.44397  ? 297 GLU A N     1 
ATOM   2341 C  CA    . GLU A 1 298 ? 48.65430 33.96629  -52.56239 1.000 78.03082  ? 297 GLU A CA    1 
ATOM   2342 C  C     . GLU A 1 298 ? 48.85083 34.27849  -51.08803 1.000 76.45031  ? 297 GLU A C     1 
ATOM   2343 O  O     . GLU A 1 298 ? 49.93877 34.05017  -50.54015 1.000 76.30497  ? 297 GLU A O     1 
ATOM   2344 C  CB    . GLU A 1 298 ? 48.97576 35.20047  -53.39590 1.000 80.16122  ? 297 GLU A CB    1 
ATOM   2345 C  CG    . GLU A 1 298 ? 48.76450 35.04272  -54.87936 1.000 91.33482  ? 297 GLU A CG    1 
ATOM   2346 C  CD    . GLU A 1 298 ? 49.37904 36.19176  -55.66205 1.000 100.23794 ? 297 GLU A CD    1 
ATOM   2347 O  OE1   . GLU A 1 298 ? 50.32126 35.94441  -56.45654 1.000 98.77575  ? 297 GLU A OE1   1 
ATOM   2348 O  OE2   . GLU A 1 298 ? 48.93031 37.34582  -55.46275 1.000 93.60245  ? 297 GLU A OE2   1 
ATOM   2349 N  N     . GLU A 1 299 ? 47.81242 34.80332  -50.43697 1.000 77.41887  ? 298 GLU A N     1 
ATOM   2350 C  CA    . GLU A 1 299 ? 47.89059 35.07385  -49.00703 1.000 77.15869  ? 298 GLU A CA    1 
ATOM   2351 C  C     . GLU A 1 299 ? 48.09520 33.78151  -48.22122 1.000 75.64070  ? 298 GLU A C     1 
ATOM   2352 O  O     . GLU A 1 299 ? 48.96866 33.70207  -47.34641 1.000 78.44834  ? 298 GLU A O     1 
ATOM   2353 C  CB    . GLU A 1 299 ? 46.62757 35.81016  -48.56028 1.000 76.81382  ? 298 GLU A CB    1 
ATOM   2354 C  CG    . GLU A 1 299 ? 46.21208 36.90903  -49.54794 1.000 85.79109  ? 298 GLU A CG    1 
ATOM   2355 C  CD    . GLU A 1 299 ? 44.81588 37.48172  -49.29235 1.000 99.39327  ? 298 GLU A CD    1 
ATOM   2356 O  OE1   . GLU A 1 299 ? 43.86404 36.69756  -49.06830 1.000 94.16367  ? 298 GLU A OE1   1 
ATOM   2357 O  OE2   . GLU A 1 299 ? 44.66783 38.72501  -49.32795 1.000 108.62593 ? 298 GLU A OE2   1 
ATOM   2358 N  N     . ALA A 1 300 ? 47.31679 32.74394  -48.54278 1.000 70.13060  ? 299 ALA A N     1 
ATOM   2359 C  CA    . ALA A 1 300 ? 47.48937 31.45818  -47.87380 1.000 68.96441  ? 299 ALA A CA    1 
ATOM   2360 C  C     . ALA A 1 300 ? 48.84312 30.84167  -48.20161 1.000 67.72109  ? 299 ALA A C     1 
ATOM   2361 O  O     . ALA A 1 300 ? 49.48653 30.23280  -47.33934 1.000 67.77201  ? 299 ALA A O     1 
ATOM   2362 C  CB    . ALA A 1 300 ? 46.35724 30.50819  -48.26079 1.000 69.34991  ? 299 ALA A CB    1 
ATOM   2363 N  N     . GLU A 1 301 ? 49.27830 30.97299  -49.45055 1.000 70.36610  ? 300 GLU A N     1 
ATOM   2364 C  CA    . GLU A 1 301 ? 50.60633 30.52456  -49.84852 1.000 73.96508  ? 300 GLU A CA    1 
ATOM   2365 C  C     . GLU A 1 301 ? 51.66998 31.10920  -48.92506 1.000 71.62415  ? 300 GLU A C     1 
ATOM   2366 O  O     . GLU A 1 301 ? 52.49112 30.38011  -48.34408 1.000 63.81802  ? 300 GLU A O     1 
ATOM   2367 C  CB    . GLU A 1 301 ? 50.83722 30.95143  -51.30197 1.000 81.75041  ? 300 GLU A CB    1 
ATOM   2368 C  CG    . GLU A 1 301 ? 51.76726 30.10815  -52.15160 1.000 83.86277  ? 300 GLU A CG    1 
ATOM   2369 C  CD    . GLU A 1 301 ? 51.75798 30.58707  -53.59749 1.000 88.78780  ? 300 GLU A CD    1 
ATOM   2370 O  OE1   . GLU A 1 301 ? 50.73446 31.17885  -54.01869 1.000 87.81853  ? 300 GLU A OE1   1 
ATOM   2371 O  OE2   . GLU A 1 301 ? 52.76996 30.39272  -54.30423 1.000 88.30989  ? 300 GLU A OE2   1 
ATOM   2372 N  N     . LEU A 1 302 ? 51.64569 32.43779  -48.76221 1.000 69.53537  ? 301 LEU A N     1 
ATOM   2373 C  CA    . LEU A 1 302 ? 52.64669 33.10469  -47.93574 1.000 73.55552  ? 301 LEU A CA    1 
ATOM   2374 C  C     . LEU A 1 302 ? 52.52878 32.68202  -46.47936 1.000 69.16912  ? 301 LEU A C     1 
ATOM   2375 O  O     . LEU A 1 302 ? 53.54403 32.46075  -45.79903 1.000 65.31766  ? 301 LEU A O     1 
ATOM   2376 C  CB    . LEU A 1 302 ? 52.50868 34.62347  -48.06668 1.000 75.97392  ? 301 LEU A CB    1 
ATOM   2377 C  CG    . LEU A 1 302 ? 53.46692 35.28272  -49.05914 1.000 78.10751  ? 301 LEU A CG    1 
ATOM   2378 C  CD1   . LEU A 1 302 ? 54.90939 35.18313  -48.54097 1.000 72.87794  ? 301 LEU A CD1   1 
ATOM   2379 C  CD2   . LEU A 1 302 ? 53.32322 34.66508  -50.45794 1.000 64.97800  ? 301 LEU A CD2   1 
ATOM   2380 N  N     . GLU A 1 303 ? 51.29477 32.58157  -45.98191 1.000 67.46409  ? 302 GLU A N     1 
ATOM   2381 C  CA    . GLU A 1 303 ? 51.07683 32.15223  -44.60594 1.000 66.43047  ? 302 GLU A CA    1 
ATOM   2382 C  C     . GLU A 1 303 ? 51.74788 30.81439  -44.35013 1.000 63.40939  ? 302 GLU A C     1 
ATOM   2383 O  O     . GLU A 1 303 ? 52.54431 30.66800  -43.41178 1.000 61.00418  ? 302 GLU A O     1 
ATOM   2384 C  CB    . GLU A 1 303 ? 49.57771 32.06672  -44.32916 1.000 64.28727  ? 302 GLU A CB    1 
ATOM   2385 C  CG    . GLU A 1 303 ? 49.20674 31.78834  -42.89242 1.000 56.76605  ? 302 GLU A CG    1 
ATOM   2386 C  CD    . GLU A 1 303 ? 47.74628 32.08704  -42.63192 1.000 61.23068  ? 302 GLU A CD    1 
ATOM   2387 O  OE1   . GLU A 1 303 ? 46.89135 31.24189  -42.98676 1.000 60.61049  ? 302 GLU A OE1   1 
ATOM   2388 O  OE2   . GLU A 1 303 ? 47.45468 33.18656  -42.10037 1.000 63.67859  ? 302 GLU A OE2   1 
ATOM   2389 N  N     . LEU A 1 304 ? 51.43804 29.83182  -45.19813 1.000 60.91565  ? 303 LEU A N     1 
ATOM   2390 C  CA    . LEU A 1 304 ? 52.01667 28.50407  -45.06163 1.000 61.86636  ? 303 LEU A CA    1 
ATOM   2391 C  C     . LEU A 1 304 ? 53.53789 28.54817  -45.13172 1.000 62.82445  ? 303 LEU A C     1 
ATOM   2392 O  O     . LEU A 1 304 ? 54.21845 27.80895  -44.41186 1.000 63.54441  ? 303 LEU A O     1 
ATOM   2393 C  CB    . LEU A 1 304 ? 51.43883 27.59634  -46.14164 1.000 64.58708  ? 303 LEU A CB    1 
ATOM   2394 C  CG    . LEU A 1 304 ? 52.01701 26.20549  -46.37410 1.000 61.97532  ? 303 LEU A CG    1 
ATOM   2395 C  CD1   . LEU A 1 304 ? 52.11319 25.42216  -45.07816 1.000 62.28981  ? 303 LEU A CD1   1 
ATOM   2396 C  CD2   . LEU A 1 304 ? 51.12764 25.49431  -47.36649 1.000 57.89684  ? 303 LEU A CD2   1 
ATOM   2397 N  N     . ALA A 1 305 ? 54.09286 29.41452  -45.98128 1.000 65.66847  ? 304 ALA A N     1 
ATOM   2398 C  CA    . ALA A 1 305 ? 55.54637 29.57144  -46.01116 1.000 64.68156  ? 304 ALA A CA    1 
ATOM   2399 C  C     . ALA A 1 305 ? 56.08386 30.01709  -44.65124 1.000 60.72229  ? 304 ALA A C     1 
ATOM   2400 O  O     . ALA A 1 305 ? 57.07083 29.46521  -44.13738 1.000 62.59162  ? 304 ALA A O     1 
ATOM   2401 C  CB    . ALA A 1 305 ? 55.93824 30.56872  -47.10303 1.000 70.77983  ? 304 ALA A CB    1 
ATOM   2402 N  N     . GLU A 1 306 ? 55.44668 31.02397  -44.05198 1.000 62.71738  ? 305 GLU A N     1 
ATOM   2403 C  CA    . GLU A 1 306 ? 55.93542 31.52387  -42.76639 1.000 64.43771  ? 305 GLU A CA    1 
ATOM   2404 C  C     . GLU A 1 306 ? 55.82399 30.45055  -41.69082 1.000 64.03040  ? 305 GLU A C     1 
ATOM   2405 O  O     . GLU A 1 306 ? 56.72921 30.28974  -40.85985 1.000 64.14118  ? 305 GLU A O     1 
ATOM   2406 C  CB    . GLU A 1 306 ? 55.17533 32.78837  -42.35759 1.000 61.20847  ? 305 GLU A CB    1 
ATOM   2407 N  N     . ASN A 1 307 ? 54.72638 29.68782  -41.71436 1.000 64.73379  ? 306 ASN A N     1 
ATOM   2408 C  CA    . ASN A 1 307 ? 54.53312 28.61792  -40.73927 1.000 57.60975  ? 306 ASN A CA    1 
ATOM   2409 C  C     . ASN A 1 307 ? 55.59132 27.53101  -40.88567 1.000 61.14335  ? 306 ASN A C     1 
ATOM   2410 O  O     . ASN A 1 307 ? 56.12437 27.03941  -39.88101 1.000 61.48191  ? 306 ASN A O     1 
ATOM   2411 C  CB    . ASN A 1 307 ? 53.14086 28.01588  -40.89149 1.000 57.33566  ? 306 ASN A CB    1 
ATOM   2412 C  CG    . ASN A 1 307 ? 52.09220 28.76795  -40.10895 1.000 50.98043  ? 306 ASN A CG    1 
ATOM   2413 O  OD1   . ASN A 1 307 ? 52.35365 29.26483  -39.01347 1.000 52.08898  ? 306 ASN A OD1   1 
ATOM   2414 N  ND2   . ASN A 1 307 ? 50.88861 28.84236  -40.66091 1.000 47.44730  ? 306 ASN A ND2   1 
ATOM   2415 N  N     . ARG A 1 308 ? 55.88155 27.11378  -42.12581 1.000 53.50719  ? 307 ARG A N     1 
ATOM   2416 C  CA    . ARG A 1 308 ? 56.93523 26.12590  -42.34114 1.000 55.71828  ? 307 ARG A CA    1 
ATOM   2417 C  C     . ARG A 1 308 ? 58.26755 26.61355  -41.79137 1.000 63.56599  ? 307 ARG A C     1 
ATOM   2418 O  O     . ARG A 1 308 ? 59.01675 25.84628  -41.16004 1.000 66.44829  ? 307 ARG A O     1 
ATOM   2419 C  CB    . ARG A 1 308 ? 57.07680 25.81287  -43.82515 1.000 61.00111  ? 307 ARG A CB    1 
ATOM   2420 C  CG    . ARG A 1 308 ? 55.86097 25.19584  -44.45789 1.000 66.75691  ? 307 ARG A CG    1 
ATOM   2421 C  CD    . ARG A 1 308 ? 56.20751 24.53945  -45.76969 1.000 64.96919  ? 307 ARG A CD    1 
ATOM   2422 N  NE    . ARG A 1 308 ? 56.09666 23.09262  -45.65859 1.000 75.62389  ? 307 ARG A NE    1 
ATOM   2423 C  CZ    . ARG A 1 308 ? 55.03625 22.39578  -46.05704 1.000 82.35260  ? 307 ARG A CZ    1 
ATOM   2424 N  NH1   . ARG A 1 308 ? 53.99899 23.01965  -46.60671 1.000 75.57676  ? 307 ARG A NH1   1 
ATOM   2425 N  NH2   . ARG A 1 308 ? 55.01218 21.07476  -45.90684 1.000 80.80984  ? 307 ARG A NH2   1 
ATOM   2426 N  N     . GLU A 1 309 ? 58.58699 27.88950  -42.02020 1.000 62.98636  ? 308 GLU A N     1 
ATOM   2427 C  CA    . GLU A 1 309 ? 59.82569 28.41493  -41.45965 1.000 64.68250  ? 308 GLU A CA    1 
ATOM   2428 C  C     . GLU A 1 309 ? 59.81094 28.31619  -39.94335 1.000 64.68787  ? 308 GLU A C     1 
ATOM   2429 O  O     . GLU A 1 309 ? 60.73986 27.76567  -39.33651 1.000 62.20493  ? 308 GLU A O     1 
ATOM   2430 C  CB    . GLU A 1 309 ? 60.05411 29.85248  -41.91881 1.000 66.59160  ? 308 GLU A CB    1 
ATOM   2431 C  CG    . GLU A 1 309 ? 60.43889 29.92986  -43.38688 1.000 72.55584  ? 308 GLU A CG    1 
ATOM   2432 C  CD    . GLU A 1 309 ? 61.39071 28.80359  -43.78352 1.000 78.81051  ? 308 GLU A CD    1 
ATOM   2433 O  OE1   . GLU A 1 309 ? 62.57604 28.87177  -43.38820 1.000 75.30080  ? 308 GLU A OE1   1 
ATOM   2434 O  OE2   . GLU A 1 309 ? 60.94796 27.84112  -44.46529 1.000 75.81632  ? 308 GLU A OE2   1 
ATOM   2435 N  N     . ILE A 1 310 ? 58.73440 28.80712  -39.31933 1.000 65.89625  ? 309 ILE A N     1 
ATOM   2436 C  CA    . ILE A 1 310 ? 58.61601 28.75858  -37.86161 1.000 62.44900  ? 309 ILE A CA    1 
ATOM   2437 C  C     . ILE A 1 310 ? 58.83733 27.34028  -37.34992 1.000 64.23024  ? 309 ILE A C     1 
ATOM   2438 O  O     . ILE A 1 310 ? 59.56149 27.12069  -36.36977 1.000 65.80334  ? 309 ILE A O     1 
ATOM   2439 C  CB    . ILE A 1 310 ? 57.25151 29.31539  -37.41869 1.000 57.44794  ? 309 ILE A CB    1 
ATOM   2440 C  CG1   . ILE A 1 310 ? 57.19337 30.82681  -37.67086 1.000 58.27216  ? 309 ILE A CG1   1 
ATOM   2441 C  CG2   . ILE A 1 310 ? 56.99234 28.97439  -35.95540 1.000 56.43738  ? 309 ILE A CG2   1 
ATOM   2442 C  CD1   . ILE A 1 310 ? 55.98484 31.53178  -37.06535 1.000 50.74570  ? 309 ILE A CD1   1 
ATOM   2443 N  N     . LEU A 1 311 ? 58.24956 26.35301  -38.02630 1.000 58.63750  ? 310 LEU A N     1 
ATOM   2444 C  CA    . LEU A 1 311 ? 58.41697 24.96447  -37.60682 1.000 63.22893  ? 310 LEU A CA    1 
ATOM   2445 C  C     . LEU A 1 311 ? 59.84596 24.45271  -37.77771 1.000 66.39616  ? 310 LEU A C     1 
ATOM   2446 O  O     . LEU A 1 311 ? 60.24777 23.53227  -37.05552 1.000 68.69766  ? 310 LEU A O     1 
ATOM   2447 C  CB    . LEU A 1 311 ? 57.44070 24.05932  -38.36350 1.000 63.72281  ? 310 LEU A CB    1 
ATOM   2448 C  CG    . LEU A 1 311 ? 56.00973 24.06914  -37.81095 1.000 60.32891  ? 310 LEU A CG    1 
ATOM   2449 C  CD1   . LEU A 1 311 ? 55.07914 23.22867  -38.65658 1.000 60.94731  ? 310 LEU A CD1   1 
ATOM   2450 C  CD2   . LEU A 1 311 ? 56.00133 23.58345  -36.37517 1.000 55.04778  ? 310 LEU A CD2   1 
ATOM   2451 N  N     . LYS A 1 312 ? 60.63458 25.02086  -38.69235 1.000 70.33645  ? 311 LYS A N     1 
ATOM   2452 C  CA    . LYS A 1 312 ? 62.01937 24.54241  -38.74253 1.000 69.32818  ? 311 LYS A CA    1 
ATOM   2453 C  C     . LYS A 1 312 ? 62.85429 24.90729  -37.50327 1.000 69.39046  ? 311 LYS A C     1 
ATOM   2454 O  O     . LYS A 1 312 ? 64.05440 24.62700  -37.51136 1.000 70.15402  ? 311 LYS A O     1 
ATOM   2455 C  CB    . LYS A 1 312 ? 62.73278 25.07418  -39.98789 1.000 69.42981  ? 311 LYS A CB    1 
ATOM   2456 C  CG    . LYS A 1 312 ? 62.27711 24.46484  -41.29873 1.000 69.70667  ? 311 LYS A CG    1 
ATOM   2457 C  CD    . LYS A 1 312 ? 62.83030 25.25464  -42.48409 1.000 72.76667  ? 311 LYS A CD    1 
ATOM   2458 C  CE    . LYS A 1 312 ? 62.35142 24.68874  -43.81454 1.000 73.20142  ? 311 LYS A CE    1 
ATOM   2459 N  NZ    . LYS A 1 312 ? 62.72050 25.60007  -44.93324 1.000 76.36779  ? 311 LYS A NZ    1 
ATOM   2460 N  N     . GLU A 1 313 ? 62.29069 25.52206  -36.44830 1.000 73.83161  ? 312 GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 313 ? 63.12563 26.01613  -35.35422 1.000 71.89724  ? 312 GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 313 ? 63.01462 25.13100  -34.11699 1.000 71.69773  ? 312 GLU A C     1 
ATOM   2463 O  O     . GLU A 1 313 ? 62.01174 24.43788  -33.91159 1.000 68.16502  ? 312 GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 313 ? 62.74194 27.45609  -34.98455 1.000 73.30559  ? 312 GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 313 ? 62.64922 28.44578  -36.16324 1.000 83.67469  ? 312 GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 313 ? 64.00177 28.83615  -36.76917 1.000 90.55825  ? 312 GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 313 ? 65.05282 28.38655  -36.25359 1.000 92.05371  ? 312 GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 313 ? 64.00610 29.59946  -37.76735 1.000 85.93779  ? 312 GLU A OE2   1 
ATOM   2469 N  N     . PRO A 1 314 ? 64.04313 25.12360  -33.26734 1.000 67.34298  ? 313 PRO A N     1 
ATOM   2470 C  CA    . PRO A 1 314 ? 63.99514 24.30915  -32.04916 1.000 66.91515  ? 313 PRO A CA    1 
ATOM   2471 C  C     . PRO A 1 314 ? 63.42270 25.07000  -30.86519 1.000 64.46230  ? 313 PRO A C     1 
ATOM   2472 O  O     . PRO A 1 314 ? 63.77086 26.22203  -30.59961 1.000 61.95647  ? 313 PRO A O     1 
ATOM   2473 C  CB    . PRO A 1 314 ? 65.47330 23.96413  -31.81970 1.000 62.22275  ? 313 PRO A CB    1 
ATOM   2474 C  CG    . PRO A 1 314 ? 66.17736 25.16297  -32.28864 1.000 62.41100  ? 313 PRO A CG    1 
ATOM   2475 C  CD    . PRO A 1 314 ? 65.38397 25.69183  -33.47632 1.000 68.76668  ? 313 PRO A CD    1 
ATOM   2476 N  N     . VAL A 1 315 ? 62.56267 24.38579  -30.11148 1.000 62.39093  ? 314 VAL A N     1 
ATOM   2477 C  CA    . VAL A 1 315 ? 61.75769 25.05615  -29.10286 1.000 54.58202  ? 314 VAL A CA    1 
ATOM   2478 C  C     . VAL A 1 315 ? 61.38683 24.05227  -28.01973 1.000 50.58468  ? 314 VAL A C     1 
ATOM   2479 O  O     . VAL A 1 315 ? 61.30828 22.85135  -28.26927 1.000 48.27276  ? 314 VAL A O     1 
ATOM   2480 C  CB    . VAL A 1 315 ? 60.51393 25.69369  -29.76921 1.000 54.95131  ? 314 VAL A CB    1 
ATOM   2481 C  CG1   . VAL A 1 315 ? 59.63869 24.60678  -30.39593 1.000 49.73053  ? 314 VAL A CG1   1 
ATOM   2482 C  CG2   . VAL A 1 315 ? 59.74810 26.55362  -28.77847 1.000 55.62673  ? 314 VAL A CG2   1 
ATOM   2483 N  N     . HIS A 1 316 ? 61.17252 24.54789  -26.80608 1.000 46.71062  ? 315 HIS A N     1 
ATOM   2484 C  CA    . HIS A 1 316 ? 60.78140 23.68524  -25.70847 1.000 42.13450  ? 315 HIS A CA    1 
ATOM   2485 C  C     . HIS A 1 316 ? 59.97873 24.48893  -24.69984 1.000 46.69313  ? 315 HIS A C     1 
ATOM   2486 O  O     . HIS A 1 316 ? 59.91761 25.71900  -24.75869 1.000 48.95020  ? 315 HIS A O     1 
ATOM   2487 C  CB    . HIS A 1 316 ? 61.99388 23.04372  -25.04635 1.000 42.00485  ? 315 HIS A CB    1 
ATOM   2488 C  CG    . HIS A 1 316 ? 62.97817 24.02623  -24.48522 1.000 46.44202  ? 315 HIS A CG    1 
ATOM   2489 N  ND1   . HIS A 1 316 ? 62.84682 24.58211  -23.23131 1.000 46.14485  ? 315 HIS A ND1   1 
ATOM   2490 C  CD2   . HIS A 1 316 ? 64.13014 24.52614  -24.99777 1.000 45.77147  ? 315 HIS A CD2   1 
ATOM   2491 C  CE1   . HIS A 1 316 ? 63.86804 25.39012  -22.99960 1.000 45.52171  ? 315 HIS A CE1   1 
ATOM   2492 N  NE2   . HIS A 1 316 ? 64.66576 25.36436  -24.05178 1.000 43.53341  ? 315 HIS A NE2   1 
ATOM   2493 N  N     . GLY A 1 317 ? 59.35005 23.76693  -23.77082 1.000 43.44999  ? 316 GLY A N     1 
ATOM   2494 C  CA    . GLY A 1 317 ? 58.66900 24.35332  -22.64273 1.000 37.51836  ? 316 GLY A CA    1 
ATOM   2495 C  C     . GLY A 1 317 ? 59.40280 24.03457  -21.35151 1.000 41.04665  ? 316 GLY A C     1 
ATOM   2496 O  O     . GLY A 1 317 ? 60.38907 23.30739  -21.32190 1.000 44.86319  ? 316 GLY A O     1 
ATOM   2497 N  N     . VAL A 1 318 ? 58.90266 24.61681  -20.26635 1.000 39.38160  ? 317 VAL A N     1 
ATOM   2498 C  CA    . VAL A 1 318 ? 59.43985 24.37567  -18.93608 1.000 37.90020  ? 317 VAL A CA    1 
ATOM   2499 C  C     . VAL A 1 318 ? 58.28492 23.97407  -18.02789 1.000 38.66237  ? 317 VAL A C     1 
ATOM   2500 O  O     . VAL A 1 318 ? 57.11809 24.06740  -18.40000 1.000 43.56357  ? 317 VAL A O     1 
ATOM   2501 C  CB    . VAL A 1 318 ? 60.19141 25.60467  -18.38189 1.000 40.98783  ? 317 VAL A CB    1 
ATOM   2502 C  CG1   . VAL A 1 318 ? 61.49399 25.78408  -19.13693 1.000 38.44256  ? 317 VAL A CG1   1 
ATOM   2503 C  CG2   . VAL A 1 318 ? 59.34223 26.85436  -18.49999 1.000 33.72311  ? 317 VAL A CG2   1 
ATOM   2504 N  N     . TYR A 1 319 ? 58.61807 23.49799  -16.83492 1.000 41.28181  ? 318 TYR A N     1 
ATOM   2505 C  CA    . TYR A 1 319 ? 57.59264 23.04868  -15.90533 1.000 34.85170  ? 318 TYR A CA    1 
ATOM   2506 C  C     . TYR A 1 319 ? 57.23208 24.17600  -14.94299 1.000 40.48532  ? 318 TYR A C     1 
ATOM   2507 O  O     . TYR A 1 319 ? 57.91560 25.19382  -14.85274 1.000 48.92605  ? 318 TYR A O     1 
ATOM   2508 C  CB    . TYR A 1 319 ? 58.05026 21.79496  -15.16519 1.000 31.79773  ? 318 TYR A CB    1 
ATOM   2509 C  CG    . TYR A 1 319 ? 58.38014 20.62906  -16.08790 1.000 32.60624  ? 318 TYR A CG    1 
ATOM   2510 C  CD1   . TYR A 1 319 ? 57.38566 19.99469  -16.82606 1.000 36.00869  ? 318 TYR A CD1   1 
ATOM   2511 C  CD2   . TYR A 1 319 ? 59.67023 20.15813  -16.20564 1.000 32.24766  ? 318 TYR A CD2   1 
ATOM   2512 C  CE1   . TYR A 1 319 ? 57.67040 18.93800  -17.67473 1.000 33.73938  ? 318 TYR A CE1   1 
ATOM   2513 C  CE2   . TYR A 1 319 ? 59.97189 19.10587  -17.05100 1.000 41.11656  ? 318 TYR A CE2   1 
ATOM   2514 C  CZ    . TYR A 1 319 ? 58.96765 18.49584  -17.78189 1.000 41.56857  ? 318 TYR A CZ    1 
ATOM   2515 O  OH    . TYR A 1 319 ? 59.26883 17.44255  -18.62205 1.000 39.85126  ? 318 TYR A OH    1 
ATOM   2516 N  N     . TYR A 1 320 ? 56.14080 23.98245  -14.21529 1.000 39.90737  ? 319 TYR A N     1 
ATOM   2517 C  CA    . TYR A 1 320 ? 55.49018 25.05477  -13.48010 1.000 33.15607  ? 319 TYR A CA    1 
ATOM   2518 C  C     . TYR A 1 320 ? 56.05953 25.16896  -12.08100 1.000 36.14183  ? 319 TYR A C     1 
ATOM   2519 O  O     . TYR A 1 320 ? 56.21347 24.16072  -11.38957 1.000 41.13439  ? 319 TYR A O     1 
ATOM   2520 C  CB    . TYR A 1 320 ? 53.98551 24.78394  -13.42272 1.000 38.05600  ? 319 TYR A CB    1 
ATOM   2521 C  CG    . TYR A 1 320 ? 53.16861 25.72233  -12.55522 1.000 39.19141  ? 319 TYR A CG    1 
ATOM   2522 C  CD1   . TYR A 1 320 ? 53.15222 27.09009  -12.79143 1.000 36.71348  ? 319 TYR A CD1   1 
ATOM   2523 C  CD2   . TYR A 1 320 ? 52.38617 25.22528  -11.51517 1.000 37.14895  ? 319 TYR A CD2   1 
ATOM   2524 C  CE1   . TYR A 1 320 ? 52.38222 27.93933  -12.00199 1.000 43.37975  ? 319 TYR A CE1   1 
ATOM   2525 C  CE2   . TYR A 1 320 ? 51.62603 26.06080  -10.71773 1.000 37.57181  ? 319 TYR A CE2   1 
ATOM   2526 C  CZ    . TYR A 1 320 ? 51.62150 27.41747  -10.96233 1.000 45.66010  ? 319 TYR A CZ    1 
ATOM   2527 O  OH    . TYR A 1 320 ? 50.85595 28.24974  -10.16792 1.000 45.77642  ? 319 TYR A OH    1 
ATOM   2528 N  N     . ASP A 1 321 ? 56.34796 26.39930  -11.65809 1.000 43.65825  ? 320 ASP A N     1 
ATOM   2529 C  CA    . ASP A 1 321 ? 56.76385 26.67789  -10.28495 1.000 41.44356  ? 320 ASP A CA    1 
ATOM   2530 C  C     . ASP A 1 321 ? 55.67269 27.46282  -9.56763  1.000 44.90128  ? 320 ASP A C     1 
ATOM   2531 O  O     . ASP A 1 321 ? 55.49169 28.65837  -9.84901  1.000 47.28489  ? 320 ASP A O     1 
ATOM   2532 C  CB    . ASP A 1 321 ? 58.07875 27.45578  -10.26943 1.000 41.16979  ? 320 ASP A CB    1 
ATOM   2533 C  CG    . ASP A 1 321 ? 58.61834 27.68160  -8.85780  1.000 49.92482  ? 320 ASP A CG    1 
ATOM   2534 O  OD1   . ASP A 1 321 ? 57.98875 27.23209  -7.87683  1.000 50.03897  ? 320 ASP A OD1   1 
ATOM   2535 O  OD2   . ASP A 1 321 ? 59.68852 28.31109  -8.73140  1.000 52.06700  ? 320 ASP A OD2   1 
ATOM   2536 N  N     . PRO A 1 322 ? 54.94987 26.85950  -8.62177  1.000 43.97448  ? 321 PRO A N     1 
ATOM   2537 C  CA    . PRO A 1 322 ? 53.80332 27.55580  -8.01035  1.000 43.35524  ? 321 PRO A CA    1 
ATOM   2538 C  C     . PRO A 1 322 ? 54.17356 28.77736  -7.19657  1.000 47.65675  ? 321 PRO A C     1 
ATOM   2539 O  O     . PRO A 1 322 ? 53.28911 29.59359  -6.90480  1.000 53.57721  ? 321 PRO A O     1 
ATOM   2540 C  CB    . PRO A 1 322 ? 53.16775 26.47907  -7.12136  1.000 44.78155  ? 321 PRO A CB    1 
ATOM   2541 C  CG    . PRO A 1 322 ? 54.26876 25.50535  -6.84720  1.000 45.90647  ? 321 PRO A CG    1 
ATOM   2542 C  CD    . PRO A 1 322 ? 55.13835 25.50379  -8.07918  1.000 47.16315  ? 321 PRO A CD    1 
ATOM   2543 N  N     . SER A 1 323 ? 55.43446 28.93210  -6.81164  1.000 46.32376  ? 322 SER A N     1 
ATOM   2544 C  CA    . SER A 1 323 ? 55.86677 30.04265  -5.97494  1.000 46.98613  ? 322 SER A CA    1 
ATOM   2545 C  C     . SER A 1 323 ? 56.23848 31.27896  -6.78006  1.000 53.03988  ? 322 SER A C     1 
ATOM   2546 O  O     . SER A 1 323 ? 56.82785 32.20851  -6.22076  1.000 59.43010  ? 322 SER A O     1 
ATOM   2547 C  CB    . SER A 1 323 ? 57.06112 29.61751  -5.11934  1.000 52.37390  ? 322 SER A CB    1 
ATOM   2548 O  OG    . SER A 1 323 ? 58.12152 29.14553  -5.95055  1.000 52.33312  ? 322 SER A OG    1 
ATOM   2549 N  N     . LYS A 1 324 ? 55.94369 31.29705  -8.07886  1.000 52.73631  ? 323 LYS A N     1 
ATOM   2550 C  CA    . LYS A 1 324 ? 56.19653 32.43818  -8.94482  1.000 45.80643  ? 323 LYS A CA    1 
ATOM   2551 C  C     . LYS A 1 324 ? 54.91803 32.83056  -9.67080  1.000 47.52342  ? 323 LYS A C     1 
ATOM   2552 O  O     . LYS A 1 324 ? 53.98525 32.03719  -9.80089  1.000 55.65072  ? 323 LYS A O     1 
ATOM   2553 C  CB    . LYS A 1 324 ? 57.29049 32.13035  -9.96402  1.000 45.71732  ? 323 LYS A CB    1 
ATOM   2554 C  CG    . LYS A 1 324 ? 58.58895 31.69389  -9.33969  1.000 50.83467  ? 323 LYS A CG    1 
ATOM   2555 C  CD    . LYS A 1 324 ? 59.67466 31.47941  -10.38893 1.000 51.43806  ? 323 LYS A CD    1 
ATOM   2556 C  CE    . LYS A 1 324 ? 61.04282 31.39844  -9.70982  1.000 60.21444  ? 323 LYS A CE    1 
ATOM   2557 N  NZ    . LYS A 1 324 ? 60.89821 31.26213  -8.21089  1.000 60.01419  ? 323 LYS A NZ    1 
ATOM   2558 N  N     . ASP A 1 325 ? 54.88081 34.06338  -10.15721 1.000 51.53335  ? 324 ASP A N     1 
ATOM   2559 C  CA    . ASP A 1 325 ? 53.70659 34.50813  -10.88388 1.000 50.95320  ? 324 ASP A CA    1 
ATOM   2560 C  C     . ASP A 1 325 ? 53.66098 33.85264  -12.25600 1.000 47.90475  ? 324 ASP A C     1 
ATOM   2561 O  O     . ASP A 1 325 ? 54.67948 33.43225  -12.81293 1.000 47.21948  ? 324 ASP A O     1 
ATOM   2562 C  CB    . ASP A 1 325 ? 53.70275 36.03440  -11.03982 1.000 58.33943  ? 324 ASP A CB    1 
ATOM   2563 C  CG    . ASP A 1 325 ? 53.52747 36.77133  -9.70995  1.000 66.40586  ? 324 ASP A CG    1 
ATOM   2564 O  OD1   . ASP A 1 325 ? 52.61484 36.40755  -8.92850  1.000 70.78845  ? 324 ASP A OD1   1 
ATOM   2565 O  OD2   . ASP A 1 325 ? 54.30879 37.71274  -9.44662  1.000 63.77970  ? 324 ASP A OD2   1 
ATOM   2566 N  N     . LEU A 1 326 ? 52.45247 33.76637  -12.79628 1.000 47.40317  ? 325 LEU A N     1 
ATOM   2567 C  CA    . LEU A 1 326 ? 52.22351 33.39766  -14.18761 1.000 43.60914  ? 325 LEU A CA    1 
ATOM   2568 C  C     . LEU A 1 326 ? 52.07407 34.65784  -15.03134 1.000 41.97054  ? 325 LEU A C     1 
ATOM   2569 O  O     . LEU A 1 326 ? 51.24435 35.51636  -14.73057 1.000 39.80485  ? 325 LEU A O     1 
ATOM   2570 C  CB    . LEU A 1 326 ? 50.95792 32.55662  -14.32132 1.000 39.76631  ? 325 LEU A CB    1 
ATOM   2571 C  CG    . LEU A 1 326 ? 51.01519 31.05678  -14.20143 1.000 40.92475  ? 325 LEU A CG    1 
ATOM   2572 C  CD1   . LEU A 1 326 ? 49.59242 30.53545  -14.13731 1.000 42.01844  ? 325 LEU A CD1   1 
ATOM   2573 C  CD2   . LEU A 1 326 ? 51.74277 30.49266  -15.39823 1.000 41.59124  ? 325 LEU A CD2   1 
ATOM   2574 N  N     . ILE A 1 327 ? 52.82368 34.74206  -16.11476 1.000 40.33638  ? 326 ILE A N     1 
ATOM   2575 C  CA    . ILE A 1 327 ? 52.79224 35.91136  -16.97477 1.000 43.46005  ? 326 ILE A CA    1 
ATOM   2576 C  C     . ILE A 1 327 ? 52.39177 35.48250  -18.37768 1.000 40.58593  ? 326 ILE A C     1 
ATOM   2577 O  O     . ILE A 1 327 ? 53.02689 34.61137  -18.97688 1.000 42.23769  ? 326 ILE A O     1 
ATOM   2578 C  CB    . ILE A 1 327 ? 54.15223 36.63062  -16.98040 1.000 44.20517  ? 326 ILE A CB    1 
ATOM   2579 C  CG1   . ILE A 1 327 ? 54.52099 37.04694  -15.55864 1.000 40.68932  ? 326 ILE A CG1   1 
ATOM   2580 C  CG2   . ILE A 1 327 ? 54.12106 37.82277  -17.90946 1.000 42.81181  ? 326 ILE A CG2   1 
ATOM   2581 C  CD1   . ILE A 1 327 ? 55.98693 37.24479  -15.37139 1.000 38.37562  ? 326 ILE A CD1   1 
ATOM   2582 N  N     . ALA A 1 328 ? 51.35808 36.10544  -18.90699 1.000 37.87374  ? 327 ALA A N     1 
ATOM   2583 C  CA    . ALA A 1 328 ? 51.00969 35.94683  -20.30620 1.000 40.78179  ? 327 ALA A CA    1 
ATOM   2584 C  C     . ALA A 1 328 ? 51.29832 37.25428  -21.03328 1.000 46.45964  ? 327 ALA A C     1 
ATOM   2585 O  O     . ALA A 1 328 ? 50.94229 38.33305  -20.54509 1.000 44.33254  ? 327 ALA A O     1 
ATOM   2586 C  CB    . ALA A 1 328 ? 49.54150 35.55238  -20.46181 1.000 43.13554  ? 327 ALA A CB    1 
ATOM   2587 N  N     . GLU A 1 329 ? 51.95996 37.14942  -22.18285 1.000 43.25158  ? 328 GLU A N     1 
ATOM   2588 C  CA    . GLU A 1 329 ? 52.29681 38.27667  -23.03611 1.000 42.38279  ? 328 GLU A CA    1 
ATOM   2589 C  C     . GLU A 1 329 ? 51.61487 38.05904  -24.37187 1.000 46.04838  ? 328 GLU A C     1 
ATOM   2590 O  O     . GLU A 1 329 ? 51.72961 36.97439  -24.95263 1.000 51.64189  ? 328 GLU A O     1 
ATOM   2591 C  CB    . GLU A 1 329 ? 53.81501 38.39338  -23.22237 1.000 50.51343  ? 328 GLU A CB    1 
ATOM   2592 C  CG    . GLU A 1 329 ? 54.30590 39.71899  -23.84081 1.000 57.22221  ? 328 GLU A CG    1 
ATOM   2593 C  CD    . GLU A 1 329 ? 55.82977 39.75413  -24.04234 1.000 72.94799  ? 328 GLU A CD    1 
ATOM   2594 O  OE1   . GLU A 1 329 ? 56.53281 38.87683  -23.47942 1.000 74.20885  ? 328 GLU A OE1   1 
ATOM   2595 O  OE2   . GLU A 1 329 ? 56.32242 40.65386  -24.76870 1.000 74.95783  ? 328 GLU A OE2   1 
ATOM   2596 N  N     . ILE A 1 330 ? 50.90393 39.07271  -24.85692 1.000 43.86042  ? 329 ILE A N     1 
ATOM   2597 C  CA    . ILE A 1 330 ? 50.15621 38.95105  -26.10453 1.000 44.73067  ? 329 ILE A CA    1 
ATOM   2598 C  C     . ILE A 1 330 ? 50.81869 39.78903  -27.19471 1.000 49.47290  ? 329 ILE A C     1 
ATOM   2599 O  O     . ILE A 1 330 ? 51.28944 40.90739  -26.94445 1.000 51.36167  ? 329 ILE A O     1 
ATOM   2600 C  CB    . ILE A 1 330 ? 48.67732 39.34715  -25.91507 1.000 44.05871  ? 329 ILE A CB    1 
ATOM   2601 C  CG1   . ILE A 1 330 ? 48.07978 38.62544  -24.71022 1.000 42.39172  ? 329 ILE A CG1   1 
ATOM   2602 C  CG2   . ILE A 1 330 ? 47.85679 38.98470  -27.13957 1.000 37.24942  ? 329 ILE A CG2   1 
ATOM   2603 C  CD1   . ILE A 1 330 ? 46.55408 38.66582  -24.69086 1.000 40.68817  ? 329 ILE A CD1   1 
ATOM   2604 N  N     . GLN A 1 331 ? 50.86451 39.23185  -28.40508 1.000 50.64614  ? 330 GLN A N     1 
ATOM   2605 C  CA    . GLN A 1 331 ? 51.37022 39.90227  -29.59531 1.000 49.13312  ? 330 GLN A CA    1 
ATOM   2606 C  C     . GLN A 1 331 ? 50.28836 39.88578  -30.66439 1.000 50.93717  ? 330 GLN A C     1 
ATOM   2607 O  O     . GLN A 1 331 ? 49.66460 38.84522  -30.90534 1.000 50.30628  ? 330 GLN A O     1 
ATOM   2608 C  CB    . GLN A 1 331 ? 52.63023 39.21824  -30.13636 1.000 52.53323  ? 330 GLN A CB    1 
ATOM   2609 C  CG    . GLN A 1 331 ? 53.93475 39.88161  -29.71715 1.000 57.26586  ? 330 GLN A CG    1 
ATOM   2610 C  CD    . GLN A 1 331 ? 54.29714 39.60271  -28.26226 1.000 64.70788  ? 330 GLN A CD    1 
ATOM   2611 O  OE1   . GLN A 1 331 ? 54.33954 40.52107  -27.42641 1.000 62.83846  ? 330 GLN A OE1   1 
ATOM   2612 N  NE2   . GLN A 1 331 ? 54.55466 38.32731  -27.94871 1.000 62.09655  ? 330 GLN A NE2   1 
ATOM   2613 N  N     . LYS A 1 332 ? 50.08088 41.02657  -31.31526 1.000 52.69383  ? 331 LYS A N     1 
ATOM   2614 C  CA    . LYS A 1 332 ? 49.11750 41.13023  -32.40161 1.000 52.88652  ? 331 LYS A CA    1 
ATOM   2615 C  C     . LYS A 1 332 ? 49.76149 40.74957  -33.72823 1.000 53.26652  ? 331 LYS A C     1 
ATOM   2616 O  O     . LYS A 1 332 ? 50.94498 41.01109  -33.95289 1.000 56.49032  ? 331 LYS A O     1 
ATOM   2617 C  CB    . LYS A 1 332 ? 48.56195 42.55400  -32.47267 1.000 51.27450  ? 331 LYS A CB    1 
ATOM   2618 C  CG    . LYS A 1 332 ? 47.97668 42.96872  -33.82460 1.000 53.75860  ? 331 LYS A CG    1 
ATOM   2619 C  CD    . LYS A 1 332 ? 47.19091 44.28314  -33.68868 1.000 55.64002  ? 331 LYS A CD    1 
ATOM   2620 C  CE    . LYS A 1 332 ? 47.02814 45.03711  -35.01240 1.000 63.21345  ? 331 LYS A CE    1 
ATOM   2621 N  NZ    . LYS A 1 332 ? 45.91468 44.53722  -35.86811 1.000 66.20427  ? 331 LYS A NZ    1 
ATOM   2622 N  N     . GLN A 1 333 ? 48.99224 40.08800  -34.58281 1.000 52.64972  ? 332 GLN A N     1 
ATOM   2623 C  CA    . GLN A 1 333 ? 49.20580 40.07361  -36.02106 1.000 59.81465  ? 332 GLN A CA    1 
ATOM   2624 C  C     . GLN A 1 333 ? 47.91712 40.54667  -36.69203 1.000 61.46491  ? 332 GLN A C     1 
ATOM   2625 O  O     . GLN A 1 333 ? 46.90968 40.83043  -36.03133 1.000 63.81285  ? 332 GLN A O     1 
ATOM   2626 C  CB    . GLN A 1 333 ? 49.62131 38.68844  -36.51789 1.000 63.34023  ? 332 GLN A CB    1 
ATOM   2627 C  CG    . GLN A 1 333 ? 51.04605 38.29107  -36.13809 1.000 67.94136  ? 332 GLN A CG    1 
ATOM   2628 C  CD    . GLN A 1 333 ? 51.08445 37.27912  -35.00622 1.000 63.47528  ? 332 GLN A CD    1 
ATOM   2629 O  OE1   . GLN A 1 333 ? 50.04372 36.73988  -34.60956 1.000 55.44604  ? 332 GLN A OE1   1 
ATOM   2630 N  NE2   . GLN A 1 333 ? 52.28799 37.01522  -34.47854 1.000 55.02557  ? 332 GLN A NE2   1 
ATOM   2631 N  N     . GLY A 1 334 ? 47.94228 40.64165  -38.01133 1.000 50.91515  ? 333 GLY A N     1 
ATOM   2632 C  CA    . GLY A 1 334 ? 46.82779 41.25954  -38.68533 1.000 54.71502  ? 333 GLY A CA    1 
ATOM   2633 C  C     . GLY A 1 334 ? 45.59080 40.39096  -38.62706 1.000 55.08641  ? 333 GLY A C     1 
ATOM   2634 O  O     . GLY A 1 334 ? 45.54126 39.35329  -37.96696 1.000 56.15951  ? 333 GLY A O     1 
ATOM   2635 N  N     . GLN A 1 335 ? 44.55861 40.84469  -39.34265 1.000 54.44775  ? 334 GLN A N     1 
ATOM   2636 C  CA    . GLN A 1 335 ? 43.37676 40.04164  -39.65459 1.000 58.42858  ? 334 GLN A CA    1 
ATOM   2637 C  C     . GLN A 1 335 ? 42.66615 39.52086  -38.41566 1.000 57.91842  ? 334 GLN A C     1 
ATOM   2638 O  O     . GLN A 1 335 ? 42.01919 38.47172  -38.48117 1.000 63.63047  ? 334 GLN A O     1 
ATOM   2639 C  CB    . GLN A 1 335 ? 43.71542 38.83081  -40.54908 1.000 66.81839  ? 334 GLN A CB    1 
ATOM   2640 C  CG    . GLN A 1 335 ? 44.96279 38.93613  -41.43131 1.000 64.90872  ? 334 GLN A CG    1 
ATOM   2641 C  CD    . GLN A 1 335 ? 44.92176 40.15101  -42.32339 1.000 73.81018  ? 334 GLN A CD    1 
ATOM   2642 O  OE1   . GLN A 1 335 ? 43.99046 40.32740  -43.12278 1.000 73.54539  ? 334 GLN A OE1   1 
ATOM   2643 N  NE2   . GLN A 1 335 ? 45.92275 41.01702  -42.17802 1.000 68.34753  ? 334 GLN A NE2   1 
ATOM   2644 N  N     . GLY A 1 336 ? 42.78551 40.18960  -37.27391 1.000 52.22531  ? 335 GLY A N     1 
ATOM   2645 C  CA    . GLY A 1 336 ? 42.25206 39.59805  -36.06225 1.000 53.04649  ? 335 GLY A CA    1 
ATOM   2646 C  C     . GLY A 1 336 ? 42.90897 38.26955  -35.72179 1.000 56.15040  ? 335 GLY A C     1 
ATOM   2647 O  O     . GLY A 1 336 ? 42.23451 37.23881  -35.58167 1.000 46.88824  ? 335 GLY A O     1 
ATOM   2648 N  N     . GLN A 1 337 ? 44.24196 38.29462  -35.61557 1.000 54.59097  ? 336 GLN A N     1 
ATOM   2649 C  CA    . GLN A 1 337 ? 45.06287 37.15588  -35.22578 1.000 50.88857  ? 336 GLN A CA    1 
ATOM   2650 C  C     . GLN A 1 337 ? 45.99533 37.59358  -34.11070 1.000 50.02752  ? 336 GLN A C     1 
ATOM   2651 O  O     . GLN A 1 337 ? 46.50625 38.71526  -34.13353 1.000 53.78691  ? 336 GLN A O     1 
ATOM   2652 C  CB    . GLN A 1 337 ? 45.89620 36.63423  -36.37982 1.000 49.66252  ? 336 GLN A CB    1 
ATOM   2653 C  CG    . GLN A 1 337 ? 45.12359 36.00985  -37.49919 1.000 51.71379  ? 336 GLN A CG    1 
ATOM   2654 C  CD    . GLN A 1 337 ? 46.05531 35.48867  -38.55752 1.000 54.13283  ? 336 GLN A CD    1 
ATOM   2655 O  OE1   . GLN A 1 337 ? 46.13291 34.28740  -38.80401 1.000 56.43107  ? 336 GLN A OE1   1 
ATOM   2656 N  NE2   . GLN A 1 337 ? 46.80283 36.39141  -39.17045 1.000 60.90385  ? 336 GLN A NE2   1 
ATOM   2657 N  N     . TRP A 1 338 ? 46.21570 36.71470  -33.13338 1.000 46.15255  ? 337 TRP A N     1 
ATOM   2658 C  CA    . TRP A 1 338 ? 47.01488 37.05177  -31.96337 1.000 47.39741  ? 337 TRP A CA    1 
ATOM   2659 C  C     . TRP A 1 338 ? 47.77656 35.81572  -31.51222 1.000 46.76909  ? 337 TRP A C     1 
ATOM   2660 O  O     . TRP A 1 338 ? 47.25792 34.70251  -31.61695 1.000 49.69205  ? 337 TRP A O     1 
ATOM   2661 C  CB    . TRP A 1 338 ? 46.12341 37.57073  -30.82633 1.000 43.83645  ? 337 TRP A CB    1 
ATOM   2662 C  CG    . TRP A 1 338 ? 45.09261 38.55419  -31.28222 1.000 45.15118  ? 337 TRP A CG    1 
ATOM   2663 C  CD1   . TRP A 1 338 ? 43.94826 38.28335  -31.97155 1.000 45.13748  ? 337 TRP A CD1   1 
ATOM   2664 C  CD2   . TRP A 1 338 ? 45.11297 39.97254  -31.08074 1.000 45.06796  ? 337 TRP A CD2   1 
ATOM   2665 N  NE1   . TRP A 1 338 ? 43.25747 39.44858  -32.22142 1.000 47.80015  ? 337 TRP A NE1   1 
ATOM   2666 C  CE2   . TRP A 1 338 ? 43.95004 40.49749  -31.67777 1.000 44.56087  ? 337 TRP A CE2   1 
ATOM   2667 C  CE3   . TRP A 1 338 ? 45.99883 40.84847  -30.44618 1.000 44.06784  ? 337 TRP A CE3   1 
ATOM   2668 C  CZ2   . TRP A 1 338 ? 43.65726 41.85506  -31.66687 1.000 42.54929  ? 337 TRP A CZ2   1 
ATOM   2669 C  CZ3   . TRP A 1 338 ? 45.70086 42.18908  -30.42673 1.000 42.10373  ? 337 TRP A CZ3   1 
ATOM   2670 C  CH2   . TRP A 1 338 ? 44.54094 42.68259  -31.03414 1.000 42.22151  ? 337 TRP A CH2   1 
ATOM   2671 N  N     . THR A 1 339 ? 48.99674 36.00434  -31.01167 1.000 42.50265  ? 338 THR A N     1 
ATOM   2672 C  CA    . THR A 1 339 ? 49.70656 34.91890  -30.34422 1.000 45.74282  ? 338 THR A CA    1 
ATOM   2673 C  C     . THR A 1 339 ? 49.98779 35.31141  -28.90195 1.000 49.27500  ? 338 THR A C     1 
ATOM   2674 O  O     . THR A 1 339 ? 49.94029 36.49151  -28.53274 1.000 44.39386  ? 338 THR A O     1 
ATOM   2675 C  CB    . THR A 1 339 ? 51.02694 34.55914  -31.02523 1.000 41.86178  ? 338 THR A CB    1 
ATOM   2676 O  OG1   . THR A 1 339 ? 51.72405 35.76531  -31.33045 1.000 53.81025  ? 338 THR A OG1   1 
ATOM   2677 C  CG2   . THR A 1 339 ? 50.78626 33.78276  -32.29089 1.000 45.05282  ? 338 THR A CG2   1 
ATOM   2678 N  N     . TYR A 1 340 ? 50.27963 34.30666  -28.07697 1.000 47.95162  ? 339 TYR A N     1 
ATOM   2679 C  CA    . TYR A 1 340 ? 50.60438 34.58752  -26.68721 1.000 48.58015  ? 339 TYR A CA    1 
ATOM   2680 C  C     . TYR A 1 340 ? 51.66795 33.62880  -26.17101 1.000 50.03805  ? 339 TYR A C     1 
ATOM   2681 O  O     . TYR A 1 340 ? 51.79917 32.49070  -26.64710 1.000 46.82514  ? 339 TYR A O     1 
ATOM   2682 C  CB    . TYR A 1 340 ? 49.35648 34.55337  -25.78898 1.000 44.62308  ? 339 TYR A CB    1 
ATOM   2683 C  CG    . TYR A 1 340 ? 48.53366 33.27540  -25.78886 1.000 44.69535  ? 339 TYR A CG    1 
ATOM   2684 C  CD1   . TYR A 1 340 ? 47.48566 33.09691  -26.68499 1.000 44.26891  ? 339 TYR A CD1   1 
ATOM   2685 C  CD2   . TYR A 1 340 ? 48.75829 32.27818  -24.84000 1.000 43.02889  ? 339 TYR A CD2   1 
ATOM   2686 C  CE1   . TYR A 1 340 ? 46.71101 31.93512  -26.65874 1.000 45.57372  ? 339 TYR A CE1   1 
ATOM   2687 C  CE2   . TYR A 1 340 ? 47.99652 31.12145  -24.81069 1.000 41.93413  ? 339 TYR A CE2   1 
ATOM   2688 C  CZ    . TYR A 1 340 ? 46.97617 30.95433  -25.71693 1.000 42.40439  ? 339 TYR A CZ    1 
ATOM   2689 O  OH    . TYR A 1 340 ? 46.22550 29.80236  -25.68122 1.000 44.16906  ? 339 TYR A OH    1 
ATOM   2690 N  N     . GLN A 1 341 ? 52.43016 34.12500  -25.19123 1.000 43.62077  ? 340 GLN A N     1 
ATOM   2691 C  CA    . GLN A 1 341 ? 53.43998 33.34991  -24.48062 1.000 43.08730  ? 340 GLN A CA    1 
ATOM   2692 C  C     . GLN A 1 341 ? 53.15268 33.40400  -22.98934 1.000 43.28093  ? 340 GLN A C     1 
ATOM   2693 O  O     . GLN A 1 341 ? 52.96961 34.48898  -22.43507 1.000 47.55037  ? 340 GLN A O     1 
ATOM   2694 C  CB    . GLN A 1 341 ? 54.84628 33.88136  -24.74937 1.000 40.86572  ? 340 GLN A CB    1 
ATOM   2695 C  CG    . GLN A 1 341 ? 55.42488 33.42343  -26.07145 1.000 49.76337  ? 340 GLN A CG    1 
ATOM   2696 C  CD    . GLN A 1 341 ? 55.63484 34.55923  -27.07032 1.000 63.04640  ? 340 GLN A CD    1 
ATOM   2697 O  OE1   . GLN A 1 341 ? 54.75394 35.41247  -27.29093 1.000 54.52400  ? 340 GLN A OE1   1 
ATOM   2698 N  NE2   . GLN A 1 341 ? 56.81537 34.56877  -27.68860 1.000 66.72257  ? 340 GLN A NE2   1 
ATOM   2699 N  N     . ILE A 1 342 ? 53.09920 32.24309  -22.34031 1.000 38.41164  ? 341 ILE A N     1 
ATOM   2700 C  CA    . ILE A 1 342 ? 52.94696 32.15810  -20.89354 1.000 36.40900  ? 341 ILE A CA    1 
ATOM   2701 C  C     . ILE A 1 342 ? 54.25095 31.63851  -20.31257 1.000 37.08072  ? 341 ILE A C     1 
ATOM   2702 O  O     . ILE A 1 342 ? 54.79657 30.62543  -20.78227 1.000 40.94129  ? 341 ILE A O     1 
ATOM   2703 C  CB    . ILE A 1 342 ? 51.76145 31.26317  -20.50121 1.000 37.09808  ? 341 ILE A CB    1 
ATOM   2704 C  CG1   . ILE A 1 342 ? 50.61408 31.47352  -21.49058 1.000 33.89360  ? 341 ILE A CG1   1 
ATOM   2705 C  CG2   . ILE A 1 342 ? 51.34007 31.52716  -19.05521 1.000 34.97217  ? 341 ILE A CG2   1 
ATOM   2706 C  CD1   . ILE A 1 342 ? 49.27145 31.03216  -20.97237 1.000 35.63202  ? 341 ILE A CD1   1 
ATOM   2707 N  N     . TYR A 1 343 ? 54.73637 32.33103  -19.29108 1.000 38.57821  ? 342 TYR A N     1 
ATOM   2708 C  CA    . TYR A 1 343 ? 56.05634 32.09652  -18.72660 1.000 41.83091  ? 342 TYR A CA    1 
ATOM   2709 C  C     . TYR A 1 343 ? 56.08766 32.63815  -17.30823 1.000 46.54338  ? 342 TYR A C     1 
ATOM   2710 O  O     . TYR A 1 343 ? 55.17305 33.33592  -16.86333 1.000 42.43735  ? 342 TYR A O     1 
ATOM   2711 C  CB    . TYR A 1 343 ? 57.15736 32.75013  -19.55862 1.000 42.69958  ? 342 TYR A CB    1 
ATOM   2712 C  CG    . TYR A 1 343 ? 57.10768 34.26808  -19.62669 1.000 47.86106  ? 342 TYR A CG    1 
ATOM   2713 C  CD1   . TYR A 1 343 ? 57.78116 35.05500  -18.69932 1.000 51.38365  ? 342 TYR A CD1   1 
ATOM   2714 C  CD2   . TYR A 1 343 ? 56.41881 34.91547  -20.64995 1.000 46.43834  ? 342 TYR A CD2   1 
ATOM   2715 C  CE1   . TYR A 1 343 ? 57.74553 36.45501  -18.78078 1.000 51.99491  ? 342 TYR A CE1   1 
ATOM   2716 C  CE2   . TYR A 1 343 ? 56.38193 36.30144  -20.74026 1.000 48.15329  ? 342 TYR A CE2   1 
ATOM   2717 C  CZ    . TYR A 1 343 ? 57.04062 37.06930  -19.80541 1.000 52.12338  ? 342 TYR A CZ    1 
ATOM   2718 O  OH    . TYR A 1 343 ? 56.98997 38.45134  -19.90035 1.000 51.41963  ? 342 TYR A OH    1 
ATOM   2719 N  N     . GLN A 1 344 ? 57.15804 32.29363  -16.60147 1.000 51.53986  ? 343 GLN A N     1 
ATOM   2720 C  CA    . GLN A 1 344 ? 57.42310 32.79532  -15.26195 1.000 46.82200  ? 343 GLN A CA    1 
ATOM   2721 C  C     . GLN A 1 344 ? 58.75861 33.51261  -15.15347 1.000 51.41595  ? 343 GLN A C     1 
ATOM   2722 O  O     . GLN A 1 344 ? 58.85687 34.49571  -14.41896 1.000 55.34036  ? 343 GLN A O     1 
ATOM   2723 C  CB    . GLN A 1 344 ? 57.36716 31.64472  -14.25705 1.000 42.85895  ? 343 GLN A CB    1 
ATOM   2724 C  CG    . GLN A 1 344 ? 56.07813 30.84880  -14.31490 1.000 41.06197  ? 343 GLN A CG    1 
ATOM   2725 C  CD    . GLN A 1 344 ? 55.98493 29.80785  -13.22123 1.000 41.87317  ? 343 GLN A CD    1 
ATOM   2726 O  OE1   . GLN A 1 344 ? 56.63977 28.75948  -13.28203 1.000 43.75240  ? 343 GLN A OE1   1 
ATOM   2727 N  NE2   . GLN A 1 344 ? 55.17410 30.08956  -12.20903 1.000 37.67357  ? 343 GLN A NE2   1 
ATOM   2728 N  N     . GLU A 1 345 ? 59.79235 33.04513  -15.86814 1.000 52.50244  ? 344 GLU A N     1 
ATOM   2729 C  CA    . GLU A 1 345 ? 61.07918 33.70323  -16.02766 1.000 46.40061  ? 344 GLU A CA    1 
ATOM   2730 C  C     . GLU A 1 345 ? 61.31303 34.05424  -17.49614 1.000 53.04480  ? 344 GLU A C     1 
ATOM   2731 O  O     . GLU A 1 345 ? 60.98816 33.25560  -18.38237 1.000 53.31016  ? 344 GLU A O     1 
ATOM   2732 C  CB    . GLU A 1 345 ? 62.22616 32.82724  -15.51045 1.000 46.06907  ? 344 GLU A CB    1 
ATOM   2733 N  N     . PRO A 1 346 ? 61.93005 35.22158  -17.77781 1.000 55.72936  ? 345 PRO A N     1 
ATOM   2734 C  CA    . PRO A 1 346 ? 61.73988 35.90495  -19.07070 1.000 59.09668  ? 345 PRO A CA    1 
ATOM   2735 C  C     . PRO A 1 346 ? 61.69876 35.07599  -20.35967 1.000 66.11197  ? 345 PRO A C     1 
ATOM   2736 O  O     . PRO A 1 346 ? 60.69785 35.15161  -21.09312 1.000 68.49289  ? 345 PRO A O     1 
ATOM   2737 C  CB    . PRO A 1 346 ? 62.92476 36.88109  -19.10155 1.000 64.64849  ? 345 PRO A CB    1 
ATOM   2738 C  CG    . PRO A 1 346 ? 63.51410 36.88599  -17.65345 1.000 63.10401  ? 345 PRO A CG    1 
ATOM   2739 C  CD    . PRO A 1 346 ? 62.57856 36.10924  -16.80136 1.000 54.05386  ? 345 PRO A CD    1 
ATOM   2740 N  N     . PHE A 1 347 ? 62.74173 34.31388  -20.69037 1.000 53.84307  ? 346 PHE A N     1 
ATOM   2741 C  CA    . PHE A 1 347 ? 62.78991 33.68980  -22.00799 1.000 52.37364  ? 346 PHE A CA    1 
ATOM   2742 C  C     . PHE A 1 347 ? 62.62384 32.17896  -21.92828 1.000 58.05181  ? 346 PHE A C     1 
ATOM   2743 O  O     . PHE A 1 347 ? 63.17159 31.43221  -22.74778 1.000 55.43732  ? 346 PHE A O     1 
ATOM   2744 C  CB    . PHE A 1 347 ? 64.07750 34.07179  -22.73405 1.000 56.89986  ? 346 PHE A CB    1 
ATOM   2745 C  CG    . PHE A 1 347 ? 64.00437 35.41034  -23.42430 1.000 62.94653  ? 346 PHE A CG    1 
ATOM   2746 C  CD1   . PHE A 1 347 ? 63.69665 35.49172  -24.77890 1.000 63.61062  ? 346 PHE A CD1   1 
ATOM   2747 C  CD2   . PHE A 1 347 ? 64.22672 36.59049  -22.72055 1.000 63.17404  ? 346 PHE A CD2   1 
ATOM   2748 C  CE1   . PHE A 1 347 ? 63.61834 36.72417  -25.42185 1.000 57.58150  ? 346 PHE A CE1   1 
ATOM   2749 C  CE2   . PHE A 1 347 ? 64.15530 37.82768  -23.36023 1.000 59.44421  ? 346 PHE A CE2   1 
ATOM   2750 C  CZ    . PHE A 1 347 ? 63.84936 37.89027  -24.71255 1.000 55.92221  ? 346 PHE A CZ    1 
ATOM   2751 N  N     . LYS A 1 348 ? 61.85663 31.72135  -20.94311 1.000 59.45528  ? 347 LYS A N     1 
ATOM   2752 C  CA    . LYS A 1 348 ? 61.59430 30.30417  -20.71121 1.000 46.08365  ? 347 LYS A CA    1 
ATOM   2753 C  C     . LYS A 1 348 ? 60.07927 30.13089  -20.69642 1.000 40.45829  ? 347 LYS A C     1 
ATOM   2754 O  O     . LYS A 1 348 ? 59.44007 30.19496  -19.64268 1.000 42.36392  ? 347 LYS A O     1 
ATOM   2755 C  CB    . LYS A 1 348 ? 62.23990 29.85343  -19.41401 1.000 42.19673  ? 347 LYS A CB    1 
ATOM   2756 C  CG    . LYS A 1 348 ? 63.69556 30.24625  -19.29361 1.000 46.47042  ? 347 LYS A CG    1 
ATOM   2757 C  CD    . LYS A 1 348 ? 64.25052 29.89769  -17.92429 1.000 57.07598  ? 347 LYS A CD    1 
ATOM   2758 C  CE    . LYS A 1 348 ? 65.77118 29.83703  -17.93127 1.000 53.28772  ? 347 LYS A CE    1 
ATOM   2759 N  NZ    . LYS A 1 348 ? 66.26464 29.15979  -16.70379 1.000 56.94902  ? 347 LYS A NZ    1 
ATOM   2760 N  N     . ASN A 1 349 ? 59.50459 29.93808  -21.87722 1.000 38.55093  ? 348 ASN A N     1 
ATOM   2761 C  CA    . ASN A 1 349 ? 58.06258 29.76839  -21.98307 1.000 38.59712  ? 348 ASN A CA    1 
ATOM   2762 C  C     . ASN A 1 349 ? 57.60281 28.54511  -21.21734 1.000 38.46138  ? 348 ASN A C     1 
ATOM   2763 O  O     . ASN A 1 349 ? 58.22158 27.48145  -21.29788 1.000 42.75329  ? 348 ASN A O     1 
ATOM   2764 C  CB    . ASN A 1 349 ? 57.64759 29.59816  -23.43834 1.000 42.28832  ? 348 ASN A CB    1 
ATOM   2765 C  CG    . ASN A 1 349 ? 57.68437 30.88237  -24.20808 1.000 42.50512  ? 348 ASN A CG    1 
ATOM   2766 O  OD1   . ASN A 1 349 ? 57.80461 31.96421  -23.63727 1.000 39.92731  ? 348 ASN A OD1   1 
ATOM   2767 N  ND2   . ASN A 1 349 ? 57.55425 30.77339  -25.52006 1.000 45.07154  ? 348 ASN A ND2   1 
ATOM   2768 N  N     . LEU A 1 350 ? 56.50222 28.69580  -20.47751 1.000 39.88916  ? 349 LEU A N     1 
ATOM   2769 C  CA    . LEU A 1 350 ? 55.72941 27.52225  -20.08748 1.000 37.35416  ? 349 LEU A CA    1 
ATOM   2770 C  C     . LEU A 1 350 ? 54.98585 26.96660  -21.28402 1.000 36.25797  ? 349 LEU A C     1 
ATOM   2771 O  O     . LEU A 1 350 ? 55.06934 25.76810  -21.58092 1.000 36.35884  ? 349 LEU A O     1 
ATOM   2772 C  CB    . LEU A 1 350 ? 54.74646 27.85709  -18.97578 1.000 38.72870  ? 349 LEU A CB    1 
ATOM   2773 C  CG    . LEU A 1 350 ? 55.25168 27.43536  -17.60191 1.000 42.68959  ? 349 LEU A CG    1 
ATOM   2774 C  CD1   . LEU A 1 350 ? 56.02267 28.58939  -16.99589 1.000 44.39233  ? 349 LEU A CD1   1 
ATOM   2775 C  CD2   . LEU A 1 350 ? 54.10044 27.04816  -16.70974 1.000 42.42536  ? 349 LEU A CD2   1 
ATOM   2776 N  N     . LYS A 1 351 ? 54.26519 27.82627  -21.99301 1.000 33.78936  ? 350 LYS A N     1 
ATOM   2777 C  CA    . LYS A 1 351 ? 53.63170 27.39036  -23.23537 1.000 39.63317  ? 350 LYS A CA    1 
ATOM   2778 C  C     . LYS A 1 351 ? 53.34204 28.61573  -24.10107 1.000 40.87937  ? 350 LYS A C     1 
ATOM   2779 O  O     . LYS A 1 351 ? 53.64068 29.75502  -23.72753 1.000 40.09614  ? 350 LYS A O     1 
ATOM   2780 C  CB    . LYS A 1 351 ? 52.36263 26.55801  -22.95991 1.000 38.13543  ? 350 LYS A CB    1 
ATOM   2781 C  CG    . LYS A 1 351 ? 51.15047 27.35842  -22.46512 1.000 37.69511  ? 350 LYS A CG    1 
ATOM   2782 C  CD    . LYS A 1 351 ? 49.98859 26.47522  -21.97064 1.000 38.93138  ? 350 LYS A CD    1 
ATOM   2783 C  CE    . LYS A 1 351 ? 49.43269 25.55460  -23.05410 1.000 31.48995  ? 350 LYS A CE    1 
ATOM   2784 N  NZ    . LYS A 1 351 ? 49.10567 26.32134  -24.27977 1.000 37.61258  ? 350 LYS A NZ    1 
ATOM   2785 N  N     . THR A 1 352 ? 52.78201 28.36885  -25.28449 1.000 37.86863  ? 351 THR A N     1 
ATOM   2786 C  CA    . THR A 1 352 ? 52.37115 29.42637  -26.19387 1.000 38.90846  ? 351 THR A CA    1 
ATOM   2787 C  C     . THR A 1 352 ? 50.97926 29.09431  -26.71879 1.000 43.87811  ? 351 THR A C     1 
ATOM   2788 O  O     . THR A 1 352 ? 50.41395 28.03721  -26.41035 1.000 40.09015  ? 351 THR A O     1 
ATOM   2789 C  CB    . THR A 1 352 ? 53.35828 29.61106  -27.35967 1.000 39.76350  ? 351 THR A CB    1 
ATOM   2790 O  OG1   . THR A 1 352 ? 53.28278 28.49118  -28.24378 1.000 37.70843  ? 351 THR A OG1   1 
ATOM   2791 C  CG2   . THR A 1 352 ? 54.79443 29.76794  -26.87296 1.000 39.13723  ? 351 THR A CG2   1 
ATOM   2792 N  N     . GLY A 1 353 ? 50.42443 30.01537  -27.50779 1.000 43.96673  ? 352 GLY A N     1 
ATOM   2793 C  CA    . GLY A 1 353 ? 49.12840 29.78244  -28.11940 1.000 37.15022  ? 352 GLY A CA    1 
ATOM   2794 C  C     . GLY A 1 353 ? 48.77830 30.85260  -29.12803 1.000 41.96951  ? 352 GLY A C     1 
ATOM   2795 O  O     . GLY A 1 353 ? 49.52483 31.81016  -29.33809 1.000 45.41484  ? 352 GLY A O     1 
ATOM   2796 N  N     . LYS A 1 354 ? 47.59618 30.69056  -29.72853 1.000 43.83770  ? 353 LYS A N     1 
ATOM   2797 C  CA    . LYS A 1 354 ? 47.06577 31.61972  -30.71787 1.000 45.15276  ? 353 LYS A CA    1 
ATOM   2798 C  C     . LYS A 1 354 ? 45.56613 31.81916  -30.51117 1.000 46.74574  ? 353 LYS A C     1 
ATOM   2799 O  O     . LYS A 1 354 ? 44.82494 30.86578  -30.25765 1.000 50.96443  ? 353 LYS A O     1 
ATOM   2800 C  CB    . LYS A 1 354 ? 47.33556 31.12087  -32.15578 1.000 47.13535  ? 353 LYS A CB    1 
ATOM   2801 C  CG    . LYS A 1 354 ? 46.42184 29.99393  -32.63887 1.000 46.16831  ? 353 LYS A CG    1 
ATOM   2802 C  CD    . LYS A 1 354 ? 46.73432 29.57135  -34.06268 1.000 42.90337  ? 353 LYS A CD    1 
ATOM   2803 N  N     . TYR A 1 355 ? 45.11707 33.06098  -30.62207 1.000 43.73113  ? 354 TYR A N     1 
ATOM   2804 C  CA    . TYR A 1 355 ? 43.69492 33.36330  -30.65851 1.000 43.58777  ? 354 TYR A CA    1 
ATOM   2805 C  C     . TYR A 1 355 ? 43.37132 34.02008  -31.98736 1.000 48.60721  ? 354 TYR A C     1 
ATOM   2806 O  O     . TYR A 1 355 ? 44.05554 34.96028  -32.39905 1.000 52.35138  ? 354 TYR A O     1 
ATOM   2807 C  CB    . TYR A 1 355 ? 43.29114 34.27195  -29.51054 1.000 40.87176  ? 354 TYR A CB    1 
ATOM   2808 C  CG    . TYR A 1 355 ? 41.83714 34.66541  -29.55496 1.000 47.12913  ? 354 TYR A CG    1 
ATOM   2809 C  CD1   . TYR A 1 355 ? 40.83811 33.73579  -29.27483 1.000 42.45036  ? 354 TYR A CD1   1 
ATOM   2810 C  CD2   . TYR A 1 355 ? 41.45844 35.97190  -29.85802 1.000 46.15767  ? 354 TYR A CD2   1 
ATOM   2811 C  CE1   . TYR A 1 355 ? 39.50479 34.08537  -29.30351 1.000 41.02149  ? 354 TYR A CE1   1 
ATOM   2812 C  CE2   . TYR A 1 355 ? 40.12461 36.33782  -29.88396 1.000 47.39203  ? 354 TYR A CE2   1 
ATOM   2813 C  CZ    . TYR A 1 355 ? 39.14947 35.38900  -29.60946 1.000 50.71759  ? 354 TYR A CZ    1 
ATOM   2814 O  OH    . TYR A 1 355 ? 37.81877 35.74800  -29.63938 1.000 53.32955  ? 354 TYR A OH    1 
ATOM   2815 N  N     . ALA A 1 356 ? 42.35235 33.51949  -32.67367 1.000 50.15223  ? 355 ALA A N     1 
ATOM   2816 C  CA    . ALA A 1 356 ? 42.03158 34.07944  -33.97958 1.000 54.46378  ? 355 ALA A CA    1 
ATOM   2817 C  C     . ALA A 1 356 ? 40.54267 34.20147  -34.27291 1.000 57.97156  ? 355 ALA A C     1 
ATOM   2818 O  O     . ALA A 1 356 ? 40.18957 34.59720  -35.38776 1.000 58.40559  ? 355 ALA A O     1 
ATOM   2819 C  CB    . ALA A 1 356 ? 42.69270 33.24681  -35.09051 1.000 45.91444  ? 355 ALA A CB    1 
ATOM   2820 N  N     . ARG A 1 357 ? 39.66412 33.88257  -33.32771 1.000 58.17585  ? 356 ARG A N     1 
ATOM   2821 C  CA    . ARG A 1 357 ? 38.26285 33.67440  -33.66435 1.000 61.09653  ? 356 ARG A CA    1 
ATOM   2822 C  C     . ARG A 1 357 ? 37.57444 34.99592  -33.97140 1.000 63.50812  ? 356 ARG A C     1 
ATOM   2823 O  O     . ARG A 1 357 ? 37.66799 35.95456  -33.20048 1.000 64.50359  ? 356 ARG A O     1 
ATOM   2824 C  CB    . ARG A 1 357 ? 37.54380 32.95454  -32.52669 1.000 58.13065  ? 356 ARG A CB    1 
ATOM   2825 C  CG    . ARG A 1 357 ? 36.07087 32.73796  -32.78884 1.000 63.16359  ? 356 ARG A CG    1 
ATOM   2826 C  CD    . ARG A 1 357 ? 35.40695 31.97553  -31.65281 1.000 66.99552  ? 356 ARG A CD    1 
ATOM   2827 N  NE    . ARG A 1 357 ? 34.00090 31.72575  -31.95085 1.000 71.37854  ? 356 ARG A NE    1 
ATOM   2828 C  CZ    . ARG A 1 357 ? 33.06425 31.52950  -31.03128 1.000 75.25327  ? 356 ARG A CZ    1 
ATOM   2829 N  NH1   . ARG A 1 357 ? 33.38271 31.56007  -29.74229 1.000 75.74993  ? 356 ARG A NH1   1 
ATOM   2830 N  NH2   . ARG A 1 357 ? 31.80610 31.31601  -31.40124 1.000 78.32271  ? 356 ARG A NH2   1 
ATOM   2831 N  N     . MET A 1 358 ? 36.86836 35.04035  -35.09331 1.000 61.17605  ? 357 MET A N     1 
ATOM   2832 C  CA    . MET A 1 358 ? 36.08280 36.21014  -35.45414 1.000 69.79873  ? 357 MET A CA    1 
ATOM   2833 C  C     . MET A 1 358 ? 34.71375 36.13842  -34.77578 1.000 66.48492  ? 357 MET A C     1 
ATOM   2834 O  O     . MET A 1 358 ? 33.93715 35.20892  -35.02908 1.000 70.21901  ? 357 MET A O     1 
ATOM   2835 C  CB    . MET A 1 358 ? 35.95296 36.31160  -36.97585 1.000 74.40823  ? 357 MET A CB    1 
ATOM   2836 C  CG    . MET A 1 358 ? 37.22163 36.81854  -37.68958 1.000 66.84210  ? 357 MET A CG    1 
ATOM   2837 S  SD    . MET A 1 358 ? 37.70765 38.47601  -37.13231 1.000 81.68986  ? 357 MET A SD    1 
ATOM   2838 C  CE    . MET A 1 358 ? 36.11701 39.32714  -37.14137 1.000 55.98241  ? 357 MET A CE    1 
ATOM   2839 N  N     . ARG A 1 359 ? 34.43136 37.11519  -33.90506 1.000 61.87102  ? 358 ARG A N     1 
ATOM   2840 C  CA    . ARG A 1 359 ? 33.16641 37.23074  -33.17732 1.000 59.33152  ? 358 ARG A CA    1 
ATOM   2841 C  C     . ARG A 1 359 ? 32.42900 38.46981  -33.67493 1.000 62.50214  ? 358 ARG A C     1 
ATOM   2842 O  O     . ARG A 1 359 ? 32.85590 39.60128  -33.41110 1.000 60.67940  ? 358 ARG A O     1 
ATOM   2843 C  CB    . ARG A 1 359 ? 33.39335 37.33335  -31.66711 1.000 62.66638  ? 358 ARG A CB    1 
ATOM   2844 C  CG    . ARG A 1 359 ? 33.89879 36.07943  -30.98382 1.000 66.54046  ? 358 ARG A CG    1 
ATOM   2845 C  CD    . ARG A 1 359 ? 32.81920 35.01194  -30.88262 1.000 74.49948  ? 358 ARG A CD    1 
ATOM   2846 N  NE    . ARG A 1 359 ? 31.79759 35.33385  -29.88993 1.000 76.01248  ? 358 ARG A NE    1 
ATOM   2847 C  CZ    . ARG A 1 359 ? 31.80597 34.87433  -28.64393 1.000 78.70712  ? 358 ARG A CZ    1 
ATOM   2848 N  NH1   . ARG A 1 359 ? 32.78801 34.07478  -28.24290 1.000 70.31751  ? 358 ARG A NH1   1 
ATOM   2849 N  NH2   . ARG A 1 359 ? 30.83311 35.21162  -27.80053 1.000 82.00003  ? 358 ARG A NH2   1 
ATOM   2850 N  N     . GLY A 1 360 ? 31.33525 38.26143  -34.39212 1.000 59.62705  ? 359 GLY A N     1 
ATOM   2851 C  CA    . GLY A 1 360 ? 30.50124 39.39935  -34.74289 1.000 52.70857  ? 359 GLY A CA    1 
ATOM   2852 C  C     . GLY A 1 360 ? 30.79691 39.96850  -36.11693 1.000 48.12906  ? 359 GLY A C     1 
ATOM   2853 O  O     . GLY A 1 360 ? 31.91996 39.92477  -36.62186 1.000 46.35988  ? 359 GLY A O     1 
ATOM   2854 N  N     . ALA A 1 361 ? 29.74930 40.55250  -36.71121 1.000 48.09860  ? 360 ALA A N     1 
ATOM   2855 C  CA    . ALA A 1 361 ? 29.83927 41.16169  -38.03424 1.000 41.86761  ? 360 ALA A CA    1 
ATOM   2856 C  C     . ALA A 1 361 ? 30.81614 42.32768  -38.05321 1.000 42.83992  ? 360 ALA A C     1 
ATOM   2857 O  O     . ALA A 1 361 ? 31.50713 42.55086  -39.05527 1.000 42.25653  ? 360 ALA A O     1 
ATOM   2858 C  CB    . ALA A 1 361 ? 28.45416 41.63181  -38.47885 1.000 37.63854  ? 360 ALA A CB    1 
ATOM   2859 N  N     . HIS A 1 362 ? 30.87653 43.09014  -36.96047 1.000 41.29270  ? 361 HIS A N     1 
ATOM   2860 C  CA    . HIS A 1 362 ? 31.71304 44.27652  -36.86776 1.000 39.89243  ? 361 HIS A CA    1 
ATOM   2861 C  C     . HIS A 1 362 ? 32.38866 44.29317  -35.50874 1.000 38.55944  ? 361 HIS A C     1 
ATOM   2862 O  O     . HIS A 1 362 ? 31.76084 43.98677  -34.49358 1.000 44.00865  ? 361 HIS A O     1 
ATOM   2863 C  CB    . HIS A 1 362 ? 30.89245 45.55348  -37.07326 1.000 34.45674  ? 361 HIS A CB    1 
ATOM   2864 C  CG    . HIS A 1 362 ? 29.76230 45.38172  -38.03257 1.000 36.51725  ? 361 HIS A CG    1 
ATOM   2865 N  ND1   . HIS A 1 362 ? 29.95582 45.25520  -39.39257 1.000 40.25137  ? 361 HIS A ND1   1 
ATOM   2866 C  CD2   . HIS A 1 362 ? 28.42619 45.28568  -37.82998 1.000 33.46526  ? 361 HIS A CD2   1 
ATOM   2867 C  CE1   . HIS A 1 362 ? 28.78374 45.10822  -39.98815 1.000 38.63500  ? 361 HIS A CE1   1 
ATOM   2868 N  NE2   . HIS A 1 362 ? 27.84019 45.11737  -39.06163 1.000 35.60801  ? 361 HIS A NE2   1 
ATOM   2869 N  N     . THR A 1 363 ? 33.65997 44.67599  -35.49705 1.000 38.71315  ? 362 THR A N     1 
ATOM   2870 C  CA    . THR A 1 363 ? 34.48764 44.60184  -34.30087 1.000 38.79818  ? 362 THR A CA    1 
ATOM   2871 C  C     . THR A 1 363 ? 35.68156 45.53330  -34.47892 1.000 39.03586  ? 362 THR A C     1 
ATOM   2872 O  O     . THR A 1 363 ? 35.91066 46.08441  -35.56159 1.000 40.94599  ? 362 THR A O     1 
ATOM   2873 C  CB    . THR A 1 363 ? 34.94234 43.15990  -34.04824 1.000 36.97984  ? 362 THR A CB    1 
ATOM   2874 O  OG1   . THR A 1 363 ? 35.79044 43.11441  -32.90032 1.000 49.48583  ? 362 THR A OG1   1 
ATOM   2875 C  CG2   . THR A 1 363 ? 35.70972 42.63268  -35.22450 1.000 34.13425  ? 362 THR A CG2   1 
ATOM   2876 N  N     . ASN A 1 364 ? 36.45098 45.69810  -33.40435 1.000 37.53796  ? 363 ASN A N     1 
ATOM   2877 C  CA    . ASN A 1 364 ? 37.72206 46.41042  -33.48644 1.000 41.79261  ? 363 ASN A CA    1 
ATOM   2878 C  C     . ASN A 1 364 ? 38.77630 45.66739  -32.67950 1.000 42.00849  ? 363 ASN A C     1 
ATOM   2879 O  O     . ASN A 1 364 ? 38.51771 44.60543  -32.11968 1.000 44.61808  ? 363 ASN A O     1 
ATOM   2880 C  CB    . ASN A 1 364 ? 37.58529 47.86371  -33.02836 1.000 37.93279  ? 363 ASN A CB    1 
ATOM   2881 C  CG    . ASN A 1 364 ? 37.23983 47.99671  -31.56862 1.000 39.66375  ? 363 ASN A CG    1 
ATOM   2882 O  OD1   . ASN A 1 364 ? 37.78001 47.29572  -30.71885 1.000 43.39058  ? 363 ASN A OD1   1 
ATOM   2883 N  ND2   . ASN A 1 364 ? 36.34015 48.92273  -31.26425 1.000 40.32073  ? 363 ASN A ND2   1 
ATOM   2884 N  N     . ASP A 1 365 ? 39.97531 46.23908  -32.60538 1.000 45.60802  ? 364 ASP A N     1 
ATOM   2885 C  CA    . ASP A 1 365 ? 41.08399 45.50878  -32.00907 1.000 42.64165  ? 364 ASP A CA    1 
ATOM   2886 C  C     . ASP A 1 365 ? 41.04704 45.48651  -30.48511 1.000 43.09324  ? 364 ASP A C     1 
ATOM   2887 O  O     . ASP A 1 365 ? 41.55944 44.53052  -29.89223 1.000 49.54530  ? 364 ASP A O     1 
ATOM   2888 C  CB    . ASP A 1 365 ? 42.41245 46.06729  -32.51504 1.000 42.52864  ? 364 ASP A CB    1 
ATOM   2889 C  CG    . ASP A 1 365 ? 42.83262 45.43479  -33.84175 1.000 55.13755  ? 364 ASP A CG    1 
ATOM   2890 O  OD1   . ASP A 1 365 ? 42.03485 44.64907  -34.40938 1.000 59.06843  ? 364 ASP A OD1   1 
ATOM   2891 O  OD2   . ASP A 1 365 ? 43.96410 45.69069  -34.31371 1.000 57.98495  ? 364 ASP A OD2   1 
ATOM   2892 N  N     . VAL A 1 366 ? 40.41088 46.45843  -29.82878 1.000 38.63522  ? 365 VAL A N     1 
ATOM   2893 C  CA    . VAL A 1 366 ? 40.31647 46.38444  -28.37197 1.000 40.67417  ? 365 VAL A CA    1 
ATOM   2894 C  C     . VAL A 1 366 ? 39.37641 45.25549  -27.94309 1.000 42.34022  ? 365 VAL A C     1 
ATOM   2895 O  O     . VAL A 1 366 ? 39.68424 44.49595  -27.01337 1.000 45.75707  ? 365 VAL A O     1 
ATOM   2896 C  CB    . VAL A 1 366 ? 39.88970 47.74106  -27.78530 1.000 43.80730  ? 365 VAL A CB    1 
ATOM   2897 C  CG1   . VAL A 1 366 ? 39.78455 47.65745  -26.26954 1.000 40.14231  ? 365 VAL A CG1   1 
ATOM   2898 C  CG2   . VAL A 1 366 ? 40.88607 48.79621  -28.16174 1.000 36.60167  ? 365 VAL A CG2   1 
ATOM   2899 N  N     . LYS A 1 367 ? 38.22405 45.12302  -28.60948 1.000 39.13097  ? 366 LYS A N     1 
ATOM   2900 C  CA    . LYS A 1 367 ? 37.32660 43.99234  -28.37063 1.000 37.34401  ? 366 LYS A CA    1 
ATOM   2901 C  C     . LYS A 1 367 ? 38.05901 42.66265  -28.50907 1.000 45.05739  ? 366 LYS A C     1 
ATOM   2902 O  O     . LYS A 1 367 ? 37.98944 41.79086  -27.62609 1.000 45.56050  ? 366 LYS A O     1 
ATOM   2903 C  CB    . LYS A 1 367 ? 36.16849 44.03005  -29.36691 1.000 37.90401  ? 366 LYS A CB    1 
ATOM   2904 C  CG    . LYS A 1 367 ? 34.99076 44.91232  -29.01782 1.000 41.79911  ? 366 LYS A CG    1 
ATOM   2905 C  CD    . LYS A 1 367 ? 34.00543 44.91148  -30.17774 1.000 40.96443  ? 366 LYS A CD    1 
ATOM   2906 C  CE    . LYS A 1 367 ? 32.71556 45.64401  -29.83223 1.000 44.45885  ? 366 LYS A CE    1 
ATOM   2907 N  NZ    . LYS A 1 367 ? 31.71407 45.58550  -30.93828 1.000 36.74889  ? 366 LYS A NZ    1 
ATOM   2908 N  N     . GLN A 1 368 ? 38.72582 42.47690  -29.65112 1.000 44.95339  ? 367 GLN A N     1 
ATOM   2909 C  CA    . GLN A 1 368 ? 39.45046 41.24271  -29.90388 1.000 44.23285  ? 367 GLN A CA    1 
ATOM   2910 C  C     . GLN A 1 368 ? 40.48974 40.98965  -28.82942 1.000 46.70673  ? 367 GLN A C     1 
ATOM   2911 O  O     . GLN A 1 368 ? 40.68352 39.84379  -28.40082 1.000 45.11388  ? 367 GLN A O     1 
ATOM   2912 C  CB    . GLN A 1 368 ? 40.10581 41.29992  -31.27538 1.000 45.97331  ? 367 GLN A CB    1 
ATOM   2913 C  CG    . GLN A 1 368 ? 39.14953 41.04702  -32.40880 1.000 49.18034  ? 367 GLN A CG    1 
ATOM   2914 C  CD    . GLN A 1 368 ? 39.81244 41.18318  -33.75696 1.000 53.90661  ? 367 GLN A CD    1 
ATOM   2915 O  OE1   . GLN A 1 368 ? 40.99298 41.53037  -33.85373 1.000 55.34086  ? 367 GLN A OE1   1 
ATOM   2916 N  NE2   . GLN A 1 368 ? 39.05486 40.91528  -34.81340 1.000 58.07283  ? 367 GLN A NE2   1 
ATOM   2917 N  N     . LEU A 1 369 ? 41.17295 42.04515  -28.37631 1.000 44.98882  ? 368 LEU A N     1 
ATOM   2918 C  CA    . LEU A 1 369 ? 42.16077 41.83804  -27.32677 1.000 42.20884  ? 368 LEU A CA    1 
ATOM   2919 C  C     . LEU A 1 369 ? 41.48743 41.40393  -26.02888 1.000 44.53632  ? 368 LEU A C     1 
ATOM   2920 O  O     . LEU A 1 369 ? 41.99955 40.53426  -25.31158 1.000 42.85060  ? 368 LEU A O     1 
ATOM   2921 C  CB    . LEU A 1 369 ? 42.98933 43.10365  -27.13055 1.000 40.87793  ? 368 LEU A CB    1 
ATOM   2922 C  CG    . LEU A 1 369 ? 44.05600 43.03620  -26.03423 1.000 42.52032  ? 368 LEU A CG    1 
ATOM   2923 C  CD1   . LEU A 1 369 ? 45.22846 42.12387  -26.44123 1.000 38.77124  ? 368 LEU A CD1   1 
ATOM   2924 C  CD2   . LEU A 1 369 ? 44.52781 44.42959  -25.65107 1.000 42.95701  ? 368 LEU A CD2   1 
ATOM   2925 N  N     . THR A 1 370 ? 40.32240 41.97522  -25.72437 1.000 45.80141  ? 369 THR A N     1 
ATOM   2926 C  CA    . THR A 1 370 ? 39.61209 41.57785  -24.51323 1.000 44.24866  ? 369 THR A CA    1 
ATOM   2927 C  C     . THR A 1 370 ? 39.20684 40.10967  -24.56500 1.000 44.78308  ? 369 THR A C     1 
ATOM   2928 O  O     . THR A 1 370 ? 39.27478 39.39744  -23.55048 1.000 46.58146  ? 369 THR A O     1 
ATOM   2929 C  CB    . THR A 1 370 ? 38.38962 42.45910  -24.31545 1.000 43.46402  ? 369 THR A CB    1 
ATOM   2930 O  OG1   . THR A 1 370 ? 38.79287 43.83241  -24.36970 1.000 43.86031  ? 369 THR A OG1   1 
ATOM   2931 C  CG2   . THR A 1 370 ? 37.75093 42.16664  -22.96431 1.000 47.16395  ? 369 THR A CG2   1 
ATOM   2932 N  N     . GLU A 1 371 ? 38.80856 39.62206  -25.74293 1.000 40.62212  ? 370 GLU A N     1 
ATOM   2933 C  CA    . GLU A 1 371 ? 38.42121 38.21607  -25.77997 1.000 41.60002  ? 370 GLU A CA    1 
ATOM   2934 C  C     . GLU A 1 371 ? 39.62834 37.26926  -25.82692 1.000 43.97164  ? 370 GLU A C     1 
ATOM   2935 O  O     . GLU A 1 371 ? 39.53778 36.13575  -25.32221 1.000 39.69885  ? 370 GLU A O     1 
ATOM   2936 C  CB    . GLU A 1 371 ? 37.44687 37.94006  -26.92648 1.000 41.23993  ? 370 GLU A CB    1 
ATOM   2937 C  CG    . GLU A 1 371 ? 37.68780 38.64538  -28.19551 1.000 49.69824  ? 370 GLU A CG    1 
ATOM   2938 C  CD    . GLU A 1 371 ? 36.38694 38.90704  -28.94888 1.000 58.86589  ? 370 GLU A CD    1 
ATOM   2939 O  OE1   . GLU A 1 371 ? 35.52110 39.65707  -28.40696 1.000 56.07840  ? 370 GLU A OE1   1 
ATOM   2940 O  OE2   . GLU A 1 371 ? 36.23921 38.36097  -30.07437 1.000 55.70864  ? 370 GLU A OE2   1 
ATOM   2941 N  N     . ALA A 1 372 ? 40.76583 37.70995  -26.38115 1.000 39.91947  ? 371 ALA A N     1 
ATOM   2942 C  CA    . ALA A 1 372 ? 41.99458 36.93659  -26.22394 1.000 33.73042  ? 371 ALA A CA    1 
ATOM   2943 C  C     . ALA A 1 372 ? 42.40196 36.84213  -24.75667 1.000 37.58712  ? 371 ALA A C     1 
ATOM   2944 O  O     . ALA A 1 372 ? 42.84749 35.77817  -24.29399 1.000 39.06234  ? 371 ALA A O     1 
ATOM   2945 C  CB    . ALA A 1 372 ? 43.11362 37.54783  -27.05145 1.000 38.71602  ? 371 ALA A CB    1 
ATOM   2946 N  N     . VAL A 1 373 ? 42.23940 37.93917  -24.00165 1.000 36.84425  ? 372 VAL A N     1 
ATOM   2947 C  CA    . VAL A 1 373 ? 42.49668 37.90399  -22.56024 1.000 34.27803  ? 372 VAL A CA    1 
ATOM   2948 C  C     . VAL A 1 373 ? 41.57804 36.89584  -21.87716 1.000 41.81537  ? 372 VAL A C     1 
ATOM   2949 O  O     . VAL A 1 373 ? 42.02076 36.09426  -21.03368 1.000 42.04086  ? 372 VAL A O     1 
ATOM   2950 C  CB    . VAL A 1 373 ? 42.35344 39.30594  -21.93829 1.000 35.25652  ? 372 VAL A CB    1 
ATOM   2951 C  CG1   . VAL A 1 373 ? 42.50293 39.23639  -20.43478 1.000 36.32352  ? 372 VAL A CG1   1 
ATOM   2952 C  CG2   . VAL A 1 373 ? 43.40189 40.25278  -22.49714 1.000 40.19974  ? 372 VAL A CG2   1 
ATOM   2953 N  N     . GLN A 1 374 ? 40.29113 36.89838  -22.24302 1.000 41.26398  ? 373 GLN A N     1 
ATOM   2954 C  CA    . GLN A 1 374 ? 39.36489 35.95084  -21.63070 1.000 40.29518  ? 373 GLN A CA    1 
ATOM   2955 C  C     . GLN A 1 374 ? 39.76208 34.50040  -21.92692 1.000 39.09609  ? 373 GLN A C     1 
ATOM   2956 O  O     . GLN A 1 374 ? 39.78419 33.64478  -21.02296 1.000 39.57768  ? 373 GLN A O     1 
ATOM   2957 C  CB    . GLN A 1 374 ? 37.94627 36.24797  -22.09571 1.000 39.84226  ? 373 GLN A CB    1 
ATOM   2958 C  CG    . GLN A 1 374 ? 37.19019 37.11236  -21.09388 1.000 51.30112  ? 373 GLN A CG    1 
ATOM   2959 C  CD    . GLN A 1 374 ? 36.58112 38.37566  -21.71788 1.000 58.43273  ? 373 GLN A CD    1 
ATOM   2960 O  OE1   . GLN A 1 374 ? 36.76113 39.50201  -21.20184 1.000 56.76450  ? 373 GLN A OE1   1 
ATOM   2961 N  NE2   . GLN A 1 374 ? 35.85097 38.19410  -22.82602 1.000 49.25383  ? 373 GLN A NE2   1 
ATOM   2962 N  N     . LYS A 1 375 ? 40.06908 34.20111  -23.18932 1.000 37.42166  ? 374 LYS A N     1 
ATOM   2963 C  CA    . LYS A 1 375 ? 40.44805 32.83755  -23.53564 1.000 34.08904  ? 374 LYS A CA    1 
ATOM   2964 C  C     . LYS A 1 375 ? 41.64736 32.39500  -22.71417 1.000 39.20235  ? 374 LYS A C     1 
ATOM   2965 O  O     . LYS A 1 375 ? 41.61435 31.33116  -22.07837 1.000 41.70619  ? 374 LYS A O     1 
ATOM   2966 C  CB    . LYS A 1 375 ? 40.74624 32.71501  -25.03121 1.000 32.44893  ? 374 LYS A CB    1 
ATOM   2967 C  CG    . LYS A 1 375 ? 40.81900 31.26070  -25.52249 1.000 44.55139  ? 374 LYS A CG    1 
ATOM   2968 C  CD    . LYS A 1 375 ? 42.06011 30.96705  -26.39545 1.000 42.74561  ? 374 LYS A CD    1 
ATOM   2969 N  N     . ILE A 1 376 ? 42.70349 33.22118  -22.68341 1.000 37.26159  ? 375 ILE A N     1 
ATOM   2970 C  CA    . ILE A 1 376 ? 43.90611 32.85475  -21.93697 1.000 36.07407  ? 375 ILE A CA    1 
ATOM   2971 C  C     . ILE A 1 376 ? 43.60235 32.69152  -20.45169 1.000 37.80494  ? 375 ILE A C     1 
ATOM   2972 O  O     . ILE A 1 376 ? 44.21736 31.86583  -19.76544 1.000 36.32792  ? 375 ILE A O     1 
ATOM   2973 C  CB    . ILE A 1 376 ? 45.01369 33.90330  -22.16736 1.000 38.22868  ? 375 ILE A CB    1 
ATOM   2974 C  CG1   . ILE A 1 376 ? 45.33957 34.01382  -23.64908 1.000 35.39584  ? 375 ILE A CG1   1 
ATOM   2975 C  CG2   . ILE A 1 376 ? 46.27526 33.56062  -21.37518 1.000 32.20898  ? 375 ILE A CG2   1 
ATOM   2976 C  CD1   . ILE A 1 376 ? 46.23545 35.14293  -23.95309 1.000 36.02914  ? 375 ILE A CD1   1 
ATOM   2977 N  N     . THR A 1 377 ? 42.65629 33.46355  -19.92560 1.000 39.11821  ? 376 THR A N     1 
ATOM   2978 C  CA    . THR A 1 377 ? 42.37342 33.36250  -18.49983 1.000 38.15038  ? 376 THR A CA    1 
ATOM   2979 C  C     . THR A 1 377 ? 41.71093 32.03535  -18.15539 1.000 38.86157  ? 376 THR A C     1 
ATOM   2980 O  O     . THR A 1 377 ? 42.08080 31.39269  -17.16361 1.000 40.00379  ? 376 THR A O     1 
ATOM   2981 C  CB    . THR A 1 377 ? 41.51039 34.53844  -18.06298 1.000 40.48755  ? 376 THR A CB    1 
ATOM   2982 O  OG1   . THR A 1 377 ? 42.19634 35.75674  -18.38785 1.000 40.77250  ? 376 THR A OG1   1 
ATOM   2983 C  CG2   . THR A 1 377 ? 41.23866 34.47544  -16.57785 1.000 35.35631  ? 376 THR A CG2   1 
ATOM   2984 N  N     . THR A 1 378 ? 40.73791 31.58783  -18.96009 1.000 38.47231  ? 377 THR A N     1 
ATOM   2985 C  CA    . THR A 1 378 ? 40.14094 30.29257  -18.61387 1.000 40.56077  ? 377 THR A CA    1 
ATOM   2986 C  C     . THR A 1 378 ? 41.08566 29.14374  -18.93018 1.000 36.80577  ? 377 THR A C     1 
ATOM   2987 O  O     . THR A 1 378 ? 41.07916 28.12770  -18.22450 1.000 38.07952  ? 377 THR A O     1 
ATOM   2988 C  CB    . THR A 1 378 ? 38.78842 30.06266  -19.29390 1.000 42.71119  ? 377 THR A CB    1 
ATOM   2989 O  OG1   . THR A 1 378 ? 38.80964 30.59689  -20.61773 1.000 50.78555  ? 377 THR A OG1   1 
ATOM   2990 C  CG2   . THR A 1 378 ? 37.67627 30.71896  -18.49453 1.000 43.49510  ? 377 THR A CG2   1 
ATOM   2991 N  N     . GLU A 1 379 ? 41.93282 29.29542  -19.94750 1.000 35.21026  ? 378 GLU A N     1 
ATOM   2992 C  CA    . GLU A 1 379 ? 42.95600 28.28482  -20.17628 1.000 36.76985  ? 378 GLU A CA    1 
ATOM   2993 C  C     . GLU A 1 379 ? 43.90842 28.19121  -18.98293 1.000 36.81988  ? 378 GLU A C     1 
ATOM   2994 O  O     . GLU A 1 379 ? 44.25139 27.08907  -18.52585 1.000 34.28449  ? 378 GLU A O     1 
ATOM   2995 C  CB    . GLU A 1 379 ? 43.70233 28.59678  -21.46954 1.000 34.48945  ? 378 GLU A CB    1 
ATOM   2996 C  CG    . GLU A 1 379 ? 44.73085 27.54861  -21.86952 1.000 45.12773  ? 378 GLU A CG    1 
ATOM   2997 C  CD    . GLU A 1 379 ? 45.46046 27.91545  -23.15679 1.000 50.63753  ? 378 GLU A CD    1 
ATOM   2998 O  OE1   . GLU A 1 379 ? 44.78328 28.36881  -24.11441 1.000 54.22465  ? 378 GLU A OE1   1 
ATOM   2999 O  OE2   . GLU A 1 379 ? 46.70906 27.77645  -23.19744 1.000 46.09345  ? 378 GLU A OE2   1 
ATOM   3000 N  N     . SER A 1 380 ? 44.31050 29.33778  -18.43550 1.000 37.01889  ? 379 SER A N     1 
ATOM   3001 C  CA    . SER A 1 380 ? 45.18258 29.32080  -17.26792 1.000 39.78288  ? 379 SER A CA    1 
ATOM   3002 C  C     . SER A 1 380 ? 44.48716 28.69758  -16.07651 1.000 36.88680  ? 379 SER A C     1 
ATOM   3003 O  O     . SER A 1 380 ? 45.11975 27.98682  -15.29316 1.000 39.55802  ? 379 SER A O     1 
ATOM   3004 C  CB    . SER A 1 380 ? 45.66304 30.73217  -16.91389 1.000 40.42040  ? 379 SER A CB    1 
ATOM   3005 O  OG    . SER A 1 380 ? 46.57186 31.22003  -17.88258 1.000 43.39827  ? 379 SER A OG    1 
ATOM   3006 N  N     . ILE A 1 381 ? 43.19484 28.96145  -15.89882 1.000 34.73811  ? 380 ILE A N     1 
ATOM   3007 C  CA    . ILE A 1 381 ? 42.54326 28.37138  -14.73625 1.000 36.79271  ? 380 ILE A CA    1 
ATOM   3008 C  C     . ILE A 1 381 ? 42.47825 26.85329  -14.86775 1.000 39.93647  ? 380 ILE A C     1 
ATOM   3009 O  O     . ILE A 1 381 ? 42.67018 26.12315  -13.88370 1.000 40.52086  ? 380 ILE A O     1 
ATOM   3010 C  CB    . ILE A 1 381 ? 41.15958 28.98870  -14.52412 1.000 43.07073  ? 380 ILE A CB    1 
ATOM   3011 C  CG1   . ILE A 1 381 ? 41.32696 30.46939  -14.14261 1.000 37.29448  ? 380 ILE A CG1   1 
ATOM   3012 C  CG2   . ILE A 1 381 ? 40.35268 28.16178  -13.46671 1.000 40.03023  ? 380 ILE A CG2   1 
ATOM   3013 C  CD1   . ILE A 1 381 ? 40.05139 31.26893  -14.25866 1.000 35.38689  ? 380 ILE A CD1   1 
ATOM   3014 N  N     . VAL A 1 382 ? 42.23902 26.34881  -16.08274 1.000 35.45447  ? 381 VAL A N     1 
ATOM   3015 C  CA    . VAL A 1 382 ? 42.25743 24.89951  -16.28431 1.000 34.26192  ? 381 VAL A CA    1 
ATOM   3016 C  C     . VAL A 1 382 ? 43.63696 24.32510  -15.96581 1.000 36.00285  ? 381 VAL A C     1 
ATOM   3017 O  O     . VAL A 1 382 ? 43.76307 23.34822  -15.22394 1.000 38.96474  ? 381 VAL A O     1 
ATOM   3018 C  CB    . VAL A 1 382 ? 41.83052 24.53844  -17.71816 1.000 35.56577  ? 381 VAL A CB    1 
ATOM   3019 C  CG1   . VAL A 1 382 ? 42.15573 23.09436  -17.98788 1.000 30.33396  ? 381 VAL A CG1   1 
ATOM   3020 C  CG2   . VAL A 1 382 ? 40.35036 24.79919  -17.93975 1.000 28.66405  ? 381 VAL A CG2   1 
ATOM   3021 N  N     . ILE A 1 383 ? 44.69509 24.92078  -16.51367 1.000 35.22887  ? 382 ILE A N     1 
ATOM   3022 C  CA    . ILE A 1 383 ? 45.99921 24.25944  -16.44233 1.000 32.54539  ? 382 ILE A CA    1 
ATOM   3023 C  C     . ILE A 1 383 ? 46.71669 24.51910  -15.11539 1.000 38.57062  ? 382 ILE A C     1 
ATOM   3024 O  O     . ILE A 1 383 ? 47.37144 23.62283  -14.57528 1.000 44.53954  ? 382 ILE A O     1 
ATOM   3025 C  CB    . ILE A 1 383 ? 46.86743 24.67814  -17.63268 1.000 33.50181  ? 382 ILE A CB    1 
ATOM   3026 C  CG1   . ILE A 1 383 ? 46.30675 24.06246  -18.90918 1.000 31.07283  ? 382 ILE A CG1   1 
ATOM   3027 C  CG2   . ILE A 1 383 ? 48.30879 24.28883  -17.40190 1.000 31.38121  ? 382 ILE A CG2   1 
ATOM   3028 C  CD1   . ILE A 1 383 ? 46.94467 24.55608  -20.14051 1.000 31.37353  ? 382 ILE A CD1   1 
ATOM   3029 N  N     . TRP A 1 384 ? 46.66125 25.73817  -14.57463 1.000 38.45511  ? 383 TRP A N     1 
ATOM   3030 C  CA    . TRP A 1 384 ? 47.33847 26.03270  -13.31378 1.000 37.04101  ? 383 TRP A CA    1 
ATOM   3031 C  C     . TRP A 1 384 ? 46.40321 26.44528  -12.18171 1.000 38.89819  ? 383 TRP A C     1 
ATOM   3032 O  O     . TRP A 1 384 ? 46.87727 26.65262  -11.06086 1.000 40.80268  ? 383 TRP A O     1 
ATOM   3033 C  CB    . TRP A 1 384 ? 48.40639 27.12244  -13.50646 1.000 35.17424  ? 383 TRP A CB    1 
ATOM   3034 C  CG    . TRP A 1 384 ? 49.36088 26.81256  -14.59558 1.000 35.78474  ? 383 TRP A CG    1 
ATOM   3035 C  CD1   . TRP A 1 384 ? 50.40182 25.94198  -14.55012 1.000 34.08212  ? 383 TRP A CD1   1 
ATOM   3036 C  CD2   . TRP A 1 384 ? 49.35867 27.36734  -15.90977 1.000 34.84083  ? 383 TRP A CD2   1 
ATOM   3037 N  NE1   . TRP A 1 384 ? 51.05163 25.91152  -15.76368 1.000 30.33909  ? 383 TRP A NE1   1 
ATOM   3038 C  CE2   . TRP A 1 384 ? 50.42654 26.78005  -16.61343 1.000 32.26096  ? 383 TRP A CE2   1 
ATOM   3039 C  CE3   . TRP A 1 384 ? 48.55036 28.30020  -16.56234 1.000 36.41185  ? 383 TRP A CE3   1 
ATOM   3040 C  CZ2   . TRP A 1 384 ? 50.71155 27.09914  -17.92788 1.000 39.35218  ? 383 TRP A CZ2   1 
ATOM   3041 C  CZ3   . TRP A 1 384 ? 48.83475 28.62583  -17.86188 1.000 37.55691  ? 383 TRP A CZ3   1 
ATOM   3042 C  CH2   . TRP A 1 384 ? 49.90618 28.02843  -18.53809 1.000 41.81008  ? 383 TRP A CH2   1 
ATOM   3043 N  N     . GLY A 1 385 ? 45.10193 26.57263  -12.42475 1.000 40.25557  ? 384 GLY A N     1 
ATOM   3044 C  CA    . GLY A 1 385 ? 44.20544 26.88061  -11.33171 1.000 39.60887  ? 384 GLY A CA    1 
ATOM   3045 C  C     . GLY A 1 385 ? 44.27714 28.29738  -10.81609 1.000 40.14338  ? 384 GLY A C     1 
ATOM   3046 O  O     . GLY A 1 385 ? 43.72590 28.58502  -9.74734  1.000 40.93438  ? 384 GLY A O     1 
ATOM   3047 N  N     . LYS A 1 386 ? 44.93085 29.19580  -11.54123 1.000 38.20957  ? 385 LYS A N     1 
ATOM   3048 C  CA    . LYS A 1 386 ? 44.91358 30.60400  -11.19565 1.000 38.36100  ? 385 LYS A CA    1 
ATOM   3049 C  C     . LYS A 1 386 ? 45.01020 31.41498  -12.47869 1.000 39.41350  ? 385 LYS A C     1 
ATOM   3050 O  O     . LYS A 1 386 ? 45.28420 30.88735  -13.55439 1.000 47.89038  ? 385 LYS A O     1 
ATOM   3051 C  CB    . LYS A 1 386 ? 46.03934 30.94631  -10.22244 1.000 39.48900  ? 385 LYS A CB    1 
ATOM   3052 C  CG    . LYS A 1 386 ? 47.43505 30.83589  -10.81199 1.000 40.21221  ? 385 LYS A CG    1 
ATOM   3053 C  CD    . LYS A 1 386 ? 48.47835 30.89631  -9.70652  1.000 44.06729  ? 385 LYS A CD    1 
ATOM   3054 C  CE    . LYS A 1 386 ? 49.44148 32.06522  -9.88498  1.000 50.40730  ? 385 LYS A CE    1 
ATOM   3055 N  NZ    . LYS A 1 386 ? 50.83224 31.65831  -9.47093  1.000 54.57292  ? 385 LYS A NZ    1 
ATOM   3056 N  N     . THR A 1 387 ? 44.77989 32.69660  -12.35709 1.000 41.97798  ? 386 THR A N     1 
ATOM   3057 C  CA    . THR A 1 387 ? 44.78647 33.72065  -13.38842 1.000 41.19965  ? 386 THR A CA    1 
ATOM   3058 C  C     . THR A 1 387 ? 46.19306 34.28072  -13.54426 1.000 37.53300  ? 386 THR A C     1 
ATOM   3059 O  O     . THR A 1 387 ? 46.89128 34.45437  -12.55177 1.000 43.19069  ? 386 THR A O     1 
ATOM   3060 C  CB    . THR A 1 387 ? 43.82247 34.83772  -13.00164 1.000 43.94186  ? 386 THR A CB    1 
ATOM   3061 O  OG1   . THR A 1 387 ? 42.48695 34.31108  -12.97856 1.000 44.58857  ? 386 THR A OG1   1 
ATOM   3062 C  CG2   . THR A 1 387 ? 43.90655 36.01902  -13.95886 1.000 46.53242  ? 386 THR A CG2   1 
ATOM   3063 N  N     . PRO A 1 388 ? 46.66336 34.55597  -14.75423 1.000 38.16199  ? 387 PRO A N     1 
ATOM   3064 C  CA    . PRO A 1 388 ? 48.00288 35.11919  -14.92506 1.000 37.85557  ? 387 PRO A CA    1 
ATOM   3065 C  C     . PRO A 1 388 ? 47.99049 36.64404  -14.91881 1.000 39.51796  ? 387 PRO A C     1 
ATOM   3066 O  O     . PRO A 1 388 ? 46.94362 37.29231  -14.88612 1.000 42.04235  ? 387 PRO A O     1 
ATOM   3067 C  CB    . PRO A 1 388 ? 48.41797 34.59309  -16.29915 1.000 40.10458  ? 387 PRO A CB    1 
ATOM   3068 C  CG    . PRO A 1 388 ? 47.12120 34.56909  -17.05795 1.000 40.57336  ? 387 PRO A CG    1 
ATOM   3069 C  CD    . PRO A 1 388 ? 46.02622 34.26476  -16.05152 1.000 40.20133  ? 387 PRO A CD    1 
ATOM   3070 N  N     . LYS A 1 389 ? 49.19180 37.20633  -14.94260 1.000 42.53789  ? 388 LYS A N     1 
ATOM   3071 C  CA    . LYS A 1 389 ? 49.39213 38.64599  -15.04637 1.000 41.16652  ? 388 LYS A CA    1 
ATOM   3072 C  C     . LYS A 1 389 ? 49.73239 38.98031  -16.49223 1.000 42.26999  ? 388 LYS A C     1 
ATOM   3073 O  O     . LYS A 1 389 ? 50.52992 38.27852  -17.12629 1.000 44.17172  ? 388 LYS A O     1 
ATOM   3074 C  CB    . LYS A 1 389 ? 50.49250 39.10714  -14.09111 1.000 36.38391  ? 388 LYS A CB    1 
ATOM   3075 C  CG    . LYS A 1 389 ? 50.21282 38.71565  -12.65786 1.000 43.36535  ? 388 LYS A CG    1 
ATOM   3076 C  CD    . LYS A 1 389 ? 51.09677 39.43385  -11.66088 1.000 58.32577  ? 388 LYS A CD    1 
ATOM   3077 C  CE    . LYS A 1 389 ? 50.65557 39.13897  -10.22182 1.000 65.61978  ? 388 LYS A CE    1 
ATOM   3078 N  NZ    . LYS A 1 389 ? 51.49065 39.84510  -9.19487  1.000 65.90012  ? 388 LYS A NZ    1 
ATOM   3079 N  N     . PHE A 1 390 ? 49.11607 40.02519  -17.02607 1.000 41.13880  ? 389 PHE A N     1 
ATOM   3080 C  CA    . PHE A 1 390 ? 49.20921 40.23200  -18.45928 1.000 44.07938  ? 389 PHE A CA    1 
ATOM   3081 C  C     . PHE A 1 390 ? 50.20579 41.32697  -18.83486 1.000 47.10092  ? 389 PHE A C     1 
ATOM   3082 O  O     . PHE A 1 390 ? 50.48250 42.25541  -18.06712 1.000 44.02882  ? 389 PHE A O     1 
ATOM   3083 C  CB    . PHE A 1 390 ? 47.83500 40.53619  -19.04672 1.000 40.56450  ? 389 PHE A CB    1 
ATOM   3084 C  CG    . PHE A 1 390 ? 46.95653 39.33622  -19.14008 1.000 44.27258  ? 389 PHE A CG    1 
ATOM   3085 C  CD1   . PHE A 1 390 ? 46.04875 39.04291  -18.12818 1.000 46.14327  ? 389 PHE A CD1   1 
ATOM   3086 C  CD2   . PHE A 1 390 ? 47.05582 38.47059  -20.21754 1.000 42.02138  ? 389 PHE A CD2   1 
ATOM   3087 C  CE1   . PHE A 1 390 ? 45.23034 37.92803  -18.20520 1.000 38.92172  ? 389 PHE A CE1   1 
ATOM   3088 C  CE2   . PHE A 1 390 ? 46.23932 37.34903  -20.29253 1.000 38.67471  ? 389 PHE A CE2   1 
ATOM   3089 C  CZ    . PHE A 1 390 ? 45.32344 37.08451  -19.28552 1.000 34.81732  ? 389 PHE A CZ    1 
ATOM   3090 N  N     . LYS A 1 391 ? 50.77453 41.15986  -20.02859 1.000 44.84075  ? 390 LYS A N     1 
ATOM   3091 C  CA    . LYS A 1 391 ? 51.60836 42.14980  -20.68999 1.000 42.20679  ? 390 LYS A CA    1 
ATOM   3092 C  C     . LYS A 1 391 ? 51.03676 42.33518  -22.08859 1.000 44.53509  ? 390 LYS A C     1 
ATOM   3093 O  O     . LYS A 1 391 ? 51.15274 41.44061  -22.93968 1.000 48.31634  ? 390 LYS A O     1 
ATOM   3094 C  CB    . LYS A 1 391 ? 53.06384 41.70029  -20.71857 1.000 42.61517  ? 390 LYS A CB    1 
ATOM   3095 C  CG    . LYS A 1 391 ? 53.69107 41.61333  -19.33099 1.000 46.73128  ? 390 LYS A CG    1 
ATOM   3096 C  CD    . LYS A 1 391 ? 55.20023 41.79391  -19.39885 1.000 55.30275  ? 390 LYS A CD    1 
ATOM   3097 C  CE    . LYS A 1 391 ? 55.80755 41.97402  -18.01110 1.000 68.73268  ? 390 LYS A CE    1 
ATOM   3098 N  NZ    . LYS A 1 391 ? 57.26764 42.33001  -18.08492 1.000 72.08896  ? 390 LYS A NZ    1 
ATOM   3099 N  N     . LEU A 1 392 ? 50.40683 43.49177  -22.31812 1.000 43.39395  ? 391 LEU A N     1 
ATOM   3100 C  CA    . LEU A 1 392 ? 49.60824 43.73809  -23.50496 1.000 42.76711  ? 391 LEU A CA    1 
ATOM   3101 C  C     . LEU A 1 392 ? 50.13118 44.93588  -24.29011 1.000 47.18814  ? 391 LEU A C     1 
ATOM   3102 O  O     . LEU A 1 392 ? 50.55449 45.93424  -23.69486 1.000 48.51728  ? 391 LEU A O     1 
ATOM   3103 C  CB    . LEU A 1 392 ? 48.14712 43.99581  -23.12344 1.000 42.16949  ? 391 LEU A CB    1 
ATOM   3104 C  CG    . LEU A 1 392 ? 47.52101 43.02202  -22.12479 1.000 40.83111  ? 391 LEU A CG    1 
ATOM   3105 C  CD1   . LEU A 1 392 ? 46.12222 43.48978  -21.72238 1.000 41.35665  ? 391 LEU A CD1   1 
ATOM   3106 C  CD2   . LEU A 1 392 ? 47.48680 41.62424  -22.70330 1.000 38.32384  ? 391 LEU A CD2   1 
ATOM   3107 N  N     . PRO A 1 393 ? 50.09142 44.87756  -25.62411 1.000 43.14070  ? 392 PRO A N     1 
ATOM   3108 C  CA    . PRO A 1 393 ? 50.51258 46.00976  -26.47170 1.000 43.02652  ? 392 PRO A CA    1 
ATOM   3109 C  C     . PRO A 1 393 ? 49.42060 47.06750  -26.61831 1.000 47.87835  ? 392 PRO A C     1 
ATOM   3110 O  O     . PRO A 1 393 ? 48.95744 47.38934  -27.72386 1.000 43.46046  ? 392 PRO A O     1 
ATOM   3111 C  CB    . PRO A 1 393 ? 50.82232 45.31548  -27.80253 1.000 48.55783  ? 392 PRO A CB    1 
ATOM   3112 C  CG    . PRO A 1 393 ? 49.83136 44.20270  -27.84718 1.000 44.88295  ? 392 PRO A CG    1 
ATOM   3113 C  CD    . PRO A 1 393 ? 49.70927 43.70333  -26.42527 1.000 41.13430  ? 392 PRO A CD    1 
ATOM   3114 N  N     . ILE A 1 394 ? 48.98472 47.61720  -25.48964 1.000 43.86845  ? 393 ILE A N     1 
ATOM   3115 C  CA    . ILE A 1 394 ? 47.91313 48.60320  -25.48594 1.000 43.67197  ? 393 ILE A CA    1 
ATOM   3116 C  C     . ILE A 1 394 ? 48.21701 49.60517  -24.38120 1.000 47.52649  ? 393 ILE A C     1 
ATOM   3117 O  O     . ILE A 1 394 ? 48.56931 49.22308  -23.26145 1.000 47.27601  ? 393 ILE A O     1 
ATOM   3118 C  CB    . ILE A 1 394 ? 46.52371 47.94397  -25.31570 1.000 40.91271  ? 393 ILE A CB    1 
ATOM   3119 C  CG1   . ILE A 1 394 ? 45.40803 48.92637  -25.66180 1.000 45.89002  ? 393 ILE A CG1   1 
ATOM   3120 C  CG2   . ILE A 1 394 ? 46.30710 47.45283  -23.91896 1.000 41.17839  ? 393 ILE A CG2   1 
ATOM   3121 C  CD1   . ILE A 1 394 ? 44.04220 48.46271  -25.26616 1.000 42.04028  ? 393 ILE A CD1   1 
ATOM   3122 N  N     . GLN A 1 395 ? 48.13469 50.89095  -24.70273 1.000 47.70542  ? 394 GLN A N     1 
ATOM   3123 C  CA    . GLN A 1 395 ? 48.45948 51.89358  -23.70523 1.000 46.97188  ? 394 GLN A CA    1 
ATOM   3124 C  C     . GLN A 1 395 ? 47.30476 52.04749  -22.72369 1.000 47.92069  ? 394 GLN A C     1 
ATOM   3125 O  O     . GLN A 1 395 ? 46.13435 51.88705  -23.08053 1.000 44.16938  ? 394 GLN A O     1 
ATOM   3126 C  CB    . GLN A 1 395 ? 48.79586 53.22413  -24.37094 1.000 47.31578  ? 394 GLN A CB    1 
ATOM   3127 C  CG    . GLN A 1 395 ? 50.27491 53.35358  -24.76194 1.000 58.49581  ? 394 GLN A CG    1 
ATOM   3128 C  CD    . GLN A 1 395 ? 50.60743 54.69649  -25.43818 1.000 76.60345  ? 394 GLN A CD    1 
ATOM   3129 O  OE1   . GLN A 1 395 ? 50.46343 55.77720  -24.84071 1.000 70.87053  ? 394 GLN A OE1   1 
ATOM   3130 N  NE2   . GLN A 1 395 ? 51.04882 54.62701  -26.69445 1.000 74.90859  ? 394 GLN A NE2   1 
ATOM   3131 N  N     . LYS A 1 396 ? 47.65472 52.33597  -21.46565 1.000 47.03596  ? 395 LYS A N     1 
ATOM   3132 C  CA    . LYS A 1 396 ? 46.64702 52.52055  -20.42376 1.000 45.55636  ? 395 LYS A CA    1 
ATOM   3133 C  C     . LYS A 1 396 ? 45.63124 53.60163  -20.79759 1.000 51.10689  ? 395 LYS A C     1 
ATOM   3134 O  O     . LYS A 1 396 ? 44.44586 53.48346  -20.46776 1.000 53.87126  ? 395 LYS A O     1 
ATOM   3135 C  CB    . LYS A 1 396 ? 47.33081 52.87161  -19.10346 1.000 49.29407  ? 395 LYS A CB    1 
ATOM   3136 C  CG    . LYS A 1 396 ? 48.12958 51.73264  -18.49929 1.000 47.15901  ? 395 LYS A CG    1 
ATOM   3137 C  CD    . LYS A 1 396 ? 47.20399 50.81571  -17.74911 1.000 49.24787  ? 395 LYS A CD    1 
ATOM   3138 C  CE    . LYS A 1 396 ? 47.87681 49.53662  -17.29024 1.000 49.06429  ? 395 LYS A CE    1 
ATOM   3139 N  NZ    . LYS A 1 396 ? 46.99566 48.83966  -16.28755 1.000 52.31153  ? 395 LYS A NZ    1 
ATOM   3140 N  N     . GLU A 1 397 ? 46.06714 54.66175  -21.49168 1.000 47.57461  ? 396 GLU A N     1 
ATOM   3141 C  CA    . GLU A 1 397 ? 45.11504 55.69042  -21.90659 1.000 46.25175  ? 396 GLU A CA    1 
ATOM   3142 C  C     . GLU A 1 397 ? 44.12728 55.14838  -22.93074 1.000 44.08789  ? 396 GLU A C     1 
ATOM   3143 O  O     . GLU A 1 397 ? 42.94863 55.51194  -22.90869 1.000 46.30055  ? 396 GLU A O     1 
ATOM   3144 C  CB    . GLU A 1 397 ? 45.84777 56.91790  -22.46169 1.000 40.43824  ? 396 GLU A CB    1 
ATOM   3145 N  N     . THR A 1 398 ? 44.58810 54.28998  -23.84362 1.000 44.33493  ? 397 THR A N     1 
ATOM   3146 C  CA    . THR A 1 398 ? 43.69034 53.70812  -24.84078 1.000 45.35331  ? 397 THR A CA    1 
ATOM   3147 C  C     . THR A 1 398 ? 42.59665 52.87887  -24.17875 1.000 50.27061  ? 397 THR A C     1 
ATOM   3148 O  O     . THR A 1 398 ? 41.40400 53.00954  -24.49815 1.000 46.08227  ? 397 THR A O     1 
ATOM   3149 C  CB    . THR A 1 398 ? 44.48150 52.83496  -25.80247 1.000 39.01270  ? 397 THR A CB    1 
ATOM   3150 O  OG1   . THR A 1 398 ? 45.62223 53.55485  -26.25592 1.000 44.76738  ? 397 THR A OG1   1 
ATOM   3151 C  CG2   . THR A 1 398 ? 43.62487 52.44539  -26.97598 1.000 40.23118  ? 397 THR A CG2   1 
ATOM   3152 N  N     . TRP A 1 399 ? 42.99748 51.99774  -23.26250 1.000 49.49218  ? 398 TRP A N     1 
ATOM   3153 C  CA    . TRP A 1 399 ? 42.02345 51.21521  -22.52751 1.000 50.76297  ? 398 TRP A CA    1 
ATOM   3154 C  C     . TRP A 1 399 ? 41.06412 52.12521  -21.78432 1.000 50.95351  ? 398 TRP A C     1 
ATOM   3155 O  O     . TRP A 1 399 ? 39.84654 51.92888  -21.82792 1.000 58.34143  ? 398 TRP A O     1 
ATOM   3156 C  CB    . TRP A 1 399 ? 42.72691 50.26761  -21.55953 1.000 51.33714  ? 398 TRP A CB    1 
ATOM   3157 C  CG    . TRP A 1 399 ? 41.74000 49.47289  -20.78979 1.000 55.11463  ? 398 TRP A CG    1 
ATOM   3158 C  CD1   . TRP A 1 399 ? 41.42722 49.60256  -19.46777 1.000 55.76221  ? 398 TRP A CD1   1 
ATOM   3159 C  CD2   . TRP A 1 399 ? 40.88346 48.45741  -21.30853 1.000 51.59262  ? 398 TRP A CD2   1 
ATOM   3160 N  NE1   . TRP A 1 399 ? 40.44528 48.70602  -19.12510 1.000 57.45984  ? 398 TRP A NE1   1 
ATOM   3161 C  CE2   . TRP A 1 399 ? 40.09501 47.98862  -20.23824 1.000 55.85134  ? 398 TRP A CE2   1 
ATOM   3162 C  CE3   . TRP A 1 399 ? 40.72550 47.87926  -22.56700 1.000 49.56485  ? 398 TRP A CE3   1 
ATOM   3163 C  CZ2   . TRP A 1 399 ? 39.15613 46.97462  -20.39155 1.000 51.84340  ? 398 TRP A CZ2   1 
ATOM   3164 C  CZ3   . TRP A 1 399 ? 39.79342 46.87397  -22.71939 1.000 52.43898  ? 398 TRP A CZ3   1 
ATOM   3165 C  CH2   . TRP A 1 399 ? 39.01770 46.43273  -21.63796 1.000 53.75437  ? 398 TRP A CH2   1 
ATOM   3166 N  N     . GLU A 1 400 ? 41.60153 53.12453  -21.08907 1.000 51.90691  ? 399 GLU A N     1 
ATOM   3167 C  CA    . GLU A 1 400 ? 40.76665 54.05557  -20.34184 1.000 51.56519  ? 399 GLU A CA    1 
ATOM   3168 C  C     . GLU A 1 400 ? 39.70964 54.68931  -21.23665 1.000 53.12770  ? 399 GLU A C     1 
ATOM   3169 O  O     . GLU A 1 400 ? 38.51792 54.70769  -20.89946 1.000 56.16600  ? 399 GLU A O     1 
ATOM   3170 C  CB    . GLU A 1 400 ? 41.65155 55.12701  -19.71062 1.000 48.27483  ? 399 GLU A CB    1 
ATOM   3171 C  CG    . GLU A 1 400 ? 40.93551 56.01406  -18.74059 1.000 55.73992  ? 399 GLU A CG    1 
ATOM   3172 C  CD    . GLU A 1 400 ? 41.06914 55.51783  -17.32816 1.000 65.87122  ? 399 GLU A CD    1 
ATOM   3173 O  OE1   . GLU A 1 400 ? 40.79799 56.31696  -16.39819 1.000 69.70922  ? 399 GLU A OE1   1 
ATOM   3174 O  OE2   . GLU A 1 400 ? 41.46151 54.33742  -17.15350 1.000 61.78623  ? 399 GLU A OE2   1 
ATOM   3175 N  N     . THR A 1 401 ? 40.14386 55.23103  -22.37889 1.000 49.92586  ? 400 THR A N     1 
ATOM   3176 C  CA    . THR A 1 401 ? 39.23166 55.86136  -23.32714 1.000 50.69383  ? 400 THR A CA    1 
ATOM   3177 C  C     . THR A 1 401 ? 38.12521 54.90190  -23.74947 1.000 56.72599  ? 400 THR A C     1 
ATOM   3178 O  O     . THR A 1 401 ? 36.93990 55.26152  -23.74185 1.000 53.98585  ? 400 THR A O     1 
ATOM   3179 C  CB    . THR A 1 401 ? 40.01667 56.33818  -24.54766 1.000 48.26076  ? 400 THR A CB    1 
ATOM   3180 O  OG1   . THR A 1 401 ? 40.99695 57.28981  -24.13090 1.000 56.41596  ? 400 THR A OG1   1 
ATOM   3181 C  CG2   . THR A 1 401 ? 39.09914 56.96343  -25.59301 1.000 39.97508  ? 400 THR A CG2   1 
ATOM   3182 N  N     . TRP A 1 402 ? 38.50301 53.67314  -24.13052 1.000 53.19548  ? 401 TRP A N     1 
ATOM   3183 C  CA    . TRP A 1 402 ? 37.52686 52.70603  -24.61966 1.000 48.01767  ? 401 TRP A CA    1 
ATOM   3184 C  C     . TRP A 1 402 ? 36.51341 52.35621  -23.54490 1.000 49.46292  ? 401 TRP A C     1 
ATOM   3185 O  O     . TRP A 1 402 ? 35.30792 52.28370  -23.81353 1.000 45.19562  ? 401 TRP A O     1 
ATOM   3186 C  CB    . TRP A 1 402 ? 38.24507 51.44895  -25.09616 1.000 48.58988  ? 401 TRP A CB    1 
ATOM   3187 C  CG    . TRP A 1 402 ? 37.32846 50.30793  -25.40921 1.000 51.41796  ? 401 TRP A CG    1 
ATOM   3188 C  CD1   . TRP A 1 402 ? 37.21603 49.12760  -24.72518 1.000 45.17650  ? 401 TRP A CD1   1 
ATOM   3189 C  CD2   . TRP A 1 402 ? 36.38908 50.23608  -26.49180 1.000 50.57367  ? 401 TRP A CD2   1 
ATOM   3190 N  NE1   . TRP A 1 402 ? 36.27124 48.32982  -25.32132 1.000 42.39097  ? 401 TRP A NE1   1 
ATOM   3191 C  CE2   . TRP A 1 402 ? 35.74464 48.98431  -26.40196 1.000 45.71864  ? 401 TRP A CE2   1 
ATOM   3192 C  CE3   . TRP A 1 402 ? 36.03119 51.10887  -27.52823 1.000 45.73209  ? 401 TRP A CE3   1 
ATOM   3193 C  CZ2   . TRP A 1 402 ? 34.76257 48.58458  -27.30795 1.000 49.14983  ? 401 TRP A CZ2   1 
ATOM   3194 C  CZ3   . TRP A 1 402 ? 35.05583 50.71043  -28.42716 1.000 43.58434  ? 401 TRP A CZ3   1 
ATOM   3195 C  CH2   . TRP A 1 402 ? 34.42948 49.46336  -28.31044 1.000 44.88191  ? 401 TRP A CH2   1 
ATOM   3196 N  N     . TRP A 1 403 ? 36.98972 52.15553  -22.31606 1.000 48.34079  ? 402 TRP A N     1 
ATOM   3197 C  CA    . TRP A 1 403 ? 36.12135 51.77519  -21.20660 1.000 53.30977  ? 402 TRP A CA    1 
ATOM   3198 C  C     . TRP A 1 403 ? 35.20619 52.92194  -20.78913 1.000 59.71752  ? 402 TRP A C     1 
ATOM   3199 O  O     . TRP A 1 403 ? 34.11470 52.68967  -20.26020 1.000 61.02361  ? 402 TRP A O     1 
ATOM   3200 C  CB    . TRP A 1 403 ? 36.99224 51.29471  -20.04628 1.000 54.45499  ? 402 TRP A CB    1 
ATOM   3201 C  CG    . TRP A 1 403 ? 36.38051 51.37415  -18.69830 1.000 61.35097  ? 402 TRP A CG    1 
ATOM   3202 C  CD1   . TRP A 1 403 ? 35.74570 50.37336  -18.02233 1.000 60.60985  ? 402 TRP A CD1   1 
ATOM   3203 C  CD2   . TRP A 1 403 ? 36.36820 52.51326  -17.83609 1.000 63.17843  ? 402 TRP A CD2   1 
ATOM   3204 N  NE1   . TRP A 1 403 ? 35.33060 50.82392  -16.79517 1.000 60.44976  ? 402 TRP A NE1   1 
ATOM   3205 C  CE2   . TRP A 1 403 ? 35.70128 52.13508  -16.65638 1.000 61.19951  ? 402 TRP A CE2   1 
ATOM   3206 C  CE3   . TRP A 1 403 ? 36.84989 53.82380  -17.95217 1.000 64.66981  ? 402 TRP A CE3   1 
ATOM   3207 C  CZ2   . TRP A 1 403 ? 35.50095 53.01630  -15.59946 1.000 68.00639  ? 402 TRP A CZ2   1 
ATOM   3208 C  CZ3   . TRP A 1 403 ? 36.65863 54.69753  -16.89610 1.000 65.91774  ? 402 TRP A CZ3   1 
ATOM   3209 C  CH2   . TRP A 1 403 ? 35.98770 54.29001  -15.73426 1.000 70.11166  ? 402 TRP A CH2   1 
ATOM   3210 N  N     . THR A 1 404 ? 35.63326 54.16105  -21.01175 1.000 60.65411  ? 403 THR A N     1 
ATOM   3211 C  CA    . THR A 1 404 ? 34.72168 55.28667  -20.86924 1.000 58.65397  ? 403 THR A CA    1 
ATOM   3212 C  C     . THR A 1 404 ? 33.65342 55.26170  -21.95893 1.000 58.58303  ? 403 THR A C     1 
ATOM   3213 O  O     . THR A 1 404 ? 32.45302 55.25466  -21.66543 1.000 61.88989  ? 403 THR A O     1 
ATOM   3214 C  CB    . THR A 1 404 ? 35.51640 56.59740  -20.90512 1.000 63.20703  ? 403 THR A CB    1 
ATOM   3215 O  OG1   . THR A 1 404 ? 36.18949 56.79352  -19.64840 1.000 59.62525  ? 403 THR A OG1   1 
ATOM   3216 C  CG2   . THR A 1 404 ? 34.60264 57.79409  -21.21952 1.000 57.04196  ? 403 THR A CG2   1 
ATOM   3217 N  N     . GLU A 1 405 ? 34.07837 55.20642  -23.22522 1.000 58.26280  ? 404 GLU A N     1 
ATOM   3218 C  CA    . GLU A 1 405 ? 33.17700 55.37598  -24.36347 1.000 59.62357  ? 404 GLU A CA    1 
ATOM   3219 C  C     . GLU A 1 405 ? 32.24214 54.18800  -24.59053 1.000 60.51103  ? 404 GLU A C     1 
ATOM   3220 O  O     . GLU A 1 405 ? 31.19231 54.36257  -25.21907 1.000 60.83098  ? 404 GLU A O     1 
ATOM   3221 C  CB    . GLU A 1 405 ? 33.99039 55.63192  -25.64192 1.000 52.68404  ? 404 GLU A CB    1 
ATOM   3222 N  N     . TYR A 1 406 ? 32.59481 52.99186  -24.12230 1.000 59.41298  ? 405 TYR A N     1 
ATOM   3223 C  CA    . TYR A 1 406 ? 31.82657 51.79066  -24.43096 1.000 55.73328  ? 405 TYR A CA    1 
ATOM   3224 C  C     . TYR A 1 406 ? 30.68576 51.64046  -23.44232 1.000 53.75205  ? 405 TYR A C     1 
ATOM   3225 O  O     . TYR A 1 406 ? 30.89181 51.75432  -22.23466 1.000 54.15020  ? 405 TYR A O     1 
ATOM   3226 C  CB    . TYR A 1 406 ? 32.70580 50.54294  -24.38240 1.000 53.79270  ? 405 TYR A CB    1 
ATOM   3227 C  CG    . TYR A 1 406 ? 32.14193 49.39573  -25.17977 1.000 54.57537  ? 405 TYR A CG    1 
ATOM   3228 C  CD1   . TYR A 1 406 ? 31.35080 49.63390  -26.29436 1.000 58.99943  ? 405 TYR A CD1   1 
ATOM   3229 C  CD2   . TYR A 1 406 ? 32.38178 48.07436  -24.81210 1.000 54.63871  ? 405 TYR A CD2   1 
ATOM   3230 C  CE1   . TYR A 1 406 ? 30.82555 48.58989  -27.03551 1.000 59.33137  ? 405 TYR A CE1   1 
ATOM   3231 C  CE2   . TYR A 1 406 ? 31.85569 47.01925  -25.54612 1.000 54.39382  ? 405 TYR A CE2   1 
ATOM   3232 C  CZ    . TYR A 1 406 ? 31.07849 47.28649  -26.65792 1.000 56.67978  ? 405 TYR A CZ    1 
ATOM   3233 O  OH    . TYR A 1 406 ? 30.54453 46.25883  -27.40581 1.000 59.28090  ? 405 TYR A OH    1 
ATOM   3234 N  N     . TRP A 1 407 ? 29.49242 51.36175  -23.95337 1.000 55.53174  ? 406 TRP A N     1 
ATOM   3235 C  CA    . TRP A 1 407 ? 28.33546 51.22760  -23.08382 1.000 56.02630  ? 406 TRP A CA    1 
ATOM   3236 C  C     . TRP A 1 407 ? 28.26794 49.87690  -22.37557 1.000 58.06686  ? 406 TRP A C     1 
ATOM   3237 O  O     . TRP A 1 407 ? 27.43773 49.71726  -21.47701 1.000 58.68601  ? 406 TRP A O     1 
ATOM   3238 C  CB    . TRP A 1 407 ? 27.04752 51.45367  -23.88119 1.000 64.58225  ? 406 TRP A CB    1 
ATOM   3239 C  CG    . TRP A 1 407 ? 26.88975 50.50716  -25.04657 1.000 70.18100  ? 406 TRP A CG    1 
ATOM   3240 C  CD1   . TRP A 1 407 ? 26.47185 49.21076  -24.99587 1.000 67.27566  ? 406 TRP A CD1   1 
ATOM   3241 C  CD2   . TRP A 1 407 ? 27.15770 50.78794  -26.43193 1.000 76.04660  ? 406 TRP A CD2   1 
ATOM   3242 N  NE1   . TRP A 1 407 ? 26.46825 48.66237  -26.25388 1.000 72.55396  ? 406 TRP A NE1   1 
ATOM   3243 C  CE2   . TRP A 1 407 ? 26.88081 49.60840  -27.15592 1.000 70.62271  ? 406 TRP A CE2   1 
ATOM   3244 C  CE3   . TRP A 1 407 ? 27.61634 51.91866  -27.12833 1.000 70.95076  ? 406 TRP A CE3   1 
ATOM   3245 C  CZ2   . TRP A 1 407 ? 27.04077 49.52384  -28.54521 1.000 69.80516  ? 406 TRP A CZ2   1 
ATOM   3246 C  CZ3   . TRP A 1 407 ? 27.77361 51.83104  -28.51269 1.000 66.10181  ? 406 TRP A CZ3   1 
ATOM   3247 C  CH2   . TRP A 1 407 ? 27.48188 50.64261  -29.20406 1.000 63.01484  ? 406 TRP A CH2   1 
ATOM   3248 N  N     . GLN A 1 408 ? 29.10459 48.90594  -22.73329 1.000 54.33812  ? 407 GLN A N     1 
ATOM   3249 C  CA    . GLN A 1 408 ? 29.02283 47.60877  -22.08108 1.000 52.02746  ? 407 GLN A CA    1 
ATOM   3250 C  C     . GLN A 1 408 ? 29.98918 47.51659  -20.90530 1.000 52.39815  ? 407 GLN A C     1 
ATOM   3251 O  O     . GLN A 1 408 ? 30.95891 48.26973  -20.78945 1.000 48.83150  ? 407 GLN A O     1 
ATOM   3252 C  CB    . GLN A 1 408 ? 29.32518 46.47298  -23.05415 1.000 53.77590  ? 407 GLN A CB    1 
ATOM   3253 C  CG    . GLN A 1 408 ? 28.35233 46.34563  -24.19406 1.000 62.27320  ? 407 GLN A CG    1 
ATOM   3254 C  CD    . GLN A 1 408 ? 28.04172 44.89065  -24.53081 1.000 69.18216  ? 407 GLN A CD    1 
ATOM   3255 O  OE1   . GLN A 1 408 ? 28.90083 44.14015  -25.02754 1.000 57.69324  ? 407 GLN A OE1   1 
ATOM   3256 N  NE2   . GLN A 1 408 ? 26.80011 44.48415  -24.25987 1.000 69.87412  ? 407 GLN A NE2   1 
ATOM   3257 N  N     . ALA A 1 409 ? 29.71149 46.56395  -20.02547 1.000 53.62796  ? 408 ALA A N     1 
ATOM   3258 C  CA    . ALA A 1 409 ? 30.68663 46.18383  -19.01631 1.000 52.56613  ? 408 ALA A CA    1 
ATOM   3259 C  C     . ALA A 1 409 ? 31.83068 45.45398  -19.69720 1.000 51.41005  ? 408 ALA A C     1 
ATOM   3260 O  O     . ALA A 1 409 ? 31.60414 44.47816  -20.41798 1.000 56.08403  ? 408 ALA A O     1 
ATOM   3261 C  CB    . ALA A 1 409 ? 30.04331 45.29687  -17.95426 1.000 48.38741  ? 408 ALA A CB    1 
ATOM   3262 N  N     . THR A 1 410 ? 33.04984 45.93611  -19.49907 1.000 46.18398  ? 409 THR A N     1 
ATOM   3263 C  CA    . THR A 1 410 ? 34.22648 45.26188  -20.01649 1.000 49.79013  ? 409 THR A CA    1 
ATOM   3264 C  C     . THR A 1 410 ? 35.34810 45.44749  -19.01139 1.000 50.39728  ? 409 THR A C     1 
ATOM   3265 O  O     . THR A 1 410 ? 35.38976 46.45082  -18.29477 1.000 53.44976  ? 409 THR A O     1 
ATOM   3266 C  CB    . THR A 1 410 ? 34.61985 45.78991  -21.41371 1.000 53.41790  ? 409 THR A CB    1 
ATOM   3267 O  OG1   . THR A 1 410 ? 35.54298 44.88030  -22.03461 1.000 60.62104  ? 409 THR A OG1   1 
ATOM   3268 C  CG2   . THR A 1 410 ? 35.25781 47.15675  -21.32341 1.000 49.63833  ? 409 THR A CG2   1 
ATOM   3269 N  N     . TRP A 1 411 ? 36.23792 44.45991  -18.93304 1.000 48.18114  ? 410 TRP A N     1 
ATOM   3270 C  CA    . TRP A 1 411 ? 37.26425 44.50492  -17.89990 1.000 50.71988  ? 410 TRP A CA    1 
ATOM   3271 C  C     . TRP A 1 411 ? 38.42838 43.58871  -18.25421 1.000 50.17046  ? 410 TRP A C     1 
ATOM   3272 O  O     . TRP A 1 411 ? 38.26024 42.56958  -18.92574 1.000 59.12410  ? 410 TRP A O     1 
ATOM   3273 C  CB    . TRP A 1 411 ? 36.68780 44.12819  -16.52712 1.000 52.42628  ? 410 TRP A CB    1 
ATOM   3274 C  CG    . TRP A 1 411 ? 37.69302 44.25292  -15.42042 1.000 56.81944  ? 410 TRP A CG    1 
ATOM   3275 C  CD1   . TRP A 1 411 ? 38.20496 45.41609  -14.89018 1.000 57.42452  ? 410 TRP A CD1   1 
ATOM   3276 C  CD2   . TRP A 1 411 ? 38.32482 43.18154  -14.71694 1.000 52.69201  ? 410 TRP A CD2   1 
ATOM   3277 N  NE1   . TRP A 1 411 ? 39.11340 45.12345  -13.90061 1.000 53.07782  ? 410 TRP A NE1   1 
ATOM   3278 C  CE2   . TRP A 1 411 ? 39.20640 43.76038  -13.77535 1.000 53.29581  ? 410 TRP A CE2   1 
ATOM   3279 C  CE3   . TRP A 1 411 ? 38.23432 41.78896  -14.79071 1.000 52.80058  ? 410 TRP A CE3   1 
ATOM   3280 C  CZ2   . TRP A 1 411 ? 39.98133 42.99279  -12.91420 1.000 51.63226  ? 410 TRP A CZ2   1 
ATOM   3281 C  CZ3   . TRP A 1 411 ? 39.00789 41.02777  -13.93221 1.000 53.24099  ? 410 TRP A CZ3   1 
ATOM   3282 C  CH2   . TRP A 1 411 ? 39.86877 41.63069  -13.00732 1.000 53.68663  ? 410 TRP A CH2   1 
ATOM   3283 N  N     . ILE A 1 412 ? 39.60911 43.96200  -17.77665 1.000 50.00763  ? 411 ILE A N     1 
ATOM   3284 C  CA    . ILE A 1 412 ? 40.83914 43.21490  -18.01809 1.000 49.35314  ? 411 ILE A CA    1 
ATOM   3285 C  C     . ILE A 1 412 ? 41.63447 43.15114  -16.71893 1.000 51.81154  ? 411 ILE A C     1 
ATOM   3286 O  O     . ILE A 1 412 ? 41.87190 44.19109  -16.08723 1.000 53.43699  ? 411 ILE A O     1 
ATOM   3287 C  CB    . ILE A 1 412 ? 41.66590 43.85920  -19.13823 1.000 51.49644  ? 411 ILE A CB    1 
ATOM   3288 C  CG1   . ILE A 1 412 ? 40.99345 43.66418  -20.48730 1.000 49.81219  ? 411 ILE A CG1   1 
ATOM   3289 C  CG2   . ILE A 1 412 ? 43.07050 43.28591  -19.17509 1.000 55.91841  ? 411 ILE A CG2   1 
ATOM   3290 C  CD1   . ILE A 1 412 ? 41.85228 44.16430  -21.63104 1.000 53.81839  ? 411 ILE A CD1   1 
ATOM   3291 N  N     . PRO A 1 413 ? 42.08818 41.96771  -16.29543 1.000 54.05755  ? 412 PRO A N     1 
ATOM   3292 C  CA    . PRO A 1 413 ? 42.75317 41.84890  -14.99039 1.000 49.34525  ? 412 PRO A CA    1 
ATOM   3293 C  C     . PRO A 1 413 ? 44.09998 42.54370  -14.96807 1.000 56.96886  ? 412 PRO A C     1 
ATOM   3294 O  O     . PRO A 1 413 ? 44.44715 43.23558  -15.93258 1.000 57.99229  ? 412 PRO A O     1 
ATOM   3295 C  CB    . PRO A 1 413 ? 42.89344 40.33979  -14.80656 1.000 50.99615  ? 412 PRO A CB    1 
ATOM   3296 C  CG    . PRO A 1 413 ? 42.91901 39.79449  -16.21261 1.000 53.76224  ? 412 PRO A CG    1 
ATOM   3297 C  CD    . PRO A 1 413 ? 42.01348 40.67780  -17.00689 1.000 56.67377  ? 412 PRO A CD    1 
ATOM   3298 N  N     . GLU A 1 414 ? 44.83959 42.40112  -13.86252 1.000 58.25461  ? 413 GLU A N     1 
ATOM   3299 C  CA    . GLU A 1 414 ? 46.09211 43.12931  -13.67041 1.000 55.39951  ? 413 GLU A CA    1 
ATOM   3300 C  C     . GLU A 1 414 ? 46.99375 42.98094  -14.88483 1.000 54.95754  ? 413 GLU A C     1 
ATOM   3301 O  O     . GLU A 1 414 ? 47.32395 41.85613  -15.29327 1.000 52.48965  ? 413 GLU A O     1 
ATOM   3302 C  CB    . GLU A 1 414 ? 46.81013 42.63003  -12.41240 1.000 55.00963  ? 413 GLU A CB    1 
ATOM   3303 C  CG    . GLU A 1 414 ? 48.34355 42.68644  -12.52494 1.000 66.29717  ? 413 GLU A CG    1 
ATOM   3304 C  CD    . GLU A 1 414 ? 49.05189 42.70833  -11.17726 1.000 74.88890  ? 413 GLU A CD    1 
ATOM   3305 O  OE1   . GLU A 1 414 ? 49.90898 43.60512  -10.97669 1.000 69.94793  ? 413 GLU A OE1   1 
ATOM   3306 O  OE2   . GLU A 1 414 ? 48.74694 41.83425  -10.32699 1.000 75.14787  ? 413 GLU A OE2   1 
ATOM   3307 N  N     . TRP A 1 415 ? 47.37177 44.11832  -15.47611 1.000 49.17896  ? 414 TRP A N     1 
ATOM   3308 C  CA    . TRP A 1 415 ? 48.16123 44.08784  -16.70027 1.000 47.99359  ? 414 TRP A CA    1 
ATOM   3309 C  C     . TRP A 1 415 ? 49.09119 45.29039  -16.77394 1.000 46.65567  ? 414 TRP A C     1 
ATOM   3310 O  O     . TRP A 1 415 ? 49.02558 46.21407  -15.96226 1.000 49.28530  ? 414 TRP A O     1 
ATOM   3311 C  CB    . TRP A 1 415 ? 47.26353 44.02878  -17.92974 1.000 48.32115  ? 414 TRP A CB    1 
ATOM   3312 C  CG    . TRP A 1 415 ? 46.43575 45.24369  -18.12225 1.000 51.50677  ? 414 TRP A CG    1 
ATOM   3313 C  CD1   . TRP A 1 415 ? 45.28184 45.56608  -17.47170 1.000 52.14546  ? 414 TRP A CD1   1 
ATOM   3314 C  CD2   . TRP A 1 415 ? 46.68663 46.30025  -19.04621 1.000 45.97110  ? 414 TRP A CD2   1 
ATOM   3315 N  NE1   . TRP A 1 415 ? 44.80005 46.76761  -17.93308 1.000 50.53809  ? 414 TRP A NE1   1 
ATOM   3316 C  CE2   . TRP A 1 415 ? 45.64598 47.23856  -18.90016 1.000 48.28426  ? 414 TRP A CE2   1 
ATOM   3317 C  CE3   . TRP A 1 415 ? 47.68648 46.54105  -19.98351 1.000 40.80476  ? 414 TRP A CE3   1 
ATOM   3318 C  CZ2   . TRP A 1 415 ? 45.57597 48.39420  -19.65845 1.000 46.26289  ? 414 TRP A CZ2   1 
ATOM   3319 C  CZ3   . TRP A 1 415 ? 47.61867 47.68104  -20.72788 1.000 47.24949  ? 414 TRP A CZ3   1 
ATOM   3320 C  CH2   . TRP A 1 415 ? 46.56761 48.59773  -20.56896 1.000 48.27641  ? 414 TRP A CH2   1 
ATOM   3321 N  N     . GLU A 1 416 ? 49.95698 45.26320  -17.78061 1.000 45.59765  ? 415 GLU A N     1 
ATOM   3322 C  CA    . GLU A 1 416 ? 51.04006 46.22100  -17.92717 1.000 45.43300  ? 415 GLU A CA    1 
ATOM   3323 C  C     . GLU A 1 416 ? 51.32087 46.41932  -19.41029 1.000 43.67371  ? 415 GLU A C     1 
ATOM   3324 O  O     . GLU A 1 416 ? 51.25833 45.47029  -20.19144 1.000 48.02887  ? 415 GLU A O     1 
ATOM   3325 C  CB    . GLU A 1 416 ? 52.28591 45.72299  -17.18772 1.000 51.64271  ? 415 GLU A CB    1 
ATOM   3326 C  CG    . GLU A 1 416 ? 53.57561 46.44638  -17.50442 1.000 57.27861  ? 415 GLU A CG    1 
ATOM   3327 C  CD    . GLU A 1 416 ? 54.79316 45.65731  -17.06145 1.000 65.94123  ? 415 GLU A CD    1 
ATOM   3328 O  OE1   . GLU A 1 416 ? 55.66352 45.36709  -17.91621 1.000 64.29288  ? 415 GLU A OE1   1 
ATOM   3329 O  OE2   . GLU A 1 416 ? 54.86860 45.31281  -15.86006 1.000 75.31693  ? 415 GLU A OE2   1 
ATOM   3330 N  N     . PHE A 1 417 ? 51.61625 47.65416  -19.79734 1.000 50.21086  ? 416 PHE A N     1 
ATOM   3331 C  CA    . PHE A 1 417 ? 51.82839 47.97677  -21.20311 1.000 48.13036  ? 416 PHE A CA    1 
ATOM   3332 C  C     . PHE A 1 417 ? 53.18396 47.46434  -21.67226 1.000 49.40268  ? 416 PHE A C     1 
ATOM   3333 O  O     . PHE A 1 417 ? 54.20314 47.66387  -21.00527 1.000 49.20727  ? 416 PHE A O     1 
ATOM   3334 C  CB    . PHE A 1 417 ? 51.72574 49.48329  -21.41856 1.000 45.58578  ? 416 PHE A CB    1 
ATOM   3335 C  CG    . PHE A 1 417 ? 52.25885 49.94836  -22.74182 1.000 49.18370  ? 416 PHE A CG    1 
ATOM   3336 C  CD1   . PHE A 1 417 ? 51.77609 49.41923  -23.92882 1.000 53.46288  ? 416 PHE A CD1   1 
ATOM   3337 C  CD2   . PHE A 1 417 ? 53.22005 50.94273  -22.80400 1.000 49.19330  ? 416 PHE A CD2   1 
ATOM   3338 C  CE1   . PHE A 1 417 ? 52.26331 49.85141  -25.15697 1.000 51.94336  ? 416 PHE A CE1   1 
ATOM   3339 C  CE2   . PHE A 1 417 ? 53.70855 51.37966  -24.02330 1.000 54.90843  ? 416 PHE A CE2   1 
ATOM   3340 C  CZ    . PHE A 1 417 ? 53.22710 50.83433  -25.20158 1.000 57.79462  ? 416 PHE A CZ    1 
ATOM   3341 N  N     . VAL A 1 418 ? 53.18763 46.78489  -22.81179 1.000 49.46668  ? 417 VAL A N     1 
ATOM   3342 C  CA    . VAL A 1 418 ? 54.40364 46.28390  -23.43569 1.000 52.06489  ? 417 VAL A CA    1 
ATOM   3343 C  C     . VAL A 1 418 ? 54.55924 46.96830  -24.78465 1.000 55.82067  ? 417 VAL A C     1 
ATOM   3344 O  O     . VAL A 1 418 ? 53.63753 46.95296  -25.60833 1.000 57.08041  ? 417 VAL A O     1 
ATOM   3345 C  CB    . VAL A 1 418 ? 54.38205 44.75091  -23.57235 1.000 47.91883  ? 417 VAL A CB    1 
ATOM   3346 C  CG1   . VAL A 1 418 ? 55.20920 44.29699  -24.73297 1.000 52.41418  ? 417 VAL A CG1   1 
ATOM   3347 C  CG2   . VAL A 1 418 ? 54.97176 44.15786  -22.33640 1.000 57.48617  ? 417 VAL A CG2   1 
ATOM   3348 N  N     . ASN A 1 419 ? 55.74115 47.52849  -25.02485 1.000 56.08562  ? 418 ASN A N     1 
ATOM   3349 C  CA    . ASN A 1 419 ? 55.97068 48.44504  -26.13153 1.000 60.43091  ? 418 ASN A CA    1 
ATOM   3350 C  C     . ASN A 1 419 ? 56.39107 47.73296  -27.41655 1.000 62.06302  ? 418 ASN A C     1 
ATOM   3351 O  O     . ASN A 1 419 ? 57.20694 48.27164  -28.17487 1.000 63.67679  ? 418 ASN A O     1 
ATOM   3352 C  CB    . ASN A 1 419 ? 57.01484 49.48716  -25.72629 1.000 70.99392  ? 418 ASN A CB    1 
ATOM   3353 C  CG    . ASN A 1 419 ? 56.87148 50.79505  -26.49809 1.000 80.59150  ? 418 ASN A CG    1 
ATOM   3354 O  OD1   . ASN A 1 419 ? 56.46039 50.79990  -27.66478 1.000 73.89613  ? 418 ASN A OD1   1 
ATOM   3355 N  ND2   . ASN A 1 419 ? 57.20898 51.91528  -25.84498 1.000 77.87111  ? 418 ASN A ND2   1 
ATOM   3356 N  N     . THR A 1 420 ? 55.88278 46.51974  -27.67033 1.000 55.86588  ? 419 THR A N     1 
ATOM   3357 C  CA    . THR A 1 420 ? 56.24490 45.78534  -28.87696 1.000 59.46626  ? 419 THR A CA    1 
ATOM   3358 C  C     . THR A 1 420 ? 55.15201 45.91569  -29.93679 1.000 56.90216  ? 419 THR A C     1 
ATOM   3359 O  O     . THR A 1 420 ? 54.12500 45.22391  -29.85227 1.000 56.07373  ? 419 THR A O     1 
ATOM   3360 C  CB    . THR A 1 420 ? 56.50997 44.30808  -28.56110 1.000 61.06100  ? 419 THR A CB    1 
ATOM   3361 O  OG1   . THR A 1 420 ? 55.28419 43.63641  -28.22858 1.000 54.10607  ? 419 THR A OG1   1 
ATOM   3362 C  CG2   . THR A 1 420 ? 57.50332 44.17916  -27.41097 1.000 64.62708  ? 419 THR A CG2   1 
ATOM   3363 N  N     . PRO A 1 421 ? 55.34126 46.74077  -30.96418 1.000 57.86454  ? 420 PRO A N     1 
ATOM   3364 C  CA    . PRO A 1 421 ? 54.27844 46.97857  -31.96108 1.000 53.21004  ? 420 PRO A CA    1 
ATOM   3365 C  C     . PRO A 1 421 ? 53.97845 45.72907  -32.76942 1.000 48.18845  ? 420 PRO A C     1 
ATOM   3366 O  O     . PRO A 1 421 ? 54.75746 44.76427  -32.74699 1.000 52.87226  ? 420 PRO A O     1 
ATOM   3367 C  CB    . PRO A 1 421 ? 54.87706 48.08284  -32.84823 1.000 51.78384  ? 420 PRO A CB    1 
ATOM   3368 C  CG    . PRO A 1 421 ? 56.34441 47.88373  -32.73707 1.000 58.14443  ? 420 PRO A CG    1 
ATOM   3369 C  CD    . PRO A 1 421 ? 56.59167 47.43919  -31.31375 1.000 60.46763  ? 420 PRO A CD    1 
ATOM   3370 N  N     . PRO A 1 422 ? 52.85813 45.70252  -33.51285 1.000 46.38289  ? 421 PRO A N     1 
ATOM   3371 C  CA    . PRO A 1 422 ? 51.78677 46.70603  -33.66366 1.000 48.48587  ? 421 PRO A CA    1 
ATOM   3372 C  C     . PRO A 1 422 ? 50.96815 46.97297  -32.40436 1.000 45.64488  ? 421 PRO A C     1 
ATOM   3373 O  O     . PRO A 1 422 ? 50.28276 46.06754  -31.95735 1.000 52.55502  ? 421 PRO A O     1 
ATOM   3374 C  CB    . PRO A 1 422 ? 50.87927 46.09176  -34.73388 1.000 47.61566  ? 421 PRO A CB    1 
ATOM   3375 C  CG    . PRO A 1 422 ? 51.74405 45.14235  -35.46869 1.000 51.50420  ? 421 PRO A CG    1 
ATOM   3376 C  CD    . PRO A 1 422 ? 52.69493 44.58911  -34.45894 1.000 45.73574  ? 421 PRO A CD    1 
ATOM   3377 N  N     . LEU A 1 423 ? 51.02565 48.18615  -31.85968 1.000 43.86360  ? 422 LEU A N     1 
ATOM   3378 C  CA    . LEU A 1 423 ? 50.19075 48.53578  -30.71720 1.000 49.00794  ? 422 LEU A CA    1 
ATOM   3379 C  C     . LEU A 1 423 ? 48.70998 48.54941  -31.09334 1.000 48.85185  ? 422 LEU A C     1 
ATOM   3380 O  O     . LEU A 1 423 ? 48.33090 48.85610  -32.22677 1.000 49.76879  ? 422 LEU A O     1 
ATOM   3381 C  CB    . LEU A 1 423 ? 50.57388 49.90335  -30.16050 1.000 44.91867  ? 422 LEU A CB    1 
ATOM   3382 C  CG    . LEU A 1 423 ? 52.04289 50.11548  -29.84279 1.000 43.41262  ? 422 LEU A CG    1 
ATOM   3383 C  CD1   . LEU A 1 423 ? 52.19795 51.35922  -29.01452 1.000 42.15448  ? 422 LEU A CD1   1 
ATOM   3384 C  CD2   . LEU A 1 423 ? 52.58471 48.91076  -29.11397 1.000 53.43901  ? 422 LEU A CD2   1 
ATOM   3385 N  N     . VAL A 1 424 ? 47.87144 48.21595  -30.11915 1.000 47.54067  ? 423 VAL A N     1 
ATOM   3386 C  CA    . VAL A 1 424 ? 46.42676 48.24381  -30.30908 1.000 50.54202  ? 423 VAL A CA    1 
ATOM   3387 C  C     . VAL A 1 424 ? 45.94092 49.65793  -30.05380 1.000 43.90025  ? 423 VAL A C     1 
ATOM   3388 O  O     . VAL A 1 424 ? 46.24509 50.25015  -29.01503 1.000 50.20492  ? 423 VAL A O     1 
ATOM   3389 C  CB    . VAL A 1 424 ? 45.73030 47.24085  -29.37276 1.000 49.08970  ? 423 VAL A CB    1 
ATOM   3390 C  CG1   . VAL A 1 424 ? 44.22935 47.37709  -29.47492 1.000 48.82376  ? 423 VAL A CG1   1 
ATOM   3391 C  CG2   . VAL A 1 424 ? 46.13444 45.82363  -29.71785 1.000 47.58901  ? 423 VAL A CG2   1 
ATOM   3392 N  N     . LYS A 1 425 ? 45.18419 50.20767  -30.99074 1.000 45.53197  ? 424 LYS A N     1 
ATOM   3393 C  CA    . LYS A 1 425 ? 44.68684 51.56508  -30.82619 1.000 49.28372  ? 424 LYS A CA    1 
ATOM   3394 C  C     . LYS A 1 425 ? 43.23582 51.63335  -31.28270 1.000 47.27104  ? 424 LYS A C     1 
ATOM   3395 O  O     . LYS A 1 425 ? 42.72549 50.73152  -31.94712 1.000 47.67972  ? 424 LYS A O     1 
ATOM   3396 C  CB    . LYS A 1 425 ? 45.55673 52.57316  -31.60069 1.000 48.30503  ? 424 LYS A CB    1 
ATOM   3397 C  CG    . LYS A 1 425 ? 45.64560 52.29185  -33.10120 1.000 56.35753  ? 424 LYS A CG    1 
ATOM   3398 C  CD    . LYS A 1 425 ? 46.55063 53.28347  -33.82052 1.000 63.26874  ? 424 LYS A CD    1 
ATOM   3399 C  CE    . LYS A 1 425 ? 45.79768 54.56795  -34.16824 1.000 73.25055  ? 424 LYS A CE    1 
ATOM   3400 N  NZ    . LYS A 1 425 ? 46.71791 55.69767  -34.53795 1.000 85.52202  ? 424 LYS A NZ    1 
ATOM   3401 N  N     . LEU A 1 426 ? 42.56672 52.71410  -30.89994 1.000 48.36942  ? 425 LEU A N     1 
ATOM   3402 C  CA    . LEU A 1 426 ? 41.32397 53.12098  -31.53539 1.000 43.89293  ? 425 LEU A CA    1 
ATOM   3403 C  C     . LEU A 1 426 ? 41.66208 54.01216  -32.72264 1.000 43.67888  ? 425 LEU A C     1 
ATOM   3404 O  O     . LEU A 1 426 ? 42.49309 54.91680  -32.61011 1.000 48.77801  ? 425 LEU A O     1 
ATOM   3405 C  CB    . LEU A 1 426 ? 40.42840 53.85380  -30.54301 1.000 50.32399  ? 425 LEU A CB    1 
ATOM   3406 C  CG    . LEU A 1 426 ? 40.16624 53.07280  -29.25969 1.000 50.65376  ? 425 LEU A CG    1 
ATOM   3407 C  CD1   . LEU A 1 426 ? 39.69382 54.00116  -28.14354 1.000 51.76705  ? 425 LEU A CD1   1 
ATOM   3408 C  CD2   . LEU A 1 426 ? 39.15876 51.98657  -29.53755 1.000 44.87363  ? 425 LEU A CD2   1 
ATOM   3409 N  N     . TRP A 1 427 ? 41.04465 53.73547  -33.86334 1.000 45.62150  ? 426 TRP A N     1 
ATOM   3410 C  CA    . TRP A 1 427 ? 41.42544 54.37606  -35.10956 1.000 44.76700  ? 426 TRP A CA    1 
ATOM   3411 C  C     . TRP A 1 427 ? 40.63075 55.63635  -35.38734 1.000 46.06020  ? 426 TRP A C     1 
ATOM   3412 O  O     . TRP A 1 427 ? 40.89780 56.31158  -36.38538 1.000 51.75390  ? 426 TRP A O     1 
ATOM   3413 C  CB    . TRP A 1 427 ? 41.29422 53.38613  -36.26958 1.000 47.41494  ? 426 TRP A CB    1 
ATOM   3414 C  CG    . TRP A 1 427 ? 42.33756 52.30983  -36.20067 1.000 50.09493  ? 426 TRP A CG    1 
ATOM   3415 C  CD1   . TRP A 1 427 ? 42.20452 51.07406  -35.63639 1.000 55.45762  ? 426 TRP A CD1   1 
ATOM   3416 C  CD2   . TRP A 1 427 ? 43.68814 52.38905  -36.67344 1.000 62.28647  ? 426 TRP A CD2   1 
ATOM   3417 N  NE1   . TRP A 1 427 ? 43.38557 50.36572  -35.73943 1.000 57.74560  ? 426 TRP A NE1   1 
ATOM   3418 C  CE2   . TRP A 1 427 ? 44.31199 51.15086  -36.37360 1.000 65.18957  ? 426 TRP A CE2   1 
ATOM   3419 C  CE3   . TRP A 1 427 ? 44.43108 53.37913  -37.32844 1.000 63.23194  ? 426 TRP A CE3   1 
ATOM   3420 C  CZ2   . TRP A 1 427 ? 45.63896 50.88072  -36.70810 1.000 59.62792  ? 426 TRP A CZ2   1 
ATOM   3421 C  CZ3   . TRP A 1 427 ? 45.75072 53.10963  -37.65656 1.000 71.54611  ? 426 TRP A CZ3   1 
ATOM   3422 C  CH2   . TRP A 1 427 ? 46.34023 51.86890  -37.34539 1.000 69.39677  ? 426 TRP A CH2   1 
ATOM   3423 N  N     . TYR A 1 428 ? 39.68496 55.97712  -34.52390 1.000 39.99498  ? 427 TYR A N     1 
ATOM   3424 C  CA    . TYR A 1 428 ? 38.97877 57.24179  -34.60392 1.000 36.63740  ? 427 TYR A CA    1 
ATOM   3425 C  C     . TYR A 1 428 ? 38.12756 57.36255  -33.35753 1.000 40.75131  ? 427 TYR A C     1 
ATOM   3426 O  O     . TYR A 1 428 ? 37.93502 56.39716  -32.62134 1.000 46.51068  ? 427 TYR A O     1 
ATOM   3427 C  CB    . TYR A 1 428 ? 38.12596 57.35553  -35.86003 1.000 38.96541  ? 427 TYR A CB    1 
ATOM   3428 C  CG    . TYR A 1 428 ? 37.13171 56.25726  -36.00177 1.000 43.62848  ? 427 TYR A CG    1 
ATOM   3429 C  CD1   . TYR A 1 428 ? 35.86039 56.38262  -35.47300 1.000 41.89758  ? 427 TYR A CD1   1 
ATOM   3430 C  CD2   . TYR A 1 428 ? 37.46179 55.08406  -36.67418 1.000 45.38470  ? 427 TYR A CD2   1 
ATOM   3431 C  CE1   . TYR A 1 428 ? 34.95105 55.37893  -35.59811 1.000 41.59223  ? 427 TYR A CE1   1 
ATOM   3432 C  CE2   . TYR A 1 428 ? 36.56136 54.07595  -36.80454 1.000 39.69756  ? 427 TYR A CE2   1 
ATOM   3433 C  CZ    . TYR A 1 428 ? 35.30679 54.22778  -36.26038 1.000 41.81764  ? 427 TYR A CZ    1 
ATOM   3434 O  OH    . TYR A 1 428 ? 34.39941 53.21605  -36.37781 1.000 44.05668  ? 427 TYR A OH    1 
ATOM   3435 N  N     . GLN A 1 429 ? 37.62537 58.56584  -33.12083 1.000 44.71687  ? 428 GLN A N     1 
ATOM   3436 C  CA    . GLN A 1 429 ? 36.84596 58.82929  -31.92316 1.000 47.03532  ? 428 GLN A CA    1 
ATOM   3437 C  C     . GLN A 1 429 ? 35.72176 59.78763  -32.27700 1.000 48.96277  ? 428 GLN A C     1 
ATOM   3438 O  O     . GLN A 1 429 ? 35.97827 60.88310  -32.78549 1.000 58.62860  ? 428 GLN A O     1 
ATOM   3439 C  CB    . GLN A 1 429 ? 37.73181 59.40491  -30.81620 1.000 53.34908  ? 428 GLN A CB    1 
ATOM   3440 C  CG    . GLN A 1 429 ? 36.95840 59.84598  -29.58255 1.000 68.17747  ? 428 GLN A CG    1 
ATOM   3441 C  CD    . GLN A 1 429 ? 37.19928 58.95391  -28.36901 1.000 71.51456  ? 428 GLN A CD    1 
ATOM   3442 O  OE1   . GLN A 1 429 ? 36.78197 57.78510  -28.33487 1.000 68.19427  ? 428 GLN A OE1   1 
ATOM   3443 N  NE2   . GLN A 1 429 ? 37.86726 59.51014  -27.35800 1.000 72.96278  ? 428 GLN A NE2   1 
ATOM   3444 N  N     . LEU A 1 430 ? 34.48351 59.37548  -32.02559 1.000 43.10460  ? 429 LEU A N     1 
ATOM   3445 C  CA    . LEU A 1 430 ? 33.35394 60.27267  -32.21009 1.000 44.43411  ? 429 LEU A CA    1 
ATOM   3446 C  C     . LEU A 1 430 ? 33.37861 61.39605  -31.17551 1.000 43.70073  ? 429 LEU A C     1 
ATOM   3447 O  O     . LEU A 1 430 ? 33.84018 61.22744  -30.04369 1.000 44.15052  ? 429 LEU A O     1 
ATOM   3448 C  CB    . LEU A 1 430 ? 32.04403 59.50666  -32.09999 1.000 40.71489  ? 429 LEU A CB    1 
ATOM   3449 C  CG    . LEU A 1 430 ? 32.01015 58.25932  -32.96907 1.000 42.75314  ? 429 LEU A CG    1 
ATOM   3450 C  CD1   . LEU A 1 430 ? 30.63747 57.64053  -32.90980 1.000 40.43705  ? 429 LEU A CD1   1 
ATOM   3451 C  CD2   . LEU A 1 430 ? 32.41266 58.58602  -34.39774 1.000 39.15624  ? 429 LEU A CD2   1 
ATOM   3452 N  N     . GLU A 1 431 ? 32.88890 62.55805  -31.57977 1.000 40.39191  ? 430 GLU A N     1 
ATOM   3453 C  CA    . GLU A 1 431 ? 32.75900 63.65210  -30.63750 1.000 44.00163  ? 430 GLU A CA    1 
ATOM   3454 C  C     . GLU A 1 431 ? 31.60831 63.37156  -29.68952 1.000 41.70264  ? 430 GLU A C     1 
ATOM   3455 O  O     . GLU A 1 431 ? 30.68804 62.61973  -30.00853 1.000 45.96163  ? 430 GLU A O     1 
ATOM   3456 C  CB    . GLU A 1 431 ? 32.52186 64.97771  -31.36470 1.000 43.31034  ? 430 GLU A CB    1 
ATOM   3457 C  CG    . GLU A 1 431 ? 33.69043 65.46990  -32.19009 1.000 38.30081  ? 430 GLU A CG    1 
ATOM   3458 C  CD    . GLU A 1 431 ? 34.97511 65.50499  -31.39893 1.000 46.45548  ? 430 GLU A CD    1 
ATOM   3459 O  OE1   . GLU A 1 431 ? 35.77971 64.55358  -31.53255 1.000 50.32562  ? 430 GLU A OE1   1 
ATOM   3460 O  OE2   . GLU A 1 431 ? 35.18545 66.47673  -30.64009 1.000 53.39375  ? 430 GLU A OE2   1 
ATOM   3461 N  N     . LYS A 1 432 ? 31.67850 63.97454  -28.50544 1.000 45.59000  ? 431 LYS A N     1 
ATOM   3462 C  CA    . LYS A 1 432 ? 30.56436 63.95911  -27.57155 1.000 42.99312  ? 431 LYS A CA    1 
ATOM   3463 C  C     . LYS A 1 432 ? 29.64791 65.15541  -27.73480 1.000 40.70732  ? 431 LYS A C     1 
ATOM   3464 O  O     . LYS A 1 432 ? 28.47373 65.06751  -27.38196 1.000 50.36539  ? 431 LYS A O     1 
ATOM   3465 C  CB    . LYS A 1 432 ? 31.06732 63.90569  -26.12369 1.000 51.53799  ? 431 LYS A CB    1 
ATOM   3466 C  CG    . LYS A 1 432 ? 31.71731 62.58382  -25.71245 1.000 51.88977  ? 431 LYS A CG    1 
ATOM   3467 C  CD    . LYS A 1 432 ? 32.19844 62.65029  -24.26787 1.000 65.72322  ? 431 LYS A CD    1 
ATOM   3468 C  CE    . LYS A 1 432 ? 32.96993 61.39360  -23.86707 1.000 77.15778  ? 431 LYS A CE    1 
ATOM   3469 N  NZ    . LYS A 1 432 ? 33.45690 61.42977  -22.45065 1.000 70.48758  ? 431 LYS A NZ    1 
ATOM   3470 N  N     . GLU A 1 433 ? 30.14520 66.26190  -28.24836 1.000 39.58240  ? 432 GLU A N     1 
ATOM   3471 C  CA    . GLU A 1 433 ? 29.28689 67.40117  -28.47344 1.000 37.43705  ? 432 GLU A CA    1 
ATOM   3472 C  C     . GLU A 1 433 ? 29.33750 67.78473  -29.94696 1.000 39.86913  ? 432 GLU A C     1 
ATOM   3473 O  O     . GLU A 1 433 ? 30.33312 67.50069  -30.61890 1.000 40.98204  ? 432 GLU A O     1 
ATOM   3474 C  CB    . GLU A 1 433 ? 29.71849 68.59211  -27.60780 1.000 41.91132  ? 432 GLU A CB    1 
ATOM   3475 C  CG    . GLU A 1 433 ? 29.90375 68.29641  -26.11555 1.000 41.64628  ? 432 GLU A CG    1 
ATOM   3476 C  CD    . GLU A 1 433 ? 28.58631 68.14548  -25.32853 1.000 60.72434  ? 432 GLU A CD    1 
ATOM   3477 O  OE1   . GLU A 1 433 ? 27.47300 68.15811  -25.92415 1.000 58.03949  ? 432 GLU A OE1   1 
ATOM   3478 O  OE2   . GLU A 1 433 ? 28.67529 68.00335  -24.08713 1.000 68.92575  ? 432 GLU A OE2   1 
ATOM   3479 N  N     . PRO A 1 434 ? 28.28512 68.40610  -30.48950 1.000 41.76289  ? 433 PRO A N     1 
ATOM   3480 C  CA    . PRO A 1 434 ? 28.33319 68.82496  -31.89437 1.000 40.55202  ? 433 PRO A CA    1 
ATOM   3481 C  C     . PRO A 1 434 ? 29.46473 69.81419  -32.10094 1.000 39.56241  ? 433 PRO A C     1 
ATOM   3482 O  O     . PRO A 1 434 ? 29.94167 70.44619  -31.15661 1.000 38.80419  ? 433 PRO A O     1 
ATOM   3483 C  CB    . PRO A 1 434 ? 26.96362 69.47337  -32.12630 1.000 39.09967  ? 433 PRO A CB    1 
ATOM   3484 C  CG    . PRO A 1 434 ? 26.50666 69.87321  -30.78480 1.000 36.96326  ? 433 PRO A CG    1 
ATOM   3485 C  CD    . PRO A 1 434 ? 27.02954 68.82874  -29.84794 1.000 41.04553  ? 433 PRO A CD    1 
ATOM   3486 N  N     . ILE A 1 435 ? 29.91135 69.92327  -33.34980 1.000 39.39792  ? 434 ILE A N     1 
ATOM   3487 C  CA    . ILE A 1 435 ? 31.13365 70.64419  -33.67703 1.000 38.72541  ? 434 ILE A CA    1 
ATOM   3488 C  C     . ILE A 1 435 ? 30.77361 71.97084  -34.31166 1.000 40.56764  ? 434 ILE A C     1 
ATOM   3489 O  O     . ILE A 1 435 ? 30.09468 72.01069  -35.34567 1.000 41.28914  ? 434 ILE A O     1 
ATOM   3490 C  CB    . ILE A 1 435 ? 32.03784 69.84371  -34.62003 1.000 42.83069  ? 434 ILE A CB    1 
ATOM   3491 C  CG1   . ILE A 1 435 ? 32.08370 68.36892  -34.23239 1.000 39.59542  ? 434 ILE A CG1   1 
ATOM   3492 C  CG2   . ILE A 1 435 ? 33.43396 70.42968  -34.58094 1.000 43.32377  ? 434 ILE A CG2   1 
ATOM   3493 C  CD1   . ILE A 1 435 ? 32.46519 67.49806  -35.39184 1.000 41.36509  ? 434 ILE A CD1   1 
ATOM   3494 N  N     . VAL A 1 436 ? 31.26491 73.04911  -33.70464 1.000 39.52171  ? 435 VAL A N     1 
ATOM   3495 C  CA    . VAL A 1 436 ? 31.09815 74.38270  -34.25497 1.000 35.07670  ? 435 VAL A CA    1 
ATOM   3496 C  C     . VAL A 1 436 ? 31.92248 74.50258  -35.52951 1.000 39.18912  ? 435 VAL A C     1 
ATOM   3497 O  O     . VAL A 1 436 ? 33.12034 74.17555  -35.55638 1.000 38.25806  ? 435 VAL A O     1 
ATOM   3498 C  CB    . VAL A 1 436 ? 31.51424 75.43855  -33.21938 1.000 36.74219  ? 435 VAL A CB    1 
ATOM   3499 C  CG1   . VAL A 1 436 ? 31.42309 76.85423  -33.80845 1.000 33.76351  ? 435 VAL A CG1   1 
ATOM   3500 C  CG2   . VAL A 1 436 ? 30.68636 75.30627  -31.96008 1.000 27.89754  ? 435 VAL A CG2   1 
ATOM   3501 N  N     . GLY A 1 437 ? 31.28617 74.98715  -36.59326 1.000 39.00919  ? 436 GLY A N     1 
ATOM   3502 C  CA    . GLY A 1 437 ? 31.96041 75.21306  -37.84189 1.000 33.59145  ? 436 GLY A CA    1 
ATOM   3503 C  C     . GLY A 1 437 ? 31.94540 74.05064  -38.79593 1.000 39.86034  ? 436 GLY A C     1 
ATOM   3504 O  O     . GLY A 1 437 ? 32.39330 74.20770  -39.93868 1.000 45.53303  ? 436 GLY A O     1 
ATOM   3505 N  N     . ALA A 1 438 ? 31.47062 72.88373  -38.36900 1.000 40.85162  ? 437 ALA A N     1 
ATOM   3506 C  CA    . ALA A 1 438 ? 31.31481 71.74931  -39.26439 1.000 34.54825  ? 437 ALA A CA    1 
ATOM   3507 C  C     . ALA A 1 438 ? 29.91606 71.75928  -39.85215 1.000 38.66121  ? 437 ALA A C     1 
ATOM   3508 O  O     . ALA A 1 438 ? 28.93502 72.01033  -39.14850 1.000 42.04160  ? 437 ALA A O     1 
ATOM   3509 C  CB    . ALA A 1 438 ? 31.55401 70.44266  -38.52537 1.000 39.20918  ? 437 ALA A CB    1 
ATOM   3510 N  N     . GLU A 1 439 ? 29.83340 71.50159  -41.14846 1.000 36.21292  ? 438 GLU A N     1 
ATOM   3511 C  CA    . GLU A 1 439 ? 28.54598 71.46248  -41.81422 1.000 36.42936  ? 438 GLU A CA    1 
ATOM   3512 C  C     . GLU A 1 439 ? 27.69394 70.33927  -41.22755 1.000 40.78748  ? 438 GLU A C     1 
ATOM   3513 O  O     . GLU A 1 439 ? 28.20761 69.29706  -40.80470 1.000 40.23265  ? 438 GLU A O     1 
ATOM   3514 C  CB    . GLU A 1 439 ? 28.77090 71.27363  -43.30870 1.000 38.62007  ? 438 GLU A CB    1 
ATOM   3515 C  CG    . GLU A 1 439 ? 27.55693 71.37331  -44.20530 1.000 38.33057  ? 438 GLU A CG    1 
ATOM   3516 C  CD    . GLU A 1 439 ? 27.96031 71.15589  -45.65348 1.000 43.98343  ? 438 GLU A CD    1 
ATOM   3517 O  OE1   . GLU A 1 439 ? 29.09551 70.65491  -45.86875 1.000 44.72854  ? 438 GLU A OE1   1 
ATOM   3518 O  OE2   . GLU A 1 439 ? 27.17833 71.49532  -46.56754 1.000 41.61458  ? 438 GLU A OE2   1 
ATOM   3519 N  N     . THR A 1 440 ? 26.37960 70.56668  -41.17682 1.000 40.19442  ? 439 THR A N     1 
ATOM   3520 C  CA    . THR A 1 440 ? 25.43849 69.61122  -40.59797 1.000 40.10991  ? 439 THR A CA    1 
ATOM   3521 C  C     . THR A 1 440 ? 24.66743 68.90741  -41.70879 1.000 39.79319  ? 439 THR A C     1 
ATOM   3522 O  O     . THR A 1 440 ? 23.91117 69.55408  -42.44491 1.000 37.74840  ? 439 THR A O     1 
ATOM   3523 C  CB    . THR A 1 440 ? 24.46495 70.30203  -39.63981 1.000 39.33706  ? 439 THR A CB    1 
ATOM   3524 O  OG1   . THR A 1 440 ? 25.18512 70.86590  -38.53499 1.000 35.83988  ? 439 THR A OG1   1 
ATOM   3525 C  CG2   . THR A 1 440 ? 23.40274 69.30486  -39.12575 1.000 35.02790  ? 439 THR A CG2   1 
ATOM   3526 N  N     . PHE A 1 441 ? 24.84729 67.58530  -41.80965 1.000 37.62697  ? 440 PHE A N     1 
ATOM   3527 C  CA    . PHE A 1 441 ? 24.15852 66.72896  -42.76978 1.000 36.52740  ? 440 PHE A CA    1 
ATOM   3528 C  C     . PHE A 1 441 ? 23.00387 66.01605  -42.07698 1.000 40.49492  ? 440 PHE A C     1 
ATOM   3529 O  O     . PHE A 1 441 ? 23.16487 65.51014  -40.96413 1.000 44.32019  ? 440 PHE A O     1 
ATOM   3530 C  CB    . PHE A 1 441 ? 25.10564 65.66622  -43.34095 1.000 35.67733  ? 440 PHE A CB    1 
ATOM   3531 C  CG    . PHE A 1 441 ? 26.13077 66.18379  -44.32852 1.000 37.99646  ? 440 PHE A CG    1 
ATOM   3532 C  CD1   . PHE A 1 441 ? 27.11253 67.08621  -43.94718 1.000 40.76086  ? 440 PHE A CD1   1 
ATOM   3533 C  CD2   . PHE A 1 441 ? 26.14204 65.70910  -45.63155 1.000 39.45712  ? 440 PHE A CD2   1 
ATOM   3534 C  CE1   . PHE A 1 441 ? 28.05053 67.52660  -44.85390 1.000 37.66556  ? 440 PHE A CE1   1 
ATOM   3535 C  CE2   . PHE A 1 441 ? 27.07030 66.14336  -46.53639 1.000 36.82846  ? 440 PHE A CE2   1 
ATOM   3536 C  CZ    . PHE A 1 441 ? 28.03169 67.05133  -46.14563 1.000 38.56263  ? 440 PHE A CZ    1 
ATOM   3537 N  N     . TYR A 1 442 ? 21.85065 65.95108  -42.74239 1.000 36.48422  ? 441 TYR A N     1 
ATOM   3538 C  CA    . TYR A 1 442 ? 20.70916 65.14542  -42.31864 1.000 33.04981  ? 441 TYR A CA    1 
ATOM   3539 C  C     . TYR A 1 442 ? 20.55154 64.04019  -43.35107 1.000 36.57886  ? 441 TYR A C     1 
ATOM   3540 O  O     . TYR A 1 442 ? 20.21868 64.32100  -44.50953 1.000 41.37791  ? 441 TYR A O     1 
ATOM   3541 C  CB    . TYR A 1 442 ? 19.43827 65.99394  -42.22576 1.000 37.54903  ? 441 TYR A CB    1 
ATOM   3542 C  CG    . TYR A 1 442 ? 19.49060 67.03174  -41.14576 1.000 35.85190  ? 441 TYR A CG    1 
ATOM   3543 C  CD1   . TYR A 1 442 ? 20.00392 68.28760  -41.40067 1.000 39.44354  ? 441 TYR A CD1   1 
ATOM   3544 C  CD2   . TYR A 1 442 ? 19.06841 66.74694  -39.85704 1.000 38.05488  ? 441 TYR A CD2   1 
ATOM   3545 C  CE1   . TYR A 1 442 ? 20.08429 69.23771  -40.41466 1.000 37.30606  ? 441 TYR A CE1   1 
ATOM   3546 C  CE2   . TYR A 1 442 ? 19.14889 67.69632  -38.85627 1.000 38.43444  ? 441 TYR A CE2   1 
ATOM   3547 C  CZ    . TYR A 1 442 ? 19.65909 68.94038  -39.15033 1.000 37.40954  ? 441 TYR A CZ    1 
ATOM   3548 O  OH    . TYR A 1 442 ? 19.73524 69.90559  -38.18587 1.000 45.28806  ? 441 TYR A OH    1 
ATOM   3549 N  N     . VAL A 1 443 ? 20.80284 62.79508  -42.94685 1.000 38.64288  ? 442 VAL A N     1 
ATOM   3550 C  CA    . VAL A 1 443 ? 20.84759 61.67283  -43.88042 1.000 36.56679  ? 442 VAL A CA    1 
ATOM   3551 C  C     . VAL A 1 443 ? 19.64657 60.77436  -43.65244 1.000 35.92706  ? 442 VAL A C     1 
ATOM   3552 O  O     . VAL A 1 443 ? 19.06995 60.72760  -42.56645 1.000 44.46375  ? 442 VAL A O     1 
ATOM   3553 C  CB    . VAL A 1 443 ? 22.14719 60.84547  -43.74836 1.000 39.56349  ? 442 VAL A CB    1 
ATOM   3554 C  CG1   . VAL A 1 443 ? 23.37314 61.73957  -43.85088 1.000 36.37957  ? 442 VAL A CG1   1 
ATOM   3555 C  CG2   . VAL A 1 443 ? 22.15899 60.05617  -42.44624 1.000 37.35847  ? 442 VAL A CG2   1 
ATOM   3556 N  N     . ASP A 1 444 ? 19.27045 60.04439  -44.69522 1.000 37.89315  ? 443 ASP A N     1 
ATOM   3557 C  CA    . ASP A 1 444 ? 18.25590 59.00743  -44.53961 1.000 37.63838  ? 443 ASP A CA    1 
ATOM   3558 C  C     . ASP A 1 444 ? 18.27146 58.10664  -45.76111 1.000 40.25681  ? 443 ASP A C     1 
ATOM   3559 O  O     . ASP A 1 444 ? 18.78195 58.47189  -46.82991 1.000 42.87213  ? 443 ASP A O     1 
ATOM   3560 C  CB    . ASP A 1 444 ? 16.85014 59.59271  -44.33379 1.000 44.38574  ? 443 ASP A CB    1 
ATOM   3561 C  CG    . ASP A 1 444 ? 15.86853 58.59339  -43.68864 1.000 46.70293  ? 443 ASP A CG    1 
ATOM   3562 O  OD1   . ASP A 1 444 ? 16.29250 57.50074  -43.20976 1.000 40.95318  ? 443 ASP A OD1   1 
ATOM   3563 O  OD2   . ASP A 1 444 ? 14.65685 58.92036  -43.65048 1.000 44.16308  ? 443 ASP A OD2   1 
ATOM   3564 N  N     . GLY A 1 445 ? 17.70935 56.91668  -45.57568 1.000 44.78476  ? 444 GLY A N     1 
ATOM   3565 C  CA    . GLY A 1 445 ? 17.49876 55.99020  -46.66865 1.000 43.27161  ? 444 GLY A CA    1 
ATOM   3566 C  C     . GLY A 1 445 ? 16.10935 55.39411  -46.59480 1.000 46.08629  ? 444 GLY A C     1 
ATOM   3567 O  O     . GLY A 1 445 ? 15.50954 55.29662  -45.52244 1.000 50.61137  ? 444 GLY A O     1 
ATOM   3568 N  N     . ALA A 1 446 ? 15.58947 55.01781  -47.76680 1.000 43.04875  ? 445 ALA A N     1 
ATOM   3569 C  CA    . ALA A 1 446 ? 14.33500 54.28443  -47.86982 1.000 40.05333  ? 445 ALA A CA    1 
ATOM   3570 C  C     . ALA A 1 446 ? 14.49836 53.16089  -48.88085 1.000 46.60960  ? 445 ALA A C     1 
ATOM   3571 O  O     . ALA A 1 446 ? 15.25173 53.28950  -49.84606 1.000 48.68967  ? 445 ALA A O     1 
ATOM   3572 C  CB    . ALA A 1 446 ? 13.18101 55.18503  -48.27966 1.000 45.88781  ? 445 ALA A CB    1 
ATOM   3573 N  N     . ALA A 1 447 ? 13.80318 52.04605  -48.64386 1.000 51.31850  ? 446 ALA A N     1 
ATOM   3574 C  CA    . ALA A 1 447 ? 13.86902 50.88541  -49.52529 1.000 50.10483  ? 446 ALA A CA    1 
ATOM   3575 C  C     . ALA A 1 447 ? 12.49858 50.23158  -49.62827 1.000 52.45418  ? 446 ALA A C     1 
ATOM   3576 O  O     . ALA A 1 447 ? 11.79010 50.08675  -48.63029 1.000 54.51986  ? 446 ALA A O     1 
ATOM   3577 C  CB    . ALA A 1 447 ? 14.89819 49.85486  -49.03637 1.000 47.31157  ? 446 ALA A CB    1 
ATOM   3578 N  N     . ASN A 1 448 ? 12.13671 49.83679  -50.84092 1.000 53.98476  ? 447 ASN A N     1 
ATOM   3579 C  CA    . ASN A 1 448 ? 10.86272 49.18671  -51.11249 1.000 58.58823  ? 447 ASN A CA    1 
ATOM   3580 C  C     . ASN A 1 448 ? 11.02483 47.67785  -50.95366 1.000 57.79691  ? 447 ASN A C     1 
ATOM   3581 O  O     . ASN A 1 448 ? 11.73991 47.04856  -51.73508 1.000 58.09904  ? 447 ASN A O     1 
ATOM   3582 C  CB    . ASN A 1 448 ? 10.40488 49.54074  -52.52742 1.000 62.03796  ? 447 ASN A CB    1 
ATOM   3583 C  CG    . ASN A 1 448 ? 9.09483  48.88500  -52.90235 1.000 66.34557  ? 447 ASN A CG    1 
ATOM   3584 O  OD1   . ASN A 1 448 ? 9.03187  47.66905  -53.11173 1.000 62.34020  ? 447 ASN A OD1   1 
ATOM   3585 N  ND2   . ASN A 1 448 ? 8.03820  49.69188  -53.00764 1.000 62.42333  ? 447 ASN A ND2   1 
ATOM   3586 N  N     . ARG A 1 449 ? 10.35191 47.08897  -49.96252 1.000 61.14504  ? 448 ARG A N     1 
ATOM   3587 C  CA    . ARG A 1 449 ? 10.60159 45.67729  -49.68105 1.000 64.98212  ? 448 ARG A CA    1 
ATOM   3588 C  C     . ARG A 1 449 ? 10.16810 44.76176  -50.82124 1.000 65.47689  ? 448 ARG A C     1 
ATOM   3589 O  O     . ARG A 1 449 ? 10.70826 43.65432  -50.93998 1.000 63.86391  ? 448 ARG A O     1 
ATOM   3590 C  CB    . ARG A 1 449 ? 9.92048  45.24256  -48.38062 1.000 65.54225  ? 448 ARG A CB    1 
ATOM   3591 C  CG    . ARG A 1 449 ? 8.42624  45.49966  -48.31788 1.000 83.70551  ? 448 ARG A CG    1 
ATOM   3592 C  CD    . ARG A 1 449 ? 7.82259  45.02216  -46.98374 1.000 91.33322  ? 448 ARG A CD    1 
ATOM   3593 N  NE    . ARG A 1 449 ? 8.71378  45.28351  -45.85174 1.000 85.40612  ? 448 ARG A NE    1 
ATOM   3594 C  CZ    . ARG A 1 449 ? 9.23085  44.34065  -45.06853 1.000 77.88250  ? 448 ARG A CZ    1 
ATOM   3595 N  NH1   . ARG A 1 449 ? 8.93344  43.06202  -45.26936 1.000 74.03043  ? 448 ARG A NH1   1 
ATOM   3596 N  NH2   . ARG A 1 449 ? 10.03867 44.67903  -44.07378 1.000 78.21773  ? 448 ARG A NH2   1 
ATOM   3597 N  N     . GLU A 1 450 ? 9.24176  45.20179  -51.67984 1.000 61.85034  ? 449 GLU A N     1 
ATOM   3598 C  CA    . GLU A 1 450 ? 8.78845  44.34931  -52.77669 1.000 61.01790  ? 449 GLU A CA    1 
ATOM   3599 C  C     . GLU A 1 450 ? 9.82489  44.29059  -53.89944 1.000 66.29637  ? 449 GLU A C     1 
ATOM   3600 O  O     . GLU A 1 450 ? 10.33508 43.21155  -54.23237 1.000 62.19697  ? 449 GLU A O     1 
ATOM   3601 C  CB    . GLU A 1 450 ? 7.43793  44.84395  -53.30051 1.000 59.31740  ? 449 GLU A CB    1 
ATOM   3602 N  N     . THR A 1 451 ? 10.16078 45.45410  -54.48758 1.000 65.06958  ? 450 THR A N     1 
ATOM   3603 C  CA    . THR A 1 451 ? 11.07001 45.55200  -55.63191 1.000 58.82183  ? 450 THR A CA    1 
ATOM   3604 C  C     . THR A 1 451 ? 12.53503 45.67553  -55.24548 1.000 57.89327  ? 450 THR A C     1 
ATOM   3605 O  O     . THR A 1 451 ? 13.40128 45.53088  -56.11315 1.000 59.90942  ? 450 THR A O     1 
ATOM   3606 C  CB    . THR A 1 451 ? 10.71568 46.76690  -56.49249 1.000 64.10465  ? 450 THR A CB    1 
ATOM   3607 O  OG1   . THR A 1 451 ? 10.83618 47.96101  -55.70038 1.000 64.85023  ? 450 THR A OG1   1 
ATOM   3608 C  CG2   . THR A 1 451 ? 9.30046  46.65054  -57.03161 1.000 58.48745  ? 450 THR A CG2   1 
ATOM   3609 N  N     . LYS A 1 452 ? 12.82412 45.96874  -53.97908 1.000 61.67241  ? 451 LYS A N     1 
ATOM   3610 C  CA    . LYS A 1 452 ? 14.17338 46.11274  -53.43461 1.000 60.28686  ? 451 LYS A CA    1 
ATOM   3611 C  C     . LYS A 1 452 ? 14.93935 47.28692  -54.04111 1.000 57.23726  ? 451 LYS A C     1 
ATOM   3612 O  O     . LYS A 1 452 ? 16.16236 47.35587  -53.91120 1.000 53.73546  ? 451 LYS A O     1 
ATOM   3613 C  CB    . LYS A 1 452 ? 14.97640 44.81290  -53.57638 1.000 55.88048  ? 451 LYS A CB    1 
ATOM   3614 C  CG    . LYS A 1 452 ? 14.15822 43.58176  -53.22500 1.000 61.07401  ? 451 LYS A CG    1 
ATOM   3615 C  CD    . LYS A 1 452 ? 14.70158 42.79871  -52.05053 1.000 63.68355  ? 451 LYS A CD    1 
ATOM   3616 C  CE    . LYS A 1 452 ? 13.58657 41.93140  -51.44606 1.000 70.17274  ? 451 LYS A CE    1 
ATOM   3617 N  NZ    . LYS A 1 452 ? 14.05957 40.92857  -50.43868 1.000 72.07159  ? 451 LYS A NZ    1 
ATOM   3618 N  N     . LEU A 1 453 ? 14.24997 48.23274  -54.67949 1.000 58.77925  ? 452 LEU A N     1 
ATOM   3619 C  CA    . LEU A 1 453 ? 14.88119 49.48165  -55.08162 1.000 54.36362  ? 452 LEU A CA    1 
ATOM   3620 C  C     . LEU A 1 453 ? 14.81262 50.46524  -53.92538 1.000 53.63517  ? 452 LEU A C     1 
ATOM   3621 O  O     . LEU A 1 453 ? 13.89177 50.42263  -53.10304 1.000 51.89487  ? 452 LEU A O     1 
ATOM   3622 C  CB    . LEU A 1 453 ? 14.20643 50.09572  -56.30794 1.000 53.55640  ? 452 LEU A CB    1 
ATOM   3623 C  CG    . LEU A 1 453 ? 13.96423 49.19331  -57.51818 1.000 57.55958  ? 452 LEU A CG    1 
ATOM   3624 C  CD1   . LEU A 1 453 ? 13.36954 49.99295  -58.66441 1.000 56.00388  ? 452 LEU A CD1   1 
ATOM   3625 C  CD2   . LEU A 1 453 ? 15.24992 48.50208  -57.94084 1.000 61.89218  ? 452 LEU A CD2   1 
ATOM   3626 N  N     . GLY A 1 454 ? 15.80156 51.35230  -53.85934 1.000 48.70121  ? 453 GLY A N     1 
ATOM   3627 C  CA    . GLY A 1 454 ? 15.85907 52.27649  -52.75015 1.000 50.17892  ? 453 GLY A CA    1 
ATOM   3628 C  C     . GLY A 1 454 ? 16.59043 53.55379  -53.09584 1.000 44.60467  ? 453 GLY A C     1 
ATOM   3629 O  O     . GLY A 1 454 ? 17.10546 53.72743  -54.20077 1.000 44.26191  ? 453 GLY A O     1 
ATOM   3630 N  N     . LYS A 1 455 ? 16.63895 54.44955  -52.11748 1.000 39.10083  ? 454 LYS A N     1 
ATOM   3631 C  CA    . LYS A 1 455 ? 17.37220 55.69352  -52.25988 1.000 44.59219  ? 454 LYS A CA    1 
ATOM   3632 C  C     . LYS A 1 455 ? 18.03371 56.05691  -50.94359 1.000 44.51586  ? 454 LYS A C     1 
ATOM   3633 O  O     . LYS A 1 455 ? 17.43936 55.90729  -49.87177 1.000 44.03865  ? 454 LYS A O     1 
ATOM   3634 C  CB    . LYS A 1 455 ? 16.46691 56.83739  -52.71732 1.000 44.24062  ? 454 LYS A CB    1 
ATOM   3635 C  CG    . LYS A 1 455 ? 16.09929 56.76553  -54.18789 1.000 49.99478  ? 454 LYS A CG    1 
ATOM   3636 C  CD    . LYS A 1 455 ? 15.20141 57.92646  -54.55392 1.000 51.77498  ? 454 LYS A CD    1 
ATOM   3637 C  CE    . LYS A 1 455 ? 14.38917 57.64768  -55.79364 1.000 50.44778  ? 454 LYS A CE    1 
ATOM   3638 N  NZ    . LYS A 1 455 ? 13.15425 58.48978  -55.73247 1.000 57.54471  ? 454 LYS A NZ    1 
ATOM   3639 N  N     . ALA A 1 456 ? 19.27197 56.53064  -51.04091 1.000 42.81470  ? 455 ALA A N     1 
ATOM   3640 C  CA    . ALA A 1 456 ? 20.00200 57.09069  -49.91811 1.000 41.97658  ? 455 ALA A CA    1 
ATOM   3641 C  C     . ALA A 1 456 ? 20.27190 58.56275  -50.20177 1.000 43.34365  ? 455 ALA A C     1 
ATOM   3642 O  O     . ALA A 1 456 ? 20.35433 58.97641  -51.35961 1.000 39.60806  ? 455 ALA A O     1 
ATOM   3643 C  CB    . ALA A 1 456 ? 21.31552 56.33148  -49.69311 1.000 37.59356  ? 455 ALA A CB    1 
ATOM   3644 N  N     . GLY A 1 457 ? 20.40134 59.37296  -49.16044 1.000 41.64852  ? 456 GLY A N     1 
ATOM   3645 C  CA    . GLY A 1 457 ? 20.76895 60.74424  -49.46107 1.000 38.28797  ? 456 GLY A CA    1 
ATOM   3646 C  C     . GLY A 1 457 ? 20.81474 61.61595  -48.23492 1.000 39.05919  ? 456 GLY A C     1 
ATOM   3647 O  O     . GLY A 1 457 ? 20.56691 61.17052  -47.10838 1.000 41.38812  ? 456 GLY A O     1 
ATOM   3648 N  N     . TYR A 1 458 ? 21.12731 62.88633  -48.48634 1.000 38.79889  ? 457 TYR A N     1 
ATOM   3649 C  CA    . TYR A 1 458 ? 21.24857 63.86700  -47.41716 1.000 36.12257  ? 457 TYR A CA    1 
ATOM   3650 C  C     . TYR A 1 458 ? 20.77452 65.22679  -47.89926 1.000 38.46635  ? 457 TYR A C     1 
ATOM   3651 O  O     . TYR A 1 458 ? 20.72236 65.50669  -49.10525 1.000 40.82435  ? 457 TYR A O     1 
ATOM   3652 C  CB    . TYR A 1 458 ? 22.69168 63.99062  -46.91943 1.000 36.46744  ? 457 TYR A CB    1 
ATOM   3653 C  CG    . TYR A 1 458 ? 23.66700 64.37278  -48.01606 1.000 41.20561  ? 457 TYR A CG    1 
ATOM   3654 C  CD1   . TYR A 1 458 ? 23.74643 65.68021  -48.48763 1.000 40.86811  ? 457 TYR A CD1   1 
ATOM   3655 C  CD2   . TYR A 1 458 ? 24.50494 63.42039  -48.59218 1.000 43.41912  ? 457 TYR A CD2   1 
ATOM   3656 C  CE1   . TYR A 1 458 ? 24.61238 66.02044  -49.49228 1.000 40.52088  ? 457 TYR A CE1   1 
ATOM   3657 C  CE2   . TYR A 1 458 ? 25.38389 63.75910  -49.60074 1.000 42.23429  ? 457 TYR A CE2   1 
ATOM   3658 C  CZ    . TYR A 1 458 ? 25.43393 65.06475  -50.04268 1.000 41.83720  ? 457 TYR A CZ    1 
ATOM   3659 O  OH    . TYR A 1 458 ? 26.31134 65.41367  -51.04223 1.000 42.04578  ? 457 TYR A OH    1 
ATOM   3660 N  N     . VAL A 1 459 ? 20.44258 66.07222  -46.92337 1.000 40.52889  ? 458 VAL A N     1 
ATOM   3661 C  CA    . VAL A 1 459 ? 20.36763 67.52477  -47.09112 1.000 38.09870  ? 458 VAL A CA    1 
ATOM   3662 C  C     . VAL A 1 459 ? 21.26783 68.14557  -46.03911 1.000 39.34909  ? 458 VAL A C     1 
ATOM   3663 O  O     . VAL A 1 459 ? 21.43236 67.59322  -44.94909 1.000 40.30173  ? 458 VAL A O     1 
ATOM   3664 C  CB    . VAL A 1 459 ? 18.94467 68.10565  -46.94891 1.000 32.95813  ? 458 VAL A CB    1 
ATOM   3665 C  CG1   . VAL A 1 459 ? 18.02742 67.57488  -48.02608 1.000 38.85681  ? 458 VAL A CG1   1 
ATOM   3666 C  CG2   . VAL A 1 459 ? 18.39114 67.83002  -45.55910 1.000 35.75370  ? 458 VAL A CG2   1 
ATOM   3667 N  N     . THR A 1 460 ? 21.85030 69.29753  -46.34917 1.000 37.65108  ? 459 THR A N     1 
ATOM   3668 C  CA    . THR A 1 460 ? 22.67761 69.97654  -45.36316 1.000 36.65854  ? 459 THR A CA    1 
ATOM   3669 C  C     . THR A 1 460 ? 22.05482 71.31220  -44.97932 1.000 41.87919  ? 459 THR A C     1 
ATOM   3670 O  O     . THR A 1 460 ? 21.23275 71.88182  -45.70498 1.000 40.57949  ? 459 THR A O     1 
ATOM   3671 C  CB    . THR A 1 460 ? 24.09506 70.22780  -45.87231 1.000 36.23773  ? 459 THR A CB    1 
ATOM   3672 O  OG1   . THR A 1 460 ? 24.06563 71.33910  -46.77604 1.000 39.80807  ? 459 THR A OG1   1 
ATOM   3673 C  CG2   . THR A 1 460 ? 24.63842 69.01639  -46.60318 1.000 36.37478  ? 459 THR A CG2   1 
ATOM   3674 N  N     . ASN A 1 461 ? 22.48058 71.81710  -43.82433 1.000 41.44258  ? 460 ASN A N     1 
ATOM   3675 C  CA    . ASN A 1 461 ? 22.06655 73.12938  -43.35467 1.000 38.36503  ? 460 ASN A CA    1 
ATOM   3676 C  C     . ASN A 1 461 ? 22.64024 74.26384  -44.18423 1.000 39.08596  ? 460 ASN A C     1 
ATOM   3677 O  O     . ASN A 1 461 ? 22.26182 75.41644  -43.96815 1.000 40.39231  ? 460 ASN A O     1 
ATOM   3678 C  CB    . ASN A 1 461 ? 22.51370 73.32468  -41.92266 1.000 38.88495  ? 460 ASN A CB    1 
ATOM   3679 C  CG    . ASN A 1 461 ? 23.97967 73.61648  -41.83498 1.000 41.16062  ? 460 ASN A CG    1 
ATOM   3680 O  OD1   . ASN A 1 461 ? 24.80802 72.72849  -42.04554 1.000 43.91407  ? 460 ASN A OD1   1 
ATOM   3681 N  ND2   . ASN A 1 461 ? 24.32182 74.86125  -41.52924 1.000 42.45059  ? 460 ASN A ND2   1 
ATOM   3682 N  N     . ARG A 1 462 ? 23.57956 73.97883  -45.07350 1.000 40.62179  ? 461 ARG A N     1 
ATOM   3683 C  CA    . ARG A 1 462 ? 24.13641 74.97059  -45.97449 1.000 37.77622  ? 461 ARG A CA    1 
ATOM   3684 C  C     . ARG A 1 462 ? 23.53546 74.86674  -47.36871 1.000 42.73720  ? 461 ARG A C     1 
ATOM   3685 O  O     . ARG A 1 462 ? 24.02011 75.53546  -48.29311 1.000 40.34590  ? 461 ARG A O     1 
ATOM   3686 C  CB    . ARG A 1 462 ? 25.66006 74.82868  -46.04782 1.000 36.15683  ? 461 ARG A CB    1 
ATOM   3687 C  CG    . ARG A 1 462 ? 26.38447 75.05098  -44.72930 1.000 39.90485  ? 461 ARG A CG    1 
ATOM   3688 C  CD    . ARG A 1 462 ? 27.88983 74.83627  -44.86545 1.000 40.11079  ? 461 ARG A CD    1 
ATOM   3689 N  NE    . ARG A 1 462 ? 28.57069 74.98727  -43.57733 1.000 43.24777  ? 461 ARG A NE    1 
ATOM   3690 C  CZ    . ARG A 1 462 ? 29.85011 74.67788  -43.35768 1.000 44.89693  ? 461 ARG A CZ    1 
ATOM   3691 N  NH1   . ARG A 1 462 ? 30.60365 74.19100  -44.34480 1.000 43.53765  ? 461 ARG A NH1   1 
ATOM   3692 N  NH2   . ARG A 1 462 ? 30.37827 74.86165  -42.14989 1.000 35.37224  ? 461 ARG A NH2   1 
ATOM   3693 N  N     . GLY A 1 463 ? 22.51801 74.01469  -47.54951 1.000 36.52880  ? 462 GLY A N     1 
ATOM   3694 C  CA    . GLY A 1 463 ? 21.75123 73.97796  -48.77499 1.000 31.97191  ? 462 GLY A CA    1 
ATOM   3695 C  C     . GLY A 1 463 ? 22.12397 72.90960  -49.77634 1.000 37.61972  ? 462 GLY A C     1 
ATOM   3696 O  O     . GLY A 1 463 ? 21.51308 72.85521  -50.85172 1.000 43.08664  ? 462 GLY A O     1 
ATOM   3697 N  N     . ARG A 1 464 ? 23.09968 72.06343  -49.48407 1.000 38.89032  ? 463 ARG A N     1 
ATOM   3698 C  CA    . ARG A 1 464 ? 23.43181 70.99905  -50.41858 1.000 40.30991  ? 463 ARG A CA    1 
ATOM   3699 C  C     . ARG A 1 464 ? 22.41373 69.86792  -50.28080 1.000 40.67007  ? 463 ARG A C     1 
ATOM   3700 O  O     . ARG A 1 464 ? 21.91554 69.59176  -49.18817 1.000 42.00520  ? 463 ARG A O     1 
ATOM   3701 C  CB    . ARG A 1 464 ? 24.86124 70.50809  -50.17377 1.000 36.79551  ? 463 ARG A CB    1 
ATOM   3702 C  CG    . ARG A 1 464 ? 25.92960 71.53058  -50.54808 1.000 32.97715  ? 463 ARG A CG    1 
ATOM   3703 C  CD    . ARG A 1 464 ? 27.26237 71.28080  -49.85157 1.000 38.30624  ? 463 ARG A CD    1 
ATOM   3704 N  NE    . ARG A 1 464 ? 27.85754 69.99550  -50.21235 1.000 44.26305  ? 463 ARG A NE    1 
ATOM   3705 C  CZ    . ARG A 1 464 ? 28.76152 69.35215  -49.47787 1.000 40.00666  ? 463 ARG A CZ    1 
ATOM   3706 N  NH1   . ARG A 1 464 ? 29.18639 69.85575  -48.33119 1.000 38.88481  ? 463 ARG A NH1   1 
ATOM   3707 N  NH2   . ARG A 1 464 ? 29.23374 68.19316  -49.88435 1.000 40.10077  ? 463 ARG A NH2   1 
ATOM   3708 N  N     . GLN A 1 465 ? 22.07247 69.24017  -51.40107 1.000 42.62773  ? 464 GLN A N     1 
ATOM   3709 C  CA    . GLN A 1 465 ? 21.15480 68.10628  -51.39484 1.000 43.84272  ? 464 GLN A CA    1 
ATOM   3710 C  C     . GLN A 1 465 ? 21.64776 67.05685  -52.38138 1.000 48.22596  ? 464 GLN A C     1 
ATOM   3711 O  O     . GLN A 1 465 ? 22.06714 67.39257  -53.49555 1.000 47.36689  ? 464 GLN A O     1 
ATOM   3712 C  CB    . GLN A 1 465 ? 19.72632 68.54237  -51.73668 1.000 45.77008  ? 464 GLN A CB    1 
ATOM   3713 C  CG    . GLN A 1 465 ? 19.11513 67.85480  -52.95344 1.000 52.87164  ? 464 GLN A CG    1 
ATOM   3714 C  CD    . GLN A 1 465 ? 17.65621 68.26270  -53.19744 1.000 66.45520  ? 464 GLN A CD    1 
ATOM   3715 O  OE1   . GLN A 1 465 ? 17.13185 69.17462  -52.54238 1.000 63.19139  ? 464 GLN A OE1   1 
ATOM   3716 N  NE2   . GLN A 1 465 ? 16.99407 67.57436  -54.13284 1.000 62.57632  ? 464 GLN A NE2   1 
ATOM   3717 N  N     . LYS A 1 466 ? 21.63272 65.78949  -51.96205 1.000 48.43946  ? 465 LYS A N     1 
ATOM   3718 C  CA    . LYS A 1 466 ? 22.01658 64.71498  -52.86853 1.000 41.84487  ? 465 LYS A CA    1 
ATOM   3719 C  C     . LYS A 1 466 ? 21.18154 63.47462  -52.60246 1.000 39.26722  ? 465 LYS A C     1 
ATOM   3720 O  O     . LYS A 1 466 ? 20.91930 63.11718  -51.44609 1.000 39.05820  ? 465 LYS A O     1 
ATOM   3721 C  CB    . LYS A 1 466 ? 23.50169 64.36535  -52.75942 1.000 41.75810  ? 465 LYS A CB    1 
ATOM   3722 C  CG    . LYS A 1 466 ? 23.89106 63.22599  -53.70042 1.000 45.54554  ? 465 LYS A CG    1 
ATOM   3723 C  CD    . LYS A 1 466 ? 25.39725 62.98339  -53.79981 1.000 49.73220  ? 465 LYS A CD    1 
ATOM   3724 C  CE    . LYS A 1 466 ? 26.11776 64.17943  -54.42823 1.000 53.48389  ? 465 LYS A CE    1 
ATOM   3725 N  NZ    . LYS A 1 466 ? 27.52713 63.84751  -54.83560 1.000 51.03971  ? 465 LYS A NZ    1 
ATOM   3726 N  N     . VAL A 1 467 ? 20.75376 62.83603  -53.68706 1.000 36.86630  ? 466 VAL A N     1 
ATOM   3727 C  CA    . VAL A 1 467 ? 20.02921 61.57506  -53.63032 1.000 40.14753  ? 466 VAL A CA    1 
ATOM   3728 C  C     . VAL A 1 467 ? 20.70931 60.58872  -54.57302 1.000 40.69146  ? 466 VAL A C     1 
ATOM   3729 O  O     . VAL A 1 467 ? 21.00989 60.93105  -55.72133 1.000 39.92934  ? 466 VAL A O     1 
ATOM   3730 C  CB    . VAL A 1 467 ? 18.54529 61.75316  -53.99770 1.000 33.03617  ? 466 VAL A CB    1 
ATOM   3731 C  CG1   . VAL A 1 467 ? 17.86579 60.41152  -54.05576 1.000 38.37115  ? 466 VAL A CG1   1 
ATOM   3732 C  CG2   . VAL A 1 467 ? 17.85862 62.60932  -52.96333 1.000 40.06394  ? 466 VAL A CG2   1 
ATOM   3733 N  N     . VAL A 1 468 ? 20.96272 59.37586  -54.08345 1.000 39.93767  ? 467 VAL A N     1 
ATOM   3734 C  CA    . VAL A 1 468 ? 21.60653 58.30212  -54.83593 1.000 43.81117  ? 467 VAL A CA    1 
ATOM   3735 C  C     . VAL A 1 468 ? 20.65479 57.11191  -54.88119 1.000 45.06520  ? 467 VAL A C     1 
ATOM   3736 O  O     . VAL A 1 468 ? 20.14105 56.68306  -53.83969 1.000 45.90222  ? 467 VAL A O     1 
ATOM   3737 C  CB    . VAL A 1 468 ? 22.95050 57.90526  -54.19499 1.000 41.49495  ? 467 VAL A CB    1 
ATOM   3738 C  CG1   . VAL A 1 468 ? 23.26789 56.45856  -54.44862 1.000 45.17962  ? 467 VAL A CG1   1 
ATOM   3739 C  CG2   . VAL A 1 468 ? 24.05364 58.77277  -54.72660 1.000 45.39289  ? 467 VAL A CG2   1 
ATOM   3740 N  N     . THR A 1 469 ? 20.42051 56.57762  -56.07737 1.000 45.34282  ? 468 THR A N     1 
ATOM   3741 C  CA    . THR A 1 469 ? 19.51348 55.44378  -56.22890 1.000 48.95835  ? 468 THR A CA    1 
ATOM   3742 C  C     . THR A 1 469 ? 20.26260 54.11868  -56.13830 1.000 48.52865  ? 468 THR A C     1 
ATOM   3743 O  O     . THR A 1 469 ? 21.42849 54.00707  -56.53327 1.000 46.72282  ? 468 THR A O     1 
ATOM   3744 C  CB    . THR A 1 469 ? 18.75369 55.49831  -57.55549 1.000 47.44122  ? 468 THR A CB    1 
ATOM   3745 O  OG1   . THR A 1 469 ? 19.63247 55.10998  -58.61160 1.000 51.11737  ? 468 THR A OG1   1 
ATOM   3746 C  CG2   . THR A 1 469 ? 18.22289 56.90845  -57.82007 1.000 47.54396  ? 468 THR A CG2   1 
ATOM   3747 N  N     . LEU A 1 470 ? 19.56150 53.10448  -55.62457 1.000 47.25114  ? 469 LEU A N     1 
ATOM   3748 C  CA    . LEU A 1 470 ? 20.14027 51.80820  -55.32201 1.000 44.80586  ? 469 LEU A CA    1 
ATOM   3749 C  C     . LEU A 1 470 ? 19.18796 50.71450  -55.77826 1.000 54.24529  ? 469 LEU A C     1 
ATOM   3750 O  O     . LEU A 1 470 ? 17.96522 50.87558  -55.73920 1.000 56.71447  ? 469 LEU A O     1 
ATOM   3751 C  CB    . LEU A 1 470 ? 20.40983 51.65128  -53.82313 1.000 44.25093  ? 469 LEU A CB    1 
ATOM   3752 C  CG    . LEU A 1 470 ? 21.32667 52.68020  -53.17083 1.000 48.46648  ? 469 LEU A CG    1 
ATOM   3753 C  CD1   . LEU A 1 470 ? 20.99793 52.85758  -51.70060 1.000 41.44107  ? 469 LEU A CD1   1 
ATOM   3754 C  CD2   . LEU A 1 470 ? 22.77510 52.26550  -53.34586 1.000 46.39642  ? 469 LEU A CD2   1 
ATOM   3755 N  N     . THR A 1 471 ? 19.76384 49.58695  -56.18429 1.000 56.89280  ? 470 THR A N     1 
ATOM   3756 C  CA    . THR A 1 471 ? 19.02016 48.42891  -56.65261 1.000 53.16959  ? 470 THR A CA    1 
ATOM   3757 C  C     . THR A 1 471 ? 19.35981 47.23095  -55.78681 1.000 58.22047  ? 470 THR A C     1 
ATOM   3758 O  O     . THR A 1 471 ? 20.52044 47.04057  -55.40760 1.000 59.88161  ? 470 THR A O     1 
ATOM   3759 C  CB    . THR A 1 471 ? 19.36215 48.08859  -58.09736 1.000 53.67123  ? 470 THR A CB    1 
ATOM   3760 O  OG1   . THR A 1 471 ? 20.78493 47.95233  -58.21942 1.000 57.76839  ? 470 THR A OG1   1 
ATOM   3761 C  CG2   . THR A 1 471 ? 18.86279 49.16636  -59.04532 1.000 55.00032  ? 470 THR A CG2   1 
ATOM   3762 N  N     . ASP A 1 472 ? 18.34852 46.41319  -55.49554 1.000 62.49373  ? 471 ASP A N     1 
ATOM   3763 C  CA    . ASP A 1 472 ? 18.54943 45.16397  -54.77212 1.000 57.40724  ? 471 ASP A CA    1 
ATOM   3764 C  C     . ASP A 1 472 ? 19.21201 45.43759  -53.41611 1.000 53.76084  ? 471 ASP A C     1 
ATOM   3765 O  O     . ASP A 1 472 ? 20.33140 45.01110  -53.14009 1.000 53.18394  ? 471 ASP A O     1 
ATOM   3766 C  CB    . ASP A 1 472 ? 19.36003 44.19091  -55.63881 1.000 55.40599  ? 471 ASP A CB    1 
ATOM   3767 C  CG    . ASP A 1 472 ? 19.62431 42.86685  -54.95274 1.000 69.23476  ? 471 ASP A CG    1 
ATOM   3768 O  OD1   . ASP A 1 472 ? 18.65475 42.13600  -54.62403 1.000 67.51193  ? 471 ASP A OD1   1 
ATOM   3769 O  OD2   . ASP A 1 472 ? 20.81859 42.55968  -54.74426 1.000 70.06235  ? 471 ASP A OD2   1 
ATOM   3770 N  N     . THR A 1 473 ? 18.49106 46.18810  -52.57379 1.000 52.83183  ? 472 THR A N     1 
ATOM   3771 C  CA    . THR A 1 473 ? 19.02266 46.73063  -51.32885 1.000 46.51549  ? 472 THR A CA    1 
ATOM   3772 C  C     . THR A 1 473 ? 17.98952 46.54339  -50.22204 1.000 47.26178  ? 472 THR A C     1 
ATOM   3773 O  O     . THR A 1 473 ? 16.94569 45.91649  -50.41290 1.000 48.19123  ? 472 THR A O     1 
ATOM   3774 C  CB    . THR A 1 473 ? 19.41761 48.20950  -51.49992 1.000 46.54938  ? 472 THR A CB    1 
ATOM   3775 O  OG1   . THR A 1 473 ? 19.85190 48.75904  -50.25499 1.000 44.09892  ? 472 THR A OG1   1 
ATOM   3776 C  CG2   . THR A 1 473 ? 18.24633 49.02904  -51.98052 1.000 54.35272  ? 472 THR A CG2   1 
ATOM   3777 N  N     . THR A 1 474 ? 18.30098 47.08305  -49.04515 1.000 48.01731  ? 473 THR A N     1 
ATOM   3778 C  CA    . THR A 1 474 ? 17.45927 46.98146  -47.86463 1.000 44.99526  ? 473 THR A CA    1 
ATOM   3779 C  C     . THR A 1 474 ? 17.40208 48.33265  -47.16587 1.000 48.01528  ? 473 THR A C     1 
ATOM   3780 O  O     . THR A 1 474 ? 18.23220 49.21223  -47.40900 1.000 48.11588  ? 473 THR A O     1 
ATOM   3781 C  CB    . THR A 1 474 ? 17.99231 45.97004  -46.85736 1.000 49.86367  ? 473 THR A CB    1 
ATOM   3782 O  OG1   . THR A 1 474 ? 18.87635 46.65478  -45.96362 1.000 49.06513  ? 473 THR A OG1   1 
ATOM   3783 C  CG2   . THR A 1 474 ? 18.75137 44.84299  -47.54629 1.000 50.15083  ? 473 THR A CG2   1 
ATOM   3784 N  N     . ASN A 1 475 ? 16.43270 48.47118  -46.25210 1.000 51.66726  ? 474 ASN A N     1 
ATOM   3785 C  CA    . ASN A 1 475 ? 16.31646 49.69951  -45.46813 1.000 48.98309  ? 474 ASN A CA    1 
ATOM   3786 C  C     . ASN A 1 475 ? 17.59596 49.96327  -44.69466 1.000 49.21653  ? 474 ASN A C     1 
ATOM   3787 O  O     . ASN A 1 475 ? 18.16691 51.06285  -44.76227 1.000 52.10917  ? 474 ASN A O     1 
ATOM   3788 C  CB    . ASN A 1 475 ? 15.12666 49.62087  -44.50229 1.000 48.04415  ? 474 ASN A CB    1 
ATOM   3789 C  CG    . ASN A 1 475 ? 13.85249 50.25457  -45.06923 1.000 57.37812  ? 474 ASN A CG    1 
ATOM   3790 O  OD1   . ASN A 1 475 ? 12.87454 49.55642  -45.32584 1.000 65.10027  ? 474 ASN A OD1   1 
ATOM   3791 N  ND2   . ASN A 1 475 ? 13.85731 51.58185  -45.25398 1.000 55.92827  ? 474 ASN A ND2   1 
ATOM   3792 N  N     . GLN A 1 476 ? 18.05832 48.95867  -43.94840 1.000 47.95972  ? 475 GLN A N     1 
ATOM   3793 C  CA    . GLN A 1 476 ? 19.29297 49.10192  -43.18566 1.000 49.18774  ? 475 GLN A CA    1 
ATOM   3794 C  C     . GLN A 1 476 ? 20.44784 49.50492  -44.09341 1.000 46.00798  ? 475 GLN A C     1 
ATOM   3795 O  O     . GLN A 1 476 ? 21.26441 50.36995  -43.73702 1.000 45.23465  ? 475 GLN A O     1 
ATOM   3796 C  CB    . GLN A 1 476 ? 19.59915 47.79489  -42.44940 1.000 49.57074  ? 475 GLN A CB    1 
ATOM   3797 C  CG    . GLN A 1 476 ? 18.59355 47.43696  -41.34027 1.000 49.28879  ? 475 GLN A CG    1 
ATOM   3798 C  CD    . GLN A 1 476 ? 17.40425 46.59690  -41.83481 1.000 59.70997  ? 475 GLN A CD    1 
ATOM   3799 O  OE1   . GLN A 1 476 ? 17.12465 46.52793  -43.03774 1.000 59.35590  ? 475 GLN A OE1   1 
ATOM   3800 N  NE2   . GLN A 1 476 ? 16.70178 45.95378  -40.89805 1.000 62.02961  ? 475 GLN A NE2   1 
ATOM   3801 N  N     . LYS A 1 477 ? 20.49809 48.92751  -45.29612 1.000 45.49848  ? 476 LYS A N     1 
ATOM   3802 C  CA    . LYS A 1 477 ? 21.57497 49.24939  -46.22242 1.000 44.31538  ? 476 LYS A CA    1 
ATOM   3803 C  C     . LYS A 1 477 ? 21.43859 50.66409  -46.75899 1.000 45.46859  ? 476 LYS A C     1 
ATOM   3804 O  O     . LYS A 1 477 ? 22.44646 51.35835  -46.92889 1.000 45.50780  ? 476 LYS A O     1 
ATOM   3805 C  CB    . LYS A 1 477 ? 21.62373 48.23843  -47.36643 1.000 43.22606  ? 476 LYS A CB    1 
ATOM   3806 C  CG    . LYS A 1 477 ? 22.04671 46.86867  -46.90810 1.000 46.02836  ? 476 LYS A CG    1 
ATOM   3807 C  CD    . LYS A 1 477 ? 22.20235 45.87651  -48.02672 1.000 43.93936  ? 476 LYS A CD    1 
ATOM   3808 C  CE    . LYS A 1 477 ? 22.73162 44.56850  -47.45726 1.000 51.81731  ? 476 LYS A CE    1 
ATOM   3809 N  NZ    . LYS A 1 477 ? 23.17277 43.60508  -48.50532 1.000 57.10046  ? 476 LYS A NZ    1 
ATOM   3810 N  N     . THR A 1 478 ? 20.21573 51.12150  -47.03335 1.000 42.47507  ? 477 THR A N     1 
ATOM   3811 C  CA    . THR A 1 478 ? 20.09080 52.50395  -47.48341 1.000 42.00794  ? 477 THR A CA    1 
ATOM   3812 C  C     . THR A 1 478 ? 20.53468 53.46496  -46.39169 1.000 40.92252  ? 477 THR A C     1 
ATOM   3813 O  O     . THR A 1 478 ? 21.15319 54.49362  -46.68254 1.000 42.88535  ? 477 THR A O     1 
ATOM   3814 C  CB    . THR A 1 478 ? 18.66360 52.83065  -47.94398 1.000 42.76255  ? 477 THR A CB    1 
ATOM   3815 O  OG1   . THR A 1 478 ? 17.72289 52.61882  -46.88077 1.000 42.43097  ? 477 THR A OG1   1 
ATOM   3816 C  CG2   . THR A 1 478 ? 18.28542 51.98888  -49.14756 1.000 45.04931  ? 477 THR A CG2   1 
ATOM   3817 N  N     . GLU A 1 479 ? 20.24543 53.14486  -45.12604 1.000 41.62859  ? 478 GLU A N     1 
ATOM   3818 C  CA    . GLU A 1 479 ? 20.68635 54.02689  -44.04675 1.000 43.44783  ? 478 GLU A CA    1 
ATOM   3819 C  C     . GLU A 1 479 ? 22.20929 54.08984  -43.99452 1.000 43.67015  ? 478 GLU A C     1 
ATOM   3820 O  O     . GLU A 1 479 ? 22.80864 55.17760  -43.86852 1.000 42.23811  ? 478 GLU A O     1 
ATOM   3821 C  CB    . GLU A 1 479 ? 20.11807 53.55278  -42.70564 1.000 38.66555  ? 478 GLU A CB    1 
ATOM   3822 C  CG    . GLU A 1 479 ? 18.59488 53.53653  -42.60286 1.000 43.94020  ? 478 GLU A CG    1 
ATOM   3823 C  CD    . GLU A 1 479 ? 17.98800 54.92236  -42.42640 1.000 41.19649  ? 478 GLU A CD    1 
ATOM   3824 O  OE1   . GLU A 1 479 ? 18.73581 55.90003  -42.60275 1.000 48.67950  ? 478 GLU A OE1   1 
ATOM   3825 O  OE2   . GLU A 1 479 ? 16.77663 55.04616  -42.12561 1.000 36.67872  ? 478 GLU A OE2   1 
ATOM   3826 N  N     . LEU A 1 480 ? 22.85411 52.92499  -44.11868 1.000 45.01531  ? 479 LEU A N     1 
ATOM   3827 C  CA    . LEU A 1 480 ? 24.31279 52.89774  -44.13396 1.000 43.67095  ? 479 LEU A CA    1 
ATOM   3828 C  C     . LEU A 1 480 ? 24.87013 53.67317  -45.32430 1.000 43.12506  ? 479 LEU A C     1 
ATOM   3829 O  O     . LEU A 1 480 ? 25.85760 54.40757  -45.18215 1.000 44.15903  ? 479 LEU A O     1 
ATOM   3830 C  CB    . LEU A 1 480 ? 24.81360 51.45443  -44.14260 1.000 42.84952  ? 479 LEU A CB    1 
ATOM   3831 C  CG    . LEU A 1 480 ? 24.96799 50.79413  -42.77063 1.000 40.63525  ? 479 LEU A CG    1 
ATOM   3832 C  CD1   . LEU A 1 480 ? 25.80067 49.54892  -42.92190 1.000 39.74424  ? 479 LEU A CD1   1 
ATOM   3833 C  CD2   . LEU A 1 480 ? 25.60335 51.72948  -41.76022 1.000 34.91131  ? 479 LEU A CD2   1 
ATOM   3834 N  N     . GLN A 1 481 ? 24.24629 53.53237  -46.50437 1.000 39.27686  ? 480 GLN A N     1 
ATOM   3835 C  CA    . GLN A 1 481 ? 24.71078 54.26196  -47.68394 1.000 39.92692  ? 480 GLN A CA    1 
ATOM   3836 C  C     . GLN A 1 481 ? 24.60261 55.77212  -47.49049 1.000 42.66525  ? 480 GLN A C     1 
ATOM   3837 O  O     . GLN A 1 481 ? 25.48873 56.52205  -47.91737 1.000 39.74418  ? 480 GLN A O     1 
ATOM   3838 C  CB    . GLN A 1 481 ? 23.92211 53.84983  -48.92129 1.000 35.77786  ? 480 GLN A CB    1 
ATOM   3839 C  CG    . GLN A 1 481 ? 24.06251 52.41130  -49.30779 1.000 43.02273  ? 480 GLN A CG    1 
ATOM   3840 C  CD    . GLN A 1 481 ? 25.30748 52.09826  -50.12558 1.000 47.39939  ? 480 GLN A CD    1 
ATOM   3841 O  OE1   . GLN A 1 481 ? 26.09572 52.98441  -50.50269 1.000 43.12279  ? 480 GLN A OE1   1 
ATOM   3842 N  NE2   . GLN A 1 481 ? 25.48167 50.81469  -50.41433 1.000 44.16098  ? 480 GLN A NE2   1 
ATOM   3843 N  N     . ALA A 1 482 ? 23.50588 56.23735  -46.88509 1.000 39.66724  ? 481 ALA A N     1 
ATOM   3844 C  CA    . ALA A 1 482 ? 23.36657 57.66120  -46.61521 1.000 38.74099  ? 481 ALA A CA    1 
ATOM   3845 C  C     . ALA A 1 482 ? 24.51360 58.15542  -45.74306 1.000 40.53175  ? 481 ALA A C     1 
ATOM   3846 O  O     . ALA A 1 482 ? 25.10865 59.21390  -46.01466 1.000 42.08083  ? 481 ALA A O     1 
ATOM   3847 C  CB    . ALA A 1 482 ? 22.00623 57.95561  -45.96898 1.000 36.39242  ? 481 ALA A CB    1 
ATOM   3848 N  N     . ILE A 1 483 ? 24.84626 57.40881  -44.68746 1.000 33.70560  ? 482 ILE A N     1 
ATOM   3849 C  CA    . ILE A 1 483 ? 25.96049 57.87283  -43.85993 1.000 37.86462  ? 482 ILE A CA    1 
ATOM   3850 C  C     . ILE A 1 483 ? 27.26231 57.89589  -44.66575 1.000 41.36596  ? 482 ILE A C     1 
ATOM   3851 O  O     . ILE A 1 483 ? 28.06324 58.83974  -44.55819 1.000 42.39127  ? 482 ILE A O     1 
ATOM   3852 C  CB    . ILE A 1 483 ? 26.09973 57.02400  -42.58692 1.000 41.13919  ? 482 ILE A CB    1 
ATOM   3853 C  CG1   . ILE A 1 483 ? 24.97143 57.33224  -41.61230 1.000 32.94937  ? 482 ILE A CG1   1 
ATOM   3854 C  CG2   . ILE A 1 483 ? 27.44079 57.30704  -41.91557 1.000 38.48105  ? 482 ILE A CG2   1 
ATOM   3855 C  CD1   . ILE A 1 483 ? 24.87039 56.34657  -40.51257 1.000 27.94012  ? 482 ILE A CD1   1 
ATOM   3856 N  N     . TYR A 1 484 ? 27.49338 56.86220  -45.48572 1.000 40.45870  ? 483 TYR A N     1 
ATOM   3857 C  CA    . TYR A 1 484 ? 28.69112 56.83219  -46.32686 1.000 40.13835  ? 483 TYR A CA    1 
ATOM   3858 C  C     . TYR A 1 484 ? 28.75539 58.05536  -47.22934 1.000 39.06350  ? 483 TYR A C     1 
ATOM   3859 O  O     . TYR A 1 484 ? 29.82034 58.65543  -47.41390 1.000 37.28158  ? 483 TYR A O     1 
ATOM   3860 C  CB    . TYR A 1 484 ? 28.70980 55.55121  -47.16463 1.000 36.80196  ? 483 TYR A CB    1 
ATOM   3861 C  CG    . TYR A 1 484 ? 29.94083 55.34386  -48.04110 1.000 37.32464  ? 483 TYR A CG    1 
ATOM   3862 C  CD1   . TYR A 1 484 ? 31.22309 55.62673  -47.58656 1.000 40.00202  ? 483 TYR A CD1   1 
ATOM   3863 C  CD2   . TYR A 1 484 ? 29.81508 54.80822  -49.30576 1.000 41.37818  ? 483 TYR A CD2   1 
ATOM   3864 C  CE1   . TYR A 1 484 ? 32.33664 55.41146  -48.39630 1.000 39.75467  ? 483 TYR A CE1   1 
ATOM   3865 C  CE2   . TYR A 1 484 ? 30.90625 54.58496  -50.11108 1.000 41.56720  ? 483 TYR A CE2   1 
ATOM   3866 C  CZ    . TYR A 1 484 ? 32.16071 54.88839  -49.66160 1.000 44.05909  ? 483 TYR A CZ    1 
ATOM   3867 O  OH    . TYR A 1 484 ? 33.22266 54.64543  -50.50903 1.000 49.83179  ? 483 TYR A OH    1 
ATOM   3868 N  N     . LEU A 1 485 ? 27.61534 58.43240  -47.80104 1.000 45.34944  ? 484 LEU A N     1 
ATOM   3869 C  CA    . LEU A 1 485 ? 27.56335 59.55940  -48.72135 1.000 42.34412  ? 484 LEU A CA    1 
ATOM   3870 C  C     . LEU A 1 485 ? 27.88524 60.85957  -47.99906 1.000 41.69630  ? 484 LEU A C     1 
ATOM   3871 O  O     . LEU A 1 485 ? 28.67375 61.67456  -48.49024 1.000 40.85974  ? 484 LEU A O     1 
ATOM   3872 C  CB    . LEU A 1 485 ? 26.18498 59.62733  -49.37511 1.000 40.08440  ? 484 LEU A CB    1 
ATOM   3873 C  CG    . LEU A 1 485 ? 26.15143 59.92393  -50.87192 1.000 46.42049  ? 484 LEU A CG    1 
ATOM   3874 C  CD1   . LEU A 1 485 ? 26.71524 58.74474  -51.64840 1.000 49.31979  ? 484 LEU A CD1   1 
ATOM   3875 C  CD2   . LEU A 1 485 ? 24.72064 60.23783  -51.31661 1.000 45.18987  ? 484 LEU A CD2   1 
ATOM   3876 N  N     . ALA A 1 486 ? 27.29357 61.06674  -46.82088 1.000 40.71261  ? 485 ALA A N     1 
ATOM   3877 C  CA    . ALA A 1 486 ? 27.61759 62.27139  -46.06197 1.000 38.63123  ? 485 ALA A CA    1 
ATOM   3878 C  C     . ALA A 1 486 ? 29.10921 62.33753  -45.75480 1.000 39.20745  ? 485 ALA A C     1 
ATOM   3879 O  O     . ALA A 1 486 ? 29.71665 63.41467  -45.81075 1.000 40.83388  ? 485 ALA A O     1 
ATOM   3880 C  CB    . ALA A 1 486 ? 26.79979 62.33137  -44.77738 1.000 35.74758  ? 485 ALA A CB    1 
ATOM   3881 N  N     . LEU A 1 487 ? 29.72392 61.19919  -45.44093 1.000 35.66304  ? 486 LEU A N     1 
ATOM   3882 C  CA    . LEU A 1 487 ? 31.15979 61.22496  -45.17714 1.000 37.36083  ? 486 LEU A CA    1 
ATOM   3883 C  C     . LEU A 1 487 ? 31.95762 61.55336  -46.44117 1.000 38.96948  ? 486 LEU A C     1 
ATOM   3884 O  O     . LEU A 1 487 ? 32.91711 62.32956  -46.38720 1.000 34.92206  ? 486 LEU A O     1 
ATOM   3885 C  CB    . LEU A 1 487 ? 31.60618 59.89099  -44.57636 1.000 36.92011  ? 486 LEU A CB    1 
ATOM   3886 C  CG    . LEU A 1 487 ? 31.02395 59.63792  -43.18384 1.000 39.77848  ? 486 LEU A CG    1 
ATOM   3887 C  CD1   . LEU A 1 487 ? 31.19686 58.17617  -42.72805 1.000 36.94180  ? 486 LEU A CD1   1 
ATOM   3888 C  CD2   . LEU A 1 487 ? 31.62430 60.60673  -42.16920 1.000 33.31916  ? 486 LEU A CD2   1 
ATOM   3889 N  N     . GLN A 1 488 ? 31.57347 60.98197  -47.58728 1.000 36.27248  ? 487 GLN A N     1 
ATOM   3890 C  CA    . GLN A 1 488 ? 32.30936 61.23904  -48.81976 1.000 34.77758  ? 487 GLN A CA    1 
ATOM   3891 C  C     . GLN A 1 488 ? 32.29975 62.72220  -49.18706 1.000 40.74599  ? 487 GLN A C     1 
ATOM   3892 O  O     . GLN A 1 488 ? 33.31336 63.26303  -49.64306 1.000 44.02213  ? 487 GLN A O     1 
ATOM   3893 C  CB    . GLN A 1 488 ? 31.72622 60.41715  -49.96589 1.000 32.12500  ? 487 GLN A CB    1 
ATOM   3894 C  CG    . GLN A 1 488 ? 32.17943 58.97497  -50.00895 1.000 44.03403  ? 487 GLN A CG    1 
ATOM   3895 C  CD    . GLN A 1 488 ? 31.49914 58.18163  -51.12546 1.000 48.80094  ? 487 GLN A CD    1 
ATOM   3896 O  OE1   . GLN A 1 488 ? 30.34517 57.75029  -50.98365 1.000 46.79426  ? 487 GLN A OE1   1 
ATOM   3897 N  NE2   . GLN A 1 488 ? 32.20804 57.98874  -52.23997 1.000 40.77168  ? 487 GLN A NE2   1 
ATOM   3898 N  N     . ASP A 1 489 ? 31.16636 63.39571  -49.00789 1.000 39.61244  ? 488 ASP A N     1 
ATOM   3899 C  CA    . ASP A 1 489 ? 30.97202 64.74666  -49.51153 1.000 38.19546  ? 488 ASP A CA    1 
ATOM   3900 C  C     . ASP A 1 489 ? 31.21559 65.83537  -48.46495 1.000 40.26070  ? 488 ASP A C     1 
ATOM   3901 O  O     . ASP A 1 489 ? 30.99312 67.01334  -48.75015 1.000 41.00781  ? 488 ASP A O     1 
ATOM   3902 C  CB    . ASP A 1 489 ? 29.56757 64.85889  -50.08564 1.000 39.16378  ? 488 ASP A CB    1 
ATOM   3903 C  CG    . ASP A 1 489 ? 29.37791 63.96812  -51.28553 1.000 40.71590  ? 488 ASP A CG    1 
ATOM   3904 O  OD1   . ASP A 1 489 ? 30.37528 63.35944  -51.70280 1.000 41.98678  ? 488 ASP A OD1   1 
ATOM   3905 O  OD2   . ASP A 1 489 ? 28.26038 63.88612  -51.82478 1.000 39.36804  ? 488 ASP A OD2   1 
ATOM   3906 N  N     . SER A 1 490 ? 31.67476 65.47819  -47.27449 1.000 36.76315  ? 489 SER A N     1 
ATOM   3907 C  CA    . SER A 1 490 ? 31.90860 66.44083  -46.21079 1.000 36.36070  ? 489 SER A CA    1 
ATOM   3908 C  C     . SER A 1 490 ? 33.38592 66.80049  -46.10326 1.000 42.34474  ? 489 SER A C     1 
ATOM   3909 O  O     . SER A 1 490 ? 34.25878 66.20031  -46.74065 1.000 43.69915  ? 489 SER A O     1 
ATOM   3910 C  CB    . SER A 1 490 ? 31.40891 65.88848  -44.87974 1.000 38.17025  ? 489 SER A CB    1 
ATOM   3911 O  OG    . SER A 1 490 ? 31.79696 64.52979  -44.71604 1.000 39.32885  ? 489 SER A OG    1 
ATOM   3912 N  N     . GLY A 1 491 ? 33.65583 67.80834  -45.27979 1.000 37.45425  ? 490 GLY A N     1 
ATOM   3913 C  CA    . GLY A 1 491 ? 35.00661 68.22478  -45.00412 1.000 26.72089  ? 490 GLY A CA    1 
ATOM   3914 C  C     . GLY A 1 491 ? 35.59017 67.39343  -43.89084 1.000 36.72354  ? 490 GLY A C     1 
ATOM   3915 O  O     . GLY A 1 491 ? 35.00318 66.41621  -43.43023 1.000 40.91910  ? 490 GLY A O     1 
ATOM   3916 N  N     . LEU A 1 492 ? 36.77646 67.80182  -43.43974 1.000 38.53876  ? 491 LEU A N     1 
ATOM   3917 C  CA    . LEU A 1 492 ? 37.43834 67.09407  -42.35605 1.000 34.51781  ? 491 LEU A CA    1 
ATOM   3918 C  C     . LEU A 1 492 ? 36.64821 67.13339  -41.05783 1.000 35.64332  ? 491 LEU A C     1 
ATOM   3919 O  O     . LEU A 1 492 ? 37.00202 66.41996  -40.10974 1.000 37.55205  ? 491 LEU A O     1 
ATOM   3920 C  CB    . LEU A 1 492 ? 38.83695 67.66933  -42.13640 1.000 35.83173  ? 491 LEU A CB    1 
ATOM   3921 C  CG    . LEU A 1 492 ? 39.85130 67.44737  -43.26579 1.000 36.33697  ? 491 LEU A CG    1 
ATOM   3922 C  CD1   . LEU A 1 492 ? 41.17686 68.10085  -42.93668 1.000 34.43500  ? 491 LEU A CD1   1 
ATOM   3923 C  CD2   . LEU A 1 492 ? 40.06297 65.99038  -43.55203 1.000 30.92815  ? 491 LEU A CD2   1 
ATOM   3924 N  N     . GLU A 1 493 ? 35.59595 67.93962  -40.98036 1.000 39.24858  ? 492 GLU A N     1 
ATOM   3925 C  CA    . GLU A 1 493 ? 34.80021 68.05015  -39.76072 1.000 43.17845  ? 492 GLU A CA    1 
ATOM   3926 C  C     . GLU A 1 493 ? 33.33407 68.07138  -40.15838 1.000 38.48535  ? 492 GLU A C     1 
ATOM   3927 O  O     . GLU A 1 493 ? 32.92865 68.91530  -40.95957 1.000 45.92508  ? 492 GLU A O     1 
ATOM   3928 C  CB    . GLU A 1 493 ? 35.20356 69.30060  -38.95632 1.000 33.95342  ? 492 GLU A CB    1 
ATOM   3929 C  CG    . GLU A 1 493 ? 36.69187 69.24777  -38.55897 1.000 40.69700  ? 492 GLU A CG    1 
ATOM   3930 C  CD    . GLU A 1 493 ? 37.14122 70.24199  -37.48374 1.000 48.36228  ? 492 GLU A CD    1 
ATOM   3931 O  OE1   . GLU A 1 493 ? 38.35595 70.55603  -37.45006 1.000 52.50135  ? 492 GLU A OE1   1 
ATOM   3932 O  OE2   . GLU A 1 493 ? 36.31629 70.69382  -36.66341 1.000 49.98929  ? 492 GLU A OE2   1 
ATOM   3933 N  N     . VAL A 1 494 ? 32.54344 67.14110  -39.63205 1.000 35.60039  ? 493 VAL A N     1 
ATOM   3934 C  CA    . VAL A 1 494 ? 31.15545 67.01917  -40.07368 1.000 39.28359  ? 493 VAL A CA    1 
ATOM   3935 C  C     . VAL A 1 494 ? 30.26626 66.60713  -38.90251 1.000 42.00405  ? 493 VAL A C     1 
ATOM   3936 O  O     . VAL A 1 494 ? 30.64476 65.77484  -38.07054 1.000 40.65750  ? 493 VAL A O     1 
ATOM   3937 C  CB    . VAL A 1 494 ? 31.02626 66.03115  -41.25177 1.000 37.26235  ? 493 VAL A CB    1 
ATOM   3938 C  CG1   . VAL A 1 494 ? 31.51924 64.65580  -40.86094 1.000 37.75078  ? 493 VAL A CG1   1 
ATOM   3939 C  CG2   . VAL A 1 494 ? 29.59417 65.94974  -41.72399 1.000 37.50310  ? 493 VAL A CG2   1 
ATOM   3940 N  N     . ASN A 1 495 ? 29.09044 67.23496  -38.82686 1.000 39.50835  ? 494 ASN A N     1 
ATOM   3941 C  CA    . ASN A 1 495 ? 27.98810 66.78614  -37.99262 1.000 36.73390  ? 494 ASN A CA    1 
ATOM   3942 C  C     . ASN A 1 495 ? 27.04246 65.97383  -38.87154 1.000 39.70378  ? 494 ASN A C     1 
ATOM   3943 O  O     . ASN A 1 495 ? 26.65310 66.43177  -39.94919 1.000 40.96066  ? 494 ASN A O     1 
ATOM   3944 C  CB    . ASN A 1 495 ? 27.24602 67.98202  -37.38844 1.000 37.69411  ? 494 ASN A CB    1 
ATOM   3945 C  CG    . ASN A 1 495 ? 28.08237 68.75796  -36.38678 1.000 41.31876  ? 494 ASN A CG    1 
ATOM   3946 O  OD1   . ASN A 1 495 ? 28.60984 68.18306  -35.42824 1.000 41.23786  ? 494 ASN A OD1   1 
ATOM   3947 N  ND2   . ASN A 1 495 ? 28.20446 70.07517  -36.59795 1.000 36.78300  ? 494 ASN A ND2   1 
ATOM   3948 N  N     . ILE A 1 496 ? 26.67329 64.77904  -38.42404 1.000 38.11061  ? 495 ILE A N     1 
ATOM   3949 C  CA    . ILE A 1 496 ? 25.73771 63.93310  -39.15347 1.000 36.89364  ? 495 ILE A CA    1 
ATOM   3950 C  C     . ILE A 1 496 ? 24.56564 63.58275  -38.24531 1.000 39.46587  ? 495 ILE A C     1 
ATOM   3951 O  O     . ILE A 1 496 ? 24.76045 63.22652  -37.07908 1.000 39.55023  ? 495 ILE A O     1 
ATOM   3952 C  CB    . ILE A 1 496 ? 26.42961 62.65744  -39.66029 1.000 39.21038  ? 495 ILE A CB    1 
ATOM   3953 C  CG1   . ILE A 1 496 ? 27.60101 63.01355  -40.57247 1.000 37.25660  ? 495 ILE A CG1   1 
ATOM   3954 C  CG2   . ILE A 1 496 ? 25.43172 61.74971  -40.36774 1.000 38.98985  ? 495 ILE A CG2   1 
ATOM   3955 C  CD1   . ILE A 1 496 ? 28.34507 61.80017  -41.05520 1.000 33.34935  ? 495 ILE A CD1   1 
ATOM   3956 N  N     . VAL A 1 497 ? 23.34897 63.67302  -38.77884 1.000 38.69341  ? 496 VAL A N     1 
ATOM   3957 C  CA    . VAL A 1 497 ? 22.13285 63.31492  -38.05146 1.000 36.35763  ? 496 VAL A CA    1 
ATOM   3958 C  C     . VAL A 1 497 ? 21.41776 62.20250  -38.81225 1.000 38.89535  ? 496 VAL A C     1 
ATOM   3959 O  O     . VAL A 1 497 ? 21.11530 62.34330  -40.01075 1.000 40.32541  ? 496 VAL A O     1 
ATOM   3960 C  CB    . VAL A 1 497 ? 21.21457 64.52301  -37.85524 1.000 33.87075  ? 496 VAL A CB    1 
ATOM   3961 C  CG1   . VAL A 1 497 ? 20.02172 64.13022  -37.03360 1.000 35.17324  ? 496 VAL A CG1   1 
ATOM   3962 C  CG2   . VAL A 1 497 ? 21.97415 65.62426  -37.16578 1.000 37.42088  ? 496 VAL A CG2   1 
ATOM   3963 N  N     . THR A 1 498 ? 21.13606 61.10450  -38.11010 1.000 39.72949  ? 497 THR A N     1 
ATOM   3964 C  CA    . THR A 1 498 ? 20.51021 59.91770  -38.68030 1.000 42.43214  ? 497 THR A CA    1 
ATOM   3965 C  C     . THR A 1 498 ? 19.25845 59.55261  -37.89335 1.000 38.20495  ? 497 THR A C     1 
ATOM   3966 O  O     . THR A 1 498 ? 19.13696 59.88963  -36.71255 1.000 39.47292  ? 497 THR A O     1 
ATOM   3967 C  CB    . THR A 1 498 ? 21.48391 58.72792  -38.67658 1.000 38.90641  ? 497 THR A CB    1 
ATOM   3968 O  OG1   . THR A 1 498 ? 20.81428 57.54626  -39.13720 1.000 41.75903  ? 497 THR A OG1   1 
ATOM   3969 C  CG2   . THR A 1 498 ? 22.00168 58.50485  -37.28898 1.000 34.49664  ? 497 THR A CG2   1 
ATOM   3970 N  N     . ASP A 1 499 ? 18.31870 58.87441  -38.56037 1.000 39.33533  ? 498 ASP A N     1 
ATOM   3971 C  CA    . ASP A 1 499 ? 17.12715 58.35730  -37.89464 1.000 36.83745  ? 498 ASP A CA    1 
ATOM   3972 C  C     . ASP A 1 499 ? 17.24461 56.87587  -37.54950 1.000 39.78489  ? 498 ASP A C     1 
ATOM   3973 O  O     . ASP A 1 499 ? 16.29423 56.30565  -37.01219 1.000 49.68284  ? 498 ASP A O     1 
ATOM   3974 C  CB    . ASP A 1 499 ? 15.85330 58.62589  -38.73997 1.000 31.68326  ? 498 ASP A CB    1 
ATOM   3975 C  CG    . ASP A 1 499 ? 15.81347 57.86401  -40.10154 1.000 40.80556  ? 498 ASP A CG    1 
ATOM   3976 O  OD1   . ASP A 1 499 ? 16.71402 57.09351  -40.46506 1.000 40.90786  ? 498 ASP A OD1   1 
ATOM   3977 O  OD2   . ASP A 1 499 ? 14.83863 58.04426  -40.85332 1.000 48.13951  ? 498 ASP A OD2   1 
ATOM   3978 N  N     . SER A 1 500 ? 18.39636 56.25114  -37.79729 1.000 37.32721  ? 499 SER A N     1 
ATOM   3979 C  CA    . SER A 1 500 ? 18.51986 54.79395  -37.84430 1.000 38.03101  ? 499 SER A CA    1 
ATOM   3980 C  C     . SER A 1 500 ? 19.36697 54.27161  -36.68605 1.000 37.94299  ? 499 SER A C     1 
ATOM   3981 O  O     . SER A 1 500 ? 20.59475 54.38403  -36.71232 1.000 38.42652  ? 499 SER A O     1 
ATOM   3982 C  CB    . SER A 1 500 ? 19.12269 54.37584  -39.18077 1.000 36.97715  ? 499 SER A CB    1 
ATOM   3983 O  OG    . SER A 1 500 ? 19.73696 53.10902  -39.08345 1.000 40.94774  ? 499 SER A OG    1 
ATOM   3984 N  N     . GLN A 1 501 ? 18.72207 53.67163  -35.67912 1.000 45.26167  ? 500 GLN A N     1 
ATOM   3985 C  CA    . GLN A 1 501 ? 19.48798 53.21641  -34.51726 1.000 46.60311  ? 500 GLN A CA    1 
ATOM   3986 C  C     . GLN A 1 501 ? 20.33827 52.00327  -34.83021 1.000 41.52293  ? 500 GLN A C     1 
ATOM   3987 O  O     . GLN A 1 501 ? 21.34176 51.78703  -34.14789 1.000 42.32909  ? 500 GLN A O     1 
ATOM   3988 C  CB    . GLN A 1 501 ? 18.58465 52.91343  -33.31935 1.000 50.96234  ? 500 GLN A CB    1 
ATOM   3989 C  CG    . GLN A 1 501 ? 17.50663 51.88319  -33.53928 1.000 57.97849  ? 500 GLN A CG    1 
ATOM   3990 C  CD    . GLN A 1 501 ? 16.51760 51.85690  -32.38577 1.000 64.26357  ? 500 GLN A CD    1 
ATOM   3991 O  OE1   . GLN A 1 501 ? 16.57871 50.98428  -31.51749 1.000 68.35448  ? 500 GLN A OE1   1 
ATOM   3992 N  NE2   . GLN A 1 501 ? 15.60536 52.82784  -32.36736 1.000 61.77868  ? 500 GLN A NE2   1 
ATOM   3993 N  N     . TYR A 1 502 ? 19.97342 51.23763  -35.85816 1.000 35.04056  ? 501 TYR A N     1 
ATOM   3994 C  CA    . TYR A 1 502 ? 20.85917 50.22476  -36.41279 1.000 35.73002  ? 501 TYR A CA    1 
ATOM   3995 C  C     . TYR A 1 502 ? 22.23084 50.80663  -36.76469 1.000 41.01607  ? 501 TYR A C     1 
ATOM   3996 O  O     . TYR A 1 502 ? 23.27413 50.38587  -36.22354 1.000 41.27469  ? 501 TYR A O     1 
ATOM   3997 C  CB    . TYR A 1 502 ? 20.19254 49.62062  -37.64846 1.000 40.65933  ? 501 TYR A CB    1 
ATOM   3998 C  CG    . TYR A 1 502 ? 21.11057 48.76979  -38.49710 1.000 44.77282  ? 501 TYR A CG    1 
ATOM   3999 C  CD1   . TYR A 1 502 ? 21.49678 47.50366  -38.07575 1.000 42.46497  ? 501 TYR A CD1   1 
ATOM   4000 C  CD2   . TYR A 1 502 ? 21.58561 49.22758  -39.72099 1.000 41.52559  ? 501 TYR A CD2   1 
ATOM   4001 C  CE1   . TYR A 1 502 ? 22.33762 46.71589  -38.84651 1.000 45.36834  ? 501 TYR A CE1   1 
ATOM   4002 C  CE2   . TYR A 1 502 ? 22.42983 48.45072  -40.49368 1.000 44.89679  ? 501 TYR A CE2   1 
ATOM   4003 C  CZ    . TYR A 1 502 ? 22.80421 47.19102  -40.05214 1.000 46.47170  ? 501 TYR A CZ    1 
ATOM   4004 O  OH    . TYR A 1 502 ? 23.64719 46.40136  -40.81105 1.000 44.56152  ? 501 TYR A OH    1 
ATOM   4005 N  N     . ALA A 1 503 ? 22.23985 51.77507  -37.69322 1.000 38.60038  ? 502 ALA A N     1 
ATOM   4006 C  CA    . ALA A 1 503 ? 23.49114 52.37194  -38.15248 1.000 37.19058  ? 502 ALA A CA    1 
ATOM   4007 C  C     . ALA A 1 503 ? 24.23842 53.03998  -37.01304 1.000 36.55544  ? 502 ALA A C     1 
ATOM   4008 O  O     . ALA A 1 503 ? 25.47525 52.98175  -36.94617 1.000 32.56722  ? 502 ALA A O     1 
ATOM   4009 C  CB    . ALA A 1 503 ? 23.21333 53.38093  -39.25305 1.000 34.50931  ? 502 ALA A CB    1 
ATOM   4010 N  N     . LEU A 1 504 ? 23.50238 53.67644  -36.10292 1.000 38.28835  ? 503 LEU A N     1 
ATOM   4011 C  CA    . LEU A 1 504 ? 24.15204 54.37664  -35.00415 1.000 41.02201  ? 503 LEU A CA    1 
ATOM   4012 C  C     . LEU A 1 504 ? 24.82301 53.39824  -34.05397 1.000 43.41626  ? 503 LEU A C     1 
ATOM   4013 O  O     . LEU A 1 504 ? 25.95985 53.62875  -33.62455 1.000 38.75916  ? 503 LEU A O     1 
ATOM   4014 C  CB    . LEU A 1 504 ? 23.13885 55.23055  -34.26098 1.000 42.49359  ? 503 LEU A CB    1 
ATOM   4015 C  CG    . LEU A 1 504 ? 23.69010 55.87303  -32.99944 1.000 44.75619  ? 503 LEU A CG    1 
ATOM   4016 C  CD1   . LEU A 1 504 ? 24.31105 57.20355  -33.35873 1.000 43.97858  ? 503 LEU A CD1   1 
ATOM   4017 C  CD2   . LEU A 1 504 ? 22.57267 56.04689  -31.98769 1.000 48.72678  ? 503 LEU A CD2   1 
ATOM   4018 N  N     . GLY A 1 505 ? 24.13629 52.29296  -33.72578 1.000 41.46092  ? 504 GLY A N     1 
ATOM   4019 C  CA    . GLY A 1 505 ? 24.74481 51.27150  -32.88929 1.000 37.39375  ? 504 GLY A CA    1 
ATOM   4020 C  C     . GLY A 1 505 ? 25.99913 50.66866  -33.50255 1.000 38.03700  ? 504 GLY A C     1 
ATOM   4021 O  O     . GLY A 1 505 ? 26.98232 50.41274  -32.80411 1.000 40.41806  ? 504 GLY A O     1 
ATOM   4022 N  N     . ILE A 1 506 ? 25.99730 50.43771  -34.81303 1.000 34.23204  ? 505 ILE A N     1 
ATOM   4023 C  CA    . ILE A 1 506 ? 27.24231 49.97035  -35.41949 1.000 39.26126  ? 505 ILE A CA    1 
ATOM   4024 C  C     . ILE A 1 506 ? 28.33722 51.02671  -35.27241 1.000 39.95317  ? 505 ILE A C     1 
ATOM   4025 O  O     . ILE A 1 506 ? 29.32859 50.81705  -34.56540 1.000 40.29243  ? 505 ILE A O     1 
ATOM   4026 C  CB    . ILE A 1 506 ? 27.03170 49.55571  -36.88622 1.000 42.96357  ? 505 ILE A CB    1 
ATOM   4027 C  CG1   . ILE A 1 506 ? 26.34856 48.18339  -36.93232 1.000 34.75225  ? 505 ILE A CG1   1 
ATOM   4028 C  CG2   . ILE A 1 506 ? 28.38642 49.47579  -37.62609 1.000 34.08518  ? 505 ILE A CG2   1 
ATOM   4029 C  CD1   . ILE A 1 506 ? 25.96160 47.74742  -38.31803 1.000 42.88346  ? 505 ILE A CD1   1 
ATOM   4030 N  N     . ILE A 1 507 ? 28.14347 52.20186  -35.88475 1.000 42.35141  ? 506 ILE A N     1 
ATOM   4031 C  CA    . ILE A 1 507 ? 29.21564 53.20207  -35.96260 1.000 37.92632  ? 506 ILE A CA    1 
ATOM   4032 C  C     . ILE A 1 507 ? 29.68099 53.65994  -34.58178 1.000 42.20668  ? 506 ILE A C     1 
ATOM   4033 O  O     . ILE A 1 507 ? 30.85039 54.02808  -34.40183 1.000 44.47352  ? 506 ILE A O     1 
ATOM   4034 C  CB    . ILE A 1 507 ? 28.76529 54.39626  -36.83092 1.000 39.02452  ? 506 ILE A CB    1 
ATOM   4035 C  CG1   . ILE A 1 507 ? 28.72621 53.98613  -38.30897 1.000 34.34218  ? 506 ILE A CG1   1 
ATOM   4036 C  CG2   . ILE A 1 507 ? 29.68680 55.59513  -36.62200 1.000 34.92217  ? 506 ILE A CG2   1 
ATOM   4037 C  CD1   . ILE A 1 507 ? 27.83905 54.84639  -39.17200 1.000 28.42564  ? 506 ILE A CD1   1 
ATOM   4038 N  N     . GLN A 1 508 ? 28.80387 53.61562  -33.57904 1.000 43.88589  ? 507 GLN A N     1 
ATOM   4039 C  CA    . GLN A 1 508 ? 29.15685 54.12945  -32.25856 1.000 45.65873  ? 507 GLN A CA    1 
ATOM   4040 C  C     . GLN A 1 508 ? 30.16270 53.24494  -31.53862 1.000 47.48391  ? 507 GLN A C     1 
ATOM   4041 O  O     . GLN A 1 508 ? 30.90011 53.72866  -30.67289 1.000 49.16210  ? 507 GLN A O     1 
ATOM   4042 C  CB    . GLN A 1 508 ? 27.90007 54.25898  -31.41820 1.000 48.94369  ? 507 GLN A CB    1 
ATOM   4043 C  CG    . GLN A 1 508 ? 28.12469 54.91391  -30.11033 1.000 56.03577  ? 507 GLN A CG    1 
ATOM   4044 C  CD    . GLN A 1 508 ? 27.35097 56.18365  -30.03286 1.000 70.01991  ? 507 GLN A CD    1 
ATOM   4045 O  OE1   . GLN A 1 508 ? 27.38600 56.88909  -29.02261 1.000 86.72921  ? 507 GLN A OE1   1 
ATOM   4046 N  NE2   . GLN A 1 508 ? 26.63100 56.49597  -31.11239 1.000 58.96841  ? 507 GLN A NE2   1 
ATOM   4047 N  N     . ALA A 1 509 ? 30.18469 51.94781  -31.85278 1.000 48.42325  ? 508 ALA A N     1 
ATOM   4048 C  CA    . ALA A 1 509 ? 31.09362 51.01357  -31.20669 1.000 44.49626  ? 508 ALA A CA    1 
ATOM   4049 C  C     . ALA A 1 509 ? 32.49802 51.06296  -31.79474 1.000 40.67822  ? 508 ALA A C     1 
ATOM   4050 O  O     . ALA A 1 509 ? 33.33911 50.23561  -31.43104 1.000 46.46066  ? 508 ALA A O     1 
ATOM   4051 C  CB    . ALA A 1 509 ? 30.52376 49.59558  -31.29393 1.000 37.10010  ? 508 ALA A CB    1 
ATOM   4052 N  N     . GLN A 1 510 ? 32.75174 51.97694  -32.70712 1.000 38.29185  ? 509 GLN A N     1 
ATOM   4053 C  CA    . GLN A 1 510 ? 34.07795 52.29331  -33.22970 1.000 43.56294  ? 509 GLN A CA    1 
ATOM   4054 C  C     . GLN A 1 510 ? 34.76994 51.10161  -33.88113 1.000 42.10801  ? 509 GLN A C     1 
ATOM   4055 O  O     . GLN A 1 510 ? 35.90739 50.77584  -33.51654 1.000 40.27738  ? 509 GLN A O     1 
ATOM   4056 C  CB    . GLN A 1 510 ? 34.95460 52.85395  -32.10627 1.000 44.27032  ? 509 GLN A CB    1 
ATOM   4057 C  CG    . GLN A 1 510 ? 34.33403 54.04395  -31.37097 1.000 45.53541  ? 509 GLN A CG    1 
ATOM   4058 C  CD    . GLN A 1 510 ? 35.21632 54.54814  -30.25342 1.000 54.86595  ? 509 GLN A CD    1 
ATOM   4059 O  OE1   . GLN A 1 510 ? 36.23384 55.21062  -30.49755 1.000 55.63996  ? 509 GLN A OE1   1 
ATOM   4060 N  NE2   . GLN A 1 510 ? 34.84172 54.23118  -29.01359 1.000 51.84636  ? 509 GLN A NE2   1 
ATOM   4061 N  N     . PRO A 1 511 ? 34.14185 50.44024  -34.85225 1.000 40.82668  ? 510 PRO A N     1 
ATOM   4062 C  CA    . PRO A 1 511 ? 34.78897 49.28455  -35.48268 1.000 37.25049  ? 510 PRO A CA    1 
ATOM   4063 C  C     . PRO A 1 511 ? 35.95390 49.68570  -36.36627 1.000 38.70457  ? 510 PRO A C     1 
ATOM   4064 O  O     . PRO A 1 511 ? 35.96312 50.76608  -36.96127 1.000 40.99406  ? 510 PRO A O     1 
ATOM   4065 C  CB    . PRO A 1 511 ? 33.66433 48.67063  -36.32251 1.000 37.48188  ? 510 PRO A CB    1 
ATOM   4066 C  CG    . PRO A 1 511 ? 32.72430 49.81110  -36.58965 1.000 35.44646  ? 510 PRO A CG    1 
ATOM   4067 C  CD    . PRO A 1 511 ? 32.75876 50.62725  -35.33694 1.000 34.94896  ? 510 PRO A CD    1 
ATOM   4068 N  N     . ASP A 1 512 ? 36.93744 48.78149  -36.47453 1.000 38.38214  ? 511 ASP A N     1 
ATOM   4069 C  CA    . ASP A 1 512 ? 37.96389 48.89935  -37.50233 1.000 36.28851  ? 511 ASP A CA    1 
ATOM   4070 C  C     . ASP A 1 512 ? 37.98060 47.73182  -38.48798 1.000 42.22174  ? 511 ASP A C     1 
ATOM   4071 O  O     . ASP A 1 512 ? 38.74063 47.77904  -39.46665 1.000 39.75198  ? 511 ASP A O     1 
ATOM   4072 C  CB    . ASP A 1 512 ? 39.36169 49.08046  -36.87589 1.000 36.59934  ? 511 ASP A CB    1 
ATOM   4073 C  CG    . ASP A 1 512 ? 39.76440 47.94704  -35.92257 1.000 44.17693  ? 511 ASP A CG    1 
ATOM   4074 O  OD1   . ASP A 1 512 ? 39.51063 46.77247  -36.23488 1.000 49.37698  ? 511 ASP A OD1   1 
ATOM   4075 O  OD2   . ASP A 1 512 ? 40.39241 48.22177  -34.86806 1.000 42.95453  ? 511 ASP A OD2   1 
ATOM   4076 N  N     . GLN A 1 513 ? 37.17138 46.69139  -38.26873 1.000 43.04493  ? 512 GLN A N     1 
ATOM   4077 C  CA    . GLN A 1 513 ? 37.01198 45.60981  -39.23206 1.000 40.28376  ? 512 GLN A CA    1 
ATOM   4078 C  C     . GLN A 1 513 ? 35.54111 45.25594  -39.35579 1.000 39.77429  ? 512 GLN A C     1 
ATOM   4079 O  O     . GLN A 1 513 ? 34.78512 45.32649  -38.38255 1.000 38.29805  ? 512 GLN A O     1 
ATOM   4080 C  CB    . GLN A 1 513 ? 37.74991 44.33538  -38.84808 1.000 36.92225  ? 512 GLN A CB    1 
ATOM   4081 C  CG    . GLN A 1 513 ? 39.01634 44.51919  -38.09564 1.000 45.35846  ? 512 GLN A CG    1 
ATOM   4082 C  CD    . GLN A 1 513 ? 39.45073 43.23755  -37.39657 1.000 57.65798  ? 512 GLN A CD    1 
ATOM   4083 O  OE1   . GLN A 1 513 ? 39.28381 42.12359  -37.92991 1.000 53.85290  ? 512 GLN A OE1   1 
ATOM   4084 N  NE2   . GLN A 1 513 ? 40.00201 43.38520  -36.18543 1.000 55.37317  ? 512 GLN A NE2   1 
ATOM   4085 N  N     . SER A 1 514 ? 35.15070 44.83018  -40.55226 1.000 35.57218  ? 513 SER A N     1 
ATOM   4086 C  CA    . SER A 1 514 ? 33.78843 44.38618  -40.76871 1.000 39.02655  ? 513 SER A CA    1 
ATOM   4087 C  C     . SER A 1 514 ? 33.78309 43.37490  -41.90264 1.000 41.45760  ? 513 SER A C     1 
ATOM   4088 O  O     . SER A 1 514 ? 34.61578 43.43683  -42.81287 1.000 38.09244  ? 513 SER A O     1 
ATOM   4089 C  CB    . SER A 1 514 ? 32.85702 45.56740  -41.07446 1.000 37.29821  ? 513 SER A CB    1 
ATOM   4090 O  OG    . SER A 1 514 ? 31.58735 45.13721  -41.54182 1.000 39.05733  ? 513 SER A OG    1 
ATOM   4091 N  N     . GLU A 1 515 ? 32.84717 42.42649  -41.82903 1.000 40.64069  ? 514 GLU A N     1 
ATOM   4092 C  CA    . GLU A 1 515 ? 32.64736 41.54776  -42.96747 1.000 46.27556  ? 514 GLU A CA    1 
ATOM   4093 C  C     . GLU A 1 515 ? 31.82000 42.20634  -44.05858 1.000 44.71784  ? 514 GLU A C     1 
ATOM   4094 O  O     . GLU A 1 515 ? 31.71072 41.64967  -45.15603 1.000 46.04815  ? 514 GLU A O     1 
ATOM   4095 C  CB    . GLU A 1 515 ? 32.01081 40.22855  -42.52342 1.000 46.96952  ? 514 GLU A CB    1 
ATOM   4096 C  CG    . GLU A 1 515 ? 30.53810 40.28767  -42.23268 1.000 55.70128  ? 514 GLU A CG    1 
ATOM   4097 C  CD    . GLU A 1 515 ? 30.08922 39.11121  -41.35729 1.000 66.08968  ? 514 GLU A CD    1 
ATOM   4098 O  OE1   . GLU A 1 515 ? 30.95609 38.54282  -40.64207 1.000 60.28869  ? 514 GLU A OE1   1 
ATOM   4099 O  OE2   . GLU A 1 515 ? 28.87864 38.76501  -41.38100 1.000 64.63896  ? 514 GLU A OE2   1 
ATOM   4100 N  N     . SER A 1 516 ? 31.27952 43.39171  -43.79629 1.000 42.00155  ? 515 SER A N     1 
ATOM   4101 C  CA    . SER A 1 516 ? 30.56356 44.16980  -44.79681 1.000 38.03089  ? 515 SER A CA    1 
ATOM   4102 C  C     . SER A 1 516 ? 31.51809 45.12564  -45.51231 1.000 42.64862  ? 515 SER A C     1 
ATOM   4103 O  O     . SER A 1 516 ? 32.18792 45.94302  -44.86747 1.000 41.94145  ? 515 SER A O     1 
ATOM   4104 C  CB    . SER A 1 516 ? 29.43661 44.94613  -44.12841 1.000 34.70261  ? 515 SER A CB    1 
ATOM   4105 O  OG    . SER A 1 516 ? 29.12315 46.10405  -44.86746 1.000 37.04148  ? 515 SER A OG    1 
ATOM   4106 N  N     . GLU A 1 517 ? 31.57349 45.03118  -46.84266 1.000 39.14978  ? 516 GLU A N     1 
ATOM   4107 C  CA    . GLU A 1 517 ? 32.35843 45.98825  -47.61604 1.000 40.30609  ? 516 GLU A CA    1 
ATOM   4108 C  C     . GLU A 1 517 ? 31.93528 47.42637  -47.30237 1.000 45.94000  ? 516 GLU A C     1 
ATOM   4109 O  O     . GLU A 1 517 ? 32.77951 48.30484  -47.06554 1.000 43.07578  ? 516 GLU A O     1 
ATOM   4110 C  CB    . GLU A 1 517 ? 32.21629 45.69280  -49.11331 1.000 29.70348  ? 516 GLU A CB    1 
ATOM   4111 N  N     . LEU A 1 518 ? 30.62594 47.68307  -47.28587 1.000 40.14351  ? 517 LEU A N     1 
ATOM   4112 C  CA    . LEU A 1 518 ? 30.15276 49.05469  -47.13630 1.000 40.46424  ? 517 LEU A CA    1 
ATOM   4113 C  C     . LEU A 1 518 ? 30.54776 49.63721  -45.77529 1.000 40.77769  ? 517 LEU A C     1 
ATOM   4114 O  O     . LEU A 1 518 ? 30.91023 50.82218  -45.67528 1.000 36.72579  ? 517 LEU A O     1 
ATOM   4115 C  CB    . LEU A 1 518 ? 28.64359 49.09285  -47.36721 1.000 29.62999  ? 517 LEU A CB    1 
ATOM   4116 C  CG    . LEU A 1 518 ? 27.83289 50.26377  -46.83672 1.000 39.74062  ? 517 LEU A CG    1 
ATOM   4117 C  CD1   . LEU A 1 518 ? 28.30907 51.61342  -47.39688 1.000 43.14619  ? 517 LEU A CD1   1 
ATOM   4118 C  CD2   . LEU A 1 518 ? 26.38062 50.04561  -47.16390 1.000 40.26139  ? 517 LEU A CD2   1 
ATOM   4119 N  N     . VAL A 1 519 ? 30.53364 48.81075  -44.72232 1.000 38.10950  ? 518 VAL A N     1 
ATOM   4120 C  CA    . VAL A 1 519 ? 31.01286 49.29440  -43.43109 1.000 37.11259  ? 518 VAL A CA    1 
ATOM   4121 C  C     . VAL A 1 519 ? 32.52034 49.51579  -43.46350 1.000 43.06690  ? 518 VAL A C     1 
ATOM   4122 O  O     . VAL A 1 519 ? 33.02379 50.43705  -42.81061 1.000 41.43630  ? 518 VAL A O     1 
ATOM   4123 C  CB    . VAL A 1 519 ? 30.62533 48.33851  -42.29329 1.000 34.17083  ? 518 VAL A CB    1 
ATOM   4124 C  CG1   . VAL A 1 519 ? 31.07643 48.90079  -40.96376 1.000 31.23965  ? 518 VAL A CG1   1 
ATOM   4125 C  CG2   . VAL A 1 519 ? 29.14513 48.11824  -42.28335 1.000 36.63992  ? 518 VAL A CG2   1 
ATOM   4126 N  N     . ASN A 1 520 ? 33.26923 48.69169  -44.21226 1.000 40.79526  ? 519 ASN A N     1 
ATOM   4127 C  CA    . ASN A 1 520 ? 34.69658 48.95792  -44.36714 1.000 39.59136  ? 519 ASN A CA    1 
ATOM   4128 C  C     . ASN A 1 520 ? 34.92679 50.32134  -45.01657 1.000 42.88542  ? 519 ASN A C     1 
ATOM   4129 O  O     . ASN A 1 520 ? 35.77384 51.09770  -44.55737 1.000 44.54502  ? 519 ASN A O     1 
ATOM   4130 C  CB    . ASN A 1 520 ? 35.37624 47.85332  -45.18245 1.000 40.17691  ? 519 ASN A CB    1 
ATOM   4131 C  CG    . ASN A 1 520 ? 35.70348 46.58227  -44.35028 1.000 43.78911  ? 519 ASN A CG    1 
ATOM   4132 O  OD1   . ASN A 1 520 ? 35.98019 46.64093  -43.15222 1.000 40.23499  ? 519 ASN A OD1   1 
ATOM   4133 N  ND2   . ASN A 1 520 ? 35.67836 45.43142  -45.01438 1.000 44.08509  ? 519 ASN A ND2   1 
ATOM   4134 N  N     . GLN A 1 521 ? 34.17280 50.63745  -46.07681 1.000 42.48031  ? 520 GLN A N     1 
ATOM   4135 C  CA    . GLN A 1 521 ? 34.33854 51.92595  -46.75074 1.000 41.49165  ? 520 GLN A CA    1 
ATOM   4136 C  C     . GLN A 1 521 ? 34.01137 53.08197  -45.80727 1.000 44.65966  ? 520 GLN A C     1 
ATOM   4137 O  O     . GLN A 1 521 ? 34.74828 54.08383  -45.74560 1.000 44.87437  ? 520 GLN A O     1 
ATOM   4138 C  CB    . GLN A 1 521 ? 33.46353 51.97868  -48.00920 1.000 42.71930  ? 520 GLN A CB    1 
ATOM   4139 C  CG    . GLN A 1 521 ? 33.99553 51.13562  -49.19330 1.000 48.02583  ? 520 GLN A CG    1 
ATOM   4140 C  CD    . GLN A 1 521 ? 32.97119 50.92688  -50.33553 1.000 55.64584  ? 520 GLN A CD    1 
ATOM   4141 O  OE1   . GLN A 1 521 ? 33.27215 50.27642  -51.34820 1.000 60.91269  ? 520 GLN A OE1   1 
ATOM   4142 N  NE2   . GLN A 1 521 ? 31.76440 51.47056  -50.16842 1.000 47.78928  ? 520 GLN A NE2   1 
ATOM   4143 N  N     . ILE A 1 522 ? 32.92263 52.94567  -45.04103 1.000 42.51820  ? 521 ILE A N     1 
ATOM   4144 C  CA    . ILE A 1 522 ? 32.61048 53.93400  -44.01219 1.000 37.50148  ? 521 ILE A CA    1 
ATOM   4145 C  C     . ILE A 1 522 ? 33.77893 54.08413  -43.04110 1.000 38.48181  ? 521 ILE A C     1 
ATOM   4146 O  O     . ILE A 1 522 ? 34.22145 55.20014  -42.75821 1.000 42.10515  ? 521 ILE A O     1 
ATOM   4147 C  CB    . ILE A 1 522 ? 31.31193 53.55813  -43.27724 1.000 35.10587  ? 521 ILE A CB    1 
ATOM   4148 C  CG1   . ILE A 1 522 ? 30.10441 53.84008  -44.15541 1.000 33.78470  ? 521 ILE A CG1   1 
ATOM   4149 C  CG2   . ILE A 1 522 ? 31.19206 54.33809  -41.97783 1.000 34.63499  ? 521 ILE A CG2   1 
ATOM   4150 C  CD1   . ILE A 1 522 ? 28.81786 53.35459  -43.56267 1.000 35.02951  ? 521 ILE A CD1   1 
ATOM   4151 N  N     . ILE A 1 523 ? 34.28350 52.96506  -42.50978 1.000 38.31905  ? 522 ILE A N     1 
ATOM   4152 C  CA    . ILE A 1 523 ? 35.38809 52.99133  -41.54461 1.000 41.82334  ? 522 ILE A CA    1 
ATOM   4153 C  C     . ILE A 1 523 ? 36.57674 53.76841  -42.10669 1.000 41.50101  ? 522 ILE A C     1 
ATOM   4154 O  O     . ILE A 1 523 ? 37.19640 54.59237  -41.41846 1.000 38.87965  ? 522 ILE A O     1 
ATOM   4155 C  CB    . ILE A 1 523 ? 35.79232 51.55230  -41.15984 1.000 36.36748  ? 522 ILE A CB    1 
ATOM   4156 C  CG1   . ILE A 1 523 ? 34.86952 50.99296  -40.08559 1.000 36.89822  ? 522 ILE A CG1   1 
ATOM   4157 C  CG2   . ILE A 1 523 ? 37.21695 51.49025  -40.65415 1.000 32.63876  ? 522 ILE A CG2   1 
ATOM   4158 C  CD1   . ILE A 1 523 ? 34.99132 49.48704  -39.93965 1.000 38.55192  ? 522 ILE A CD1   1 
ATOM   4159 N  N     . GLU A 1 524 ? 36.92284 53.49003  -43.36171 1.000 39.14672  ? 523 GLU A N     1 
ATOM   4160 C  CA    . GLU A 1 524 ? 38.00686 54.20530  -44.01949 1.000 41.00086  ? 523 GLU A CA    1 
ATOM   4161 C  C     . GLU A 1 524 ? 37.76568 55.71652  -43.99293 1.000 41.52754  ? 523 GLU A C     1 
ATOM   4162 O  O     . GLU A 1 524 ? 38.63290 56.50238  -43.57655 1.000 43.94399  ? 523 GLU A O     1 
ATOM   4163 C  CB    . GLU A 1 524 ? 38.14053 53.68855  -45.44843 1.000 41.33783  ? 523 GLU A CB    1 
ATOM   4164 C  CG    . GLU A 1 524 ? 39.27403 54.32187  -46.21164 1.000 59.04953  ? 523 GLU A CG    1 
ATOM   4165 C  CD    . GLU A 1 524 ? 39.29154 53.90319  -47.67070 1.000 69.80542  ? 523 GLU A CD    1 
ATOM   4166 O  OE1   . GLU A 1 524 ? 38.66161 52.87006  -48.00811 1.000 68.67312  ? 523 GLU A OE1   1 
ATOM   4167 O  OE2   . GLU A 1 524 ? 39.93270 54.61959  -48.47603 1.000 75.74776  ? 523 GLU A OE2   1 
ATOM   4168 N  N     . GLN A 1 525 ? 36.57483 56.13773  -44.41191 1.000 40.34561  ? 524 GLN A N     1 
ATOM   4169 C  CA    . GLN A 1 525 ? 36.23261 57.55130  -44.34708 1.000 36.55612  ? 524 GLN A CA    1 
ATOM   4170 C  C     . GLN A 1 525 ? 36.40493 58.09979  -42.93383 1.000 41.35337  ? 524 GLN A C     1 
ATOM   4171 O  O     . GLN A 1 525 ? 36.97945 59.17707  -42.73548 1.000 43.31620  ? 524 GLN A O     1 
ATOM   4172 C  CB    . GLN A 1 525 ? 34.79632 57.76178  -44.82809 1.000 39.67246  ? 524 GLN A CB    1 
ATOM   4173 C  CG    . GLN A 1 525 ? 34.56702 57.45861  -46.29296 1.000 38.34582  ? 524 GLN A CG    1 
ATOM   4174 C  CD    . GLN A 1 525 ? 35.43413 58.30101  -47.20642 1.000 45.16014  ? 524 GLN A CD    1 
ATOM   4175 O  OE1   . GLN A 1 525 ? 35.95636 57.80885  -48.21709 1.000 47.22384  ? 524 GLN A OE1   1 
ATOM   4176 N  NE2   . GLN A 1 525 ? 35.59133 59.58395  -46.86211 1.000 43.75888  ? 524 GLN A NE2   1 
ATOM   4177 N  N     . LEU A 1 526 ? 35.91361 57.36663  -41.93413 1.000 39.83602  ? 525 LEU A N     1 
ATOM   4178 C  CA    . LEU A 1 526 ? 35.96025 57.86811  -40.56268 1.000 36.26296  ? 525 LEU A CA    1 
ATOM   4179 C  C     . LEU A 1 526 ? 37.38934 58.03955  -40.08724 1.000 39.09439  ? 525 LEU A C     1 
ATOM   4180 O  O     . LEU A 1 526 ? 37.67134 58.90135  -39.24627 1.000 39.12950  ? 525 LEU A O     1 
ATOM   4181 C  CB    . LEU A 1 526 ? 35.21318 56.92563  -39.63118 1.000 37.87292  ? 525 LEU A CB    1 
ATOM   4182 C  CG    . LEU A 1 526 ? 33.69563 56.96872  -39.74583 1.000 38.39700  ? 525 LEU A CG    1 
ATOM   4183 C  CD1   . LEU A 1 526 ? 33.08296 55.81686  -38.99444 1.000 35.05165  ? 525 LEU A CD1   1 
ATOM   4184 C  CD2   . LEU A 1 526 ? 33.20214 58.29240  -39.20570 1.000 36.62882  ? 525 LEU A CD2   1 
ATOM   4185 N  N     . ILE A 1 527 ? 38.29878 57.20410  -40.58522 1.000 39.49295  ? 526 ILE A N     1 
ATOM   4186 C  CA    . ILE A 1 527 ? 39.69370 57.35629  -40.19920 1.000 38.85444  ? 526 ILE A CA    1 
ATOM   4187 C  C     . ILE A 1 527 ? 40.27511 58.59134  -40.86802 1.000 43.57973  ? 526 ILE A C     1 
ATOM   4188 O  O     . ILE A 1 527 ? 41.14900 59.26242  -40.30421 1.000 40.38849  ? 526 ILE A O     1 
ATOM   4189 C  CB    . ILE A 1 527 ? 40.49159 56.08665  -40.54640 1.000 42.45151  ? 526 ILE A CB    1 
ATOM   4190 C  CG1   . ILE A 1 527 ? 39.95521 54.88992  -39.77007 1.000 41.46750  ? 526 ILE A CG1   1 
ATOM   4191 C  CG2   . ILE A 1 527 ? 41.94705 56.25920  -40.21097 1.000 42.27035  ? 526 ILE A CG2   1 
ATOM   4192 C  CD1   . ILE A 1 527 ? 40.40728 53.58889  -40.33859 1.000 37.25103  ? 526 ILE A CD1   1 
ATOM   4193 N  N     . LYS A 1 528 ? 39.80668 58.91564  -42.07728 1.000 40.28721  ? 527 LYS A N     1 
ATOM   4194 C  CA    . LYS A 1 528 ? 40.30903 60.11472  -42.73491 1.000 36.72189  ? 527 LYS A CA    1 
ATOM   4195 C  C     . LYS A 1 528 ? 39.84848 61.40815  -42.05650 1.000 42.51760  ? 527 LYS A C     1 
ATOM   4196 O  O     . LYS A 1 528 ? 40.44216 62.46374  -42.30292 1.000 44.29880  ? 527 LYS A O     1 
ATOM   4197 C  CB    . LYS A 1 528 ? 39.88250 60.13732  -44.20082 1.000 37.10778  ? 527 LYS A CB    1 
ATOM   4198 C  CG    . LYS A 1 528 ? 40.67900 59.24997  -45.10924 1.000 42.59620  ? 527 LYS A CG    1 
ATOM   4199 C  CD    . LYS A 1 528 ? 40.20597 59.40993  -46.54588 1.000 53.07412  ? 527 LYS A CD    1 
ATOM   4200 C  CE    . LYS A 1 528 ? 41.05609 58.58490  -47.50945 1.000 67.68274  ? 527 LYS A CE    1 
ATOM   4201 N  NZ    . LYS A 1 528 ? 40.24625 58.05796  -48.65521 1.000 70.03206  ? 527 LYS A NZ    1 
ATOM   4202 N  N     . LYS A 1 529 ? 38.80819 61.36975  -41.23035 1.000 37.36833  ? 528 LYS A N     1 
ATOM   4203 C  CA    . LYS A 1 529 ? 38.26329 62.61493  -40.71326 1.000 35.90391  ? 528 LYS A CA    1 
ATOM   4204 C  C     . LYS A 1 529 ? 39.01417 63.05113  -39.46351 1.000 39.35195  ? 528 LYS A C     1 
ATOM   4205 O  O     . LYS A 1 529 ? 39.78470 62.29835  -38.86394 1.000 34.86056  ? 528 LYS A O     1 
ATOM   4206 C  CB    . LYS A 1 529 ? 36.77674 62.48164  -40.38543 1.000 32.76043  ? 528 LYS A CB    1 
ATOM   4207 C  CG    . LYS A 1 529 ? 35.88689 62.15150  -41.55857 1.000 34.91775  ? 528 LYS A CG    1 
ATOM   4208 C  CD    . LYS A 1 529 ? 35.65522 63.34409  -42.45332 1.000 33.62831  ? 528 LYS A CD    1 
ATOM   4209 C  CE    . LYS A 1 529 ? 34.83902 62.93910  -43.68427 1.000 37.82766  ? 528 LYS A CE    1 
ATOM   4210 N  NZ    . LYS A 1 529 ? 34.62389 64.06832  -44.64359 1.000 38.92526  ? 528 LYS A NZ    1 
ATOM   4211 N  N     . GLU A 1 530 ? 38.77975 64.29996  -39.07447 1.000 40.15167  ? 529 GLU A N     1 
ATOM   4212 C  CA    . GLU A 1 530 ? 39.35275 64.83833  -37.85447 1.000 39.41566  ? 529 GLU A CA    1 
ATOM   4213 C  C     . GLU A 1 530 ? 38.33177 64.92782  -36.74313 1.000 39.28273  ? 529 GLU A C     1 
ATOM   4214 O  O     . GLU A 1 530 ? 38.64741 64.65787  -35.58241 1.000 41.43210  ? 529 GLU A O     1 
ATOM   4215 C  CB    . GLU A 1 530 ? 39.93748 66.22766  -38.11406 1.000 44.29732  ? 529 GLU A CB    1 
ATOM   4216 C  CG    . GLU A 1 530 ? 40.98157 66.25172  -39.21720 1.000 45.32505  ? 529 GLU A CG    1 
ATOM   4217 C  CD    . GLU A 1 530 ? 42.27062 66.89639  -38.76533 1.000 57.61514  ? 529 GLU A CD    1 
ATOM   4218 O  OE1   . GLU A 1 530 ? 42.64331 66.68581  -37.58754 1.000 66.21990  ? 529 GLU A OE1   1 
ATOM   4219 O  OE2   . GLU A 1 530 ? 42.89694 67.62310  -39.57530 1.000 55.90788  ? 529 GLU A OE2   1 
ATOM   4220 N  N     . LYS A 1 531 ? 37.10686 65.31583  -37.07673 1.000 43.83857  ? 530 LYS A N     1 
ATOM   4221 C  CA    . LYS A 1 531 ? 36.02315 65.34601  -36.10931 1.000 43.00421  ? 530 LYS A CA    1 
ATOM   4222 C  C     . LYS A 1 531 ? 34.75463 64.86337  -36.79266 1.000 37.76954  ? 530 LYS A C     1 
ATOM   4223 O  O     . LYS A 1 531 ? 34.42898 65.30826  -37.89686 1.000 38.51693  ? 530 LYS A O     1 
ATOM   4224 C  CB    . LYS A 1 531 ? 35.84085 66.75233  -35.53142 1.000 41.50854  ? 530 LYS A CB    1 
ATOM   4225 C  CG    . LYS A 1 531 ? 36.87678 67.15409  -34.51114 1.000 39.04376  ? 530 LYS A CG    1 
ATOM   4226 C  CD    . LYS A 1 531 ? 36.25855 68.14127  -33.56396 1.000 44.90381  ? 530 LYS A CD    1 
ATOM   4227 C  CE    . LYS A 1 531 ? 37.26758 68.81774  -32.67877 1.000 46.03842  ? 530 LYS A CE    1 
ATOM   4228 N  NZ    . LYS A 1 531 ? 36.53976 69.54460  -31.59746 1.000 57.70673  ? 530 LYS A NZ    1 
ATOM   4229 N  N     . VAL A 1 532 ? 34.07638 63.91733  -36.16109 1.000 35.92741  ? 531 VAL A N     1 
ATOM   4230 C  CA    . VAL A 1 532 ? 32.76810 63.46032  -36.60047 1.000 36.76639  ? 531 VAL A CA    1 
ATOM   4231 C  C     . VAL A 1 532 ? 31.86259 63.46931  -35.38990 1.000 37.64059  ? 531 VAL A C     1 
ATOM   4232 O  O     . VAL A 1 532 ? 32.27821 63.05537  -34.30391 1.000 40.92991  ? 531 VAL A O     1 
ATOM   4233 C  CB    . VAL A 1 532 ? 32.82154 62.05446  -37.22320 1.000 37.37326  ? 531 VAL A CB    1 
ATOM   4234 C  CG1   . VAL A 1 532 ? 31.43343 61.57542  -37.56835 1.000 31.37197  ? 531 VAL A CG1   1 
ATOM   4235 C  CG2   . VAL A 1 532 ? 33.69484 62.07428  -38.45793 1.000 39.55503  ? 531 VAL A CG2   1 
ATOM   4236 N  N     . TYR A 1 533 ? 30.64956 63.97635  -35.55739 1.000 37.80289  ? 532 TYR A N     1 
ATOM   4237 C  CA    . TYR A 1 533 ? 29.64547 63.91645  -34.51109 1.000 39.21027  ? 532 TYR A CA    1 
ATOM   4238 C  C     . TYR A 1 533 ? 28.39088 63.29493  -35.09714 1.000 41.87336  ? 532 TYR A C     1 
ATOM   4239 O  O     . TYR A 1 533 ? 27.96230 63.66226  -36.19582 1.000 40.58243  ? 532 TYR A O     1 
ATOM   4240 C  CB    . TYR A 1 533 ? 29.35995 65.29536  -33.92668 1.000 40.10768  ? 532 TYR A CB    1 
ATOM   4241 C  CG    . TYR A 1 533 ? 28.23082 65.31905  -32.91951 1.000 41.87575  ? 532 TYR A CG    1 
ATOM   4242 C  CD1   . TYR A 1 533 ? 28.43263 64.92044  -31.60272 1.000 43.38307  ? 532 TYR A CD1   1 
ATOM   4243 C  CD2   . TYR A 1 533 ? 26.96084 65.74828  -33.28839 1.000 40.97338  ? 532 TYR A CD2   1 
ATOM   4244 C  CE1   . TYR A 1 533 ? 27.39354 64.94955  -30.67897 1.000 41.17526  ? 532 TYR A CE1   1 
ATOM   4245 C  CE2   . TYR A 1 533 ? 25.92408 65.78381  -32.38385 1.000 38.97385  ? 532 TYR A CE2   1 
ATOM   4246 C  CZ    . TYR A 1 533 ? 26.14213 65.39002  -31.08158 1.000 41.61677  ? 532 TYR A CZ    1 
ATOM   4247 O  OH    . TYR A 1 533 ? 25.09621 65.42902  -30.18562 1.000 43.70634  ? 532 TYR A OH    1 
ATOM   4248 N  N     . LEU A 1 534 ? 27.81362 62.34902  -34.36446 1.000 44.54114  ? 533 LEU A N     1 
ATOM   4249 C  CA    . LEU A 1 534 ? 26.69061 61.55246  -34.84433 1.000 41.46736  ? 533 LEU A CA    1 
ATOM   4250 C  C     . LEU A 1 534 ? 25.57362 61.66643  -33.82290 1.000 38.39756  ? 533 LEU A C     1 
ATOM   4251 O  O     . LEU A 1 534 ? 25.69641 61.15768  -32.70403 1.000 42.11647  ? 533 LEU A O     1 
ATOM   4252 C  CB    . LEU A 1 534 ? 27.10354 60.09382  -35.04339 1.000 44.46724  ? 533 LEU A CB    1 
ATOM   4253 C  CG    . LEU A 1 534 ? 26.36287 59.31871  -36.12370 1.000 42.37593  ? 533 LEU A CG    1 
ATOM   4254 C  CD1   . LEU A 1 534 ? 26.72775 59.88076  -37.46562 1.000 46.43651  ? 533 LEU A CD1   1 
ATOM   4255 C  CD2   . LEU A 1 534 ? 26.71684 57.84915  -36.06088 1.000 45.11192  ? 533 LEU A CD2   1 
ATOM   4256 N  N     . ALA A 1 535 ? 24.50293 62.34759  -34.19415 1.000 37.68831  ? 534 ALA A N     1 
ATOM   4257 C  CA    . ALA A 1 535 ? 23.32818 62.47108  -33.35390 1.000 35.41170  ? 534 ALA A CA    1 
ATOM   4258 C  C     . ALA A 1 535 ? 22.20892 61.60154  -33.90820 1.000 36.55973  ? 534 ALA A C     1 
ATOM   4259 O  O     . ALA A 1 535 ? 22.22968 61.19605  -35.07153 1.000 39.55892  ? 534 ALA A O     1 
ATOM   4260 C  CB    . ALA A 1 535 ? 22.88529 63.93019  -33.26749 1.000 39.88050  ? 534 ALA A CB    1 
ATOM   4261 N  N     . TRP A 1 536 ? 21.22242 61.30937  -33.06829 1.000 39.27619  ? 535 TRP A N     1 
ATOM   4262 C  CA    . TRP A 1 536 ? 20.07377 60.52713  -33.49813 1.000 39.25834  ? 535 TRP A CA    1 
ATOM   4263 C  C     . TRP A 1 536 ? 18.80096 61.34518  -33.35266 1.000 38.72540  ? 535 TRP A C     1 
ATOM   4264 O  O     . TRP A 1 536 ? 18.69663 62.19061  -32.46455 1.000 43.04194  ? 535 TRP A O     1 
ATOM   4265 C  CB    . TRP A 1 536 ? 19.95762 59.24586  -32.68227 1.000 42.05377  ? 535 TRP A CB    1 
ATOM   4266 C  CG    . TRP A 1 536 ? 18.80387 58.38395  -33.06730 1.000 43.98000  ? 535 TRP A CG    1 
ATOM   4267 C  CD1   . TRP A 1 536 ? 18.74266 57.51565  -34.11820 1.000 43.90492  ? 535 TRP A CD1   1 
ATOM   4268 C  CD2   . TRP A 1 536 ? 17.54954 58.29187  -32.39654 1.000 42.83496  ? 535 TRP A CD2   1 
ATOM   4269 N  NE1   . TRP A 1 536 ? 17.52626 56.89369  -34.14809 1.000 43.30803  ? 535 TRP A NE1   1 
ATOM   4270 C  CE2   . TRP A 1 536 ? 16.77148 57.35095  -33.09779 1.000 46.68584  ? 535 TRP A CE2   1 
ATOM   4271 C  CE3   . TRP A 1 536 ? 17.00842 58.90898  -31.26239 1.000 46.19825  ? 535 TRP A CE3   1 
ATOM   4272 C  CZ2   . TRP A 1 536 ? 15.47009 57.01484  -32.70751 1.000 45.20136  ? 535 TRP A CZ2   1 
ATOM   4273 C  CZ3   . TRP A 1 536 ? 15.72243 58.58647  -30.88178 1.000 47.99422  ? 535 TRP A CZ3   1 
ATOM   4274 C  CH2   . TRP A 1 536 ? 14.96397 57.64238  -31.60480 1.000 49.29485  ? 535 TRP A CH2   1 
ATOM   4275 N  N     . VAL A 1 537 ? 17.83501 61.09623  -34.23386 1.000 37.09064  ? 536 VAL A N     1 
ATOM   4276 C  CA    . VAL A 1 537 ? 16.47202 61.60047  -34.03793 1.000 42.13151  ? 536 VAL A CA    1 
ATOM   4277 C  C     . VAL A 1 537 ? 15.47879 60.52113  -34.42274 1.000 41.93897  ? 536 VAL A C     1 
ATOM   4278 O  O     . VAL A 1 537 ? 15.69553 59.74761  -35.36373 1.000 38.75531  ? 536 VAL A O     1 
ATOM   4279 C  CB    . VAL A 1 537 ? 16.17850 62.88236  -34.86674 1.000 38.42035  ? 536 VAL A CB    1 
ATOM   4280 C  CG1   . VAL A 1 537 ? 16.99319 64.09019  -34.37152 1.000 36.76299  ? 536 VAL A CG1   1 
ATOM   4281 C  CG2   . VAL A 1 537 ? 16.37622 62.61752  -36.35049 1.000 38.92503  ? 536 VAL A CG2   1 
ATOM   4282 N  N     . PRO A 1 538 ? 14.34324 60.47432  -33.72244 1.000 46.00897  ? 537 PRO A N     1 
ATOM   4283 C  CA    . PRO A 1 538 ? 13.27432 59.54157  -34.10253 1.000 43.41037  ? 537 PRO A CA    1 
ATOM   4284 C  C     . PRO A 1 538 ? 12.76283 59.82511  -35.50458 1.000 44.09356  ? 537 PRO A C     1 
ATOM   4285 O  O     . PRO A 1 538 ? 12.53697 60.97768  -35.87505 1.000 46.05787  ? 537 PRO A O     1 
ATOM   4286 C  CB    . PRO A 1 538 ? 12.19018 59.80906  -33.05643 1.000 45.71106  ? 537 PRO A CB    1 
ATOM   4287 C  CG    . PRO A 1 538 ? 12.42994 61.22343  -32.64469 1.000 52.60015  ? 537 PRO A CG    1 
ATOM   4288 C  CD    . PRO A 1 538 ? 13.91705 61.39056  -32.64727 1.000 47.15485  ? 537 PRO A CD    1 
ATOM   4289 N  N     . ALA A 1 539 ? 12.56834 58.75961  -36.28134 1.000 43.42779  ? 538 ALA A N     1 
ATOM   4290 C  CA    . ALA A 1 539 ? 12.10090 58.91863  -37.64946 1.000 45.26827  ? 538 ALA A CA    1 
ATOM   4291 C  C     . ALA A 1 539 ? 10.60512 59.24181  -37.69317 1.000 53.50463  ? 538 ALA A C     1 
ATOM   4292 O  O     . ALA A 1 539 ? 9.84972  58.95191  -36.76384 1.000 56.61966  ? 538 ALA A O     1 
ATOM   4293 C  CB    . ALA A 1 539 ? 12.37954 57.65704  -38.45562 1.000 42.50683  ? 538 ALA A CB    1 
ATOM   4294 N  N     . HIS A 1 540 ? 10.18318 59.85930  -38.79775 1.000 55.88993  ? 539 HIS A N     1 
ATOM   4295 C  CA    . HIS A 1 540 ? 8.76681  60.09126  -39.08298 1.000 56.32232  ? 539 HIS A CA    1 
ATOM   4296 C  C     . HIS A 1 540 ? 8.08300  60.85240  -37.95006 1.000 57.47068  ? 539 HIS A C     1 
ATOM   4297 O  O     . HIS A 1 540 ? 7.08938  60.40152  -37.38230 1.000 62.85637  ? 539 HIS A O     1 
ATOM   4298 C  CB    . HIS A 1 540 ? 8.02522  58.77713  -39.33659 1.000 54.84753  ? 539 HIS A CB    1 
ATOM   4299 C  CG    . HIS A 1 540 ? 8.74506  57.81811  -40.22713 1.000 55.81660  ? 539 HIS A CG    1 
ATOM   4300 N  ND1   . HIS A 1 540 ? 9.02075  58.09303  -41.54915 1.000 62.84409  ? 539 HIS A ND1   1 
ATOM   4301 C  CD2   . HIS A 1 540 ? 9.22278  56.57178  -39.99284 1.000 57.33066  ? 539 HIS A CD2   1 
ATOM   4302 C  CE1   . HIS A 1 540 ? 9.65549  57.06379  -42.08698 1.000 64.77308  ? 539 HIS A CE1   1 
ATOM   4303 N  NE2   . HIS A 1 540 ? 9.78616  56.12520  -41.16522 1.000 61.07135  ? 539 HIS A NE2   1 
ATOM   4304 N  N     . LYS A 1 541 ? 8.64314  62.00303  -37.59051 1.000 57.52482  ? 540 LYS A N     1 
ATOM   4305 C  CA    . LYS A 1 541 ? 8.03145  62.84883  -36.57263 1.000 55.08144  ? 540 LYS A CA    1 
ATOM   4306 C  C     . LYS A 1 541 ? 8.14040  64.31883  -36.95169 1.000 55.39652  ? 540 LYS A C     1 
ATOM   4307 O  O     . LYS A 1 541 ? 7.86991  65.18928  -36.10646 1.000 50.80419  ? 540 LYS A O     1 
ATOM   4308 C  CB    . LYS A 1 541 ? 8.66182  62.60352  -35.18790 1.000 57.27121  ? 540 LYS A CB    1 
ATOM   4309 C  CG    . LYS A 1 541 ? 8.52190  61.17638  -34.64377 1.000 56.52209  ? 540 LYS A CG    1 
ATOM   4310 C  CD    . LYS A 1 541 ? 7.10490  60.89932  -34.12605 1.000 70.35545  ? 540 LYS A CD    1 
ATOM   4311 C  CE    . LYS A 1 541 ? 6.83876  59.38401  -33.94044 1.000 71.40302  ? 540 LYS A CE    1 
ATOM   4312 N  NZ    . LYS A 1 541 ? 5.46700  59.06188  -33.40367 1.000 63.53299  ? 540 LYS A NZ    1 
ATOM   4313 N  N     . GLY A 1 542 ? 8.52054  64.61171  -38.19659 1.000 55.20262  ? 541 GLY A N     1 
ATOM   4314 C  CA    . GLY A 1 542 ? 8.60934  65.96371  -38.70954 1.000 53.83770  ? 541 GLY A CA    1 
ATOM   4315 C  C     . GLY A 1 542 ? 9.77211  66.77942  -38.20002 1.000 52.45288  ? 541 GLY A C     1 
ATOM   4316 O  O     . GLY A 1 542 ? 9.82158  67.98358  -38.46023 1.000 62.49325  ? 541 GLY A O     1 
ATOM   4317 N  N     . ILE A 1 543 ? 10.72015 66.16032  -37.49961 1.000 51.84623  ? 542 ILE A N     1 
ATOM   4318 C  CA    . ILE A 1 543 ? 11.79118 66.90195  -36.84557 1.000 49.11156  ? 542 ILE A CA    1 
ATOM   4319 C  C     . ILE A 1 543 ? 12.76788 67.44140  -37.88025 1.000 57.32518  ? 542 ILE A C     1 
ATOM   4320 O  O     . ILE A 1 543 ? 13.17033 66.72336  -38.80557 1.000 57.67675  ? 542 ILE A O     1 
ATOM   4321 C  CB    . ILE A 1 543 ? 12.51626 66.01396  -35.83055 1.000 46.50010  ? 542 ILE A CB    1 
ATOM   4322 C  CG1   . ILE A 1 543 ? 11.62469 65.79183  -34.61111 1.000 53.22594  ? 542 ILE A CG1   1 
ATOM   4323 C  CG2   . ILE A 1 543 ? 13.82111 66.64413  -35.44265 1.000 45.03460  ? 542 ILE A CG2   1 
ATOM   4324 C  CD1   . ILE A 1 543 ? 11.98720 64.56007  -33.81838 1.000 48.55520  ? 542 ILE A CD1   1 
ATOM   4325 N  N     . GLY A 1 544 ? 13.10961 68.73241  -37.74944 1.000 57.62477  ? 543 GLY A N     1 
ATOM   4326 C  CA    . GLY A 1 544 ? 14.26811 69.36296  -38.35799 1.000 47.58233  ? 543 GLY A CA    1 
ATOM   4327 C  C     . GLY A 1 544 ? 14.59457 68.95340  -39.77192 1.000 46.30803  ? 543 GLY A C     1 
ATOM   4328 O  O     . GLY A 1 544 ? 13.69605 68.73329  -40.58318 1.000 51.61205  ? 543 GLY A O     1 
ATOM   4329 N  N     . GLY A 1 545 ? 15.88467 68.82297  -40.07605 1.000 42.88665  ? 544 GLY A N     1 
ATOM   4330 C  CA    . GLY A 1 545 ? 16.26654 68.44545  -41.42219 1.000 45.69485  ? 544 GLY A CA    1 
ATOM   4331 C  C     . GLY A 1 545 ? 15.92172 67.01171  -41.76879 1.000 47.45720  ? 544 GLY A C     1 
ATOM   4332 O  O     . GLY A 1 545 ? 15.87692 66.65827  -42.95535 1.000 49.14199  ? 544 GLY A O     1 
ATOM   4333 N  N     . ASN A 1 546 ? 15.69269 66.17584  -40.75337 1.000 44.85546  ? 545 ASN A N     1 
ATOM   4334 C  CA    . ASN A 1 546 ? 15.25322 64.81244  -40.99343 1.000 43.44843  ? 545 ASN A CA    1 
ATOM   4335 C  C     . ASN A 1 546 ? 14.04971 64.77236  -41.92234 1.000 50.98209  ? 545 ASN A C     1 
ATOM   4336 O  O     . ASN A 1 546 ? 13.96068 63.89649  -42.79313 1.000 52.17887  ? 545 ASN A O     1 
ATOM   4337 C  CB    . ASN A 1 546 ? 14.93519 64.15149  -39.66243 1.000 43.38538  ? 545 ASN A CB    1 
ATOM   4338 C  CG    . ASN A 1 546 ? 14.40722 62.75999  -39.82398 1.000 42.84962  ? 545 ASN A CG    1 
ATOM   4339 O  OD1   . ASN A 1 546 ? 13.23148 62.49749  -39.58091 1.000 52.91817  ? 545 ASN A OD1   1 
ATOM   4340 N  ND2   . ASN A 1 546 ? 15.27006 61.84882  -40.23701 1.000 48.53158  ? 545 ASN A ND2   1 
ATOM   4341 N  N     . GLU A 1 547 ? 13.12606 65.73278  -41.77609 1.000 49.38471  ? 546 GLU A N     1 
ATOM   4342 C  CA    . GLU A 1 547 ? 11.91474 65.72348  -42.59421 1.000 54.09310  ? 546 GLU A CA    1 
ATOM   4343 C  C     . GLU A 1 547 ? 12.22370 65.92678  -44.07628 1.000 53.78071  ? 546 GLU A C     1 
ATOM   4344 O  O     . GLU A 1 547 ? 11.67863 65.22023  -44.93745 1.000 53.67289  ? 546 GLU A O     1 
ATOM   4345 C  CB    . GLU A 1 547 ? 10.94517 66.79832  -42.11503 1.000 60.74011  ? 546 GLU A CB    1 
ATOM   4346 C  CG    . GLU A 1 547 ? 9.68999  66.85780  -42.97094 1.000 64.16252  ? 546 GLU A CG    1 
ATOM   4347 C  CD    . GLU A 1 547 ? 8.76832  67.96522  -42.56268 1.000 73.60555  ? 546 GLU A CD    1 
ATOM   4348 O  OE1   . GLU A 1 547 ? 9.20616  68.82702  -41.76556 1.000 75.82018  ? 546 GLU A OE1   1 
ATOM   4349 O  OE2   . GLU A 1 547 ? 7.60792  67.96835  -43.03488 1.000 80.63046  ? 546 GLU A OE2   1 
ATOM   4350 N  N     . GLN A 1 548 ? 13.06839 66.91565  -44.39005 1.000 52.54575  ? 547 GLN A N     1 
ATOM   4351 C  CA    . GLN A 1 548 ? 13.41545 67.20845  -45.77775 1.000 49.18444  ? 547 GLN A CA    1 
ATOM   4352 C  C     . GLN A 1 548 ? 14.03394 65.99693  -46.46207 1.000 51.72508  ? 547 GLN A C     1 
ATOM   4353 O  O     . GLN A 1 548 ? 13.60885 65.60271  -47.56007 1.000 54.25634  ? 547 GLN A O     1 
ATOM   4354 C  CB    . GLN A 1 548 ? 14.37307 68.40127  -45.83541 1.000 51.51970  ? 547 GLN A CB    1 
ATOM   4355 C  CG    . GLN A 1 548 ? 13.69434 69.78011  -45.89764 1.000 57.55814  ? 547 GLN A CG    1 
ATOM   4356 C  CD    . GLN A 1 548 ? 12.82312 70.09753  -44.68086 1.000 60.22062  ? 547 GLN A CD    1 
ATOM   4357 O  OE1   . GLN A 1 548 ? 11.62674 69.80248  -44.66512 1.000 63.29654  ? 547 GLN A OE1   1 
ATOM   4358 N  NE2   . GLN A 1 548 ? 13.42168 70.71244  -43.66277 1.000 55.97272  ? 547 GLN A NE2   1 
ATOM   4359 N  N     . VAL A 1 549 ? 15.03242 65.37845  -45.82045 1.000 46.33263  ? 548 VAL A N     1 
ATOM   4360 C  CA    . VAL A 1 549 ? 15.70826 64.25246  -46.45974 1.000 45.36784  ? 548 VAL A CA    1 
ATOM   4361 C  C     . VAL A 1 549 ? 14.79534 63.03765  -46.52420 1.000 46.53715  ? 548 VAL A C     1 
ATOM   4362 O  O     . VAL A 1 549 ? 14.86916 62.25816  -47.48313 1.000 45.14018  ? 548 VAL A O     1 
ATOM   4363 C  CB    . VAL A 1 549 ? 17.03685 63.92741  -45.75120 1.000 42.03668  ? 548 VAL A CB    1 
ATOM   4364 C  CG1   . VAL A 1 549 ? 16.80723 63.63293  -44.29342 1.000 42.55659  ? 548 VAL A CG1   1 
ATOM   4365 C  CG2   . VAL A 1 549 ? 17.73613 62.76430  -46.42688 1.000 40.42707  ? 548 VAL A CG2   1 
ATOM   4366 N  N     . ASP A 1 550 ? 13.91714 62.85199  -45.52901 1.000 45.13844  ? 549 ASP A N     1 
ATOM   4367 C  CA    . ASP A 1 550 ? 12.94999 61.76132  -45.60744 1.000 45.37620  ? 549 ASP A CA    1 
ATOM   4368 C  C     . ASP A 1 550 ? 12.04293 61.91749  -46.82558 1.000 50.20834  ? 549 ASP A C     1 
ATOM   4369 O  O     . ASP A 1 550 ? 11.79076 60.94901  -47.55864 1.000 45.38727  ? 549 ASP A O     1 
ATOM   4370 C  CB    . ASP A 1 550 ? 12.13059 61.70003  -44.32395 1.000 43.82337  ? 549 ASP A CB    1 
ATOM   4371 C  CG    . ASP A 1 550 ? 11.08497 60.60519  -44.35744 1.000 51.95179  ? 549 ASP A CG    1 
ATOM   4372 O  OD1   . ASP A 1 550 ? 11.44639 59.43625  -44.59668 1.000 56.56405  ? 549 ASP A OD1   1 
ATOM   4373 O  OD2   . ASP A 1 550 ? 9.89531  60.90849  -44.13921 1.000 55.94449  ? 549 ASP A OD2   1 
ATOM   4374 N  N     . LYS A 1 551 ? 11.57010 63.14239  -47.07689 1.000 52.00366  ? 550 LYS A N     1 
ATOM   4375 C  CA    . LYS A 1 551 ? 10.73567 63.38019  -48.25012 1.000 50.26755  ? 550 LYS A CA    1 
ATOM   4376 C  C     . LYS A 1 551 ? 11.52548 63.24432  -49.54336 1.000 52.51893  ? 550 LYS A C     1 
ATOM   4377 O  O     . LYS A 1 551 ? 10.96522 62.84627  -50.56910 1.000 58.21637  ? 550 LYS A O     1 
ATOM   4378 C  CB    . LYS A 1 551 ? 10.09784 64.75783  -48.16848 1.000 52.09977  ? 550 LYS A CB    1 
ATOM   4379 C  CG    . LYS A 1 551 ? 8.78432  64.85776  -48.89662 1.000 59.19841  ? 550 LYS A CG    1 
ATOM   4380 C  CD    . LYS A 1 551 ? 7.88875  65.88899  -48.21552 1.000 73.52887  ? 550 LYS A CD    1 
ATOM   4381 C  CE    . LYS A 1 551 ? 7.56064  65.47711  -46.77710 1.000 71.55818  ? 550 LYS A CE    1 
ATOM   4382 N  NZ    . LYS A 1 551 ? 7.22204  66.65929  -45.93801 1.000 75.46942  ? 550 LYS A NZ    1 
ATOM   4383 N  N     . LEU A 1 552 ? 12.81720 63.57193  -49.52113 1.000 51.82270  ? 551 LEU A N     1 
ATOM   4384 C  CA    . LEU A 1 552 ? 13.64725 63.37160  -50.70766 1.000 52.87155  ? 551 LEU A CA    1 
ATOM   4385 C  C     . LEU A 1 552 ? 13.82325 61.88411  -51.03273 1.000 52.52045  ? 551 LEU A C     1 
ATOM   4386 O  O     . LEU A 1 552 ? 13.66406 61.46698  -52.18750 1.000 44.85183  ? 551 LEU A O     1 
ATOM   4387 C  CB    . LEU A 1 552 ? 15.00536 64.03636  -50.50202 1.000 51.75433  ? 551 LEU A CB    1 
ATOM   4388 C  CG    . LEU A 1 552 ? 15.41408 65.04758  -51.55993 1.000 54.60860  ? 551 LEU A CG    1 
ATOM   4389 C  CD1   . LEU A 1 552 ? 14.29730 66.03165  -51.77743 1.000 59.59721  ? 551 LEU A CD1   1 
ATOM   4390 C  CD2   . LEU A 1 552 ? 16.65007 65.76850  -51.09008 1.000 58.67279  ? 551 LEU A CD2   1 
ATOM   4391 N  N     . VAL A 1 553 ? 14.16564 61.06514  -50.02766 1.000 50.69005  ? 552 VAL A N     1 
ATOM   4392 C  CA    . VAL A 1 553 ? 14.48336 59.66017  -50.30285 1.000 53.92780  ? 552 VAL A CA    1 
ATOM   4393 C  C     . VAL A 1 553 ? 13.26296 58.76246  -50.35738 1.000 51.69244  ? 552 VAL A C     1 
ATOM   4394 O  O     . VAL A 1 553 ? 13.38382 57.62167  -50.81299 1.000 52.79297  ? 552 VAL A O     1 
ATOM   4395 C  CB    . VAL A 1 553 ? 15.44756 58.98492  -49.30221 1.000 47.69514  ? 552 VAL A CB    1 
ATOM   4396 C  CG1   . VAL A 1 553 ? 16.81736 59.69155  -49.28083 1.000 41.52510  ? 552 VAL A CG1   1 
ATOM   4397 C  CG2   . VAL A 1 553 ? 14.82028 58.86416  -47.90826 1.000 45.60166  ? 552 VAL A CG2   1 
ATOM   4398 N  N     . SER A 1 554 ? 12.10007 59.22447  -49.89981 1.000 53.23992  ? 553 SER A N     1 
ATOM   4399 C  CA    . SER A 1 554 ? 10.89957 58.41032  -50.03796 1.000 55.63511  ? 553 SER A CA    1 
ATOM   4400 C  C     . SER A 1 554 ? 10.28457 58.48067  -51.43003 1.000 59.19462  ? 553 SER A C     1 
ATOM   4401 O  O     . SER A 1 554 ? 9.43212  57.64581  -51.74900 1.000 62.19886  ? 553 SER A O     1 
ATOM   4402 C  CB    . SER A 1 554 ? 9.85221  58.83358  -49.00862 1.000 55.37611  ? 553 SER A CB    1 
ATOM   4403 O  OG    . SER A 1 554 ? 10.07943 58.21797  -47.75667 1.000 65.37198  ? 553 SER A OG    1 
ATOM   4404 N  N     . ALA A 1 555 ? 10.71072 59.43105  -52.26157 1.000 55.62014  ? 554 ALA A N     1 
ATOM   4405 C  CA    . ALA A 1 555 ? 9.94525  59.85131  -53.42745 1.000 58.81211  ? 554 ALA A CA    1 
ATOM   4406 C  C     . ALA A 1 555 ? 9.46519  58.70582  -54.30797 1.000 65.71821  ? 554 ALA A C     1 
ATOM   4407 O  O     . ALA A 1 555 ? 8.26048  58.43876  -54.37546 1.000 75.40614  ? 554 ALA A O     1 
ATOM   4408 C  CB    . ALA A 1 555 ? 10.77127 60.82029  -54.27015 1.000 59.81369  ? 554 ALA A CB    1 
ATOM   4409 N  N     . GLY A 1 556 ? 10.37550 57.99470  -54.95284 1.000 62.53179  ? 555 GLY A N     1 
ATOM   4410 C  CA    . GLY A 1 556 ? 9.92171  56.96553  -55.86937 1.000 64.31318  ? 555 GLY A CA    1 
ATOM   4411 C  C     . GLY A 1 556 ? 9.95602  55.57371  -55.27644 1.000 66.63026  ? 555 GLY A C     1 
ATOM   4412 O  O     . GLY A 1 556 ? 9.99105  54.58128  -56.01558 1.000 62.44800  ? 555 GLY A O     1 
ATOM   4413 N  N     . ILE A 1 557 ? 9.96893  55.49027  -53.94606 1.000 63.86147  ? 556 ILE A N     1 
ATOM   4414 C  CA    . ILE A 1 557 ? 10.18324 54.21841  -53.26177 1.000 63.69770  ? 556 ILE A CA    1 
ATOM   4415 C  C     . ILE A 1 557 ? 9.12896  53.92033  -52.21218 1.000 65.43280  ? 556 ILE A C     1 
ATOM   4416 O  O     . ILE A 1 557 ? 8.93398  52.74216  -51.85929 1.000 61.40978  ? 556 ILE A O     1 
ATOM   4417 C  CB    . ILE A 1 557 ? 11.59527 54.17859  -52.63329 1.000 51.68281  ? 556 ILE A CB    1 
ATOM   4418 N  N     . ARG A 1 558 ? 8.42218  54.92363  -51.70080 1.000 71.26750  ? 557 ARG A N     1 
ATOM   4419 C  CA    . ARG A 1 558 ? 7.38870  54.72853  -50.69186 1.000 70.47947  ? 557 ARG A CA    1 
ATOM   4420 C  C     . ARG A 1 558 ? 6.08463  55.42516  -51.06859 1.000 71.21449  ? 557 ARG A C     1 
ATOM   4421 O  O     . ARG A 1 558 ? 5.27706  55.75306  -50.19753 1.000 75.99688  ? 557 ARG A O     1 
ATOM   4422 C  CB    . ARG A 1 558 ? 7.87015  55.23629  -49.33434 1.000 65.69189  ? 557 ARG A CB    1 
ATOM   4423 C  CG    . ARG A 1 558 ? 8.58035  54.17887  -48.52077 1.000 75.72103  ? 557 ARG A CG    1 
ATOM   4424 C  CD    . ARG A 1 558 ? 8.40856  54.42454  -47.03458 1.000 75.60733  ? 557 ARG A CD    1 
ATOM   4425 N  NE    . ARG A 1 558 ? 9.38736  55.37679  -46.52900 1.000 71.73301  ? 557 ARG A NE    1 
ATOM   4426 C  CZ    . ARG A 1 558 ? 10.49019 55.02279  -45.87748 1.000 73.55617  ? 557 ARG A CZ    1 
ATOM   4427 N  NH1   . ARG A 1 558 ? 10.74092 53.73297  -45.65256 1.000 67.21819  ? 557 ARG A NH1   1 
ATOM   4428 N  NH2   . ARG A 1 558 ? 11.34051 55.95635  -45.45090 1.000 69.25519  ? 557 ARG A NH2   1 
ATOM   4429 N  N     . GLU B 2 18  ? 11.28691 9.71889   7.08029   1.000 70.00198  ? 6   GLU B N     1 
ATOM   4430 C  CA    . GLU B 2 18  ? 10.52629 9.29959   5.90520   1.000 71.77636  ? 6   GLU B CA    1 
ATOM   4431 C  C     . GLU B 2 18  ? 10.35994 10.45769  4.90981   1.000 78.81711  ? 6   GLU B C     1 
ATOM   4432 O  O     . GLU B 2 18  ? 10.12569 11.60273  5.30955   1.000 71.80007  ? 6   GLU B O     1 
ATOM   4433 C  CB    . GLU B 2 18  ? 9.16099  8.75308   6.32131   1.000 78.14812  ? 6   GLU B CB    1 
ATOM   4434 N  N     . THR B 2 19  ? 10.45456 10.13810  3.61684   1.000 80.09330  ? 7   THR B N     1 
ATOM   4435 C  CA    . THR B 2 19  ? 10.64624 11.11565  2.55240   1.000 73.76985  ? 7   THR B CA    1 
ATOM   4436 C  C     . THR B 2 19  ? 9.33059  11.53229  1.90104   1.000 70.40434  ? 7   THR B C     1 
ATOM   4437 O  O     . THR B 2 19  ? 8.30534  10.85612  2.00556   1.000 67.66695  ? 7   THR B O     1 
ATOM   4438 C  CB    . THR B 2 19  ? 11.59157 10.56547  1.47183   1.000 71.82537  ? 7   THR B CB    1 
ATOM   4439 O  OG1   . THR B 2 19  ? 10.94162 9.51770   0.73178   1.000 64.67174  ? 7   THR B OG1   1 
ATOM   4440 C  CG2   . THR B 2 19  ? 12.88061 10.03685  2.09980   1.000 65.21459  ? 7   THR B CG2   1 
ATOM   4441 N  N     . VAL B 2 20  ? 9.38938  12.65792  1.20213   1.000 71.41757  ? 8   VAL B N     1 
ATOM   4442 C  CA    . VAL B 2 20  ? 8.26965  13.21888  0.45170   1.000 73.06209  ? 8   VAL B CA    1 
ATOM   4443 C  C     . VAL B 2 20  ? 8.54795  13.01067  -1.03355  1.000 70.99937  ? 8   VAL B C     1 
ATOM   4444 O  O     . VAL B 2 20  ? 9.51949  13.57637  -1.55504  1.000 70.49143  ? 8   VAL B O     1 
ATOM   4445 C  CB    . VAL B 2 20  ? 8.06898  14.71278  0.76158   1.000 69.29179  ? 8   VAL B CB    1 
ATOM   4446 C  CG1   . VAL B 2 20  ? 6.97659  15.28975  -0.12459  1.000 64.00413  ? 8   VAL B CG1   1 
ATOM   4447 C  CG2   . VAL B 2 20  ? 7.75469  14.92986  2.24321   1.000 64.27070  ? 8   VAL B CG2   1 
ATOM   4448 N  N     . PRO B 2 21  ? 7.73508  12.22960  -1.75100  1.000 70.18258  ? 9   PRO B N     1 
ATOM   4449 C  CA    . PRO B 2 21  ? 7.96604  12.05442  -3.19201  1.000 68.44502  ? 9   PRO B CA    1 
ATOM   4450 C  C     . PRO B 2 21  ? 7.88577  13.38146  -3.93277  1.000 68.54622  ? 9   PRO B C     1 
ATOM   4451 O  O     . PRO B 2 21  ? 7.06617  14.24654  -3.61107  1.000 68.11142  ? 9   PRO B O     1 
ATOM   4452 C  CB    . PRO B 2 21  ? 6.84137  11.10201  -3.62042  1.000 64.80645  ? 9   PRO B CB    1 
ATOM   4453 C  CG    . PRO B 2 21  ? 5.78008  11.29207  -2.59286  1.000 62.85679  ? 9   PRO B CG    1 
ATOM   4454 C  CD    . PRO B 2 21  ? 6.53171  11.51113  -1.30201  1.000 69.19674  ? 9   PRO B CD    1 
ATOM   4455 N  N     . VAL B 2 22  ? 8.77587  13.54686  -4.91142  1.000 64.26179  ? 10  VAL B N     1 
ATOM   4456 C  CA    . VAL B 2 22  ? 8.80631  14.72486  -5.76889  1.000 63.79028  ? 10  VAL B CA    1 
ATOM   4457 C  C     . VAL B 2 22  ? 9.04137  14.26720  -7.20082  1.000 65.40330  ? 10  VAL B C     1 
ATOM   4458 O  O     . VAL B 2 22  ? 9.81308  13.33381  -7.44480  1.000 69.85225  ? 10  VAL B O     1 
ATOM   4459 C  CB    . VAL B 2 22  ? 9.89562  15.73049  -5.34079  1.000 62.96718  ? 10  VAL B CB    1 
ATOM   4460 C  CG1   . VAL B 2 22  ? 9.60024  17.09472  -5.94483  1.000 67.02800  ? 10  VAL B CG1   1 
ATOM   4461 C  CG2   . VAL B 2 22  ? 10.00071 15.82741  -3.82779  1.000 58.21553  ? 10  VAL B CG2   1 
ATOM   4462 N  N     . LYS B 2 23  ? 8.37906  14.92176  -8.14822  1.000 61.91891  ? 11  LYS B N     1 
ATOM   4463 C  CA    . LYS B 2 23  ? 8.49874  14.58268  -9.55809  1.000 66.72101  ? 11  LYS B CA    1 
ATOM   4464 C  C     . LYS B 2 23  ? 8.99948  15.79357  -10.33712 1.000 72.52562  ? 11  LYS B C     1 
ATOM   4465 O  O     . LYS B 2 23  ? 9.15645  16.89137  -9.79523  1.000 69.70499  ? 11  LYS B O     1 
ATOM   4466 C  CB    . LYS B 2 23  ? 7.15789  14.09338  -10.12740 1.000 65.53837  ? 11  LYS B CB    1 
ATOM   4467 N  N     . LEU B 2 24  ? 9.27659  15.57550  -11.61923 1.000 71.17168  ? 12  LEU B N     1 
ATOM   4468 C  CA    . LEU B 2 24  ? 9.58783  16.66377  -12.53074 1.000 65.98260  ? 12  LEU B CA    1 
ATOM   4469 C  C     . LEU B 2 24  ? 8.32582  17.11706  -13.25763 1.000 69.90104  ? 12  LEU B C     1 
ATOM   4470 O  O     . LEU B 2 24  ? 7.31811  16.40742  -13.30912 1.000 74.60374  ? 12  LEU B O     1 
ATOM   4471 C  CB    . LEU B 2 24  ? 10.64026 16.24048  -13.55189 1.000 64.84317  ? 12  LEU B CB    1 
ATOM   4472 C  CG    . LEU B 2 24  ? 12.05689 15.94805  -13.05950 1.000 65.72411  ? 12  LEU B CG    1 
ATOM   4473 C  CD1   . LEU B 2 24  ? 12.91880 15.50393  -14.23240 1.000 59.33655  ? 12  LEU B CD1   1 
ATOM   4474 C  CD2   . LEU B 2 24  ? 12.66006 17.17150  -12.37951 1.000 65.92808  ? 12  LEU B CD2   1 
ATOM   4475 N  N     . LYS B 2 25  ? 8.38700  18.32112  -13.81153 1.000 68.33068  ? 13  LYS B N     1 
ATOM   4476 C  CA    . LYS B 2 25  ? 7.30410  18.77785  -14.65931 1.000 69.02967  ? 13  LYS B CA    1 
ATOM   4477 C  C     . LYS B 2 25  ? 7.15450  17.81350  -15.83273 1.000 77.19729  ? 13  LYS B C     1 
ATOM   4478 O  O     . LYS B 2 25  ? 8.16034  17.32433  -16.36450 1.000 74.82898  ? 13  LYS B O     1 
ATOM   4479 C  CB    . LYS B 2 25  ? 7.56223  20.20423  -15.15000 1.000 72.43252  ? 13  LYS B CB    1 
ATOM   4480 C  CG    . LYS B 2 25  ? 7.46315  21.24264  -14.03676 1.000 70.53101  ? 13  LYS B CG    1 
ATOM   4481 C  CD    . LYS B 2 25  ? 7.50345  22.67387  -14.54561 1.000 60.89422  ? 13  LYS B CD    1 
ATOM   4482 C  CE    . LYS B 2 25  ? 7.39036  23.63736  -13.36524 1.000 71.49099  ? 13  LYS B CE    1 
ATOM   4483 N  NZ    . LYS B 2 25  ? 7.63751  25.07469  -13.69236 1.000 75.01575  ? 13  LYS B NZ    1 
ATOM   4484 N  N     . PRO B 2 26  ? 5.92328  17.50160  -16.24313 1.000 82.29592  ? 14  PRO B N     1 
ATOM   4485 C  CA    . PRO B 2 26  ? 5.71480  16.42002  -17.21532 1.000 78.82923  ? 14  PRO B CA    1 
ATOM   4486 C  C     . PRO B 2 26  ? 6.41850  16.67763  -18.54114 1.000 75.16767  ? 14  PRO B C     1 
ATOM   4487 O  O     . PRO B 2 26  ? 6.41819  17.79302  -19.06516 1.000 71.71720  ? 14  PRO B O     1 
ATOM   4488 C  CB    . PRO B 2 26  ? 4.19064  16.38960  -17.38578 1.000 85.07986  ? 14  PRO B CB    1 
ATOM   4489 C  CG    . PRO B 2 26  ? 3.71596  17.73703  -16.90112 1.000 77.52243  ? 14  PRO B CG    1 
ATOM   4490 C  CD    . PRO B 2 26  ? 4.65167  18.09223  -15.79289 1.000 77.29355  ? 14  PRO B CD    1 
ATOM   4491 N  N     . GLY B 2 27  ? 7.02082  15.61982  -19.08016 1.000 76.12418  ? 15  GLY B N     1 
ATOM   4492 C  CA    . GLY B 2 27  ? 7.72184  15.71392  -20.34468 1.000 71.76485  ? 15  GLY B CA    1 
ATOM   4493 C  C     . GLY B 2 27  ? 9.06277  16.40586  -20.26459 1.000 75.55780  ? 15  GLY B C     1 
ATOM   4494 O  O     . GLY B 2 27  ? 9.50896  16.99291  -21.25537 1.000 75.52692  ? 15  GLY B O     1 
ATOM   4495 N  N     . MET B 2 28  ? 9.72529  16.35437  -19.11013 1.000 74.73834  ? 16  MET B N     1 
ATOM   4496 C  CA    . MET B 2 28  ? 10.99750 17.03951  -18.91453 1.000 71.55673  ? 16  MET B CA    1 
ATOM   4497 C  C     . MET B 2 28  ? 12.00738 16.08445  -18.29093 1.000 69.80945  ? 16  MET B C     1 
ATOM   4498 O  O     . MET B 2 28  ? 11.76703 15.53938  -17.20582 1.000 63.01557  ? 16  MET B O     1 
ATOM   4499 C  CB    . MET B 2 28  ? 10.81892 18.29483  -18.04631 1.000 65.55421  ? 16  MET B CB    1 
ATOM   4500 C  CG    . MET B 2 28  ? 10.54717 19.55887  -18.84954 1.000 68.72540  ? 16  MET B CG    1 
ATOM   4501 S  SD    . MET B 2 28  ? 10.39450 21.06992  -17.86130 1.000 78.59733  ? 16  MET B SD    1 
ATOM   4502 C  CE    . MET B 2 28  ? 11.06894 22.29021  -19.00886 1.000 62.85494  ? 16  MET B CE    1 
ATOM   4503 N  N     . ASP B 2 29  ? 13.13146 15.88969  -18.98266 1.000 63.84079  ? 17  ASP B N     1 
ATOM   4504 C  CA    . ASP B 2 29  ? 14.29212 15.19258  -18.45602 1.000 57.49117  ? 17  ASP B CA    1 
ATOM   4505 C  C     . ASP B 2 29  ? 15.10756 16.12833  -17.55540 1.000 55.89612  ? 17  ASP B C     1 
ATOM   4506 O  O     . ASP B 2 29  ? 14.88957 17.34355  -17.51193 1.000 53.58966  ? 17  ASP B O     1 
ATOM   4507 C  CB    . ASP B 2 29  ? 15.15398 14.66617  -19.60153 1.000 59.11888  ? 17  ASP B CB    1 
ATOM   4508 C  CG    . ASP B 2 29  ? 15.91740 13.39708  -19.23361 1.000 66.18860  ? 17  ASP B CG    1 
ATOM   4509 O  OD1   . ASP B 2 29  ? 15.81825 12.94059  -18.06885 1.000 60.81839  ? 17  ASP B OD1   1 
ATOM   4510 O  OD2   . ASP B 2 29  ? 16.61347 12.85041  -20.12700 1.000 67.48827  ? 17  ASP B OD2   1 
ATOM   4511 N  N     . GLY B 2 30  ? 16.06596 15.54218  -16.82958 1.000 56.95162  ? 18  GLY B N     1 
ATOM   4512 C  CA    . GLY B 2 30  ? 16.81741 16.26086  -15.82959 1.000 48.23717  ? 18  GLY B CA    1 
ATOM   4513 C  C     . GLY B 2 30  ? 17.87627 17.15575  -16.43000 1.000 45.14560  ? 18  GLY B C     1 
ATOM   4514 O  O     . GLY B 2 30  ? 18.00328 17.30902  -17.64880 1.000 52.72551  ? 18  GLY B O     1 
ATOM   4515 N  N     . PRO B 2 31  ? 18.65781 17.78194  -15.55859 1.000 42.74489  ? 19  PRO B N     1 
ATOM   4516 C  CA    . PRO B 2 31  ? 19.66945 18.73658  -16.03200 1.000 43.09243  ? 19  PRO B CA    1 
ATOM   4517 C  C     . PRO B 2 31  ? 20.92221 18.05199  -16.56876 1.000 42.76181  ? 19  PRO B C     1 
ATOM   4518 O  O     . PRO B 2 31  ? 21.37193 17.01878  -16.06283 1.000 41.04174  ? 19  PRO B O     1 
ATOM   4519 C  CB    . PRO B 2 31  ? 19.97316 19.57602  -14.78719 1.000 40.34881  ? 19  PRO B CB    1 
ATOM   4520 C  CG    . PRO B 2 31  ? 19.61175 18.70952  -13.63363 1.000 43.44547  ? 19  PRO B CG    1 
ATOM   4521 C  CD    . PRO B 2 31  ? 18.54162 17.75784  -14.09301 1.000 45.23112  ? 19  PRO B CD    1 
ATOM   4522 N  N     . LYS B 2 32  ? 21.48049 18.64176  -17.62144 1.000 40.17662  ? 20  LYS B N     1 
ATOM   4523 C  CA    . LYS B 2 32  ? 22.66443 18.10534  -18.29402 1.000 41.05943  ? 20  LYS B CA    1 
ATOM   4524 C  C     . LYS B 2 32  ? 23.65030 19.23327  -18.61425 1.000 40.02801  ? 20  LYS B C     1 
ATOM   4525 O  O     . LYS B 2 32  ? 24.02966 19.44686  -19.76657 1.000 39.18617  ? 20  LYS B O     1 
ATOM   4526 C  CB    . LYS B 2 32  ? 22.25947 17.30015  -19.53076 1.000 41.26665  ? 20  LYS B CB    1 
ATOM   4527 C  CG    . LYS B 2 32  ? 21.50493 16.01154  -19.18275 1.000 35.92938  ? 20  LYS B CG    1 
ATOM   4528 C  CD    . LYS B 2 32  ? 20.81451 15.42725  -20.39671 1.000 42.51803  ? 20  LYS B CD    1 
ATOM   4529 C  CE    . LYS B 2 32  ? 20.29621 14.01065  -20.11660 1.000 50.75083  ? 20  LYS B CE    1 
ATOM   4530 N  NZ    . LYS B 2 32  ? 20.31489 13.13043  -21.32705 1.000 50.04383  ? 20  LYS B NZ    1 
ATOM   4531 N  N     . VAL B 2 33  ? 24.02624 19.99983  -17.58103 1.000 38.13999  ? 21  VAL B N     1 
ATOM   4532 C  CA    . VAL B 2 33  ? 24.89531 21.17380  -17.70014 1.000 41.05839  ? 21  VAL B CA    1 
ATOM   4533 C  C     . VAL B 2 33  ? 26.34735 20.79266  -17.42165 1.000 38.48505  ? 21  VAL B C     1 
ATOM   4534 O  O     . VAL B 2 33  ? 26.64915 20.19846  -16.38242 1.000 39.62822  ? 21  VAL B O     1 
ATOM   4535 C  CB    . VAL B 2 33  ? 24.44093 22.27282  -16.72475 1.000 40.31101  ? 21  VAL B CB    1 
ATOM   4536 C  CG1   . VAL B 2 33  ? 25.27746 23.54802  -16.88937 1.000 31.32368  ? 21  VAL B CG1   1 
ATOM   4537 C  CG2   . VAL B 2 33  ? 22.95571 22.52053  -16.87934 1.000 35.68535  ? 21  VAL B CG2   1 
ATOM   4538 N  N     . LYS B 2 34  ? 27.25757 21.17955  -18.31903 1.000 38.93399  ? 22  LYS B N     1 
ATOM   4539 C  CA    . LYS B 2 34  ? 28.67255 20.85415  -18.13509 1.000 37.71902  ? 22  LYS B CA    1 
ATOM   4540 C  C     . LYS B 2 34  ? 29.29644 21.72574  -17.05358 1.000 35.38822  ? 22  LYS B C     1 
ATOM   4541 O  O     . LYS B 2 34  ? 28.99433 22.91035  -16.94053 1.000 43.30790  ? 22  LYS B O     1 
ATOM   4542 C  CB    . LYS B 2 34  ? 29.44212 21.00917  -19.45348 1.000 34.84755  ? 22  LYS B CB    1 
ATOM   4543 C  CG    . LYS B 2 34  ? 29.16612 19.85810  -20.43438 1.000 41.54026  ? 22  LYS B CG    1 
ATOM   4544 C  CD    . LYS B 2 34  ? 29.77758 20.05382  -21.80605 1.000 41.50420  ? 22  LYS B CD    1 
ATOM   4545 C  CE    . LYS B 2 34  ? 31.26547 19.69419  -21.83942 1.000 48.57222  ? 22  LYS B CE    1 
ATOM   4546 N  NZ    . LYS B 2 34  ? 31.75321 19.44746  -23.25479 1.000 47.19932  ? 22  LYS B NZ    1 
ATOM   4547 N  N     . GLN B 2 35  ? 30.16179 21.12635  -16.24454 1.000 39.72268  ? 23  GLN B N     1 
ATOM   4548 C  CA    . GLN B 2 35  ? 30.85970 21.86199  -15.19740 1.000 35.68860  ? 23  GLN B CA    1 
ATOM   4549 C  C     . GLN B 2 35  ? 31.89772 22.79464  -15.81366 1.000 38.81311  ? 23  GLN B C     1 
ATOM   4550 O  O     . GLN B 2 35  ? 32.54409 22.46144  -16.81385 1.000 39.16407  ? 23  GLN B O     1 
ATOM   4551 C  CB    . GLN B 2 35  ? 31.53124 20.87894  -14.23315 1.000 32.51975  ? 23  GLN B CB    1 
ATOM   4552 C  CG    . GLN B 2 35  ? 32.57079 21.47194  -13.31254 1.000 31.74014  ? 23  GLN B CG    1 
ATOM   4553 C  CD    . GLN B 2 35  ? 31.95409 22.12290  -12.10458 1.000 37.78292  ? 23  GLN B CD    1 
ATOM   4554 O  OE1   . GLN B 2 35  ? 30.90324 21.69009  -11.62634 1.000 36.67169  ? 23  GLN B OE1   1 
ATOM   4555 N  NE2   . GLN B 2 35  ? 32.60139 23.17031  -11.59216 1.000 39.24550  ? 23  GLN B NE2   1 
ATOM   4556 N  N     . TRP B 2 36  ? 32.05790 23.96582  -15.21961 1.000 39.42438  ? 24  TRP B N     1 
ATOM   4557 C  CA    . TRP B 2 36  ? 33.01493 24.93224  -15.73845 1.000 40.48546  ? 24  TRP B CA    1 
ATOM   4558 C  C     . TRP B 2 36  ? 34.30806 24.90521  -14.92839 1.000 39.95177  ? 24  TRP B C     1 
ATOM   4559 O  O     . TRP B 2 36  ? 34.35192 24.35209  -13.82785 1.000 43.48371  ? 24  TRP B O     1 
ATOM   4560 C  CB    . TRP B 2 36  ? 32.39372 26.33624  -15.75437 1.000 36.99507  ? 24  TRP B CB    1 
ATOM   4561 C  CG    . TRP B 2 36  ? 31.91991 26.91503  -14.45925 1.000 38.35661  ? 24  TRP B CG    1 
ATOM   4562 C  CD1   . TRP B 2 36  ? 32.69369 27.38821  -13.43999 1.000 44.70538  ? 24  TRP B CD1   1 
ATOM   4563 C  CD2   . TRP B 2 36  ? 30.55739 27.17429  -14.07907 1.000 39.96875  ? 24  TRP B CD2   1 
ATOM   4564 N  NE1   . TRP B 2 36  ? 31.89772 27.90140  -12.42889 1.000 43.53353  ? 24  TRP B NE1   1 
ATOM   4565 C  CE2   . TRP B 2 36  ? 30.58357 27.77753  -12.79656 1.000 44.01548  ? 24  TRP B CE2   1 
ATOM   4566 C  CE3   . TRP B 2 36  ? 29.32358 26.94729  -14.68793 1.000 31.33232  ? 24  TRP B CE3   1 
ATOM   4567 C  CZ2   . TRP B 2 36  ? 29.41454 28.14621  -12.11187 1.000 41.81150  ? 24  TRP B CZ2   1 
ATOM   4568 C  CZ3   . TRP B 2 36  ? 28.16927 27.32607  -14.01104 1.000 33.83421  ? 24  TRP B CZ3   1 
ATOM   4569 C  CH2   . TRP B 2 36  ? 28.22173 27.91281  -12.73609 1.000 34.16946  ? 24  TRP B CH2   1 
ATOM   4570 N  N     . PRO B 2 37  ? 35.39834 25.46871  -15.45077 1.000 41.42672  ? 25  PRO B N     1 
ATOM   4571 C  CA    . PRO B 2 37  ? 36.69059 25.35441  -14.75098 1.000 39.53070  ? 25  PRO B CA    1 
ATOM   4572 C  C     . PRO B 2 37  ? 36.71488 26.14445  -13.44869 1.000 44.26014  ? 25  PRO B C     1 
ATOM   4573 O  O     . PRO B 2 37  ? 36.20141 27.26575  -13.37286 1.000 45.60955  ? 25  PRO B O     1 
ATOM   4574 C  CB    . PRO B 2 37  ? 37.69144 25.93543  -15.75692 1.000 39.78375  ? 25  PRO B CB    1 
ATOM   4575 C  CG    . PRO B 2 37  ? 36.96465 25.98911  -17.07429 1.000 31.65430  ? 25  PRO B CG    1 
ATOM   4576 C  CD    . PRO B 2 37  ? 35.52749 26.14981  -16.75183 1.000 33.08907  ? 25  PRO B CD    1 
ATOM   4577 N  N     . LEU B 2 38  ? 37.34034 25.56265  -12.42184 1.000 41.06181  ? 26  LEU B N     1 
ATOM   4578 C  CA    . LEU B 2 38  ? 37.43843 26.20405  -11.11568 1.000 42.59663  ? 26  LEU B CA    1 
ATOM   4579 C  C     . LEU B 2 38  ? 38.89331 26.45790  -10.74694 1.000 47.07768  ? 26  LEU B C     1 
ATOM   4580 O  O     . LEU B 2 38  ? 39.78240 25.68877  -11.11676 1.000 48.05872  ? 26  LEU B O     1 
ATOM   4581 C  CB    . LEU B 2 38  ? 36.79074 25.35985  -10.01565 1.000 38.47922  ? 26  LEU B CB    1 
ATOM   4582 C  CG    . LEU B 2 38  ? 35.31980 25.00220  -10.23770 1.000 45.02655  ? 26  LEU B CG    1 
ATOM   4583 C  CD1   . LEU B 2 38  ? 34.79759 24.14080  -9.08924  1.000 41.99025  ? 26  LEU B CD1   1 
ATOM   4584 C  CD2   . LEU B 2 38  ? 34.44619 26.23007  -10.45439 1.000 36.49091  ? 26  LEU B CD2   1 
ATOM   4585 N  N     . THR B 2 39  ? 39.12870 27.53498  -9.99442  1.000 45.99099  ? 27  THR B N     1 
ATOM   4586 C  CA    . THR B 2 39  ? 40.46659 27.79464  -9.48730  1.000 41.66194  ? 27  THR B CA    1 
ATOM   4587 C  C     . THR B 2 39  ? 40.84710 26.76409  -8.43369  1.000 40.22871  ? 27  THR B C     1 
ATOM   4588 O  O     . THR B 2 39  ? 40.01852 26.02223  -7.90596  1.000 43.23384  ? 27  THR B O     1 
ATOM   4589 C  CB    . THR B 2 39  ? 40.58083 29.18874  -8.86852  1.000 41.14852  ? 27  THR B CB    1 
ATOM   4590 O  OG1   . THR B 2 39  ? 39.67957 29.29508  -7.76108  1.000 44.31659  ? 27  THR B OG1   1 
ATOM   4591 C  CG2   . THR B 2 39  ? 40.28518 30.28430  -9.89192  1.000 39.30602  ? 27  THR B CG2   1 
ATOM   4592 N  N     . GLU B 2 40  ? 42.13211 26.75760  -8.10939  1.000 41.24880  ? 28  GLU B N     1 
ATOM   4593 C  CA    . GLU B 2 40  ? 42.65516 25.82813  -7.11716  1.000 43.61029  ? 28  GLU B CA    1 
ATOM   4594 C  C     . GLU B 2 40  ? 42.02342 26.04324  -5.74255  1.000 42.03413  ? 28  GLU B C     1 
ATOM   4595 O  O     . GLU B 2 40  ? 41.67203 25.07479  -5.06435  1.000 44.72206  ? 28  GLU B O     1 
ATOM   4596 C  CB    . GLU B 2 40  ? 44.16910 25.98225  -7.05382  1.000 45.95919  ? 28  GLU B CB    1 
ATOM   4597 C  CG    . GLU B 2 40  ? 44.90349 24.91813  -6.30422  1.000 50.04889  ? 28  GLU B CG    1 
ATOM   4598 C  CD    . GLU B 2 40  ? 46.37830 24.95224  -6.63397  1.000 56.73765  ? 28  GLU B CD    1 
ATOM   4599 O  OE1   . GLU B 2 40  ? 47.04743 23.90832  -6.44387  1.000 51.72959  ? 28  GLU B OE1   1 
ATOM   4600 O  OE2   . GLU B 2 40  ? 46.84785 26.02959  -7.10226  1.000 57.66311  ? 28  GLU B OE2   1 
ATOM   4601 N  N     . GLU B 2 41  ? 41.89549 27.29779  -5.30108  1.000 44.83686  ? 29  GLU B N     1 
ATOM   4602 C  CA    . GLU B 2 41  ? 41.22252 27.57335  -4.03175  1.000 47.45309  ? 29  GLU B CA    1 
ATOM   4603 C  C     . GLU B 2 41  ? 39.86826 26.88860  -3.97050  1.000 45.06340  ? 29  GLU B C     1 
ATOM   4604 O  O     . GLU B 2 41  ? 39.54720 26.18430  -3.00452  1.000 50.15966  ? 29  GLU B O     1 
ATOM   4605 C  CB    . GLU B 2 41  ? 41.01405 29.07291  -3.83719  1.000 48.33940  ? 29  GLU B CB    1 
ATOM   4606 C  CG    . GLU B 2 41  ? 42.20441 29.88661  -3.43154  1.000 61.39367  ? 29  GLU B CG    1 
ATOM   4607 C  CD    . GLU B 2 41  ? 41.83913 31.37787  -3.37138  1.000 79.27120  ? 29  GLU B CD    1 
ATOM   4608 O  OE1   . GLU B 2 41  ? 42.35119 32.10022  -2.47586  1.000 76.51084  ? 29  GLU B OE1   1 
ATOM   4609 O  OE2   . GLU B 2 41  ? 41.01684 31.81596  -4.22100  1.000 70.24243  ? 29  GLU B OE2   1 
ATOM   4610 N  N     . LYS B 2 42  ? 39.04641 27.11703  -4.98805  1.000 41.53867  ? 30  LYS B N     1 
ATOM   4611 C  CA    . LYS B 2 42  ? 37.69975 26.58158  -4.96826  1.000 39.12546  ? 30  LYS B CA    1 
ATOM   4612 C  C     . LYS B 2 42  ? 37.71745 25.06433  -5.02222  1.000 42.09914  ? 30  LYS B C     1 
ATOM   4613 O  O     . LYS B 2 42  ? 36.92772 24.41246  -4.33342  1.000 43.37154  ? 30  LYS B O     1 
ATOM   4614 C  CB    . LYS B 2 42  ? 36.88824 27.16441  -6.12293  1.000 41.27430  ? 30  LYS B CB    1 
ATOM   4615 C  CG    . LYS B 2 42  ? 36.81871 28.68455  -6.10733  1.000 41.91525  ? 30  LYS B CG    1 
ATOM   4616 C  CD    . LYS B 2 42  ? 35.76923 29.24189  -7.05666  1.000 42.76393  ? 30  LYS B CD    1 
ATOM   4617 C  CE    . LYS B 2 42  ? 35.91059 30.74888  -7.17361  1.000 53.50605  ? 30  LYS B CE    1 
ATOM   4618 N  NZ    . LYS B 2 42  ? 34.63871 31.44057  -7.56635  1.000 58.57210  ? 30  LYS B NZ    1 
ATOM   4619 N  N     . ILE B 2 43  ? 38.61867 24.47425  -5.81239  1.000 41.93877  ? 31  ILE B N     1 
ATOM   4620 C  CA    . ILE B 2 43  ? 38.64267 23.01522  -5.89789  1.000 43.44603  ? 31  ILE B CA    1 
ATOM   4621 C  C     . ILE B 2 43  ? 39.02196 22.40757  -4.55618  1.000 44.19618  ? 31  ILE B C     1 
ATOM   4622 O  O     . ILE B 2 43  ? 38.40284 21.43359  -4.11014  1.000 42.52819  ? 31  ILE B O     1 
ATOM   4623 C  CB    . ILE B 2 43  ? 39.58460 22.53099  -7.01101  1.000 41.71167  ? 31  ILE B CB    1 
ATOM   4624 C  CG1   . ILE B 2 43  ? 39.06161 22.98685  -8.37108  1.000 41.61743  ? 31  ILE B CG1   1 
ATOM   4625 C  CG2   . ILE B 2 43  ? 39.71852 20.99580  -6.95019  1.000 30.63548  ? 31  ILE B CG2   1 
ATOM   4626 C  CD1   . ILE B 2 43  ? 39.72346 22.30571  -9.53415  1.000 37.70635  ? 31  ILE B CD1   1 
ATOM   4627 N  N     . LYS B 2 44  ? 40.05640 22.95704  -3.90239  1.000 40.60051  ? 32  LYS B N     1 
ATOM   4628 C  CA    . LYS B 2 44  ? 40.46143 22.44214  -2.59519  1.000 38.34289  ? 32  LYS B CA    1 
ATOM   4629 C  C     . LYS B 2 44  ? 39.32980 22.55583  -1.58252  1.000 40.68594  ? 32  LYS B C     1 
ATOM   4630 O  O     . LYS B 2 44  ? 39.03410 21.59840  -0.84602  1.000 46.44344  ? 32  LYS B O     1 
ATOM   4631 C  CB    . LYS B 2 44  ? 41.70127 23.17171  -2.09199  1.000 39.12126  ? 32  LYS B CB    1 
ATOM   4632 C  CG    . LYS B 2 44  ? 43.02353 22.72518  -2.71305  1.000 46.42769  ? 32  LYS B CG    1 
ATOM   4633 C  CD    . LYS B 2 44  ? 44.19080 23.45775  -2.02389  1.000 54.37806  ? 32  LYS B CD    1 
ATOM   4634 C  CE    . LYS B 2 44  ? 45.56362 22.87662  -2.36788  1.000 56.78608  ? 32  LYS B CE    1 
ATOM   4635 N  NZ    . LYS B 2 44  ? 46.02512 23.23417  -3.73835  1.000 59.48052  ? 32  LYS B NZ    1 
ATOM   4636 N  N     . ALA B 2 45  ? 38.67997 23.72075  -1.52776  1.000 39.61409  ? 33  ALA B N     1 
ATOM   4637 C  CA    . ALA B 2 45  ? 37.54768 23.87191  -0.61972  1.000 43.34661  ? 33  ALA B CA    1 
ATOM   4638 C  C     . ALA B 2 45  ? 36.47072 22.82797  -0.90375  1.000 44.39055  ? 33  ALA B C     1 
ATOM   4639 O  O     . ALA B 2 45  ? 36.00835 22.13740  0.00996   1.000 44.98770  ? 33  ALA B O     1 
ATOM   4640 C  CB    . ALA B 2 45  ? 36.97580 25.28495  -0.71701  1.000 47.33484  ? 33  ALA B CB    1 
ATOM   4641 N  N     . LEU B 2 46  ? 36.06703 22.69953  -2.17008  1.000 42.26973  ? 34  LEU B N     1 
ATOM   4642 C  CA    . LEU B 2 46  ? 35.01580 21.75850  -2.53608  1.000 42.57992  ? 34  LEU B CA    1 
ATOM   4643 C  C     . LEU B 2 46  ? 35.39994 20.32996  -2.19297  1.000 44.43277  ? 34  LEU B C     1 
ATOM   4644 O  O     . LEU B 2 46  ? 34.54870 19.54896  -1.76352  1.000 44.56923  ? 34  LEU B O     1 
ATOM   4645 C  CB    . LEU B 2 46  ? 34.69326 21.87508  -4.02828  1.000 41.99718  ? 34  LEU B CB    1 
ATOM   4646 C  CG    . LEU B 2 46  ? 33.89430 23.12907  -4.36588  1.000 43.56146  ? 34  LEU B CG    1 
ATOM   4647 C  CD1   . LEU B 2 46  ? 33.73512 23.31953  -5.85276  1.000 43.93998  ? 34  LEU B CD1   1 
ATOM   4648 C  CD2   . LEU B 2 46  ? 32.54286 23.05523  -3.69738  1.000 43.62147  ? 34  LEU B CD2   1 
ATOM   4649 N  N     . VAL B 2 47  ? 36.67578 19.96761  -2.36246  1.000 42.74518  ? 35  VAL B N     1 
ATOM   4650 C  CA    . VAL B 2 47  ? 37.08292 18.59320  -2.08195  1.000 43.71786  ? 35  VAL B CA    1 
ATOM   4651 C  C     . VAL B 2 47  ? 37.00033 18.30286  -0.58677  1.000 44.90407  ? 35  VAL B C     1 
ATOM   4652 O  O     . VAL B 2 47  ? 36.48930 17.24932  -0.17659  1.000 46.46364  ? 35  VAL B O     1 
ATOM   4653 C  CB    . VAL B 2 47  ? 38.48726 18.29872  -2.64169  1.000 38.84349  ? 35  VAL B CB    1 
ATOM   4654 C  CG1   . VAL B 2 47  ? 39.08442 17.10045  -1.92717  1.000 35.75033  ? 35  VAL B CG1   1 
ATOM   4655 C  CG2   . VAL B 2 47  ? 38.39893 17.98927  -4.10665  1.000 35.15984  ? 35  VAL B CG2   1 
ATOM   4656 N  N     . GLU B 2 48  ? 37.45980 19.23770  0.25343   1.000 41.22505  ? 36  GLU B N     1 
ATOM   4657 C  CA    . GLU B 2 48  ? 37.33448 19.02910  1.69827   1.000 47.13612  ? 36  GLU B CA    1 
ATOM   4658 C  C     . GLU B 2 48  ? 35.86318 19.01918  2.15075   1.000 49.16408  ? 36  GLU B C     1 
ATOM   4659 O  O     . GLU B 2 48  ? 35.44348 18.16611  2.95492   1.000 45.43349  ? 36  GLU B O     1 
ATOM   4660 C  CB    . GLU B 2 48  ? 38.12615 20.09547  2.44727   1.000 49.69943  ? 36  GLU B CB    1 
ATOM   4661 C  CG    . GLU B 2 48  ? 37.85005 20.08565  3.93615   1.000 58.12700  ? 36  GLU B CG    1 
ATOM   4662 C  CD    . GLU B 2 48  ? 38.23744 21.38467  4.60150   1.000 69.72674  ? 36  GLU B CD    1 
ATOM   4663 O  OE1   . GLU B 2 48  ? 39.26114 21.98919  4.17273   1.000 59.29909  ? 36  GLU B OE1   1 
ATOM   4664 O  OE2   . GLU B 2 48  ? 37.50375 21.79180  5.54019   1.000 68.01639  ? 36  GLU B OE2   1 
ATOM   4665 N  N     . ILE B 2 49  ? 35.06586 19.96448  1.64529   1.000 45.52366  ? 37  ILE B N     1 
ATOM   4666 C  CA    . ILE B 2 49  ? 33.65794 20.04199  2.01751   1.000 41.49959  ? 37  ILE B CA    1 
ATOM   4667 C  C     . ILE B 2 49  ? 32.92834 18.76607  1.59945   1.000 44.85498  ? 37  ILE B C     1 
ATOM   4668 O  O     . ILE B 2 49  ? 32.16281 18.18454  2.37759   1.000 43.81787  ? 37  ILE B O     1 
ATOM   4669 C  CB    . ILE B 2 49  ? 33.01786 21.31134  1.41566   1.000 36.65329  ? 37  ILE B CB    1 
ATOM   4670 C  CG1   . ILE B 2 49  ? 33.59204 22.56256  2.07476   1.000 42.77214  ? 37  ILE B CG1   1 
ATOM   4671 C  CG2   . ILE B 2 49  ? 31.52839 21.33102  1.59216   1.000 33.10100  ? 37  ILE B CG2   1 
ATOM   4672 C  CD1   . ILE B 2 49  ? 32.94222 23.87747  1.62014   1.000 42.16179  ? 37  ILE B CD1   1 
ATOM   4673 N  N     . CYS B 2 50  ? 33.16466 18.29909  0.37355   1.000 43.01977  ? 38  CYS B N     1 
ATOM   4674 C  CA    . CYS B 2 50  ? 32.52412 17.06932  -0.07791  1.000 48.19733  ? 38  CYS B CA    1 
ATOM   4675 C  C     . CYS B 2 50  ? 33.00057 15.85457  0.72045   1.000 48.00374  ? 38  CYS B C     1 
ATOM   4676 O  O     . CYS B 2 50  ? 32.21736 14.93593  0.98834   1.000 44.48454  ? 38  CYS B O     1 
ATOM   4677 C  CB    . CYS B 2 50  ? 32.77961 16.86636  -1.57051  1.000 47.87652  ? 38  CYS B CB    1 
ATOM   4678 S  SG    . CYS B 2 50  ? 31.83734 17.96245  -2.65250  1.000 51.56373  ? 38  CYS B SG    1 
ATOM   4679 N  N     . THR B 2 51  ? 34.27628 15.82441  1.10901   1.000 42.79389  ? 39  THR B N     1 
ATOM   4680 C  CA    . THR B 2 51  ? 34.75340 14.73015  1.94782   1.000 47.01082  ? 39  THR B CA    1 
ATOM   4681 C  C     . THR B 2 51  ? 33.96937 14.65146  3.25625   1.000 51.93561  ? 39  THR B C     1 
ATOM   4682 O  O     . THR B 2 51  ? 33.42990 13.58867  3.61007   1.000 52.46336  ? 39  THR B O     1 
ATOM   4683 C  CB    . THR B 2 51  ? 36.24332 14.90701  2.21765   1.000 49.27502  ? 39  THR B CB    1 
ATOM   4684 O  OG1   . THR B 2 51  ? 36.97329 14.72563  0.99444   1.000 54.18600  ? 39  THR B OG1   1 
ATOM   4685 C  CG2   . THR B 2 51  ? 36.70794 13.90686  3.23608   1.000 44.85094  ? 39  THR B CG2   1 
ATOM   4686 N  N     . GLU B 2 52  ? 33.89199 15.77547  3.98723   1.000 54.69844  ? 40  GLU B N     1 
ATOM   4687 C  CA    . GLU B 2 52  ? 33.06948 15.81528  5.19922   1.000 48.33713  ? 40  GLU B CA    1 
ATOM   4688 C  C     . GLU B 2 52  ? 31.62737 15.42886  4.89781   1.000 51.69119  ? 40  GLU B C     1 
ATOM   4689 O  O     . GLU B 2 52  ? 31.04999 14.57100  5.57432   1.000 55.33462  ? 40  GLU B O     1 
ATOM   4690 C  CB    . GLU B 2 52  ? 33.11414 17.19488  5.84861   1.000 41.23101  ? 40  GLU B CB    1 
ATOM   4691 N  N     . MET B 2 53  ? 31.02973 16.03531  3.87163   1.000 50.57953  ? 41  MET B N     1 
ATOM   4692 C  CA    . MET B 2 53  ? 29.63713 15.72790  3.55857   1.000 53.58979  ? 41  MET B CA    1 
ATOM   4693 C  C     . MET B 2 53  ? 29.42699 14.23993  3.30268   1.000 49.88665  ? 41  MET B C     1 
ATOM   4694 O  O     . MET B 2 53  ? 28.34381 13.70915  3.57135   1.000 53.50642  ? 41  MET B O     1 
ATOM   4695 C  CB    . MET B 2 53  ? 29.17126 16.53434  2.34556   1.000 49.08727  ? 41  MET B CB    1 
ATOM   4696 C  CG    . MET B 2 53  ? 29.12197 18.02505  2.55995   1.000 44.85884  ? 41  MET B CG    1 
ATOM   4697 S  SD    . MET B 2 53  ? 28.15587 18.82528  1.27312   1.000 56.48553  ? 41  MET B SD    1 
ATOM   4698 C  CE    . MET B 2 53  ? 26.50372 18.31072  1.72489   1.000 56.52330  ? 41  MET B CE    1 
ATOM   4699 N  N     . GLU B 2 54  ? 30.43671 13.55550  2.78086   1.000 47.11417  ? 42  GLU B N     1 
ATOM   4700 C  CA    . GLU B 2 54  ? 30.28792 12.13532  2.50980   1.000 50.63398  ? 42  GLU B CA    1 
ATOM   4701 C  C     . GLU B 2 54  ? 30.44628 11.30505  3.78566   1.000 52.43344  ? 42  GLU B C     1 
ATOM   4702 O  O     . GLU B 2 54  ? 29.69033 10.34356  3.99584   1.000 47.70920  ? 42  GLU B O     1 
ATOM   4703 C  CB    . GLU B 2 54  ? 31.29155 11.71408  1.43565   1.000 51.31062  ? 42  GLU B CB    1 
ATOM   4704 C  CG    . GLU B 2 54  ? 31.21911 10.25661  1.02171   1.000 49.99094  ? 42  GLU B CG    1 
ATOM   4705 C  CD    . GLU B 2 54  ? 32.37794 9.85203   0.12420   1.000 50.04656  ? 42  GLU B CD    1 
ATOM   4706 O  OE1   . GLU B 2 54  ? 32.20007 8.91701   -0.67985  1.000 61.02677  ? 42  GLU B OE1   1 
ATOM   4707 O  OE2   . GLU B 2 54  ? 33.46162 10.46061  0.21444   1.000 45.39430  ? 42  GLU B OE2   1 
ATOM   4708 N  N     . LYS B 2 55  ? 31.40408 11.66631  4.65797   1.000 52.06857  ? 43  LYS B N     1 
ATOM   4709 C  CA    . LYS B 2 55  ? 31.51267 10.96951  5.94365   1.000 50.75461  ? 43  LYS B CA    1 
ATOM   4710 C  C     . LYS B 2 55  ? 30.20204 11.01447  6.72167   1.000 53.40203  ? 43  LYS B C     1 
ATOM   4711 O  O     . LYS B 2 55  ? 29.90962 10.09415  7.48972   1.000 59.33607  ? 43  LYS B O     1 
ATOM   4712 C  CB    . LYS B 2 55  ? 32.63408 11.56900  6.80181   1.000 45.59221  ? 43  LYS B CB    1 
ATOM   4713 N  N     . GLU B 2 56  ? 29.39307 12.05456  6.51577   1.000 52.95256  ? 44  GLU B N     1 
ATOM   4714 C  CA    . GLU B 2 56  ? 28.14546 12.25984  7.23507   1.000 50.84405  ? 44  GLU B CA    1 
ATOM   4715 C  C     . GLU B 2 56  ? 26.93088 11.69680  6.50670   1.000 53.87681  ? 44  GLU B C     1 
ATOM   4716 O  O     . GLU B 2 56  ? 25.80529 11.86827  6.98782   1.000 55.71403  ? 44  GLU B O     1 
ATOM   4717 C  CB    . GLU B 2 56  ? 27.94220 13.75653  7.50105   1.000 54.87004  ? 44  GLU B CB    1 
ATOM   4718 C  CG    . GLU B 2 56  ? 28.88630 14.31965  8.55858   1.000 67.11708  ? 44  GLU B CG    1 
ATOM   4719 C  CD    . GLU B 2 56  ? 29.18492 15.81092  8.38984   1.000 77.12266  ? 44  GLU B CD    1 
ATOM   4720 O  OE1   . GLU B 2 56  ? 29.67908 16.21675  7.31275   1.000 75.78452  ? 44  GLU B OE1   1 
ATOM   4721 O  OE2   . GLU B 2 56  ? 28.93357 16.58297  9.34277   1.000 86.81387  ? 44  GLU B OE2   1 
ATOM   4722 N  N     . GLY B 2 57  ? 27.12127 11.03849  5.36521   1.000 46.58503  ? 45  GLY B N     1 
ATOM   4723 C  CA    . GLY B 2 57  ? 26.00932 10.45008  4.65245   1.000 44.39364  ? 45  GLY B CA    1 
ATOM   4724 C  C     . GLY B 2 57  ? 25.15731 11.40308  3.84127   1.000 57.56094  ? 45  GLY B C     1 
ATOM   4725 O  O     . GLY B 2 57  ? 24.13158 10.96933  3.28711   1.000 51.72409  ? 45  GLY B O     1 
ATOM   4726 N  N     . LYS B 2 58  ? 25.55887 12.67861  3.71888   1.000 49.66973  ? 46  LYS B N     1 
ATOM   4727 C  CA    . LYS B 2 58  ? 24.72466 13.65226  3.02296   1.000 49.91417  ? 46  LYS B CA    1 
ATOM   4728 C  C     . LYS B 2 58  ? 24.82763 13.54396  1.49821   1.000 49.37728  ? 46  LYS B C     1 
ATOM   4729 O  O     . LYS B 2 58  ? 23.87305 13.90471  0.79275   1.000 44.17153  ? 46  LYS B O     1 
ATOM   4730 C  CB    . LYS B 2 58  ? 25.07766 15.05755  3.51459   1.000 53.04175  ? 46  LYS B CB    1 
ATOM   4731 C  CG    . LYS B 2 58  ? 24.67447 15.28877  4.97862   1.000 56.36811  ? 46  LYS B CG    1 
ATOM   4732 C  CD    . LYS B 2 58  ? 25.58182 16.28686  5.67210   1.000 52.09339  ? 46  LYS B CD    1 
ATOM   4733 N  N     . ILE B 2 59  ? 25.95227 13.04338  0.97077   1.000 45.28677  ? 47  ILE B N     1 
ATOM   4734 C  CA    . ILE B 2 59  ? 26.11085 12.80262  -0.46044  1.000 47.40850  ? 47  ILE B CA    1 
ATOM   4735 C  C     . ILE B 2 59  ? 26.76784 11.43959  -0.66312  1.000 48.47982  ? 47  ILE B C     1 
ATOM   4736 O  O     . ILE B 2 59  ? 27.40471 10.88951  0.23899   1.000 51.87691  ? 47  ILE B O     1 
ATOM   4737 C  CB    . ILE B 2 59  ? 26.94280 13.91116  -1.17154  1.000 48.76310  ? 47  ILE B CB    1 
ATOM   4738 C  CG1   . ILE B 2 59  ? 28.34678 14.01383  -0.57287  1.000 49.79119  ? 47  ILE B CG1   1 
ATOM   4739 C  CG2   . ILE B 2 59  ? 26.22849 15.27069  -1.12534  1.000 42.75136  ? 47  ILE B CG2   1 
ATOM   4740 C  CD1   . ILE B 2 59  ? 29.25499 14.97289  -1.31743  1.000 47.18912  ? 47  ILE B CD1   1 
ATOM   4741 N  N     . SER B 2 60  ? 26.61684 10.89532  -1.87245  1.000 44.03698  ? 48  SER B N     1 
ATOM   4742 C  CA    . SER B 2 60  ? 27.24504 9.62620   -2.22941  1.000 43.28641  ? 48  SER B CA    1 
ATOM   4743 C  C     . SER B 2 60  ? 27.92502 9.72305   -3.58575  1.000 42.37308  ? 48  SER B C     1 
ATOM   4744 O  O     . SER B 2 60  ? 27.40883 10.37668  -4.49951  1.000 44.81342  ? 48  SER B O     1 
ATOM   4745 C  CB    . SER B 2 60  ? 26.22400 8.46845   -2.24845  1.000 40.56209  ? 48  SER B CB    1 
ATOM   4746 O  OG    . SER B 2 60  ? 25.78438 8.17291   -0.93157  1.000 41.32350  ? 48  SER B OG    1 
ATOM   4747 N  N     . LYS B 2 61  ? 29.07512 9.05283   -3.72034  1.000 41.49973  ? 49  LYS B N     1 
ATOM   4748 C  CA    . LYS B 2 61  ? 29.71140 8.92927   -5.02927  1.000 37.83202  ? 49  LYS B CA    1 
ATOM   4749 C  C     . LYS B 2 61  ? 28.80794 8.16331   -5.98283  1.000 35.83863  ? 49  LYS B C     1 
ATOM   4750 O  O     . LYS B 2 61  ? 28.05237 7.26844   -5.58463  1.000 37.12262  ? 49  LYS B O     1 
ATOM   4751 C  CB    . LYS B 2 61  ? 31.06566 8.21950   -4.93471  1.000 32.48479  ? 49  LYS B CB    1 
ATOM   4752 C  CG    . LYS B 2 61  ? 32.14522 9.01754   -4.24526  1.000 42.75235  ? 49  LYS B CG    1 
ATOM   4753 C  CD    . LYS B 2 61  ? 33.48971 8.33836   -4.35662  1.000 38.91827  ? 49  LYS B CD    1 
ATOM   4754 C  CE    . LYS B 2 61  ? 34.60942 9.26609   -3.89972  1.000 43.32114  ? 49  LYS B CE    1 
ATOM   4755 N  NZ    . LYS B 2 61  ? 34.62784 9.41747   -2.41283  1.000 45.34983  ? 49  LYS B NZ    1 
ATOM   4756 N  N     . ILE B 2 62  ? 28.89749 8.52295   -7.25677  1.000 33.27092  ? 50  ILE B N     1 
ATOM   4757 C  CA    . ILE B 2 62  ? 28.14202 7.88230   -8.32219  1.000 36.77330  ? 50  ILE B CA    1 
ATOM   4758 C  C     . ILE B 2 62  ? 29.05571 7.75428   -9.53465  1.000 36.45120  ? 50  ILE B C     1 
ATOM   4759 O  O     . ILE B 2 62  ? 30.19585 8.21647   -9.53590  1.000 40.32892  ? 50  ILE B O     1 
ATOM   4760 C  CB    . ILE B 2 62  ? 26.85857 8.66789   -8.67359  1.000 43.56991  ? 50  ILE B CB    1 
ATOM   4761 C  CG1   . ILE B 2 62  ? 27.19979 10.11585  -9.06067  1.000 38.81141  ? 50  ILE B CG1   1 
ATOM   4762 C  CG2   . ILE B 2 62  ? 25.87101 8.63230   -7.49848  1.000 37.51593  ? 50  ILE B CG2   1 
ATOM   4763 C  CD1   . ILE B 2 62  ? 25.99845 10.97831  -9.22256  1.000 36.46818  ? 50  ILE B CD1   1 
ATOM   4764 N  N     . GLY B 2 63  ? 28.55355 7.10985   -10.57010 1.000 35.17154  ? 51  GLY B N     1 
ATOM   4765 C  CA    . GLY B 2 63  ? 29.35944 6.91193   -11.74095 1.000 37.40758  ? 51  GLY B CA    1 
ATOM   4766 C  C     . GLY B 2 63  ? 28.80572 7.63056   -12.94593 1.000 39.87403  ? 51  GLY B C     1 
ATOM   4767 O  O     . GLY B 2 63  ? 27.94623 8.51233   -12.83926 1.000 41.13357  ? 51  GLY B O     1 
ATOM   4768 N  N     . PRO B 2 64  ? 29.30060 7.26624   -14.12927 1.000 36.78305  ? 52  PRO B N     1 
ATOM   4769 C  CA    . PRO B 2 64  ? 28.80251 7.87857   -15.36206 1.000 39.98220  ? 52  PRO B CA    1 
ATOM   4770 C  C     . PRO B 2 64  ? 27.52256 7.25982   -15.89367 1.000 41.86648  ? 52  PRO B C     1 
ATOM   4771 O  O     . PRO B 2 64  ? 27.06107 7.68713   -16.95555 1.000 43.51690  ? 52  PRO B O     1 
ATOM   4772 C  CB    . PRO B 2 64  ? 29.96323 7.65230   -16.34265 1.000 42.07396  ? 52  PRO B CB    1 
ATOM   4773 C  CG    . PRO B 2 64  ? 30.58338 6.37778   -15.88068 1.000 37.49270  ? 52  PRO B CG    1 
ATOM   4774 C  CD    . PRO B 2 64  ? 30.44431 6.36834   -14.37655 1.000 35.51077  ? 52  PRO B CD    1 
ATOM   4775 N  N     . GLU B 2 65  ? 26.94554 6.25865   -15.22044 1.000 41.05672  ? 53  GLU B N     1 
ATOM   4776 C  CA    . GLU B 2 65  ? 25.66986 5.71722   -15.67986 1.000 41.71493  ? 53  GLU B CA    1 
ATOM   4777 C  C     . GLU B 2 65  ? 24.50739 6.62163   -15.29453 1.000 39.75247  ? 53  GLU B C     1 
ATOM   4778 O  O     . GLU B 2 65  ? 23.41769 6.49362   -15.86123 1.000 40.34309  ? 53  GLU B O     1 
ATOM   4779 C  CB    . GLU B 2 65  ? 25.45874 4.29866   -15.13744 1.000 38.17208  ? 53  GLU B CB    1 
ATOM   4780 C  CG    . GLU B 2 65  ? 25.04651 4.20442   -13.66884 1.000 38.00255  ? 53  GLU B CG    1 
ATOM   4781 C  CD    . GLU B 2 65  ? 26.15552 4.60191   -12.71395 1.000 46.27458  ? 53  GLU B CD    1 
ATOM   4782 O  OE1   . GLU B 2 65  ? 27.27497 4.92040   -13.17597 1.000 47.05527  ? 53  GLU B OE1   1 
ATOM   4783 O  OE2   . GLU B 2 65  ? 25.91131 4.60293   -11.49167 1.000 51.74554  ? 53  GLU B OE2   1 
ATOM   4784 N  N     . ASN B 2 66  ? 24.72280 7.52260   -14.35224 1.000 36.82120  ? 54  ASN B N     1 
ATOM   4785 C  CA    . ASN B 2 66  ? 23.82952 8.63050   -14.07772 1.000 38.15871  ? 54  ASN B CA    1 
ATOM   4786 C  C     . ASN B 2 66  ? 24.11034 9.70584   -15.11794 1.000 42.03729  ? 54  ASN B C     1 
ATOM   4787 O  O     . ASN B 2 66  ? 25.19469 10.30613  -15.09694 1.000 41.37227  ? 54  ASN B O     1 
ATOM   4788 C  CB    . ASN B 2 66  ? 24.06575 9.15416   -12.66035 1.000 39.73392  ? 54  ASN B CB    1 
ATOM   4789 C  CG    . ASN B 2 66  ? 23.14428 10.31105  -12.28637 1.000 40.78935  ? 54  ASN B CG    1 
ATOM   4790 O  OD1   . ASN B 2 66  ? 22.69193 11.06770  -13.13794 1.000 41.06596  ? 54  ASN B OD1   1 
ATOM   4791 N  ND2   . ASN B 2 66  ? 22.86923 10.44867  -10.99109 1.000 41.59545  ? 54  ASN B ND2   1 
ATOM   4792 N  N     . PRO B 2 67  ? 23.17058 9.99663   -16.01831 1.000 45.03822  ? 55  PRO B N     1 
ATOM   4793 C  CA    . PRO B 2 67  ? 23.43325 10.93385  -17.12178 1.000 43.23188  ? 55  PRO B CA    1 
ATOM   4794 C  C     . PRO B 2 67  ? 23.16553 12.40080  -16.82140 1.000 37.67158  ? 55  PRO B C     1 
ATOM   4795 O  O     . PRO B 2 67  ? 23.16368 13.19068  -17.76383 1.000 43.29572  ? 55  PRO B O     1 
ATOM   4796 C  CB    . PRO B 2 67  ? 22.45507 10.44182  -18.19440 1.000 43.34238  ? 55  PRO B CB    1 
ATOM   4797 C  CG    . PRO B 2 67  ? 21.26645 10.03515  -17.40079 1.000 45.35378  ? 55  PRO B CG    1 
ATOM   4798 C  CD    . PRO B 2 67  ? 21.79725 9.46675   -16.08666 1.000 43.99048  ? 55  PRO B CD    1 
ATOM   4799 N  N     . TYR B 2 68  ? 22.95128 12.80019  -15.57246 1.000 38.53043  ? 56  TYR B N     1 
ATOM   4800 C  CA    . TYR B 2 68  ? 22.55726 14.16626  -15.24559 1.000 43.76523  ? 56  TYR B CA    1 
ATOM   4801 C  C     . TYR B 2 68  ? 23.72033 14.94627  -14.63410 1.000 41.16532  ? 56  TYR B C     1 
ATOM   4802 O  O     . TYR B 2 68  ? 24.62731 14.36768  -14.02258 1.000 36.48856  ? 56  TYR B O     1 
ATOM   4803 C  CB    . TYR B 2 68  ? 21.34519 14.16088  -14.29558 1.000 43.37250  ? 56  TYR B CB    1 
ATOM   4804 C  CG    . TYR B 2 68  ? 20.19678 13.33584  -14.84730 1.000 48.32042  ? 56  TYR B CG    1 
ATOM   4805 C  CD1   . TYR B 2 68  ? 19.48295 13.76384  -15.96674 1.000 47.98033  ? 56  TYR B CD1   1 
ATOM   4806 C  CD2   . TYR B 2 68  ? 19.84811 12.11638  -14.27566 1.000 47.27589  ? 56  TYR B CD2   1 
ATOM   4807 C  CE1   . TYR B 2 68  ? 18.44972 13.00485  -16.49289 1.000 50.79906  ? 56  TYR B CE1   1 
ATOM   4808 C  CE2   . TYR B 2 68  ? 18.81521 11.35642  -14.78831 1.000 48.36101  ? 56  TYR B CE2   1 
ATOM   4809 C  CZ    . TYR B 2 68  ? 18.11795 11.80082  -15.89794 1.000 55.49657  ? 56  TYR B CZ    1 
ATOM   4810 O  OH    . TYR B 2 68  ? 17.08812 11.03712  -16.41642 1.000 57.88800  ? 56  TYR B OH    1 
ATOM   4811 N  N     . ASN B 2 69  ? 23.70421 16.27168  -14.81019 1.000 39.55277  ? 57  ASN B N     1 
ATOM   4812 C  CA    . ASN B 2 69  ? 24.77216 17.05023  -14.19549 1.000 39.74655  ? 57  ASN B CA    1 
ATOM   4813 C  C     . ASN B 2 69  ? 24.41483 18.51197  -14.00841 1.000 42.90422  ? 57  ASN B C     1 
ATOM   4814 O  O     . ASN B 2 69  ? 23.87205 19.15788  -14.90654 1.000 44.75685  ? 57  ASN B O     1 
ATOM   4815 C  CB    . ASN B 2 69  ? 26.05355 16.98560  -14.99652 1.000 38.62399  ? 57  ASN B CB    1 
ATOM   4816 C  CG    . ASN B 2 69  ? 27.23781 17.33536  -14.16542 1.000 39.17205  ? 57  ASN B CG    1 
ATOM   4817 O  OD1   . ASN B 2 69  ? 27.53679 16.64292  -13.19733 1.000 40.35979  ? 57  ASN B OD1   1 
ATOM   4818 N  ND2   . ASN B 2 69  ? 27.91158 18.42246  -14.50561 1.000 41.56002  ? 57  ASN B ND2   1 
ATOM   4819 N  N     . THR B 2 70  ? 24.81546 19.03159  -12.85454 1.000 42.59362  ? 58  THR B N     1 
ATOM   4820 C  CA    . THR B 2 70  ? 24.58373 20.39408  -12.43095 1.000 40.23383  ? 58  THR B CA    1 
ATOM   4821 C  C     . THR B 2 70  ? 25.91051 20.96803  -11.95207 1.000 36.56381  ? 58  THR B C     1 
ATOM   4822 O  O     . THR B 2 70  ? 26.60395 20.32447  -11.15230 1.000 36.40089  ? 58  THR B O     1 
ATOM   4823 C  CB    . THR B 2 70  ? 23.54227 20.41819  -11.30394 1.000 42.82413  ? 58  THR B CB    1 
ATOM   4824 O  OG1   . THR B 2 70  ? 22.24076 20.11356  -11.83659 1.000 43.80184  ? 58  THR B OG1   1 
ATOM   4825 C  CG2   . THR B 2 70  ? 23.52555 21.75945  -10.62480 1.000 40.36560  ? 58  THR B CG2   1 
ATOM   4826 N  N     . PRO B 2 71  ? 26.29685 22.15632  -12.39996 1.000 37.47311  ? 59  PRO B N     1 
ATOM   4827 C  CA    . PRO B 2 71  ? 27.62173 22.68372  -12.04974 1.000 36.11452  ? 59  PRO B CA    1 
ATOM   4828 C  C     . PRO B 2 71  ? 27.71230 23.03792  -10.57549 1.000 34.13832  ? 59  PRO B C     1 
ATOM   4829 O  O     . PRO B 2 71  ? 26.72168 23.07653  -9.84852  1.000 36.52920  ? 59  PRO B O     1 
ATOM   4830 C  CB    . PRO B 2 71  ? 27.77670 23.91853  -12.94313 1.000 36.75421  ? 59  PRO B CB    1 
ATOM   4831 C  CG    . PRO B 2 71  ? 26.40864 24.29403  -13.31598 1.000 37.52922  ? 59  PRO B CG    1 
ATOM   4832 C  CD    . PRO B 2 71  ? 25.56629 23.04884  -13.31068 1.000 40.73607  ? 59  PRO B CD    1 
ATOM   4833 N  N     . VAL B 2 72  ? 28.94350 23.28387  -10.13107 1.000 35.76492  ? 60  VAL B N     1 
ATOM   4834 C  CA    . VAL B 2 72  ? 29.22310 23.51048  -8.71853  1.000 37.87987  ? 60  VAL B CA    1 
ATOM   4835 C  C     . VAL B 2 72  ? 30.42522 24.43720  -8.60841  1.000 37.43008  ? 60  VAL B C     1 
ATOM   4836 O  O     . VAL B 2 72  ? 31.30455 24.43898  -9.47215  1.000 39.12922  ? 60  VAL B O     1 
ATOM   4837 C  CB    . VAL B 2 72  ? 29.46209 22.16973  -7.97926  1.000 36.24644  ? 60  VAL B CB    1 
ATOM   4838 C  CG1   . VAL B 2 72  ? 30.74649 21.52445  -8.45294  1.000 36.34702  ? 60  VAL B CG1   1 
ATOM   4839 C  CG2   . VAL B 2 72  ? 29.48996 22.37025  -6.47450  1.000 43.15997  ? 60  VAL B CG2   1 
ATOM   4840 N  N     . PHE B 2 73  ? 30.45183 25.24032  -7.54882  1.000 37.42789  ? 61  PHE B N     1 
ATOM   4841 C  CA    . PHE B 2 73  ? 31.60948 26.07856  -7.26155  1.000 40.68118  ? 61  PHE B CA    1 
ATOM   4842 C  C     . PHE B 2 73  ? 31.59007 26.42512  -5.77233  1.000 44.92173  ? 61  PHE B C     1 
ATOM   4843 O  O     . PHE B 2 73  ? 30.92157 25.74723  -4.98361  1.000 43.90124  ? 61  PHE B O     1 
ATOM   4844 C  CB    . PHE B 2 73  ? 31.65264 27.29921  -8.20084  1.000 41.15568  ? 61  PHE B CB    1 
ATOM   4845 C  CG    . PHE B 2 73  ? 30.52157 28.26863  -8.03995  1.000 41.82842  ? 61  PHE B CG    1 
ATOM   4846 C  CD1   . PHE B 2 73  ? 29.25078 27.96539  -8.47864  1.000 45.48692  ? 61  PHE B CD1   1 
ATOM   4847 C  CD2   . PHE B 2 73  ? 30.75341 29.52738  -7.51875  1.000 49.68822  ? 61  PHE B CD2   1 
ATOM   4848 C  CE1   . PHE B 2 73  ? 28.21815 28.88184  -8.35034  1.000 46.36225  ? 61  PHE B CE1   1 
ATOM   4849 C  CE2   . PHE B 2 73  ? 29.72088 30.45658  -7.39566  1.000 50.42738  ? 61  PHE B CE2   1 
ATOM   4850 C  CZ    . PHE B 2 73  ? 28.45422 30.12859  -7.81097  1.000 42.92766  ? 61  PHE B CZ    1 
ATOM   4851 N  N     . ALA B 2 74  ? 32.35552 27.44747  -5.37675  1.000 45.04947  ? 62  ALA B N     1 
ATOM   4852 C  CA    . ALA B 2 74  ? 32.47788 27.80156  -3.96717  1.000 45.17390  ? 62  ALA B CA    1 
ATOM   4853 C  C     . ALA B 2 74  ? 32.74639 29.28786  -3.82421  1.000 46.59361  ? 62  ALA B C     1 
ATOM   4854 O  O     . ALA B 2 74  ? 33.43980 29.88531  -4.64589  1.000 54.99026  ? 62  ALA B O     1 
ATOM   4855 C  CB    . ALA B 2 74  ? 33.60065 27.00965  -3.28111  1.000 45.78428  ? 62  ALA B CB    1 
ATOM   4856 N  N     . ILE B 2 75  ? 32.21859 29.87383  -2.75484  1.000 50.99625  ? 63  ILE B N     1 
ATOM   4857 C  CA    . ILE B 2 75  ? 32.43739 31.28243  -2.43677  1.000 53.13437  ? 63  ILE B CA    1 
ATOM   4858 C  C     . ILE B 2 75  ? 33.09145 31.37738  -1.06476  1.000 58.26352  ? 63  ILE B C     1 
ATOM   4859 O  O     . ILE B 2 75  ? 32.67852 30.69436  -0.11950  1.000 56.46687  ? 63  ILE B O     1 
ATOM   4860 C  CB    . ILE B 2 75  ? 31.13118 32.09607  -2.47299  1.000 50.19132  ? 63  ILE B CB    1 
ATOM   4861 C  CG1   . ILE B 2 75  ? 30.14098 31.57523  -1.42368  1.000 51.04357  ? 63  ILE B CG1   1 
ATOM   4862 C  CG2   . ILE B 2 75  ? 30.52994 32.04869  -3.86322  1.000 48.28854  ? 63  ILE B CG2   1 
ATOM   4863 C  CD1   . ILE B 2 75  ? 28.80556 32.29108  -1.39668  1.000 48.50812  ? 63  ILE B CD1   1 
ATOM   4864 N  N     . LYS B 2 76  ? 34.13169 32.19800  -0.96586  1.000 62.53471  ? 64  LYS B N     1 
ATOM   4865 C  CA    . LYS B 2 76  ? 34.74350 32.52590  0.31731   1.000 66.64429  ? 64  LYS B CA    1 
ATOM   4866 C  C     . LYS B 2 76  ? 34.11751 33.82595  0.79999   1.000 69.76011  ? 64  LYS B C     1 
ATOM   4867 O  O     . LYS B 2 76  ? 34.35619 34.88638  0.21651   1.000 67.66239  ? 64  LYS B O     1 
ATOM   4868 C  CB    . LYS B 2 76  ? 36.25761 32.65759  0.18561   1.000 65.61615  ? 64  LYS B CB    1 
ATOM   4869 C  CG    . LYS B 2 76  ? 36.97881 32.91931  1.49727   1.000 70.27624  ? 64  LYS B CG    1 
ATOM   4870 C  CD    . LYS B 2 76  ? 38.46503 33.16202  1.26643   1.000 69.56620  ? 64  LYS B CD    1 
ATOM   4871 C  CE    . LYS B 2 76  ? 39.25362 33.06411  2.56399   1.000 71.12857  ? 64  LYS B CE    1 
ATOM   4872 N  NZ    . LYS B 2 76  ? 40.72011 33.04971  2.29491   1.000 65.28900  ? 64  LYS B NZ    1 
ATOM   4873 N  N     . LYS B 2 77  ? 33.30761 33.74362  1.85118   1.000 73.33688  ? 65  LYS B N     1 
ATOM   4874 C  CA    . LYS B 2 77  ? 32.57735 34.91690  2.29764   1.000 83.22239  ? 65  LYS B CA    1 
ATOM   4875 C  C     . LYS B 2 77  ? 33.53040 35.94219  2.90310   1.000 87.64642  ? 65  LYS B C     1 
ATOM   4876 O  O     . LYS B 2 77  ? 34.64843 35.62141  3.32093   1.000 90.54760  ? 65  LYS B O     1 
ATOM   4877 C  CB    . LYS B 2 77  ? 31.47816 34.52581  3.28609   1.000 86.30287  ? 65  LYS B CB    1 
ATOM   4878 C  CG    . LYS B 2 77  ? 30.19073 34.10117  2.57923   1.000 78.29867  ? 65  LYS B CG    1 
ATOM   4879 C  CD    . LYS B 2 77  ? 29.09442 33.73363  3.55380   1.000 84.10751  ? 65  LYS B CD    1 
ATOM   4880 C  CE    . LYS B 2 77  ? 27.86183 33.24430  2.81050   1.000 81.03582  ? 65  LYS B CE    1 
ATOM   4881 N  NZ    . LYS B 2 77  ? 26.84293 32.64811  3.72238   1.000 81.92911  ? 65  LYS B NZ    1 
ATOM   4882 N  N     . LYS B 2 78  ? 33.06971 37.19676  2.92295   1.000 88.69540  ? 66  LYS B N     1 
ATOM   4883 C  CA    . LYS B 2 78  ? 33.93030 38.33794  3.22250   1.000 98.68161  ? 66  LYS B CA    1 
ATOM   4884 C  C     . LYS B 2 78  ? 34.52892 38.22521  4.62048   1.000 104.75928 ? 66  LYS B C     1 
ATOM   4885 O  O     . LYS B 2 78  ? 33.80070 38.21179  5.61941   1.000 98.37459  ? 66  LYS B O     1 
ATOM   4886 C  CB    . LYS B 2 78  ? 33.13688 39.63791  3.08483   1.000 97.51268  ? 66  LYS B CB    1 
ATOM   4887 N  N     . ASP B 2 79  ? 35.85975 38.13778  4.68486   1.000 100.16954 ? 67  ASP B N     1 
ATOM   4888 C  CA    . ASP B 2 79  ? 36.60165 38.05504  5.94097   1.000 101.29561 ? 67  ASP B CA    1 
ATOM   4889 C  C     . ASP B 2 79  ? 36.21731 36.82932  6.77353   1.000 103.99722 ? 67  ASP B C     1 
ATOM   4890 O  O     . ASP B 2 79  ? 36.54653 36.75116  7.96500   1.000 103.57599 ? 67  ASP B O     1 
ATOM   4891 C  CB    . ASP B 2 79  ? 36.42508 39.33628  6.76831   1.000 111.18157 ? 67  ASP B CB    1 
ATOM   4892 N  N     . SER B 2 80  ? 35.51365 35.87349  6.16980   1.000 105.13453 ? 68  SER B N     1 
ATOM   4893 C  CA    . SER B 2 80  ? 35.25430 34.57917  6.78556   1.000 102.38493 ? 68  SER B CA    1 
ATOM   4894 C  C     . SER B 2 80  ? 36.32268 33.60518  6.32155   1.000 94.21419  ? 68  SER B C     1 
ATOM   4895 O  O     . SER B 2 80  ? 36.60551 33.51501  5.12408   1.000 93.68448  ? 68  SER B O     1 
ATOM   4896 C  CB    . SER B 2 80  ? 33.86055 34.05683  6.41959   1.000 97.12252  ? 68  SER B CB    1 
ATOM   4897 N  N     . THR B 2 81  ? 36.92414 32.89307  7.26871   1.000 93.50209  ? 69  THR B N     1 
ATOM   4898 C  CA    . THR B 2 81  ? 37.97210 31.94023  6.92620   1.000 96.33181  ? 69  THR B CA    1 
ATOM   4899 C  C     . THR B 2 81  ? 37.41557 30.60590  6.43189   1.000 93.34664  ? 69  THR B C     1 
ATOM   4900 O  O     . THR B 2 81  ? 38.19697 29.69577  6.11668   1.000 81.61547  ? 69  THR B O     1 
ATOM   4901 C  CB    . THR B 2 81  ? 38.89106 31.72400  8.13223   1.000 90.91612  ? 69  THR B CB    1 
ATOM   4902 O  OG1   . THR B 2 81  ? 39.92430 30.79119  7.78594   1.000 87.28187  ? 69  THR B OG1   1 
ATOM   4903 C  CG2   . THR B 2 81  ? 38.09294 31.21001  9.33649   1.000 83.48568  ? 69  THR B CG2   1 
ATOM   4904 N  N     . LYS B 2 82  ? 36.09181 30.47454  6.35890   1.000 87.69120  ? 70  LYS B N     1 
ATOM   4905 C  CA    . LYS B 2 82  ? 35.43296 29.29766  5.81583   1.000 82.11246  ? 70  LYS B CA    1 
ATOM   4906 C  C     . LYS B 2 82  ? 34.94992 29.57301  4.39492   1.000 75.61895  ? 70  LYS B C     1 
ATOM   4907 O  O     . LYS B 2 82  ? 34.71779 30.72152  4.00778   1.000 71.40752  ? 70  LYS B O     1 
ATOM   4908 C  CB    . LYS B 2 82  ? 34.25274 28.87437  6.69572   1.000 70.77827  ? 70  LYS B CB    1 
ATOM   4909 N  N     . TRP B 2 83  ? 34.82868 28.50262  3.61499   1.000 67.23588  ? 71  TRP B N     1 
ATOM   4910 C  CA    . TRP B 2 83  ? 34.21851 28.54165  2.29662   1.000 57.89760  ? 71  TRP B CA    1 
ATOM   4911 C  C     . TRP B 2 83  ? 32.79860 28.00598  2.37421   1.000 57.37608  ? 71  TRP B C     1 
ATOM   4912 O  O     . TRP B 2 83  ? 32.40226 27.37201  3.35649   1.000 59.05774  ? 71  TRP B O     1 
ATOM   4913 C  CB    . TRP B 2 83  ? 35.01543 27.71628  1.29075   1.000 53.93113  ? 71  TRP B CB    1 
ATOM   4914 C  CG    . TRP B 2 83  ? 36.31137 28.30992  0.91073   1.000 54.67689  ? 71  TRP B CG    1 
ATOM   4915 C  CD1   . TRP B 2 83  ? 37.47289 28.27435  1.62704   1.000 51.00277  ? 71  TRP B CD1   1 
ATOM   4916 C  CD2   . TRP B 2 83  ? 36.60010 29.02123  -0.29417  1.000 54.94889  ? 71  TRP B CD2   1 
ATOM   4917 N  NE1   . TRP B 2 83  ? 38.46304 28.93466  0.94726   1.000 53.79796  ? 71  TRP B NE1   1 
ATOM   4918 C  CE2   . TRP B 2 83  ? 37.95510 29.39987  -0.23827  1.000 55.90799  ? 71  TRP B CE2   1 
ATOM   4919 C  CE3   . TRP B 2 83  ? 35.84091 29.38782  -1.40931  1.000 54.04123  ? 71  TRP B CE3   1 
ATOM   4920 C  CZ2   . TRP B 2 83  ? 38.57143 30.11871  -1.26106  1.000 55.31372  ? 71  TRP B CZ2   1 
ATOM   4921 C  CZ3   . TRP B 2 83  ? 36.45023 30.10308  -2.42247  1.000 51.81575  ? 71  TRP B CZ3   1 
ATOM   4922 C  CH2   . TRP B 2 83  ? 37.80355 30.46205  -2.34062  1.000 56.00538  ? 71  TRP B CH2   1 
ATOM   4923 N  N     . ARG B 2 84  ? 32.03000 28.27198  1.32155   1.000 52.67969  ? 72  ARG B N     1 
ATOM   4924 C  CA    . ARG B 2 84  ? 30.69273 27.72125  1.18680   1.000 49.19290  ? 72  ARG B CA    1 
ATOM   4925 C  C     . ARG B 2 84  ? 30.54119 27.16173  -0.21599  1.000 50.82657  ? 72  ARG B C     1 
ATOM   4926 O  O     . ARG B 2 84  ? 30.79429 27.86397  -1.20051  1.000 49.60338  ? 72  ARG B O     1 
ATOM   4927 C  CB    . ARG B 2 84  ? 29.59918 28.75801  1.45784   1.000 48.89336  ? 72  ARG B CB    1 
ATOM   4928 C  CG    . ARG B 2 84  ? 28.22779 28.12047  1.61426   1.000 48.17178  ? 72  ARG B CG    1 
ATOM   4929 C  CD    . ARG B 2 84  ? 27.11022 29.10975  1.45491   1.000 58.67640  ? 72  ARG B CD    1 
ATOM   4930 N  NE    . ARG B 2 84  ? 25.83506 28.61519  1.97690   1.000 64.85503  ? 72  ARG B NE    1 
ATOM   4931 C  CZ    . ARG B 2 84  ? 24.91883 27.96472  1.26258   1.000 61.47230  ? 72  ARG B CZ    1 
ATOM   4932 N  NH1   . ARG B 2 84  ? 25.12254 27.69677  -0.02296  1.000 56.96753  ? 72  ARG B NH1   1 
ATOM   4933 N  NH2   . ARG B 2 84  ? 23.78792 27.58523  1.84024   1.000 62.12637  ? 72  ARG B NH2   1 
ATOM   4934 N  N     . LYS B 2 85  ? 30.16283 25.89050  -0.29679  1.000 47.80634  ? 73  LYS B N     1 
ATOM   4935 C  CA    . LYS B 2 85  ? 29.81567 25.30452  -1.57102  1.000 38.94004  ? 73  LYS B CA    1 
ATOM   4936 C  C     . LYS B 2 85  ? 28.55529 25.95849  -2.08695  1.000 42.91776  ? 73  LYS B C     1 
ATOM   4937 O  O     . LYS B 2 85  ? 27.69892 26.39377  -1.31567  1.000 48.81473  ? 73  LYS B O     1 
ATOM   4938 C  CB    . LYS B 2 85  ? 29.60828 23.80327  -1.42637  1.000 41.74798  ? 73  LYS B CB    1 
ATOM   4939 C  CG    . LYS B 2 85  ? 29.12464 23.11524  -2.66133  1.000 40.85177  ? 73  LYS B CG    1 
ATOM   4940 C  CD    . LYS B 2 85  ? 29.29013 21.64003  -2.51092  1.000 46.75634  ? 73  LYS B CD    1 
ATOM   4941 C  CE    . LYS B 2 85  ? 28.18864 21.08409  -1.65735  1.000 54.69031  ? 73  LYS B CE    1 
ATOM   4942 N  NZ    . LYS B 2 85  ? 26.99069 20.85121  -2.49988  1.000 61.47721  ? 73  LYS B NZ    1 
ATOM   4943 N  N     . LEU B 2 86  ? 28.44843 26.02901  -3.40888  1.000 48.03543  ? 74  LEU B N     1 
ATOM   4944 C  CA    . LEU B 2 86  ? 27.27984 26.58821  -4.07088  1.000 43.16116  ? 74  LEU B CA    1 
ATOM   4945 C  C     . LEU B 2 86  ? 27.01338 25.76284  -5.31735  1.000 42.59725  ? 74  LEU B C     1 
ATOM   4946 O  O     . LEU B 2 86  ? 27.84277 25.72842  -6.23505  1.000 42.66994  ? 74  LEU B O     1 
ATOM   4947 C  CB    . LEU B 2 86  ? 27.51819 28.05643  -4.42106  1.000 48.25651  ? 74  LEU B CB    1 
ATOM   4948 C  CG    . LEU B 2 86  ? 26.33407 28.97663  -4.67909  1.000 50.53780  ? 74  LEU B CG    1 
ATOM   4949 C  CD1   . LEU B 2 86  ? 25.30094 28.81842  -3.58964  1.000 51.96478  ? 74  LEU B CD1   1 
ATOM   4950 C  CD2   . LEU B 2 86  ? 26.86791 30.39764  -4.69342  1.000 51.65725  ? 74  LEU B CD2   1 
ATOM   4951 N  N     . VAL B 2 87  ? 25.87923 25.08314  -5.33638  1.000 41.68767  ? 75  VAL B N     1 
ATOM   4952 C  CA    . VAL B 2 87  ? 25.43428 24.34251  -6.51044  1.000 40.84744  ? 75  VAL B CA    1 
ATOM   4953 C  C     . VAL B 2 87  ? 24.53205 25.25897  -7.32534  1.000 41.04268  ? 75  VAL B C     1 
ATOM   4954 O  O     . VAL B 2 87  ? 23.65016 25.92796  -6.77439  1.000 42.51429  ? 75  VAL B O     1 
ATOM   4955 C  CB    . VAL B 2 87  ? 24.69073 23.05750  -6.10422  1.000 40.85312  ? 75  VAL B CB    1 
ATOM   4956 C  CG1   . VAL B 2 87  ? 24.47010 22.19149  -7.28771  1.000 35.99460  ? 75  VAL B CG1   1 
ATOM   4957 C  CG2   . VAL B 2 87  ? 25.44217 22.30799  -5.01271  1.000 39.05572  ? 75  VAL B CG2   1 
ATOM   4958 N  N     . ASP B 2 88  ? 24.74861 25.29505  -8.63740  1.000 38.13208  ? 76  ASP B N     1 
ATOM   4959 C  CA    . ASP B 2 88  ? 23.94324 26.12839  -9.52924  1.000 41.61252  ? 76  ASP B CA    1 
ATOM   4960 C  C     . ASP B 2 88  ? 22.76210 25.30316  -10.03071 1.000 43.66112  ? 76  ASP B C     1 
ATOM   4961 O  O     . ASP B 2 88  ? 22.76561 24.75385  -11.13533 1.000 47.50647  ? 76  ASP B O     1 
ATOM   4962 C  CB    . ASP B 2 88  ? 24.79358 26.65957  -10.67915 1.000 43.04623  ? 76  ASP B CB    1 
ATOM   4963 C  CG    . ASP B 2 88  ? 23.96314 27.33047  -11.76551 1.000 47.04124  ? 76  ASP B CG    1 
ATOM   4964 O  OD1   . ASP B 2 88  ? 22.90080 27.90985  -11.43724 1.000 46.24110  ? 76  ASP B OD1   1 
ATOM   4965 O  OD2   . ASP B 2 88  ? 24.36118 27.25136  -12.95279 1.000 48.71242  ? 76  ASP B OD2   1 
ATOM   4966 N  N     . PHE B 2 89  ? 21.71965 25.24055  -9.20442  1.000 40.91974  ? 77  PHE B N     1 
ATOM   4967 C  CA    . PHE B 2 89  ? 20.54413 24.42498  -9.48545  1.000 44.18913  ? 77  PHE B CA    1 
ATOM   4968 C  C     . PHE B 2 89  ? 19.50192 25.13804  -10.34882 1.000 43.02521  ? 77  PHE B C     1 
ATOM   4969 O  O     . PHE B 2 89  ? 18.32485 24.77792  -10.28439 1.000 46.51067  ? 77  PHE B O     1 
ATOM   4970 C  CB    . PHE B 2 89  ? 19.87583 23.97616  -8.18111  1.000 42.79828  ? 77  PHE B CB    1 
ATOM   4971 C  CG    . PHE B 2 89  ? 20.44347 22.71953  -7.58967  1.000 42.96013  ? 77  PHE B CG    1 
ATOM   4972 C  CD1   . PHE B 2 89  ? 20.48718 21.54279  -8.32222  1.000 43.90778  ? 77  PHE B CD1   1 
ATOM   4973 C  CD2   . PHE B 2 89  ? 20.88634 22.69795  -6.27466  1.000 45.54910  ? 77  PHE B CD2   1 
ATOM   4974 C  CE1   . PHE B 2 89  ? 20.99554 20.38412  -7.76110  1.000 39.55392  ? 77  PHE B CE1   1 
ATOM   4975 C  CE2   . PHE B 2 89  ? 21.38662 21.53438  -5.70985  1.000 42.59080  ? 77  PHE B CE2   1 
ATOM   4976 C  CZ    . PHE B 2 89  ? 21.44327 20.38512  -6.45662  1.000 36.67325  ? 77  PHE B CZ    1 
ATOM   4977 N  N     . ARG B 2 90  ? 19.89265 26.13163  -11.14949 1.000 45.31651  ? 78  ARG B N     1 
ATOM   4978 C  CA    . ARG B 2 90  ? 18.88616 26.92121  -11.86155 1.000 49.04823  ? 78  ARG B CA    1 
ATOM   4979 C  C     . ARG B 2 90  ? 18.08742 26.07044  -12.84226 1.000 48.23094  ? 78  ARG B C     1 
ATOM   4980 O  O     . ARG B 2 90  ? 16.85564 26.18729  -12.91606 1.000 52.70474  ? 78  ARG B O     1 
ATOM   4981 C  CB    . ARG B 2 90  ? 19.53697 28.10956  -12.57253 1.000 42.56843  ? 78  ARG B CB    1 
ATOM   4982 C  CG    . ARG B 2 90  ? 19.66703 29.35489  -11.68028 1.000 39.63916  ? 78  ARG B CG    1 
ATOM   4983 C  CD    . ARG B 2 90  ? 20.45771 30.43090  -12.37420 1.000 43.13006  ? 78  ARG B CD    1 
ATOM   4984 N  NE    . ARG B 2 90  ? 21.76016 29.91010  -12.77814 1.000 44.41950  ? 78  ARG B NE    1 
ATOM   4985 C  CZ    . ARG B 2 90  ? 22.70243 30.62277  -13.37669 1.000 41.11904  ? 78  ARG B CZ    1 
ATOM   4986 N  NH1   . ARG B 2 90  ? 22.50222 31.90547  -13.65168 1.000 40.99349  ? 78  ARG B NH1   1 
ATOM   4987 N  NH2   . ARG B 2 90  ? 23.85089 30.05091  -13.69157 1.000 42.18641  ? 78  ARG B NH2   1 
ATOM   4988 N  N     . GLU B 2 91  ? 18.76146 25.19765  -13.58955 1.000 48.93864  ? 79  GLU B N     1 
ATOM   4989 C  CA    . GLU B 2 91  ? 18.05518 24.33582  -14.53579 1.000 53.13745  ? 79  GLU B CA    1 
ATOM   4990 C  C     . GLU B 2 91  ? 17.12458 23.36393  -13.80312 1.000 51.45946  ? 79  GLU B C     1 
ATOM   4991 O  O     . GLU B 2 91  ? 15.93383 23.25716  -14.12757 1.000 54.94428  ? 79  GLU B O     1 
ATOM   4992 C  CB    . GLU B 2 91  ? 19.07026 23.59270  -15.41005 1.000 46.76908  ? 79  GLU B CB    1 
ATOM   4993 C  CG    . GLU B 2 91  ? 18.62370 23.36906  -16.83874 1.000 55.94643  ? 79  GLU B CG    1 
ATOM   4994 C  CD    . GLU B 2 91  ? 18.18833 24.65564  -17.52751 1.000 59.73575  ? 79  GLU B CD    1 
ATOM   4995 O  OE1   . GLU B 2 91  ? 17.10468 24.66921  -18.15866 1.000 59.33952  ? 79  GLU B OE1   1 
ATOM   4996 O  OE2   . GLU B 2 91  ? 18.92259 25.65671  -17.42989 1.000 59.08670  ? 79  GLU B OE2   1 
ATOM   4997 N  N     . LEU B 2 92  ? 17.64370 22.67066  -12.78688 1.000 48.93728  ? 80  LEU B N     1 
ATOM   4998 C  CA    . LEU B 2 92  ? 16.81926 21.73567  -12.02895 1.000 48.51050  ? 80  LEU B CA    1 
ATOM   4999 C  C     . LEU B 2 92  ? 15.59713 22.42297  -11.45355 1.000 52.47732  ? 80  LEU B C     1 
ATOM   5000 O  O     . LEU B 2 92  ? 14.49696 21.86161  -11.45716 1.000 53.06757  ? 80  LEU B O     1 
ATOM   5001 C  CB    . LEU B 2 92  ? 17.63061 21.10725  -10.90173 1.000 50.13609  ? 80  LEU B CB    1 
ATOM   5002 C  CG    . LEU B 2 92  ? 16.90310 20.02273  -10.11505 1.000 46.33275  ? 80  LEU B CG    1 
ATOM   5003 C  CD1   . LEU B 2 92  ? 16.48407 18.90968  -11.05166 1.000 43.79475  ? 80  LEU B CD1   1 
ATOM   5004 C  CD2   . LEU B 2 92  ? 17.79058 19.50980  -9.01048  1.000 41.40373  ? 80  LEU B CD2   1 
ATOM   5005 N  N     . ASN B 2 93  ? 15.77234 23.64125  -10.95028 1.000 55.64514  ? 81  ASN B N     1 
ATOM   5006 C  CA    . ASN B 2 93  ? 14.63860 24.37945  -10.41704 1.000 51.59017  ? 81  ASN B CA    1 
ATOM   5007 C  C     . ASN B 2 93  ? 13.64023 24.70832  -11.51765 1.000 54.65427  ? 81  ASN B C     1 
ATOM   5008 O  O     . ASN B 2 93  ? 12.42882 24.54715  -11.32852 1.000 60.44990  ? 81  ASN B O     1 
ATOM   5009 C  CB    . ASN B 2 93  ? 15.13959 25.63154  -9.70502  1.000 46.61689  ? 81  ASN B CB    1 
ATOM   5010 C  CG    . ASN B 2 93  ? 15.92003 25.29830  -8.44629  1.000 48.04248  ? 81  ASN B CG    1 
ATOM   5011 O  OD1   . ASN B 2 93  ? 15.80166 24.19384  -7.91879  1.000 53.09939  ? 81  ASN B OD1   1 
ATOM   5012 N  ND2   . ASN B 2 93  ? 16.70971 26.24650  -7.95151  1.000 45.78261  ? 81  ASN B ND2   1 
ATOM   5013 N  N     . LYS B 2 94  ? 14.12724 25.13696  -12.68623 1.000 49.18071  ? 82  LYS B N     1 
ATOM   5014 C  CA    . LYS B 2 94  ? 13.23518 25.30313  -13.82812 1.000 50.55236  ? 82  LYS B CA    1 
ATOM   5015 C  C     . LYS B 2 94  ? 12.41115 24.04424  -14.07781 1.000 56.21273  ? 82  LYS B C     1 
ATOM   5016 O  O     . LYS B 2 94  ? 11.24589 24.13234  -14.47682 1.000 63.18563  ? 82  LYS B O     1 
ATOM   5017 C  CB    . LYS B 2 94  ? 14.03424 25.65364  -15.08555 1.000 54.62246  ? 82  LYS B CB    1 
ATOM   5018 C  CG    . LYS B 2 94  ? 13.92279 27.08957  -15.57074 1.000 50.89489  ? 82  LYS B CG    1 
ATOM   5019 C  CD    . LYS B 2 94  ? 14.85365 27.36868  -16.76267 1.000 49.98828  ? 82  LYS B CD    1 
ATOM   5020 C  CE    . LYS B 2 94  ? 16.32557 27.44252  -16.32341 1.000 56.41044  ? 82  LYS B CE    1 
ATOM   5021 N  NZ    . LYS B 2 94  ? 17.26703 28.03701  -17.33966 1.000 56.47162  ? 82  LYS B NZ    1 
ATOM   5022 N  N     . ARG B 2 95  ? 12.98044 22.86727  -13.82613 1.000 56.98449  ? 83  ARG B N     1 
ATOM   5023 C  CA    . ARG B 2 95  ? 12.34067 21.61732  -14.22580 1.000 60.62218  ? 83  ARG B CA    1 
ATOM   5024 C  C     . ARG B 2 95  ? 11.56617 20.91544  -13.11527 1.000 61.57960  ? 83  ARG B C     1 
ATOM   5025 O  O     . ARG B 2 95  ? 10.91137 19.91017  -13.39233 1.000 61.66220  ? 83  ARG B O     1 
ATOM   5026 C  CB    . ARG B 2 95  ? 13.38648 20.65674  -14.79157 1.000 57.18854  ? 83  ARG B CB    1 
ATOM   5027 C  CG    . ARG B 2 95  ? 13.98052 21.13155  -16.08773 1.000 54.63332  ? 83  ARG B CG    1 
ATOM   5028 C  CD    . ARG B 2 95  ? 15.29464 20.45287  -16.35441 1.000 53.69588  ? 83  ARG B CD    1 
ATOM   5029 N  NE    . ARG B 2 95  ? 16.14046 21.27058  -17.21680 1.000 58.02506  ? 83  ARG B NE    1 
ATOM   5030 C  CZ    . ARG B 2 95  ? 16.45523 20.96461  -18.46826 1.000 55.42617  ? 83  ARG B CZ    1 
ATOM   5031 N  NH1   . ARG B 2 95  ? 16.00435 19.84407  -19.01438 1.000 50.24133  ? 83  ARG B NH1   1 
ATOM   5032 N  NH2   . ARG B 2 95  ? 17.23856 21.77620  -19.16224 1.000 57.59674  ? 83  ARG B NH2   1 
ATOM   5033 N  N     . THR B 2 96  ? 11.61660 21.40277  -11.87883 1.000 65.96980  ? 84  THR B N     1 
ATOM   5034 C  CA    . THR B 2 96  ? 10.94306 20.72452  -10.77597 1.000 64.21551  ? 84  THR B CA    1 
ATOM   5035 C  C     . THR B 2 96  ? 9.46889  21.10625  -10.73856 1.000 70.09711  ? 84  THR B C     1 
ATOM   5036 O  O     . THR B 2 96  ? 9.10729  22.25867  -10.99337 1.000 70.48971  ? 84  THR B O     1 
ATOM   5037 C  CB    . THR B 2 96  ? 11.60489 21.07853  -9.44294  1.000 60.30771  ? 84  THR B CB    1 
ATOM   5038 O  OG1   . THR B 2 96  ? 12.99214 20.73431  -9.49025  1.000 62.71120  ? 84  THR B OG1   1 
ATOM   5039 C  CG2   . THR B 2 96  ? 10.97077 20.31650  -8.30674  1.000 63.06148  ? 84  THR B CG2   1 
ATOM   5040 N  N     . GLN B 2 97  ? 8.61599  20.12857  -10.41715 1.000 73.47700  ? 85  GLN B N     1 
ATOM   5041 C  CA    . GLN B 2 97  ? 7.18524  20.37632  -10.28925 1.000 72.52788  ? 85  GLN B CA    1 
ATOM   5042 C  C     . GLN B 2 97  ? 6.93219  21.52579  -9.31831  1.000 76.12820  ? 85  GLN B C     1 
ATOM   5043 O  O     . GLN B 2 97  ? 7.75900  21.81536  -8.44235  1.000 69.84144  ? 85  GLN B O     1 
ATOM   5044 C  CB    . GLN B 2 97  ? 6.45727  19.11131  -9.82867  1.000 61.95860  ? 85  GLN B CB    1 
ATOM   5045 N  N     . ASP B 2 98  ? 5.80073  22.20072  -9.48026  1.000 75.88755  ? 86  ASP B N     1 
ATOM   5046 C  CA    . ASP B 2 98  ? 5.47176  23.32349  -8.61568  1.000 75.98215  ? 86  ASP B CA    1 
ATOM   5047 C  C     . ASP B 2 98  ? 4.62096  22.86208  -7.43941  1.000 70.68547  ? 86  ASP B C     1 
ATOM   5048 O  O     . ASP B 2 98  ? 5.15206  22.36026  -6.44547  1.000 64.69978  ? 86  ASP B O     1 
ATOM   5049 C  CB    . ASP B 2 98  ? 4.76447  24.41748  -9.42126  1.000 80.82151  ? 86  ASP B CB    1 
ATOM   5050 C  CG    . ASP B 2 98  ? 5.67006  25.03002  -10.49499 1.000 85.17857  ? 86  ASP B CG    1 
ATOM   5051 O  OD1   . ASP B 2 98  ? 6.86156  25.28307  -10.20067 1.000 81.17652  ? 86  ASP B OD1   1 
ATOM   5052 O  OD2   . ASP B 2 98  ? 5.20025  25.25452  -11.63577 1.000 84.44385  ? 86  ASP B OD2   1 
ATOM   5053 N  N     . HIS B 2 108 ? 3.04126  36.09011  0.31096   1.000 64.12078  ? 96  HIS B N     1 
ATOM   5054 C  CA    . HIS B 2 108 ? 4.25952  36.86633  0.53907   1.000 74.61333  ? 96  HIS B CA    1 
ATOM   5055 C  C     . HIS B 2 108 ? 3.98831  38.02639  1.48991   1.000 74.13993  ? 96  HIS B C     1 
ATOM   5056 O  O     . HIS B 2 108 ? 3.11029  38.84967  1.23468   1.000 72.58277  ? 96  HIS B O     1 
ATOM   5057 C  CB    . HIS B 2 108 ? 4.83403  37.39878  -0.78949  1.000 72.35189  ? 96  HIS B CB    1 
ATOM   5058 C  CG    . HIS B 2 108 ? 5.97814  38.35533  -0.61764  1.000 68.46647  ? 96  HIS B CG    1 
ATOM   5059 N  ND1   . HIS B 2 108 ? 7.27131  37.93789  -0.38345  1.000 63.94294  ? 96  HIS B ND1   1 
ATOM   5060 C  CD2   . HIS B 2 108 ? 6.01837  39.71117  -0.62750  1.000 68.91588  ? 96  HIS B CD2   1 
ATOM   5061 C  CE1   . HIS B 2 108 ? 8.05843  38.99405  -0.25924  1.000 63.51672  ? 96  HIS B CE1   1 
ATOM   5062 N  NE2   . HIS B 2 108 ? 7.32388  40.08256  -0.40414  1.000 62.54375  ? 96  HIS B NE2   1 
ATOM   5063 N  N     . PRO B 2 109 ? 4.76701  38.11578  2.56666   1.000 73.36279  ? 97  PRO B N     1 
ATOM   5064 C  CA    . PRO B 2 109 ? 4.51159  39.15749  3.57281   1.000 79.14932  ? 97  PRO B CA    1 
ATOM   5065 C  C     . PRO B 2 109 ? 4.81180  40.56721  3.07755   1.000 80.34336  ? 97  PRO B C     1 
ATOM   5066 O  O     . PRO B 2 109 ? 5.97357  40.99783  3.02047   1.000 75.47751  ? 97  PRO B O     1 
ATOM   5067 C  CB    . PRO B 2 109 ? 5.44174  38.76033  4.73086   1.000 76.36322  ? 97  PRO B CB    1 
ATOM   5068 C  CG    . PRO B 2 109 ? 6.50028  37.92506  4.10955   1.000 70.55569  ? 97  PRO B CG    1 
ATOM   5069 C  CD    . PRO B 2 109 ? 5.82090  37.18065  2.98940   1.000 71.26973  ? 97  PRO B CD    1 
ATOM   5070 N  N     . ALA B 2 110 ? 3.73709  41.30823  2.76868   1.000 83.85586  ? 98  ALA B N     1 
ATOM   5071 C  CA    . ALA B 2 110 ? 3.86684  42.64442  2.20115   1.000 79.02713  ? 98  ALA B CA    1 
ATOM   5072 C  C     . ALA B 2 110 ? 4.46357  43.63514  3.18526   1.000 79.70787  ? 98  ALA B C     1 
ATOM   5073 O  O     . ALA B 2 110 ? 4.95955  44.68346  2.75973   1.000 80.13795  ? 98  ALA B O     1 
ATOM   5074 C  CB    . ALA B 2 110 ? 2.50936  43.14578  1.71561   1.000 71.39106  ? 98  ALA B CB    1 
ATOM   5075 N  N     . GLY B 2 111 ? 4.43870  43.32611  4.48387   1.000 80.34427  ? 99  GLY B N     1 
ATOM   5076 C  CA    . GLY B 2 111 ? 4.97595  44.23700  5.48269   1.000 82.35096  ? 99  GLY B CA    1 
ATOM   5077 C  C     . GLY B 2 111 ? 6.47846  44.19125  5.65898   1.000 82.29821  ? 99  GLY B C     1 
ATOM   5078 O  O     . GLY B 2 111 ? 7.03275  45.00813  6.40706   1.000 80.49475  ? 99  GLY B O     1 
ATOM   5079 N  N     . LEU B 2 112 ? 7.14998  43.25253  4.98535   1.000 78.31989  ? 100 LEU B N     1 
ATOM   5080 C  CA    . LEU B 2 112 ? 8.59805  43.14452  5.11693   1.000 75.90337  ? 100 LEU B CA    1 
ATOM   5081 C  C     . LEU B 2 112 ? 9.32146  44.30644  4.43781   1.000 78.81651  ? 100 LEU B C     1 
ATOM   5082 O  O     . LEU B 2 112 ? 10.37996 44.73685  4.91526   1.000 76.03939  ? 100 LEU B O     1 
ATOM   5083 C  CB    . LEU B 2 112 ? 9.07193  41.80460  4.54909   1.000 70.55154  ? 100 LEU B CB    1 
ATOM   5084 C  CG    . LEU B 2 112 ? 10.58668 41.61311  4.44896   1.000 67.89140  ? 100 LEU B CG    1 
ATOM   5085 C  CD1   . LEU B 2 112 ? 11.22621 41.54261  5.83275   1.000 68.92639  ? 100 LEU B CD1   1 
ATOM   5086 C  CD2   . LEU B 2 112 ? 10.92832 40.38727  3.61048   1.000 65.79091  ? 100 LEU B CD2   1 
ATOM   5087 N  N     . LYS B 2 113 ? 8.76865  44.83672  3.33839   1.000 78.06413  ? 101 LYS B N     1 
ATOM   5088 C  CA    . LYS B 2 113 ? 9.40693  45.94044  2.62066   1.000 79.01604  ? 101 LYS B CA    1 
ATOM   5089 C  C     . LYS B 2 113 ? 9.38964  47.25749  3.39314   1.000 83.18753  ? 101 LYS B C     1 
ATOM   5090 O  O     . LYS B 2 113 ? 9.91748  48.25238  2.88202   1.000 83.21745  ? 101 LYS B O     1 
ATOM   5091 C  CB    . LYS B 2 113 ? 8.74279  46.14086  1.25132   1.000 73.02799  ? 101 LYS B CB    1 
ATOM   5092 C  CG    . LYS B 2 113 ? 7.22274  46.07587  1.26488   1.000 73.53407  ? 101 LYS B CG    1 
ATOM   5093 C  CD    . LYS B 2 113 ? 6.62626  46.43255  -0.09391  1.000 66.56804  ? 101 LYS B CD    1 
ATOM   5094 C  CE    . LYS B 2 113 ? 5.13365  46.11916  -0.16501  1.000 68.39089  ? 101 LYS B CE    1 
ATOM   5095 N  NZ    . LYS B 2 113 ? 4.87138  44.67020  -0.42329  1.000 72.82578  ? 101 LYS B NZ    1 
ATOM   5096 N  N     . LYS B 2 114 ? 8.82917  47.28510  4.60794   1.000 87.79303  ? 102 LYS B N     1 
ATOM   5097 C  CA    . LYS B 2 114 ? 8.62163  48.51754  5.35536   1.000 82.77749  ? 102 LYS B CA    1 
ATOM   5098 C  C     . LYS B 2 114 ? 9.39831  48.60824  6.66334   1.000 84.04949  ? 102 LYS B C     1 
ATOM   5099 O  O     . LYS B 2 114 ? 9.43538  49.69115  7.25747   1.000 83.93294  ? 102 LYS B O     1 
ATOM   5100 C  CB    . LYS B 2 114 ? 7.12856  48.69433  5.66100   1.000 76.82104  ? 102 LYS B CB    1 
ATOM   5101 C  CG    . LYS B 2 114 ? 6.25478  48.61612  4.43196   1.000 80.38375  ? 102 LYS B CG    1 
ATOM   5102 C  CD    . LYS B 2 114 ? 4.92765  47.94681  4.74177   1.000 79.26642  ? 102 LYS B CD    1 
ATOM   5103 C  CE    . LYS B 2 114 ? 3.94733  48.12822  3.59068   1.000 83.13706  ? 102 LYS B CE    1 
ATOM   5104 N  NZ    . LYS B 2 114 ? 2.68482  47.35455  3.79894   1.000 85.69048  ? 102 LYS B NZ    1 
ATOM   5105 N  N     . LYS B 2 115 ? 10.01963 47.52500  7.12583   1.000 85.31235  ? 103 LYS B N     1 
ATOM   5106 C  CA    . LYS B 2 115 ? 10.68746 47.53896  8.42148   1.000 82.17250  ? 103 LYS B CA    1 
ATOM   5107 C  C     . LYS B 2 115 ? 11.96861 48.37242  8.38066   1.000 81.31097  ? 103 LYS B C     1 
ATOM   5108 O  O     . LYS B 2 115 ? 12.66318 48.44597  7.36440   1.000 80.41157  ? 103 LYS B O     1 
ATOM   5109 C  CB    . LYS B 2 115 ? 10.99755 46.11192  8.87716   1.000 80.24895  ? 103 LYS B CB    1 
ATOM   5110 C  CG    . LYS B 2 115 ? 9.76485  45.28549  9.28049   1.000 82.30073  ? 103 LYS B CG    1 
ATOM   5111 C  CD    . LYS B 2 115 ? 9.25455  45.64782  10.67584  1.000 79.83101  ? 103 LYS B CD    1 
ATOM   5112 N  N     . LYS B 2 116 ? 12.27138 49.01030  9.51560   1.000 82.80558  ? 104 LYS B N     1 
ATOM   5113 C  CA    . LYS B 2 116 ? 13.41802 49.90943  9.58933   1.000 83.40436  ? 104 LYS B CA    1 
ATOM   5114 C  C     . LYS B 2 116 ? 14.71112 49.18726  9.24275   1.000 83.62316  ? 104 LYS B C     1 
ATOM   5115 O  O     . LYS B 2 116 ? 15.56133 49.72971  8.52441   1.000 85.34777  ? 104 LYS B O     1 
ATOM   5116 C  CB    . LYS B 2 116 ? 13.50643 50.53519  10.98440  1.000 84.54247  ? 104 LYS B CB    1 
ATOM   5117 N  N     . SER B 2 117 ? 14.87598 47.95901  9.72869   1.000 83.50784  ? 105 SER B N     1 
ATOM   5118 C  CA    . SER B 2 117 ? 16.09389 47.20648  9.45711   1.000 82.36004  ? 105 SER B CA    1 
ATOM   5119 C  C     . SER B 2 117 ? 15.75524 45.74279  9.21798   1.000 78.15378  ? 105 SER B C     1 
ATOM   5120 O  O     . SER B 2 117 ? 14.82246 45.20461  9.81931   1.000 82.68750  ? 105 SER B O     1 
ATOM   5121 C  CB    . SER B 2 117 ? 17.10029 47.35003  10.61005  1.000 86.72397  ? 105 SER B CB    1 
ATOM   5122 O  OG    . SER B 2 117 ? 16.44472 47.70127  11.82060  1.000 89.33205  ? 105 SER B OG    1 
ATOM   5123 N  N     . VAL B 2 118 ? 16.51342 45.10370  8.32111   1.000 78.25079  ? 106 VAL B N     1 
ATOM   5124 C  CA    . VAL B 2 118 ? 16.30126 43.70241  7.95159   1.000 72.44371  ? 106 VAL B CA    1 
ATOM   5125 C  C     . VAL B 2 118 ? 17.65615 43.02057  7.79959   1.000 71.33366  ? 106 VAL B C     1 
ATOM   5126 O  O     . VAL B 2 118 ? 18.51372 43.49247  7.04673   1.000 72.14486  ? 106 VAL B O     1 
ATOM   5127 C  CB    . VAL B 2 118 ? 15.48670 43.55988  6.64997   1.000 67.21107  ? 106 VAL B CB    1 
ATOM   5128 C  CG1   . VAL B 2 118 ? 15.41746 42.11876  6.23447   1.000 68.26259  ? 106 VAL B CG1   1 
ATOM   5129 C  CG2   . VAL B 2 118 ? 14.08314 44.11383  6.81920   1.000 70.32121  ? 106 VAL B CG2   1 
ATOM   5130 N  N     . THR B 2 119 ? 17.85032 41.91575  8.51357   1.000 67.41470  ? 107 THR B N     1 
ATOM   5131 C  CA    . THR B 2 119 ? 19.06499 41.11476  8.43076   1.000 68.94316  ? 107 THR B CA    1 
ATOM   5132 C  C     . THR B 2 119 ? 18.74997 39.80239  7.72228   1.000 64.81553  ? 107 THR B C     1 
ATOM   5133 O  O     . THR B 2 119 ? 17.60624 39.34512  7.71994   1.000 66.56532  ? 107 THR B O     1 
ATOM   5134 C  CB    . THR B 2 119 ? 19.65420 40.85662  9.83073   1.000 68.44258  ? 107 THR B CB    1 
ATOM   5135 O  OG1   . THR B 2 119 ? 19.84588 42.10747  10.50795  1.000 68.90313  ? 107 THR B OG1   1 
ATOM   5136 C  CG2   . THR B 2 119 ? 21.00060 40.14685  9.75220   1.000 61.80053  ? 107 THR B CG2   1 
ATOM   5137 N  N     . VAL B 2 120 ? 19.76009 39.20856  7.08810   1.000 66.70267  ? 108 VAL B N     1 
ATOM   5138 C  CA    . VAL B 2 120 ? 19.57494 38.00913  6.27302   1.000 66.41459  ? 108 VAL B CA    1 
ATOM   5139 C  C     . VAL B 2 120 ? 20.48999 36.90452  6.79617   1.000 67.55538  ? 108 VAL B C     1 
ATOM   5140 O  O     . VAL B 2 120 ? 21.71347 36.96499  6.60994   1.000 68.73482  ? 108 VAL B O     1 
ATOM   5141 C  CB    . VAL B 2 120 ? 19.84455 38.27842  4.78690   1.000 64.39676  ? 108 VAL B CB    1 
ATOM   5142 C  CG1   . VAL B 2 120 ? 19.28638 37.14131  3.94564   1.000 67.65559  ? 108 VAL B CG1   1 
ATOM   5143 C  CG2   . VAL B 2 120 ? 19.24517 39.60702  4.35896   1.000 63.27889  ? 108 VAL B CG2   1 
ATOM   5144 N  N     . LEU B 2 121 ? 19.89372 35.87943  7.41252   1.000 64.38875  ? 109 LEU B N     1 
ATOM   5145 C  CA    . LEU B 2 121 ? 20.60323 34.71597  7.93157   1.000 63.08737  ? 109 LEU B CA    1 
ATOM   5146 C  C     . LEU B 2 121 ? 20.64721 33.58911  6.91155   1.000 62.73599  ? 109 LEU B C     1 
ATOM   5147 O  O     . LEU B 2 121 ? 19.69403 33.36517  6.15948   1.000 63.69925  ? 109 LEU B O     1 
ATOM   5148 C  CB    . LEU B 2 121 ? 19.93595 34.18423  9.19699   1.000 60.09509  ? 109 LEU B CB    1 
ATOM   5149 C  CG    . LEU B 2 121 ? 19.77629 35.14209  10.36365  1.000 69.23037  ? 109 LEU B CG    1 
ATOM   5150 C  CD1   . LEU B 2 121 ? 18.97719 34.46170  11.46413  1.000 68.16777  ? 109 LEU B CD1   1 
ATOM   5151 C  CD2   . LEU B 2 121 ? 21.13997 35.59698  10.86430  1.000 67.91248  ? 109 LEU B CD2   1 
ATOM   5152 N  N     . ASP B 2 122 ? 21.74920 32.84695  6.93210   1.000 59.60573  ? 110 ASP B N     1 
ATOM   5153 C  CA    . ASP B 2 122 ? 21.94231 31.68691  6.06684   1.000 61.59690  ? 110 ASP B CA    1 
ATOM   5154 C  C     . ASP B 2 122 ? 21.58536 30.43566  6.86826   1.000 64.49156  ? 110 ASP B C     1 
ATOM   5155 O  O     . ASP B 2 122 ? 22.39475 29.93687  7.65584   1.000 61.39635  ? 110 ASP B O     1 
ATOM   5156 C  CB    . ASP B 2 122 ? 23.37692 31.64621  5.54808   1.000 61.40627  ? 110 ASP B CB    1 
ATOM   5157 C  CG    . ASP B 2 122 ? 23.65736 30.43190  4.67910   1.000 67.00055  ? 110 ASP B CG    1 
ATOM   5158 O  OD1   . ASP B 2 122 ? 22.68857 29.76703  4.24475   1.000 65.17789  ? 110 ASP B OD1   1 
ATOM   5159 O  OD2   . ASP B 2 122 ? 24.85547 30.14060  4.43840   1.000 66.39216  ? 110 ASP B OD2   1 
ATOM   5160 N  N     . VAL B 2 123 ? 20.37639 29.91500  6.64427   1.000 65.67507  ? 111 VAL B N     1 
ATOM   5161 C  CA    . VAL B 2 123 ? 19.89225 28.73817  7.35809   1.000 61.40548  ? 111 VAL B CA    1 
ATOM   5162 C  C     . VAL B 2 123 ? 19.77672 27.54599  6.41958   1.000 61.60228  ? 111 VAL B C     1 
ATOM   5163 O  O     . VAL B 2 123 ? 18.91541 26.68058  6.60502   1.000 65.06060  ? 111 VAL B O     1 
ATOM   5164 C  CB    . VAL B 2 123 ? 18.54376 29.01592  8.03780   1.000 57.87344  ? 111 VAL B CB    1 
ATOM   5165 C  CG1   . VAL B 2 123 ? 18.70680 30.11130  9.06075   1.000 58.31482  ? 111 VAL B CG1   1 
ATOM   5166 C  CG2   . VAL B 2 123 ? 17.48621 29.37403  7.00358   1.000 56.44602  ? 111 VAL B CG2   1 
ATOM   5167 N  N     . GLY B 2 124 ? 20.63510 27.48669  5.40123   1.000 63.99101  ? 112 GLY B N     1 
ATOM   5168 C  CA    . GLY B 2 124 ? 20.66237 26.30647  4.54749   1.000 64.99418  ? 112 GLY B CA    1 
ATOM   5169 C  C     . GLY B 2 124 ? 21.04236 25.04079  5.29459   1.000 67.45138  ? 112 GLY B C     1 
ATOM   5170 O  O     . GLY B 2 124 ? 20.58929 23.94524  4.94190   1.000 68.11743  ? 112 GLY B O     1 
ATOM   5171 N  N     . ASP B 2 125 ? 21.85823 25.18040  6.34500   1.000 66.39206  ? 113 ASP B N     1 
ATOM   5172 C  CA    . ASP B 2 125 ? 22.32325 24.04339  7.13565   1.000 70.44114  ? 113 ASP B CA    1 
ATOM   5173 C  C     . ASP B 2 125 ? 21.17681 23.12124  7.54752   1.000 67.62165  ? 113 ASP B C     1 
ATOM   5174 O  O     . ASP B 2 125 ? 21.29653 21.88993  7.47106   1.000 67.65219  ? 113 ASP B O     1 
ATOM   5175 C  CB    . ASP B 2 125 ? 23.06246 24.57023  8.36679   1.000 74.81309  ? 113 ASP B CB    1 
ATOM   5176 C  CG    . ASP B 2 125 ? 24.11756 23.61791  8.86617   1.000 82.05532  ? 113 ASP B CG    1 
ATOM   5177 O  OD1   . ASP B 2 125 ? 24.97842 23.21951  8.05061   1.000 83.85139  ? 113 ASP B OD1   1 
ATOM   5178 O  OD2   . ASP B 2 125 ? 24.09234 23.27887  10.07410  1.000 84.83453  ? 113 ASP B OD2   1 
ATOM   5179 N  N     . ALA B 2 126 ? 20.04616 23.70549  7.95162   1.000 64.42879  ? 114 ALA B N     1 
ATOM   5180 C  CA    . ALA B 2 126 ? 18.89199 22.92566  8.39182   1.000 63.04584  ? 114 ALA B CA    1 
ATOM   5181 C  C     . ALA B 2 126 ? 18.52641 21.82891  7.40187   1.000 60.94060  ? 114 ALA B C     1 
ATOM   5182 O  O     . ALA B 2 126 ? 18.18432 20.70842  7.79827   1.000 67.10215  ? 114 ALA B O     1 
ATOM   5183 C  CB    . ALA B 2 126 ? 17.69958 23.85651  8.60840   1.000 64.33678  ? 114 ALA B CB    1 
ATOM   5184 N  N     . TYR B 2 127 ? 18.61370 22.12597  6.10625   1.000 63.64539  ? 115 TYR B N     1 
ATOM   5185 C  CA    . TYR B 2 127 ? 18.17793 21.17979  5.08531   1.000 62.57601  ? 115 TYR B CA    1 
ATOM   5186 C  C     . TYR B 2 127 ? 18.89634 19.83604  5.16767   1.000 62.40074  ? 115 TYR B C     1 
ATOM   5187 O  O     . TYR B 2 127 ? 18.34311 18.82264  4.72580   1.000 62.04761  ? 115 TYR B O     1 
ATOM   5188 C  CB    . TYR B 2 127 ? 18.38364 21.80254  3.71133   1.000 60.80536  ? 115 TYR B CB    1 
ATOM   5189 C  CG    . TYR B 2 127 ? 17.50818 23.00246  3.47041   1.000 61.74499  ? 115 TYR B CG    1 
ATOM   5190 C  CD1   . TYR B 2 127 ? 16.17789 23.00014  3.86515   1.000 64.30043  ? 115 TYR B CD1   1 
ATOM   5191 C  CD2   . TYR B 2 127 ? 18.00465 24.13702  2.85348   1.000 60.19703  ? 115 TYR B CD2   1 
ATOM   5192 C  CE1   . TYR B 2 127 ? 15.35944 24.09092  3.64525   1.000 60.89463  ? 115 TYR B CE1   1 
ATOM   5193 C  CE2   . TYR B 2 127 ? 17.19222 25.23151  2.62731   1.000 62.31516  ? 115 TYR B CE2   1 
ATOM   5194 C  CZ    . TYR B 2 127 ? 15.87022 25.20231  3.02765   1.000 59.81980  ? 115 TYR B CZ    1 
ATOM   5195 O  OH    . TYR B 2 127 ? 15.05667 26.28461  2.80800   1.000 58.61420  ? 115 TYR B OH    1 
ATOM   5196 N  N     . PHE B 2 128 ? 20.10561 19.79241  5.73108   1.000 62.95258  ? 116 PHE B N     1 
ATOM   5197 C  CA    . PHE B 2 128 ? 20.81571 18.51979  5.76241   1.000 60.56100  ? 116 PHE B CA    1 
ATOM   5198 C  C     . PHE B 2 128 ? 20.22445 17.54267  6.76115   1.000 63.02856  ? 116 PHE B C     1 
ATOM   5199 O  O     . PHE B 2 128 ? 20.77022 16.44300  6.92282   1.000 59.50705  ? 116 PHE B O     1 
ATOM   5200 C  CB    . PHE B 2 128 ? 22.29788 18.75117  6.06306   1.000 63.68488  ? 116 PHE B CB    1 
ATOM   5201 C  CG    . PHE B 2 128 ? 22.99857 19.56943  5.01671   1.000 64.72577  ? 116 PHE B CG    1 
ATOM   5202 C  CD1   . PHE B 2 128 ? 22.53546 19.57738  3.70351   1.000 62.99964  ? 116 PHE B CD1   1 
ATOM   5203 C  CD2   . PHE B 2 128 ? 24.10075 20.34643  5.34459   1.000 66.72077  ? 116 PHE B CD2   1 
ATOM   5204 C  CE1   . PHE B 2 128 ? 23.15644 20.34155  2.72691   1.000 63.92173  ? 116 PHE B CE1   1 
ATOM   5205 C  CE2   . PHE B 2 128 ? 24.73248 21.11069  4.38268   1.000 69.54852  ? 116 PHE B CE2   1 
ATOM   5206 C  CZ    . PHE B 2 128 ? 24.25932 21.10854  3.06597   1.000 73.46177  ? 116 PHE B CZ    1 
ATOM   5207 N  N     . SER B 2 129 ? 19.12564 17.89892  7.42417   1.000 61.82022  ? 117 SER B N     1 
ATOM   5208 C  CA    . SER B 2 129 ? 18.51731 17.01437  8.40458   1.000 59.22912  ? 117 SER B CA    1 
ATOM   5209 C  C     . SER B 2 129 ? 17.34407 16.21862  7.84912   1.000 58.41111  ? 117 SER B C     1 
ATOM   5210 O  O     . SER B 2 129 ? 16.71797 15.47591  8.60175   1.000 62.03939  ? 117 SER B O     1 
ATOM   5211 C  CB    . SER B 2 129 ? 18.05125 17.81568  9.62038   1.000 60.55353  ? 117 SER B CB    1 
ATOM   5212 O  OG    . SER B 2 129 ? 16.82006 18.47813  9.35353   1.000 64.09200  ? 117 SER B OG    1 
ATOM   5213 N  N     . VAL B 2 130 ? 17.02175 16.35599  6.56207   1.000 56.71393  ? 118 VAL B N     1 
ATOM   5214 C  CA    . VAL B 2 130 ? 15.82575 15.76228  5.98101   1.000 58.00870  ? 118 VAL B CA    1 
ATOM   5215 C  C     . VAL B 2 130 ? 16.20780 14.92586  4.76902   1.000 62.73022  ? 118 VAL B C     1 
ATOM   5216 O  O     . VAL B 2 130 ? 16.82412 15.43731  3.83079   1.000 64.99380  ? 118 VAL B O     1 
ATOM   5217 C  CB    . VAL B 2 130 ? 14.78879 16.82789  5.57729   1.000 55.19868  ? 118 VAL B CB    1 
ATOM   5218 C  CG1   . VAL B 2 130 ? 13.60043 16.17252  4.88660   1.000 52.73544  ? 118 VAL B CG1   1 
ATOM   5219 C  CG2   . VAL B 2 130 ? 14.35538 17.61882  6.79276   1.000 52.75186  ? 118 VAL B CG2   1 
ATOM   5220 N  N     . PRO B 2 131 ? 15.85674 13.64511  4.72086   1.000 60.50915  ? 119 PRO B N     1 
ATOM   5221 C  CA    . PRO B 2 131 ? 16.21502 12.82251  3.56185   1.000 60.84399  ? 119 PRO B CA    1 
ATOM   5222 C  C     . PRO B 2 131 ? 15.51004 13.29560  2.30117   1.000 61.29623  ? 119 PRO B C     1 
ATOM   5223 O  O     . PRO B 2 131 ? 14.56574 14.08414  2.33866   1.000 61.23907  ? 119 PRO B O     1 
ATOM   5224 C  CB    . PRO B 2 131 ? 15.75526 11.42078  3.96890   1.000 63.65386  ? 119 PRO B CB    1 
ATOM   5225 C  CG    . PRO B 2 131 ? 15.74404 11.45423  5.47140   1.000 63.01123  ? 119 PRO B CG    1 
ATOM   5226 C  CD    . PRO B 2 131 ? 15.31218 12.84246  5.82801   1.000 59.02654  ? 119 PRO B CD    1 
ATOM   5227 N  N     . LEU B 2 132 ? 15.98295 12.76940  1.16912   1.000 62.72366  ? 120 LEU B N     1 
ATOM   5228 C  CA    . LEU B 2 132 ? 15.50483 13.12835  -0.16012  1.000 57.16976  ? 120 LEU B CA    1 
ATOM   5229 C  C     . LEU B 2 132 ? 15.01324 11.88363  -0.89161  1.000 58.23159  ? 120 LEU B C     1 
ATOM   5230 O  O     . LEU B 2 132 ? 15.71103 10.86394  -0.93377  1.000 56.89855  ? 120 LEU B O     1 
ATOM   5231 C  CB    . LEU B 2 132 ? 16.61518 13.81938  -0.96557  1.000 57.70145  ? 120 LEU B CB    1 
ATOM   5232 C  CG    . LEU B 2 132 ? 16.35124 14.10062  -2.45173  1.000 57.33665  ? 120 LEU B CG    1 
ATOM   5233 C  CD1   . LEU B 2 132 ? 15.17387 15.04435  -2.64985  1.000 52.46822  ? 120 LEU B CD1   1 
ATOM   5234 C  CD2   . LEU B 2 132 ? 17.59777 14.64776  -3.13205  1.000 54.94217  ? 120 LEU B CD2   1 
ATOM   5235 N  N     . ASP B 2 133 ? 13.82027 11.98453  -1.47392  1.000 56.88319  ? 121 ASP B N     1 
ATOM   5236 C  CA    . ASP B 2 133 ? 13.18505 10.89761  -2.20921  1.000 54.90524  ? 121 ASP B CA    1 
ATOM   5237 C  C     . ASP B 2 133 ? 14.15499 10.21695  -3.16856  1.000 56.55480  ? 121 ASP B C     1 
ATOM   5238 O  O     . ASP B 2 133 ? 14.68839 10.85640  -4.07903  1.000 57.62293  ? 121 ASP B O     1 
ATOM   5239 C  CB    . ASP B 2 133 ? 11.98833 11.46845  -2.96703  1.000 55.73883  ? 121 ASP B CB    1 
ATOM   5240 C  CG    . ASP B 2 133 ? 11.25131 10.42835  -3.76833  1.000 63.65927  ? 121 ASP B CG    1 
ATOM   5241 O  OD1   . ASP B 2 133 ? 10.84779 9.40692   -3.17721  1.000 71.46763  ? 121 ASP B OD1   1 
ATOM   5242 O  OD2   . ASP B 2 133 ? 11.04897 10.64091  -4.98472  1.000 65.12469  ? 121 ASP B OD2   1 
ATOM   5243 N  N     . GLU B 2 134 ? 14.36400 8.90729   -2.96573  1.000 58.25200  ? 122 GLU B N     1 
ATOM   5244 C  CA    . GLU B 2 134 ? 15.40286 8.17489   -3.69357  1.000 58.91259  ? 122 GLU B CA    1 
ATOM   5245 C  C     . GLU B 2 134 ? 15.27709 8.35703   -5.20277  1.000 62.42614  ? 122 GLU B C     1 
ATOM   5246 O  O     . GLU B 2 134 ? 16.27947 8.61150   -5.89176  1.000 59.74065  ? 122 GLU B O     1 
ATOM   5247 C  CB    . GLU B 2 134 ? 15.36177 6.68883   -3.33172  1.000 51.86908  ? 122 GLU B CB    1 
ATOM   5248 N  N     . ASP B 2 135 ? 14.04992 8.26373   -5.73270  1.000 60.03009  ? 123 ASP B N     1 
ATOM   5249 C  CA    . ASP B 2 135 ? 13.84739 8.39521   -7.17350  1.000 60.84596  ? 123 ASP B CA    1 
ATOM   5250 C  C     . ASP B 2 135 ? 14.23381 9.76350   -7.69492  1.000 61.85591  ? 123 ASP B C     1 
ATOM   5251 O  O     . ASP B 2 135 ? 14.31593 9.94313   -8.91675  1.000 61.10912  ? 123 ASP B O     1 
ATOM   5252 C  CB    . ASP B 2 135 ? 12.39537 8.12275   -7.55568  1.000 64.80379  ? 123 ASP B CB    1 
ATOM   5253 C  CG    . ASP B 2 135 ? 12.11469 6.65042   -7.74401  1.000 78.47574  ? 123 ASP B CG    1 
ATOM   5254 O  OD1   . ASP B 2 135 ? 13.00515 5.83131   -7.42708  1.000 76.86370  ? 123 ASP B OD1   1 
ATOM   5255 O  OD2   . ASP B 2 135 ? 11.00538 6.31097   -8.21125  1.000 91.06883  ? 123 ASP B OD2   1 
ATOM   5256 N  N     . PHE B 2 136 ? 14.46357 10.72744  -6.80680  1.000 55.90923  ? 124 PHE B N     1 
ATOM   5257 C  CA    . PHE B 2 136 ? 14.88011 12.05077  -7.22191  1.000 54.35393  ? 124 PHE B CA    1 
ATOM   5258 C  C     . PHE B 2 136 ? 16.38399 12.24425  -7.15709  1.000 55.12808  ? 124 PHE B C     1 
ATOM   5259 O  O     . PHE B 2 136 ? 16.90933 13.09558  -7.88174  1.000 55.17297  ? 124 PHE B O     1 
ATOM   5260 C  CB    . PHE B 2 136 ? 14.20347 13.11435  -6.35600  1.000 53.53446  ? 124 PHE B CB    1 
ATOM   5261 C  CG    . PHE B 2 136 ? 14.08620 14.43864  -7.02776  1.000 54.12673  ? 124 PHE B CG    1 
ATOM   5262 C  CD1   . PHE B 2 136 ? 13.18608 14.62195  -8.06266  1.000 55.44777  ? 124 PHE B CD1   1 
ATOM   5263 C  CD2   . PHE B 2 136 ? 14.87861 15.49617  -6.63826  1.000 53.51591  ? 124 PHE B CD2   1 
ATOM   5264 C  CE1   . PHE B 2 136 ? 13.07318 15.82875  -8.69421  1.000 52.57398  ? 124 PHE B CE1   1 
ATOM   5265 C  CE2   . PHE B 2 136 ? 14.77110 16.72000  -7.26874  1.000 52.10194  ? 124 PHE B CE2   1 
ATOM   5266 C  CZ    . PHE B 2 136 ? 13.86446 16.88450  -8.29565  1.000 52.29013  ? 124 PHE B CZ    1 
ATOM   5267 N  N     . ARG B 2 137 ? 17.08255 11.44982  -6.34218  1.000 50.58499  ? 125 ARG B N     1 
ATOM   5268 C  CA    . ARG B 2 137 ? 18.47217 11.75205  -6.01670  1.000 49.49678  ? 125 ARG B CA    1 
ATOM   5269 C  C     . ARG B 2 137 ? 19.34164 11.89541  -7.25963  1.000 46.21061  ? 125 ARG B C     1 
ATOM   5270 O  O     . ARG B 2 137 ? 20.17688 12.80240  -7.33119  1.000 49.19641  ? 125 ARG B O     1 
ATOM   5271 C  CB    . ARG B 2 137 ? 19.02386 10.67795  -5.08908  1.000 51.61849  ? 125 ARG B CB    1 
ATOM   5272 C  CG    . ARG B 2 137 ? 18.35633 10.70987  -3.74213  1.000 54.04225  ? 125 ARG B CG    1 
ATOM   5273 C  CD    . ARG B 2 137 ? 18.87666 9.63732   -2.82659  1.000 52.80120  ? 125 ARG B CD    1 
ATOM   5274 N  NE    . ARG B 2 137 ? 18.55551 9.96045   -1.44589  1.000 57.11479  ? 125 ARG B NE    1 
ATOM   5275 C  CZ    . ARG B 2 137 ? 18.26503 9.05975   -0.51573  1.000 63.39074  ? 125 ARG B CZ    1 
ATOM   5276 N  NH1   . ARG B 2 137 ? 18.24173 7.76418   -0.81673  1.000 60.89804  ? 125 ARG B NH1   1 
ATOM   5277 N  NH2   . ARG B 2 137 ? 17.98303 9.46184   0.71823   1.000 68.20970  ? 125 ARG B NH2   1 
ATOM   5278 N  N     . LYS B 2 138 ? 19.13852 11.04076  -8.26184  1.000 43.74766  ? 126 LYS B N     1 
ATOM   5279 C  CA    . LYS B 2 138 ? 19.98672 11.07175  -9.44793  1.000 43.14353  ? 126 LYS B CA    1 
ATOM   5280 C  C     . LYS B 2 138 ? 19.98116 12.43235  -10.14027 1.000 49.61641  ? 126 LYS B C     1 
ATOM   5281 O  O     . LYS B 2 138 ? 20.95343 12.77741  -10.82356 1.000 46.71889  ? 126 LYS B O     1 
ATOM   5282 C  CB    . LYS B 2 138 ? 19.54841 9.98893   -10.42358 1.000 40.49724  ? 126 LYS B CB    1 
ATOM   5283 C  CG    . LYS B 2 138 ? 18.05827 9.93944   -10.62754 1.000 47.46948  ? 126 LYS B CG    1 
ATOM   5284 C  CD    . LYS B 2 138 ? 17.67185 8.88837   -11.66446 1.000 54.11522  ? 126 LYS B CD    1 
ATOM   5285 C  CE    . LYS B 2 138 ? 16.15773 8.87421   -11.87500 1.000 66.86673  ? 126 LYS B CE    1 
ATOM   5286 N  NZ    . LYS B 2 138 ? 15.73606 8.03957   -13.03493 1.000 73.06019  ? 126 LYS B NZ    1 
ATOM   5287 N  N     . TYR B 2 139 ? 18.92458 13.22209  -9.96547  1.000 50.38722  ? 127 TYR B N     1 
ATOM   5288 C  CA    . TYR B 2 139 ? 18.84737 14.51383  -10.62957 1.000 49.86400  ? 127 TYR B CA    1 
ATOM   5289 C  C     . TYR B 2 139 ? 19.71575 15.57756  -9.97907  1.000 48.38196  ? 127 TYR B C     1 
ATOM   5290 O  O     . TYR B 2 139 ? 19.81662 16.67815  -10.53128 1.000 48.97491  ? 127 TYR B O     1 
ATOM   5291 C  CB    . TYR B 2 139 ? 17.40668 15.01672  -10.66772 1.000 52.66108  ? 127 TYR B CB    1 
ATOM   5292 C  CG    . TYR B 2 139 ? 16.43700 14.11095  -11.39568 1.000 55.43958  ? 127 TYR B CG    1 
ATOM   5293 C  CD1   . TYR B 2 139 ? 16.63852 13.75673  -12.73141 1.000 50.94686  ? 127 TYR B CD1   1 
ATOM   5294 C  CD2   . TYR B 2 139 ? 15.29712 13.64043  -10.75455 1.000 54.85922  ? 127 TYR B CD2   1 
ATOM   5295 C  CE1   . TYR B 2 139 ? 15.73552 12.94558  -13.39498 1.000 55.58485  ? 127 TYR B CE1   1 
ATOM   5296 C  CE2   . TYR B 2 139 ? 14.39377 12.83417  -11.40925 1.000 55.62036  ? 127 TYR B CE2   1 
ATOM   5297 C  CZ    . TYR B 2 139 ? 14.61180 12.48657  -12.71991 1.000 57.19321  ? 127 TYR B CZ    1 
ATOM   5298 O  OH    . TYR B 2 139 ? 13.68813 11.68055  -13.34289 1.000 61.11225  ? 127 TYR B OH    1 
ATOM   5299 N  N     . THR B 2 140 ? 20.34079 15.29130  -8.83548  1.000 46.64003  ? 128 THR B N     1 
ATOM   5300 C  CA    . THR B 2 140 ? 21.19941 16.26147  -8.16601  1.000 47.03652  ? 128 THR B CA    1 
ATOM   5301 C  C     . THR B 2 140 ? 22.68529 15.96030  -8.34890  1.000 44.92947  ? 128 THR B C     1 
ATOM   5302 O  O     . THR B 2 140 ? 23.50929 16.47935  -7.59217  1.000 44.61072  ? 128 THR B O     1 
ATOM   5303 C  CB    . THR B 2 140 ? 20.86961 16.32618  -6.67723  1.000 51.96153  ? 128 THR B CB    1 
ATOM   5304 O  OG1   . THR B 2 140 ? 21.19612 15.06616  -6.07778  1.000 54.41158  ? 128 THR B OG1   1 
ATOM   5305 C  CG2   . THR B 2 140 ? 19.38228 16.63223  -6.46269  1.000 46.66625  ? 128 THR B CG2   1 
ATOM   5306 N  N     . ALA B 2 141 ? 23.03725 15.12476  -9.32335  1.000 42.80220  ? 129 ALA B N     1 
ATOM   5307 C  CA    . ALA B 2 141 ? 24.43159 14.82856  -9.62656  1.000 37.63823  ? 129 ALA B CA    1 
ATOM   5308 C  C     . ALA B 2 141 ? 25.24817 16.09717  -9.89977  1.000 40.05949  ? 129 ALA B C     1 
ATOM   5309 O  O     . ALA B 2 141 ? 24.76792 17.06755  -10.49881 1.000 39.80082  ? 129 ALA B O     1 
ATOM   5310 C  CB    . ALA B 2 141 ? 24.50696 13.90550  -10.84010 1.000 35.46452  ? 129 ALA B CB    1 
ATOM   5311 N  N     . PHE B 2 142 ? 26.50899 16.06489  -9.47086  1.000 35.27358  ? 130 PHE B N     1 
ATOM   5312 C  CA    . PHE B 2 142 ? 27.46646 17.11370  -9.77047  1.000 35.32202  ? 130 PHE B CA    1 
ATOM   5313 C  C     . PHE B 2 142 ? 28.87224 16.52151  -9.80468  1.000 39.29301  ? 130 PHE B C     1 
ATOM   5314 O  O     . PHE B 2 142 ? 29.09886 15.39880  -9.35297  1.000 35.87316  ? 130 PHE B O     1 
ATOM   5315 C  CB    . PHE B 2 142 ? 27.36651 18.25635  -8.76625  1.000 37.13726  ? 130 PHE B CB    1 
ATOM   5316 C  CG    . PHE B 2 142 ? 27.72476 17.88295  -7.37066  1.000 36.07996  ? 130 PHE B CG    1 
ATOM   5317 C  CD1   . PHE B 2 142 ? 26.74845 17.50347  -6.47474  1.000 35.13577  ? 130 PHE B CD1   1 
ATOM   5318 C  CD2   . PHE B 2 142 ? 29.03827 17.95314  -6.93556  1.000 38.84714  ? 130 PHE B CD2   1 
ATOM   5319 C  CE1   . PHE B 2 142 ? 27.08268 17.18660  -5.17207  1.000 38.94260  ? 130 PHE B CE1   1 
ATOM   5320 C  CE2   . PHE B 2 142 ? 29.38093 17.62717  -5.63231  1.000 33.99459  ? 130 PHE B CE2   1 
ATOM   5321 C  CZ    . PHE B 2 142 ? 28.40341 17.25752  -4.74951  1.000 35.80603  ? 130 PHE B CZ    1 
ATOM   5322 N  N     . THR B 2 143 ? 29.82850 17.29558  -10.34025 1.000 39.71393  ? 131 THR B N     1 
ATOM   5323 C  CA    . THR B 2 143 ? 31.15409 16.76694  -10.66092 1.000 36.75673  ? 131 THR B CA    1 
ATOM   5324 C  C     . THR B 2 143 ? 32.26201 17.71321  -10.22573 1.000 37.90481  ? 131 THR B C     1 
ATOM   5325 O  O     . THR B 2 143 ? 32.38439 18.81788  -10.76980 1.000 34.44061  ? 131 THR B O     1 
ATOM   5326 C  CB    . THR B 2 143 ? 31.27829 16.51259  -12.15928 1.000 39.80835  ? 131 THR B CB    1 
ATOM   5327 O  OG1   . THR B 2 143 ? 30.10021 15.84434  -12.62056 1.000 40.76971  ? 131 THR B OG1   1 
ATOM   5328 C  CG2   . THR B 2 143 ? 32.53635 15.66568  -12.46099 1.000 36.88793  ? 131 THR B CG2   1 
ATOM   5329 N  N     . ILE B 2 144 ? 33.11123 17.25079  -9.31202  1.000 38.13879  ? 132 ILE B N     1 
ATOM   5330 C  CA    . ILE B 2 144 ? 34.30839 18.00844  -8.93302  1.000 38.17957  ? 132 ILE B CA    1 
ATOM   5331 C  C     . ILE B 2 144 ? 35.36421 17.84810  -10.02510 1.000 36.72902  ? 132 ILE B C     1 
ATOM   5332 O  O     . ILE B 2 144 ? 35.71096 16.71016  -10.37698 1.000 39.35927  ? 132 ILE B O     1 
ATOM   5333 C  CB    . ILE B 2 144 ? 34.84523 17.54012  -7.58882  1.000 35.77884  ? 132 ILE B CB    1 
ATOM   5334 C  CG1   . ILE B 2 144 ? 33.72419 17.43739  -6.55408  1.000 34.67132  ? 132 ILE B CG1   1 
ATOM   5335 C  CG2   . ILE B 2 144 ? 35.90454 18.50548  -7.08592  1.000 34.95171  ? 132 ILE B CG2   1 
ATOM   5336 C  CD1   . ILE B 2 144 ? 33.40122 18.72240  -5.90693  1.000 42.26987  ? 132 ILE B CD1   1 
ATOM   5337 N  N     . PRO B 2 145 ? 35.88979 18.94565  -10.57910 1.000 36.87536  ? 133 PRO B N     1 
ATOM   5338 C  CA    . PRO B 2 145 ? 36.96745 18.84207  -11.57230 1.000 36.55713  ? 133 PRO B CA    1 
ATOM   5339 C  C     . PRO B 2 145 ? 38.33395 18.77792  -10.91341 1.000 35.55965  ? 133 PRO B C     1 
ATOM   5340 O  O     . PRO B 2 145 ? 38.42212 18.83950  -9.68337  1.000 37.12395  ? 133 PRO B O     1 
ATOM   5341 C  CB    . PRO B 2 145 ? 36.81064 20.13279  -12.37562 1.000 40.43395  ? 133 PRO B CB    1 
ATOM   5342 C  CG    . PRO B 2 145 ? 36.35559 21.12733  -11.33275 1.000 37.95621  ? 133 PRO B CG    1 
ATOM   5343 C  CD    . PRO B 2 145 ? 35.48119 20.34622  -10.35556 1.000 35.89889  ? 133 PRO B CD    1 
ATOM   5344 N  N     . SER B 2 146 ? 39.40291 18.66661  -11.70310 1.000 31.82583  ? 134 SER B N     1 
ATOM   5345 C  CA    . SER B 2 146 ? 40.75522 18.62285  -11.16250 1.000 33.21994  ? 134 SER B CA    1 
ATOM   5346 C  C     . SER B 2 146 ? 41.64089 19.62158  -11.89911 1.000 36.33418  ? 134 SER B C     1 
ATOM   5347 O  O     . SER B 2 146 ? 41.40997 19.92976  -13.07332 1.000 37.73028  ? 134 SER B O     1 
ATOM   5348 C  CB    . SER B 2 146 ? 41.35292 17.20396  -11.26443 1.000 33.28114  ? 134 SER B CB    1 
ATOM   5349 O  OG    . SER B 2 146 ? 41.75258 16.90335  -12.58614 1.000 32.60553  ? 134 SER B OG    1 
ATOM   5350 N  N     . ILE B 2 147 ? 42.66506 20.12720  -11.20420 1.000 36.23803  ? 135 ILE B N     1 
ATOM   5351 C  CA    . ILE B 2 147 ? 43.62567 21.02048  -11.85410 1.000 37.10159  ? 135 ILE B CA    1 
ATOM   5352 C  C     . ILE B 2 147 ? 44.33105 20.27164  -12.97320 1.000 35.46824  ? 135 ILE B C     1 
ATOM   5353 O  O     . ILE B 2 147 ? 44.78408 19.13778  -12.78880 1.000 35.27315  ? 135 ILE B O     1 
ATOM   5354 C  CB    . ILE B 2 147 ? 44.65743 21.56409  -10.85052 1.000 32.80634  ? 135 ILE B CB    1 
ATOM   5355 C  CG1   . ILE B 2 147 ? 43.98781 22.18217  -9.63701  1.000 36.68282  ? 135 ILE B CG1   1 
ATOM   5356 C  CG2   . ILE B 2 147 ? 45.50816 22.60187  -11.50332 1.000 33.04951  ? 135 ILE B CG2   1 
ATOM   5357 C  CD1   . ILE B 2 147 ? 43.03936 23.26780  -10.00353 1.000 48.92101  ? 135 ILE B CD1   1 
ATOM   5358 N  N     . ASN B 2 148 ? 44.44242 20.90733  -14.13730 1.000 35.22013  ? 136 ASN B N     1 
ATOM   5359 C  CA    . ASN B 2 148 ? 45.23421 20.36311  -15.24258 1.000 32.89969  ? 136 ASN B CA    1 
ATOM   5360 C  C     . ASN B 2 148 ? 44.80748 18.94149  -15.56783 1.000 34.36166  ? 136 ASN B C     1 
ATOM   5361 O  O     . ASN B 2 148 ? 45.60148 18.14370  -16.06604 1.000 36.40212  ? 136 ASN B O     1 
ATOM   5362 C  CB    . ASN B 2 148 ? 46.73386 20.42032  -14.93469 1.000 29.56836  ? 136 ASN B CB    1 
ATOM   5363 C  CG    . ASN B 2 148 ? 47.60368 20.23757  -16.17398 1.000 34.35114  ? 136 ASN B CG    1 
ATOM   5364 O  OD1   . ASN B 2 148 ? 47.20491 20.56168  -17.29757 1.000 37.15900  ? 136 ASN B OD1   1 
ATOM   5365 N  ND2   . ASN B 2 148 ? 48.79220 19.68728  -15.97477 1.000 32.26754  ? 136 ASN B ND2   1 
ATOM   5366 N  N     . ASN B 2 149 ? 43.55155 18.61480  -15.25212 1.000 35.47528  ? 137 ASN B N     1 
ATOM   5367 C  CA    . ASN B 2 149 ? 42.92816 17.35640  -15.64526 1.000 28.46619  ? 137 ASN B CA    1 
ATOM   5368 C  C     . ASN B 2 149 ? 43.79729 16.17039  -15.26049 1.000 33.01605  ? 137 ASN B C     1 
ATOM   5369 O  O     . ASN B 2 149 ? 44.08157 15.28794  -16.06493 1.000 35.80996  ? 137 ASN B O     1 
ATOM   5370 C  CB    . ASN B 2 149 ? 42.61703 17.35011  -17.13420 1.000 31.03907  ? 137 ASN B CB    1 
ATOM   5371 C  CG    . ASN B 2 149 ? 41.47770 18.30132  -17.48836 1.000 37.69408  ? 137 ASN B CG    1 
ATOM   5372 O  OD1   . ASN B 2 149 ? 40.29795 17.95810  -17.33021 1.000 38.52434  ? 137 ASN B OD1   1 
ATOM   5373 N  ND2   . ASN B 2 149 ? 41.82194 19.50249  -17.95688 1.000 29.90996  ? 137 ASN B ND2   1 
ATOM   5374 N  N     . GLU B 2 150 ? 44.23922 16.18216  -14.00575 1.000 33.42136  ? 138 GLU B N     1 
ATOM   5375 C  CA    . GLU B 2 150 ? 45.05495 15.11258  -13.45825 1.000 30.10696  ? 138 GLU B CA    1 
ATOM   5376 C  C     . GLU B 2 150 ? 44.25276 13.82853  -13.29820 1.000 35.71231  ? 138 GLU B C     1 
ATOM   5377 O  O     . GLU B 2 150 ? 44.80529 12.72741  -13.41826 1.000 36.50788  ? 138 GLU B O     1 
ATOM   5378 C  CB    . GLU B 2 150 ? 45.60372 15.56230  -12.10834 1.000 29.99880  ? 138 GLU B CB    1 
ATOM   5379 C  CG    . GLU B 2 150 ? 46.49276 14.57577  -11.39548 1.000 33.85388  ? 138 GLU B CG    1 
ATOM   5380 C  CD    . GLU B 2 150 ? 46.77756 15.00005  -9.96584  1.000 41.78411  ? 138 GLU B CD    1 
ATOM   5381 O  OE1   . GLU B 2 150 ? 46.54381 14.19272  -9.03933  1.000 43.64540  ? 138 GLU B OE1   1 
ATOM   5382 O  OE2   . GLU B 2 150 ? 47.22480 16.15862  -9.77015  1.000 47.89329  ? 138 GLU B OE2   1 
ATOM   5383 N  N     . THR B 2 151 ? 42.97427 13.94401  -12.97581 1.000 30.42510  ? 139 THR B N     1 
ATOM   5384 C  CA    . THR B 2 151 ? 42.08534 12.80555  -12.83591 1.000 35.60253  ? 139 THR B CA    1 
ATOM   5385 C  C     . THR B 2 151 ? 40.80607 13.10086  -13.59562 1.000 33.42531  ? 139 THR B C     1 
ATOM   5386 O  O     . THR B 2 151 ? 40.50670 14.25969  -13.89591 1.000 34.15167  ? 139 THR B O     1 
ATOM   5387 C  CB    . THR B 2 151 ? 41.75047 12.49135  -11.36435 1.000 34.02965  ? 139 THR B CB    1 
ATOM   5388 O  OG1   . THR B 2 151 ? 40.64169 13.28370  -10.93741 1.000 27.32431  ? 139 THR B OG1   1 
ATOM   5389 C  CG2   . THR B 2 151 ? 42.94310 12.73053  -10.45481 1.000 30.20075  ? 139 THR B CG2   1 
ATOM   5390 N  N     . PRO B 2 152 ? 40.04782 12.07105  -13.95566 1.000 32.97921  ? 140 PRO B N     1 
ATOM   5391 C  CA    . PRO B 2 152 ? 38.67211 12.30462  -14.40121 1.000 30.10500  ? 140 PRO B CA    1 
ATOM   5392 C  C     . PRO B 2 152 ? 37.91642 13.03822  -13.30959 1.000 29.99750  ? 140 PRO B C     1 
ATOM   5393 O  O     . PRO B 2 152 ? 38.30791 13.02057  -12.14534 1.000 33.57235  ? 140 PRO B O     1 
ATOM   5394 C  CB    . PRO B 2 152 ? 38.11288 10.89193  -14.61889 1.000 33.42604  ? 140 PRO B CB    1 
ATOM   5395 C  CG    . PRO B 2 152 ? 39.32072 10.00460  -14.80460 1.000 31.34047  ? 140 PRO B CG    1 
ATOM   5396 C  CD    . PRO B 2 152 ? 40.44339 10.64956  -14.01746 1.000 32.52060  ? 140 PRO B CD    1 
ATOM   5397 N  N     . GLY B 2 153 ? 36.83543 13.70838  -13.69333 1.000 28.43002  ? 141 GLY B N     1 
ATOM   5398 C  CA    . GLY B 2 153 ? 35.98602 14.33444  -12.70264 1.000 29.31131  ? 141 GLY B CA    1 
ATOM   5399 C  C     . GLY B 2 153 ? 35.39609 13.32236  -11.73791 1.000 35.11591  ? 141 GLY B C     1 
ATOM   5400 O  O     . GLY B 2 153 ? 35.22338 12.14125  -12.04607 1.000 40.70213  ? 141 GLY B O     1 
ATOM   5401 N  N     . ILE B 2 154 ? 35.05451 13.79349  -10.54580 1.000 34.89316  ? 142 ILE B N     1 
ATOM   5402 C  CA    . ILE B 2 154 ? 34.56156 12.91612  -9.49578  1.000 30.61558  ? 142 ILE B CA    1 
ATOM   5403 C  C     . ILE B 2 154 ? 33.13371 13.32565  -9.12917  1.000 36.66103  ? 142 ILE B C     1 
ATOM   5404 O  O     . ILE B 2 154 ? 32.89284 14.46070  -8.69958  1.000 37.33515  ? 142 ILE B O     1 
ATOM   5405 C  CB    . ILE B 2 154 ? 35.52173 12.92825  -8.30268  1.000 33.89880  ? 142 ILE B CB    1 
ATOM   5406 C  CG1   . ILE B 2 154 ? 36.77970 12.14901  -8.71900  1.000 33.00914  ? 142 ILE B CG1   1 
ATOM   5407 C  CG2   . ILE B 2 154 ? 34.88413 12.32745  -7.08623  1.000 39.60413  ? 142 ILE B CG2   1 
ATOM   5408 C  CD1   . ILE B 2 154 ? 37.83795 12.04337  -7.67303  1.000 38.70080  ? 142 ILE B CD1   1 
ATOM   5409 N  N     . ARG B 2 155 ? 32.18843 12.39716  -9.31273  1.000 37.75472  ? 143 ARG B N     1 
ATOM   5410 C  CA    . ARG B 2 155 ? 30.75201 12.67219  -9.33227  1.000 37.11615  ? 143 ARG B CA    1 
ATOM   5411 C  C     . ARG B 2 155 ? 30.07263 12.31845  -8.01296  1.000 39.26422  ? 143 ARG B C     1 
ATOM   5412 O  O     . ARG B 2 155 ? 30.37449 11.28591  -7.41524  1.000 45.93722  ? 143 ARG B O     1 
ATOM   5413 C  CB    . ARG B 2 155 ? 30.09155 11.88786  -10.47070 1.000 38.19577  ? 143 ARG B CB    1 
ATOM   5414 C  CG    . ARG B 2 155 ? 30.42766 12.46432  -11.83443 1.000 37.84416  ? 143 ARG B CG    1 
ATOM   5415 C  CD    . ARG B 2 155 ? 29.88411 11.65908  -12.99471 1.000 35.04231  ? 143 ARG B CD    1 
ATOM   5416 N  NE    . ARG B 2 155 ? 28.43440 11.53618  -13.03672 1.000 39.37511  ? 143 ARG B NE    1 
ATOM   5417 C  CZ    . ARG B 2 155 ? 27.57406 12.55104  -13.10062 1.000 38.48473  ? 143 ARG B CZ    1 
ATOM   5418 N  NH1   . ARG B 2 155 ? 27.99115 13.79878  -13.08808 1.000 34.36728  ? 143 ARG B NH1   1 
ATOM   5419 N  NH2   . ARG B 2 155 ? 26.27344 12.30466  -13.17101 1.000 43.97034  ? 143 ARG B NH2   1 
ATOM   5420 N  N     . TYR B 2 156 ? 29.14055 13.17459  -7.57265  1.000 38.80681  ? 144 TYR B N     1 
ATOM   5421 C  CA    . TYR B 2 156 ? 28.34626 12.95117  -6.36751  1.000 40.27762  ? 144 TYR B CA    1 
ATOM   5422 C  C     . TYR B 2 156 ? 26.85758 13.15168  -6.64955  1.000 40.63389  ? 144 TYR B C     1 
ATOM   5423 O  O     . TYR B 2 156 ? 26.46557 13.73633  -7.66066  1.000 42.29324  ? 144 TYR B O     1 
ATOM   5424 C  CB    . TYR B 2 156 ? 28.75520 13.88089  -5.22446  1.000 36.68186  ? 144 TYR B CB    1 
ATOM   5425 C  CG    . TYR B 2 156 ? 30.14258 13.63528  -4.63655  1.000 46.08293  ? 144 TYR B CG    1 
ATOM   5426 C  CD1   . TYR B 2 156 ? 31.24599 14.35685  -5.08150  1.000 42.50124  ? 144 TYR B CD1   1 
ATOM   5427 C  CD2   . TYR B 2 156 ? 30.34607 12.70175  -3.62144  1.000 47.10814  ? 144 TYR B CD2   1 
ATOM   5428 C  CE1   . TYR B 2 156 ? 32.50568 14.16018  -4.54223  1.000 41.38001  ? 144 TYR B CE1   1 
ATOM   5429 C  CE2   . TYR B 2 156 ? 31.61136 12.49339  -3.07940  1.000 44.61896  ? 144 TYR B CE2   1 
ATOM   5430 C  CZ    . TYR B 2 156 ? 32.68792 13.23285  -3.54214  1.000 46.85400  ? 144 TYR B CZ    1 
ATOM   5431 O  OH    . TYR B 2 156 ? 33.95556 13.04646  -3.01442  1.000 47.74390  ? 144 TYR B OH    1 
ATOM   5432 N  N     . GLN B 2 157 ? 26.02393 12.62878  -5.74780  1.000 43.55846  ? 145 GLN B N     1 
ATOM   5433 C  CA    . GLN B 2 157 ? 24.59608 12.93839  -5.72714  1.000 44.80325  ? 145 GLN B CA    1 
ATOM   5434 C  C     . GLN B 2 157 ? 24.13783 13.07664  -4.27657  1.000 45.43992  ? 145 GLN B C     1 
ATOM   5435 O  O     . GLN B 2 157 ? 24.82146 12.65463  -3.33548  1.000 41.14009  ? 145 GLN B O     1 
ATOM   5436 C  CB    . GLN B 2 157 ? 23.74276 11.89842  -6.48700  1.000 38.98533  ? 145 GLN B CB    1 
ATOM   5437 C  CG    . GLN B 2 157 ? 23.38693 10.63083  -5.73046  1.000 41.04827  ? 145 GLN B CG    1 
ATOM   5438 C  CD    . GLN B 2 157 ? 22.48096 9.68090   -6.53471  1.000 45.09939  ? 145 GLN B CD    1 
ATOM   5439 O  OE1   . GLN B 2 157 ? 22.39146 9.75828   -7.76834  1.000 47.57642  ? 145 GLN B OE1   1 
ATOM   5440 N  NE2   . GLN B 2 157 ? 21.81418 8.77477   -5.83068  1.000 40.79148  ? 145 GLN B NE2   1 
ATOM   5441 N  N     . TYR B 2 158 ? 22.97437 13.69884  -4.10983  1.000 43.43581  ? 146 TYR B N     1 
ATOM   5442 C  CA    . TYR B 2 158 ? 22.49406 14.12484  -2.80273  1.000 47.52264  ? 146 TYR B CA    1 
ATOM   5443 C  C     . TYR B 2 158 ? 21.64029 13.04924  -2.14921  1.000 46.81311  ? 146 TYR B C     1 
ATOM   5444 O  O     . TYR B 2 158 ? 20.94748 12.28596  -2.82357  1.000 48.14150  ? 146 TYR B O     1 
ATOM   5445 C  CB    . TYR B 2 158 ? 21.68936 15.42612  -2.92461  1.000 49.17603  ? 146 TYR B CB    1 
ATOM   5446 C  CG    . TYR B 2 158 ? 22.54089 16.64934  -2.69655  1.000 50.54288  ? 146 TYR B CG    1 
ATOM   5447 C  CD1   . TYR B 2 158 ? 23.20929 17.26906  -3.74621  1.000 44.43887  ? 146 TYR B CD1   1 
ATOM   5448 C  CD2   . TYR B 2 158 ? 22.70650 17.16190  -1.41841  1.000 49.32365  ? 146 TYR B CD2   1 
ATOM   5449 C  CE1   . TYR B 2 158 ? 24.00956 18.37121  -3.52012  1.000 42.52871  ? 146 TYR B CE1   1 
ATOM   5450 C  CE2   . TYR B 2 158 ? 23.49374 18.25904  -1.18744  1.000 50.29782  ? 146 TYR B CE2   1 
ATOM   5451 C  CZ    . TYR B 2 158 ? 24.14522 18.86066  -2.23571  1.000 48.44065  ? 146 TYR B CZ    1 
ATOM   5452 O  OH    . TYR B 2 158 ? 24.93346 19.95452  -1.97618  1.000 50.94855  ? 146 TYR B OH    1 
ATOM   5453 N  N     . ASN B 2 159 ? 21.70646 12.99091  -0.81794  1.000 49.00459  ? 147 ASN B N     1 
ATOM   5454 C  CA    . ASN B 2 159 ? 20.84858 12.11368  -0.02480  1.000 55.66736  ? 147 ASN B CA    1 
ATOM   5455 C  C     . ASN B 2 159 ? 19.91416 12.87528  0.89047   1.000 57.70686  ? 147 ASN B C     1 
ATOM   5456 O  O     . ASN B 2 159 ? 19.05246 12.25656  1.52653   1.000 61.78339  ? 147 ASN B O     1 
ATOM   5457 C  CB    . ASN B 2 159 ? 21.68183 11.15404  0.84254   1.000 52.09789  ? 147 ASN B CB    1 
ATOM   5458 C  CG    . ASN B 2 159 ? 22.54830 10.24330  0.02822   1.000 46.61843  ? 147 ASN B CG    1 
ATOM   5459 O  OD1   . ASN B 2 159 ? 22.12135 9.70585   -0.99101  1.000 45.12349  ? 147 ASN B OD1   1 
ATOM   5460 N  ND2   . ASN B 2 159 ? 23.79308 10.08369  0.45835   1.000 46.31191  ? 147 ASN B ND2   1 
ATOM   5461 N  N     . VAL B 2 160 ? 20.08134 14.18547  0.99290   1.000 59.32524  ? 148 VAL B N     1 
ATOM   5462 C  CA    . VAL B 2 160 ? 19.30494 15.04579  1.85632   1.000 58.16502  ? 148 VAL B CA    1 
ATOM   5463 C  C     . VAL B 2 160 ? 18.90510 16.26807  1.04183   1.000 59.83487  ? 148 VAL B C     1 
ATOM   5464 O  O     . VAL B 2 160 ? 19.30462 16.42163  -0.11627  1.000 58.54570  ? 148 VAL B O     1 
ATOM   5465 C  CB    . VAL B 2 160 ? 20.09339 15.45761  3.10834   1.000 60.08788  ? 148 VAL B CB    1 
ATOM   5466 C  CG1   . VAL B 2 160 ? 20.45862 14.21823  3.92456   1.000 54.98767  ? 148 VAL B CG1   1 
ATOM   5467 C  CG2   . VAL B 2 160 ? 21.33862 16.21406  2.68162   1.000 56.59229  ? 148 VAL B CG2   1 
ATOM   5468 N  N     . LEU B 2 161 ? 18.10498 17.13660  1.64768   1.000 62.28231  ? 149 LEU B N     1 
ATOM   5469 C  CA    . LEU B 2 161 ? 17.63015 18.31655  0.94277   1.000 54.25294  ? 149 LEU B CA    1 
ATOM   5470 C  C     . LEU B 2 161 ? 18.82911 19.16722  0.56485   1.000 53.31362  ? 149 LEU B C     1 
ATOM   5471 O  O     . LEU B 2 161 ? 19.59294 19.57778  1.45031   1.000 54.20476  ? 149 LEU B O     1 
ATOM   5472 C  CB    . LEU B 2 161 ? 16.66200 19.11974  1.79863   1.000 57.18940  ? 149 LEU B CB    1 
ATOM   5473 C  CG    . LEU B 2 161 ? 15.32756 18.45081  2.10177   1.000 53.23438  ? 149 LEU B CG    1 
ATOM   5474 C  CD1   . LEU B 2 161 ? 14.49083 19.36437  2.94454   1.000 52.14209  ? 149 LEU B CD1   1 
ATOM   5475 C  CD2   . LEU B 2 161 ? 14.60907 18.08515  0.81908   1.000 52.16441  ? 149 LEU B CD2   1 
ATOM   5476 N  N     . PRO B 2 162 ? 19.05026 19.42882  -0.71356  1.000 53.12259  ? 150 PRO B N     1 
ATOM   5477 C  CA    . PRO B 2 162 ? 20.21233 20.22903  -1.11139  1.000 51.62849  ? 150 PRO B CA    1 
ATOM   5478 C  C     . PRO B 2 162 ? 19.94347 21.72641  -0.99137  1.000 49.10282  ? 150 PRO B C     1 
ATOM   5479 O  O     . PRO B 2 162 ? 18.83594 22.20708  -1.23690  1.000 47.69634  ? 150 PRO B O     1 
ATOM   5480 C  CB    . PRO B 2 162 ? 20.44214 19.81127  -2.57079  1.000 50.59354  ? 150 PRO B CB    1 
ATOM   5481 C  CG    . PRO B 2 162 ? 19.23566 18.90113  -2.94979  1.000 49.86678  ? 150 PRO B CG    1 
ATOM   5482 C  CD    . PRO B 2 162 ? 18.22904 19.01205  -1.86101  1.000 51.02906  ? 150 PRO B CD    1 
ATOM   5483 N  N     . GLN B 2 163 ? 20.97606 22.46201  -0.59125  1.000 49.38704  ? 151 GLN B N     1 
ATOM   5484 C  CA    . GLN B 2 163 ? 20.89005 23.91330  -0.52626  1.000 50.32243  ? 151 GLN B CA    1 
ATOM   5485 C  C     . GLN B 2 163 ? 20.77487 24.49800  -1.92926  1.000 55.22717  ? 151 GLN B C     1 
ATOM   5486 O  O     . GLN B 2 163 ? 21.46280 24.06576  -2.85954  1.000 54.94816  ? 151 GLN B O     1 
ATOM   5487 C  CB    . GLN B 2 163 ? 22.12000 24.48891  0.17415   1.000 51.47691  ? 151 GLN B CB    1 
ATOM   5488 C  CG    . GLN B 2 163 ? 22.72129 23.57710  1.21309   1.000 57.63351  ? 151 GLN B CG    1 
ATOM   5489 C  CD    . GLN B 2 163 ? 23.67466 24.30124  2.13328   1.000 62.17943  ? 151 GLN B CD    1 
ATOM   5490 O  OE1   . GLN B 2 163 ? 23.25908 25.14243  2.92639   1.000 63.98819  ? 151 GLN B OE1   1 
ATOM   5491 N  NE2   . GLN B 2 163 ? 24.96219 23.98236  2.03439   1.000 65.38109  ? 151 GLN B NE2   1 
ATOM   5492 N  N     . GLY B 2 164 ? 19.89995 25.48770  -2.08550  1.000 52.20581  ? 152 GLY B N     1 
ATOM   5493 C  CA    . GLY B 2 164 ? 19.70569 26.08529  -3.38961  1.000 49.53242  ? 152 GLY B CA    1 
ATOM   5494 C  C     . GLY B 2 164 ? 18.76494 25.35321  -4.32064  1.000 49.54304  ? 152 GLY B C     1 
ATOM   5495 O  O     . GLY B 2 164 ? 18.64718 25.75630  -5.48710  1.000 50.75936  ? 152 GLY B O     1 
ATOM   5496 N  N     . TRP B 2 165 ? 18.08893 24.30051  -3.85550  1.000 43.55800  ? 153 TRP B N     1 
ATOM   5497 C  CA    . TRP B 2 165 ? 17.07713 23.60772  -4.64496  1.000 46.73914  ? 153 TRP B CA    1 
ATOM   5498 C  C     . TRP B 2 165 ? 15.68829 24.10397  -4.27329  1.000 50.64799  ? 153 TRP B C     1 
ATOM   5499 O  O     . TRP B 2 165 ? 15.34710 24.16884  -3.09080  1.000 54.11565  ? 153 TRP B O     1 
ATOM   5500 C  CB    . TRP B 2 165 ? 17.14537 22.09464  -4.43885  1.000 54.82902  ? 153 TRP B CB    1 
ATOM   5501 C  CG    . TRP B 2 165 ? 16.02148 21.33473  -5.13900  1.000 51.34187  ? 153 TRP B CG    1 
ATOM   5502 C  CD1   . TRP B 2 165 ? 15.68101 21.41349  -6.45448  1.000 50.07045  ? 153 TRP B CD1   1 
ATOM   5503 C  CD2   . TRP B 2 165 ? 15.12400 20.38199  -4.55252  1.000 47.23969  ? 153 TRP B CD2   1 
ATOM   5504 N  NE1   . TRP B 2 165 ? 14.62836 20.57791  -6.72282  1.000 50.67539  ? 153 TRP B NE1   1 
ATOM   5505 C  CE2   . TRP B 2 165 ? 14.27024 19.93159  -5.57106  1.000 49.61163  ? 153 TRP B CE2   1 
ATOM   5506 C  CE3   . TRP B 2 165 ? 14.96791 19.86037  -3.26863  1.000 52.19323  ? 153 TRP B CE3   1 
ATOM   5507 C  CZ2   . TRP B 2 165 ? 13.26591 18.99137  -5.34432  1.000 53.30924  ? 153 TRP B CZ2   1 
ATOM   5508 C  CZ3   . TRP B 2 165 ? 13.96977 18.92369  -3.04892  1.000 51.70467  ? 153 TRP B CZ3   1 
ATOM   5509 C  CH2   . TRP B 2 165 ? 13.13468 18.50147  -4.07956  1.000 47.87347  ? 153 TRP B CH2   1 
ATOM   5510 N  N     . LYS B 2 166 ? 14.87962 24.40891  -5.29213  1.000 53.78927  ? 154 LYS B N     1 
ATOM   5511 C  CA    . LYS B 2 166 ? 13.55754 24.99523  -5.07307  1.000 57.93861  ? 154 LYS B CA    1 
ATOM   5512 C  C     . LYS B 2 166 ? 12.74525 24.20685  -4.04977  1.000 58.34218  ? 154 LYS B C     1 
ATOM   5513 O  O     . LYS B 2 166 ? 12.02925 24.79081  -3.22590  1.000 56.41988  ? 154 LYS B O     1 
ATOM   5514 C  CB    . LYS B 2 166 ? 12.79880 25.07248  -6.40317  1.000 59.04574  ? 154 LYS B CB    1 
ATOM   5515 C  CG    . LYS B 2 166 ? 11.30348 25.30610  -6.24650  1.000 61.99770  ? 154 LYS B CG    1 
ATOM   5516 C  CD    . LYS B 2 166 ? 10.49785 24.56493  -7.29482  1.000 60.38413  ? 154 LYS B CD    1 
ATOM   5517 C  CE    . LYS B 2 166 ? 10.40688 25.33800  -8.59169  1.000 60.58117  ? 154 LYS B CE    1 
ATOM   5518 N  NZ    . LYS B 2 166 ? 9.42685  24.69579  -9.52167  1.000 66.90578  ? 154 LYS B NZ    1 
ATOM   5519 N  N     . GLY B 2 167 ? 12.85876 22.87690  -4.07506  1.000 54.57805  ? 155 GLY B N     1 
ATOM   5520 C  CA    . GLY B 2 167 ? 12.04414 22.04678  -3.20783  1.000 54.50814  ? 155 GLY B CA    1 
ATOM   5521 C  C     . GLY B 2 167 ? 12.49068 21.96573  -1.76167  1.000 55.12885  ? 155 GLY B C     1 
ATOM   5522 O  O     . GLY B 2 167 ? 11.69109 21.56080  -0.91140  1.000 55.89347  ? 155 GLY B O     1 
ATOM   5523 N  N     . SER B 2 168 ? 13.74976 22.29920  -1.46262  1.000 53.60730  ? 156 SER B N     1 
ATOM   5524 C  CA    . SER B 2 168 ? 14.21405 22.23697  -0.07590  1.000 56.82820  ? 156 SER B CA    1 
ATOM   5525 C  C     . SER B 2 168 ? 13.38661 23.10609  0.86653   1.000 59.78514  ? 156 SER B C     1 
ATOM   5526 O  O     . SER B 2 168 ? 12.94686 22.59574  1.91449   1.000 57.74755  ? 156 SER B O     1 
ATOM   5527 C  CB    . SER B 2 168 ? 15.69944 22.61045  0.00430   1.000 57.37106  ? 156 SER B CB    1 
ATOM   5528 O  OG    . SER B 2 168 ? 16.53106 21.61017  -0.54526  1.000 56.56447  ? 156 SER B OG    1 
ATOM   5529 N  N     . PRO B 2 169 ? 13.13517 24.39262  0.58366   1.000 59.84580  ? 157 PRO B N     1 
ATOM   5530 C  CA    . PRO B 2 169 ? 12.28301 25.15719  1.50802   1.000 62.76700  ? 157 PRO B CA    1 
ATOM   5531 C  C     . PRO B 2 169 ? 10.83469 24.69389  1.49964   1.000 60.49550  ? 157 PRO B C     1 
ATOM   5532 O  O     . PRO B 2 169 ? 10.19792 24.68897  2.56164   1.000 64.26645  ? 157 PRO B O     1 
ATOM   5533 C  CB    . PRO B 2 169 ? 12.43952 26.60320  1.01538   1.000 58.28520  ? 157 PRO B CB    1 
ATOM   5534 C  CG    . PRO B 2 169 ? 12.78029 26.46916  -0.40461  1.000 56.98569  ? 157 PRO B CG    1 
ATOM   5535 C  CD    . PRO B 2 169 ? 13.61848 25.23806  -0.52142  1.000 55.89553  ? 157 PRO B CD    1 
ATOM   5536 N  N     . ALA B 2 170 ? 10.30331 24.27581  0.34346   1.000 54.39169  ? 158 ALA B N     1 
ATOM   5537 C  CA    . ALA B 2 170 ? 8.93352  23.76587  0.29640   1.000 53.80998  ? 158 ALA B CA    1 
ATOM   5538 C  C     . ALA B 2 170 ? 8.75413  22.59511  1.25098   1.000 59.26535  ? 158 ALA B C     1 
ATOM   5539 O  O     . ALA B 2 170 ? 7.81971  22.57016  2.06000   1.000 61.24528  ? 158 ALA B O     1 
ATOM   5540 C  CB    . ALA B 2 170 ? 8.56583  23.34408  -1.12562  1.000 40.74440  ? 158 ALA B CB    1 
ATOM   5541 N  N     . ILE B 2 171 ? 9.66107  21.62399  1.18581   1.000 60.58762  ? 159 ILE B N     1 
ATOM   5542 C  CA    . ILE B 2 171 ? 9.51510  20.41469  1.98482   1.000 59.16442  ? 159 ILE B CA    1 
ATOM   5543 C  C     . ILE B 2 171 ? 9.85210  20.68677  3.44918   1.000 56.42631  ? 159 ILE B C     1 
ATOM   5544 O  O     . ILE B 2 171 ? 9.21364  20.14675  4.35818   1.000 62.41590  ? 159 ILE B O     1 
ATOM   5545 C  CB    . ILE B 2 171 ? 10.37000 19.28580  1.36231   1.000 58.16611  ? 159 ILE B CB    1 
ATOM   5546 C  CG1   . ILE B 2 171 ? 9.60015  18.62097  0.21621   1.000 53.00350  ? 159 ILE B CG1   1 
ATOM   5547 C  CG2   . ILE B 2 171 ? 10.78706 18.25531  2.38739   1.000 54.37008  ? 159 ILE B CG2   1 
ATOM   5548 C  CD1   . ILE B 2 171 ? 10.47245 17.96277  -0.79577  1.000 48.17355  ? 159 ILE B CD1   1 
ATOM   5549 N  N     . PHE B 2 172 ? 10.82271 21.54703  3.71936   1.000 54.73767  ? 160 PHE B N     1 
ATOM   5550 C  CA    . PHE B 2 172 ? 11.15637 21.81997  5.11109   1.000 59.07164  ? 160 PHE B CA    1 
ATOM   5551 C  C     . PHE B 2 172 ? 10.20954 22.82058  5.77138   1.000 65.38503  ? 160 PHE B C     1 
ATOM   5552 O  O     . PHE B 2 172 ? 10.30581 23.01981  6.98833   1.000 66.02363  ? 160 PHE B O     1 
ATOM   5553 C  CB    . PHE B 2 172 ? 12.59223 22.32216  5.18088   1.000 58.06064  ? 160 PHE B CB    1 
ATOM   5554 C  CG    . PHE B 2 172 ? 13.14650 22.40331  6.55742   1.000 58.66573  ? 160 PHE B CG    1 
ATOM   5555 C  CD1   . PHE B 2 172 ? 13.73990 21.30125  7.13784   1.000 60.39335  ? 160 PHE B CD1   1 
ATOM   5556 C  CD2   . PHE B 2 172 ? 13.13464 23.60328  7.25078   1.000 62.68285  ? 160 PHE B CD2   1 
ATOM   5557 C  CE1   . PHE B 2 172 ? 14.28605 21.38147  8.40048   1.000 64.38453  ? 160 PHE B CE1   1 
ATOM   5558 C  CE2   . PHE B 2 172 ? 13.66420 23.69454  8.51343   1.000 62.68679  ? 160 PHE B CE2   1 
ATOM   5559 C  CZ    . PHE B 2 172 ? 14.24505 22.58109  9.09267   1.000 69.12164  ? 160 PHE B CZ    1 
ATOM   5560 N  N     . GLN B 2 173 ? 9.29028  23.42310  5.00514   1.000 66.52835  ? 161 GLN B N     1 
ATOM   5561 C  CA    . GLN B 2 173 ? 8.45942  24.51039  5.51663   1.000 69.20146  ? 161 GLN B CA    1 
ATOM   5562 C  C     . GLN B 2 173 ? 7.80357  24.17660  6.85152   1.000 71.05089  ? 161 GLN B C     1 
ATOM   5563 O  O     . GLN B 2 173 ? 7.77143  25.01852  7.75605   1.000 70.09431  ? 161 GLN B O     1 
ATOM   5564 C  CB    . GLN B 2 173 ? 7.39546  24.87366  4.47974   1.000 62.86588  ? 161 GLN B CB    1 
ATOM   5565 C  CG    . GLN B 2 173 ? 6.52347  26.04321  4.87175   1.000 65.61986  ? 161 GLN B CG    1 
ATOM   5566 C  CD    . GLN B 2 173 ? 5.59406  26.46703  3.74733   1.000 79.21833  ? 161 GLN B CD    1 
ATOM   5567 O  OE1   . GLN B 2 173 ? 4.83628  25.65564  3.20646   1.000 78.56203  ? 161 GLN B OE1   1 
ATOM   5568 N  NE2   . GLN B 2 173 ? 5.65515  27.74292  3.38183   1.000 79.63968  ? 161 GLN B NE2   1 
ATOM   5569 N  N     . SER B 2 174 ? 7.25334  22.96663  6.98719   1.000 70.87196  ? 162 SER B N     1 
ATOM   5570 C  CA    . SER B 2 174 ? 6.48314  22.63888  8.18461   1.000 69.11420  ? 162 SER B CA    1 
ATOM   5571 C  C     . SER B 2 174 ? 7.37215  22.62481  9.42479   1.000 70.34313  ? 162 SER B C     1 
ATOM   5572 O  O     . SER B 2 174 ? 7.02800  23.22122  10.45752  1.000 73.91661  ? 162 SER B O     1 
ATOM   5573 C  CB    . SER B 2 174 ? 5.78397  21.29657  7.99876   1.000 66.93927  ? 162 SER B CB    1 
ATOM   5574 O  OG    . SER B 2 174 ? 6.74445  20.26091  7.86081   1.000 79.42004  ? 162 SER B OG    1 
ATOM   5575 N  N     . SER B 2 175 ? 8.52666  21.95249  9.33857   1.000 65.83819  ? 163 SER B N     1 
ATOM   5576 C  CA    . SER B 2 175 ? 9.49007  21.97390  10.43790  1.000 67.32894  ? 163 SER B CA    1 
ATOM   5577 C  C     . SER B 2 175 ? 9.98896  23.38723  10.71539  1.000 72.42451  ? 163 SER B C     1 
ATOM   5578 O  O     . SER B 2 175 ? 10.25592 23.74289  11.87380  1.000 71.10403  ? 163 SER B O     1 
ATOM   5579 C  CB    . SER B 2 175 ? 10.66374 21.04896  10.11969  1.000 64.15845  ? 163 SER B CB    1 
ATOM   5580 O  OG    . SER B 2 175 ? 10.20103 19.85801  9.50326   1.000 71.32371  ? 163 SER B OG    1 
ATOM   5581 N  N     . MET B 2 176 ? 10.09704 24.21339  9.67003   1.000 72.69705  ? 164 MET B N     1 
ATOM   5582 C  CA    . MET B 2 176 ? 10.50996 25.60050  9.86355   1.000 73.87766  ? 164 MET B CA    1 
ATOM   5583 C  C     . MET B 2 176 ? 9.47524  26.36823  10.68229  1.000 72.64312  ? 164 MET B C     1 
ATOM   5584 O  O     . MET B 2 176 ? 9.81674  27.06991  11.64585  1.000 69.14788  ? 164 MET B O     1 
ATOM   5585 C  CB    . MET B 2 176 ? 10.73903 26.26982  8.50486   1.000 70.96760  ? 164 MET B CB    1 
ATOM   5586 C  CG    . MET B 2 176 ? 11.18936 27.71461  8.60534   1.000 66.54931  ? 164 MET B CG    1 
ATOM   5587 S  SD    . MET B 2 176 ? 12.73089 27.87926  9.52440   1.000 64.64160  ? 164 MET B SD    1 
ATOM   5588 C  CE    . MET B 2 176 ? 13.89218 27.20388  8.33549   1.000 73.67861  ? 164 MET B CE    1 
ATOM   5589 N  N     . THR B 2 177 ? 8.20168  26.24836  10.29678  1.000 66.54931  ? 165 THR B N     1 
ATOM   5590 C  CA    . THR B 2 177 ? 7.12027  26.88192  11.04062  1.000 67.54657  ? 165 THR B CA    1 
ATOM   5591 C  C     . THR B 2 177 ? 7.11939  26.42821  12.49247  1.000 76.01356  ? 165 THR B C     1 
ATOM   5592 O  O     . THR B 2 177 ? 6.90407  27.23643  13.40886  1.000 74.25862  ? 165 THR B O     1 
ATOM   5593 C  CB    . THR B 2 177 ? 5.78062  26.55493  10.38905  1.000 66.37138  ? 165 THR B CB    1 
ATOM   5594 O  OG1   . THR B 2 177 ? 5.77330  27.03152  9.03848   1.000 68.35072  ? 165 THR B OG1   1 
ATOM   5595 C  CG2   . THR B 2 177 ? 4.65195  27.19981  11.16091  1.000 58.90215  ? 165 THR B CG2   1 
ATOM   5596 N  N     . LYS B 2 178 ? 7.35313  25.13036  12.71881  1.000 74.37535  ? 166 LYS B N     1 
ATOM   5597 C  CA    . LYS B 2 178 ? 7.39002  24.61882  14.08558  1.000 72.77101  ? 166 LYS B CA    1 
ATOM   5598 C  C     . LYS B 2 178 ? 8.52712  25.25143  14.87650  1.000 73.34496  ? 166 LYS B C     1 
ATOM   5599 O  O     . LYS B 2 178 ? 8.34730  25.63054  16.03847  1.000 79.53397  ? 166 LYS B O     1 
ATOM   5600 C  CB    . LYS B 2 178 ? 7.51503  23.09218  14.08201  1.000 69.33737  ? 166 LYS B CB    1 
ATOM   5601 N  N     . ILE B 2 179 ? 9.70601  25.38434  14.26460  1.000 76.63379  ? 167 ILE B N     1 
ATOM   5602 C  CA    . ILE B 2 179 ? 10.82957 25.96316  14.99978  1.000 80.22186  ? 167 ILE B CA    1 
ATOM   5603 C  C     . ILE B 2 179 ? 10.59294 27.44532  15.27515  1.000 78.09245  ? 167 ILE B C     1 
ATOM   5604 O  O     . ILE B 2 179 ? 11.06156 27.97804  16.28951  1.000 79.61212  ? 167 ILE B O     1 
ATOM   5605 C  CB    . ILE B 2 179 ? 12.15571 25.72578  14.24617  1.000 81.03411  ? 167 ILE B CB    1 
ATOM   5606 C  CG1   . ILE B 2 179 ? 12.50130 24.23636  14.22996  1.000 82.62250  ? 167 ILE B CG1   1 
ATOM   5607 C  CG2   . ILE B 2 179 ? 13.30575 26.49577  14.89264  1.000 82.49524  ? 167 ILE B CG2   1 
ATOM   5608 C  CD1   . ILE B 2 179 ? 13.91159 23.94347  13.77490  1.000 77.39633  ? 167 ILE B CD1   1 
ATOM   5609 N  N     . LEU B 2 180 ? 9.84648  28.12940  14.40762  1.000 77.84356  ? 168 LEU B N     1 
ATOM   5610 C  CA    . LEU B 2 180 ? 9.71351  29.57722  14.53387  1.000 77.44403  ? 168 LEU B CA    1 
ATOM   5611 C  C     . LEU B 2 180 ? 8.50629  30.02605  15.35366  1.000 81.82894  ? 168 LEU B C     1 
ATOM   5612 O  O     . LEU B 2 180 ? 8.51962  31.15653  15.85343  1.000 79.78564  ? 168 LEU B O     1 
ATOM   5613 C  CB    . LEU B 2 180 ? 9.65287  30.22623  13.14423  1.000 76.44935  ? 168 LEU B CB    1 
ATOM   5614 C  CG    . LEU B 2 180 ? 10.88939 30.04900  12.24731  1.000 70.08210  ? 168 LEU B CG    1 
ATOM   5615 C  CD1   . LEU B 2 180 ? 10.70782 30.76053  10.91551  1.000 61.69417  ? 168 LEU B CD1   1 
ATOM   5616 C  CD2   . LEU B 2 180 ? 12.16633 30.51339  12.94012  1.000 63.64233  ? 168 LEU B CD2   1 
ATOM   5617 N  N     . GLU B 2 181 ? 7.47530  29.18279  15.51222  1.000 84.61919  ? 169 GLU B N     1 
ATOM   5618 C  CA    . GLU B 2 181 ? 6.26744  29.56046  16.26555  1.000 87.78821  ? 169 GLU B CA    1 
ATOM   5619 C  C     . GLU B 2 181 ? 6.53056  30.32117  17.56537  1.000 85.76429  ? 169 GLU B C     1 
ATOM   5620 O  O     . GLU B 2 181 ? 5.91998  31.38293  17.75568  1.000 82.42923  ? 169 GLU B O     1 
ATOM   5621 C  CB    . GLU B 2 181 ? 5.42501  28.30702  16.55560  1.000 77.77583  ? 169 GLU B CB    1 
ATOM   5622 N  N     . PRO B 2 182 ? 7.41037  29.87161  18.47440  1.000 87.96564  ? 170 PRO B N     1 
ATOM   5623 C  CA    . PRO B 2 182 ? 7.58432  30.61774  19.73787  1.000 85.88976  ? 170 PRO B CA    1 
ATOM   5624 C  C     . PRO B 2 182 ? 8.25206  31.97358  19.57202  1.000 87.11610  ? 170 PRO B C     1 
ATOM   5625 O  O     . PRO B 2 182 ? 7.86715  32.93333  20.25666  1.000 82.98269  ? 170 PRO B O     1 
ATOM   5626 C  CB    . PRO B 2 182 ? 8.44954  29.67331  20.58931  1.000 81.16796  ? 170 PRO B CB    1 
ATOM   5627 C  CG    . PRO B 2 182 ? 8.32625  28.34232  19.95096  1.000 85.66318  ? 170 PRO B CG    1 
ATOM   5628 C  CD    . PRO B 2 182 ? 8.16815  28.60833  18.49211  1.000 87.23882  ? 170 PRO B CD    1 
ATOM   5629 N  N     . PHE B 2 183 ? 9.28161  32.06852  18.72324  1.000 87.89917  ? 171 PHE B N     1 
ATOM   5630 C  CA    . PHE B 2 183 ? 9.94798  33.35055  18.50834  1.000 83.26873  ? 171 PHE B CA    1 
ATOM   5631 C  C     . PHE B 2 183 ? 8.98214  34.36198  17.90128  1.000 81.54760  ? 171 PHE B C     1 
ATOM   5632 O  O     . PHE B 2 183 ? 8.98005  35.54383  18.27700  1.000 80.33115  ? 171 PHE B O     1 
ATOM   5633 C  CB    . PHE B 2 183 ? 11.17669 33.14995  17.61434  1.000 81.36792  ? 171 PHE B CB    1 
ATOM   5634 C  CG    . PHE B 2 183 ? 12.13682 34.31117  17.61643  1.000 77.45473  ? 171 PHE B CG    1 
ATOM   5635 C  CD1   . PHE B 2 183 ? 12.04050 35.31375  16.66369  1.000 74.05170  ? 171 PHE B CD1   1 
ATOM   5636 C  CD2   . PHE B 2 183 ? 13.14607 34.38950  18.56353  1.000 79.41702  ? 171 PHE B CD2   1 
ATOM   5637 C  CE1   . PHE B 2 183 ? 12.92065 36.37921  16.66791  1.000 75.55702  ? 171 PHE B CE1   1 
ATOM   5638 C  CE2   . PHE B 2 183 ? 14.03349 35.45723  18.57480  1.000 77.92253  ? 171 PHE B CE2   1 
ATOM   5639 C  CZ    . PHE B 2 183 ? 13.91764 36.45385  17.62731  1.000 77.54851  ? 171 PHE B CZ    1 
ATOM   5640 N  N     . ARG B 2 184 ? 8.12783  33.90164  16.98374  1.000 77.26923  ? 172 ARG B N     1 
ATOM   5641 C  CA    . ARG B 2 184 ? 7.10847  34.76651  16.40708  1.000 77.80325  ? 172 ARG B CA    1 
ATOM   5642 C  C     . ARG B 2 184 ? 6.03833  35.14244  17.42278  1.000 79.56782  ? 172 ARG B C     1 
ATOM   5643 O  O     . ARG B 2 184 ? 5.49409  36.25117  17.35664  1.000 81.71723  ? 172 ARG B O     1 
ATOM   5644 C  CB    . ARG B 2 184 ? 6.47879  34.08515  15.19691  1.000 81.80977  ? 172 ARG B CB    1 
ATOM   5645 C  CG    . ARG B 2 184 ? 7.39860  34.01649  13.99988  1.000 78.32818  ? 172 ARG B CG    1 
ATOM   5646 C  CD    . ARG B 2 184 ? 6.83144  33.13589  12.90674  1.000 75.88926  ? 172 ARG B CD    1 
ATOM   5647 N  NE    . ARG B 2 184 ? 7.48845  33.41376  11.63564  1.000 78.59886  ? 172 ARG B NE    1 
ATOM   5648 C  CZ    . ARG B 2 184 ? 7.55200  32.56159  10.61908  1.000 77.78417  ? 172 ARG B CZ    1 
ATOM   5649 N  NH1   . ARG B 2 184 ? 7.00429  31.35422  10.72943  1.000 73.67195  ? 172 ARG B NH1   1 
ATOM   5650 N  NH2   . ARG B 2 184 ? 8.17185  32.92000  9.49588   1.000 68.34385  ? 172 ARG B NH2   1 
ATOM   5651 N  N     . LYS B 2 185 ? 5.71383  34.24313  18.35809  1.000 79.37722  ? 173 LYS B N     1 
ATOM   5652 C  CA    . LYS B 2 185 ? 4.76810  34.59792  19.41626  1.000 82.64564  ? 173 LYS B CA    1 
ATOM   5653 C  C     . LYS B 2 185 ? 5.33939  35.68924  20.31749  1.000 77.65576  ? 173 LYS B C     1 
ATOM   5654 O  O     . LYS B 2 185 ? 4.71129  36.73562  20.52094  1.000 70.34158  ? 173 LYS B O     1 
ATOM   5655 C  CB    . LYS B 2 185 ? 4.39747  33.35945  20.23606  1.000 75.04898  ? 173 LYS B CB    1 
ATOM   5656 N  N     . GLN B 2 186 ? 6.54552  35.46424  20.84970  1.000 82.11647  ? 174 GLN B N     1 
ATOM   5657 C  CA    . GLN B 2 186 ? 7.18615  36.42313  21.74858  1.000 80.04101  ? 174 GLN B CA    1 
ATOM   5658 C  C     . GLN B 2 186 ? 7.57281  37.72165  21.05123  1.000 80.43383  ? 174 GLN B C     1 
ATOM   5659 O  O     . GLN B 2 186 ? 7.81256  38.72439  21.73100  1.000 78.48981  ? 174 GLN B O     1 
ATOM   5660 C  CB    . GLN B 2 186 ? 8.42737  35.80171  22.39716  1.000 73.24307  ? 174 GLN B CB    1 
ATOM   5661 N  N     . ASN B 2 187 ? 7.65889  37.73135  19.72201  1.000 81.21964  ? 175 ASN B N     1 
ATOM   5662 C  CA    . ASN B 2 187 ? 7.84975  38.97096  18.97238  1.000 80.76453  ? 175 ASN B CA    1 
ATOM   5663 C  C     . ASN B 2 187 ? 6.92564  38.94355  17.76892  1.000 83.43052  ? 175 ASN B C     1 
ATOM   5664 O  O     . ASN B 2 187 ? 7.31370  38.49342  16.68264  1.000 80.92218  ? 175 ASN B O     1 
ATOM   5665 C  CB    . ASN B 2 187 ? 9.29973  39.15055  18.52458  1.000 82.56794  ? 175 ASN B CB    1 
ATOM   5666 C  CG    . ASN B 2 187 ? 10.29990 38.64635  19.54239  1.000 82.18211  ? 175 ASN B CG    1 
ATOM   5667 O  OD1   . ASN B 2 187 ? 10.82364 39.41356  20.35266  1.000 81.07711  ? 175 ASN B OD1   1 
ATOM   5668 N  ND2   . ASN B 2 187 ? 10.58460 37.34844  19.49455  1.000 77.92672  ? 175 ASN B ND2   1 
ATOM   5669 N  N     . PRO B 2 188 ? 5.67527  39.39116  17.92986  1.000 87.00689  ? 176 PRO B N     1 
ATOM   5670 C  CA    . PRO B 2 188 ? 4.80287  39.56589  16.75959  1.000 86.34880  ? 176 PRO B CA    1 
ATOM   5671 C  C     . PRO B 2 188 ? 5.10793  40.82919  15.97146  1.000 86.14343  ? 176 PRO B C     1 
ATOM   5672 O  O     . PRO B 2 188 ? 4.55605  41.00143  14.87468  1.000 85.78805  ? 176 PRO B O     1 
ATOM   5673 C  CB    . PRO B 2 188 ? 3.39803  39.61545  17.37415  1.000 85.19884  ? 176 PRO B CB    1 
ATOM   5674 C  CG    . PRO B 2 188 ? 3.61819  40.16534  18.74208  1.000 84.79063  ? 176 PRO B CG    1 
ATOM   5675 C  CD    . PRO B 2 188 ? 4.97150  39.66955  19.19523  1.000 84.34609  ? 176 PRO B CD    1 
ATOM   5676 N  N     . ASP B 2 189 ? 5.98421  41.70101  16.48808  1.000 85.04877  ? 177 ASP B N     1 
ATOM   5677 C  CA    . ASP B 2 189 ? 6.43482  42.89432  15.77725  1.000 87.96256  ? 177 ASP B CA    1 
ATOM   5678 C  C     . ASP B 2 189 ? 7.59710  42.62738  14.82839  1.000 84.69043  ? 177 ASP B C     1 
ATOM   5679 O  O     . ASP B 2 189 ? 7.96517  43.52640  14.06366  1.000 84.91284  ? 177 ASP B O     1 
ATOM   5680 C  CB    . ASP B 2 189 ? 6.84366  43.98097  16.77588  1.000 87.42716  ? 177 ASP B CB    1 
ATOM   5681 C  CG    . ASP B 2 189 ? 5.87679  45.15421  16.79067  1.000 95.25167  ? 177 ASP B CG    1 
ATOM   5682 O  OD1   . ASP B 2 189 ? 4.93064  45.16544  15.96960  1.000 93.81546  ? 177 ASP B OD1   1 
ATOM   5683 O  OD2   . ASP B 2 189 ? 6.06433  46.06710  17.62409  1.000 94.73550  ? 177 ASP B OD2   1 
ATOM   5684 N  N     . ILE B 2 190 ? 8.18713  41.43202  14.87323  1.000 82.69587  ? 178 ILE B N     1 
ATOM   5685 C  CA    . ILE B 2 190 ? 9.28144  41.03475  13.99324  1.000 75.58967  ? 178 ILE B CA    1 
ATOM   5686 C  C     . ILE B 2 190 ? 8.72301  40.21263  12.84124  1.000 73.12714  ? 178 ILE B C     1 
ATOM   5687 O  O     . ILE B 2 190 ? 7.87635  39.33246  13.04853  1.000 71.78381  ? 178 ILE B O     1 
ATOM   5688 C  CB    . ILE B 2 190 ? 10.34186 40.24092  14.77676  1.000 74.34737  ? 178 ILE B CB    1 
ATOM   5689 C  CG1   . ILE B 2 190 ? 10.87005 41.08645  15.93958  1.000 78.34820  ? 178 ILE B CG1   1 
ATOM   5690 C  CG2   . ILE B 2 190 ? 11.44595 39.77130  13.85872  1.000 67.92809  ? 178 ILE B CG2   1 
ATOM   5691 C  CD1   . ILE B 2 190 ? 12.36403 41.27642  15.95321  1.000 69.72850  ? 178 ILE B CD1   1 
ATOM   5692 N  N     . VAL B 2 191 ? 9.19732  40.48934  11.62503  1.000 73.22111  ? 179 VAL B N     1 
ATOM   5693 C  CA    . VAL B 2 191 ? 8.73838  39.79181  10.42460  1.000 74.94641  ? 179 VAL B CA    1 
ATOM   5694 C  C     . VAL B 2 191 ? 9.84190  38.85115  9.94718   1.000 72.95247  ? 179 VAL B C     1 
ATOM   5695 O  O     . VAL B 2 191 ? 10.96693 39.28343  9.66691   1.000 68.05726  ? 179 VAL B O     1 
ATOM   5696 C  CB    . VAL B 2 191 ? 8.32999  40.77114  9.31538   1.000 70.19261  ? 179 VAL B CB    1 
ATOM   5697 C  CG1   . VAL B 2 191 ? 7.52024  40.04103  8.25344   1.000 62.71609  ? 179 VAL B CG1   1 
ATOM   5698 C  CG2   . VAL B 2 191 ? 7.54264  41.93643  9.90116   1.000 72.77088  ? 179 VAL B CG2   1 
ATOM   5699 N  N     . ILE B 2 192 ? 9.52180  37.56428  9.85747   1.000 69.80715  ? 180 ILE B N     1 
ATOM   5700 C  CA    . ILE B 2 192 ? 10.45794 36.55237  9.39055   1.000 70.39863  ? 180 ILE B CA    1 
ATOM   5701 C  C     . ILE B 2 192 ? 9.91873  35.95910  8.09646   1.000 70.37670  ? 180 ILE B C     1 
ATOM   5702 O  O     . ILE B 2 192 ? 8.76477  35.51539  8.04120   1.000 69.25698  ? 180 ILE B O     1 
ATOM   5703 C  CB    . ILE B 2 192 ? 10.68844 35.45739  10.44643  1.000 72.16233  ? 180 ILE B CB    1 
ATOM   5704 C  CG1   . ILE B 2 192 ? 11.30887 36.05612  11.71130  1.000 69.08307  ? 180 ILE B CG1   1 
ATOM   5705 C  CG2   . ILE B 2 192 ? 11.59003 34.37154  9.88953   1.000 71.93052  ? 180 ILE B CG2   1 
ATOM   5706 C  CD1   . ILE B 2 192 ? 11.52792 35.03443  12.80812  1.000 70.05192  ? 180 ILE B CD1   1 
ATOM   5707 N  N     . TYR B 2 193 ? 10.75262 35.96634  7.05657   1.000 70.16447  ? 181 TYR B N     1 
ATOM   5708 C  CA    . TYR B 2 193 ? 10.40024 35.42989  5.74970   1.000 69.77028  ? 181 TYR B CA    1 
ATOM   5709 C  C     . TYR B 2 193 ? 11.48713 34.47773  5.26871   1.000 69.22234  ? 181 TYR B C     1 
ATOM   5710 O  O     . TYR B 2 193 ? 12.67784 34.68422  5.51608   1.000 65.83568  ? 181 TYR B O     1 
ATOM   5711 C  CB    . TYR B 2 193 ? 10.19691 36.54198  4.73081   1.000 63.14149  ? 181 TYR B CB    1 
ATOM   5712 C  CG    . TYR B 2 193 ? 9.95149  36.06160  3.32191   1.000 59.83634  ? 181 TYR B CG    1 
ATOM   5713 C  CD1   . TYR B 2 193 ? 8.83106  35.31366  3.00862   1.000 57.71442  ? 181 TYR B CD1   1 
ATOM   5714 C  CD2   . TYR B 2 193 ? 10.83398 36.38454  2.29772   1.000 63.82277  ? 181 TYR B CD2   1 
ATOM   5715 C  CE1   . TYR B 2 193 ? 8.59823  34.88715  1.71484   1.000 61.06434  ? 181 TYR B CE1   1 
ATOM   5716 C  CE2   . TYR B 2 193 ? 10.61410 35.96908  1.00025   1.000 59.53788  ? 181 TYR B CE2   1 
ATOM   5717 C  CZ    . TYR B 2 193 ? 9.49511  35.22186  0.70998   1.000 63.48801  ? 181 TYR B CZ    1 
ATOM   5718 O  OH    . TYR B 2 193 ? 9.28071  34.80731  -0.59103  1.000 64.19569  ? 181 TYR B OH    1 
ATOM   5719 N  N     . GLN B 2 194 ? 11.06717 33.42987  4.57061   1.000 66.62294  ? 182 GLN B N     1 
ATOM   5720 C  CA    . GLN B 2 194 ? 11.97195 32.38133  4.12255   1.000 66.59029  ? 182 GLN B CA    1 
ATOM   5721 C  C     . GLN B 2 194 ? 12.01425 32.38902  2.60090   1.000 65.69314  ? 182 GLN B C     1 
ATOM   5722 O  O     . GLN B 2 194 ? 10.97576 32.23799  1.94488   1.000 63.61144  ? 182 GLN B O     1 
ATOM   5723 C  CB    . GLN B 2 194 ? 11.51131 31.02475  4.66417   1.000 69.90742  ? 182 GLN B CB    1 
ATOM   5724 C  CG    . GLN B 2 194 ? 12.39586 29.83365  4.37763   1.000 65.86345  ? 182 GLN B CG    1 
ATOM   5725 C  CD    . GLN B 2 194 ? 11.80280 28.56594  4.96867   1.000 78.73205  ? 182 GLN B CD    1 
ATOM   5726 O  OE1   . GLN B 2 194 ? 12.39476 27.48403  4.89826   1.000 80.60534  ? 182 GLN B OE1   1 
ATOM   5727 N  NE2   . GLN B 2 194 ? 10.61464 28.69660  5.55996   1.000 78.82865  ? 182 GLN B NE2   1 
ATOM   5728 N  N     . TYR B 2 195 ? 13.20243 32.61016  2.04473   1.000 59.29398  ? 183 TYR B N     1 
ATOM   5729 C  CA    . TYR B 2 195 ? 13.45418 32.39751  0.62485   1.000 59.40028  ? 183 TYR B CA    1 
ATOM   5730 C  C     . TYR B 2 195 ? 14.74274 31.61397  0.52751   1.000 56.67760  ? 183 TYR B C     1 
ATOM   5731 O  O     . TYR B 2 195 ? 15.68123 31.91036  1.25050   1.000 62.23575  ? 183 TYR B O     1 
ATOM   5732 C  CB    . TYR B 2 195 ? 13.57345 33.69885  -0.16493  1.000 57.73249  ? 183 TYR B CB    1 
ATOM   5733 C  CG    . TYR B 2 195 ? 13.62309 33.47704  -1.65505  1.000 49.62430  ? 183 TYR B CG    1 
ATOM   5734 C  CD1   . TYR B 2 195 ? 12.45866 33.28579  -2.37836  1.000 46.51899  ? 183 TYR B CD1   1 
ATOM   5735 C  CD2   . TYR B 2 195 ? 14.82861 33.45256  -2.33187  1.000 50.32956  ? 183 TYR B CD2   1 
ATOM   5736 C  CE1   . TYR B 2 195 ? 12.48543 33.07828  -3.72491  1.000 43.14292  ? 183 TYR B CE1   1 
ATOM   5737 C  CE2   . TYR B 2 195 ? 14.86874 33.24678  -3.68435  1.000 51.48990  ? 183 TYR B CE2   1 
ATOM   5738 C  CZ    . TYR B 2 195 ? 13.69091 33.06041  -4.37823  1.000 49.70479  ? 183 TYR B CZ    1 
ATOM   5739 O  OH    . TYR B 2 195 ? 13.73073 32.85905  -5.73983  1.000 50.39213  ? 183 TYR B OH    1 
ATOM   5740 N  N     . MET B 2 196 ? 14.84119 30.74507  -0.47443  1.000 53.62567  ? 184 MET B N     1 
ATOM   5741 C  CA    . MET B 2 196 ? 15.23704 29.35726  -0.27273  1.000 53.65831  ? 184 MET B CA    1 
ATOM   5742 C  C     . MET B 2 196 ? 16.23725 29.11561  0.86146   1.000 51.82381  ? 184 MET B C     1 
ATOM   5743 O  O     . MET B 2 196 ? 15.85692 28.48273  1.84931   1.000 59.00777  ? 184 MET B O     1 
ATOM   5744 C  CB    . MET B 2 196 ? 15.78187 28.78568  -1.58091  1.000 64.41007  ? 184 MET B CB    1 
ATOM   5745 C  CG    . MET B 2 196 ? 14.84167 28.97548  -2.78303  1.000 66.86071  ? 184 MET B CG    1 
ATOM   5746 S  SD    . MET B 2 196 ? 15.64657 29.68697  -4.23022  1.000 80.99655  ? 184 MET B SD    1 
ATOM   5747 C  CE    . MET B 2 196 ? 17.06182 28.59302  -4.44809  1.000 63.82585  ? 184 MET B CE    1 
ATOM   5748 N  N     . ASP B 2 197 ? 17.46769 29.62721  0.81929   1.000 52.11273  ? 185 ASP B N     1 
ATOM   5749 C  CA    . ASP B 2 197 ? 18.44238 29.27186  1.85353   1.000 55.41055  ? 185 ASP B CA    1 
ATOM   5750 C  C     . ASP B 2 197 ? 18.57311 30.33448  2.93108   1.000 55.18734  ? 185 ASP B C     1 
ATOM   5751 O  O     . ASP B 2 197 ? 19.54743 30.32541  3.69169   1.000 56.78685  ? 185 ASP B O     1 
ATOM   5752 C  CB    . ASP B 2 197 ? 19.82334 29.01013  1.25072   1.000 58.63708  ? 185 ASP B CB    1 
ATOM   5753 C  CG    . ASP B 2 197 ? 19.88739 27.72784  0.46545   1.000 55.32905  ? 185 ASP B CG    1 
ATOM   5754 O  OD1   . ASP B 2 197 ? 18.85641 27.05445  0.32369   1.000 55.65338  ? 185 ASP B OD1   1 
ATOM   5755 O  OD2   . ASP B 2 197 ? 20.98384 27.40445  -0.03497  1.000 61.44724  ? 185 ASP B OD2   1 
ATOM   5756 N  N     . ASP B 2 198 ? 17.59276 31.21565  3.03684   1.000 53.93936  ? 186 ASP B N     1 
ATOM   5757 C  CA    . ASP B 2 198 ? 17.75187 32.52853  3.64099   1.000 60.69011  ? 186 ASP B CA    1 
ATOM   5758 C  C     . ASP B 2 198 ? 16.53901 32.85408  4.49210   1.000 59.07423  ? 186 ASP B C     1 
ATOM   5759 O  O     . ASP B 2 198 ? 15.39233 32.69078  4.05148   1.000 56.74945  ? 186 ASP B O     1 
ATOM   5760 C  CB    . ASP B 2 198 ? 17.92504 33.62952  2.57578   1.000 63.41486  ? 186 ASP B CB    1 
ATOM   5761 C  CG    . ASP B 2 198 ? 19.24909 33.53588  1.80651   1.000 64.35064  ? 186 ASP B CG    1 
ATOM   5762 O  OD1   . ASP B 2 198 ? 20.25100 32.98523  2.32670   1.000 63.22846  ? 186 ASP B OD1   1 
ATOM   5763 O  OD2   . ASP B 2 198 ? 19.28449 34.04728  0.66585   1.000 61.79183  ? 186 ASP B OD2   1 
ATOM   5764 N  N     . LEU B 2 199 ? 16.81308 33.32748  5.70288   1.000 62.19510  ? 187 LEU B N     1 
ATOM   5765 C  CA    . LEU B 2 199 ? 15.81368 33.94007  6.56344   1.000 65.31720  ? 187 LEU B CA    1 
ATOM   5766 C  C     . LEU B 2 199 ? 16.01417 35.44719  6.53177   1.000 64.27547  ? 187 LEU B C     1 
ATOM   5767 O  O     . LEU B 2 199 ? 17.10511 35.93624  6.83579   1.000 64.10517  ? 187 LEU B O     1 
ATOM   5768 C  CB    . LEU B 2 199 ? 15.91724 33.42213  7.99826   1.000 65.86137  ? 187 LEU B CB    1 
ATOM   5769 C  CG    . LEU B 2 199 ? 15.18012 32.12711  8.36570   1.000 59.16458  ? 187 LEU B CG    1 
ATOM   5770 C  CD1   . LEU B 2 199 ? 14.93865 32.09401  9.85720   1.000 57.22408  ? 187 LEU B CD1   1 
ATOM   5771 C  CD2   . LEU B 2 199 ? 13.86964 31.96577  7.60262   1.000 60.50450  ? 187 LEU B CD2   1 
ATOM   5772 N  N     . TYR B 2 200 ? 14.97449 36.17208  6.13925   1.000 64.41767  ? 188 TYR B N     1 
ATOM   5773 C  CA    . TYR B 2 200 ? 14.94587 37.62584  6.19384   1.000 65.58354  ? 188 TYR B CA    1 
ATOM   5774 C  C     . TYR B 2 200 ? 14.19579 38.02008  7.45850   1.000 67.72857  ? 188 TYR B C     1 
ATOM   5775 O  O     . TYR B 2 200 ? 13.04348 37.61319  7.64837   1.000 70.68596  ? 188 TYR B O     1 
ATOM   5776 C  CB    . TYR B 2 200 ? 14.27677 38.19757  4.93998   1.000 69.48612  ? 188 TYR B CB    1 
ATOM   5777 C  CG    . TYR B 2 200 ? 15.07083 37.93239  3.67922   1.000 64.54548  ? 188 TYR B CG    1 
ATOM   5778 C  CD1   . TYR B 2 200 ? 14.92378 36.73969  2.98041   1.000 66.38484  ? 188 TYR B CD1   1 
ATOM   5779 C  CD2   . TYR B 2 200 ? 15.98656 38.85882  3.20807   1.000 58.80044  ? 188 TYR B CD2   1 
ATOM   5780 C  CE1   . TYR B 2 200 ? 15.66127 36.48098  1.84100   1.000 65.32062  ? 188 TYR B CE1   1 
ATOM   5781 C  CE2   . TYR B 2 200 ? 16.72253 38.61767  2.07311   1.000 62.82155  ? 188 TYR B CE2   1 
ATOM   5782 C  CZ    . TYR B 2 200 ? 16.56013 37.42651  1.39166   1.000 69.43468  ? 188 TYR B CZ    1 
ATOM   5783 O  OH    . TYR B 2 200 ? 17.30468 37.17718  0.25924   1.000 68.40177  ? 188 TYR B OH    1 
ATOM   5784 N  N     . VAL B 2 201 ? 14.85286 38.77934  8.33279   1.000 63.66287  ? 189 VAL B N     1 
ATOM   5785 C  CA    . VAL B 2 201 ? 14.31421 39.12685  9.64641   1.000 66.82570  ? 189 VAL B CA    1 
ATOM   5786 C  C     . VAL B 2 201 ? 14.28116 40.64591  9.76733   1.000 71.11392  ? 189 VAL B C     1 
ATOM   5787 O  O     . VAL B 2 201 ? 15.33382 41.29679  9.74098   1.000 72.83482  ? 189 VAL B O     1 
ATOM   5788 C  CB    . VAL B 2 201 ? 15.14472 38.50701  10.77980  1.000 63.38233  ? 189 VAL B CB    1 
ATOM   5789 C  CG1   . VAL B 2 201 ? 14.42315 38.65234  12.09821  1.000 64.87271  ? 189 VAL B CG1   1 
ATOM   5790 C  CG2   . VAL B 2 201 ? 15.42809 37.03846  10.48780  1.000 68.65607  ? 189 VAL B CG2   1 
ATOM   5791 N  N     . GLY B 2 202 ? 13.08494 41.20343  9.91896   1.000 71.25373  ? 190 GLY B N     1 
ATOM   5792 C  CA    . GLY B 2 202 ? 12.88904 42.64788  9.90409   1.000 74.51648  ? 190 GLY B CA    1 
ATOM   5793 C  C     . GLY B 2 202 ? 12.22485 43.17177  11.16391  1.000 76.36728  ? 190 GLY B C     1 
ATOM   5794 O  O     . GLY B 2 202 ? 11.29527 42.55160  11.69071  1.000 73.60808  ? 190 GLY B O     1 
ATOM   5795 N  N     . SER B 2 203 ? 12.69213 44.33581  11.62494  1.000 81.28057  ? 191 SER B N     1 
ATOM   5796 C  CA    . SER B 2 203 ? 12.14595 44.97874  12.81436  1.000 81.82020  ? 191 SER B CA    1 
ATOM   5797 C  C     . SER B 2 203 ? 12.27632 46.49621  12.71554  1.000 81.27948  ? 191 SER B C     1 
ATOM   5798 O  O     . SER B 2 203 ? 12.95339 47.03901  11.83118  1.000 81.58833  ? 191 SER B O     1 
ATOM   5799 C  CB    . SER B 2 203 ? 12.84607 44.49033  14.08312  1.000 79.90637  ? 191 SER B CB    1 
ATOM   5800 O  OG    . SER B 2 203 ? 14.16451 45.00412  14.14605  1.000 77.92399  ? 191 SER B OG    1 
ATOM   5801 N  N     . ASP B 2 204 ? 11.63815 47.17103  13.67752  1.000 83.31525  ? 192 ASP B N     1 
ATOM   5802 C  CA    . ASP B 2 204 ? 11.65875 48.62496  13.83317  1.000 82.87765  ? 192 ASP B CA    1 
ATOM   5803 C  C     . ASP B 2 204 ? 12.41474 49.04272  15.09878  1.000 80.91458  ? 192 ASP B C     1 
ATOM   5804 O  O     . ASP B 2 204 ? 12.01933 49.97190  15.80246  1.000 84.34913  ? 192 ASP B O     1 
ATOM   5805 C  CB    . ASP B 2 204 ? 10.23248 49.17909  13.85189  1.000 80.67941  ? 192 ASP B CB    1 
ATOM   5806 C  CG    . ASP B 2 204 ? 9.52260  49.03841  12.50390  1.000 84.92890  ? 192 ASP B CG    1 
ATOM   5807 O  OD1   . ASP B 2 204 ? 10.04227 49.58169  11.50677  1.000 88.49436  ? 192 ASP B OD1   1 
ATOM   5808 O  OD2   . ASP B 2 204 ? 8.45376  48.38631  12.43358  1.000 79.68939  ? 192 ASP B OD2   1 
ATOM   5809 N  N     . LEU B 2 205 ? 13.51929 48.36387  15.39415  1.000 83.24473  ? 193 LEU B N     1 
ATOM   5810 C  CA    . LEU B 2 205 ? 14.31379 48.57690  16.59644  1.000 79.83783  ? 193 LEU B CA    1 
ATOM   5811 C  C     . LEU B 2 205 ? 15.52181 49.46359  16.31550  1.000 81.17429  ? 193 LEU B C     1 
ATOM   5812 O  O     . LEU B 2 205 ? 15.99951 49.57146  15.18033  1.000 79.11095  ? 193 LEU B O     1 
ATOM   5813 C  CB    . LEU B 2 205 ? 14.80673 47.23907  17.16318  1.000 79.93966  ? 193 LEU B CB    1 
ATOM   5814 C  CG    . LEU B 2 205 ? 13.96514 46.41496  18.13732  1.000 77.13955  ? 193 LEU B CG    1 
ATOM   5815 C  CD1   . LEU B 2 205 ? 12.54314 46.23359  17.64681  1.000 79.91460  ? 193 LEU B CD1   1 
ATOM   5816 C  CD2   . LEU B 2 205 ? 14.62361 45.06651  18.34204  1.000 74.71315  ? 193 LEU B CD2   1 
ATOM   5817 N  N     . GLU B 2 206 ? 16.02108 50.09403  17.37867  1.000 81.39606  ? 194 GLU B N     1 
ATOM   5818 C  CA    . GLU B 2 206 ? 17.36236 50.65552  17.32840  1.000 83.74208  ? 194 GLU B CA    1 
ATOM   5819 C  C     . GLU B 2 206 ? 18.33076 49.54365  16.95858  1.000 81.49844  ? 194 GLU B C     1 
ATOM   5820 O  O     . GLU B 2 206 ? 18.12231 48.38138  17.31203  1.000 84.02296  ? 194 GLU B O     1 
ATOM   5821 C  CB    . GLU B 2 206 ? 17.74265 51.28226  18.67364  1.000 76.70239  ? 194 GLU B CB    1 
ATOM   5822 N  N     . ILE B 2 207 ? 19.39027 49.89829  16.22517  1.000 82.80900  ? 195 ILE B N     1 
ATOM   5823 C  CA    . ILE B 2 207 ? 20.21601 48.86036  15.60715  1.000 87.17613  ? 195 ILE B CA    1 
ATOM   5824 C  C     . ILE B 2 207 ? 20.86541 47.95746  16.65756  1.000 87.67000  ? 195 ILE B C     1 
ATOM   5825 O  O     . ILE B 2 207 ? 21.05855 46.75916  16.41530  1.000 91.10370  ? 195 ILE B O     1 
ATOM   5826 C  CB    . ILE B 2 207 ? 21.26382 49.48087  14.65699  1.000 87.30676  ? 195 ILE B CB    1 
ATOM   5827 C  CG1   . ILE B 2 207 ? 22.08495 48.36718  13.98754  1.000 83.22201  ? 195 ILE B CG1   1 
ATOM   5828 C  CG2   . ILE B 2 207 ? 22.13280 50.50328  15.39126  1.000 85.72539  ? 195 ILE B CG2   1 
ATOM   5829 C  CD1   . ILE B 2 207 ? 23.16668 48.84911  13.06551  1.000 86.82507  ? 195 ILE B CD1   1 
ATOM   5830 N  N     . GLY B 2 208 ? 21.17973 48.49065  17.84128  1.000 83.78510  ? 196 GLY B N     1 
ATOM   5831 C  CA    . GLY B 2 208 ? 21.70688 47.64161  18.90210  1.000 81.36344  ? 196 GLY B CA    1 
ATOM   5832 C  C     . GLY B 2 208 ? 20.69417 46.61707  19.38717  1.000 84.41051  ? 196 GLY B C     1 
ATOM   5833 O  O     . GLY B 2 208 ? 20.99634 45.42172  19.48732  1.000 82.62146  ? 196 GLY B O     1 
ATOM   5834 N  N     . GLN B 2 209 ? 19.47271 47.07172  19.68905  1.000 84.58413  ? 197 GLN B N     1 
ATOM   5835 C  CA    . GLN B 2 209 ? 18.41522 46.15250  20.10194  1.000 84.12245  ? 197 GLN B CA    1 
ATOM   5836 C  C     . GLN B 2 209 ? 18.04124 45.19430  18.97294  1.000 84.12800  ? 197 GLN B C     1 
ATOM   5837 O  O     . GLN B 2 209 ? 17.72481 44.02305  19.22231  1.000 80.07120  ? 197 GLN B O     1 
ATOM   5838 C  CB    . GLN B 2 209 ? 17.19012 46.94047  20.57378  1.000 78.94312  ? 197 GLN B CB    1 
ATOM   5839 N  N     . HIS B 2 210 ? 18.08086 45.67079  17.72243  1.000 81.95940  ? 198 HIS B N     1 
ATOM   5840 C  CA    . HIS B 2 210 ? 17.81213 44.79834  16.58121  1.000 79.02196  ? 198 HIS B CA    1 
ATOM   5841 C  C     . HIS B 2 210 ? 18.84526 43.68083  16.48507  1.000 79.71094  ? 198 HIS B C     1 
ATOM   5842 O  O     . HIS B 2 210 ? 18.49368 42.51214  16.29396  1.000 78.56241  ? 198 HIS B O     1 
ATOM   5843 C  CB    . HIS B 2 210 ? 17.78158 45.61087  15.28882  1.000 76.76130  ? 198 HIS B CB    1 
ATOM   5844 C  CG    . HIS B 2 210 ? 17.68762 44.77236  14.04678  1.000 83.39734  ? 198 HIS B CG    1 
ATOM   5845 N  ND1   . HIS B 2 210 ? 16.48519 44.35392  13.51462  1.000 81.85338  ? 198 HIS B ND1   1 
ATOM   5846 C  CD2   . HIS B 2 210 ? 18.64987 44.28279  13.22708  1.000 76.83108  ? 198 HIS B CD2   1 
ATOM   5847 C  CE1   . HIS B 2 210 ? 16.71112 43.64687  12.42148  1.000 76.31973  ? 198 HIS B CE1   1 
ATOM   5848 N  NE2   . HIS B 2 210 ? 18.01665 43.58875  12.22531  1.000 74.37881  ? 198 HIS B NE2   1 
ATOM   5849 N  N     . ARG B 2 211 ? 20.13180 44.02488  16.60917  1.000 81.98584  ? 199 ARG B N     1 
ATOM   5850 C  CA    . ARG B 2 211 ? 21.18925 43.01436  16.59897  1.000 82.16594  ? 199 ARG B CA    1 
ATOM   5851 C  C     . ARG B 2 211 ? 21.06595 42.05601  17.77957  1.000 80.23417  ? 199 ARG B C     1 
ATOM   5852 O  O     . ARG B 2 211 ? 21.34426 40.85390  17.64556  1.000 76.80106  ? 199 ARG B O     1 
ATOM   5853 C  CB    . ARG B 2 211 ? 22.55932 43.69797  16.59751  1.000 77.53544  ? 199 ARG B CB    1 
ATOM   5854 N  N     . THR B 2 212 ? 20.63536 42.56363  18.93593  1.000 82.33494  ? 200 THR B N     1 
ATOM   5855 C  CA    . THR B 2 212 ? 20.41200 41.68681  20.07974  1.000 82.72065  ? 200 THR B CA    1 
ATOM   5856 C  C     . THR B 2 212 ? 19.27497 40.70062  19.80623  1.000 82.65410  ? 200 THR B C     1 
ATOM   5857 O  O     . THR B 2 212 ? 19.38493 39.50649  20.12532  1.000 81.18200  ? 200 THR B O     1 
ATOM   5858 C  CB    . THR B 2 212 ? 20.13588 42.52667  21.32903  1.000 83.38123  ? 200 THR B CB    1 
ATOM   5859 O  OG1   . THR B 2 212 ? 21.14333 43.53946  21.45391  1.000 75.69732  ? 200 THR B OG1   1 
ATOM   5860 C  CG2   . THR B 2 212 ? 20.15234 41.65177  22.57703  1.000 85.78610  ? 200 THR B CG2   1 
ATOM   5861 N  N     . LYS B 2 213 ? 18.18458 41.17460  19.19325  1.000 77.95947  ? 201 LYS B N     1 
ATOM   5862 C  CA    . LYS B 2 213 ? 17.09163 40.27502  18.83776  1.000 78.28333  ? 201 LYS B CA    1 
ATOM   5863 C  C     . LYS B 2 213 ? 17.52747 39.25612  17.78524  1.000 78.10372  ? 201 LYS B C     1 
ATOM   5864 O  O     . LYS B 2 213 ? 17.10123 38.09071  17.82437  1.000 77.81219  ? 201 LYS B O     1 
ATOM   5865 C  CB    . LYS B 2 213 ? 15.88815 41.08565  18.35381  1.000 74.56796  ? 201 LYS B CB    1 
ATOM   5866 C  CG    . LYS B 2 213 ? 14.53820 40.53097  18.80045  1.000 76.37719  ? 201 LYS B CG    1 
ATOM   5867 C  CD    . LYS B 2 213 ? 14.35555 40.61069  20.31839  1.000 71.81071  ? 201 LYS B CD    1 
ATOM   5868 N  N     . ILE B 2 214 ? 18.39473 39.66601  16.85695  1.000 75.15471  ? 202 ILE B N     1 
ATOM   5869 C  CA    . ILE B 2 214 ? 18.89908 38.73618  15.84748  1.000 77.27204  ? 202 ILE B CA    1 
ATOM   5870 C  C     . ILE B 2 214 ? 19.72997 37.63411  16.49869  1.000 79.21305  ? 202 ILE B C     1 
ATOM   5871 O  O     . ILE B 2 214 ? 19.64120 36.45430  16.12116  1.000 74.01644  ? 202 ILE B O     1 
ATOM   5872 C  CB    . ILE B 2 214 ? 19.70064 39.49573  14.77407  1.000 73.04747  ? 202 ILE B CB    1 
ATOM   5873 C  CG1   . ILE B 2 214 ? 18.76283 40.34571  13.91559  1.000 70.03967  ? 202 ILE B CG1   1 
ATOM   5874 C  CG2   . ILE B 2 214 ? 20.49608 38.53074  13.90353  1.000 71.05205  ? 202 ILE B CG2   1 
ATOM   5875 C  CD1   . ILE B 2 214 ? 17.58559 39.59832  13.38266  1.000 62.78322  ? 202 ILE B CD1   1 
ATOM   5876 N  N     . GLU B 2 215 ? 20.55431 37.99644  17.48476  1.000 79.81826  ? 203 GLU B N     1 
ATOM   5877 C  CA    . GLU B 2 215 ? 21.29957 36.96464  18.19842  1.000 76.48541  ? 203 GLU B CA    1 
ATOM   5878 C  C     . GLU B 2 215 ? 20.37715 36.07028  19.01275  1.000 77.95451  ? 203 GLU B C     1 
ATOM   5879 O  O     . GLU B 2 215 ? 20.65367 34.87471  19.15482  1.000 76.52925  ? 203 GLU B O     1 
ATOM   5880 C  CB    . GLU B 2 215 ? 22.36190 37.58829  19.09472  1.000 76.27797  ? 203 GLU B CB    1 
ATOM   5881 C  CG    . GLU B 2 215 ? 23.76227 37.50599  18.52099  1.000 80.43311  ? 203 GLU B CG    1 
ATOM   5882 C  CD    . GLU B 2 215 ? 24.19398 36.07720  18.22163  1.000 83.52184  ? 203 GLU B CD    1 
ATOM   5883 O  OE1   . GLU B 2 215 ? 24.42470 35.76459  17.02864  1.000 80.44608  ? 203 GLU B OE1   1 
ATOM   5884 O  OE2   . GLU B 2 215 ? 24.30535 35.27183  19.17922  1.000 79.34615  ? 203 GLU B OE2   1 
ATOM   5885 N  N     . GLU B 2 216 ? 19.28683 36.62258  19.55513  1.000 77.93174  ? 204 GLU B N     1 
ATOM   5886 C  CA    . GLU B 2 216 ? 18.27540 35.77283  20.18084  1.000 79.85846  ? 204 GLU B CA    1 
ATOM   5887 C  C     . GLU B 2 216 ? 17.77547 34.72259  19.20006  1.000 80.76971  ? 204 GLU B C     1 
ATOM   5888 O  O     . GLU B 2 216 ? 17.67652 33.53517  19.53443  1.000 82.60117  ? 204 GLU B O     1 
ATOM   5889 C  CB    . GLU B 2 216 ? 17.09816 36.60547  20.68507  1.000 83.25757  ? 204 GLU B CB    1 
ATOM   5890 C  CG    . GLU B 2 216 ? 17.39252 37.49095  21.86724  1.000 87.27174  ? 204 GLU B CG    1 
ATOM   5891 C  CD    . GLU B 2 216 ? 16.16010 38.23867  22.32130  1.000 89.98444  ? 204 GLU B CD    1 
ATOM   5892 O  OE1   . GLU B 2 216 ? 15.08814 37.59842  22.40991  1.000 89.10221  ? 204 GLU B OE1   1 
ATOM   5893 O  OE2   . GLU B 2 216 ? 16.26272 39.46347  22.56799  1.000 91.92300  ? 204 GLU B OE2   1 
ATOM   5894 N  N     . LEU B 2 217 ? 17.45222 35.15118  17.97763  1.000 77.17514  ? 205 LEU B N     1 
ATOM   5895 C  CA    . LEU B 2 217 ? 16.94449 34.21412  16.97915  1.000 76.75021  ? 205 LEU B CA    1 
ATOM   5896 C  C     . LEU B 2 217 ? 17.99601 33.17515  16.59263  1.000 75.39667  ? 205 LEU B C     1 
ATOM   5897 O  O     . LEU B 2 217 ? 17.66289 32.01018  16.35203  1.000 73.06117  ? 205 LEU B O     1 
ATOM   5898 C  CB    . LEU B 2 217 ? 16.45050 34.97474  15.75018  1.000 74.07154  ? 205 LEU B CB    1 
ATOM   5899 C  CG    . LEU B 2 217 ? 15.70216 34.12959  14.71787  1.000 74.40220  ? 205 LEU B CG    1 
ATOM   5900 C  CD1   . LEU B 2 217 ? 14.71785 33.18449  15.38907  1.000 76.40344  ? 205 LEU B CD1   1 
ATOM   5901 C  CD2   . LEU B 2 217 ? 14.98282 35.02253  13.72420  1.000 74.39297  ? 205 LEU B CD2   1 
ATOM   5902 N  N     . ARG B 2 218 ? 19.26732 33.57280  16.52177  1.000 75.75250  ? 206 ARG B N     1 
ATOM   5903 C  CA    . ARG B 2 218 ? 20.30232 32.60736  16.15395  1.000 77.43163  ? 206 ARG B CA    1 
ATOM   5904 C  C     . ARG B 2 218 ? 20.59128 31.63447  17.28970  1.000 79.27149  ? 206 ARG B C     1 
ATOM   5905 O  O     . ARG B 2 218 ? 21.02387 30.50111  17.04206  1.000 80.25256  ? 206 ARG B O     1 
ATOM   5906 C  CB    . ARG B 2 218 ? 21.58669 33.31924  15.72664  1.000 81.13731  ? 206 ARG B CB    1 
ATOM   5907 C  CG    . ARG B 2 218 ? 21.44822 34.14128  14.44706  1.000 82.30974  ? 206 ARG B CG    1 
ATOM   5908 C  CD    . ARG B 2 218 ? 22.71099 34.93844  14.14098  1.000 80.42639  ? 206 ARG B CD    1 
ATOM   5909 N  NE    . ARG B 2 218 ? 23.86140 34.07080  13.90823  1.000 86.58532  ? 206 ARG B NE    1 
ATOM   5910 C  CZ    . ARG B 2 218 ? 25.12333 34.49415  13.87302  1.000 97.71391  ? 206 ARG B CZ    1 
ATOM   5911 N  NH1   . ARG B 2 218 ? 26.10898 33.63017  13.65589  1.000 100.19286 ? 206 ARG B NH1   1 
ATOM   5912 N  NH2   . ARG B 2 218 ? 25.40559 35.77960  14.06430  1.000 93.93158  ? 206 ARG B NH2   1 
ATOM   5913 N  N     . GLN B 2 219 ? 20.37084 32.05653  18.53576  1.000 83.43180  ? 207 GLN B N     1 
ATOM   5914 C  CA    . GLN B 2 219 ? 20.45888 31.12261  19.65533  1.000 84.75667  ? 207 GLN B CA    1 
ATOM   5915 C  C     . GLN B 2 219 ? 19.28694 30.15256  19.64641  1.000 80.64443  ? 207 GLN B C     1 
ATOM   5916 O  O     . GLN B 2 219 ? 19.46944 28.94421  19.82734  1.000 83.67339  ? 207 GLN B O     1 
ATOM   5917 C  CB    . GLN B 2 219 ? 20.51127 31.88392  20.98212  1.000 85.33791  ? 207 GLN B CB    1 
ATOM   5918 C  CG    . GLN B 2 219 ? 21.81842 32.63187  21.23522  1.000 81.90163  ? 207 GLN B CG    1 
ATOM   5919 C  CD    . GLN B 2 219 ? 23.04573 31.74171  21.09857  1.000 87.84012  ? 207 GLN B CD    1 
ATOM   5920 O  OE1   . GLN B 2 219 ? 23.94852 32.03541  20.31522  1.000 94.23924  ? 207 GLN B OE1   1 
ATOM   5921 N  NE2   . GLN B 2 219 ? 23.08872 30.65569  21.86693  1.000 87.07390  ? 207 GLN B NE2   1 
ATOM   5922 N  N     . HIS B 2 220 ? 18.07736 30.66644  19.43168  1.000 79.65284  ? 208 HIS B N     1 
ATOM   5923 C  CA    . HIS B 2 220 ? 16.90967 29.80170  19.32760  1.000 82.19545  ? 208 HIS B CA    1 
ATOM   5924 C  C     . HIS B 2 220 ? 17.06901 28.78799  18.20160  1.000 81.07637  ? 208 HIS B C     1 
ATOM   5925 O  O     . HIS B 2 220 ? 16.63214 27.63920  18.33296  1.000 84.66513  ? 208 HIS B O     1 
ATOM   5926 C  CB    . HIS B 2 220 ? 15.65904 30.66351  19.12501  1.000 82.75323  ? 208 HIS B CB    1 
ATOM   5927 C  CG    . HIS B 2 220 ? 14.37466 29.89613  19.13462  1.000 82.56942  ? 208 HIS B CG    1 
ATOM   5928 N  ND1   . HIS B 2 220 ? 13.16951 30.46871  18.79105  1.000 89.26061  ? 208 HIS B ND1   1 
ATOM   5929 C  CD2   . HIS B 2 220 ? 14.10189 28.60842  19.44973  1.000 85.69877  ? 208 HIS B CD2   1 
ATOM   5930 C  CE1   . HIS B 2 220 ? 12.21025 29.56500  18.88612  1.000 89.38538  ? 208 HIS B CE1   1 
ATOM   5931 N  NE2   . HIS B 2 220 ? 12.75035 28.42617  19.28104  1.000 90.51491  ? 208 HIS B NE2   1 
ATOM   5932 N  N     . LEU B 2 221 ? 17.72571 29.17356  17.11162  1.000 79.32920  ? 209 LEU B N     1 
ATOM   5933 C  CA    . LEU B 2 221 ? 17.88026 28.29300  15.96161  1.000 82.59765  ? 209 LEU B CA    1 
ATOM   5934 C  C     . LEU B 2 221 ? 18.91371 27.19660  16.18253  1.000 87.31025  ? 209 LEU B C     1 
ATOM   5935 O  O     . LEU B 2 221 ? 19.22072 26.45498  15.24293  1.000 86.76390  ? 209 LEU B O     1 
ATOM   5936 C  CB    . LEU B 2 221 ? 18.24886 29.10571  14.71993  1.000 83.87348  ? 209 LEU B CB    1 
ATOM   5937 C  CG    . LEU B 2 221 ? 17.19868 29.13032  13.60774  1.000 78.96975  ? 209 LEU B CG    1 
ATOM   5938 C  CD1   . LEU B 2 221 ? 15.83823 29.53380  14.15905  1.000 77.87006  ? 209 LEU B CD1   1 
ATOM   5939 C  CD2   . LEU B 2 221 ? 17.63589 30.07584  12.50376  1.000 74.50518  ? 209 LEU B CD2   1 
ATOM   5940 N  N     . LEU B 2 222 ? 19.46293 27.07641  17.38778  1.000 91.43993  ? 210 LEU B N     1 
ATOM   5941 C  CA    . LEU B 2 222 ? 20.27231 25.91429  17.74532  1.000 90.00065  ? 210 LEU B CA    1 
ATOM   5942 C  C     . LEU B 2 222 ? 19.31668 24.91702  18.38834  1.000 95.05621  ? 210 LEU B C     1 
ATOM   5943 O  O     . LEU B 2 222 ? 19.04376 24.95276  19.59163  1.000 89.21713  ? 210 LEU B O     1 
ATOM   5944 C  CB    . LEU B 2 222 ? 21.43527 26.31624  18.64054  1.000 89.47847  ? 210 LEU B CB    1 
ATOM   5945 C  CG    . LEU B 2 222 ? 22.32766 27.34646  17.93183  1.000 86.84587  ? 210 LEU B CG    1 
ATOM   5946 C  CD1   . LEU B 2 222 ? 23.57433 27.70384  18.73973  1.000 87.02985  ? 210 LEU B CD1   1 
ATOM   5947 C  CD2   . LEU B 2 222 ? 22.70899 26.84508  16.55230  1.000 80.83460  ? 210 LEU B CD2   1 
ATOM   5948 N  N     . ARG B 2 223 ? 18.77799 24.04120  17.54260  1.000 98.64916  ? 211 ARG B N     1 
ATOM   5949 C  CA    . ARG B 2 223 ? 17.71826 23.11005  17.88410  1.000 89.96760  ? 211 ARG B CA    1 
ATOM   5950 C  C     . ARG B 2 223 ? 17.72957 21.98035  16.86955  1.000 87.27738  ? 211 ARG B C     1 
ATOM   5951 O  O     . ARG B 2 223 ? 17.61808 22.22790  15.66774  1.000 86.98814  ? 211 ARG B O     1 
ATOM   5952 C  CB    . ARG B 2 223 ? 16.35861 23.80753  17.88151  1.000 88.16046  ? 211 ARG B CB    1 
ATOM   5953 C  CG    . ARG B 2 223 ? 15.18232 22.85646  17.70084  1.000 93.15223  ? 211 ARG B CG    1 
ATOM   5954 C  CD    . ARG B 2 223 ? 13.87224 23.60737  17.55690  1.000 93.28746  ? 211 ARG B CD    1 
ATOM   5955 N  NE    . ARG B 2 223 ? 13.76829 24.71258  18.50876  1.000 98.98634  ? 211 ARG B NE    1 
ATOM   5956 C  CZ    . ARG B 2 223 ? 13.43791 24.57101  19.79098  1.000 103.62437 ? 211 ARG B CZ    1 
ATOM   5957 N  NH1   . ARG B 2 223 ? 13.18252 23.36230  20.28612  1.000 104.74345 ? 211 ARG B NH1   1 
ATOM   5958 N  NH2   . ARG B 2 223 ? 13.36805 25.63771  20.58183  1.000 96.08579  ? 211 ARG B NH2   1 
ATOM   5959 N  N     . GLU B 2 245 ? 23.60002 44.74198  6.79597   1.000 68.02832  ? 233 GLU B N     1 
ATOM   5960 C  CA    . GLU B 2 245 ? 22.30723 45.12234  7.36376   1.000 77.66439  ? 233 GLU B CA    1 
ATOM   5961 C  C     . GLU B 2 245 ? 21.45332 45.92137  6.37176   1.000 83.69459  ? 233 GLU B C     1 
ATOM   5962 O  O     . GLU B 2 245 ? 21.84253 47.01221  5.94324   1.000 87.62052  ? 233 GLU B O     1 
ATOM   5963 C  CB    . GLU B 2 245 ? 22.50565 45.93496  8.65073   1.000 74.77552  ? 233 GLU B CB    1 
ATOM   5964 N  N     . LEU B 2 246 ? 20.28766 45.38217  6.01537   1.000 80.09461  ? 234 LEU B N     1 
ATOM   5965 C  CA    . LEU B 2 246 ? 19.39971 46.02753  5.05846   1.000 74.16203  ? 234 LEU B CA    1 
ATOM   5966 C  C     . LEU B 2 246 ? 18.52504 47.05460  5.74482   1.000 75.63651  ? 234 LEU B C     1 
ATOM   5967 O  O     . LEU B 2 246 ? 18.20279 46.92736  6.92664   1.000 80.37641  ? 234 LEU B O     1 
ATOM   5968 C  CB    . LEU B 2 246 ? 18.48369 45.02439  4.36283   1.000 73.00120  ? 234 LEU B CB    1 
ATOM   5969 C  CG    . LEU B 2 246 ? 19.01683 43.98877  3.38694   1.000 73.26782  ? 234 LEU B CG    1 
ATOM   5970 C  CD1   . LEU B 2 246 ? 17.86468 43.59223  2.48111   1.000 73.06980  ? 234 LEU B CD1   1 
ATOM   5971 C  CD2   . LEU B 2 246 ? 20.20150 44.50673  2.58887   1.000 68.22924  ? 234 LEU B CD2   1 
ATOM   5972 N  N     . HIS B 2 247 ? 18.11967 48.06275  4.97562   1.000 79.88390  ? 235 HIS B N     1 
ATOM   5973 C  CA    . HIS B 2 247 ? 17.14071 49.05888  5.41441   1.000 82.39610  ? 235 HIS B CA    1 
ATOM   5974 C  C     . HIS B 2 247 ? 16.19877 49.30178  4.24985   1.000 80.05403  ? 235 HIS B C     1 
ATOM   5975 O  O     . HIS B 2 247 ? 16.34711 50.26797  3.49361   1.000 79.73302  ? 235 HIS B O     1 
ATOM   5976 C  CB    . HIS B 2 247 ? 17.81602 50.35488  5.87478   1.000 78.02347  ? 235 HIS B CB    1 
ATOM   5977 C  CG    . HIS B 2 247 ? 18.78904 50.15645  6.99154   1.000 81.95457  ? 235 HIS B CG    1 
ATOM   5978 N  ND1   . HIS B 2 247 ? 18.39638 49.79261  8.26221   1.000 80.17650  ? 235 HIS B ND1   1 
ATOM   5979 C  CD2   . HIS B 2 247 ? 20.14112 50.24091  7.02271   1.000 82.11711  ? 235 HIS B CD2   1 
ATOM   5980 C  CE1   . HIS B 2 247 ? 19.46525 49.67064  9.03085   1.000 85.86678  ? 235 HIS B CE1   1 
ATOM   5981 N  NE2   . HIS B 2 247 ? 20.53644 49.93779  8.30307   1.000 86.96159  ? 235 HIS B NE2   1 
ATOM   5982 N  N     . PRO B 2 248 ? 15.20936 48.42844  4.06810   1.000 81.09307  ? 236 PRO B N     1 
ATOM   5983 C  CA    . PRO B 2 248 ? 14.32418 48.55815  2.89962   1.000 80.85256  ? 236 PRO B CA    1 
ATOM   5984 C  C     . PRO B 2 248 ? 13.49824 49.83228  2.87989   1.000 80.96510  ? 236 PRO B C     1 
ATOM   5985 O  O     . PRO B 2 248 ? 12.98882 50.19366  1.81311   1.000 83.02831  ? 236 PRO B O     1 
ATOM   5986 C  CB    . PRO B 2 248 ? 13.42881 47.31574  2.99667   1.000 74.81666  ? 236 PRO B CB    1 
ATOM   5987 C  CG    . PRO B 2 248 ? 13.48812 46.91851  4.43564   1.000 79.36868  ? 236 PRO B CG    1 
ATOM   5988 C  CD    . PRO B 2 248 ? 14.87691 47.25715  4.89365   1.000 75.73890  ? 236 PRO B CD    1 
ATOM   5989 N  N     . ASP B 2 249 ? 13.33684 50.52544  4.00645   1.000 83.35928  ? 237 ASP B N     1 
ATOM   5990 C  CA    . ASP B 2 249 ? 12.51606 51.73198  3.99832   1.000 91.74103  ? 237 ASP B CA    1 
ATOM   5991 C  C     . ASP B 2 249 ? 13.25052 52.94385  3.43327   1.000 89.76027  ? 237 ASP B C     1 
ATOM   5992 O  O     . ASP B 2 249 ? 12.69599 54.04812  3.45881   1.000 87.17135  ? 237 ASP B O     1 
ATOM   5993 C  CB    . ASP B 2 249 ? 11.98345 52.03956  5.40979   1.000 87.25217  ? 237 ASP B CB    1 
ATOM   5994 C  CG    . ASP B 2 249 ? 13.08779 52.39837  6.40608   1.000 90.60146  ? 237 ASP B CG    1 
ATOM   5995 O  OD1   . ASP B 2 249 ? 14.27149 52.07618  6.15722   1.000 90.69314  ? 237 ASP B OD1   1 
ATOM   5996 O  OD2   . ASP B 2 249 ? 12.75970 52.99727  7.45890   1.000 87.35636  ? 237 ASP B OD2   1 
ATOM   5997 N  N     . LYS B 2 250 ? 14.46797 52.76741  2.91643   1.000 88.17474  ? 238 LYS B N     1 
ATOM   5998 C  CA    . LYS B 2 250 ? 15.23766 53.86836  2.34996   1.000 92.39650  ? 238 LYS B CA    1 
ATOM   5999 C  C     . LYS B 2 250 ? 15.59067 53.64314  0.87934   1.000 94.40488  ? 238 LYS B C     1 
ATOM   6000 O  O     . LYS B 2 250 ? 16.32486 54.45467  0.29802   1.000 92.85157  ? 238 LYS B O     1 
ATOM   6001 C  CB    . LYS B 2 250 ? 16.51148 54.10087  3.17125   1.000 86.89684  ? 238 LYS B CB    1 
ATOM   6002 N  N     . TRP B 2 251 ? 15.09365 52.56633  0.26275   1.000 90.81537  ? 239 TRP B N     1 
ATOM   6003 C  CA    . TRP B 2 251 ? 15.25948 52.37129  -1.17447  1.000 89.71231  ? 239 TRP B CA    1 
ATOM   6004 C  C     . TRP B 2 251 ? 14.40999 53.38070  -1.93583  1.000 91.43433  ? 239 TRP B C     1 
ATOM   6005 O  O     . TRP B 2 251 ? 13.20512 53.51010  -1.68921  1.000 89.43480  ? 239 TRP B O     1 
ATOM   6006 C  CB    . TRP B 2 251 ? 14.85478 50.95480  -1.58452  1.000 87.14527  ? 239 TRP B CB    1 
ATOM   6007 C  CG    . TRP B 2 251 ? 15.59108 49.85255  -0.88468  1.000 82.39996  ? 239 TRP B CG    1 
ATOM   6008 C  CD1   . TRP B 2 251 ? 16.79731 49.93381  -0.24677  1.000 79.36378  ? 239 TRP B CD1   1 
ATOM   6009 C  CD2   . TRP B 2 251 ? 15.15258 48.49980  -0.74421  1.000 73.18738  ? 239 TRP B CD2   1 
ATOM   6010 N  NE1   . TRP B 2 251 ? 17.13676 48.71171  0.27685   1.000 74.33829  ? 239 TRP B NE1   1 
ATOM   6011 C  CE2   . TRP B 2 251 ? 16.14256 47.81293  -0.01277  1.000 76.85375  ? 239 TRP B CE2   1 
ATOM   6012 C  CE3   . TRP B 2 251 ? 14.01536 47.80211  -1.16386  1.000 70.43702  ? 239 TRP B CE3   1 
ATOM   6013 C  CZ2   . TRP B 2 251 ? 16.03187 46.45488  0.30431   1.000 71.66527  ? 239 TRP B CZ2   1 
ATOM   6014 C  CZ3   . TRP B 2 251 ? 13.90477 46.45842  -0.85045  1.000 67.09784  ? 239 TRP B CZ3   1 
ATOM   6015 C  CH2   . TRP B 2 251 ? 14.90811 45.79836  -0.12398  1.000 67.42485  ? 239 TRP B CH2   1 
ATOM   6016 N  N     . THR B 2 252 ? 15.03258 54.06839  -2.88670  1.000 93.73388  ? 240 THR B N     1 
ATOM   6017 C  CA    . THR B 2 252 ? 14.40922 55.16993  -3.60079  1.000 91.32346  ? 240 THR B CA    1 
ATOM   6018 C  C     . THR B 2 252 ? 14.30747 54.85485  -5.08902  1.000 87.89580  ? 240 THR B C     1 
ATOM   6019 O  O     . THR B 2 252 ? 15.06099 54.04038  -5.63485  1.000 82.34156  ? 240 THR B O     1 
ATOM   6020 C  CB    . THR B 2 252 ? 15.19417 56.47323  -3.39128  1.000 91.75676  ? 240 THR B CB    1 
ATOM   6021 O  OG1   . THR B 2 252 ? 16.52262 56.32496  -3.91738  1.000 89.76277  ? 240 THR B OG1   1 
ATOM   6022 C  CG2   . THR B 2 252 ? 15.27274 56.80419  -1.90359  1.000 90.23592  ? 240 THR B CG2   1 
ATOM   6023 N  N     . VAL B 2 253 ? 13.35300 55.52337  -5.73709  1.000 87.62520  ? 241 VAL B N     1 
ATOM   6024 C  CA    . VAL B 2 253 ? 13.07228 55.35835  -7.15923  1.000 79.25083  ? 241 VAL B CA    1 
ATOM   6025 C  C     . VAL B 2 253 ? 13.85738 56.40202  -7.93637  1.000 78.88671  ? 241 VAL B C     1 
ATOM   6026 O  O     . VAL B 2 253 ? 13.92972 57.56988  -7.52722  1.000 76.60930  ? 241 VAL B O     1 
ATOM   6027 C  CB    . VAL B 2 253 ? 11.56363 55.49185  -7.43844  1.000 76.55805  ? 241 VAL B CB    1 
ATOM   6028 C  CG1   . VAL B 2 253 ? 11.28735 55.39697  -8.92582  1.000 72.90133  ? 241 VAL B CG1   1 
ATOM   6029 C  CG2   . VAL B 2 253 ? 10.78930 54.43479  -6.67868  1.000 80.96651  ? 241 VAL B CG2   1 
ATOM   6030 N  N     . GLN B 2 254 ? 14.44945 55.98649  -9.06280  1.000 74.21665  ? 242 GLN B N     1 
ATOM   6031 C  CA    . GLN B 2 254 ? 15.15017 56.92726  -9.93227  1.000 74.44178  ? 242 GLN B CA    1 
ATOM   6032 C  C     . GLN B 2 254 ? 14.23237 57.38838  -11.06094 1.000 73.22881  ? 242 GLN B C     1 
ATOM   6033 O  O     . GLN B 2 254 ? 14.00676 56.64109  -12.02071 1.000 67.94839  ? 242 GLN B O     1 
ATOM   6034 C  CB    . GLN B 2 254 ? 16.42670 56.30744  -10.50479 1.000 67.22085  ? 242 GLN B CB    1 
ATOM   6035 C  CG    . GLN B 2 254 ? 17.19228 57.24462  -11.43869 1.000 75.47174  ? 242 GLN B CG    1 
ATOM   6036 C  CD    . GLN B 2 254 ? 17.41441 58.64483  -10.84691 1.000 74.92096  ? 242 GLN B CD    1 
ATOM   6037 O  OE1   . GLN B 2 254 ? 17.96137 58.79720  -9.75195  1.000 75.00123  ? 242 GLN B OE1   1 
ATOM   6038 N  NE2   . GLN B 2 254 ? 16.98956 59.66855  -11.57927 1.000 71.50077  ? 242 GLN B NE2   1 
ATOM   6039 N  N     . PRO B 2 255 ? 13.69013 58.60295  -10.98676 1.000 72.80425  ? 243 PRO B N     1 
ATOM   6040 C  CA    . PRO B 2 255 ? 12.76106 59.05953  -12.01996 1.000 67.62762  ? 243 PRO B CA    1 
ATOM   6041 C  C     . PRO B 2 255 ? 13.48026 59.57242  -13.25705 1.000 63.83803  ? 243 PRO B C     1 
ATOM   6042 O  O     . PRO B 2 255 ? 14.62983 60.01124  -13.20362 1.000 64.76197  ? 243 PRO B O     1 
ATOM   6043 C  CB    . PRO B 2 255 ? 12.00264 60.19214  -11.31936 1.000 67.80395  ? 243 PRO B CB    1 
ATOM   6044 C  CG    . PRO B 2 255 ? 13.00862 60.75741  -10.36884 1.000 64.10022  ? 243 PRO B CG    1 
ATOM   6045 C  CD    . PRO B 2 255 ? 13.85310 59.60304  -9.91280  1.000 69.21497  ? 243 PRO B CD    1 
ATOM   6046 N  N     . ILE B 2 256 ? 12.77604 59.49490  -14.38931 1.000 63.65363  ? 244 ILE B N     1 
ATOM   6047 C  CA    . ILE B 2 256 ? 13.21821 60.17251  -15.60217 1.000 65.54483  ? 244 ILE B CA    1 
ATOM   6048 C  C     . ILE B 2 256 ? 13.33168 61.66009  -15.31872 1.000 67.50313  ? 244 ILE B C     1 
ATOM   6049 O  O     . ILE B 2 256 ? 12.43423 62.26269  -14.71596 1.000 67.51166  ? 244 ILE B O     1 
ATOM   6050 C  CB    . ILE B 2 256 ? 12.23576 59.91787  -16.75554 1.000 69.90962  ? 244 ILE B CB    1 
ATOM   6051 C  CG1   . ILE B 2 256 ? 12.03044 58.41923  -16.99507 1.000 62.66701  ? 244 ILE B CG1   1 
ATOM   6052 C  CG2   . ILE B 2 256 ? 12.72138 60.62223  -18.02422 1.000 67.98687  ? 244 ILE B CG2   1 
ATOM   6053 C  CD1   . ILE B 2 256 ? 13.02516 57.82468  -17.94806 1.000 63.51385  ? 244 ILE B CD1   1 
ATOM   6054 N  N     . VAL B 2 257 ? 14.42884 62.26791  -15.75414 1.000 64.79063  ? 245 VAL B N     1 
ATOM   6055 C  CA    . VAL B 2 257 ? 14.71049 63.65004  -15.39001 1.000 68.15962  ? 245 VAL B CA    1 
ATOM   6056 C  C     . VAL B 2 257 ? 15.27912 64.38262  -16.60182 1.000 69.28197  ? 245 VAL B C     1 
ATOM   6057 O  O     . VAL B 2 257 ? 16.09955 63.83419  -17.34639 1.000 69.54930  ? 245 VAL B O     1 
ATOM   6058 C  CB    . VAL B 2 257 ? 15.64862 63.71085  -14.16421 1.000 66.63793  ? 245 VAL B CB    1 
ATOM   6059 C  CG1   . VAL B 2 257 ? 16.90342 62.85529  -14.39058 1.000 67.90538  ? 245 VAL B CG1   1 
ATOM   6060 C  CG2   . VAL B 2 257 ? 15.98083 65.16122  -13.80309 1.000 70.60775  ? 245 VAL B CG2   1 
ATOM   6061 N  N     . LEU B 2 258 ? 14.81862 65.63867  -16.80591 1.000 68.52600  ? 246 LEU B N     1 
ATOM   6062 C  CA    . LEU B 2 258 ? 15.07701 66.44832  -17.98927 1.000 70.45377  ? 246 LEU B CA    1 
ATOM   6063 C  C     . LEU B 2 258 ? 16.08082 67.56781  -17.70323 1.000 71.69563  ? 246 LEU B C     1 
ATOM   6064 O  O     . LEU B 2 258 ? 16.12684 68.11102  -16.59442 1.000 69.96158  ? 246 LEU B O     1 
ATOM   6065 C  CB    . LEU B 2 258 ? 13.78193 67.06710  -18.52916 1.000 63.16227  ? 246 LEU B CB    1 
ATOM   6066 C  CG    . LEU B 2 258 ? 12.75692 66.08756  -19.09116 1.000 63.38485  ? 246 LEU B CG    1 
ATOM   6067 C  CD1   . LEU B 2 258 ? 11.68586 66.82736  -19.87120 1.000 58.67086  ? 246 LEU B CD1   1 
ATOM   6068 C  CD2   . LEU B 2 258 ? 13.43163 65.04406  -19.96571 1.000 64.31522  ? 246 LEU B CD2   1 
ATOM   6069 N  N     . PRO B 2 259 ? 16.88489 67.94198  -18.69654 1.000 70.79151  ? 247 PRO B N     1 
ATOM   6070 C  CA    . PRO B 2 259 ? 17.93736 68.93348  -18.46224 1.000 71.34019  ? 247 PRO B CA    1 
ATOM   6071 C  C     . PRO B 2 259 ? 17.37348 70.31088  -18.17020 1.000 69.79332  ? 247 PRO B C     1 
ATOM   6072 O  O     . PRO B 2 259 ? 16.29176 70.67584  -18.63404 1.000 72.11197  ? 247 PRO B O     1 
ATOM   6073 C  CB    . PRO B 2 259 ? 18.71992 68.92989  -19.78064 1.000 71.69758  ? 247 PRO B CB    1 
ATOM   6074 C  CG    . PRO B 2 259 ? 17.73225 68.44731  -20.79748 1.000 64.81881  ? 247 PRO B CG    1 
ATOM   6075 C  CD    . PRO B 2 259 ? 16.90401 67.43477  -20.08084 1.000 68.72878  ? 247 PRO B CD    1 
ATOM   6076 N  N     . GLU B 2 260 ? 18.13229 71.07539  -17.38799 1.000 69.64263  ? 248 GLU B N     1 
ATOM   6077 C  CA    . GLU B 2 260 ? 17.86280 72.48482  -17.12531 1.000 69.07835  ? 248 GLU B CA    1 
ATOM   6078 C  C     . GLU B 2 260 ? 18.90800 73.31621  -17.85181 1.000 69.91725  ? 248 GLU B C     1 
ATOM   6079 O  O     . GLU B 2 260 ? 20.11235 73.10689  -17.66069 1.000 68.31957  ? 248 GLU B O     1 
ATOM   6080 C  CB    . GLU B 2 260 ? 17.92886 72.80710  -15.63070 1.000 73.31388  ? 248 GLU B CB    1 
ATOM   6081 C  CG    . GLU B 2 260 ? 17.16104 71.88505  -14.71029 1.000 71.17007  ? 248 GLU B CG    1 
ATOM   6082 C  CD    . GLU B 2 260 ? 15.80789 72.44609  -14.35288 1.000 83.27708  ? 248 GLU B CD    1 
ATOM   6083 O  OE1   . GLU B 2 260 ? 15.40491 73.46849  -14.97396 1.000 80.85302  ? 248 GLU B OE1   1 
ATOM   6084 O  OE2   . GLU B 2 260 ? 15.15675 71.86470  -13.45016 1.000 80.51264  ? 248 GLU B OE2   1 
ATOM   6085 N  N     . LYS B 2 261 ? 18.45779 74.26148  -18.66988 1.000 64.29605  ? 249 LYS B N     1 
ATOM   6086 C  CA    . LYS B 2 261 ? 19.39442 75.09185  -19.41061 1.000 61.70645  ? 249 LYS B CA    1 
ATOM   6087 C  C     . LYS B 2 261 ? 18.81717 76.48871  -19.57529 1.000 67.00459  ? 249 LYS B C     1 
ATOM   6088 O  O     . LYS B 2 261 ? 17.60093 76.66704  -19.70266 1.000 64.83151  ? 249 LYS B O     1 
ATOM   6089 C  CB    . LYS B 2 261 ? 19.72230 74.49593  -20.78998 1.000 59.77559  ? 249 LYS B CB    1 
ATOM   6090 C  CG    . LYS B 2 261 ? 20.65677 73.30042  -20.75771 1.000 59.85941  ? 249 LYS B CG    1 
ATOM   6091 C  CD    . LYS B 2 261 ? 20.99078 72.81056  -22.15662 1.000 57.39718  ? 249 LYS B CD    1 
ATOM   6092 C  CE    . LYS B 2 261 ? 22.21976 71.89343  -22.14264 1.000 60.46187  ? 249 LYS B CE    1 
ATOM   6093 N  NZ    . LYS B 2 261 ? 21.91305 70.45411  -21.84371 1.000 56.92751  ? 249 LYS B NZ    1 
ATOM   6094 N  N     . ASP B 2 262 ? 19.70750 77.48112  -19.57523 1.000 69.73267  ? 250 ASP B N     1 
ATOM   6095 C  CA    . ASP B 2 262 ? 19.31908 78.83852  -19.92179 1.000 61.96824  ? 250 ASP B CA    1 
ATOM   6096 C  C     . ASP B 2 262 ? 19.51654 79.14335  -21.39330 1.000 61.00998  ? 250 ASP B C     1 
ATOM   6097 O  O     . ASP B 2 262 ? 19.00622 80.16125  -21.86683 1.000 64.86549  ? 250 ASP B O     1 
ATOM   6098 C  CB    . ASP B 2 262 ? 20.09347 79.84897  -19.07981 1.000 58.83855  ? 250 ASP B CB    1 
ATOM   6099 C  CG    . ASP B 2 262 ? 19.27775 80.36132  -17.90508 1.000 81.35440  ? 250 ASP B CG    1 
ATOM   6100 O  OD1   . ASP B 2 262 ? 18.06365 80.05397  -17.84720 1.000 79.02324  ? 250 ASP B OD1   1 
ATOM   6101 O  OD2   . ASP B 2 262 ? 19.84219 81.07396  -17.03932 1.000 94.70403  ? 250 ASP B OD2   1 
ATOM   6102 N  N     . SER B 2 263 ? 20.22400 78.28305  -22.12447 1.000 58.32623  ? 251 SER B N     1 
ATOM   6103 C  CA    . SER B 2 263 ? 20.45830 78.46385  -23.55076 1.000 53.47247  ? 251 SER B CA    1 
ATOM   6104 C  C     . SER B 2 263 ? 20.41121 77.11260  -24.23953 1.000 54.59964  ? 251 SER B C     1 
ATOM   6105 O  O     . SER B 2 263 ? 21.12406 76.18778  -23.84143 1.000 57.58300  ? 251 SER B O     1 
ATOM   6106 C  CB    . SER B 2 263 ? 21.80741 79.12671  -23.81172 1.000 58.12245  ? 251 SER B CB    1 
ATOM   6107 O  OG    . SER B 2 263 ? 21.92476 79.46871  -25.17583 1.000 62.86562  ? 251 SER B OG    1 
ATOM   6108 N  N     . TRP B 2 264 ? 19.58664 77.00380  -25.27519 1.000 50.20117  ? 252 TRP B N     1 
ATOM   6109 C  CA    . TRP B 2 264 ? 19.29863 75.72984  -25.91200 1.000 47.92966  ? 252 TRP B CA    1 
ATOM   6110 C  C     . TRP B 2 264 ? 19.75677 75.76129  -27.36083 1.000 48.08856  ? 252 TRP B C     1 
ATOM   6111 O  O     . TRP B 2 264 ? 19.45858 76.71720  -28.08582 1.000 48.34426  ? 252 TRP B O     1 
ATOM   6112 C  CB    . TRP B 2 264 ? 17.79892 75.42044  -25.83940 1.000 50.49004  ? 252 TRP B CB    1 
ATOM   6113 C  CG    . TRP B 2 264 ? 17.28920 75.15125  -24.43946 1.000 56.26545  ? 252 TRP B CG    1 
ATOM   6114 C  CD1   . TRP B 2 264 ? 16.89787 76.07786  -23.51630 1.000 53.34248  ? 252 TRP B CD1   1 
ATOM   6115 C  CD2   . TRP B 2 264 ? 17.10288 73.86790  -23.81929 1.000 55.76754  ? 252 TRP B CD2   1 
ATOM   6116 N  NE1   . TRP B 2 264 ? 16.49062 75.45626  -22.36253 1.000 56.33752  ? 252 TRP B NE1   1 
ATOM   6117 C  CE2   . TRP B 2 264 ? 16.60208 74.10002  -22.52280 1.000 55.56614  ? 252 TRP B CE2   1 
ATOM   6118 C  CE3   . TRP B 2 264 ? 17.31357 72.54909  -24.23464 1.000 53.32806  ? 252 TRP B CE3   1 
ATOM   6119 C  CZ2   . TRP B 2 264 ? 16.31271 73.06602  -21.63987 1.000 55.21577  ? 252 TRP B CZ2   1 
ATOM   6120 C  CZ3   . TRP B 2 264 ? 17.02119 71.52251  -23.35800 1.000 53.81009  ? 252 TRP B CZ3   1 
ATOM   6121 C  CH2   . TRP B 2 264 ? 16.53099 71.78697  -22.07358 1.000 59.01349  ? 252 TRP B CH2   1 
ATOM   6122 N  N     . THR B 2 265 ? 20.45308 74.71183  -27.79349 1.000 44.84334  ? 253 THR B N     1 
ATOM   6123 C  CA    . THR B 2 265 ? 20.81024 74.58881  -29.19920 1.000 43.31293  ? 253 THR B CA    1 
ATOM   6124 C  C     . THR B 2 265 ? 19.88005 73.62129  -29.91080 1.000 38.66561  ? 253 THR B C     1 
ATOM   6125 O  O     . THR B 2 265 ? 19.09635 72.89807  -29.29617 1.000 38.78893  ? 253 THR B O     1 
ATOM   6126 C  CB    . THR B 2 265 ? 22.26024 74.13349  -29.37726 1.000 44.80087  ? 253 THR B CB    1 
ATOM   6127 O  OG1   . THR B 2 265 ? 22.39614 72.75674  -28.98597 1.000 44.30047  ? 253 THR B OG1   1 
ATOM   6128 C  CG2   . THR B 2 265 ? 23.19038 75.01293  -28.55176 1.000 42.92065  ? 253 THR B CG2   1 
ATOM   6129 N  N     . VAL B 2 266 ? 19.96489 73.64778  -31.24043 1.000 36.72293  ? 254 VAL B N     1 
ATOM   6130 C  CA    . VAL B 2 266 ? 19.26422 72.67259  -32.06870 1.000 39.67245  ? 254 VAL B CA    1 
ATOM   6131 C  C     . VAL B 2 266 ? 19.60680 71.26296  -31.61816 1.000 45.49250  ? 254 VAL B C     1 
ATOM   6132 O  O     . VAL B 2 266 ? 18.72905 70.39591  -31.50830 1.000 46.33251  ? 254 VAL B O     1 
ATOM   6133 C  CB    . VAL B 2 266 ? 19.61207 72.87902  -33.55495 1.000 37.25486  ? 254 VAL B CB    1 
ATOM   6134 C  CG1   . VAL B 2 266 ? 19.17777 71.66960  -34.37654 1.000 37.16766  ? 254 VAL B CG1   1 
ATOM   6135 C  CG2   . VAL B 2 266 ? 18.97226 74.13662  -34.08224 1.000 38.18829  ? 254 VAL B CG2   1 
ATOM   6136 N  N     . ASN B 2 267 ? 20.88843 71.01268  -31.34618 1.000 37.85206  ? 255 ASN B N     1 
ATOM   6137 C  CA    . ASN B 2 267 ? 21.28934 69.70821  -30.84416 1.000 42.06602  ? 255 ASN B CA    1 
ATOM   6138 C  C     . ASN B 2 267 ? 20.58866 69.37146  -29.52568 1.000 42.90274  ? 255 ASN B C     1 
ATOM   6139 O  O     . ASN B 2 267 ? 20.02861 68.27887  -29.37081 1.000 43.11528  ? 255 ASN B O     1 
ATOM   6140 C  CB    . ASN B 2 267 ? 22.80778 69.66274  -30.68054 1.000 42.94452  ? 255 ASN B CB    1 
ATOM   6141 C  CG    . ASN B 2 267 ? 23.28030 68.31952  -30.20008 1.000 40.91309  ? 255 ASN B CG    1 
ATOM   6142 O  OD1   . ASN B 2 267 ? 23.10426 67.32135  -30.89125 1.000 43.11771  ? 255 ASN B OD1   1 
ATOM   6143 N  ND2   . ASN B 2 267 ? 23.83883 68.27276  -28.99878 1.000 40.35068  ? 255 ASN B ND2   1 
ATOM   6144 N  N     . ASP B 2 268 ? 20.65227 70.28636  -28.55037 1.000 43.94750  ? 256 ASP B N     1 
ATOM   6145 C  CA    . ASP B 2 268 ? 19.98932 70.09077  -27.26278 1.000 41.05624  ? 256 ASP B CA    1 
ATOM   6146 C  C     . ASP B 2 268 ? 18.51301 69.75286  -27.43873 1.000 43.77355  ? 256 ASP B C     1 
ATOM   6147 O  O     . ASP B 2 268 ? 18.00761 68.78767  -26.85778 1.000 47.60865  ? 256 ASP B O     1 
ATOM   6148 C  CB    . ASP B 2 268 ? 20.13353 71.35037  -26.40854 1.000 44.39380  ? 256 ASP B CB    1 
ATOM   6149 C  CG    . ASP B 2 268 ? 21.55719 71.60002  -25.95686 1.000 49.23088  ? 256 ASP B CG    1 
ATOM   6150 O  OD1   . ASP B 2 268 ? 22.28437 70.61364  -25.71080 1.000 52.65617  ? 256 ASP B OD1   1 
ATOM   6151 O  OD2   . ASP B 2 268 ? 21.94443 72.78819  -25.83508 1.000 48.86753  ? 256 ASP B OD2   1 
ATOM   6152 N  N     . ILE B 2 269 ? 17.80193 70.54712  -28.23790 1.000 43.27776  ? 257 ILE B N     1 
ATOM   6153 C  CA    . ILE B 2 269 ? 16.37223 70.32298  -28.39903 1.000 45.74325  ? 257 ILE B CA    1 
ATOM   6154 C  C     . ILE B 2 269 ? 16.09985 69.02714  -29.16030 1.000 46.15025  ? 257 ILE B C     1 
ATOM   6155 O  O     . ILE B 2 269 ? 15.10897 68.34640  -28.88546 1.000 47.60450  ? 257 ILE B O     1 
ATOM   6156 C  CB    . ILE B 2 269 ? 15.72439 71.54775  -29.07383 1.000 43.82924  ? 257 ILE B CB    1 
ATOM   6157 C  CG1   . ILE B 2 269 ? 15.91221 72.78449  -28.20855 1.000 45.66959  ? 257 ILE B CG1   1 
ATOM   6158 C  CG2   . ILE B 2 269 ? 14.25287 71.34397  -29.28819 1.000 41.30998  ? 257 ILE B CG2   1 
ATOM   6159 C  CD1   . ILE B 2 269 ? 15.57871 74.06737  -28.93864 1.000 52.03343  ? 257 ILE B CD1   1 
ATOM   6160 N  N     . GLN B 2 270 ? 16.96732 68.64875  -30.10700 1.000 45.85353  ? 258 GLN B N     1 
ATOM   6161 C  CA    . GLN B 2 270 ? 16.79646 67.37038  -30.79769 1.000 44.80111  ? 258 GLN B CA    1 
ATOM   6162 C  C     . GLN B 2 270 ? 16.95736 66.20013  -29.82829 1.000 44.76775  ? 258 GLN B C     1 
ATOM   6163 O  O     . GLN B 2 270 ? 16.14654 65.25894  -29.82782 1.000 44.48275  ? 258 GLN B O     1 
ATOM   6164 C  CB    . GLN B 2 270 ? 17.78504 67.25831  -31.97079 1.000 43.95256  ? 258 GLN B CB    1 
ATOM   6165 C  CG    . GLN B 2 270 ? 17.23776 67.74868  -33.33502 1.000 40.74155  ? 258 GLN B CG    1 
ATOM   6166 C  CD    . GLN B 2 270 ? 18.27267 67.75090  -34.47805 1.000 40.00553  ? 258 GLN B CD    1 
ATOM   6167 O  OE1   . GLN B 2 270 ? 19.35142 67.17705  -34.36335 1.000 39.15705  ? 258 GLN B OE1   1 
ATOM   6168 N  NE2   . GLN B 2 270 ? 17.93286 68.41327  -35.58523 1.000 41.74997  ? 258 GLN B NE2   1 
ATOM   6169 N  N     . LYS B 2 271 ? 17.97681 66.25563  -28.96960 1.000 43.40603  ? 259 LYS B N     1 
ATOM   6170 C  CA    . LYS B 2 271 ? 18.13664 65.20249  -27.97203 1.000 44.62624  ? 259 LYS B CA    1 
ATOM   6171 C  C     . LYS B 2 271 ? 16.93157 65.15771  -27.04217 1.000 44.16564  ? 259 LYS B C     1 
ATOM   6172 O  O     . LYS B 2 271 ? 16.41777 64.07642  -26.71964 1.000 47.29852  ? 259 LYS B O     1 
ATOM   6173 C  CB    . LYS B 2 271 ? 19.43611 65.39522  -27.18251 1.000 40.25146  ? 259 LYS B CB    1 
ATOM   6174 C  CG    . LYS B 2 271 ? 20.71402 65.12848  -27.98636 1.000 41.07475  ? 259 LYS B CG    1 
ATOM   6175 C  CD    . LYS B 2 271 ? 21.92057 64.75854  -27.10977 1.000 47.25546  ? 259 LYS B CD    1 
ATOM   6176 C  CE    . LYS B 2 271 ? 22.29384 65.87867  -26.12288 1.000 57.42987  ? 259 LYS B CE    1 
ATOM   6177 N  NZ    . LYS B 2 271 ? 23.70539 65.82447  -25.57347 1.000 55.35187  ? 259 LYS B NZ    1 
ATOM   6178 N  N     . LEU B 2 272 ? 16.44694 66.32661  -26.62713 1.000 45.84335  ? 260 LEU B N     1 
ATOM   6179 C  CA    . LEU B 2 272 ? 15.31401 66.37244  -25.71085 1.000 46.45097  ? 260 LEU B CA    1 
ATOM   6180 C  C     . LEU B 2 272 ? 14.05542 65.80088  -26.35180 1.000 51.00967  ? 260 LEU B C     1 
ATOM   6181 O  O     . LEU B 2 272 ? 13.30530 65.05516  -25.70825 1.000 52.17387  ? 260 LEU B O     1 
ATOM   6182 C  CB    . LEU B 2 272 ? 15.08145 67.80443  -25.26533 1.000 48.66329  ? 260 LEU B CB    1 
ATOM   6183 C  CG    . LEU B 2 272 ? 13.93343 68.14428  -24.32620 1.000 53.88884  ? 260 LEU B CG    1 
ATOM   6184 C  CD1   . LEU B 2 272 ? 14.19519 67.57518  -22.94016 1.000 48.39038  ? 260 LEU B CD1   1 
ATOM   6185 C  CD2   . LEU B 2 272 ? 13.78012 69.68393  -24.30590 1.000 49.55902  ? 260 LEU B CD2   1 
ATOM   6186 N  N     . VAL B 2 273 ? 13.80929 66.12864  -27.62112 1.000 47.01224  ? 261 VAL B N     1 
ATOM   6187 C  CA    . VAL B 2 273 ? 12.61926 65.61801  -28.28811 1.000 46.12273  ? 261 VAL B CA    1 
ATOM   6188 C  C     . VAL B 2 273 ? 12.70127 64.10442  -28.44435 1.000 51.85730  ? 261 VAL B C     1 
ATOM   6189 O  O     . VAL B 2 273 ? 11.69904 63.39982  -28.28920 1.000 50.98301  ? 261 VAL B O     1 
ATOM   6190 C  CB    . VAL B 2 273 ? 12.41420 66.32317  -29.63746 1.000 45.91257  ? 261 VAL B CB    1 
ATOM   6191 C  CG1   . VAL B 2 273 ? 11.36539 65.60073  -30.45239 1.000 46.01907  ? 261 VAL B CG1   1 
ATOM   6192 C  CG2   . VAL B 2 273 ? 11.99054 67.77305  -29.41092 1.000 50.38191  ? 261 VAL B CG2   1 
ATOM   6193 N  N     . GLY B 2 274 ? 13.89090 63.57254  -28.73252 1.000 52.48698  ? 262 GLY B N     1 
ATOM   6194 C  CA    . GLY B 2 274 ? 14.01819 62.12551  -28.83033 1.000 46.71232  ? 262 GLY B CA    1 
ATOM   6195 C  C     . GLY B 2 274 ? 13.78009 61.43851  -27.50085 1.000 48.44180  ? 262 GLY B C     1 
ATOM   6196 O  O     . GLY B 2 274 ? 13.07693 60.41910  -27.42907 1.000 49.52332  ? 262 GLY B O     1 
ATOM   6197 N  N     . LYS B 2 275 ? 14.32609 62.01184  -26.42288 1.000 49.12437  ? 263 LYS B N     1 
ATOM   6198 C  CA    . LYS B 2 275 ? 14.11154 61.44966  -25.09071 1.000 50.76363  ? 263 LYS B CA    1 
ATOM   6199 C  C     . LYS B 2 275 ? 12.63721 61.48894  -24.68806 1.000 51.56292  ? 263 LYS B C     1 
ATOM   6200 O  O     . LYS B 2 275 ? 12.12292 60.53499  -24.09270 1.000 49.50645  ? 263 LYS B O     1 
ATOM   6201 C  CB    . LYS B 2 275 ? 14.97517 62.19127  -24.07395 1.000 43.67307  ? 263 LYS B CB    1 
ATOM   6202 C  CG    . LYS B 2 275 ? 15.06053 61.51683  -22.71849 1.000 44.83072  ? 263 LYS B CG    1 
ATOM   6203 C  CD    . LYS B 2 275 ? 15.65067 62.47505  -21.69947 1.000 45.77651  ? 263 LYS B CD    1 
ATOM   6204 C  CE    . LYS B 2 275 ? 16.11791 61.78818  -20.43658 1.000 51.43120  ? 263 LYS B CE    1 
ATOM   6205 N  NZ    . LYS B 2 275 ? 17.42989 62.33132  -19.96877 1.000 51.55237  ? 263 LYS B NZ    1 
ATOM   6206 N  N     . LEU B 2 276 ? 11.93478 62.57742  -25.01096 1.000 49.38835  ? 264 LEU B N     1 
ATOM   6207 C  CA    . LEU B 2 276 ? 10.52250 62.65978  -24.65332 1.000 49.10089  ? 264 LEU B CA    1 
ATOM   6208 C  C     . LEU B 2 276 ? 9.66936  61.75389  -25.52738 1.000 48.18782  ? 264 LEU B C     1 
ATOM   6209 O  O     . LEU B 2 276 ? 8.68548  61.17471  -25.05698 1.000 48.22996  ? 264 LEU B O     1 
ATOM   6210 C  CB    . LEU B 2 276 ? 10.02764 64.08947  -24.77863 1.000 52.94353  ? 264 LEU B CB    1 
ATOM   6211 C  CG    . LEU B 2 276 ? 10.48701 65.14929  -23.80583 1.000 47.65871  ? 264 LEU B CG    1 
ATOM   6212 C  CD1   . LEU B 2 276 ? 10.05620 66.45293  -24.41355 1.000 46.68437  ? 264 LEU B CD1   1 
ATOM   6213 C  CD2   . LEU B 2 276 ? 9.85322  64.92155  -22.45630 1.000 47.86344  ? 264 LEU B CD2   1 
ATOM   6214 N  N     . ASN B 2 277 ? 10.00123 61.65483  -26.81122 1.000 48.37888  ? 265 ASN B N     1 
ATOM   6215 C  CA    . ASN B 2 277 ? 9.32534  60.70188  -27.68086 1.000 52.21459  ? 265 ASN B CA    1 
ATOM   6216 C  C     . ASN B 2 277 ? 9.40795  59.29957  -27.10547 1.000 53.57430  ? 265 ASN B C     1 
ATOM   6217 O  O     . ASN B 2 277 ? 8.40942  58.57094  -27.07001 1.000 52.85220  ? 265 ASN B O     1 
ATOM   6218 C  CB    . ASN B 2 277 ? 9.94388  60.74824  -29.07477 1.000 50.95312  ? 265 ASN B CB    1 
ATOM   6219 C  CG    . ASN B 2 277 ? 9.27207  59.82078  -30.03455 1.000 49.15571  ? 265 ASN B CG    1 
ATOM   6220 O  OD1   . ASN B 2 277 ? 8.10831  60.00567  -30.37628 1.000 51.52259  ? 265 ASN B OD1   1 
ATOM   6221 N  ND2   . ASN B 2 277 ? 10.00776 58.82477  -30.50356 1.000 52.39852  ? 265 ASN B ND2   1 
ATOM   6222 N  N     . TRP B 2 278 ? 10.58858 58.91126  -26.62155 1.000 54.01849  ? 266 TRP B N     1 
ATOM   6223 C  CA    . TRP B 2 278 ? 10.70577 57.60241  -25.98550 1.000 54.24402  ? 266 TRP B CA    1 
ATOM   6224 C  C     . TRP B 2 278 ? 9.85782  57.52695  -24.72216 1.000 55.07533  ? 266 TRP B C     1 
ATOM   6225 O  O     . TRP B 2 278 ? 9.05958  56.59832  -24.55343 1.000 57.06596  ? 266 TRP B O     1 
ATOM   6226 C  CB    . TRP B 2 278 ? 12.16594 57.29415  -25.67759 1.000 54.60906  ? 266 TRP B CB    1 
ATOM   6227 C  CG    . TRP B 2 278 ? 12.34523 56.10643  -24.82482 1.000 61.20138  ? 266 TRP B CG    1 
ATOM   6228 C  CD1   . TRP B 2 278 ? 12.38059 54.79119  -25.22463 1.000 63.44051  ? 266 TRP B CD1   1 
ATOM   6229 C  CD2   . TRP B 2 278 ? 12.52561 56.10272  -23.40529 1.000 60.23335  ? 266 TRP B CD2   1 
ATOM   6230 N  NE1   . TRP B 2 278 ? 12.57637 53.97455  -24.12913 1.000 63.12377  ? 266 TRP B NE1   1 
ATOM   6231 C  CE2   . TRP B 2 278 ? 12.66715 54.75381  -23.00378 1.000 57.73114  ? 266 TRP B CE2   1 
ATOM   6232 C  CE3   . TRP B 2 278 ? 12.58933 57.11048  -22.43470 1.000 57.31655  ? 266 TRP B CE3   1 
ATOM   6233 C  CZ2   . TRP B 2 278 ? 12.86166 54.39273  -21.67878 1.000 59.04912  ? 266 TRP B CZ2   1 
ATOM   6234 C  CZ3   . TRP B 2 278 ? 12.78864 56.75419  -21.11965 1.000 55.70284  ? 266 TRP B CZ3   1 
ATOM   6235 C  CH2   . TRP B 2 278 ? 12.91831 55.40614  -20.75051 1.000 66.41165  ? 266 TRP B CH2   1 
ATOM   6236 N  N     . ALA B 2 279 ? 9.99895  58.51085  -23.83096 1.000 53.27453  ? 267 ALA B N     1 
ATOM   6237 C  CA    . ALA B 2 279 ? 9.30762  58.45326  -22.54709 1.000 50.86229  ? 267 ALA B CA    1 
ATOM   6238 C  C     . ALA B 2 279 ? 7.78951  58.51886  -22.68629 1.000 51.31725  ? 267 ALA B C     1 
ATOM   6239 O  O     . ALA B 2 279 ? 7.07809  58.19092  -21.73466 1.000 51.80034  ? 267 ALA B O     1 
ATOM   6240 C  CB    . ALA B 2 279 ? 9.80799  59.57503  -21.62817 1.000 44.99718  ? 267 ALA B CB    1 
ATOM   6241 N  N     . SER B 2 280 ? 7.27095  58.93683  -23.83708 1.000 51.51854  ? 268 SER B N     1 
ATOM   6242 C  CA    . SER B 2 280 ? 5.82114  58.97595  -23.98863 1.000 56.34252  ? 268 SER B CA    1 
ATOM   6243 C  C     . SER B 2 280 ? 5.19636  57.57992  -24.00314 1.000 56.20655  ? 268 SER B C     1 
ATOM   6244 O  O     . SER B 2 280 ? 3.98324  57.45001  -23.79169 1.000 52.53098  ? 268 SER B O     1 
ATOM   6245 C  CB    . SER B 2 280 ? 5.44806  59.75947  -25.25244 1.000 51.31639  ? 268 SER B CB    1 
ATOM   6246 O  OG    . SER B 2 280 ? 6.01307  59.18316  -26.40610 1.000 46.04011  ? 268 SER B OG    1 
ATOM   6247 N  N     . GLN B 2 281 ? 5.99698  56.53869  -24.23460 1.000 55.98107  ? 269 GLN B N     1 
ATOM   6248 C  CA    . GLN B 2 281 ? 5.51815  55.16520  -24.14246 1.000 56.24041  ? 269 GLN B CA    1 
ATOM   6249 C  C     . GLN B 2 281 ? 5.34510  54.70241  -22.70288 1.000 56.86092  ? 269 GLN B C     1 
ATOM   6250 O  O     . GLN B 2 281 ? 4.60705  53.74826  -22.45103 1.000 63.47804  ? 269 GLN B O     1 
ATOM   6251 C  CB    . GLN B 2 281 ? 6.48141  54.23000  -24.86177 1.000 59.06932  ? 269 GLN B CB    1 
ATOM   6252 C  CG    . GLN B 2 281 ? 6.65702  54.51133  -26.34063 1.000 61.76963  ? 269 GLN B CG    1 
ATOM   6253 C  CD    . GLN B 2 281 ? 7.88467  53.81775  -26.89102 1.000 67.45892  ? 269 GLN B CD    1 
ATOM   6254 O  OE1   . GLN B 2 281 ? 8.99776  54.04468  -26.41025 1.000 69.17654  ? 269 GLN B OE1   1 
ATOM   6255 N  NE2   . GLN B 2 281 ? 7.69172  52.94982  -27.88378 1.000 67.70528  ? 269 GLN B NE2   1 
ATOM   6256 N  N     . ILE B 2 282 ? 6.02204  55.34109  -21.76217 1.000 56.80624  ? 270 ILE B N     1 
ATOM   6257 C  CA    . ILE B 2 282 ? 5.78639  55.09637  -20.34677 1.000 59.01255  ? 270 ILE B CA    1 
ATOM   6258 C  C     . ILE B 2 282 ? 4.78773  56.09574  -19.77116 1.000 62.23327  ? 270 ILE B C     1 
ATOM   6259 O  O     . ILE B 2 282 ? 3.97636  55.74845  -18.91313 1.000 68.95312  ? 270 ILE B O     1 
ATOM   6260 C  CB    . ILE B 2 282 ? 7.12801  55.13925  -19.59265 1.000 60.54018  ? 270 ILE B CB    1 
ATOM   6261 C  CG1   . ILE B 2 282 ? 8.08992  54.09979  -20.16726 1.000 55.42648  ? 270 ILE B CG1   1 
ATOM   6262 C  CG2   . ILE B 2 282 ? 6.92030  54.97015  -18.08451 1.000 58.79885  ? 270 ILE B CG2   1 
ATOM   6263 C  CD1   . ILE B 2 282 ? 9.49122  54.22824  -19.61672 1.000 61.05146  ? 270 ILE B CD1   1 
ATOM   6264 N  N     . TYR B 2 283 ? 4.82021  57.34361  -20.22319 1.000 58.04864  ? 271 TYR B N     1 
ATOM   6265 C  CA    . TYR B 2 283 ? 3.88441  58.36469  -19.75929 1.000 59.10759  ? 271 TYR B CA    1 
ATOM   6266 C  C     . TYR B 2 283 ? 3.14361  58.96933  -20.94522 1.000 63.74858  ? 271 TYR B C     1 
ATOM   6267 O  O     . TYR B 2 283 ? 3.71396  59.79182  -21.68552 1.000 63.25202  ? 271 TYR B O     1 
ATOM   6268 C  CB    . TYR B 2 283 ? 4.61600  59.45661  -18.99090 1.000 63.14651  ? 271 TYR B CB    1 
ATOM   6269 C  CG    . TYR B 2 283 ? 5.40434  58.99132  -17.79641 1.000 66.48831  ? 271 TYR B CG    1 
ATOM   6270 C  CD1   . TYR B 2 283 ? 4.85030  59.02464  -16.52498 1.000 71.12245  ? 271 TYR B CD1   1 
ATOM   6271 C  CD2   . TYR B 2 283 ? 6.72163  58.56468  -17.92900 1.000 63.90923  ? 271 TYR B CD2   1 
ATOM   6272 C  CE1   . TYR B 2 283 ? 5.57423  58.62464  -15.41953 1.000 72.84763  ? 271 TYR B CE1   1 
ATOM   6273 C  CE2   . TYR B 2 283 ? 7.45935  58.16566  -16.82612 1.000 62.35755  ? 271 TYR B CE2   1 
ATOM   6274 C  CZ    . TYR B 2 283 ? 6.87573  58.19380  -15.57415 1.000 71.27016  ? 271 TYR B CZ    1 
ATOM   6275 O  OH    . TYR B 2 283 ? 7.58652  57.79084  -14.46648 1.000 74.92444  ? 271 TYR B OH    1 
ATOM   6276 N  N     . PRO B 2 284 ? 1.87028  58.62775  -21.15870 1.000 65.09788  ? 272 PRO B N     1 
ATOM   6277 C  CA    . PRO B 2 284 ? 1.13463  59.22706  -22.27955 1.000 64.06673  ? 272 PRO B CA    1 
ATOM   6278 C  C     . PRO B 2 284 ? 0.86551  60.71168  -22.10127 1.000 66.24418  ? 272 PRO B C     1 
ATOM   6279 O  O     . PRO B 2 284 ? 0.37794  61.34998  -23.04252 1.000 69.81795  ? 272 PRO B O     1 
ATOM   6280 C  CB    . PRO B 2 284 ? -0.17202 58.42305  -22.31388 1.000 66.59381  ? 272 PRO B CB    1 
ATOM   6281 C  CG    . PRO B 2 284 ? 0.08543  57.20035  -21.46359 1.000 63.71783  ? 272 PRO B CG    1 
ATOM   6282 C  CD    . PRO B 2 284 ? 1.04689  57.65654  -20.42318 1.000 66.33444  ? 272 PRO B CD    1 
ATOM   6283 N  N     . GLY B 2 285 ? 1.16124  61.28026  -20.93242 1.000 67.12970  ? 273 GLY B N     1 
ATOM   6284 C  CA    . GLY B 2 285 ? 1.03909  62.71774  -20.77587 1.000 71.16804  ? 273 GLY B CA    1 
ATOM   6285 C  C     . GLY B 2 285 ? 2.00737  63.49070  -21.65105 1.000 72.27918  ? 273 GLY B C     1 
ATOM   6286 O  O     . GLY B 2 285 ? 1.70603  64.61303  -22.07462 1.000 74.46593  ? 273 GLY B O     1 
ATOM   6287 N  N     . ILE B 2 286 ? 3.16764  62.89503  -21.95177 1.000 69.52659  ? 274 ILE B N     1 
ATOM   6288 C  CA    . ILE B 2 286 ? 4.24322  63.61100  -22.62786 1.000 63.93550  ? 274 ILE B CA    1 
ATOM   6289 C  C     . ILE B 2 286 ? 3.81069  64.05082  -24.01664 1.000 60.85040  ? 274 ILE B C     1 
ATOM   6290 O  O     . ILE B 2 286 ? 3.18773  63.28946  -24.76188 1.000 63.52910  ? 274 ILE B O     1 
ATOM   6291 C  CB    . ILE B 2 286 ? 5.48752  62.71211  -22.70594 1.000 64.08008  ? 274 ILE B CB    1 
ATOM   6292 C  CG1   . ILE B 2 286 ? 5.92237  62.24986  -21.30498 1.000 62.75327  ? 274 ILE B CG1   1 
ATOM   6293 C  CG2   . ILE B 2 286 ? 6.60444  63.40328  -23.47336 1.000 58.11628  ? 274 ILE B CG2   1 
ATOM   6294 C  CD1   . ILE B 2 286 ? 6.30749  63.36573  -20.37419 1.000 62.30735  ? 274 ILE B CD1   1 
ATOM   6295 N  N     . LYS B 2 287 ? 4.15100  65.28660  -24.37707 1.000 61.74013  ? 275 LYS B N     1 
ATOM   6296 C  CA    . LYS B 2 287 ? 3.88185  65.79749  -25.71410 1.000 65.88740  ? 275 LYS B CA    1 
ATOM   6297 C  C     . LYS B 2 287 ? 5.08847  66.58842  -26.20870 1.000 65.06281  ? 275 LYS B C     1 
ATOM   6298 O  O     . LYS B 2 287 ? 5.76066  67.25866  -25.41982 1.000 61.50690  ? 275 LYS B O     1 
ATOM   6299 C  CB    . LYS B 2 287 ? 2.61676  66.66965  -25.73132 1.000 63.36238  ? 275 LYS B CB    1 
ATOM   6300 N  N     . VAL B 2 288 ? 5.36320  66.50289  -27.51444 1.000 63.45289  ? 276 VAL B N     1 
ATOM   6301 C  CA    . VAL B 2 288 ? 6.53686  67.12660  -28.11691 1.000 63.13317  ? 276 VAL B CA    1 
ATOM   6302 C  C     . VAL B 2 288 ? 6.16618  68.04583  -29.27746 1.000 64.11168  ? 276 VAL B C     1 
ATOM   6303 O  O     . VAL B 2 288 ? 6.99228  68.30659  -30.13571 1.000 65.50565  ? 276 VAL B O     1 
ATOM   6304 C  CB    . VAL B 2 288 ? 7.55890  66.07229  -28.58592 1.000 59.75933  ? 276 VAL B CB    1 
ATOM   6305 C  CG1   . VAL B 2 288 ? 8.03183  65.23936  -27.42713 1.000 58.70620  ? 276 VAL B CG1   1 
ATOM   6306 C  CG2   . VAL B 2 288 ? 6.96845  65.19802  -29.68075 1.000 50.02754  ? 276 VAL B CG2   1 
ATOM   6307 N  N     . ARG B 2 289 ? 4.93080  68.54271  -29.32028 1.000 70.24224  ? 277 ARG B N     1 
ATOM   6308 C  CA    . ARG B 2 289 ? 4.49133  69.29308  -30.49437 1.000 70.11330  ? 277 ARG B CA    1 
ATOM   6309 C  C     . ARG B 2 289 ? 5.23984  70.61866  -30.61891 1.000 62.63758  ? 277 ARG B C     1 
ATOM   6310 O  O     . ARG B 2 289 ? 5.84058  70.90327  -31.65921 1.000 56.51136  ? 277 ARG B O     1 
ATOM   6311 C  CB    . ARG B 2 289 ? 2.97697  69.51592  -30.43744 1.000 74.87067  ? 277 ARG B CB    1 
ATOM   6312 C  CG    . ARG B 2 289 ? 2.31774  69.82532  -31.78414 1.000 80.92962  ? 277 ARG B CG    1 
ATOM   6313 C  CD    . ARG B 2 289 ? 1.87652  68.56221  -32.51555 1.000 89.35287  ? 277 ARG B CD    1 
ATOM   6314 N  NE    . ARG B 2 289 ? 0.92236  68.85146  -33.59020 1.000 94.99282  ? 277 ARG B NE    1 
ATOM   6315 C  CZ    . ARG B 2 289 ? 0.44971  67.93765  -34.43909 1.000 95.90776  ? 277 ARG B CZ    1 
ATOM   6316 N  NH1   . ARG B 2 289 ? -0.41689 68.29100  -35.38631 1.000 84.15962  ? 277 ARG B NH1   1 
ATOM   6317 N  NH2   . ARG B 2 289 ? 0.84805  66.66852  -34.34529 1.000 86.96791  ? 277 ARG B NH2   1 
ATOM   6318 N  N     . GLN B 2 290 ? 5.23357  71.43271  -29.55940 1.000 62.69143  ? 278 GLN B N     1 
ATOM   6319 C  CA    . GLN B 2 290 ? 5.79043  72.78358  -29.64961 1.000 66.99301  ? 278 GLN B CA    1 
ATOM   6320 C  C     . GLN B 2 290 ? 7.31830  72.76438  -29.68924 1.000 64.93279  ? 278 GLN B C     1 
ATOM   6321 O  O     . GLN B 2 290 ? 7.94939  73.48104  -30.48958 1.000 61.43157  ? 278 GLN B O     1 
ATOM   6322 C  CB    . GLN B 2 290 ? 5.29160  73.62932  -28.47351 1.000 69.54418  ? 278 GLN B CB    1 
ATOM   6323 C  CG    . GLN B 2 290 ? 3.76296  73.72423  -28.35406 1.000 74.29007  ? 278 GLN B CG    1 
ATOM   6324 C  CD    . GLN B 2 290 ? 3.08509  74.29482  -29.60232 1.000 78.62175  ? 278 GLN B CD    1 
ATOM   6325 O  OE1   . GLN B 2 290 ? 3.50886  75.31900  -30.14483 1.000 74.65127  ? 278 GLN B OE1   1 
ATOM   6326 N  NE2   . GLN B 2 290 ? 2.02464  73.62520  -30.06147 1.000 76.87846  ? 278 GLN B NE2   1 
ATOM   6327 N  N     . LEU B 2 291 ? 7.93076  71.96797  -28.80916 1.000 64.43913  ? 279 LEU B N     1 
ATOM   6328 C  CA    . LEU B 2 291 ? 9.37794  71.80081  -28.84388 1.000 56.53361  ? 279 LEU B CA    1 
ATOM   6329 C  C     . LEU B 2 291 ? 9.84103  71.39056  -30.22733 1.000 55.26372  ? 279 LEU B C     1 
ATOM   6330 O  O     . LEU B 2 291 ? 10.84749 71.89940  -30.73320 1.000 59.09745  ? 279 LEU B O     1 
ATOM   6331 C  CB    . LEU B 2 291 ? 9.80554  70.76800  -27.80915 1.000 54.55654  ? 279 LEU B CB    1 
ATOM   6332 C  CG    . LEU B 2 291 ? 9.82295  71.28754  -26.37941 1.000 53.38175  ? 279 LEU B CG    1 
ATOM   6333 C  CD1   . LEU B 2 291 ? 9.90987  70.14918  -25.38753 1.000 48.69067  ? 279 LEU B CD1   1 
ATOM   6334 C  CD2   . LEU B 2 291 ? 10.98283 72.25483  -26.22290 1.000 47.50681  ? 279 LEU B CD2   1 
ATOM   6335 N  N     . SER B 2 292 ? 9.10486  70.48537  -30.86501 1.000 55.07931  ? 280 SER B N     1 
ATOM   6336 C  CA    . SER B 2 292 ? 9.47021  70.07238  -32.20992 1.000 54.71746  ? 280 SER B CA    1 
ATOM   6337 C  C     . SER B 2 292 ? 9.23499  71.19192  -33.20392 1.000 54.57059  ? 280 SER B C     1 
ATOM   6338 O  O     . SER B 2 292 ? 9.99580  71.33910  -34.16304 1.000 54.35774  ? 280 SER B O     1 
ATOM   6339 C  CB    . SER B 2 292 ? 8.68738  68.82986  -32.61794 1.000 54.92221  ? 280 SER B CB    1 
ATOM   6340 O  OG    . SER B 2 292 ? 8.87391  68.57233  -33.99936 1.000 65.20552  ? 280 SER B OG    1 
ATOM   6341 N  N     . LYS B 2 293 ? 8.17519  71.97982  -32.99499 1.000 62.98299  ? 281 LYS B N     1 
ATOM   6342 C  CA    . LYS B 2 293 ? 7.87464  73.09716  -33.88750 1.000 62.16738  ? 281 LYS B CA    1 
ATOM   6343 C  C     . LYS B 2 293 ? 9.05905  74.04522  -33.97299 1.000 56.69142  ? 281 LYS B C     1 
ATOM   6344 O  O     . LYS B 2 293 ? 9.36249  74.58919  -35.04196 1.000 56.09522  ? 281 LYS B O     1 
ATOM   6345 C  CB    . LYS B 2 293 ? 6.62347  73.83593  -33.39469 1.000 62.72349  ? 281 LYS B CB    1 
ATOM   6346 C  CG    . LYS B 2 293 ? 5.73381  74.41746  -34.49285 1.000 67.63283  ? 281 LYS B CG    1 
ATOM   6347 C  CD    . LYS B 2 293 ? 4.41060  74.92826  -33.91158 1.000 77.90141  ? 281 LYS B CD    1 
ATOM   6348 C  CE    . LYS B 2 293 ? 3.37967  75.29402  -34.99522 1.000 85.13483  ? 281 LYS B CE    1 
ATOM   6349 N  NZ    . LYS B 2 293 ? 3.65919  76.57873  -35.73035 1.000 72.80553  ? 281 LYS B NZ    1 
ATOM   6350 N  N     . LEU B 2 294 ? 9.75314  74.23099  -32.85225 1.000 55.02448  ? 282 LEU B N     1 
ATOM   6351 C  CA    . LEU B 2 294 ? 10.95088 75.06794  -32.83662 1.000 52.79097  ? 282 LEU B CA    1 
ATOM   6352 C  C     . LEU B 2 294 ? 12.01252 74.63906  -33.84600 1.000 56.63598  ? 282 LEU B C     1 
ATOM   6353 O  O     . LEU B 2 294 ? 12.94982 75.40834  -34.08797 1.000 59.94335  ? 282 LEU B O     1 
ATOM   6354 C  CB    . LEU B 2 294 ? 11.58781 75.06296  -31.45237 1.000 55.46807  ? 282 LEU B CB    1 
ATOM   6355 C  CG    . LEU B 2 294 ? 10.83377 75.67555  -30.27942 1.000 59.36513  ? 282 LEU B CG    1 
ATOM   6356 C  CD1   . LEU B 2 294 ? 11.52885 75.24309  -29.01849 1.000 55.18156  ? 282 LEU B CD1   1 
ATOM   6357 C  CD2   . LEU B 2 294 ? 10.78544 77.19416  -30.38144 1.000 50.38653  ? 282 LEU B CD2   1 
ATOM   6358 N  N     . LEU B 2 295 ? 11.90786 73.44417  -34.43099 1.000 59.02769  ? 283 LEU B N     1 
ATOM   6359 C  CA    . LEU B 2 295 ? 12.96082 72.89331  -35.27892 1.000 56.30857  ? 283 LEU B CA    1 
ATOM   6360 C  C     . LEU B 2 295 ? 12.60049 72.83782  -36.75584 1.000 57.57226  ? 283 LEU B C     1 
ATOM   6361 O  O     . LEU B 2 295 ? 13.29760 72.15568  -37.51025 1.000 60.90122  ? 283 LEU B O     1 
ATOM   6362 C  CB    . LEU B 2 295 ? 13.34188 71.48407  -34.82072 1.000 52.78185  ? 283 LEU B CB    1 
ATOM   6363 C  CG    . LEU B 2 295 ? 14.06371 71.39446  -33.48586 1.000 50.96189  ? 283 LEU B CG    1 
ATOM   6364 C  CD1   . LEU B 2 295 ? 14.30893 69.95501  -33.14337 1.000 46.96132  ? 283 LEU B CD1   1 
ATOM   6365 C  CD2   . LEU B 2 295 ? 15.35898 72.15894  -33.58386 1.000 50.25881  ? 283 LEU B CD2   1 
ATOM   6366 N  N     . ARG B 2 296 ? 11.54258 73.51272  -37.19935 1.000 51.89588  ? 284 ARG B N     1 
ATOM   6367 C  CA    . ARG B 2 296 ? 11.24800 73.48628  -38.62555 1.000 54.49695  ? 284 ARG B CA    1 
ATOM   6368 C  C     . ARG B 2 296 ? 12.37977 74.13107  -39.41644 1.000 53.39420  ? 284 ARG B C     1 
ATOM   6369 O  O     . ARG B 2 296 ? 12.97382 75.11776  -38.98119 1.000 53.78264  ? 284 ARG B O     1 
ATOM   6370 C  CB    . ARG B 2 296 ? 9.92474  74.18471  -38.91579 1.000 56.47502  ? 284 ARG B CB    1 
ATOM   6371 C  CG    . ARG B 2 296 ? 8.70937  73.39100  -38.51223 1.000 59.39328  ? 284 ARG B CG    1 
ATOM   6372 C  CD    . ARG B 2 296 ? 7.52075  73.78344  -39.37628 1.000 77.98473  ? 284 ARG B CD    1 
ATOM   6373 N  NE    . ARG B 2 296 ? 6.24017  73.35369  -38.81132 1.000 85.39922  ? 284 ARG B NE    1 
ATOM   6374 C  CZ    . ARG B 2 296 ? 5.51081  74.08620  -37.97213 1.000 77.80719  ? 284 ARG B CZ    1 
ATOM   6375 N  NH1   . ARG B 2 296 ? 5.93913  75.28375  -37.59407 1.000 77.07356  ? 284 ARG B NH1   1 
ATOM   6376 N  NH2   . ARG B 2 296 ? 4.35632  73.62226  -37.50792 1.000 78.72544  ? 284 ARG B NH2   1 
ATOM   6377 N  N     . GLY B 2 297 ? 12.67285 73.56755  -40.58410 1.000 50.78314  ? 285 GLY B N     1 
ATOM   6378 C  CA    . GLY B 2 297 ? 13.80838 73.99457  -41.38300 1.000 47.97116  ? 285 GLY B CA    1 
ATOM   6379 C  C     . GLY B 2 297 ? 14.95091 72.99593  -41.32969 1.000 52.74104  ? 285 GLY B C     1 
ATOM   6380 O  O     . GLY B 2 297 ? 14.80589 71.85275  -40.89286 1.000 52.75775  ? 285 GLY B O     1 
ATOM   6381 N  N     . THR B 2 298 ? 16.12379 73.44542  -41.78985 1.000 50.71957  ? 286 THR B N     1 
ATOM   6382 C  CA    . THR B 2 298 ? 17.33090 72.60948  -41.81178 1.000 44.20061  ? 286 THR B CA    1 
ATOM   6383 C  C     . THR B 2 298 ? 18.47197 73.36037  -41.11960 1.000 42.65987  ? 286 THR B C     1 
ATOM   6384 O  O     . THR B 2 298 ? 19.32317 73.95300  -41.77338 1.000 45.58941  ? 286 THR B O     1 
ATOM   6385 C  CB    . THR B 2 298 ? 17.69470 72.24003  -43.24564 1.000 44.64813  ? 286 THR B CB    1 
ATOM   6386 O  OG1   . THR B 2 298 ? 16.53871 71.73226  -43.92749 1.000 49.24942  ? 286 THR B OG1   1 
ATOM   6387 C  CG2   . THR B 2 298 ? 18.78206 71.18583  -43.25896 1.000 43.84949  ? 286 THR B CG2   1 
ATOM   6388 N  N     . LYS B 2 299 ? 18.52923 73.28321  -39.79790 1.000 44.04247  ? 287 LYS B N     1 
ATOM   6389 C  CA    . LYS B 2 299 ? 19.40635 74.15115  -39.02815 1.000 42.71878  ? 287 LYS B CA    1 
ATOM   6390 C  C     . LYS B 2 299 ? 20.72477 73.46182  -38.67146 1.000 46.83626  ? 287 LYS B C     1 
ATOM   6391 O  O     . LYS B 2 299 ? 20.85299 72.23666  -38.70737 1.000 43.34083  ? 287 LYS B O     1 
ATOM   6392 C  CB    . LYS B 2 299 ? 18.69322 74.62674  -37.75563 1.000 42.79623  ? 287 LYS B CB    1 
ATOM   6393 C  CG    . LYS B 2 299 ? 17.34238 75.27537  -38.01472 1.000 44.30970  ? 287 LYS B CG    1 
ATOM   6394 C  CD    . LYS B 2 299 ? 16.78358 75.92224  -36.75795 1.000 50.61131  ? 287 LYS B CD    1 
ATOM   6395 C  CE    . LYS B 2 299 ? 15.65491 76.89732  -37.08037 1.000 51.52002  ? 287 LYS B CE    1 
ATOM   6396 N  NZ    . LYS B 2 299 ? 16.08477 77.98694  -38.01512 1.000 50.04505  ? 287 LYS B NZ    1 
ATOM   6397 N  N     . ALA B 2 300 ? 21.71549 74.27940  -38.32590 1.000 48.02887  ? 288 ALA B N     1 
ATOM   6398 C  CA    . ALA B 2 300 ? 22.97173 73.75679  -37.81354 1.000 40.07720  ? 288 ALA B CA    1 
ATOM   6399 C  C     . ALA B 2 300 ? 22.77978 73.23123  -36.39676 1.000 38.68970  ? 288 ALA B C     1 
ATOM   6400 O  O     . ALA B 2 300 ? 21.97597 73.75362  -35.62852 1.000 43.62165  ? 288 ALA B O     1 
ATOM   6401 C  CB    . ALA B 2 300 ? 24.03965 74.84754  -37.82718 1.000 40.23095  ? 288 ALA B CB    1 
ATOM   6402 N  N     . LEU B 2 301 ? 23.54034 72.19520  -36.04139 1.000 39.14235  ? 289 LEU B N     1 
ATOM   6403 C  CA    . LEU B 2 301 ? 23.37779 71.59718  -34.72128 1.000 37.46064  ? 289 LEU B CA    1 
ATOM   6404 C  C     . LEU B 2 301 ? 23.71354 72.57677  -33.60374 1.000 37.68541  ? 289 LEU B C     1 
ATOM   6405 O  O     . LEU B 2 301 ? 23.14636 72.48093  -32.51005 1.000 42.72384  ? 289 LEU B O     1 
ATOM   6406 C  CB    . LEU B 2 301 ? 24.22671 70.32761  -34.59679 1.000 35.38714  ? 289 LEU B CB    1 
ATOM   6407 C  CG    . LEU B 2 301 ? 23.77934 69.16243  -35.46973 1.000 35.81163  ? 289 LEU B CG    1 
ATOM   6408 C  CD1   . LEU B 2 301 ? 24.41850 67.84728  -35.04253 1.000 36.07703  ? 289 LEU B CD1   1 
ATOM   6409 C  CD2   . LEU B 2 301 ? 22.29120 69.05224  -35.42338 1.000 35.87504  ? 289 LEU B CD2   1 
ATOM   6410 N  N     . THR B 2 302 ? 24.61233 73.52356  -33.84271 1.000 39.98744  ? 290 THR B N     1 
ATOM   6411 C  CA    . THR B 2 302 ? 25.01320 74.44785  -32.79198 1.000 37.21507  ? 290 THR B CA    1 
ATOM   6412 C  C     . THR B 2 302 ? 24.30641 75.78948  -32.85790 1.000 39.56480  ? 290 THR B C     1 
ATOM   6413 O  O     . THR B 2 302 ? 24.63939 76.68217  -32.07223 1.000 45.05986  ? 290 THR B O     1 
ATOM   6414 C  CB    . THR B 2 302 ? 26.51302 74.67766  -32.83365 1.000 38.64190  ? 290 THR B CB    1 
ATOM   6415 O  OG1   . THR B 2 302 ? 26.88083 75.00987  -34.17441 1.000 42.02580  ? 290 THR B OG1   1 
ATOM   6416 C  CG2   . THR B 2 302 ? 27.25466 73.41474  -32.39134 1.000 41.18402  ? 290 THR B CG2   1 
ATOM   6417 N  N     . GLU B 2 303 ? 23.35196 75.96845  -33.76225 1.000 38.51241  ? 291 GLU B N     1 
ATOM   6418 C  CA    . GLU B 2 303 ? 22.53505 77.17550  -33.72236 1.000 44.32923  ? 291 GLU B CA    1 
ATOM   6419 C  C     . GLU B 2 303 ? 21.76729 77.25945  -32.40136 1.000 43.96023  ? 291 GLU B C     1 
ATOM   6420 O  O     . GLU B 2 303 ? 21.19253 76.26976  -31.94383 1.000 43.41407  ? 291 GLU B O     1 
ATOM   6421 C  CB    . GLU B 2 303 ? 21.57567 77.18348  -34.90871 1.000 45.59036  ? 291 GLU B CB    1 
ATOM   6422 C  CG    . GLU B 2 303 ? 20.74861 78.43686  -35.05577 1.000 46.15326  ? 291 GLU B CG    1 
ATOM   6423 C  CD    . GLU B 2 303 ? 20.03680 78.48343  -36.39810 1.000 56.35451  ? 291 GLU B CD    1 
ATOM   6424 O  OE1   . GLU B 2 303 ? 18.82887 78.83096  -36.41800 1.000 54.55190  ? 291 GLU B OE1   1 
ATOM   6425 O  OE2   . GLU B 2 303 ? 20.69045 78.15596  -37.42644 1.000 56.53130  ? 291 GLU B OE2   1 
ATOM   6426 N  N     . VAL B 2 304 ? 21.77738 78.43915  -31.78241 1.000 40.20966  ? 292 VAL B N     1 
ATOM   6427 C  CA    . VAL B 2 304 ? 21.09927 78.66980  -30.51165 1.000 42.38864  ? 292 VAL B CA    1 
ATOM   6428 C  C     . VAL B 2 304 ? 19.64000 79.01364  -30.78205 1.000 48.70832  ? 292 VAL B C     1 
ATOM   6429 O  O     . VAL B 2 304 ? 19.34353 79.93517  -31.55000 1.000 47.75000  ? 292 VAL B O     1 
ATOM   6430 C  CB    . VAL B 2 304 ? 21.78128 79.78461  -29.70615 1.000 39.48282  ? 292 VAL B CB    1 
ATOM   6431 C  CG1   . VAL B 2 304 ? 20.87926 80.23242  -28.57436 1.000 36.35264  ? 292 VAL B CG1   1 
ATOM   6432 C  CG2   . VAL B 2 304 ? 23.09636 79.29275  -29.13717 1.000 40.82481  ? 292 VAL B CG2   1 
ATOM   6433 N  N     . ILE B 2 305 ? 18.73083 78.28255  -30.14869 1.000 47.54682  ? 293 ILE B N     1 
ATOM   6434 C  CA    . ILE B 2 305 ? 17.29575 78.42567  -30.37877 1.000 46.77788  ? 293 ILE B CA    1 
ATOM   6435 C  C     . ILE B 2 305 ? 16.66394 79.01036  -29.12350 1.000 49.34249  ? 293 ILE B C     1 
ATOM   6436 O  O     . ILE B 2 305 ? 16.82795 78.44716  -28.03310 1.000 52.08922  ? 293 ILE B O     1 
ATOM   6437 C  CB    . ILE B 2 305 ? 16.63292 77.09025  -30.73538 1.000 49.98923  ? 293 ILE B CB    1 
ATOM   6438 C  CG1   . ILE B 2 305 ? 17.13615 76.57820  -32.08749 1.000 48.35561  ? 293 ILE B CG1   1 
ATOM   6439 C  CG2   . ILE B 2 305 ? 15.12247 77.25630  -30.73325 1.000 50.53142  ? 293 ILE B CG2   1 
ATOM   6440 C  CD1   . ILE B 2 305 ? 16.40670 77.16792  -33.27401 1.000 47.50032  ? 293 ILE B CD1   1 
ATOM   6441 N  N     . PRO B 2 306 ? 15.94637 80.12712  -29.22268 1.000 51.87063  ? 294 PRO B N     1 
ATOM   6442 C  CA    . PRO B 2 306 ? 15.21815 80.64747  -28.05968 1.000 53.62370  ? 294 PRO B CA    1 
ATOM   6443 C  C     . PRO B 2 306 ? 13.86110 79.96748  -27.93559 1.000 52.76319  ? 294 PRO B C     1 
ATOM   6444 O  O     . PRO B 2 306 ? 13.13293 79.83236  -28.92151 1.000 51.48316  ? 294 PRO B O     1 
ATOM   6445 C  CB    . PRO B 2 306 ? 15.07558 82.13694  -28.37708 1.000 48.18910  ? 294 PRO B CB    1 
ATOM   6446 C  CG    . PRO B 2 306 ? 15.02918 82.16580  -29.86659 1.000 50.06959  ? 294 PRO B CG    1 
ATOM   6447 C  CD    . PRO B 2 306 ? 15.94068 81.07445  -30.34907 1.000 45.83057  ? 294 PRO B CD    1 
ATOM   6448 N  N     . LEU B 2 307 ? 13.53021 79.53135  -26.71731 1.000 55.88489  ? 295 LEU B N     1 
ATOM   6449 C  CA    . LEU B 2 307 ? 12.30069 78.78279  -26.47981 1.000 57.85093  ? 295 LEU B CA    1 
ATOM   6450 C  C     . LEU B 2 307 ? 11.11271 79.73455  -26.39847 1.000 66.49017  ? 295 LEU B C     1 
ATOM   6451 O  O     . LEU B 2 307 ? 11.14247 80.71035  -25.63971 1.000 65.55818  ? 295 LEU B O     1 
ATOM   6452 C  CB    . LEU B 2 307 ? 12.40256 77.96619  -25.19040 1.000 58.98176  ? 295 LEU B CB    1 
ATOM   6453 C  CG    . LEU B 2 307 ? 13.45933 76.85669  -25.06464 1.000 61.54616  ? 295 LEU B CG    1 
ATOM   6454 C  CD1   . LEU B 2 307 ? 13.40505 76.18409  -23.70494 1.000 59.00912  ? 295 LEU B CD1   1 
ATOM   6455 C  CD2   . LEU B 2 307 ? 13.29300 75.81636  -26.13053 1.000 59.58119  ? 295 LEU B CD2   1 
ATOM   6456 N  N     . THR B 2 308 ? 10.06445 79.44215  -27.17363 1.000 67.21187  ? 296 THR B N     1 
ATOM   6457 C  CA    . THR B 2 308 ? 8.83643  80.22646  -27.14605 1.000 61.21284  ? 296 THR B CA    1 
ATOM   6458 C  C     . THR B 2 308 ? 8.12402  80.03370  -25.81059 1.000 65.81520  ? 296 THR B C     1 
ATOM   6459 O  O     . THR B 2 308 ? 8.55663  79.26579  -24.94559 1.000 68.97453  ? 296 THR B O     1 
ATOM   6460 C  CB    . THR B 2 308 ? 7.90557  79.83611  -28.29801 1.000 61.73950  ? 296 THR B CB    1 
ATOM   6461 O  OG1   . THR B 2 308 ? 7.52460  78.45970  -28.17368 1.000 69.34690  ? 296 THR B OG1   1 
ATOM   6462 C  CG2   . THR B 2 308 ? 8.57029  80.05747  -29.65636 1.000 52.30809  ? 296 THR B CG2   1 
ATOM   6463 N  N     . GLU B 2 309 ? 7.01131  80.75372  -25.63990 1.000 69.99286  ? 297 GLU B N     1 
ATOM   6464 C  CA    . GLU B 2 309 ? 6.17652  80.55773  -24.45678 1.000 72.48118  ? 297 GLU B CA    1 
ATOM   6465 C  C     . GLU B 2 309 ? 5.49750  79.19205  -24.49561 1.000 69.63359  ? 297 GLU B C     1 
ATOM   6466 O  O     . GLU B 2 309 ? 5.50636  78.45187  -23.50443 1.000 67.23776  ? 297 GLU B O     1 
ATOM   6467 C  CB    . GLU B 2 309 ? 5.13770  81.67877  -24.34448 1.000 73.09237  ? 297 GLU B CB    1 
ATOM   6468 N  N     . GLU B 2 310 ? 4.90860  78.84204  -25.64003 1.000 65.82977  ? 298 GLU B N     1 
ATOM   6469 C  CA    . GLU B 2 310 ? 4.26957  77.53802  -25.79394 1.000 69.48922  ? 298 GLU B CA    1 
ATOM   6470 C  C     . GLU B 2 310 ? 5.23206  76.40595  -25.44985 1.000 73.68590  ? 298 GLU B C     1 
ATOM   6471 O  O     . GLU B 2 310 ? 4.91367  75.52632  -24.63802 1.000 76.93527  ? 298 GLU B O     1 
ATOM   6472 C  CB    . GLU B 2 310 ? 3.75169  77.37043  -27.22959 1.000 75.93069  ? 298 GLU B CB    1 
ATOM   6473 C  CG    . GLU B 2 310 ? 2.75034  78.42979  -27.71371 1.000 79.49776  ? 298 GLU B CG    1 
ATOM   6474 C  CD    . GLU B 2 310 ? 3.37204  79.81000  -27.93315 1.000 77.72090  ? 298 GLU B CD    1 
ATOM   6475 O  OE1   . GLU B 2 310 ? 4.58598  79.98923  -27.65642 1.000 66.38171  ? 298 GLU B OE1   1 
ATOM   6476 O  OE2   . GLU B 2 310 ? 2.62921  80.71806  -28.36817 1.000 79.34082  ? 298 GLU B OE2   1 
ATOM   6477 N  N     . ALA B 2 311 ? 6.41206  76.40361  -26.07877 1.000 68.87424  ? 299 ALA B N     1 
ATOM   6478 C  CA    . ALA B 2 311 ? 7.36633  75.32635  -25.84888 1.000 66.98793  ? 299 ALA B CA    1 
ATOM   6479 C  C     . ALA B 2 311 ? 7.82357  75.29775  -24.40036 1.000 65.29506  ? 299 ALA B C     1 
ATOM   6480 O  O     . ALA B 2 311 ? 8.01881  74.22264  -23.82289 1.000 68.42147  ? 299 ALA B O     1 
ATOM   6481 C  CB    . ALA B 2 311 ? 8.55895  75.47925  -26.78572 1.000 67.61447  ? 299 ALA B CB    1 
ATOM   6482 N  N     . GLU B 2 312 ? 8.00225  76.47055  -23.79742 1.000 67.71056  ? 300 GLU B N     1 
ATOM   6483 C  CA    . GLU B 2 312 ? 8.40664  76.52360  -22.39889 1.000 70.49478  ? 300 GLU B CA    1 
ATOM   6484 C  C     . GLU B 2 312 ? 7.33636  75.90660  -21.51033 1.000 69.42652  ? 300 GLU B C     1 
ATOM   6485 O  O     . GLU B 2 312 ? 7.64229  75.15268  -20.57304 1.000 72.95938  ? 300 GLU B O     1 
ATOM   6486 C  CB    . GLU B 2 312 ? 8.68394  77.97369  -22.00549 1.000 68.67919  ? 300 GLU B CB    1 
ATOM   6487 C  CG    . GLU B 2 312 ? 9.56653  78.15899  -20.78734 1.000 77.22497  ? 300 GLU B CG    1 
ATOM   6488 C  CD    . GLU B 2 312 ? 11.04002 77.93941  -21.07836 1.000 77.44293  ? 300 GLU B CD    1 
ATOM   6489 O  OE1   . GLU B 2 312 ? 11.51554 76.80883  -20.85205 1.000 83.85592  ? 300 GLU B OE1   1 
ATOM   6490 O  OE2   . GLU B 2 312 ? 11.72484 78.89303  -21.52022 1.000 74.56255  ? 300 GLU B OE2   1 
ATOM   6491 N  N     . LEU B 2 313 ? 6.06958  76.19581  -21.81067 1.000 69.25475  ? 301 LEU B N     1 
ATOM   6492 C  CA    . LEU B 2 313 ? 4.97325  75.57425  -21.07938 1.000 71.42889  ? 301 LEU B CA    1 
ATOM   6493 C  C     . LEU B 2 313 ? 5.01619  74.06341  -21.23414 1.000 71.55097  ? 301 LEU B C     1 
ATOM   6494 O  O     . LEU B 2 313 ? 4.97388  73.32784  -20.24030 1.000 70.70457  ? 301 LEU B O     1 
ATOM   6495 C  CB    . LEU B 2 313 ? 3.63024  76.12631  -21.56262 1.000 69.03054  ? 301 LEU B CB    1 
ATOM   6496 N  N     . GLU B 2 314 ? 5.08364  73.59191  -22.48366 1.000 68.49477  ? 302 GLU B N     1 
ATOM   6497 C  CA    . GLU B 2 314 ? 5.13685  72.16027  -22.76133 1.000 62.78999  ? 302 GLU B CA    1 
ATOM   6498 C  C     . GLU B 2 314 ? 6.24587  71.48338  -21.96935 1.000 66.46817  ? 302 GLU B C     1 
ATOM   6499 O  O     . GLU B 2 314 ? 6.05584  70.38861  -21.41856 1.000 67.90292  ? 302 GLU B O     1 
ATOM   6500 C  CB    . GLU B 2 314 ? 5.33603  71.93776  -24.25731 1.000 62.54762  ? 302 GLU B CB    1 
ATOM   6501 C  CG    . GLU B 2 314 ? 5.09892  70.50912  -24.71721 1.000 64.63864  ? 302 GLU B CG    1 
ATOM   6502 C  CD    . GLU B 2 314 ? 5.26949  70.35186  -26.22135 1.000 69.37699  ? 302 GLU B CD    1 
ATOM   6503 O  OE1   . GLU B 2 314 ? 6.37757  70.63401  -26.73324 1.000 70.10093  ? 302 GLU B OE1   1 
ATOM   6504 O  OE2   . GLU B 2 314 ? 4.29386  69.96190  -26.89818 1.000 71.19730  ? 302 GLU B OE2   1 
ATOM   6505 N  N     . LEU B 2 315 ? 7.41093  72.12961  -21.89223 1.000 62.88371  ? 303 LEU B N     1 
ATOM   6506 C  CA    . LEU B 2 315 ? 8.52936  71.54473  -21.16831 1.000 61.69765  ? 303 LEU B CA    1 
ATOM   6507 C  C     . LEU B 2 315 ? 8.24808  71.47556  -19.67451 1.000 65.76933  ? 303 LEU B C     1 
ATOM   6508 O  O     . LEU B 2 315 ? 8.55466  70.46707  -19.02742 1.000 69.62218  ? 303 LEU B O     1 
ATOM   6509 C  CB    . LEU B 2 315 ? 9.80592  72.33555  -21.44318 1.000 64.48195  ? 303 LEU B CB    1 
ATOM   6510 C  CG    . LEU B 2 315 ? 11.04265 71.82050  -20.69790 1.000 64.18062  ? 303 LEU B CG    1 
ATOM   6511 C  CD1   . LEU B 2 315 ? 11.23136 70.33000  -20.90517 1.000 58.76670  ? 303 LEU B CD1   1 
ATOM   6512 C  CD2   . LEU B 2 315 ? 12.26798 72.57070  -21.14723 1.000 61.02070  ? 303 LEU B CD2   1 
ATOM   6513 N  N     . ALA B 2 316 ? 7.65933  72.52597  -19.10075 1.000 69.37264  ? 304 ALA B N     1 
ATOM   6514 C  CA    . ALA B 2 316 ? 7.36351  72.46255  -17.66873 1.000 74.30798  ? 304 ALA B CA    1 
ATOM   6515 C  C     . ALA B 2 316 ? 6.28718  71.41248  -17.37148 1.000 73.15104  ? 304 ALA B C     1 
ATOM   6516 O  O     . ALA B 2 316 ? 6.37122  70.67724  -16.37344 1.000 64.88678  ? 304 ALA B O     1 
ATOM   6517 C  CB    . ALA B 2 316 ? 6.95408  73.84314  -17.15940 1.000 70.74136  ? 304 ALA B CB    1 
ATOM   6518 N  N     . GLU B 2 317 ? 5.28394  71.30947  -18.24643 1.000 70.90601  ? 305 GLU B N     1 
ATOM   6519 C  CA    . GLU B 2 317 ? 4.25496  70.28721  -18.09008 1.000 73.46278  ? 305 GLU B CA    1 
ATOM   6520 C  C     . GLU B 2 317 ? 4.87150  68.89673  -18.10256 1.000 73.47405  ? 305 GLU B C     1 
ATOM   6521 O  O     . GLU B 2 317 ? 4.72957  68.14104  -17.13768 1.000 72.05697  ? 305 GLU B O     1 
ATOM   6522 C  CB    . GLU B 2 317 ? 3.19300  70.42065  -19.18380 1.000 76.61380  ? 305 GLU B CB    1 
ATOM   6523 C  CG    . GLU B 2 317 ? 2.23146  71.58108  -18.96837 1.000 80.94926  ? 305 GLU B CG    1 
ATOM   6524 C  CD    . GLU B 2 317 ? 0.97376  71.47654  -19.82190 1.000 96.23430  ? 305 GLU B CD    1 
ATOM   6525 O  OE1   . GLU B 2 317 ? 1.01665  70.82587  -20.89606 1.000 92.65899  ? 305 GLU B OE1   1 
ATOM   6526 O  OE2   . GLU B 2 317 ? -0.06256 72.04739  -19.41028 1.000 100.87463 ? 305 GLU B OE2   1 
ATOM   6527 N  N     . ASN B 2 318 ? 5.57608  68.54914  -19.19044 1.000 73.07548  ? 306 ASN B N     1 
ATOM   6528 C  CA    . ASN B 2 318 ? 6.28951  67.27368  -19.24792 1.000 64.96670  ? 306 ASN B CA    1 
ATOM   6529 C  C     . ASN B 2 318 ? 7.13189  67.04720  -17.99965 1.000 67.61096  ? 306 ASN B C     1 
ATOM   6530 O  O     . ASN B 2 318 ? 7.18151  65.93496  -17.46852 1.000 71.87479  ? 306 ASN B O     1 
ATOM   6531 C  CB    . ASN B 2 318 ? 7.18751  67.22021  -20.48077 1.000 61.02535  ? 306 ASN B CB    1 
ATOM   6532 C  CG    . ASN B 2 318 ? 6.41827  67.26752  -21.77639 1.000 63.98498  ? 306 ASN B CG    1 
ATOM   6533 O  OD1   . ASN B 2 318 ? 5.32905  66.70493  -21.89972 1.000 67.14371  ? 306 ASN B OD1   1 
ATOM   6534 N  ND2   . ASN B 2 318 ? 6.99503  67.93217  -22.76645 1.000 60.35435  ? 306 ASN B ND2   1 
ATOM   6535 N  N     . ARG B 2 319 ? 7.80728  68.09103  -17.51614 1.000 70.53924  ? 307 ARG B N     1 
ATOM   6536 C  CA    . ARG B 2 319 ? 8.61845  67.94274  -16.31621 1.000 71.58494  ? 307 ARG B CA    1 
ATOM   6537 C  C     . ARG B 2 319 ? 7.76153  67.53411  -15.12647 1.000 74.96677  ? 307 ARG B C     1 
ATOM   6538 O  O     . ARG B 2 319 ? 8.22638  66.80144  -14.24612 1.000 73.85909  ? 307 ARG B O     1 
ATOM   6539 C  CB    . ARG B 2 319 ? 9.35416  69.25223  -16.03137 1.000 73.54353  ? 307 ARG B CB    1 
ATOM   6540 C  CG    . ARG B 2 319 ? 10.83055 69.10714  -15.67734 1.000 76.33303  ? 307 ARG B CG    1 
ATOM   6541 C  CD    . ARG B 2 319 ? 11.48925 70.48557  -15.63291 1.000 77.87476  ? 307 ARG B CD    1 
ATOM   6542 N  NE    . ARG B 2 319 ? 12.79927 70.50942  -16.28102 1.000 77.72903  ? 307 ARG B NE    1 
ATOM   6543 C  CZ    . ARG B 2 319 ? 13.24610 71.53031  -17.01451 1.000 82.58877  ? 307 ARG B CZ    1 
ATOM   6544 N  NH1   . ARG B 2 319 ? 12.48330 72.60980  -17.20639 1.000 76.42481  ? 307 ARG B NH1   1 
ATOM   6545 N  NH2   . ARG B 2 319 ? 14.45328 71.47117  -17.56778 1.000 77.90703  ? 307 ARG B NH2   1 
ATOM   6546 N  N     . GLU B 2 320 ? 6.51009  68.00524  -15.08057 1.000 77.10713  ? 308 GLU B N     1 
ATOM   6547 C  CA    . GLU B 2 320 ? 5.61569  67.61999  -13.98765 1.000 78.44935  ? 308 GLU B CA    1 
ATOM   6548 C  C     . GLU B 2 320 ? 5.04968  66.21468  -14.19081 1.000 80.35913  ? 308 GLU B C     1 
ATOM   6549 O  O     . GLU B 2 320 ? 4.93625  65.44303  -13.23236 1.000 84.36865  ? 308 GLU B O     1 
ATOM   6550 C  CB    . GLU B 2 320 ? 4.48373  68.63591  -13.84479 1.000 75.69707  ? 308 GLU B CB    1 
ATOM   6551 N  N     . ILE B 2 321 ? 4.68823  65.87363  -15.42998 1.000 74.21727  ? 309 ILE B N     1 
ATOM   6552 C  CA    . ILE B 2 321 ? 4.16200  64.54958  -15.75082 1.000 68.99262  ? 309 ILE B CA    1 
ATOM   6553 C  C     . ILE B 2 321 ? 5.12837  63.46069  -15.31365 1.000 77.05705  ? 309 ILE B C     1 
ATOM   6554 O  O     . ILE B 2 321 ? 4.71907  62.40042  -14.82489 1.000 83.77106  ? 309 ILE B O     1 
ATOM   6555 C  CB    . ILE B 2 321 ? 3.86675  64.46113  -17.25578 1.000 67.93756  ? 309 ILE B CB    1 
ATOM   6556 C  CG1   . ILE B 2 321 ? 2.75849  65.44039  -17.61596 1.000 72.97799  ? 309 ILE B CG1   1 
ATOM   6557 C  CG2   . ILE B 2 321 ? 3.51530  63.04461  -17.65650 1.000 70.79369  ? 309 ILE B CG2   1 
ATOM   6558 C  CD1   . ILE B 2 321 ? 2.49936  65.54131  -19.08675 1.000 74.87660  ? 309 ILE B CD1   1 
ATOM   6559 N  N     . LEU B 2 322 ? 6.42620  63.69594  -15.48577 1.000 73.18648  ? 310 LEU B N     1 
ATOM   6560 C  CA    . LEU B 2 322 ? 7.39990  62.68813  -15.09409 1.000 74.48475  ? 310 LEU B CA    1 
ATOM   6561 C  C     . LEU B 2 322 ? 7.50719  62.52402  -13.58264 1.000 78.98771  ? 310 LEU B C     1 
ATOM   6562 O  O     . LEU B 2 322 ? 8.20581  61.60820  -13.12936 1.000 74.07054  ? 310 LEU B O     1 
ATOM   6563 C  CB    . LEU B 2 322 ? 8.76613  63.03592  -15.67880 1.000 72.62671  ? 310 LEU B CB    1 
ATOM   6564 C  CG    . LEU B 2 322 ? 8.88332  63.01140  -17.19891 1.000 69.70199  ? 310 LEU B CG    1 
ATOM   6565 C  CD1   . LEU B 2 322 ? 10.28806 63.40561  -17.62972 1.000 64.63952  ? 310 LEU B CD1   1 
ATOM   6566 C  CD2   . LEU B 2 322 ? 8.53257  61.63319  -17.71541 1.000 69.24934  ? 310 LEU B CD2   1 
ATOM   6567 N  N     . LYS B 2 323 ? 6.83913  63.38234  -12.79997 1.000 79.95299  ? 311 LYS B N     1 
ATOM   6568 C  CA    . LYS B 2 323 ? 6.83325  63.23596  -11.34611 1.000 85.28165  ? 311 LYS B CA    1 
ATOM   6569 C  C     . LYS B 2 323 ? 5.90818  62.10469  -10.90672 1.000 89.64226  ? 311 LYS B C     1 
ATOM   6570 O  O     . LYS B 2 323 ? 6.33119  61.19157  -10.18429 1.000 90.18116  ? 311 LYS B O     1 
ATOM   6571 C  CB    . LYS B 2 323 ? 6.41297  64.54750  -10.67509 1.000 84.97953  ? 311 LYS B CB    1 
ATOM   6572 C  CG    . LYS B 2 323 ? 7.34745  65.72239  -10.90286 1.000 85.48217  ? 311 LYS B CG    1 
ATOM   6573 C  CD    . LYS B 2 323 ? 7.18589  66.75458  -9.79142  1.000 85.27574  ? 311 LYS B CD    1 
ATOM   6574 C  CE    . LYS B 2 323 ? 7.99712  68.01514  -10.06347 1.000 86.14702  ? 311 LYS B CE    1 
ATOM   6575 N  NZ    . LYS B 2 323 ? 7.32871  68.91419  -11.04969 1.000 93.58229  ? 311 LYS B NZ    1 
ATOM   6576 N  N     . GLU B 2 324 ? 4.63731  62.15826  -11.33863 1.000 86.04297  ? 312 GLU B N     1 
ATOM   6577 C  CA    . GLU B 2 324 ? 3.61177  61.14603  -11.10747 1.000 85.66306  ? 312 GLU B CA    1 
ATOM   6578 C  C     . GLU B 2 324 ? 4.16756  59.74651  -11.34874 1.000 89.64297  ? 312 GLU B C     1 
ATOM   6579 O  O     . GLU B 2 324 ? 5.06869  59.57183  -12.18019 1.000 90.76787  ? 312 GLU B O     1 
ATOM   6580 C  CB    . GLU B 2 324 ? 2.41359  61.39167  -12.02597 1.000 85.13302  ? 312 GLU B CB    1 
ATOM   6581 C  CG    . GLU B 2 324 ? 2.06487  62.85903  -12.22536 1.000 88.73172  ? 312 GLU B CG    1 
ATOM   6582 C  CD    . GLU B 2 324 ? 1.13415  63.07425  -13.40956 1.000 94.91791  ? 312 GLU B CD    1 
ATOM   6583 O  OE1   . GLU B 2 324 ? 0.91465  62.09997  -14.17275 1.000 91.77443  ? 312 GLU B OE1   1 
ATOM   6584 O  OE2   . GLU B 2 324 ? 0.62771  64.21265  -13.57502 1.000 90.18347  ? 312 GLU B OE2   1 
ATOM   6585 N  N     . PRO B 2 325 ? 3.68466  58.73065  -10.64208 1.000 91.02618  ? 313 PRO B N     1 
ATOM   6586 C  CA    . PRO B 2 325 ? 4.15292  57.36903  -10.90756 1.000 83.10362  ? 313 PRO B CA    1 
ATOM   6587 C  C     . PRO B 2 325 ? 3.45743  56.76782  -12.12501 1.000 81.11804  ? 313 PRO B C     1 
ATOM   6588 O  O     . PRO B 2 325 ? 2.41200  57.23898  -12.58461 1.000 76.67253  ? 313 PRO B O     1 
ATOM   6589 C  CB    . PRO B 2 325 ? 3.78652  56.62058  -9.62229  1.000 81.14053  ? 313 PRO B CB    1 
ATOM   6590 C  CG    . PRO B 2 325 ? 2.53208  57.31482  -9.15731  1.000 84.62617  ? 313 PRO B CG    1 
ATOM   6591 C  CD    . PRO B 2 325 ? 2.67372  58.77154  -9.56571  1.000 84.85178  ? 313 PRO B CD    1 
ATOM   6592 N  N     . VAL B 2 326 ? 4.07497  55.70711  -12.65045 1.000 79.60917  ? 314 VAL B N     1 
ATOM   6593 C  CA    . VAL B 2 326 ? 3.49902  54.96740  -13.77215 1.000 77.88497  ? 314 VAL B CA    1 
ATOM   6594 C  C     . VAL B 2 326 ? 2.14915  54.39470  -13.36187 1.000 79.48241  ? 314 VAL B C     1 
ATOM   6595 O  O     . VAL B 2 326 ? 2.04026  53.62833  -12.39528 1.000 79.16240  ? 314 VAL B O     1 
ATOM   6596 C  CB    . VAL B 2 326 ? 4.45128  53.85974  -14.24141 1.000 76.20443  ? 314 VAL B CB    1 
ATOM   6597 C  CG1   . VAL B 2 326 ? 3.87754  53.14081  -15.45691 1.000 67.89911  ? 314 VAL B CG1   1 
ATOM   6598 C  CG2   . VAL B 2 326 ? 5.82254  54.43143  -14.55551 1.000 74.47803  ? 314 VAL B CG2   1 
ATOM   6599 N  N     . HIS B 2 327 ? 1.11594  54.74975  -14.10879 1.000 79.18077  ? 315 HIS B N     1 
ATOM   6600 C  CA    . HIS B 2 327 ? -0.23801 54.32178  -13.80768 1.000 80.58612  ? 315 HIS B CA    1 
ATOM   6601 C  C     . HIS B 2 327 ? -0.54297 52.97585  -14.46128 1.000 77.73651  ? 315 HIS B C     1 
ATOM   6602 O  O     . HIS B 2 327 ? -0.11544 52.70453  -15.58631 1.000 74.07716  ? 315 HIS B O     1 
ATOM   6603 C  CB    . HIS B 2 327 ? -1.22682 55.38806  -14.28228 1.000 82.47068  ? 315 HIS B CB    1 
ATOM   6604 C  CG    . HIS B 2 327 ? -2.65172 54.94112  -14.26946 1.000 84.87611  ? 315 HIS B CG    1 
ATOM   6605 N  ND1   . HIS B 2 327 ? -3.28474 54.44726  -15.39120 1.000 84.48172  ? 315 HIS B ND1   1 
ATOM   6606 C  CD2   . HIS B 2 327 ? -3.56903 54.91503  -13.27394 1.000 81.90102  ? 315 HIS B CD2   1 
ATOM   6607 C  CE1   . HIS B 2 327 ? -4.53261 54.13878  -15.08777 1.000 85.65579  ? 315 HIS B CE1   1 
ATOM   6608 N  NE2   . HIS B 2 327 ? -4.73014 54.41237  -13.80933 1.000 90.72868  ? 315 HIS B NE2   1 
ATOM   6609 N  N     . GLY B 2 328 ? -1.26956 52.12682  -13.73515 1.000 78.64412  ? 316 GLY B N     1 
ATOM   6610 C  CA    . GLY B 2 328 ? -1.81221 50.89880  -14.28573 1.000 71.14672  ? 316 GLY B CA    1 
ATOM   6611 C  C     . GLY B 2 328 ? -0.82217 49.76457  -14.46165 1.000 71.40099  ? 316 GLY B C     1 
ATOM   6612 O  O     . GLY B 2 328 ? -0.72972 49.18289  -15.54888 1.000 68.97883  ? 316 GLY B O     1 
ATOM   6613 N  N     . VAL B 2 329 ? -0.08638 49.41856  -13.40818 1.000 67.52526  ? 317 VAL B N     1 
ATOM   6614 C  CA    . VAL B 2 329 ? 0.93469  48.37860  -13.48375 1.000 67.16185  ? 317 VAL B CA    1 
ATOM   6615 C  C     . VAL B 2 329 ? 0.75314  47.44504  -12.29459 1.000 63.84855  ? 317 VAL B C     1 
ATOM   6616 O  O     . VAL B 2 329 ? 1.05153  47.81697  -11.15384 1.000 66.34023  ? 317 VAL B O     1 
ATOM   6617 C  CB    . VAL B 2 329 ? 2.35246  48.96177  -13.51242 1.000 65.68786  ? 317 VAL B CB    1 
ATOM   6618 C  CG1   . VAL B 2 329 ? 3.36776  47.84982  -13.47329 1.000 62.57431  ? 317 VAL B CG1   1 
ATOM   6619 C  CG2   . VAL B 2 329 ? 2.55125  49.80000  -14.75979 1.000 64.03627  ? 317 VAL B CG2   1 
ATOM   6620 N  N     . TYR B 2 330 ? 0.28362  46.23100  -12.55745 1.000 62.13765  ? 318 TYR B N     1 
ATOM   6621 C  CA    . TYR B 2 330 ? -0.07079 45.28570  -11.50783 1.000 63.61298  ? 318 TYR B CA    1 
ATOM   6622 C  C     . TYR B 2 330 ? 0.82018  44.06073  -11.60046 1.000 54.64100  ? 318 TYR B C     1 
ATOM   6623 O  O     . TYR B 2 330 ? 0.94734  43.46205  -12.67139 1.000 55.62436  ? 318 TYR B O     1 
ATOM   6624 C  CB    . TYR B 2 330 ? -1.54886 44.88779  -11.60999 1.000 61.93968  ? 318 TYR B CB    1 
ATOM   6625 C  CG    . TYR B 2 330 ? -2.47557 46.08674  -11.63071 1.000 68.25151  ? 318 TYR B CG    1 
ATOM   6626 C  CD1   . TYR B 2 330 ? -2.87295 46.65968  -12.83699 1.000 66.57561  ? 318 TYR B CD1   1 
ATOM   6627 C  CD2   . TYR B 2 330 ? -2.93085 46.66449  -10.44256 1.000 67.39048  ? 318 TYR B CD2   1 
ATOM   6628 C  CE1   . TYR B 2 330 ? -3.70822 47.76357  -12.86101 1.000 65.78800  ? 318 TYR B CE1   1 
ATOM   6629 C  CE2   . TYR B 2 330 ? -3.76745 47.75983  -10.45667 1.000 66.13313  ? 318 TYR B CE2   1 
ATOM   6630 C  CZ    . TYR B 2 330 ? -4.15067 48.30758  -11.66781 1.000 70.13729  ? 318 TYR B CZ    1 
ATOM   6631 O  OH    . TYR B 2 330 ? -4.98116 49.40703  -11.69500 1.000 79.14862  ? 318 TYR B OH    1 
ATOM   6632 N  N     . TYR B 2 331 ? 1.42217  43.69217  -10.47537 1.000 53.56137  ? 319 TYR B N     1 
ATOM   6633 C  CA    . TYR B 2 331 ? 2.32192  42.54703  -10.42992 1.000 59.02500  ? 319 TYR B CA    1 
ATOM   6634 C  C     . TYR B 2 331 ? 1.56278  41.24289  -10.67427 1.000 58.13025  ? 319 TYR B C     1 
ATOM   6635 O  O     . TYR B 2 331 ? 0.57622  40.95015  -9.99716  1.000 55.57936  ? 319 TYR B O     1 
ATOM   6636 C  CB    . TYR B 2 331 ? 3.04590  42.52921  -9.08066  1.000 58.40737  ? 319 TYR B CB    1 
ATOM   6637 C  CG    . TYR B 2 331 ? 3.81775  41.27247  -8.75742  1.000 63.73843  ? 319 TYR B CG    1 
ATOM   6638 C  CD1   . TYR B 2 331 ? 4.68617  40.70247  -9.67826  1.000 67.98163  ? 319 TYR B CD1   1 
ATOM   6639 C  CD2   . TYR B 2 331 ? 3.69137  40.66661  -7.51328  1.000 65.09400  ? 319 TYR B CD2   1 
ATOM   6640 C  CE1   . TYR B 2 331 ? 5.39159  39.54648  -9.37136  1.000 68.68523  ? 319 TYR B CE1   1 
ATOM   6641 C  CE2   . TYR B 2 331 ? 4.39171  39.52053  -7.19701  1.000 65.27486  ? 319 TYR B CE2   1 
ATOM   6642 C  CZ    . TYR B 2 331 ? 5.23827  38.96489  -8.12700  1.000 69.41983  ? 319 TYR B CZ    1 
ATOM   6643 O  OH    . TYR B 2 331 ? 5.92872  37.81688  -7.80629  1.000 75.70410  ? 319 TYR B OH    1 
ATOM   6644 N  N     . ASP B 2 332 ? 2.01803  40.47222  -11.67078 1.000 60.37800  ? 320 ASP B N     1 
ATOM   6645 C  CA    . ASP B 2 332 ? 1.49421  39.14334  -11.96735 1.000 65.69572  ? 320 ASP B CA    1 
ATOM   6646 C  C     . ASP B 2 332 ? 2.48679  38.09079  -11.48205 1.000 68.65137  ? 320 ASP B C     1 
ATOM   6647 O  O     . ASP B 2 332 ? 3.56792  37.95056  -12.07557 1.000 66.12807  ? 320 ASP B O     1 
ATOM   6648 C  CB    . ASP B 2 332 ? 1.24474  38.99242  -13.47041 1.000 64.04643  ? 320 ASP B CB    1 
ATOM   6649 C  CG    . ASP B 2 332 ? 0.75613  37.59286  -13.87176 1.000 67.77040  ? 320 ASP B CG    1 
ATOM   6650 O  OD1   . ASP B 2 332 ? 1.01812  36.59763  -13.15882 1.000 65.75904  ? 320 ASP B OD1   1 
ATOM   6651 O  OD2   . ASP B 2 332 ? 0.11285  37.48505  -14.94164 1.000 69.69903  ? 320 ASP B OD2   1 
ATOM   6652 N  N     . PRO B 2 333 ? 2.15334  37.29648  -10.46351 1.000 68.16690  ? 321 PRO B N     1 
ATOM   6653 C  CA    . PRO B 2 333 ? 3.12444  36.30753  -9.96476  1.000 67.70558  ? 321 PRO B CA    1 
ATOM   6654 C  C     . PRO B 2 333 ? 3.40662  35.17364  -10.93909 1.000 68.40868  ? 321 PRO B C     1 
ATOM   6655 O  O     . PRO B 2 333 ? 4.49052  34.58292  -10.87462 1.000 70.52552  ? 321 PRO B O     1 
ATOM   6656 C  CB    . PRO B 2 333 ? 2.46944  35.78718  -8.67773  1.000 66.71276  ? 321 PRO B CB    1 
ATOM   6657 C  CG    . PRO B 2 333 ? 1.39138  36.79572  -8.34950  1.000 73.45536  ? 321 PRO B CG    1 
ATOM   6658 C  CD    . PRO B 2 333 ? 0.92226  37.32650  -9.66189  1.000 64.99042  ? 321 PRO B CD    1 
ATOM   6659 N  N     . SER B 2 334 ? 2.48491  34.84836  -11.84238 1.000 66.97063  ? 322 SER B N     1 
ATOM   6660 C  CA    . SER B 2 334 ? 2.71682  33.74794  -12.77149 1.000 66.16902  ? 322 SER B CA    1 
ATOM   6661 C  C     . SER B 2 334 ? 3.54185  34.15297  -13.98898 1.000 68.26173  ? 322 SER B C     1 
ATOM   6662 O  O     . SER B 2 334 ? 3.54730  33.41846  -14.98388 1.000 67.95523  ? 322 SER B O     1 
ATOM   6663 C  CB    . SER B 2 334 ? 1.38912  33.15201  -13.23736 1.000 65.88058  ? 322 SER B CB    1 
ATOM   6664 O  OG    . SER B 2 334 ? 0.97121  33.73093  -14.46065 1.000 67.60632  ? 322 SER B OG    1 
ATOM   6665 N  N     . LYS B 2 335 ? 4.20264  35.30765  -13.95153 1.000 67.00650  ? 323 LYS B N     1 
ATOM   6666 C  CA    . LYS B 2 335 ? 5.12074  35.73265  -14.99937 1.000 68.92553  ? 323 LYS B CA    1 
ATOM   6667 C  C     . LYS B 2 335 ? 6.45301  36.11607  -14.36330 1.000 68.18675  ? 323 LYS B C     1 
ATOM   6668 O  O     . LYS B 2 335 ? 6.53888  36.38161  -13.15936 1.000 68.19620  ? 323 LYS B O     1 
ATOM   6669 C  CB    . LYS B 2 335 ? 4.55406  36.91214  -15.81184 1.000 70.79999  ? 323 LYS B CB    1 
ATOM   6670 C  CG    . LYS B 2 335 ? 3.25294  36.61426  -16.54558 1.000 68.46749  ? 323 LYS B CG    1 
ATOM   6671 C  CD    . LYS B 2 335 ? 2.78482  37.82582  -17.35447 1.000 70.76922  ? 323 LYS B CD    1 
ATOM   6672 C  CE    . LYS B 2 335 ? 3.81661  38.23478  -18.40904 1.000 73.87068  ? 323 LYS B CE    1 
ATOM   6673 N  NZ    . LYS B 2 335 ? 3.29846  38.16771  -19.81823 1.000 75.98954  ? 323 LYS B NZ    1 
ATOM   6674 N  N     . ASP B 2 336 ? 7.50339  36.14010  -15.17446 1.000 62.50830  ? 324 ASP B N     1 
ATOM   6675 C  CA    . ASP B 2 336 ? 8.82104  36.43058  -14.62514 1.000 65.25259  ? 324 ASP B CA    1 
ATOM   6676 C  C     . ASP B 2 336 ? 9.04053  37.92807  -14.49318 1.000 58.63721  ? 324 ASP B C     1 
ATOM   6677 O  O     . ASP B 2 336 ? 8.56665  38.72398  -15.30668 1.000 58.63786  ? 324 ASP B O     1 
ATOM   6678 C  CB    . ASP B 2 336 ? 9.93052  35.85038  -15.50114 1.000 67.55975  ? 324 ASP B CB    1 
ATOM   6679 C  CG    . ASP B 2 336 ? 9.87510  34.34504  -15.59157 1.000 74.70880  ? 324 ASP B CG    1 
ATOM   6680 O  OD1   . ASP B 2 336 ? 9.80946  33.68056  -14.52383 1.000 72.40641  ? 324 ASP B OD1   1 
ATOM   6681 O  OD2   . ASP B 2 336 ? 9.88991  33.83734  -16.73794 1.000 70.69037  ? 324 ASP B OD2   1 
ATOM   6682 N  N     . LEU B 2 337 ? 9.77838  38.30556  -13.46132 1.000 53.24853  ? 325 LEU B N     1 
ATOM   6683 C  CA    . LEU B 2 337 ? 10.30937 39.65359  -13.38467 1.000 52.01681  ? 325 LEU B CA    1 
ATOM   6684 C  C     . LEU B 2 337 ? 11.48497 39.78392  -14.34448 1.000 53.07143  ? 325 LEU B C     1 
ATOM   6685 O  O     . LEU B 2 337 ? 12.41189 38.96950  -14.32331 1.000 49.98826  ? 325 LEU B O     1 
ATOM   6686 C  CB    . LEU B 2 337 ? 10.75181 39.98353  -11.96228 1.000 50.40170  ? 325 LEU B CB    1 
ATOM   6687 C  CG    . LEU B 2 337 ? 9.67923  39.89305  -10.88046 1.000 55.86244  ? 325 LEU B CG    1 
ATOM   6688 C  CD1   . LEU B 2 337 ? 10.29923 40.10012  -9.49806  1.000 53.11803  ? 325 LEU B CD1   1 
ATOM   6689 C  CD2   . LEU B 2 337 ? 8.57603  40.90481  -11.15371 1.000 52.79417  ? 325 LEU B CD2   1 
ATOM   6690 N  N     . ILE B 2 338 ? 11.42570 40.79171  -15.20407 1.000 50.26512  ? 326 ILE B N     1 
ATOM   6691 C  CA    . ILE B 2 338 ? 12.51934 41.15588  -16.08810 1.000 48.79808  ? 326 ILE B CA    1 
ATOM   6692 C  C     . ILE B 2 338 ? 13.26947 42.31975  -15.46042 1.000 51.50201  ? 326 ILE B C     1 
ATOM   6693 O  O     . ILE B 2 338 ? 12.66589 43.35037  -15.12681 1.000 54.17702  ? 326 ILE B O     1 
ATOM   6694 C  CB    . ILE B 2 338 ? 12.00177 41.54332  -17.48003 1.000 49.95721  ? 326 ILE B CB    1 
ATOM   6695 C  CG1   . ILE B 2 338 ? 11.14126 40.43554  -18.06853 1.000 42.53920  ? 326 ILE B CG1   1 
ATOM   6696 C  CG2   . ILE B 2 338 ? 13.17194 41.87287  -18.39424 1.000 53.54570  ? 326 ILE B CG2   1 
ATOM   6697 C  CD1   . ILE B 2 338 ? 11.93128 39.25232  -18.54182 1.000 46.65304  ? 326 ILE B CD1   1 
ATOM   6698 N  N     . ALA B 2 339 ? 14.57993 42.16771  -15.30278 1.000 49.31590  ? 327 ALA B N     1 
ATOM   6699 C  CA    . ALA B 2 339 ? 15.44981 43.26909  -14.91040 1.000 48.39449  ? 327 ALA B CA    1 
ATOM   6700 C  C     . ALA B 2 339 ? 16.32057 43.66853  -16.09656 1.000 51.67764  ? 327 ALA B C     1 
ATOM   6701 O  O     . ALA B 2 339 ? 16.90113 42.80791  -16.76747 1.000 51.69960  ? 327 ALA B O     1 
ATOM   6702 C  CB    . ALA B 2 339 ? 16.32391 42.89202  -13.71461 1.000 41.44598  ? 327 ALA B CB    1 
ATOM   6703 N  N     . GLU B 2 340 ? 16.37524 44.96206  -16.38530 1.000 47.06358  ? 328 GLU B N     1 
ATOM   6704 C  CA    . GLU B 2 340 ? 17.34587 45.48511  -17.33390 1.000 47.63354  ? 328 GLU B CA    1 
ATOM   6705 C  C     . GLU B 2 340 ? 18.29969 46.41526  -16.60173 1.000 50.14096  ? 328 GLU B C     1 
ATOM   6706 O  O     . GLU B 2 340 ? 17.87687 47.19223  -15.73205 1.000 48.93692  ? 328 GLU B O     1 
ATOM   6707 C  CB    . GLU B 2 340 ? 16.67920 46.22568  -18.49024 1.000 50.88207  ? 328 GLU B CB    1 
ATOM   6708 C  CG    . GLU B 2 340 ? 16.12750 45.32817  -19.57493 1.000 57.81031  ? 328 GLU B CG    1 
ATOM   6709 C  CD    . GLU B 2 340 ? 15.49685 46.11171  -20.71256 1.000 61.17819  ? 328 GLU B CD    1 
ATOM   6710 O  OE1   . GLU B 2 340 ? 15.97386 47.22528  -21.00569 1.000 57.75771  ? 328 GLU B OE1   1 
ATOM   6711 O  OE2   . GLU B 2 340 ? 14.51859 45.61141  -21.31183 1.000 66.94420  ? 328 GLU B OE2   1 
ATOM   6712 N  N     . ILE B 2 341 ? 19.58937 46.30882  -16.93720 1.000 45.05409  ? 329 ILE B N     1 
ATOM   6713 C  CA    . ILE B 2 341 ? 20.61993 47.18832  -16.40344 1.000 45.20987  ? 329 ILE B CA    1 
ATOM   6714 C  C     . ILE B 2 341 ? 21.31951 47.88436  -17.55930 1.000 44.47494  ? 329 ILE B C     1 
ATOM   6715 O  O     . ILE B 2 341 ? 21.57092 47.27574  -18.60458 1.000 46.75791  ? 329 ILE B O     1 
ATOM   6716 C  CB    . ILE B 2 341 ? 21.64043 46.42448  -15.53995 1.000 45.99779  ? 329 ILE B CB    1 
ATOM   6717 C  CG1   . ILE B 2 341 ? 20.92456 45.53190  -14.52666 1.000 43.01829  ? 329 ILE B CG1   1 
ATOM   6718 C  CG2   . ILE B 2 341 ? 22.55969 47.39961  -14.82321 1.000 37.77384  ? 329 ILE B CG2   1 
ATOM   6719 C  CD1   . ILE B 2 341 ? 21.86767 44.68699  -13.72816 1.000 38.45351  ? 329 ILE B CD1   1 
ATOM   6720 N  N     . GLN B 2 342 ? 21.62814 49.16352  -17.36764 1.000 44.49596  ? 330 GLN B N     1 
ATOM   6721 C  CA    . GLN B 2 342 ? 22.43121 49.93622  -18.30800 1.000 43.33334  ? 330 GLN B CA    1 
ATOM   6722 C  C     . GLN B 2 342 ? 23.60379 50.55646  -17.56908 1.000 45.65117  ? 330 GLN B C     1 
ATOM   6723 O  O     . GLN B 2 342 ? 23.41242 51.22085  -16.54187 1.000 49.81699  ? 330 GLN B O     1 
ATOM   6724 C  CB    . GLN B 2 342 ? 21.61698 51.03883  -18.98626 1.000 44.72304  ? 330 GLN B CB    1 
ATOM   6725 C  CG    . GLN B 2 342 ? 20.31222 50.58785  -19.58476 1.000 47.32870  ? 330 GLN B CG    1 
ATOM   6726 C  CD    . GLN B 2 342 ? 19.18915 50.66347  -18.59215 1.000 49.03420  ? 330 GLN B CD    1 
ATOM   6727 O  OE1   . GLN B 2 342 ? 19.22556 51.47479  -17.66731 1.000 47.67782  ? 330 GLN B OE1   1 
ATOM   6728 N  NE2   . GLN B 2 342 ? 18.18528 49.80744  -18.76270 1.000 49.75995  ? 330 GLN B NE2   1 
ATOM   6729 N  N     . LYS B 2 343 ? 24.81125 50.31983  -18.08380 1.000 44.16638  ? 331 LYS B N     1 
ATOM   6730 C  CA    . LYS B 2 343 ? 26.00542 50.98682  -17.58124 1.000 48.94972  ? 331 LYS B CA    1 
ATOM   6731 C  C     . LYS B 2 343 ? 25.97791 52.45963  -17.97987 1.000 47.01152  ? 331 LYS B C     1 
ATOM   6732 O  O     . LYS B 2 343 ? 25.93106 52.77994  -19.16947 1.000 49.49997  ? 331 LYS B O     1 
ATOM   6733 C  CB    . LYS B 2 343 ? 27.25035 50.29847  -18.13294 1.000 47.96632  ? 331 LYS B CB    1 
ATOM   6734 C  CG    . LYS B 2 343 ? 28.48768 51.17560  -18.17250 1.000 47.70201  ? 331 LYS B CG    1 
ATOM   6735 C  CD    . LYS B 2 343 ? 29.66263 50.39845  -18.69011 1.000 47.01757  ? 331 LYS B CD    1 
ATOM   6736 C  CE    . LYS B 2 343 ? 30.92204 51.22756  -18.70349 1.000 47.11556  ? 331 LYS B CE    1 
ATOM   6737 N  NZ    . LYS B 2 343 ? 32.01578 50.49972  -19.40011 1.000 50.19571  ? 331 LYS B NZ    1 
ATOM   6738 N  N     . GLN B 2 344 ? 25.97478 53.36046  -16.99703 1.000 48.92370  ? 332 GLN B N     1 
ATOM   6739 C  CA    . GLN B 2 344 ? 25.96170 54.79041  -17.26806 1.000 54.40484  ? 332 GLN B CA    1 
ATOM   6740 C  C     . GLN B 2 344 ? 27.34469 55.41865  -17.24917 1.000 57.59066  ? 332 GLN B C     1 
ATOM   6741 O  O     . GLN B 2 344 ? 27.46835 56.59746  -17.58056 1.000 60.08601  ? 332 GLN B O     1 
ATOM   6742 C  CB    . GLN B 2 344 ? 25.07780 55.52191  -16.24973 1.000 55.75352  ? 332 GLN B CB    1 
ATOM   6743 C  CG    . GLN B 2 344 ? 23.58216 55.28924  -16.43776 1.000 58.19057  ? 332 GLN B CG    1 
ATOM   6744 C  CD    . GLN B 2 344 ? 23.07507 55.68159  -17.82066 1.000 61.78568  ? 332 GLN B CD    1 
ATOM   6745 O  OE1   . GLN B 2 344 ? 23.67391 56.50851  -18.51267 1.000 67.00018  ? 332 GLN B OE1   1 
ATOM   6746 N  NE2   . GLN B 2 344 ? 21.95879 55.08824  -18.22449 1.000 60.74729  ? 332 GLN B NE2   1 
ATOM   6747 N  N     . GLY B 2 345 ? 28.37402 54.67130  -16.86846 1.000 64.30563  ? 333 GLY B N     1 
ATOM   6748 C  CA    . GLY B 2 345 ? 29.72407 55.18425  -16.80597 1.000 57.10830  ? 333 GLY B CA    1 
ATOM   6749 C  C     . GLY B 2 345 ? 30.03470 55.83116  -15.46857 1.000 60.79948  ? 333 GLY B C     1 
ATOM   6750 O  O     . GLY B 2 345 ? 29.14998 56.20266  -14.69834 1.000 60.52751  ? 333 GLY B O     1 
ATOM   6751 N  N     . GLN B 2 346 ? 31.33540 55.95639  -15.19995 1.000 62.58189  ? 334 GLN B N     1 
ATOM   6752 C  CA    . GLN B 2 346 ? 31.83832 56.59795  -13.98483 1.000 62.95812  ? 334 GLN B CA    1 
ATOM   6753 C  C     . GLN B 2 346 ? 31.25051 55.95742  -12.72979 1.000 68.06075  ? 334 GLN B C     1 
ATOM   6754 O  O     . GLN B 2 346 ? 31.02833 56.62736  -11.71566 1.000 70.79252  ? 334 GLN B O     1 
ATOM   6755 C  CB    . GLN B 2 346 ? 31.57227 58.10690  -14.00731 1.000 58.60991  ? 334 GLN B CB    1 
ATOM   6756 N  N     . GLY B 2 347 ? 30.98919 54.65166  -12.79500 1.000 62.79691  ? 335 GLY B N     1 
ATOM   6757 C  CA    . GLY B 2 347 ? 30.50385 53.91399  -11.64694 1.000 62.85508  ? 335 GLY B CA    1 
ATOM   6758 C  C     . GLY B 2 347 ? 29.01099 53.96631  -11.41212 1.000 61.38856  ? 335 GLY B C     1 
ATOM   6759 O  O     . GLY B 2 347 ? 28.55283 53.50817  -10.36017 1.000 66.63587  ? 335 GLY B O     1 
ATOM   6760 N  N     . GLN B 2 348 ? 28.23731 54.51329  -12.34123 1.000 57.14091  ? 336 GLN B N     1 
ATOM   6761 C  CA    . GLN B 2 348 ? 26.79077 54.59641  -12.19882 1.000 58.97821  ? 336 GLN B CA    1 
ATOM   6762 C  C     . GLN B 2 348 ? 26.13760 53.52464  -13.05937 1.000 58.22547  ? 336 GLN B C     1 
ATOM   6763 O  O     . GLN B 2 348 ? 26.58657 53.24640  -14.17775 1.000 58.49386  ? 336 GLN B O     1 
ATOM   6764 C  CB    . GLN B 2 348 ? 26.25679 55.97594  -12.61232 1.000 64.01244  ? 336 GLN B CB    1 
ATOM   6765 C  CG    . GLN B 2 348 ? 27.12912 57.17312  -12.23156 1.000 60.64002  ? 336 GLN B CG    1 
ATOM   6766 C  CD    . GLN B 2 348 ? 26.98252 57.58040  -10.77329 1.000 71.79134  ? 336 GLN B CD    1 
ATOM   6767 O  OE1   . GLN B 2 348 ? 25.86461 57.69486  -10.25552 1.000 73.05127  ? 336 GLN B OE1   1 
ATOM   6768 N  NE2   . GLN B 2 348 ? 28.11667 57.80589  -10.10008 1.000 71.72927  ? 336 GLN B NE2   1 
ATOM   6769 N  N     . TRP B 2 349 ? 25.07124 52.92921  -12.53839 1.000 55.48122  ? 337 TRP B N     1 
ATOM   6770 C  CA    . TRP B 2 349 ? 24.32590 51.90579  -13.25451 1.000 57.43146  ? 337 TRP B CA    1 
ATOM   6771 C  C     . TRP B 2 349 ? 22.85036 52.13430  -12.98369 1.000 55.62148  ? 337 TRP B C     1 
ATOM   6772 O  O     . TRP B 2 349 ? 22.47334 52.49705  -11.86695 1.000 56.60949  ? 337 TRP B O     1 
ATOM   6773 C  CB    . TRP B 2 349 ? 24.72692 50.49076  -12.80738 1.000 51.93390  ? 337 TRP B CB    1 
ATOM   6774 C  CG    . TRP B 2 349 ? 26.19631 50.23012  -12.82956 1.000 52.47461  ? 337 TRP B CG    1 
ATOM   6775 C  CD1   . TRP B 2 349 ? 27.13308 50.71362  -11.96175 1.000 54.57011  ? 337 TRP B CD1   1 
ATOM   6776 C  CD2   . TRP B 2 349 ? 26.90044 49.40488  -13.75788 1.000 50.45857  ? 337 TRP B CD2   1 
ATOM   6777 N  NE1   . TRP B 2 349 ? 28.38099 50.24678  -12.30079 1.000 51.77974  ? 337 TRP B NE1   1 
ATOM   6778 C  CE2   . TRP B 2 349 ? 28.26042 49.43498  -13.39834 1.000 51.22237  ? 337 TRP B CE2   1 
ATOM   6779 C  CE3   . TRP B 2 349 ? 26.51242 48.64176  -14.86044 1.000 51.92942  ? 337 TRP B CE3   1 
ATOM   6780 C  CZ2   . TRP B 2 349 ? 29.23153 48.73276  -14.10469 1.000 51.01929  ? 337 TRP B CZ2   1 
ATOM   6781 C  CZ3   . TRP B 2 349 ? 27.47576 47.94270  -15.55326 1.000 51.16658  ? 337 TRP B CZ3   1 
ATOM   6782 C  CH2   . TRP B 2 349 ? 28.82107 47.99904  -15.17851 1.000 50.42897  ? 337 TRP B CH2   1 
ATOM   6783 N  N     . THR B 2 350 ? 22.01975 51.93243  -13.99536 1.000 47.79666  ? 338 THR B N     1 
ATOM   6784 C  CA    . THR B 2 350 ? 20.58799 52.11507  -13.82967 1.000 50.17378  ? 338 THR B CA    1 
ATOM   6785 C  C     . THR B 2 350 ? 19.86747 50.80796  -14.11651 1.000 52.77927  ? 338 THR B C     1 
ATOM   6786 O  O     . THR B 2 350 ? 20.33757 49.98833  -14.90923 1.000 54.05603  ? 338 THR B O     1 
ATOM   6787 C  CB    . THR B 2 350 ? 20.06620 53.21243  -14.74463 1.000 50.15955  ? 338 THR B CB    1 
ATOM   6788 O  OG1   . THR B 2 350 ? 20.30667 52.85277  -16.10912 1.000 45.47023  ? 338 THR B OG1   1 
ATOM   6789 C  CG2   . THR B 2 350 ? 20.77434 54.49937  -14.43448 1.000 51.26229  ? 338 THR B CG2   1 
ATOM   6790 N  N     . TYR B 2 351 ? 18.72001 50.60865  -13.47348 1.000 50.42543  ? 339 TYR B N     1 
ATOM   6791 C  CA    . TYR B 2 351 ? 18.00574 49.35425  -13.62946 1.000 47.90538  ? 339 TYR B CA    1 
ATOM   6792 C  C     . TYR B 2 351 ? 16.50719 49.59616  -13.61788 1.000 52.29075  ? 339 TYR B C     1 
ATOM   6793 O  O     . TYR B 2 351 ? 16.01064 50.53274  -12.98642 1.000 49.59903  ? 339 TYR B O     1 
ATOM   6794 C  CB    . TYR B 2 351 ? 18.39290 48.34043  -12.54234 1.000 46.16805  ? 339 TYR B CB    1 
ATOM   6795 C  CG    . TYR B 2 351 ? 17.98193 48.68423  -11.12325 1.000 45.91107  ? 339 TYR B CG    1 
ATOM   6796 C  CD1   . TYR B 2 351 ? 18.86857 49.30062  -10.25361 1.000 50.14874  ? 339 TYR B CD1   1 
ATOM   6797 C  CD2   . TYR B 2 351 ? 16.72030 48.35009  -10.63978 1.000 48.91467  ? 339 TYR B CD2   1 
ATOM   6798 C  CE1   . TYR B 2 351 ? 18.49862 49.61415  -8.95253  1.000 53.03458  ? 339 TYR B CE1   1 
ATOM   6799 C  CE2   . TYR B 2 351 ? 16.33830 48.65271  -9.34040  1.000 48.09237  ? 339 TYR B CE2   1 
ATOM   6800 C  CZ    . TYR B 2 351 ? 17.22878 49.28414  -8.50013  1.000 55.63994  ? 339 TYR B CZ    1 
ATOM   6801 O  OH    . TYR B 2 351 ? 16.85283 49.58532  -7.20368  1.000 66.43793  ? 339 TYR B OH    1 
ATOM   6802 N  N     . GLN B 2 352 ? 15.79391 48.73405  -14.33526 1.000 50.94794  ? 340 GLN B N     1 
ATOM   6803 C  CA    . GLN B 2 352 ? 14.33788 48.73647  -14.33011 1.000 50.73421  ? 340 GLN B CA    1 
ATOM   6804 C  C     . GLN B 2 352 ? 13.84011 47.31042  -14.15253 1.000 52.25666  ? 340 GLN B C     1 
ATOM   6805 O  O     . GLN B 2 352 ? 14.32262 46.39871  -14.83092 1.000 58.75777  ? 340 GLN B O     1 
ATOM   6806 C  CB    . GLN B 2 352 ? 13.76792 49.33270  -15.62280 1.000 52.48606  ? 340 GLN B CB    1 
ATOM   6807 C  CG    . GLN B 2 352 ? 14.31479 50.69859  -15.98817 1.000 50.33021  ? 340 GLN B CG    1 
ATOM   6808 C  CD    . GLN B 2 352 ? 15.55580 50.59385  -16.81702 1.000 49.79811  ? 340 GLN B CD    1 
ATOM   6809 O  OE1   . GLN B 2 352 ? 15.58165 49.88217  -17.82179 1.000 52.87801  ? 340 GLN B OE1   1 
ATOM   6810 N  NE2   . GLN B 2 352 ? 16.60478 51.27641  -16.39512 1.000 49.27790  ? 340 GLN B NE2   1 
ATOM   6811 N  N     . ILE B 2 353 ? 12.88391 47.12157  -13.24502 1.000 50.01025  ? 341 ILE B N     1 
ATOM   6812 C  CA    . ILE B 2 353 ? 12.16782 45.86110  -13.06447 1.000 53.08917  ? 341 ILE B CA    1 
ATOM   6813 C  C     . ILE B 2 353 ? 10.77040 46.04133  -13.63689 1.000 52.13669  ? 341 ILE B C     1 
ATOM   6814 O  O     . ILE B 2 353 ? 9.99683  46.87585  -13.14198 1.000 53.82082  ? 341 ILE B O     1 
ATOM   6815 C  CB    . ILE B 2 353 ? 12.07439 45.45081  -11.58428 1.000 55.79193  ? 341 ILE B CB    1 
ATOM   6816 C  CG1   . ILE B 2 353 ? 13.45779 45.26664  -10.95250 1.000 53.10144  ? 341 ILE B CG1   1 
ATOM   6817 C  CG2   . ILE B 2 353 ? 11.19180 44.20471  -11.42629 1.000 50.35343  ? 341 ILE B CG2   1 
ATOM   6818 C  CD1   . ILE B 2 353 ? 13.41395 45.03722  -9.43319  1.000 45.45150  ? 341 ILE B CD1   1 
ATOM   6819 N  N     . TYR B 2 354 ? 10.44442 45.24374  -14.65197 1.000 47.50897  ? 342 TYR B N     1 
ATOM   6820 C  CA    . TYR B 2 354 ? 9.13339  45.25047  -15.28470 1.000 49.38211  ? 342 TYR B CA    1 
ATOM   6821 C  C     . TYR B 2 354 ? 8.77107  43.81707  -15.65608 1.000 56.04502  ? 342 TYR B C     1 
ATOM   6822 O  O     . TYR B 2 354 ? 9.61087  42.91863  -15.62140 1.000 54.25793  ? 342 TYR B O     1 
ATOM   6823 C  CB    . TYR B 2 354 ? 9.11686  46.13734  -16.53279 1.000 46.11266  ? 342 TYR B CB    1 
ATOM   6824 C  CG    . TYR B 2 354 ? 9.99960  45.59732  -17.63745 1.000 52.50399  ? 342 TYR B CG    1 
ATOM   6825 C  CD1   . TYR B 2 354 ? 11.34511 45.94767  -17.72264 1.000 53.80202  ? 342 TYR B CD1   1 
ATOM   6826 C  CD2   . TYR B 2 354 ? 9.49740  44.71746  -18.58527 1.000 54.10435  ? 342 TYR B CD2   1 
ATOM   6827 C  CE1   . TYR B 2 354 ? 12.15587 45.44340  -18.73106 1.000 47.45681  ? 342 TYR B CE1   1 
ATOM   6828 C  CE2   . TYR B 2 354 ? 10.29971 44.20957  -19.58850 1.000 53.13406  ? 342 TYR B CE2   1 
ATOM   6829 C  CZ    . TYR B 2 354 ? 11.62038 44.57684  -19.65594 1.000 50.67522  ? 342 TYR B CZ    1 
ATOM   6830 O  OH    . TYR B 2 354 ? 12.39952 44.05639  -20.65679 1.000 59.89827  ? 342 TYR B OH    1 
ATOM   6831 N  N     . GLN B 2 355 ? 7.50859  43.60287  -16.03986 1.000 57.33218  ? 343 GLN B N     1 
ATOM   6832 C  CA    . GLN B 2 355 ? 7.06209  42.31315  -16.55307 1.000 48.67732  ? 343 GLN B CA    1 
ATOM   6833 C  C     . GLN B 2 355 ? 6.53467  42.37276  -17.97381 1.000 50.25247  ? 343 GLN B C     1 
ATOM   6834 O  O     . GLN B 2 355 ? 6.52597  41.34541  -18.65463 1.000 53.22750  ? 343 GLN B O     1 
ATOM   6835 C  CB    . GLN B 2 355 ? 5.96695  41.71791  -15.65790 1.000 49.80936  ? 343 GLN B CB    1 
ATOM   6836 C  CG    . GLN B 2 355 ? 6.46117  41.14542  -14.35123 1.000 57.05861  ? 343 GLN B CG    1 
ATOM   6837 C  CD    . GLN B 2 355 ? 5.32295  40.67930  -13.44700 1.000 62.01280  ? 343 GLN B CD    1 
ATOM   6838 O  OE1   . GLN B 2 355 ? 5.49080  39.75764  -12.65753 1.000 60.98751  ? 343 GLN B OE1   1 
ATOM   6839 N  NE2   . GLN B 2 355 ? 4.16678  41.32963  -13.55233 1.000 59.06865  ? 343 GLN B NE2   1 
ATOM   6840 N  N     . GLU B 2 356 ? 6.06994  43.52552  -18.42551 1.000 55.88724  ? 344 GLU B N     1 
ATOM   6841 C  CA    . GLU B 2 356 ? 5.69797  43.77564  -19.80312 1.000 57.09841  ? 344 GLU B CA    1 
ATOM   6842 C  C     . GLU B 2 356 ? 6.33902  45.09833  -20.19805 1.000 53.38593  ? 344 GLU B C     1 
ATOM   6843 O  O     . GLU B 2 356 ? 6.46970  45.98974  -19.35381 1.000 58.93786  ? 344 GLU B O     1 
ATOM   6844 C  CB    . GLU B 2 356 ? 4.16504  43.82315  -19.97255 1.000 53.27389  ? 344 GLU B CB    1 
ATOM   6845 N  N     . PRO B 2 357 ? 6.77308  45.25120  -21.44558 1.000 55.09099  ? 345 PRO B N     1 
ATOM   6846 C  CA    . PRO B 2 357 ? 7.61844  46.40475  -21.79346 1.000 60.10921  ? 345 PRO B CA    1 
ATOM   6847 C  C     . PRO B 2 357 ? 6.92286  47.73825  -21.53342 1.000 58.45546  ? 345 PRO B C     1 
ATOM   6848 O  O     . PRO B 2 357 ? 5.76780  47.94477  -21.91166 1.000 56.54818  ? 345 PRO B O     1 
ATOM   6849 C  CB    . PRO B 2 357 ? 7.90001  46.19317  -23.28553 1.000 66.65418  ? 345 PRO B CB    1 
ATOM   6850 C  CG    . PRO B 2 357 ? 6.70970  45.39568  -23.76891 1.000 66.36839  ? 345 PRO B CG    1 
ATOM   6851 C  CD    . PRO B 2 357 ? 6.39851  44.46464  -22.63333 1.000 58.01152  ? 345 PRO B CD    1 
ATOM   6852 N  N     . PHE B 2 358 ? 7.64505  48.63816  -20.86763 1.000 58.05672  ? 346 PHE B N     1 
ATOM   6853 C  CA    . PHE B 2 358 ? 7.27255  50.00444  -20.49907 1.000 56.40257  ? 346 PHE B CA    1 
ATOM   6854 C  C     . PHE B 2 358 ? 6.35746  50.06042  -19.28181 1.000 58.61831  ? 346 PHE B C     1 
ATOM   6855 O  O     . PHE B 2 358 ? 5.98240  51.17826  -18.86120 1.000 55.87200  ? 346 PHE B O     1 
ATOM   6856 C  CB    . PHE B 2 358 ? 6.61650  50.77606  -21.65487 1.000 60.06474  ? 346 PHE B CB    1 
ATOM   6857 C  CG    . PHE B 2 358 ? 7.42001  50.73793  -22.92618 1.000 63.61690  ? 346 PHE B CG    1 
ATOM   6858 C  CD1   . PHE B 2 358 ? 8.69586  51.29967  -22.97057 1.000 62.91585  ? 346 PHE B CD1   1 
ATOM   6859 C  CD2   . PHE B 2 358 ? 6.91591  50.12726  -24.06893 1.000 61.50065  ? 346 PHE B CD2   1 
ATOM   6860 C  CE1   . PHE B 2 358 ? 9.45086  51.25914  -24.12874 1.000 63.14408  ? 346 PHE B CE1   1 
ATOM   6861 C  CE2   . PHE B 2 358 ? 7.66553  50.08402  -25.23876 1.000 64.62966  ? 346 PHE B CE2   1 
ATOM   6862 C  CZ    . PHE B 2 358 ? 8.93785  50.64990  -25.26725 1.000 65.58188  ? 346 PHE B CZ    1 
ATOM   6863 N  N     . LYS B 2 359 ? 5.98485  48.92004  -18.69233 1.000 53.85341  ? 347 LYS B N     1 
ATOM   6864 C  CA    . LYS B 2 359 ? 5.19254  48.90063  -17.46321 1.000 53.64158  ? 347 LYS B CA    1 
ATOM   6865 C  C     . LYS B 2 359 ? 6.10750  48.56335  -16.28605 1.000 51.88677  ? 347 LYS B C     1 
ATOM   6866 O  O     . LYS B 2 359 ? 6.10473  47.45662  -15.75592 1.000 58.44377  ? 347 LYS B O     1 
ATOM   6867 C  CB    . LYS B 2 359 ? 4.03656  47.91786  -17.59846 1.000 58.07553  ? 347 LYS B CB    1 
ATOM   6868 N  N     . ASN B 2 360 ? 6.89067  49.54878  -15.85831 1.000 53.51826  ? 348 ASN B N     1 
ATOM   6869 C  CA    . ASN B 2 360 ? 7.90042  49.29395  -14.83948 1.000 52.64822  ? 348 ASN B CA    1 
ATOM   6870 C  C     . ASN B 2 360 ? 7.26194  49.14642  -13.46813 1.000 55.27383  ? 348 ASN B C     1 
ATOM   6871 O  O     . ASN B 2 360 ? 6.48054  49.99737  -13.03291 1.000 57.19753  ? 348 ASN B O     1 
ATOM   6872 C  CB    . ASN B 2 360 ? 8.93993  50.41295  -14.79853 1.000 46.99220  ? 348 ASN B CB    1 
ATOM   6873 C  CG    . ASN B 2 360 ? 9.82251  50.43888  -16.02503 1.000 52.21515  ? 348 ASN B CG    1 
ATOM   6874 O  OD1   . ASN B 2 360 ? 10.11280 49.39820  -16.62771 1.000 56.22637  ? 348 ASN B OD1   1 
ATOM   6875 N  ND2   . ASN B 2 360 ? 10.26234 51.63389  -16.40584 1.000 51.32383  ? 348 ASN B ND2   1 
ATOM   6876 N  N     . LEU B 2 361 ? 7.60861  48.06156  -12.78317 1.000 54.33534  ? 349 LEU B N     1 
ATOM   6877 C  CA    . LEU B 2 361 ? 7.28268  47.94492  -11.37190 1.000 50.30127  ? 349 LEU B CA    1 
ATOM   6878 C  C     . LEU B 2 361 ? 8.22904  48.78072  -10.52418 1.000 54.57678  ? 349 LEU B C     1 
ATOM   6879 O  O     . LEU B 2 361 ? 7.81008  49.37590  -9.52634  1.000 60.00298  ? 349 LEU B O     1 
ATOM   6880 C  CB    . LEU B 2 361 ? 7.32087  46.47675  -10.95656 1.000 56.64100  ? 349 LEU B CB    1 
ATOM   6881 C  CG    . LEU B 2 361 ? 6.27819  45.61795  -11.68076 1.000 59.18892  ? 349 LEU B CG    1 
ATOM   6882 C  CD1   . LEU B 2 361 ? 6.71938  44.16117  -11.77644 1.000 51.15612  ? 349 LEU B CD1   1 
ATOM   6883 C  CD2   . LEU B 2 361 ? 4.91322  45.74440  -10.99262 1.000 52.50547  ? 349 LEU B CD2   1 
ATOM   6884 N  N     . LYS B 2 362 ? 9.50473  48.84639  -10.89874 1.000 56.79377  ? 350 LYS B N     1 
ATOM   6885 C  CA    . LYS B 2 362 ? 10.42488 49.72452  -10.17772 1.000 58.05118  ? 350 LYS B CA    1 
ATOM   6886 C  C     . LYS B 2 362 ? 11.52720 50.18267  -11.12046 1.000 56.41511  ? 350 LYS B C     1 
ATOM   6887 O  O     . LYS B 2 362 ? 11.83444 49.52390  -12.11365 1.000 58.70568  ? 350 LYS B O     1 
ATOM   6888 C  CB    . LYS B 2 362 ? 11.03861 49.04556  -8.93894  1.000 57.86011  ? 350 LYS B CB    1 
ATOM   6889 C  CG    . LYS B 2 362 ? 11.80719 50.00292  -8.01140  1.000 61.48431  ? 350 LYS B CG    1 
ATOM   6890 C  CD    . LYS B 2 362 ? 12.58743 49.26308  -6.92959  1.000 65.19539  ? 350 LYS B CD    1 
ATOM   6891 C  CE    . LYS B 2 362 ? 13.08904 50.21733  -5.82761  1.000 76.82309  ? 350 LYS B CE    1 
ATOM   6892 N  NZ    . LYS B 2 362 ? 14.27143 51.06134  -6.18765  1.000 72.35056  ? 350 LYS B NZ    1 
ATOM   6893 N  N     . THR B 2 363 ? 12.10449 51.33697  -10.80991 1.000 52.17643  ? 351 THR B N     1 
ATOM   6894 C  CA    . THR B 2 363 ? 13.27526 51.84584  -11.50591 1.000 54.86960  ? 351 THR B CA    1 
ATOM   6895 C  C     . THR B 2 363 ? 14.25229 52.35061  -10.45520 1.000 58.08843  ? 351 THR B C     1 
ATOM   6896 O  O     . THR B 2 363 ? 13.83266 52.90901  -9.43926  1.000 67.04471  ? 351 THR B O     1 
ATOM   6897 C  CB    . THR B 2 363 ? 12.91069 52.97603  -12.47590 1.000 51.69278  ? 351 THR B CB    1 
ATOM   6898 O  OG1   . THR B 2 363 ? 12.39791 54.08035  -11.73313 1.000 60.10396  ? 351 THR B OG1   1 
ATOM   6899 C  CG2   . THR B 2 363 ? 11.86547 52.52924  -13.46926 1.000 44.29624  ? 351 THR B CG2   1 
ATOM   6900 N  N     . GLY B 2 364 ? 15.54667 52.15413  -10.68614 1.000 51.02608  ? 352 GLY B N     1 
ATOM   6901 C  CA    . GLY B 2 364 ? 16.50343 52.51220  -9.65824  1.000 50.92888  ? 352 GLY B CA    1 
ATOM   6902 C  C     . GLY B 2 364 ? 17.88283 52.71616  -10.23457 1.000 51.77301  ? 352 GLY B C     1 
ATOM   6903 O  O     . GLY B 2 364 ? 18.11105 52.55686  -11.43371 1.000 54.56026  ? 352 GLY B O     1 
ATOM   6904 N  N     . LYS B 2 365 ? 18.81465 53.06426  -9.35358  1.000 57.71090  ? 353 LYS B N     1 
ATOM   6905 C  CA    . LYS B 2 365 ? 20.21326 53.18749  -9.73141  1.000 60.39687  ? 353 LYS B CA    1 
ATOM   6906 C  C     . LYS B 2 365 ? 21.08924 52.62444  -8.62267  1.000 62.93800  ? 353 LYS B C     1 
ATOM   6907 O  O     . LYS B 2 365 ? 20.72532 52.64908  -7.44277  1.000 65.76343  ? 353 LYS B O     1 
ATOM   6908 C  CB    . LYS B 2 365 ? 20.61817 54.65376  -10.03299 1.000 58.60446  ? 353 LYS B CB    1 
ATOM   6909 C  CG    . LYS B 2 365 ? 20.81516 55.53582  -8.81413  1.000 59.81123  ? 353 LYS B CG    1 
ATOM   6910 C  CD    . LYS B 2 365 ? 21.61865 56.79422  -9.14957  1.000 66.69548  ? 353 LYS B CD    1 
ATOM   6911 C  CE    . LYS B 2 365 ? 21.67670 57.77699  -7.96779  1.000 66.14078  ? 353 LYS B CE    1 
ATOM   6912 N  NZ    . LYS B 2 365 ? 22.76488 58.80039  -8.09750  1.000 61.60254  ? 353 LYS B NZ    1 
ATOM   6913 N  N     . TYR B 2 366 ? 22.24750 52.10931  -9.02756  1.000 62.26773  ? 354 TYR B N     1 
ATOM   6914 C  CA    . TYR B 2 366 ? 23.32015 51.70014  -8.12989  1.000 64.84522  ? 354 TYR B CA    1 
ATOM   6915 C  C     . TYR B 2 366 ? 24.54989 52.52243  -8.49903  1.000 62.08033  ? 354 TYR B C     1 
ATOM   6916 O  O     . TYR B 2 366 ? 24.89969 52.61738  -9.67957  1.000 63.36874  ? 354 TYR B O     1 
ATOM   6917 C  CB    . TYR B 2 366 ? 23.57376 50.17725  -8.24703  1.000 64.92646  ? 354 TYR B CB    1 
ATOM   6918 C  CG    . TYR B 2 366 ? 24.76693 49.63995  -7.46759  1.000 64.97211  ? 354 TYR B CG    1 
ATOM   6919 C  CD1   . TYR B 2 366 ? 24.75537 49.59550  -6.07984  1.000 65.01072  ? 354 TYR B CD1   1 
ATOM   6920 C  CD2   . TYR B 2 366 ? 25.89832 49.16655  -8.12553  1.000 58.26846  ? 354 TYR B CD2   1 
ATOM   6921 C  CE1   . TYR B 2 366 ? 25.83914 49.11368  -5.37258  1.000 62.91821  ? 354 TYR B CE1   1 
ATOM   6922 C  CE2   . TYR B 2 366 ? 26.98466 48.68612  -7.42372  1.000 57.31705  ? 354 TYR B CE2   1 
ATOM   6923 C  CZ    . TYR B 2 366 ? 26.95025 48.66166  -6.04702  1.000 61.46362  ? 354 TYR B CZ    1 
ATOM   6924 O  OH    . TYR B 2 366 ? 28.03079 48.18214  -5.33736  1.000 65.42213  ? 354 TYR B OH    1 
ATOM   6925 N  N     . ALA B 2 367 ? 25.19785 53.13788  -7.50421  1.000 64.50377  ? 355 ALA B N     1 
ATOM   6926 C  CA    . ALA B 2 367 ? 26.26749 54.10700  -7.78898  1.000 70.62841  ? 355 ALA B CA    1 
ATOM   6927 C  C     . ALA B 2 367 ? 27.41730 53.96298  -6.79457  1.000 78.83559  ? 355 ALA B C     1 
ATOM   6928 O  O     . ALA B 2 367 ? 27.39367 54.57357  -5.72311  1.000 84.65658  ? 355 ALA B O     1 
ATOM   6929 C  CB    . ALA B 2 367 ? 25.72186 55.52930  -7.77676  1.000 67.61017  ? 355 ALA B CB    1 
ATOM   6930 N  N     . ARG B 2 368 ? 28.43578 53.18781  -7.16871  1.000 79.46846  ? 356 ARG B N     1 
ATOM   6931 C  CA    . ARG B 2 368 ? 29.70835 53.27016  -6.46501  1.000 85.76865  ? 356 ARG B CA    1 
ATOM   6932 C  C     . ARG B 2 368 ? 30.40014 54.59883  -6.80184  1.000 92.45659  ? 356 ARG B C     1 
ATOM   6933 O  O     . ARG B 2 368 ? 29.92994 55.38730  -7.63234  1.000 88.46497  ? 356 ARG B O     1 
ATOM   6934 C  CB    . ARG B 2 368 ? 30.60066 52.07981  -6.82060  1.000 81.26489  ? 356 ARG B CB    1 
ATOM   6935 N  N     . MET B 2 369 ? 31.52582 54.85532  -6.13875  1.000 97.78780  ? 357 MET B N     1 
ATOM   6936 C  CA    . MET B 2 369 ? 32.26932 56.08997  -6.35814  1.000 96.22607  ? 357 MET B CA    1 
ATOM   6937 C  C     . MET B 2 369 ? 33.21210 55.93687  -7.54534  1.000 93.63321  ? 357 MET B C     1 
ATOM   6938 O  O     . MET B 2 369 ? 33.66851 54.83099  -7.85996  1.000 88.80094  ? 357 MET B O     1 
ATOM   6939 C  CB    . MET B 2 369 ? 33.05917 56.48712  -5.10637  1.000 91.94147  ? 357 MET B CB    1 
ATOM   6940 N  N     . ARG B 2 370 ? 33.50106 57.07222  -8.19542  1.000 95.50342  ? 358 ARG B N     1 
ATOM   6941 C  CA    . ARG B 2 370 ? 34.28510 57.08600  -9.42809  1.000 92.81674  ? 358 ARG B CA    1 
ATOM   6942 C  C     . ARG B 2 370 ? 35.58572 56.31102  -9.25351  1.000 97.48547  ? 358 ARG B C     1 
ATOM   6943 O  O     . ARG B 2 370 ? 36.18133 56.28900  -8.17250  1.000 94.88129  ? 358 ARG B O     1 
ATOM   6944 C  CB    . ARG B 2 370 ? 34.57105 58.52406  -9.86200  1.000 86.39946  ? 358 ARG B CB    1 
ATOM   6945 N  N     . GLY B 2 371 ? 36.01223 55.65373  -10.32494 1.000 98.99761  ? 359 GLY B N     1 
ATOM   6946 C  CA    . GLY B 2 371 ? 37.01035 54.61834  -10.18149 1.000 96.42466  ? 359 GLY B CA    1 
ATOM   6947 C  C     . GLY B 2 371 ? 38.39455 54.89021  -10.72638 1.000 94.24745  ? 359 GLY B C     1 
ATOM   6948 O  O     . GLY B 2 371 ? 38.61087 54.90578  -11.94301 1.000 90.57559  ? 359 GLY B O     1 
ATOM   6949 N  N     . ALA B 2 372 ? 39.35131 55.08251  -9.81655  1.000 100.44407 ? 360 ALA B N     1 
ATOM   6950 C  CA    . ALA B 2 372 ? 40.75469 55.01204  -10.20592 1.000 99.82939  ? 360 ALA B CA    1 
ATOM   6951 C  C     . ALA B 2 372 ? 41.14880 53.57380  -10.53463 1.000 95.75125  ? 360 ALA B C     1 
ATOM   6952 O  O     . ALA B 2 372 ? 41.91908 53.33381  -11.47146 1.000 95.17516  ? 360 ALA B O     1 
ATOM   6953 C  CB    . ALA B 2 372 ? 41.64053 55.59138  -9.09717  1.000 94.33571  ? 360 ALA B CB    1 
ATOM   6954 N  N     . HIS B 2 373 ? 40.60987 52.60629  -9.78925  1.000 93.19819  ? 361 HIS B N     1 
ATOM   6955 C  CA    . HIS B 2 373 ? 40.84208 51.17491  -9.98236  1.000 90.70197  ? 361 HIS B CA    1 
ATOM   6956 C  C     . HIS B 2 373 ? 39.51063 50.42247  -9.99252  1.000 87.28310  ? 361 HIS B C     1 
ATOM   6957 O  O     . HIS B 2 373 ? 39.32038 49.42406  -9.29254  1.000 85.76472  ? 361 HIS B O     1 
ATOM   6958 C  CB    . HIS B 2 373 ? 41.77286 50.62132  -8.90445  1.000 89.82737  ? 361 HIS B CB    1 
ATOM   6959 N  N     . THR B 2 374 ? 38.56071 50.91521  -10.78549 1.000 79.75182  ? 362 THR B N     1 
ATOM   6960 C  CA    . THR B 2 374 ? 37.21368 50.36201  -10.80387 1.000 73.20486  ? 362 THR B CA    1 
ATOM   6961 C  C     . THR B 2 374 ? 37.13411 49.12983  -11.69701 1.000 63.82373  ? 362 THR B C     1 
ATOM   6962 O  O     . THR B 2 374 ? 37.79333 49.05529  -12.73500 1.000 65.94481  ? 362 THR B O     1 
ATOM   6963 C  CB    . THR B 2 374 ? 36.21957 51.42446  -11.27298 1.000 76.62180  ? 362 THR B CB    1 
ATOM   6964 O  OG1   . THR B 2 374 ? 34.90832 50.85856  -11.38524 1.000 73.72023  ? 362 THR B OG1   1 
ATOM   6965 C  CG2   . THR B 2 374 ? 36.64540 51.99352  -12.60862 1.000 72.82347  ? 362 THR B CG2   1 
ATOM   6966 N  N     . ASN B 2 375 ? 36.30556 48.16576  -11.28851 1.000 58.82309  ? 363 ASN B N     1 
ATOM   6967 C  CA    . ASN B 2 375 ? 36.12709 46.89528  -11.98953 1.000 53.16829  ? 363 ASN B CA    1 
ATOM   6968 C  C     . ASN B 2 375 ? 34.66940 46.76691  -12.43883 1.000 55.90263  ? 363 ASN B C     1 
ATOM   6969 O  O     . ASN B 2 375 ? 33.78358 46.52007  -11.61321 1.000 54.15168  ? 363 ASN B O     1 
ATOM   6970 C  CB    . ASN B 2 375 ? 36.53700 45.73987  -11.08045 1.000 52.80767  ? 363 ASN B CB    1 
ATOM   6971 C  CG    . ASN B 2 375 ? 36.37665 44.36868  -11.73835 1.000 56.12072  ? 363 ASN B CG    1 
ATOM   6972 O  OD1   . ASN B 2 375 ? 35.54012 44.16819  -12.62132 1.000 51.26196  ? 363 ASN B OD1   1 
ATOM   6973 N  ND2   . ASN B 2 375 ? 37.17959 43.40650  -11.28261 1.000 54.83337  ? 363 ASN B ND2   1 
ATOM   6974 N  N     . ASP B 2 376 ? 34.43498 46.88447  -13.75457 1.000 51.05441  ? 364 ASP B N     1 
ATOM   6975 C  CA    . ASP B 2 376 ? 33.07863 46.86103  -14.30113 1.000 46.77679  ? 364 ASP B CA    1 
ATOM   6976 C  C     . ASP B 2 376 ? 32.34202 45.56559  -13.98270 1.000 49.30509  ? 364 ASP B C     1 
ATOM   6977 O  O     . ASP B 2 376 ? 31.13854 45.58546  -13.69844 1.000 50.36498  ? 364 ASP B O     1 
ATOM   6978 C  CB    . ASP B 2 376 ? 33.11751 47.05674  -15.81284 1.000 50.93393  ? 364 ASP B CB    1 
ATOM   6979 C  CG    . ASP B 2 376 ? 32.88872 48.48419  -16.22121 1.000 48.46869  ? 364 ASP B CG    1 
ATOM   6980 O  OD1   . ASP B 2 376 ? 32.52202 49.30526  -15.36277 1.000 53.72597  ? 364 ASP B OD1   1 
ATOM   6981 O  OD2   . ASP B 2 376 ? 33.07817 48.78685  -17.40989 1.000 49.56643  ? 364 ASP B OD2   1 
ATOM   6982 N  N     . VAL B 2 377 ? 33.02428 44.42368  -14.06598 1.000 50.29811  ? 365 VAL B N     1 
ATOM   6983 C  CA    . VAL B 2 377 ? 32.33124 43.15525  -13.84335 1.000 49.97322  ? 365 VAL B CA    1 
ATOM   6984 C  C     . VAL B 2 377 ? 31.97394 42.99319  -12.37417 1.000 49.42725  ? 365 VAL B C     1 
ATOM   6985 O  O     . VAL B 2 377 ? 30.87177 42.54743  -12.03585 1.000 48.98003  ? 365 VAL B O     1 
ATOM   6986 C  CB    . VAL B 2 377 ? 33.17756 41.97630  -14.35363 1.000 49.29126  ? 365 VAL B CB    1 
ATOM   6987 C  CG1   . VAL B 2 377 ? 32.59791 40.65902  -13.87597 1.000 47.50197  ? 365 VAL B CG1   1 
ATOM   6988 C  CG2   . VAL B 2 377 ? 33.25382 42.00668  -15.87052 1.000 50.12730  ? 365 VAL B CG2   1 
ATOM   6989 N  N     . LYS B 2 378 ? 32.88904 43.35937  -11.47558 1.000 49.57970  ? 366 LYS B N     1 
ATOM   6990 C  CA    . LYS B 2 378 ? 32.56160 43.30362  -10.05591 1.000 50.51370  ? 366 LYS B CA    1 
ATOM   6991 C  C     . LYS B 2 378 ? 31.37524 44.20189  -9.73375  1.000 50.05606  ? 366 LYS B C     1 
ATOM   6992 O  O     . LYS B 2 378 ? 30.47462 43.81278  -8.97809  1.000 52.37477  ? 366 LYS B O     1 
ATOM   6993 C  CB    . LYS B 2 378 ? 33.77918 43.68633  -9.21924  1.000 49.43212  ? 366 LYS B CB    1 
ATOM   6994 C  CG    . LYS B 2 378 ? 33.52771 43.63610  -7.73323  1.000 47.09682  ? 366 LYS B CG    1 
ATOM   6995 C  CD    . LYS B 2 378 ? 34.79836 43.89281  -6.95636  1.000 46.68431  ? 366 LYS B CD    1 
ATOM   6996 C  CE    . LYS B 2 378 ? 34.50577 44.75801  -5.74739  1.000 60.33647  ? 366 LYS B CE    1 
ATOM   6997 N  NZ    . LYS B 2 378 ? 33.65735 45.95289  -6.11187  1.000 57.55121  ? 366 LYS B NZ    1 
ATOM   6998 N  N     . GLN B 2 379 ? 31.34765 45.40248  -10.31338 1.000 50.65047  ? 367 GLN B N     1 
ATOM   6999 C  CA    . GLN B 2 379 ? 30.23261 46.30715  -10.07024 1.000 49.35604  ? 367 GLN B CA    1 
ATOM   7000 C  C     . GLN B 2 379 ? 28.94188 45.74993  -10.63984 1.000 50.06167  ? 367 GLN B C     1 
ATOM   7001 O  O     . GLN B 2 379 ? 27.88516 45.86646  -10.01306 1.000 53.40864  ? 367 GLN B O     1 
ATOM   7002 C  CB    . GLN B 2 379 ? 30.51613 47.68346  -10.66408 1.000 51.52912  ? 367 GLN B CB    1 
ATOM   7003 C  CG    . GLN B 2 379 ? 31.25532 48.62404  -9.74805  1.000 51.35486  ? 367 GLN B CG    1 
ATOM   7004 C  CD    . GLN B 2 379 ? 31.54791 49.94308  -10.41876 1.000 58.07112  ? 367 GLN B CD    1 
ATOM   7005 O  OE1   . GLN B 2 379 ? 31.04871 50.21899  -11.51499 1.000 52.93836  ? 367 GLN B OE1   1 
ATOM   7006 N  NE2   . GLN B 2 379 ? 32.36073 50.77197  -9.76674  1.000 61.13706  ? 367 GLN B NE2   1 
ATOM   7007 N  N     . LEU B 2 380 ? 28.99497 45.15371  -11.82917 1.000 47.64219  ? 368 LEU B N     1 
ATOM   7008 C  CA    . LEU B 2 380 ? 27.77097 44.59359  -12.38633 1.000 47.41684  ? 368 LEU B CA    1 
ATOM   7009 C  C     . LEU B 2 380 ? 27.26034 43.45514  -11.52429 1.000 48.07995  ? 368 LEU B C     1 
ATOM   7010 O  O     . LEU B 2 380 ? 26.04351 43.30041  -11.35161 1.000 49.91622  ? 368 LEU B O     1 
ATOM   7011 C  CB    . LEU B 2 380 ? 27.99239 44.12146  -13.81918 1.000 46.05009  ? 368 LEU B CB    1 
ATOM   7012 C  CG    . LEU B 2 380 ? 26.71927 43.57287  -14.46214 1.000 44.07753  ? 368 LEU B CG    1 
ATOM   7013 C  CD1   . LEU B 2 380 ? 25.58655 44.57873  -14.35175 1.000 41.27330  ? 368 LEU B CD1   1 
ATOM   7014 C  CD2   . LEU B 2 380 ? 26.97532 43.19100  -15.90835 1.000 41.46897  ? 368 LEU B CD2   1 
ATOM   7015 N  N     . THR B 2 381 ? 28.17620 42.68106  -10.93569 1.000 48.52773  ? 369 THR B N     1 
ATOM   7016 C  CA    . THR B 2 381 ? 27.76960 41.57427  -10.07540 1.000 48.71863  ? 369 THR B CA    1 
ATOM   7017 C  C     . THR B 2 381 ? 27.11054 42.08872  -8.80605  1.000 49.20380  ? 369 THR B C     1 
ATOM   7018 O  O     . THR B 2 381 ? 26.06786 41.56743  -8.38468  1.000 49.84139  ? 369 THR B O     1 
ATOM   7019 C  CB    . THR B 2 381 ? 28.97839 40.70803  -9.73762  1.000 47.20072  ? 369 THR B CB    1 
ATOM   7020 O  OG1   . THR B 2 381 ? 29.55144 40.21189  -10.95276 1.000 46.33412  ? 369 THR B OG1   1 
ATOM   7021 C  CG2   . THR B 2 381 ? 28.56849 39.55567  -8.84169  1.000 41.64519  ? 369 THR B CG2   1 
ATOM   7022 N  N     . GLU B 2 382 ? 27.70947 43.11783  -8.19277  1.000 48.39087  ? 370 GLU B N     1 
ATOM   7023 C  CA    . GLU B 2 382 ? 27.09740 43.78265  -7.04388  1.000 51.31843  ? 370 GLU B CA    1 
ATOM   7024 C  C     . GLU B 2 382 ? 25.71739 44.34600  -7.37742  1.000 51.22868  ? 370 GLU B C     1 
ATOM   7025 O  O     . GLU B 2 382 ? 24.77654 44.21425  -6.58423  1.000 51.49844  ? 370 GLU B O     1 
ATOM   7026 C  CB    . GLU B 2 382 ? 28.01987 44.89204  -6.54487  1.000 55.22797  ? 370 GLU B CB    1 
ATOM   7027 C  CG    . GLU B 2 382 ? 29.12657 44.38449  -5.64094  1.000 55.96564  ? 370 GLU B CG    1 
ATOM   7028 C  CD    . GLU B 2 382 ? 30.33662 45.28305  -5.64223  1.000 61.98083  ? 370 GLU B CD    1 
ATOM   7029 O  OE1   . GLU B 2 382 ? 30.20482 46.46207  -6.05478  1.000 59.97109  ? 370 GLU B OE1   1 
ATOM   7030 O  OE2   . GLU B 2 382 ? 31.42088 44.79877  -5.23795  1.000 59.49727  ? 370 GLU B OE2   1 
ATOM   7031 N  N     . ALA B 2 383 ? 25.57592 44.98676  -8.53992  1.000 50.60748  ? 371 ALA B N     1 
ATOM   7032 C  CA    . ALA B 2 383 ? 24.26353 45.48439  -8.94543  1.000 50.18208  ? 371 ALA B CA    1 
ATOM   7033 C  C     . ALA B 2 383 ? 23.25449 44.35226  -9.03992  1.000 49.66571  ? 371 ALA B C     1 
ATOM   7034 O  O     . ALA B 2 383 ? 22.11321 44.49332  -8.58214  1.000 47.49853  ? 371 ALA B O     1 
ATOM   7035 C  CB    . ALA B 2 383 ? 24.35395 46.21614  -10.28240 1.000 45.62105  ? 371 ALA B CB    1 
ATOM   7036 N  N     . VAL B 2 384 ? 23.66175 43.21950  -9.63274  1.000 48.27833  ? 372 VAL B N     1 
ATOM   7037 C  CA    . VAL B 2 384 ? 22.74216 42.09654  -9.82657  1.000 50.09092  ? 372 VAL B CA    1 
ATOM   7038 C  C     . VAL B 2 384 ? 22.31889 41.50991  -8.48354  1.000 47.02481  ? 372 VAL B C     1 
ATOM   7039 O  O     . VAL B 2 384 ? 21.14874 41.16019  -8.28139  1.000 46.88113  ? 372 VAL B O     1 
ATOM   7040 C  CB    . VAL B 2 384 ? 23.37280 41.03124  -10.75000 1.000 48.08108  ? 372 VAL B CB    1 
ATOM   7041 C  CG1   . VAL B 2 384 ? 22.56213 39.74775  -10.73577 1.000 41.82834  ? 372 VAL B CG1   1 
ATOM   7042 C  CG2   . VAL B 2 384 ? 23.45612 41.54933  -12.17102 1.000 41.77578  ? 372 VAL B CG2   1 
ATOM   7043 N  N     . GLN B 2 385 ? 23.24428 41.42965  -7.53130  1.000 44.62252  ? 373 GLN B N     1 
ATOM   7044 C  CA    . GLN B 2 385 ? 22.87022 40.89062  -6.22719  1.000 47.47437  ? 373 GLN B CA    1 
ATOM   7045 C  C     . GLN B 2 385 ? 21.97783 41.86131  -5.45566  1.000 51.63909  ? 373 GLN B C     1 
ATOM   7046 O  O     . GLN B 2 385 ? 21.01708 41.44317  -4.79674  1.000 52.25821  ? 373 GLN B O     1 
ATOM   7047 C  CB    . GLN B 2 385 ? 24.11903 40.53857  -5.42631  1.000 47.38051  ? 373 GLN B CB    1 
ATOM   7048 C  CG    . GLN B 2 385 ? 24.83801 39.29167  -5.93801  1.000 47.48405  ? 373 GLN B CG    1 
ATOM   7049 C  CD    . GLN B 2 385 ? 26.17717 39.08479  -5.26474  1.000 45.21449  ? 373 GLN B CD    1 
ATOM   7050 O  OE1   . GLN B 2 385 ? 26.28631 38.33712  -4.29451  1.000 48.53237  ? 373 GLN B OE1   1 
ATOM   7051 N  NE2   . GLN B 2 385 ? 27.20505 39.76040  -5.76959  1.000 43.70474  ? 373 GLN B NE2   1 
ATOM   7052 N  N     . LYS B 2 386 ? 22.26523 43.16199  -5.52969  1.000 52.49188  ? 374 LYS B N     1 
ATOM   7053 C  CA    . LYS B 2 386 ? 21.40499 44.13336  -4.86950  1.000 48.85417  ? 374 LYS B CA    1 
ATOM   7054 C  C     . LYS B 2 386 ? 19.98848 44.07534  -5.43228  1.000 53.99755  ? 374 LYS B C     1 
ATOM   7055 O  O     . LYS B 2 386 ? 19.00707 44.02038  -4.67602  1.000 57.08598  ? 374 LYS B O     1 
ATOM   7056 C  CB    . LYS B 2 386 ? 22.00176 45.52932  -5.01661  1.000 53.59165  ? 374 LYS B CB    1 
ATOM   7057 C  CG    . LYS B 2 386 ? 21.03600 46.66517  -4.68063  1.000 65.34665  ? 374 LYS B CG    1 
ATOM   7058 C  CD    . LYS B 2 386 ? 21.69768 48.03019  -4.91196  1.000 72.43993  ? 374 LYS B CD    1 
ATOM   7059 C  CE    . LYS B 2 386 ? 20.68280 49.17489  -4.91996  1.000 68.48283  ? 374 LYS B CE    1 
ATOM   7060 N  NZ    . LYS B 2 386 ? 21.36783 50.49161  -5.00428  1.000 63.18622  ? 374 LYS B NZ    1 
ATOM   7061 N  N     . ILE B 2 387 ? 19.86266 44.06283  -6.76291  1.000 45.79158  ? 375 ILE B N     1 
ATOM   7062 C  CA    . ILE B 2 387 ? 18.53858 44.04493  -7.37173  1.000 49.08580  ? 375 ILE B CA    1 
ATOM   7063 C  C     . ILE B 2 387 ? 17.80094 42.75974  -7.02125  1.000 52.64401  ? 375 ILE B C     1 
ATOM   7064 O  O     . ILE B 2 387 ? 16.59219 42.77653  -6.74782  1.000 55.64024  ? 375 ILE B O     1 
ATOM   7065 C  CB    . ILE B 2 387 ? 18.64198 44.23632  -8.89250  1.000 50.81398  ? 375 ILE B CB    1 
ATOM   7066 C  CG1   . ILE B 2 387 ? 19.22253 45.61027  -9.21238  1.000 49.83345  ? 375 ILE B CG1   1 
ATOM   7067 C  CG2   . ILE B 2 387 ? 17.26909 44.08031  -9.55132  1.000 47.43318  ? 375 ILE B CG2   1 
ATOM   7068 C  CD1   . ILE B 2 387 ? 19.71526 45.72829  -10.63579 1.000 45.97713  ? 375 ILE B CD1   1 
ATOM   7069 N  N     . THR B 2 388 ? 18.49997 41.62343  -7.03288  1.000 51.00612  ? 376 THR B N     1 
ATOM   7070 C  CA    . THR B 2 388 ? 17.82623 40.38747  -6.66352  1.000 51.51799  ? 376 THR B CA    1 
ATOM   7071 C  C     . THR B 2 388 ? 17.32321 40.46631  -5.23373  1.000 53.03185  ? 376 THR B C     1 
ATOM   7072 O  O     . THR B 2 388 ? 16.19515 40.05039  -4.94513  1.000 54.71319  ? 376 THR B O     1 
ATOM   7073 C  CB    . THR B 2 388 ? 18.75116 39.18108  -6.84534  1.000 47.53603  ? 376 THR B CB    1 
ATOM   7074 O  OG1   . THR B 2 388 ? 19.27702 39.17526  -8.17500  1.000 45.80773  ? 376 THR B OG1   1 
ATOM   7075 C  CG2   . THR B 2 388 ? 17.97702 37.89827  -6.63532  1.000 44.30631  ? 376 THR B CG2   1 
ATOM   7076 N  N     . THR B 2 389 ? 18.14851 41.00035  -4.32850  1.000 53.00818  ? 377 THR B N     1 
ATOM   7077 C  CA    . THR B 2 389 ? 17.73302 41.17884  -2.94154  1.000 54.19354  ? 377 THR B CA    1 
ATOM   7078 C  C     . THR B 2 389 ? 16.44253 41.98086  -2.86111  1.000 54.75752  ? 377 THR B C     1 
ATOM   7079 O  O     . THR B 2 389 ? 15.48895 41.58518  -2.17902  1.000 56.96750  ? 377 THR B O     1 
ATOM   7080 C  CB    . THR B 2 389 ? 18.84999 41.87476  -2.15917  1.000 57.26040  ? 377 THR B CB    1 
ATOM   7081 O  OG1   . THR B 2 389 ? 19.96176 40.98535  -2.01354  1.000 57.78591  ? 377 THR B OG1   1 
ATOM   7082 C  CG2   . THR B 2 389 ? 18.37684 42.29479  -0.78668  1.000 58.73000  ? 377 THR B CG2   1 
ATOM   7083 N  N     . GLU B 2 390 ? 16.39407 43.11187  -3.56686  1.000 57.18242  ? 378 GLU B N     1 
ATOM   7084 C  CA    . GLU B 2 390 ? 15.20476 43.95893  -3.51567  1.000 56.45409  ? 378 GLU B CA    1 
ATOM   7085 C  C     . GLU B 2 390 ? 13.98308 43.23295  -4.06111  1.000 56.13992  ? 378 GLU B C     1 
ATOM   7086 O  O     . GLU B 2 390 ? 12.88705 43.33911  -3.49476  1.000 58.61531  ? 378 GLU B O     1 
ATOM   7087 C  CB    . GLU B 2 390 ? 15.43934 45.25683  -4.28647  1.000 59.41156  ? 378 GLU B CB    1 
ATOM   7088 C  CG    . GLU B 2 390 ? 16.38296 46.22980  -3.60823  1.000 58.07403  ? 378 GLU B CG    1 
ATOM   7089 C  CD    . GLU B 2 390 ? 16.60443 47.47702  -4.43756  1.000 73.43868  ? 378 GLU B CD    1 
ATOM   7090 O  OE1   . GLU B 2 390 ? 15.70171 47.83289  -5.23864  1.000 72.94070  ? 378 GLU B OE1   1 
ATOM   7091 O  OE2   . GLU B 2 390 ? 17.68454 48.09649  -4.29853  1.000 76.33390  ? 378 GLU B OE2   1 
ATOM   7092 N  N     . SER B 2 391 ? 14.14826 42.48737  -5.15903  1.000 53.00212  ? 379 SER B N     1 
ATOM   7093 C  CA    . SER B 2 391 ? 13.00750 41.77557  -5.73307  1.000 53.01854  ? 379 SER B CA    1 
ATOM   7094 C  C     . SER B 2 391 ? 12.51939 40.67143  -4.80883  1.000 58.15346  ? 379 SER B C     1 
ATOM   7095 O  O     . SER B 2 391 ? 11.31225 40.41979  -4.72143  1.000 58.82833  ? 379 SER B O     1 
ATOM   7096 C  CB    . SER B 2 391 ? 13.37114 41.18946  -7.08862  1.000 52.51937  ? 379 SER B CB    1 
ATOM   7097 O  OG    . SER B 2 391 ? 14.05321 42.14936  -7.86273  1.000 60.06196  ? 379 SER B OG    1 
ATOM   7098 N  N     . ILE B 2 392 ? 13.44384 39.98961  -4.12656  1.000 55.50752  ? 380 ILE B N     1 
ATOM   7099 C  CA    . ILE B 2 392 ? 13.05222 38.95024  -3.18069  1.000 54.20165  ? 380 ILE B CA    1 
ATOM   7100 C  C     . ILE B 2 392 ? 12.27158 39.56264  -2.03047  1.000 55.98048  ? 380 ILE B C     1 
ATOM   7101 O  O     . ILE B 2 392 ? 11.24053 39.02747  -1.61055  1.000 60.58921  ? 380 ILE B O     1 
ATOM   7102 C  CB    . ILE B 2 392 ? 14.28850 38.17168  -2.68432  1.000 56.35117  ? 380 ILE B CB    1 
ATOM   7103 C  CG1   . ILE B 2 392 ? 14.81410 37.24096  -3.77663  1.000 53.80586  ? 380 ILE B CG1   1 
ATOM   7104 C  CG2   . ILE B 2 392 ? 13.97159 37.35961  -1.43406  1.000 53.49671  ? 380 ILE B CG2   1 
ATOM   7105 C  CD1   . ILE B 2 392 ? 16.27347 36.86608  -3.59834  1.000 51.36336  ? 380 ILE B CD1   1 
ATOM   7106 N  N     . VAL B 2 393 ? 12.72816 40.71059  -1.52288  1.000 56.62551  ? 381 VAL B N     1 
ATOM   7107 C  CA    . VAL B 2 393 ? 12.04754 41.33603  -0.38977  1.000 54.87560  ? 381 VAL B CA    1 
ATOM   7108 C  C     . VAL B 2 393 ? 10.65486 41.81063  -0.79063  1.000 59.92175  ? 381 VAL B C     1 
ATOM   7109 O  O     . VAL B 2 393 ? 9.66528  41.53009  -0.10424  1.000 61.48329  ? 381 VAL B O     1 
ATOM   7110 C  CB    . VAL B 2 393 ? 12.88919 42.48793  0.17530   1.000 55.88961  ? 381 VAL B CB    1 
ATOM   7111 C  CG1   . VAL B 2 393 ? 12.09433 43.23365  1.22625   1.000 61.26948  ? 381 VAL B CG1   1 
ATOM   7112 C  CG2   . VAL B 2 393 ? 14.19230 41.95858  0.75895   1.000 52.02972  ? 381 VAL B CG2   1 
ATOM   7113 N  N     . ILE B 2 394 ? 10.55034 42.51002  -1.92181  1.000 60.01049  ? 382 ILE B N     1 
ATOM   7114 C  CA    . ILE B 2 394 ? 9.27050  43.08848  -2.32388  1.000 54.01111  ? 382 ILE B CA    1 
ATOM   7115 C  C     . ILE B 2 394 ? 8.29218  42.00331  -2.77583  1.000 58.04421  ? 382 ILE B C     1 
ATOM   7116 O  O     . ILE B 2 394 ? 7.18141  41.90132  -2.24831  1.000 64.39411  ? 382 ILE B O     1 
ATOM   7117 C  CB    . ILE B 2 394 ? 9.48361  44.14853  -3.41331  1.000 53.32478  ? 382 ILE B CB    1 
ATOM   7118 C  CG1   . ILE B 2 394 ? 10.30219 45.31019  -2.85396  1.000 54.57572  ? 382 ILE B CG1   1 
ATOM   7119 C  CG2   . ILE B 2 394 ? 8.15449  44.63591  -3.93794  1.000 55.57776  ? 382 ILE B CG2   1 
ATOM   7120 C  CD1   . ILE B 2 394 ? 10.80380 46.27051  -3.90836  1.000 57.54192  ? 382 ILE B CD1   1 
ATOM   7121 N  N     . TRP B 2 395 ? 8.67570  41.18249  -3.76423  1.000 57.77084  ? 383 TRP B N     1 
ATOM   7122 C  CA    . TRP B 2 395 ? 7.73837  40.25527  -4.39433  1.000 55.69072  ? 383 TRP B CA    1 
ATOM   7123 C  C     . TRP B 2 395 ? 8.02600  38.78349  -4.13284  1.000 59.32199  ? 383 TRP B C     1 
ATOM   7124 O  O     . TRP B 2 395 ? 7.23347  37.93939  -4.56751  1.000 56.67015  ? 383 TRP B O     1 
ATOM   7125 C  CB    . TRP B 2 395 ? 7.69301  40.46596  -5.91584  1.000 55.78728  ? 383 TRP B CB    1 
ATOM   7126 C  CG    . TRP B 2 395 ? 7.41492  41.86956  -6.34957  1.000 61.94013  ? 383 TRP B CG    1 
ATOM   7127 C  CD1   . TRP B 2 395 ? 6.20314  42.48990  -6.39371  1.000 63.15228  ? 383 TRP B CD1   1 
ATOM   7128 C  CD2   . TRP B 2 395 ? 8.37215  42.82671  -6.82481  1.000 60.35585  ? 383 TRP B CD2   1 
ATOM   7129 N  NE1   . TRP B 2 395 ? 6.34621  43.77833  -6.85334  1.000 62.49159  ? 383 TRP B NE1   1 
ATOM   7130 C  CE2   . TRP B 2 395 ? 7.66865  44.00605  -7.12766  1.000 60.18868  ? 383 TRP B CE2   1 
ATOM   7131 C  CE3   . TRP B 2 395 ? 9.75501  42.79873  -7.02119  1.000 55.27196  ? 383 TRP B CE3   1 
ATOM   7132 C  CZ2   . TRP B 2 395 ? 8.29964  45.14189  -7.61307  1.000 58.41316  ? 383 TRP B CZ2   1 
ATOM   7133 C  CZ3   . TRP B 2 395 ? 10.37480 43.92448  -7.50331  1.000 54.80150  ? 383 TRP B CZ3   1 
ATOM   7134 C  CH2   . TRP B 2 395 ? 9.65030  45.08206  -7.79051  1.000 56.87809  ? 383 TRP B CH2   1 
ATOM   7135 N  N     . GLY B 2 396 ? 9.12527  38.44893  -3.45721  1.000 58.68937  ? 384 GLY B N     1 
ATOM   7136 C  CA    . GLY B 2 396 ? 9.46274  37.06119  -3.19103  1.000 55.52897  ? 384 GLY B CA    1 
ATOM   7137 C  C     . GLY B 2 396 ? 9.62779  36.22627  -4.44306  1.000 56.76735  ? 384 GLY B C     1 
ATOM   7138 O  O     . GLY B 2 396 ? 8.94780  35.21390  -4.62957  1.000 56.31014  ? 384 GLY B O     1 
ATOM   7139 N  N     . LYS B 2 397 ? 10.53957 36.65247  -5.30890  1.000 59.45754  ? 385 LYS B N     1 
ATOM   7140 C  CA    . LYS B 2 397 ? 10.76209 36.07467  -6.62867  1.000 55.72432  ? 385 LYS B CA    1 
ATOM   7141 C  C     . LYS B 2 397 ? 12.02474 36.71395  -7.19269  1.000 55.89409  ? 385 LYS B C     1 
ATOM   7142 O  O     . LYS B 2 397 ? 12.37511 37.83952  -6.82179  1.000 54.44490  ? 385 LYS B O     1 
ATOM   7143 C  CB    . LYS B 2 397 ? 9.55839  36.32001  -7.55173  1.000 48.65169  ? 385 LYS B CB    1 
ATOM   7144 C  CG    . LYS B 2 397 ? 9.49875  35.45605  -8.79249  1.000 51.00116  ? 385 LYS B CG    1 
ATOM   7145 C  CD    . LYS B 2 397 ? 8.21733  35.77555  -9.56479  1.000 65.12873  ? 385 LYS B CD    1 
ATOM   7146 C  CE    . LYS B 2 397 ? 7.62449  34.55755  -10.27436 1.000 68.24447  ? 385 LYS B CE    1 
ATOM   7147 N  NZ    . LYS B 2 397 ? 8.18608  34.32912  -11.64589 1.000 70.20894  ? 385 LYS B NZ    1 
ATOM   7148 N  N     . THR B 2 398 ? 12.72018 35.98288  -8.05352  1.000 53.03737  ? 386 THR B N     1 
ATOM   7149 C  CA    . THR B 2 398 ? 13.90620 36.59419  -8.61569  1.000 47.53111  ? 386 THR B CA    1 
ATOM   7150 C  C     . THR B 2 398 ? 13.65056 37.00076  -10.05546 1.000 48.44480  ? 386 THR B C     1 
ATOM   7151 O  O     . THR B 2 398 ? 12.87201 36.35825  -10.76773 1.000 45.56995  ? 386 THR B O     1 
ATOM   7152 C  CB    . THR B 2 398 ? 15.12819 35.67009  -8.58995  1.000 45.84005  ? 386 THR B CB    1 
ATOM   7153 O  OG1   . THR B 2 398 ? 14.94260 34.59323  -9.51729  1.000 49.90939  ? 386 THR B OG1   1 
ATOM   7154 C  CG2   . THR B 2 398 ? 15.35749 35.12827  -7.20029  1.000 42.58682  ? 386 THR B CG2   1 
ATOM   7155 N  N     . PRO B 2 399 ? 14.29414 38.06570  -10.51262 1.000 46.52898  ? 387 PRO B N     1 
ATOM   7156 C  CA    . PRO B 2 399 ? 14.12921 38.48714  -11.90185 1.000 45.64473  ? 387 PRO B CA    1 
ATOM   7157 C  C     . PRO B 2 399 ? 15.04559 37.72331  -12.84562 1.000 46.46703  ? 387 PRO B C     1 
ATOM   7158 O  O     . PRO B 2 399 ? 16.09721 37.20652  -12.45464 1.000 46.23633  ? 387 PRO B O     1 
ATOM   7159 C  CB    . PRO B 2 399 ? 14.50485 39.97968  -11.86375 1.000 49.03540  ? 387 PRO B CB    1 
ATOM   7160 C  CG    . PRO B 2 399 ? 14.75442 40.31215  -10.42382 1.000 46.38554  ? 387 PRO B CG    1 
ATOM   7161 C  CD    . PRO B 2 399 ? 15.09931 39.02977  -9.75321  1.000 45.81899  ? 387 PRO B CD    1 
ATOM   7162 N  N     . LYS B 2 400 ? 14.61913 37.65776  -14.10686 1.000 43.59522  ? 388 LYS B N     1 
ATOM   7163 C  CA    . LYS B 2 400 ? 15.51078 37.30234  -15.19871 1.000 40.14504  ? 388 LYS B CA    1 
ATOM   7164 C  C     . LYS B 2 400 ? 16.22966 38.56803  -15.65272 1.000 46.32005  ? 388 LYS B C     1 
ATOM   7165 O  O     . LYS B 2 400 ? 15.58638 39.54620  -16.05481 1.000 47.22450  ? 388 LYS B O     1 
ATOM   7166 C  CB    . LYS B 2 400 ? 14.72813 36.67229  -16.34496 1.000 44.20400  ? 388 LYS B CB    1 
ATOM   7167 C  CG    . LYS B 2 400 ? 15.52525 36.56964  -17.63417 1.000 53.77694  ? 388 LYS B CG    1 
ATOM   7168 C  CD    . LYS B 2 400 ? 15.12863 35.35810  -18.48754 1.000 56.85242  ? 388 LYS B CD    1 
ATOM   7169 C  CE    . LYS B 2 400 ? 16.26377 35.00117  -19.46084 1.000 57.84827  ? 388 LYS B CE    1 
ATOM   7170 N  NZ    . LYS B 2 400 ? 15.90825 33.97199  -20.48815 1.000 64.81816  ? 388 LYS B NZ    1 
ATOM   7171 N  N     . PHE B 2 401 ? 17.55373 38.57636  -15.54410 1.000 45.15401  ? 389 PHE B N     1 
ATOM   7172 C  CA    . PHE B 2 401 ? 18.34813 39.75528  -15.87475 1.000 42.78058  ? 389 PHE B CA    1 
ATOM   7173 C  C     . PHE B 2 401 ? 18.77139 39.74708  -17.33879 1.000 46.49116  ? 389 PHE B C     1 
ATOM   7174 O  O     . PHE B 2 401 ? 19.20902 38.71777  -17.86246 1.000 50.33844  ? 389 PHE B O     1 
ATOM   7175 C  CB    . PHE B 2 401 ? 19.60427 39.81415  -15.01024 1.000 41.35649  ? 389 PHE B CB    1 
ATOM   7176 C  CG    . PHE B 2 401 ? 19.35368 40.16997  -13.57929 1.000 46.34883  ? 389 PHE B CG    1 
ATOM   7177 C  CD1   . PHE B 2 401 ? 19.00823 39.19318  -12.65652 1.000 50.88283  ? 389 PHE B CD1   1 
ATOM   7178 C  CD2   . PHE B 2 401 ? 19.50969 41.48113  -13.13692 1.000 45.03527  ? 389 PHE B CD2   1 
ATOM   7179 C  CE1   . PHE B 2 401 ? 18.79546 39.52199  -11.31451 1.000 49.87010  ? 389 PHE B CE1   1 
ATOM   7180 C  CE2   . PHE B 2 401 ? 19.30753 41.81336  -11.80111 1.000 43.75961  ? 389 PHE B CE2   1 
ATOM   7181 C  CZ    . PHE B 2 401 ? 18.95316 40.83427  -10.89084 1.000 47.65751  ? 389 PHE B CZ    1 
ATOM   7182 N  N     . LYS B 2 402 ? 18.67065 40.90808  -17.98914 1.000 45.89676  ? 390 LYS B N     1 
ATOM   7183 C  CA    . LYS B 2 402 ? 19.29454 41.14737  -19.28852 1.000 44.88280  ? 390 LYS B CA    1 
ATOM   7184 C  C     . LYS B 2 402 ? 20.60307 41.89053  -19.03573 1.000 43.54863  ? 390 LYS B C     1 
ATOM   7185 O  O     . LYS B 2 402 ? 20.58913 43.06360  -18.65850 1.000 44.88743  ? 390 LYS B O     1 
ATOM   7186 C  CB    . LYS B 2 402 ? 18.37467 41.95076  -20.20192 1.000 48.95004  ? 390 LYS B CB    1 
ATOM   7187 C  CG    . LYS B 2 402 ? 17.12318 41.21455  -20.64265 1.000 53.75335  ? 390 LYS B CG    1 
ATOM   7188 C  CD    . LYS B 2 402 ? 16.30271 42.06467  -21.60424 1.000 54.99433  ? 390 LYS B CD    1 
ATOM   7189 C  CE    . LYS B 2 402 ? 15.13084 41.28359  -22.16740 1.000 57.27582  ? 390 LYS B CE    1 
ATOM   7190 N  NZ    . LYS B 2 402 ? 14.37206 42.12389  -23.13086 1.000 61.77903  ? 390 LYS B NZ    1 
ATOM   7191 N  N     . LEU B 2 403 ? 21.73388 41.21166  -19.23235 1.000 44.38849  ? 391 LEU B N     1 
ATOM   7192 C  CA    . LEU B 2 403 ? 22.97335 41.81925  -18.76116 1.000 43.32138  ? 391 LEU B CA    1 
ATOM   7193 C  C     . LEU B 2 403 ? 23.70643 42.51289  -19.89516 1.000 44.06592  ? 391 LEU B C     1 
ATOM   7194 O  O     . LEU B 2 403 ? 23.92357 41.89838  -20.94860 1.000 47.01384  ? 391 LEU B O     1 
ATOM   7195 C  CB    . LEU B 2 403 ? 23.87202 40.76481  -18.13363 1.000 41.70861  ? 391 LEU B CB    1 
ATOM   7196 C  CG    . LEU B 2 403 ? 23.27525 40.09494  -16.89388 1.000 41.70792  ? 391 LEU B CG    1 
ATOM   7197 C  CD1   . LEU B 2 403 ? 24.18748 38.99059  -16.34395 1.000 40.57140  ? 391 LEU B CD1   1 
ATOM   7198 C  CD2   . LEU B 2 403 ? 23.00293 41.13278  -15.83239 1.000 39.95989  ? 391 LEU B CD2   1 
ATOM   7199 N  N     . PRO B 2 404 ? 24.09449 43.78500  -19.72171 1.000 41.20151  ? 392 PRO B N     1 
ATOM   7200 C  CA    . PRO B 2 404 ? 24.84614 44.53681  -20.74542 1.000 46.37338  ? 392 PRO B CA    1 
ATOM   7201 C  C     . PRO B 2 404 ? 26.33895 44.22999  -20.69162 1.000 52.39430  ? 392 PRO B C     1 
ATOM   7202 O  O     . PRO B 2 404 ? 27.19220 45.05057  -20.30923 1.000 50.05503  ? 392 PRO B O     1 
ATOM   7203 C  CB    . PRO B 2 404 ? 24.53105 45.98574  -20.37405 1.000 44.77436  ? 392 PRO B CB    1 
ATOM   7204 C  CG    . PRO B 2 404 ? 24.45575 45.94699  -18.89520 1.000 38.84245  ? 392 PRO B CG    1 
ATOM   7205 C  CD    . PRO B 2 404 ? 23.81417 44.62502  -18.54549 1.000 43.93957  ? 392 PRO B CD    1 
ATOM   7206 N  N     . ILE B 2 405 ? 26.67848 43.00467  -21.08615 1.000 48.80884  ? 393 ILE B N     1 
ATOM   7207 C  CA    . ILE B 2 405 ? 28.04681 42.51675  -21.00852 1.000 46.20096  ? 393 ILE B CA    1 
ATOM   7208 C  C     . ILE B 2 405 ? 28.14296 41.36314  -21.98430 1.000 46.88301  ? 393 ILE B C     1 
ATOM   7209 O  O     . ILE B 2 405 ? 27.13151 40.80562  -22.40360 1.000 51.33238  ? 393 ILE B O     1 
ATOM   7210 C  CB    . ILE B 2 405 ? 28.40308 42.09418  -19.56093 1.000 42.04851  ? 393 ILE B CB    1 
ATOM   7211 C  CG1   . ILE B 2 405 ? 29.89381 41.78167  -19.43507 1.000 45.79536  ? 393 ILE B CG1   1 
ATOM   7212 C  CG2   . ILE B 2 405 ? 27.55812 40.91583  -19.13882 1.000 42.04388  ? 393 ILE B CG2   1 
ATOM   7213 C  CD1   . ILE B 2 405 ? 30.36332 41.53500  -18.01417 1.000 44.75323  ? 393 ILE B CD1   1 
ATOM   7214 N  N     . GLN B 2 406 ? 29.36019 41.02410  -22.38567 1.000 49.45238  ? 394 GLN B N     1 
ATOM   7215 C  CA    . GLN B 2 406 ? 29.53930 39.84420  -23.21366 1.000 44.37582  ? 394 GLN B CA    1 
ATOM   7216 C  C     . GLN B 2 406 ? 29.33994 38.58938  -22.38346 1.000 48.99199  ? 394 GLN B C     1 
ATOM   7217 O  O     . GLN B 2 406 ? 29.75598 38.52236  -21.22162 1.000 50.26344  ? 394 GLN B O     1 
ATOM   7218 C  CB    . GLN B 2 406 ? 30.92366 39.82197  -23.83718 1.000 49.50457  ? 394 GLN B CB    1 
ATOM   7219 C  CG    . GLN B 2 406 ? 31.14193 38.62994  -24.74898 1.000 58.65653  ? 394 GLN B CG    1 
ATOM   7220 C  CD    . GLN B 2 406 ? 32.50260 38.64744  -25.40889 1.000 68.17468  ? 394 GLN B CD    1 
ATOM   7221 O  OE1   . GLN B 2 406 ? 33.42435 37.94270  -24.98609 1.000 64.72743  ? 394 GLN B OE1   1 
ATOM   7222 N  NE2   . GLN B 2 406 ? 32.64259 39.46716  -26.45040 1.000 76.15530  ? 394 GLN B NE2   1 
ATOM   7223 N  N     . LYS B 2 407 ? 28.68604 37.59728  -22.99412 1.000 49.39426  ? 395 LYS B N     1 
ATOM   7224 C  CA    . LYS B 2 407 ? 28.56493 36.26631  -22.40370 1.000 48.16292  ? 395 LYS B CA    1 
ATOM   7225 C  C     . LYS B 2 407 ? 29.89641 35.76524  -21.85501 1.000 46.88419  ? 395 LYS B C     1 
ATOM   7226 O  O     . LYS B 2 407 ? 29.98309 35.29817  -20.71180 1.000 46.24089  ? 395 LYS B O     1 
ATOM   7227 C  CB    . LYS B 2 407 ? 28.02363 35.30229  -23.45867 1.000 50.38594  ? 395 LYS B CB    1 
ATOM   7228 C  CG    . LYS B 2 407 ? 27.84263 33.87759  -23.00489 1.000 56.03025  ? 395 LYS B CG    1 
ATOM   7229 C  CD    . LYS B 2 407 ? 27.34363 33.01055  -24.15936 1.000 64.04621  ? 395 LYS B CD    1 
ATOM   7230 C  CE    . LYS B 2 407 ? 27.50665 31.53316  -23.85329 1.000 62.94682  ? 395 LYS B CE    1 
ATOM   7231 N  NZ    . LYS B 2 407 ? 26.90726 31.18558  -22.53957 1.000 59.12299  ? 395 LYS B NZ    1 
ATOM   7232 N  N     . GLU B 2 408 ? 30.95367 35.88072  -22.65102 1.000 50.29384  ? 396 GLU B N     1 
ATOM   7233 C  CA    . GLU B 2 408 ? 32.23293 35.28921  -22.27159 1.000 57.30305  ? 396 GLU B CA    1 
ATOM   7234 C  C     . GLU B 2 408 ? 32.88152 36.02445  -21.09809 1.000 54.60687  ? 396 GLU B C     1 
ATOM   7235 O  O     . GLU B 2 408 ? 33.37959 35.38640  -20.16805 1.000 51.11545  ? 396 GLU B O     1 
ATOM   7236 C  CB    . GLU B 2 408 ? 33.15543 35.26822  -23.48318 1.000 60.75374  ? 396 GLU B CB    1 
ATOM   7237 C  CG    . GLU B 2 408 ? 32.43262 34.88648  -24.77518 1.000 62.22393  ? 396 GLU B CG    1 
ATOM   7238 C  CD    . GLU B 2 408 ? 32.36310 33.39218  -24.96460 1.000 72.13650  ? 396 GLU B CD    1 
ATOM   7239 O  OE1   . GLU B 2 408 ? 31.30217 32.89032  -25.40946 1.000 74.49874  ? 396 GLU B OE1   1 
ATOM   7240 O  OE2   . GLU B 2 408 ? 33.37511 32.71780  -24.65571 1.000 71.53255  ? 396 GLU B OE2   1 
ATOM   7241 N  N     . THR B 2 409 ? 32.89930 37.36362  -21.13051 1.000 54.67156  ? 397 THR B N     1 
ATOM   7242 C  CA    . THR B 2 409 ? 33.47267 38.15302  -20.03459 1.000 50.18804  ? 397 THR B CA    1 
ATOM   7243 C  C     . THR B 2 409 ? 32.79735 37.81607  -18.71127 1.000 50.87987  ? 397 THR B C     1 
ATOM   7244 O  O     . THR B 2 409 ? 33.45955 37.51305  -17.69707 1.000 54.01859  ? 397 THR B O     1 
ATOM   7245 C  CB    . THR B 2 409 ? 33.31111 39.65623  -20.32718 1.000 52.48321  ? 397 THR B CB    1 
ATOM   7246 O  OG1   . THR B 2 409 ? 33.81646 39.98905  -21.63428 1.000 47.49631  ? 397 THR B OG1   1 
ATOM   7247 C  CG2   . THR B 2 409 ? 34.01413 40.50013  -19.26179 1.000 48.34521  ? 397 THR B CG2   1 
ATOM   7248 N  N     . TRP B 2 410 ? 31.46607 37.89281  -18.70424 1.000 49.01673  ? 398 TRP B N     1 
ATOM   7249 C  CA    . TRP B 2 410 ? 30.70142 37.54890  -17.51587 1.000 48.42178  ? 398 TRP B CA    1 
ATOM   7250 C  C     . TRP B 2 410 ? 31.04362 36.14813  -17.02832 1.000 48.14781  ? 398 TRP B C     1 
ATOM   7251 O  O     . TRP B 2 410 ? 31.41388 35.95271  -15.86568 1.000 50.34831  ? 398 TRP B O     1 
ATOM   7252 C  CB    . TRP B 2 410 ? 29.20858 37.66313  -17.81369 1.000 44.93081  ? 398 TRP B CB    1 
ATOM   7253 C  CG    . TRP B 2 410 ? 28.36736 37.30604  -16.65266 1.000 42.74637  ? 398 TRP B CG    1 
ATOM   7254 C  CD1   . TRP B 2 410 ? 27.83048 36.09194  -16.37245 1.000 43.88909  ? 398 TRP B CD1   1 
ATOM   7255 C  CD2   . TRP B 2 410 ? 27.97472 38.17286  -15.59432 1.000 45.43490  ? 398 TRP B CD2   1 
ATOM   7256 N  NE1   . TRP B 2 410 ? 27.11598 36.14493  -15.20568 1.000 40.89318  ? 398 TRP B NE1   1 
ATOM   7257 C  CE2   . TRP B 2 410 ? 27.18750 37.41781  -14.70815 1.000 45.51169  ? 398 TRP B CE2   1 
ATOM   7258 C  CE3   . TRP B 2 410 ? 28.19496 39.52460  -15.31763 1.000 42.81297  ? 398 TRP B CE3   1 
ATOM   7259 C  CZ2   . TRP B 2 410 ? 26.61955 37.96934  -13.56218 1.000 45.76364  ? 398 TRP B CZ2   1 
ATOM   7260 C  CZ3   . TRP B 2 410 ? 27.64059 40.06556  -14.17318 1.000 44.37922  ? 398 TRP B CZ3   1 
ATOM   7261 C  CH2   . TRP B 2 410 ? 26.85863 39.29166  -13.31309 1.000 42.71520  ? 398 TRP B CH2   1 
ATOM   7262 N  N     . GLU B 2 411 ? 30.92672 35.14896  -17.90430 1.000 46.33777  ? 399 GLU B N     1 
ATOM   7263 C  CA    . GLU B 2 411 ? 31.15504 33.78729  -17.43827 1.000 50.64615  ? 399 GLU B CA    1 
ATOM   7264 C  C     . GLU B 2 411 ? 32.58696 33.59069  -16.95096 1.000 48.40894  ? 399 GLU B C     1 
ATOM   7265 O  O     . GLU B 2 411 ? 32.81447 32.84517  -15.98761 1.000 47.15042  ? 399 GLU B O     1 
ATOM   7266 C  CB    . GLU B 2 411 ? 30.79638 32.78736  -18.53265 1.000 57.92309  ? 399 GLU B CB    1 
ATOM   7267 C  CG    . GLU B 2 411 ? 29.29239 32.75220  -18.82893 1.000 56.04326  ? 399 GLU B CG    1 
ATOM   7268 C  CD    . GLU B 2 411 ? 28.93778 31.79911  -19.95438 1.000 64.67312  ? 399 GLU B CD    1 
ATOM   7269 O  OE1   . GLU B 2 411 ? 29.86030 31.37997  -20.69562 1.000 59.06900  ? 399 GLU B OE1   1 
ATOM   7270 O  OE2   . GLU B 2 411 ? 27.73612 31.47147  -20.09272 1.000 70.98316  ? 399 GLU B OE2   1 
ATOM   7271 N  N     . THR B 2 412 ? 33.55218 34.29171  -17.55394 1.000 45.04579  ? 400 THR B N     1 
ATOM   7272 C  CA    . THR B 2 412 ? 34.92824 34.22664  -17.07116 1.000 47.00019  ? 400 THR B CA    1 
ATOM   7273 C  C     . THR B 2 412 ? 35.03287 34.67907  -15.62124 1.000 51.57937  ? 400 THR B C     1 
ATOM   7274 O  O     . THR B 2 412 ? 35.74493 34.05361  -14.82769 1.000 51.81760  ? 400 THR B O     1 
ATOM   7275 C  CB    . THR B 2 412 ? 35.86223 35.09140  -17.93047 1.000 52.20433  ? 400 THR B CB    1 
ATOM   7276 O  OG1   . THR B 2 412 ? 35.84351 34.66467  -19.29754 1.000 57.21029  ? 400 THR B OG1   1 
ATOM   7277 C  CG2   . THR B 2 412 ? 37.30003 35.01146  -17.41206 1.000 49.88737  ? 400 THR B CG2   1 
ATOM   7278 N  N     . TRP B 2 413 ? 34.36187 35.78686  -15.25036 1.000 53.59002  ? 401 TRP B N     1 
ATOM   7279 C  CA    . TRP B 2 413 ? 34.70524 36.39276  -13.95933 1.000 49.83138  ? 401 TRP B CA    1 
ATOM   7280 C  C     . TRP B 2 413 ? 33.63145 36.47068  -12.87065 1.000 48.82265  ? 401 TRP B C     1 
ATOM   7281 O  O     . TRP B 2 413 ? 33.99453 36.74858  -11.72400 1.000 46.31755  ? 401 TRP B O     1 
ATOM   7282 C  CB    . TRP B 2 413 ? 35.26658 37.80178  -14.17366 1.000 49.29609  ? 401 TRP B CB    1 
ATOM   7283 C  CG    . TRP B 2 413 ? 36.72636 37.75286  -14.46330 1.000 51.48658  ? 401 TRP B CG    1 
ATOM   7284 C  CD1   . TRP B 2 413 ? 37.72733 37.39229  -13.59884 1.000 52.09065  ? 401 TRP B CD1   1 
ATOM   7285 C  CD2   . TRP B 2 413 ? 37.35641 38.06117  -15.70022 1.000 48.04970  ? 401 TRP B CD2   1 
ATOM   7286 N  NE1   . TRP B 2 413 ? 38.94569 37.46328  -14.23012 1.000 51.22587  ? 401 TRP B NE1   1 
ATOM   7287 C  CE2   . TRP B 2 413 ? 38.74499 37.87156  -15.52275 1.000 52.37620  ? 401 TRP B CE2   1 
ATOM   7288 C  CE3   . TRP B 2 413 ? 36.88492 38.48858  -16.94256 1.000 55.86848  ? 401 TRP B CE3   1 
ATOM   7289 C  CZ2   . TRP B 2 413 ? 39.66746 38.08866  -16.54663 1.000 56.86924  ? 401 TRP B CZ2   1 
ATOM   7290 C  CZ3   . TRP B 2 413 ? 37.80258 38.70869  -17.96351 1.000 62.55388  ? 401 TRP B CZ3   1 
ATOM   7291 C  CH2   . TRP B 2 413 ? 39.17976 38.50502  -17.75716 1.000 60.35678  ? 401 TRP B CH2   1 
ATOM   7292 N  N     . TRP B 2 414 ? 32.34812 36.21327  -13.14833 1.000 47.86957  ? 402 TRP B N     1 
ATOM   7293 C  CA    . TRP B 2 414 ? 31.32722 36.64954  -12.18450 1.000 50.53539  ? 402 TRP B CA    1 
ATOM   7294 C  C     . TRP B 2 414 ? 31.40810 35.94023  -10.83522 1.000 50.34950  ? 402 TRP B C     1 
ATOM   7295 O  O     . TRP B 2 414 ? 31.00822 36.52832  -9.82262  1.000 49.30466  ? 402 TRP B O     1 
ATOM   7296 C  CB    . TRP B 2 414 ? 29.91323 36.49446  -12.74642 1.000 46.18117  ? 402 TRP B CB    1 
ATOM   7297 C  CG    . TRP B 2 414 ? 29.44788 35.09928  -12.94380 1.000 47.20095  ? 402 TRP B CG    1 
ATOM   7298 C  CD1   . TRP B 2 414 ? 29.63611 34.33636  -14.05029 1.000 45.35591  ? 402 TRP B CD1   1 
ATOM   7299 C  CD2   . TRP B 2 414 ? 28.67164 34.30499  -12.03220 1.000 44.59906  ? 402 TRP B CD2   1 
ATOM   7300 N  NE1   . TRP B 2 414 ? 29.03810 33.11472  -13.88796 1.000 49.90017  ? 402 TRP B NE1   1 
ATOM   7301 C  CE2   . TRP B 2 414 ? 28.43572 33.06697  -12.65869 1.000 46.76629  ? 402 TRP B CE2   1 
ATOM   7302 C  CE3   . TRP B 2 414 ? 28.15087 34.52121  -10.75376 1.000 44.53119  ? 402 TRP B CE3   1 
ATOM   7303 C  CZ2   . TRP B 2 414 ? 27.70934 32.03679  -12.04522 1.000 40.90534  ? 402 TRP B CZ2   1 
ATOM   7304 C  CZ3   . TRP B 2 414 ? 27.42745 33.49909  -10.14626 1.000 43.19733  ? 402 TRP B CZ3   1 
ATOM   7305 C  CH2   . TRP B 2 414 ? 27.21700 32.27344  -10.79377 1.000 41.63732  ? 402 TRP B CH2   1 
ATOM   7306 N  N     . THR B 2 415 ? 31.89236 34.69259  -10.78390 1.000 49.81370  ? 403 THR B N     1 
ATOM   7307 C  CA    . THR B 2 415 ? 31.87181 33.96152  -9.51800  1.000 48.22207  ? 403 THR B CA    1 
ATOM   7308 C  C     . THR B 2 415 ? 32.95220 34.42888  -8.55463  1.000 51.58750  ? 403 THR B C     1 
ATOM   7309 O  O     . THR B 2 415 ? 32.87148 34.12919  -7.35622  1.000 52.50276  ? 403 THR B O     1 
ATOM   7310 C  CB    . THR B 2 415 ? 32.00039 32.45012  -9.75251  1.000 47.82149  ? 403 THR B CB    1 
ATOM   7311 O  OG1   . THR B 2 415 ? 33.35491 32.11368  -10.08753 1.000 52.44888  ? 403 THR B OG1   1 
ATOM   7312 C  CG2   . THR B 2 415 ? 31.10772 32.03647  -10.88164 1.000 44.03585  ? 403 THR B CG2   1 
ATOM   7313 N  N     . GLU B 2 416 ? 33.94446 35.17177  -9.03991  1.000 51.41413  ? 404 GLU B N     1 
ATOM   7314 C  CA    . GLU B 2 416 ? 34.90244 35.79140  -8.13677  1.000 51.78621  ? 404 GLU B CA    1 
ATOM   7315 C  C     . GLU B 2 416 ? 34.29114 36.90371  -7.29399  1.000 47.49148  ? 404 GLU B C     1 
ATOM   7316 O  O     . GLU B 2 416 ? 34.95924 37.38352  -6.37496  1.000 49.14666  ? 404 GLU B O     1 
ATOM   7317 C  CB    . GLU B 2 416 ? 36.09797 36.34372  -8.92580  1.000 54.82097  ? 404 GLU B CB    1 
ATOM   7318 C  CG    . GLU B 2 416 ? 36.87044 35.28809  -9.71298  1.000 59.03357  ? 404 GLU B CG    1 
ATOM   7319 C  CD    . GLU B 2 416 ? 37.66514 34.34913  -8.81926  1.000 62.77577  ? 404 GLU B CD    1 
ATOM   7320 O  OE1   . GLU B 2 416 ? 38.74946 34.76037  -8.33280  1.000 55.41504  ? 404 GLU B OE1   1 
ATOM   7321 O  OE2   . GLU B 2 416 ? 37.19975 33.20176  -8.61105  1.000 64.39878  ? 404 GLU B OE2   1 
ATOM   7322 N  N     . TYR B 2 417 ? 33.05840 37.33975  -7.57694  1.000 47.13668  ? 405 TYR B N     1 
ATOM   7323 C  CA    . TYR B 2 417 ? 32.44556 38.40366  -6.78985  1.000 46.16723  ? 405 TYR B CA    1 
ATOM   7324 C  C     . TYR B 2 417 ? 31.07682 38.00731  -6.24290  1.000 50.48124  ? 405 TYR B C     1 
ATOM   7325 O  O     . TYR B 2 417 ? 30.41295 38.83788  -5.60361  1.000 52.90420  ? 405 TYR B O     1 
ATOM   7326 C  CB    . TYR B 2 417 ? 32.34200 39.70638  -7.60923  1.000 46.96471  ? 405 TYR B CB    1 
ATOM   7327 C  CG    . TYR B 2 417 ? 33.60274 39.98564  -8.40720  1.000 48.74214  ? 405 TYR B CG    1 
ATOM   7328 C  CD1   . TYR B 2 417 ? 34.81749 40.22707  -7.77173  1.000 43.83269  ? 405 TYR B CD1   1 
ATOM   7329 C  CD2   . TYR B 2 417 ? 33.59138 39.95070  -9.79362  1.000 47.04505  ? 405 TYR B CD2   1 
ATOM   7330 C  CE1   . TYR B 2 417 ? 35.97986 40.44610  -8.49775  1.000 42.89572  ? 405 TYR B CE1   1 
ATOM   7331 C  CE2   . TYR B 2 417 ? 34.74905 40.16478  -10.52667 1.000 48.32159  ? 405 TYR B CE2   1 
ATOM   7332 C  CZ    . TYR B 2 417 ? 35.93890 40.41265  -9.87608  1.000 48.47837  ? 405 TYR B CZ    1 
ATOM   7333 O  OH    . TYR B 2 417 ? 37.08289 40.63398  -10.61783 1.000 52.42012  ? 405 TYR B OH    1 
ATOM   7334 N  N     . TRP B 2 418 ? 30.64141 36.76053  -6.44084  1.000 49.58176  ? 406 TRP B N     1 
ATOM   7335 C  CA    . TRP B 2 418 ? 29.34344 36.33962  -5.92474  1.000 49.25699  ? 406 TRP B CA    1 
ATOM   7336 C  C     . TRP B 2 418 ? 29.40290 36.03546  -4.43264  1.000 48.46009  ? 406 TRP B C     1 
ATOM   7337 O  O     . TRP B 2 418 ? 30.34254 35.40134  -3.94362  1.000 52.72837  ? 406 TRP B O     1 
ATOM   7338 C  CB    . TRP B 2 418 ? 28.83689 35.11813  -6.67602  1.000 48.90637  ? 406 TRP B CB    1 
ATOM   7339 C  CG    . TRP B 2 418 ? 27.35741 34.99068  -6.60541  1.000 47.14256  ? 406 TRP B CG    1 
ATOM   7340 C  CD1   . TRP B 2 418 ? 26.64217 34.20696  -5.75281  1.000 48.55362  ? 406 TRP B CD1   1 
ATOM   7341 C  CD2   . TRP B 2 418 ? 26.40375 35.67251  -7.42182  1.000 43.73742  ? 406 TRP B CD2   1 
ATOM   7342 N  NE1   . TRP B 2 418 ? 25.29787 34.34056  -5.99965  1.000 48.47623  ? 406 TRP B NE1   1 
ATOM   7343 C  CE2   . TRP B 2 418 ? 25.12447 35.24031  -7.01810  1.000 47.64581  ? 406 TRP B CE2   1 
ATOM   7344 C  CE3   . TRP B 2 418 ? 26.50509 36.60462  -8.45772  1.000 42.17744  ? 406 TRP B CE3   1 
ATOM   7345 C  CZ2   . TRP B 2 418 ? 23.95348 35.71578  -7.60931  1.000 43.71855  ? 406 TRP B CZ2   1 
ATOM   7346 C  CZ3   . TRP B 2 418 ? 25.33798 37.07407  -9.04711  1.000 41.39239  ? 406 TRP B CZ3   1 
ATOM   7347 C  CH2   . TRP B 2 418 ? 24.08361 36.63042  -8.61911  1.000 41.10159  ? 406 TRP B CH2   1 
ATOM   7348 N  N     . GLN B 2 419 ? 28.37499 36.47440  -3.71971  1.000 48.37469  ? 407 GLN B N     1 
ATOM   7349 C  CA    . GLN B 2 419 ? 28.32827 36.36003  -2.27132  1.000 49.97268  ? 407 GLN B CA    1 
ATOM   7350 C  C     . GLN B 2 419 ? 26.97362 35.90508  -1.75289  1.000 50.05588  ? 407 GLN B C     1 
ATOM   7351 O  O     . GLN B 2 419 ? 26.80183 35.81386  -0.53386  1.000 52.54284  ? 407 GLN B O     1 
ATOM   7352 C  CB    . GLN B 2 419 ? 28.69662 37.70492  -1.62174  1.000 52.19201  ? 407 GLN B CB    1 
ATOM   7353 C  CG    . GLN B 2 419 ? 30.17875 37.99927  -1.62954  1.000 58.66962  ? 407 GLN B CG    1 
ATOM   7354 C  CD    . GLN B 2 419 ? 30.94508 37.12151  -0.65330  1.000 67.19036  ? 407 GLN B CD    1 
ATOM   7355 O  OE1   . GLN B 2 419 ? 31.88039 36.41601  -1.02963  1.000 61.52822  ? 407 GLN B OE1   1 
ATOM   7356 N  NE2   . GLN B 2 419 ? 30.55328 37.17259  0.61507   1.000 75.09214  ? 407 GLN B NE2   1 
ATOM   7357 N  N     . ALA B 2 420 ? 26.01663 35.62254  -2.62839  1.000 47.16551  ? 408 ALA B N     1 
ATOM   7358 C  CA    . ALA B 2 420 ? 24.69240 35.15386  -2.25298  1.000 49.48918  ? 408 ALA B CA    1 
ATOM   7359 C  C     . ALA B 2 420 ? 24.59666 33.63542  -2.40491  1.000 50.02080  ? 408 ALA B C     1 
ATOM   7360 O  O     . ALA B 2 420 ? 25.44647 32.99079  -3.02222  1.000 46.81373  ? 408 ALA B O     1 
ATOM   7361 C  CB    . ALA B 2 420 ? 23.62534 35.84621  -3.11099  1.000 48.07397  ? 408 ALA B CB    1 
ATOM   7362 N  N     . THR B 2 421 ? 23.52743 33.06253  -1.84845  1.000 48.95397  ? 409 THR B N     1 
ATOM   7363 C  CA    . THR B 2 421 ? 23.31559 31.62292  -1.92491  1.000 48.47874  ? 409 THR B CA    1 
ATOM   7364 C  C     . THR B 2 421 ? 22.38206 31.20972  -3.04929  1.000 51.76209  ? 409 THR B C     1 
ATOM   7365 O  O     . THR B 2 421 ? 22.30831 30.01258  -3.36111  1.000 48.56023  ? 409 THR B O     1 
ATOM   7366 C  CB    . THR B 2 421 ? 22.76609 31.09674  -0.60039  1.000 54.40538  ? 409 THR B CB    1 
ATOM   7367 O  OG1   . THR B 2 421 ? 21.42426 31.56600  -0.41315  1.000 55.92418  ? 409 THR B OG1   1 
ATOM   7368 C  CG2   . THR B 2 421 ? 23.64357 31.58286  0.55175   1.000 56.32712  ? 409 THR B CG2   1 
ATOM   7369 N  N     . TRP B 2 422 ? 21.65533 32.15904  -3.63900  1.000 51.30239  ? 410 TRP B N     1 
ATOM   7370 C  CA    . TRP B 2 422 ? 20.85749 31.93698  -4.83662  1.000 47.29780  ? 410 TRP B CA    1 
ATOM   7371 C  C     . TRP B 2 422 ? 21.57730 32.51031  -6.05671  1.000 45.36897  ? 410 TRP B C     1 
ATOM   7372 O  O     . TRP B 2 422 ? 22.54746 33.26639  -5.94983  1.000 44.01730  ? 410 TRP B O     1 
ATOM   7373 C  CB    . TRP B 2 422 ? 19.46861 32.56256  -4.68776  1.000 43.99064  ? 410 TRP B CB    1 
ATOM   7374 C  CG    . TRP B 2 422 ? 19.46088 33.81952  -3.86622  1.000 50.96601  ? 410 TRP B CG    1 
ATOM   7375 C  CD1   . TRP B 2 422 ? 18.95925 33.96494  -2.61504  1.000 53.15560  ? 410 TRP B CD1   1 
ATOM   7376 C  CD2   . TRP B 2 422 ? 19.99340 35.10100  -4.23367  1.000 49.37851  ? 410 TRP B CD2   1 
ATOM   7377 N  NE1   . TRP B 2 422 ? 19.13945 35.25120  -2.17526  1.000 53.04461  ? 410 TRP B NE1   1 
ATOM   7378 C  CE2   . TRP B 2 422 ? 19.77638 35.96857  -3.14940  1.000 47.88944  ? 410 TRP B CE2   1 
ATOM   7379 C  CE3   . TRP B 2 422 ? 20.62730 35.59726  -5.37439  1.000 47.94943  ? 410 TRP B CE3   1 
ATOM   7380 C  CZ2   . TRP B 2 422 ? 20.16731 37.30473  -3.16827  1.000 49.41209  ? 410 TRP B CZ2   1 
ATOM   7381 C  CZ3   . TRP B 2 422 ? 21.02042 36.92427  -5.38935  1.000 53.29592  ? 410 TRP B CZ3   1 
ATOM   7382 C  CH2   . TRP B 2 422 ? 20.78643 37.76490  -4.29209  1.000 47.83052  ? 410 TRP B CH2   1 
ATOM   7383 N  N     . ILE B 2 423 ? 21.10447 32.11281  -7.23139  1.000 38.23998  ? 411 ILE B N     1 
ATOM   7384 C  CA    . ILE B 2 423 ? 21.64010 32.61694  -8.48999  1.000 38.58401  ? 411 ILE B CA    1 
ATOM   7385 C  C     . ILE B 2 423 ? 20.46734 32.86045  -9.42692  1.000 41.58015  ? 411 ILE B C     1 
ATOM   7386 O  O     . ILE B 2 423 ? 19.73017 31.91305  -9.74088  1.000 44.23220  ? 411 ILE B O     1 
ATOM   7387 C  CB    . ILE B 2 423 ? 22.63797 31.63824  -9.12252  1.000 42.04566  ? 411 ILE B CB    1 
ATOM   7388 C  CG1   . ILE B 2 423 ? 23.76579 31.29369  -8.15937  1.000 41.57025  ? 411 ILE B CG1   1 
ATOM   7389 C  CG2   . ILE B 2 423 ? 23.19907 32.21330  -10.40414 1.000 42.47019  ? 411 ILE B CG2   1 
ATOM   7390 C  CD1   . ILE B 2 423 ? 24.35879 29.92745  -8.43208  1.000 43.03896  ? 411 ILE B CD1   1 
ATOM   7391 N  N     . PRO B 2 424 ? 20.24869 34.09127  -9.87974  1.000 37.50571  ? 412 PRO B N     1 
ATOM   7392 C  CA    . PRO B 2 424 ? 19.13017 34.36428  -10.78164 1.000 40.47603  ? 412 PRO B CA    1 
ATOM   7393 C  C     . PRO B 2 424 ? 19.44893 33.93953  -12.20111 1.000 41.38304  ? 412 PRO B C     1 
ATOM   7394 O  O     . PRO B 2 424 ? 20.60672 33.80312  -12.59533 1.000 42.12242  ? 412 PRO B O     1 
ATOM   7395 C  CB    . PRO B 2 424 ? 18.98051 35.88463  -10.70470 1.000 44.02558  ? 412 PRO B CB    1 
ATOM   7396 C  CG    . PRO B 2 424 ? 20.37351 36.35056  -10.45981 1.000 43.33310  ? 412 PRO B CG    1 
ATOM   7397 C  CD    . PRO B 2 424 ? 20.99779 35.31357  -9.55076  1.000 38.39580  ? 412 PRO B CD    1 
ATOM   7398 N  N     . GLU B 2 425 ? 18.38647 33.74961  -12.97168 1.000 41.03007  ? 413 GLU B N     1 
ATOM   7399 C  CA    . GLU B 2 425 ? 18.53797 33.50905  -14.39275 1.000 40.61935  ? 413 GLU B CA    1 
ATOM   7400 C  C     . GLU B 2 425 ? 18.94641 34.78979  -15.09904 1.000 40.93968  ? 413 GLU B C     1 
ATOM   7401 O  O     . GLU B 2 425 ? 18.57759 35.89090  -14.68637 1.000 44.05295  ? 413 GLU B O     1 
ATOM   7402 C  CB    . GLU B 2 425 ? 17.23719 32.97377  -14.96537 1.000 43.51644  ? 413 GLU B CB    1 
ATOM   7403 C  CG    . GLU B 2 425 ? 16.85336 31.64821  -14.33984 1.000 50.07976  ? 413 GLU B CG    1 
ATOM   7404 C  CD    . GLU B 2 425 ? 16.07824 30.75645  -15.29372 1.000 62.88173  ? 413 GLU B CD    1 
ATOM   7405 O  OE1   . GLU B 2 425 ? 16.30142 30.84652  -16.53256 1.000 62.66878  ? 413 GLU B OE1   1 
ATOM   7406 O  OE2   . GLU B 2 425 ? 15.23573 29.97241  -14.79720 1.000 63.90350  ? 413 GLU B OE2   1 
ATOM   7407 N  N     . TRP B 2 426 ? 19.72209 34.64563  -16.17124 1.000 36.34472  ? 414 TRP B N     1 
ATOM   7408 C  CA    . TRP B 2 426 ? 20.13920 35.81789  -16.91889 1.000 39.73844  ? 414 TRP B CA    1 
ATOM   7409 C  C     . TRP B 2 426 ? 20.30811 35.49660  -18.39585 1.000 46.31992  ? 414 TRP B C     1 
ATOM   7410 O  O     . TRP B 2 426 ? 20.42557 34.33998  -18.80430 1.000 46.91602  ? 414 TRP B O     1 
ATOM   7411 C  CB    . TRP B 2 426 ? 21.43493 36.40953  -16.36195 1.000 40.90323  ? 414 TRP B CB    1 
ATOM   7412 C  CG    . TRP B 2 426 ? 22.56737 35.45082  -16.21895 1.000 38.09670  ? 414 TRP B CG    1 
ATOM   7413 C  CD1   . TRP B 2 426 ? 23.13699 34.70935  -17.20316 1.000 38.31901  ? 414 TRP B CD1   1 
ATOM   7414 C  CD2   . TRP B 2 426 ? 23.30349 35.15816  -15.01594 1.000 40.88471  ? 414 TRP B CD2   1 
ATOM   7415 N  NE1   . TRP B 2 426 ? 24.16957 33.95189  -16.69009 1.000 42.04459  ? 414 TRP B NE1   1 
ATOM   7416 C  CE2   . TRP B 2 426 ? 24.29458 34.21249  -15.35256 1.000 38.37367  ? 414 TRP B CE2   1 
ATOM   7417 C  CE3   . TRP B 2 426 ? 23.21679 35.60187  -13.69092 1.000 38.09860  ? 414 TRP B CE3   1 
ATOM   7418 C  CZ2   . TRP B 2 426 ? 25.18897 33.70299  -14.42016 1.000 39.24547  ? 414 TRP B CZ2   1 
ATOM   7419 C  CZ3   . TRP B 2 426 ? 24.10561 35.09153  -12.76315 1.000 40.59212  ? 414 TRP B CZ3   1 
ATOM   7420 C  CH2   . TRP B 2 426 ? 25.07907 34.15137  -13.13165 1.000 41.90480  ? 414 TRP B CH2   1 
ATOM   7421 N  N     . GLU B 2 427 ? 20.29791 36.55482  -19.19708 1.000 49.04946  ? 415 GLU B N     1 
ATOM   7422 C  CA    . GLU B 2 427 ? 20.67304 36.48646  -20.59791 1.000 49.92257  ? 415 GLU B CA    1 
ATOM   7423 C  C     . GLU B 2 427 ? 21.48784 37.73476  -20.89898 1.000 47.65035  ? 415 GLU B C     1 
ATOM   7424 O  O     . GLU B 2 427 ? 21.51148 38.67603  -20.10425 1.000 47.97882  ? 415 GLU B O     1 
ATOM   7425 C  CB    . GLU B 2 427 ? 19.44452 36.36097  -21.51512 1.000 51.48222  ? 415 GLU B CB    1 
ATOM   7426 C  CG    . GLU B 2 427 ? 18.59846 37.61575  -21.62338 1.000 55.88300  ? 415 GLU B CG    1 
ATOM   7427 C  CD    . GLU B 2 427 ? 17.29087 37.39336  -22.38605 1.000 64.94519  ? 415 GLU B CD    1 
ATOM   7428 O  OE1   . GLU B 2 427 ? 17.15034 36.34649  -23.05271 1.000 65.37487  ? 415 GLU B OE1   1 
ATOM   7429 O  OE2   . GLU B 2 427 ? 16.39809 38.26928  -22.31282 1.000 70.04725  ? 415 GLU B OE2   1 
ATOM   7430 N  N     . PHE B 2 428 ? 22.18421 37.73032  -22.03368 1.000 51.39140  ? 416 PHE B N     1 
ATOM   7431 C  CA    . PHE B 2 428 ? 23.06323 38.83327  -22.40594 1.000 52.82236  ? 416 PHE B CA    1 
ATOM   7432 C  C     . PHE B 2 428 ? 22.50786 39.58409  -23.61065 1.000 54.30732  ? 416 PHE B C     1 
ATOM   7433 O  O     . PHE B 2 428 ? 21.86316 39.00062  -24.48861 1.000 61.09041  ? 416 PHE B O     1 
ATOM   7434 C  CB    . PHE B 2 428 ? 24.47840 38.33302  -22.70008 1.000 43.50593  ? 416 PHE B CB    1 
ATOM   7435 C  CG    . PHE B 2 428 ? 25.01186 37.43550  -21.64162 1.000 47.63616  ? 416 PHE B CG    1 
ATOM   7436 C  CD1   . PHE B 2 428 ? 25.60342 37.96130  -20.50276 1.000 47.15479  ? 416 PHE B CD1   1 
ATOM   7437 C  CD2   . PHE B 2 428 ? 24.89462 36.05294  -21.76218 1.000 48.35813  ? 416 PHE B CD2   1 
ATOM   7438 C  CE1   . PHE B 2 428 ? 26.08813 37.11619  -19.49551 1.000 47.07740  ? 416 PHE B CE1   1 
ATOM   7439 C  CE2   . PHE B 2 428 ? 25.37501 35.20769  -20.77243 1.000 44.42622  ? 416 PHE B CE2   1 
ATOM   7440 C  CZ    . PHE B 2 428 ? 25.97218 35.73945  -19.63465 1.000 44.12733  ? 416 PHE B CZ    1 
ATOM   7441 N  N     . VAL B 2 429 ? 22.75178 40.89559  -23.63431 1.000 50.35336  ? 417 VAL B N     1 
ATOM   7442 C  CA    . VAL B 2 429 ? 22.25796 41.76233  -24.69329 1.000 60.24199  ? 417 VAL B CA    1 
ATOM   7443 C  C     . VAL B 2 429 ? 23.35961 42.71835  -25.11626 1.000 65.34241  ? 417 VAL B C     1 
ATOM   7444 O  O     . VAL B 2 429 ? 24.35248 42.91129  -24.41516 1.000 66.30010  ? 417 VAL B O     1 
ATOM   7445 C  CB    . VAL B 2 429 ? 21.02101 42.57091  -24.26116 1.000 56.56432  ? 417 VAL B CB    1 
ATOM   7446 C  CG1   . VAL B 2 429 ? 19.87170 41.64223  -23.95615 1.000 62.84000  ? 417 VAL B CG1   1 
ATOM   7447 C  CG2   . VAL B 2 429 ? 21.35480 43.41610  -23.06087 1.000 51.67443  ? 417 VAL B CG2   1 
ATOM   7448 N  N     . ASN B 2 430 ? 23.16162 43.32486  -26.27993 1.000 74.47355  ? 418 ASN B N     1 
ATOM   7449 C  CA    . ASN B 2 430 ? 23.99194 44.41730  -26.77992 1.000 76.67138  ? 418 ASN B CA    1 
ATOM   7450 C  C     . ASN B 2 430 ? 23.10200 45.65855  -26.75121 1.000 76.90503  ? 418 ASN B C     1 
ATOM   7451 O  O     . ASN B 2 430 ? 22.32709 45.91270  -27.67661 1.000 75.69888  ? 418 ASN B O     1 
ATOM   7452 C  CB    . ASN B 2 430 ? 24.52745 44.09652  -28.17540 1.000 76.22527  ? 418 ASN B CB    1 
ATOM   7453 C  CG    . ASN B 2 430 ? 24.92384 42.63212  -28.31649 1.000 81.93286  ? 418 ASN B CG    1 
ATOM   7454 O  OD1   . ASN B 2 430 ? 26.01810 42.22287  -27.90417 1.000 79.99701  ? 418 ASN B OD1   1 
ATOM   7455 N  ND2   . ASN B 2 430 ? 24.02130 41.82873  -28.87842 1.000 79.47612  ? 418 ASN B ND2   1 
ATOM   7456 N  N     . THR B 2 431 ? 23.20532 46.41476  -25.66209 1.000 77.57659  ? 419 THR B N     1 
ATOM   7457 C  CA    . THR B 2 431 ? 22.26788 47.50299  -25.41166 1.000 82.21557  ? 419 THR B CA    1 
ATOM   7458 C  C     . THR B 2 431 ? 22.43410 48.61737  -26.44430 1.000 82.73357  ? 419 THR B C     1 
ATOM   7459 O  O     . THR B 2 431 ? 23.55772 48.97830  -26.80609 1.000 84.82543  ? 419 THR B O     1 
ATOM   7460 C  CB    . THR B 2 431 ? 22.46373 48.07124  -24.00377 1.000 77.78061  ? 419 THR B CB    1 
ATOM   7461 N  N     . PRO B 2 432 ? 21.34029 49.18912  -26.92539 1.000 84.28267  ? 420 PRO B N     1 
ATOM   7462 C  CA    . PRO B 2 432 ? 21.43912 50.35965  -27.79699 1.000 85.00334  ? 420 PRO B CA    1 
ATOM   7463 C  C     . PRO B 2 432 ? 21.63138 51.61307  -26.96519 1.000 82.23602  ? 420 PRO B C     1 
ATOM   7464 O  O     . PRO B 2 432 ? 20.74470 51.97880  -26.17753 1.000 80.70843  ? 420 PRO B O     1 
ATOM   7465 C  CB    . PRO B 2 432 ? 20.08600 50.37623  -28.52984 1.000 85.20441  ? 420 PRO B CB    1 
ATOM   7466 C  CG    . PRO B 2 432 ? 19.23628 49.25999  -27.86897 1.000 89.02969  ? 420 PRO B CG    1 
ATOM   7467 C  CD    . PRO B 2 432 ? 19.94590 48.84991  -26.61438 1.000 83.20993  ? 420 PRO B CD    1 
ATOM   7468 N  N     . PRO B 2 433 ? 22.76727 52.32184  -27.13290 1.000 83.91783  ? 421 PRO B N     1 
ATOM   7469 C  CA    . PRO B 2 433 ? 23.10914 53.42862  -26.21254 1.000 83.07940  ? 421 PRO B CA    1 
ATOM   7470 C  C     . PRO B 2 433 ? 22.02286 54.50051  -26.08691 1.000 79.83830  ? 421 PRO B C     1 
ATOM   7471 O  O     . PRO B 2 433 ? 22.11568 55.40055  -25.23650 1.000 81.17191  ? 421 PRO B O     1 
ATOM   7472 C  CB    . PRO B 2 433 ? 24.40408 54.00098  -26.81262 1.000 80.58220  ? 421 PRO B CB    1 
ATOM   7473 C  CG    . PRO B 2 433 ? 24.46005 53.47751  -28.24406 1.000 74.96458  ? 421 PRO B CG    1 
ATOM   7474 C  CD    . PRO B 2 433 ? 23.75047 52.15726  -28.22034 1.000 79.39811  ? 421 PRO B CD    1 
ATOM   7475 N  N     . LEU B 2 434 ? 20.97399 54.38544  -26.91046 1.000 75.06903  ? 422 LEU B N     1 
ATOM   7476 C  CA    . LEU B 2 434 ? 19.78537 55.21733  -26.75634 1.000 75.75735  ? 422 LEU B CA    1 
ATOM   7477 C  C     . LEU B 2 434 ? 19.19259 55.10182  -25.35395 1.000 73.86003  ? 422 LEU B C     1 
ATOM   7478 O  O     . LEU B 2 434 ? 19.00901 56.10924  -24.66474 1.000 72.14869  ? 422 LEU B O     1 
ATOM   7479 C  CB    . LEU B 2 434 ? 18.75113 54.83820  -27.81255 1.000 72.54618  ? 422 LEU B CB    1 
ATOM   7480 C  CG    . LEU B 2 434 ? 19.10296 55.38242  -29.19184 1.000 67.34271  ? 422 LEU B CG    1 
ATOM   7481 C  CD1   . LEU B 2 434 ? 17.94749 55.16129  -30.16027 1.000 60.65639  ? 422 LEU B CD1   1 
ATOM   7482 C  CD2   . LEU B 2 434 ? 19.49511 56.86957  -29.08811 1.000 64.86432  ? 422 LEU B CD2   1 
ATOM   7483 N  N     . VAL B 2 435 ? 18.87205 53.87782  -24.91664 1.000 76.12692  ? 423 VAL B N     1 
ATOM   7484 C  CA    . VAL B 2 435 ? 18.25099 53.69238  -23.60059 1.000 74.91478  ? 423 VAL B CA    1 
ATOM   7485 C  C     . VAL B 2 435 ? 19.18418 54.14149  -22.48058 1.000 73.84751  ? 423 VAL B C     1 
ATOM   7486 O  O     . VAL B 2 435 ? 18.73238 54.68654  -21.45652 1.000 69.30855  ? 423 VAL B O     1 
ATOM   7487 C  CB    . VAL B 2 435 ? 17.81288 52.22686  -23.41963 1.000 68.24300  ? 423 VAL B CB    1 
ATOM   7488 C  CG1   . VAL B 2 435 ? 17.08956 52.04442  -22.09145 1.000 60.72319  ? 423 VAL B CG1   1 
ATOM   7489 C  CG2   . VAL B 2 435 ? 16.92776 51.80210  -24.58392 1.000 74.51111  ? 423 VAL B CG2   1 
ATOM   7490 N  N     . LYS B 2 436 ? 20.49173 53.92030  -22.64743 1.000 71.65454  ? 424 LYS B N     1 
ATOM   7491 C  CA    . LYS B 2 436 ? 21.45974 54.50584  -21.72814 1.000 73.51308  ? 424 LYS B CA    1 
ATOM   7492 C  C     . LYS B 2 436 ? 21.24343 56.01150  -21.60407 1.000 77.32587  ? 424 LYS B C     1 
ATOM   7493 O  O     . LYS B 2 436 ? 21.19918 56.55390  -20.49278 1.000 75.99601  ? 424 LYS B O     1 
ATOM   7494 C  CB    . LYS B 2 436 ? 22.88351 54.18819  -22.19226 1.000 72.49438  ? 424 LYS B CB    1 
ATOM   7495 N  N     . LEU B 2 437 ? 21.07248 56.70190  -22.73936 1.000 77.57702  ? 425 LEU B N     1 
ATOM   7496 C  CA    . LEU B 2 437 ? 20.80502 58.14001  -22.67854 1.000 78.36763  ? 425 LEU B CA    1 
ATOM   7497 C  C     . LEU B 2 437 ? 19.45815 58.43005  -22.01164 1.000 76.16765  ? 425 LEU B C     1 
ATOM   7498 O  O     . LEU B 2 437 ? 19.31537 59.41757  -21.27723 1.000 74.45896  ? 425 LEU B O     1 
ATOM   7499 C  CB    . LEU B 2 437 ? 20.85529 58.74577  -24.08327 1.000 77.75935  ? 425 LEU B CB    1 
ATOM   7500 C  CG    . LEU B 2 437 ? 21.23455 60.23148  -24.14024 1.000 89.77414  ? 425 LEU B CG    1 
ATOM   7501 C  CD1   . LEU B 2 437 ? 22.64899 60.46106  -23.59782 1.000 87.45650  ? 425 LEU B CD1   1 
ATOM   7502 C  CD2   . LEU B 2 437 ? 21.08895 60.80806  -25.55673 1.000 87.31276  ? 425 LEU B CD2   1 
ATOM   7503 N  N     . TRP B 2 438 ? 18.46640 57.56705  -22.24521 1.000 72.84111  ? 426 TRP B N     1 
ATOM   7504 C  CA    . TRP B 2 438 ? 17.11843 57.79480  -21.72030 1.000 67.64426  ? 426 TRP B CA    1 
ATOM   7505 C  C     . TRP B 2 438 ? 17.10228 57.79550  -20.19581 1.000 66.95178  ? 426 TRP B C     1 
ATOM   7506 O  O     . TRP B 2 438 ? 16.54640 58.70187  -19.56750 1.000 61.31723  ? 426 TRP B O     1 
ATOM   7507 C  CB    . TRP B 2 438 ? 16.15116 56.72685  -22.23883 1.000 65.20431  ? 426 TRP B CB    1 
ATOM   7508 C  CG    . TRP B 2 438 ? 15.97760 56.60250  -23.74210 1.000 68.24173  ? 426 TRP B CG    1 
ATOM   7509 C  CD1   . TRP B 2 438 ? 15.56351 55.48029  -24.41983 1.000 67.66349  ? 426 TRP B CD1   1 
ATOM   7510 C  CD2   . TRP B 2 438 ? 16.18516 57.61836  -24.74669 1.000 68.34527  ? 426 TRP B CD2   1 
ATOM   7511 N  NE1   . TRP B 2 438 ? 15.51085 55.73083  -25.77183 1.000 70.02178  ? 426 TRP B NE1   1 
ATOM   7512 C  CE2   . TRP B 2 438 ? 15.88524 57.03173  -25.99971 1.000 69.75484  ? 426 TRP B CE2   1 
ATOM   7513 C  CE3   . TRP B 2 438 ? 16.61213 58.95221  -24.71404 1.000 63.78698  ? 426 TRP B CE3   1 
ATOM   7514 C  CZ2   . TRP B 2 438 ? 15.99000 57.73761  -27.19888 1.000 62.27335  ? 426 TRP B CZ2   1 
ATOM   7515 C  CZ3   . TRP B 2 438 ? 16.72591 59.64141  -25.91025 1.000 65.76405  ? 426 TRP B CZ3   1 
ATOM   7516 C  CH2   . TRP B 2 438 ? 16.40290 59.03796  -27.13065 1.000 60.67175  ? 426 TRP B CH2   1 
ATOM   7517 N  N     . TYR B 2 439 ? 17.67507 56.76576  -19.58124 1.000 69.93636  ? 427 TYR B N     1 
ATOM   7518 C  CA    . TYR B 2 439 ? 17.64241 56.66352  -18.12807 1.000 66.50500  ? 427 TYR B CA    1 
ATOM   7519 C  C     . TYR B 2 439 ? 18.81584 57.36229  -17.45809 1.000 71.15221  ? 427 TYR B C     1 
ATOM   7520 O  O     . TYR B 2 439 ? 18.95455 57.26253  -16.23425 1.000 71.29693  ? 427 TYR B O     1 
ATOM   7521 C  CB    . TYR B 2 439 ? 17.60079 55.19529  -17.69047 1.000 58.91762  ? 427 TYR B CB    1 
ATOM   7522 C  CG    . TYR B 2 439 ? 16.27815 54.50579  -17.95456 1.000 59.31803  ? 427 TYR B CG    1 
ATOM   7523 C  CD1   . TYR B 2 439 ? 15.14535 54.81334  -17.20341 1.000 57.83511  ? 427 TYR B CD1   1 
ATOM   7524 C  CD2   . TYR B 2 439 ? 16.16588 53.53462  -18.94379 1.000 56.78496  ? 427 TYR B CD2   1 
ATOM   7525 C  CE1   . TYR B 2 439 ? 13.93536 54.17796  -17.44068 1.000 54.10430  ? 427 TYR B CE1   1 
ATOM   7526 C  CE2   . TYR B 2 439 ? 14.97143 52.90120  -19.18991 1.000 53.10536  ? 427 TYR B CE2   1 
ATOM   7527 C  CZ    . TYR B 2 439 ? 13.86044 53.22242  -18.43489 1.000 58.75387  ? 427 TYR B CZ    1 
ATOM   7528 O  OH    . TYR B 2 439 ? 12.66643 52.58000  -18.68460 1.000 64.84969  ? 427 TYR B OH    1 
ATOM   7529 N  N     . GLN B 2 440 ? 19.65257 58.06357  -18.22620 1.000 74.57144  ? 428 GLN B N     1 
ATOM   7530 C  CA    . GLN B 2 440 ? 20.81856 58.74186  -17.67311 1.000 76.08718  ? 428 GLN B CA    1 
ATOM   7531 C  C     . GLN B 2 440 ? 20.41533 59.66124  -16.52628 1.000 79.11361  ? 428 GLN B C     1 
ATOM   7532 O  O     . GLN B 2 440 ? 19.29218 60.17490  -16.48077 1.000 75.67870  ? 428 GLN B O     1 
ATOM   7533 C  CB    . GLN B 2 440 ? 21.53288 59.54119  -18.76862 1.000 76.05740  ? 428 GLN B CB    1 
ATOM   7534 N  N     . LEU B 2 441 ? 21.34039 59.84706  -15.58167 1.000 84.43195  ? 429 LEU B N     1 
ATOM   7535 C  CA    . LEU B 2 441 ? 21.11905 60.73856  -14.43815 1.000 88.53873  ? 429 LEU B CA    1 
ATOM   7536 C  C     . LEU B 2 441 ? 22.00878 61.99077  -14.51392 1.000 87.43825  ? 429 LEU B C     1 
ATOM   7537 O  O     . LEU B 2 441 ? 22.10811 62.64543  -15.56143 1.000 78.40415  ? 429 LEU B O     1 
ATOM   7538 C  CB    . LEU B 2 441 ? 21.36294 59.99262  -13.12016 1.000 72.36258  ? 429 LEU B CB    1 
ATOM   7539 O  "O5'" . DG  C 3 4   ? 3.73636  37.21858  -36.06574 1.000 67.33190  ? 805 DG  P "O5'" 1 
ATOM   7540 C  "C5'" . DG  C 3 4   ? 3.31135  36.30286  -37.12185 1.000 72.71088  ? 805 DG  P "C5'" 1 
ATOM   7541 C  "C4'" . DG  C 3 4   ? 2.70099  37.05473  -38.31947 1.000 78.08178  ? 805 DG  P "C4'" 1 
ATOM   7542 O  "O4'" . DG  C 3 4   ? 2.22769  38.35770  -37.89005 1.000 72.77097  ? 805 DG  P "O4'" 1 
ATOM   7543 C  "C3'" . DG  C 3 4   ? 3.64895  37.30429  -39.49779 1.000 77.23728  ? 805 DG  P "C3'" 1 
ATOM   7544 O  "O3'" . DG  C 3 4   ? 3.45102  36.31474  -40.51415 1.000 78.32315  ? 805 DG  P "O3'" 1 
ATOM   7545 C  "C2'" . DG  C 3 4   ? 3.29681  38.71629  -40.00691 1.000 67.54509  ? 805 DG  P "C2'" 1 
ATOM   7546 C  "C1'" . DG  C 3 4   ? 2.53829  39.36108  -38.84168 1.000 66.87055  ? 805 DG  P "C1'" 1 
ATOM   7547 N  N9    . DG  C 3 4   ? 3.24454  40.44437  -38.13115 1.000 70.20646  ? 805 DG  P N9    1 
ATOM   7548 C  C8    . DG  C 3 4   ? 3.34982  40.57655  -36.76076 1.000 72.48483  ? 805 DG  P C8    1 
ATOM   7549 N  N7    . DG  C 3 4   ? 4.00026  41.64201  -36.37841 1.000 63.11709  ? 805 DG  P N7    1 
ATOM   7550 C  C5    . DG  C 3 4   ? 4.35333  42.26996  -37.56715 1.000 62.17144  ? 805 DG  P C5    1 
ATOM   7551 C  C6    . DG  C 3 4   ? 5.07662  43.47287  -37.77069 1.000 65.50343  ? 805 DG  P C6    1 
ATOM   7552 O  O6    . DG  C 3 4   ? 5.56227  44.23266  -36.90475 1.000 61.92454  ? 805 DG  P O6    1 
ATOM   7553 N  N1    . DG  C 3 4   ? 5.21411  43.76708  -39.12336 1.000 59.38442  ? 805 DG  P N1    1 
ATOM   7554 C  C2    . DG  C 3 4   ? 4.71863  42.99635  -40.15775 1.000 62.77784  ? 805 DG  P C2    1 
ATOM   7555 N  N2    . DG  C 3 4   ? 4.95771  43.44852  -41.40495 1.000 61.89992  ? 805 DG  P N2    1 
ATOM   7556 N  N3    . DG  C 3 4   ? 4.03529  41.86001  -39.98043 1.000 61.76185  ? 805 DG  P N3    1 
ATOM   7557 C  C4    . DG  C 3 4   ? 3.89121  41.55768  -38.66316 1.000 61.05763  ? 805 DG  P C4    1 
ATOM   7558 P  P     . DT  C 3 5   ? 4.72117  35.63644  -41.23481 1.000 87.95203  ? 806 DT  P P     1 
ATOM   7559 O  OP1   . DT  C 3 5   ? 4.25062  34.70749  -42.29270 1.000 76.70590  ? 806 DT  P OP1   1 
ATOM   7560 O  OP2   . DT  C 3 5   ? 5.62812  35.17224  -40.15408 1.000 77.02752  ? 806 DT  P OP2   1 
ATOM   7561 O  "O5'" . DT  C 3 5   ? 5.41569  36.85003  -41.99505 1.000 78.15050  ? 806 DT  P "O5'" 1 
ATOM   7562 C  "C5'" . DT  C 3 5   ? 4.80181  37.40910  -43.15006 1.000 78.10590  ? 806 DT  P "C5'" 1 
ATOM   7563 C  "C4'" . DT  C 3 5   ? 5.78129  38.31457  -43.86188 1.000 74.62091  ? 806 DT  P "C4'" 1 
ATOM   7564 O  "O4'" . DT  C 3 5   ? 5.79055  39.60122  -43.20633 1.000 70.59097  ? 806 DT  P "O4'" 1 
ATOM   7565 C  "C3'" . DT  C 3 5   ? 7.21106  37.79573  -43.84259 1.000 74.01058  ? 806 DT  P "C3'" 1 
ATOM   7566 O  "O3'" . DT  C 3 5   ? 7.52673  37.20564  -45.11541 1.000 79.16407  ? 806 DT  P "O3'" 1 
ATOM   7567 C  "C2'" . DT  C 3 5   ? 8.06914  39.02063  -43.54736 1.000 70.46000  ? 806 DT  P "C2'" 1 
ATOM   7568 C  "C1'" . DT  C 3 5   ? 7.11112  40.05735  -43.00052 1.000 69.75416  ? 806 DT  P "C1'" 1 
ATOM   7569 N  N1    . DT  C 3 5   ? 7.30794  40.34676  -41.54402 1.000 64.61571  ? 806 DT  P N1    1 
ATOM   7570 C  C2    . DT  C 3 5   ? 7.86957  41.54455  -41.18116 1.000 61.79367  ? 806 DT  P C2    1 
ATOM   7571 O  O2    . DT  C 3 5   ? 8.23058  42.37989  -41.99210 1.000 63.19328  ? 806 DT  P O2    1 
ATOM   7572 N  N3    . DT  C 3 5   ? 7.99464  41.73263  -39.83123 1.000 56.23949  ? 806 DT  P N3    1 
ATOM   7573 C  C4    . DT  C 3 5   ? 7.62832  40.85866  -38.83198 1.000 59.51372  ? 806 DT  P C4    1 
ATOM   7574 O  O4    . DT  C 3 5   ? 7.78328  41.11661  -37.64044 1.000 60.01905  ? 806 DT  P O4    1 
ATOM   7575 C  C5    . DT  C 3 5   ? 7.04508  39.61929  -39.27986 1.000 60.30414  ? 806 DT  P C5    1 
ATOM   7576 C  C7    . DT  C 3 5   ? 6.61210  38.60022  -38.27633 1.000 62.42959  ? 806 DT  P C7    1 
ATOM   7577 C  C6    . DT  C 3 5   ? 6.91105  39.42190  -40.59856 1.000 60.30882  ? 806 DT  P C6    1 
ATOM   7578 P  P     . DC  C 3 6   ? 8.97564  37.38486  -45.79800 1.000 83.14693  ? 807 DC  P P     1 
ATOM   7579 O  OP1   . DC  C 3 6   ? 8.94108  36.59557  -47.05164 1.000 76.97890  ? 807 DC  P OP1   1 
ATOM   7580 O  OP2   . DC  C 3 6   ? 10.01766 37.00004  -44.80309 1.000 69.46733  ? 807 DC  P OP2   1 
ATOM   7581 O  "O5'" . DC  C 3 6   ? 9.01557  38.96307  -46.16614 1.000 73.59257  ? 807 DC  P "O5'" 1 
ATOM   7582 C  "C5'" . DC  C 3 6   ? 10.03432 39.50016  -46.98211 1.000 68.10007  ? 807 DC  P "C5'" 1 
ATOM   7583 C  "C4'" . DC  C 3 6   ? 10.98547 40.43057  -46.22096 1.000 64.78356  ? 807 DC  P "C4'" 1 
ATOM   7584 O  "O4'" . DC  C 3 6   ? 10.62414 40.60052  -44.83358 1.000 67.29924  ? 807 DC  P "O4'" 1 
ATOM   7585 C  "C3'" . DC  C 3 6   ? 12.42884 39.96414  -46.20946 1.000 66.83172  ? 807 DC  P "C3'" 1 
ATOM   7586 O  "O3'" . DC  C 3 6   ? 13.14137 40.70930  -47.18154 1.000 62.41538  ? 807 DC  P "O3'" 1 
ATOM   7587 C  "C2'" . DC  C 3 6   ? 12.92498 40.20837  -44.76042 1.000 60.75658  ? 807 DC  P "C2'" 1 
ATOM   7588 C  "C1'" . DC  C 3 6   ? 11.79015 40.98156  -44.11538 1.000 60.57318  ? 807 DC  P "C1'" 1 
ATOM   7589 N  N1    . DC  C 3 6   ? 11.56798 40.64780  -42.66032 1.000 62.98931  ? 807 DC  P N1    1 
ATOM   7590 C  C2    . DC  C 3 6   ? 11.92385 41.55542  -41.63295 1.000 60.35972  ? 807 DC  P C2    1 
ATOM   7591 O  O2    . DC  C 3 6   ? 12.45956 42.63647  -41.91856 1.000 60.75421  ? 807 DC  P O2    1 
ATOM   7592 N  N3    . DC  C 3 6   ? 11.66562 41.20256  -40.33234 1.000 59.31565  ? 807 DC  P N3    1 
ATOM   7593 C  C4    . DC  C 3 6   ? 11.08446 40.02573  -40.05688 1.000 57.14212  ? 807 DC  P C4    1 
ATOM   7594 N  N4    . DC  C 3 6   ? 10.84159 39.71357  -38.77562 1.000 51.34077  ? 807 DC  P N4    1 
ATOM   7595 C  C5    . DC  C 3 6   ? 10.72169 39.11657  -41.08401 1.000 55.61928  ? 807 DC  P C5    1 
ATOM   7596 C  C6    . DC  C 3 6   ? 10.98538 39.45842  -42.34539 1.000 60.36208  ? 807 DC  P C6    1 
ATOM   7597 P  P     . DC  C 3 7   ? 14.73609 40.80487  -47.14694 1.000 65.90733  ? 808 DC  P P     1 
ATOM   7598 O  OP1   . DC  C 3 7   ? 15.12593 41.46370  -48.41912 1.000 65.07471  ? 808 DC  P OP1   1 
ATOM   7599 O  OP2   . DC  C 3 7   ? 15.30017 39.46450  -46.80852 1.000 55.62725  ? 808 DC  P OP2   1 
ATOM   7600 O  "O5'" . DC  C 3 7   ? 14.99240 41.81773  -45.93522 1.000 56.98210  ? 808 DC  P "O5'" 1 
ATOM   7601 C  "C5'" . DC  C 3 7   ? 16.16558 42.51350  -45.86491 1.000 52.23819  ? 808 DC  P "C5'" 1 
ATOM   7602 C  "C4'" . DC  C 3 7   ? 16.52676 42.83770  -44.43772 1.000 52.39403  ? 808 DC  P "C4'" 1 
ATOM   7603 O  "O4'" . DC  C 3 7   ? 15.67658 42.16046  -43.50018 1.000 52.17300  ? 808 DC  P "O4'" 1 
ATOM   7604 C  "C3'" . DC  C 3 7   ? 17.93767 42.42890  -44.06841 1.000 57.12848  ? 808 DC  P "C3'" 1 
ATOM   7605 O  "O3'" . DC  C 3 7   ? 18.72066 43.58032  -43.98598 1.000 54.81586  ? 808 DC  P "O3'" 1 
ATOM   7606 C  "C2'" . DC  C 3 7   ? 17.80915 41.70392  -42.70917 1.000 51.11248  ? 808 DC  P "C2'" 1 
ATOM   7607 C  "C1'" . DC  C 3 7   ? 16.39772 42.04672  -42.29186 1.000 52.34494  ? 808 DC  P "C1'" 1 
ATOM   7608 N  N1    . DC  C 3 7   ? 15.72491 41.02862  -41.41369 1.000 54.47529  ? 808 DC  P N1    1 
ATOM   7609 C  C2    . DC  C 3 7   ? 15.61702 41.26129  -40.03586 1.000 56.56532  ? 808 DC  P C2    1 
ATOM   7610 O  O2    . DC  C 3 7   ? 16.12491 42.28241  -39.55859 1.000 54.85229  ? 808 DC  P O2    1 
ATOM   7611 N  N3    . DC  C 3 7   ? 14.96471 40.34688  -39.26210 1.000 55.75590  ? 808 DC  P N3    1 
ATOM   7612 C  C4    . DC  C 3 7   ? 14.43910 39.25626  -39.82024 1.000 52.98872  ? 808 DC  P C4    1 
ATOM   7613 N  N4    . DC  C 3 7   ? 13.81321 38.38512  -39.02807 1.000 55.47346  ? 808 DC  P N4    1 
ATOM   7614 C  C5    . DC  C 3 7   ? 14.52560 39.01405  -41.21775 1.000 51.59865  ? 808 DC  P C5    1 
ATOM   7615 C  C6    . DC  C 3 7   ? 15.16909 39.91410  -41.96869 1.000 54.64443  ? 808 DC  P C6    1 
ATOM   7616 P  P     . DC  C 3 8   ? 20.26760 43.47261  -44.32239 1.000 50.10190  ? 809 DC  P P     1 
ATOM   7617 O  OP1   . DC  C 3 8   ? 20.69003 44.77018  -44.86603 1.000 56.10749  ? 809 DC  P OP1   1 
ATOM   7618 O  OP2   . DC  C 3 8   ? 20.45328 42.22225  -45.11487 1.000 49.32432  ? 809 DC  P OP2   1 
ATOM   7619 O  "O5'" . DC  C 3 8   ? 20.90670 43.30548  -42.88351 1.000 44.30537  ? 809 DC  P "O5'" 1 
ATOM   7620 C  "C5'" . DC  C 3 8   ? 20.45170 44.11924  -41.85276 1.000 45.89989  ? 809 DC  P "C5'" 1 
ATOM   7621 C  "C4'" . DC  C 3 8   ? 20.80845 43.54335  -40.49854 1.000 48.99376  ? 809 DC  P "C4'" 1 
ATOM   7622 O  "O4'" . DC  C 3 8   ? 19.80908 42.59079  -40.08406 1.000 54.20172  ? 809 DC  P "O4'" 1 
ATOM   7623 C  "C3'" . DC  C 3 8   ? 22.15815 42.82370  -40.40431 1.000 47.25459  ? 809 DC  P "C3'" 1 
ATOM   7624 O  "O3'" . DC  C 3 8   ? 22.93116 43.48681  -39.41664 1.000 51.68680  ? 809 DC  P "O3'" 1 
ATOM   7625 C  "C2'" . DC  C 3 8   ? 21.78019 41.38687  -39.97960 1.000 49.08091  ? 809 DC  P "C2'" 1 
ATOM   7626 C  "C1'" . DC  C 3 8   ? 20.43303 41.61035  -39.30887 1.000 52.00757  ? 809 DC  P "C1'" 1 
ATOM   7627 N  N1    . DC  C 3 8   ? 19.52224 40.42317  -39.26205 1.000 49.99630  ? 809 DC  P N1    1 
ATOM   7628 C  C2    . DC  C 3 8   ? 18.90276 40.08101  -38.05557 1.000 51.78990  ? 809 DC  P C2    1 
ATOM   7629 O  O2    . DC  C 3 8   ? 19.15195 40.74786  -37.04948 1.000 57.05712  ? 809 DC  P O2    1 
ATOM   7630 N  N3    . DC  C 3 8   ? 18.06914 39.01663  -38.01939 1.000 51.51933  ? 809 DC  P N3    1 
ATOM   7631 C  C4    . DC  C 3 8   ? 17.82212 38.33079  -39.12725 1.000 53.18546  ? 809 DC  P C4    1 
ATOM   7632 N  N4    . DC  C 3 8   ? 16.97902 37.29934  -39.04769 1.000 53.13471  ? 809 DC  P N4    1 
ATOM   7633 C  C5    . DC  C 3 8   ? 18.42771 38.67361  -40.37512 1.000 54.59624  ? 809 DC  P C5    1 
ATOM   7634 C  C6    . DC  C 3 8   ? 19.26272 39.71954  -40.39418 1.000 52.07492  ? 809 DC  P C6    1 
ATOM   7635 P  P     . DT  C 3 9   ? 24.50935 43.24000  -39.25876 1.000 52.20205  ? 810 DT  P P     1 
ATOM   7636 O  OP1   . DT  C 3 9   ? 25.12912 44.54765  -38.95706 1.000 53.78676  ? 810 DT  P OP1   1 
ATOM   7637 O  OP2   . DT  C 3 9   ? 24.98533 42.48997  -40.43423 1.000 49.12068  ? 810 DT  P OP2   1 
ATOM   7638 O  "O5'" . DT  C 3 9   ? 24.59131 42.41515  -37.89058 1.000 52.13563  ? 810 DT  P "O5'" 1 
ATOM   7639 C  "C5'" . DT  C 3 9   ? 23.82505 42.87862  -36.77308 1.000 55.39282  ? 810 DT  P "C5'" 1 
ATOM   7640 C  "C4'" . DT  C 3 9   ? 23.67431 41.80412  -35.70734 1.000 62.08407  ? 810 DT  P "C4'" 1 
ATOM   7641 O  "O4'" . DT  C 3 9   ? 22.56503 40.92362  -36.02265 1.000 57.49651  ? 810 DT  P "O4'" 1 
ATOM   7642 C  "C3'" . DT  C 3 9   ? 24.89816 40.91166  -35.51658 1.000 59.60152  ? 810 DT  P "C3'" 1 
ATOM   7643 O  "O3'" . DT  C 3 9   ? 25.38551 41.05831  -34.20898 1.000 66.91217  ? 810 DT  P "O3'" 1 
ATOM   7644 C  "C2'" . DT  C 3 9   ? 24.37898 39.49510  -35.75490 1.000 58.81924  ? 810 DT  P "C2'" 1 
ATOM   7645 C  "C1'" . DT  C 3 9   ? 22.87871 39.63827  -35.57318 1.000 59.63595  ? 810 DT  P "C1'" 1 
ATOM   7646 N  N1    . DT  C 3 9   ? 22.10341 38.63973  -36.37839 1.000 59.06776  ? 810 DT  P N1    1 
ATOM   7647 C  C2    . DT  C 3 9   ? 21.17485 37.86471  -35.74777 1.000 58.06704  ? 810 DT  P C2    1 
ATOM   7648 O  O2    . DT  C 3 9   ? 20.92978 37.95762  -34.55738 1.000 63.96111  ? 810 DT  P O2    1 
ATOM   7649 N  N3    . DT  C 3 9   ? 20.52175 36.98082  -36.55152 1.000 53.47123  ? 810 DT  P N3    1 
ATOM   7650 C  C4    . DT  C 3 9   ? 20.70982 36.78917  -37.91157 1.000 56.68653  ? 810 DT  P C4    1 
ATOM   7651 O  O4    . DT  C 3 9   ? 20.06497 35.95458  -38.55697 1.000 57.98446  ? 810 DT  P O4    1 
ATOM   7652 C  C5    . DT  C 3 9   ? 21.71470 37.63009  -38.51606 1.000 53.55066  ? 810 DT  P C5    1 
ATOM   7653 C  C7    . DT  C 3 9   ? 22.01475 37.51215  -39.98124 1.000 45.77036  ? 810 DT  P C7    1 
ATOM   7654 C  C6    . DT  C 3 9   ? 22.35843 38.50109  -37.72867 1.000 54.95318  ? 810 DT  P C6    1 
ATOM   7655 P  P     . DG  C 3 10  ? 26.76830 40.36852  -33.78682 1.000 67.92130  ? 811 DG  P P     1 
ATOM   7656 O  OP1   . DG  C 3 10  ? 27.57466 41.42940  -33.13679 1.000 60.67231  ? 811 DG  P OP1   1 
ATOM   7657 O  OP2   . DG  C 3 10  ? 27.28940 39.65719  -34.98157 1.000 63.36503  ? 811 DG  P OP2   1 
ATOM   7658 O  "O5'" . DG  C 3 10  ? 26.33322 39.22978  -32.73962 1.000 61.65705  ? 811 DG  P "O5'" 1 
ATOM   7659 C  "C5'" . DG  C 3 10  ? 25.58980 39.57004  -31.56321 1.000 63.96795  ? 811 DG  P "C5'" 1 
ATOM   7660 C  "C4'" . DG  C 3 10  ? 24.89515 38.34222  -31.00061 1.000 66.05538  ? 811 DG  P "C4'" 1 
ATOM   7661 O  "O4'" . DG  C 3 10  ? 23.95470 37.86226  -31.97319 1.000 62.60174  ? 811 DG  P "O4'" 1 
ATOM   7662 C  "C3'" . DG  C 3 10  ? 25.83142 37.17061  -30.70390 1.000 68.50745  ? 811 DG  P "C3'" 1 
ATOM   7663 O  "O3'" . DG  C 3 10  ? 25.93588 36.94955  -29.32675 1.000 66.28358  ? 811 DG  P "O3'" 1 
ATOM   7664 C  "C2'" . DG  C 3 10  ? 25.20827 35.95961  -31.39556 1.000 68.80697  ? 811 DG  P "C2'" 1 
ATOM   7665 C  "C1'" . DG  C 3 10  ? 23.87789 36.46446  -31.91203 1.000 63.36935  ? 811 DG  P "C1'" 1 
ATOM   7666 N  N9    . DG  C 3 10  ? 23.57269 35.97857  -33.24943 1.000 63.05643  ? 811 DG  P N9    1 
ATOM   7667 C  C8    . DG  C 3 10  ? 24.08072 36.44771  -34.43451 1.000 61.48931  ? 811 DG  P C8    1 
ATOM   7668 N  N7    . DG  C 3 10  ? 23.61518 35.82873  -35.48012 1.000 59.43238  ? 811 DG  P N7    1 
ATOM   7669 C  C5    . DG  C 3 10  ? 22.74409 34.88018  -34.95082 1.000 60.92709  ? 811 DG  P C5    1 
ATOM   7670 C  C6    . DG  C 3 10  ? 21.94001 33.91082  -35.59934 1.000 60.71208  ? 811 DG  P C6    1 
ATOM   7671 O  O6    . DG  C 3 10  ? 21.82770 33.68529  -36.81270 1.000 58.55656  ? 811 DG  P O6    1 
ATOM   7672 N  N1    . DG  C 3 10  ? 21.20836 33.16152  -34.68610 1.000 61.99455  ? 811 DG  P N1    1 
ATOM   7673 C  C2    . DG  C 3 10  ? 21.24613 33.32307  -33.31844 1.000 64.11378  ? 811 DG  P C2    1 
ATOM   7674 N  N2    . DG  C 3 10  ? 20.47218 32.50157  -32.59359 1.000 65.15710  ? 811 DG  P N2    1 
ATOM   7675 N  N3    . DG  C 3 10  ? 21.98960 34.22498  -32.70422 1.000 63.06207  ? 811 DG  P N3    1 
ATOM   7676 C  C4    . DG  C 3 10  ? 22.70763 34.96608  -33.57897 1.000 61.22013  ? 811 DG  P C4    1 
ATOM   7677 P  P     . DT  C 3 11  ? 27.00863 35.88599  -28.78845 1.000 74.53616  ? 812 DT  P P     1 
ATOM   7678 O  OP1   . DT  C 3 11  ? 27.31511 36.24385  -27.37956 1.000 81.67888  ? 812 DT  P OP1   1 
ATOM   7679 O  OP2   . DT  C 3 11  ? 28.11865 35.81850  -29.76762 1.000 62.28997  ? 812 DT  P OP2   1 
ATOM   7680 O  "O5'" . DT  C 3 11  ? 26.19491 34.51128  -28.79626 1.000 70.74143  ? 812 DT  P "O5'" 1 
ATOM   7681 C  "C5'" . DT  C 3 11  ? 25.09113 34.34924  -27.91593 1.000 67.85236  ? 812 DT  P "C5'" 1 
ATOM   7682 C  "C4'" . DT  C 3 11  ? 24.48340 32.96867  -28.05599 1.000 65.18902  ? 812 DT  P "C4'" 1 
ATOM   7683 O  "O4'" . DT  C 3 11  ? 23.97357 32.79761  -29.40418 1.000 63.27965  ? 812 DT  P "O4'" 1 
ATOM   7684 C  "C3'" . DT  C 3 11  ? 25.44955 31.81010  -27.80838 1.000 66.66713  ? 812 DT  P "C3'" 1 
ATOM   7685 O  "O3'" . DT  C 3 11  ? 24.87072 30.86283  -26.89883 1.000 71.92167  ? 812 DT  P "O3'" 1 
ATOM   7686 C  "C2'" . DT  C 3 11  ? 25.64960 31.20951  -29.19705 1.000 69.78081  ? 812 DT  P "C2'" 1 
ATOM   7687 C  "C1'" . DT  C 3 11  ? 24.33553 31.52958  -29.88437 1.000 65.31289  ? 812 DT  P "C1'" 1 
ATOM   7688 N  N1    . DT  C 3 11  ? 24.44670 31.62713  -31.36033 1.000 60.89415  ? 812 DT  P N1    1 
ATOM   7689 C  C2    . DT  C 3 11  ? 23.64643 30.84610  -32.15016 1.000 61.24361  ? 812 DT  P C2    1 
ATOM   7690 O  O2    . DT  C 3 11  ? 22.84417 30.05055  -31.70060 1.000 64.58888  ? 812 DT  P O2    1 
ATOM   7691 N  N3    . DT  C 3 11  ? 23.82448 31.02849  -33.49990 1.000 60.85641  ? 812 DT  P N3    1 
ATOM   7692 C  C4    . DT  C 3 11  ? 24.69964 31.90135  -34.11922 1.000 62.24783  ? 812 DT  P C4    1 
ATOM   7693 O  O4    . DT  C 3 11  ? 24.78594 31.99585  -35.34215 1.000 62.16942  ? 812 DT  P O4    1 
ATOM   7694 C  C5    . DT  C 3 11  ? 25.50649 32.69949  -33.22573 1.000 63.70367  ? 812 DT  P C5    1 
ATOM   7695 C  C7    . DT  C 3 11  ? 26.49795 33.68646  -33.77698 1.000 54.54117  ? 812 DT  P C7    1 
ATOM   7696 C  C6    . DT  C 3 11  ? 25.34140 32.52314  -31.90560 1.000 64.30375  ? 812 DT  P C6    1 
ATOM   7697 P  P     . DT  C 3 12  ? 25.66748 29.52584  -26.48387 1.000 73.81343  ? 813 DT  P P     1 
ATOM   7698 O  OP1   . DT  C 3 12  ? 25.21155 29.18830  -25.11811 1.000 71.53821  ? 813 DT  P OP1   1 
ATOM   7699 O  OP2   . DT  C 3 12  ? 27.11581 29.65603  -26.81392 1.000 64.62748  ? 813 DT  P OP2   1 
ATOM   7700 O  "O5'" . DT  C 3 12  ? 25.08639 28.42918  -27.46545 1.000 67.75387  ? 813 DT  P "O5'" 1 
ATOM   7701 C  "C5'" . DT  C 3 12  ? 23.71386 28.41904  -27.75831 1.000 69.83557  ? 813 DT  P "C5'" 1 
ATOM   7702 C  "C4'" . DT  C 3 12  ? 23.31120 27.07814  -28.32464 1.000 69.36337  ? 813 DT  P "C4'" 1 
ATOM   7703 O  "O4'" . DT  C 3 12  ? 23.32843 27.12682  -29.77596 1.000 65.05362  ? 813 DT  P "O4'" 1 
ATOM   7704 C  "C3'" . DT  C 3 12  ? 24.21680 25.92875  -27.93989 1.000 73.25215  ? 813 DT  P "C3'" 1 
ATOM   7705 O  "O3'" . DT  C 3 12  ? 23.42419 24.73687  -27.84074 1.000 80.32499  ? 813 DT  P "O3'" 1 
ATOM   7706 C  "C2'" . DT  C 3 12  ? 25.22352 25.88597  -29.10462 1.000 66.64440  ? 813 DT  P "C2'" 1 
ATOM   7707 C  "C1'" . DT  C 3 12  ? 24.37155 26.32984  -30.28962 1.000 62.28501  ? 813 DT  P "C1'" 1 
ATOM   7708 N  N1    . DT  C 3 12  ? 25.09889 27.14312  -31.32410 1.000 65.70288  ? 813 DT  P N1    1 
ATOM   7709 C  C2    . DT  C 3 12  ? 24.76109 26.97820  -32.64756 1.000 63.33734  ? 813 DT  P C2    1 
ATOM   7710 O  O2    . DT  C 3 12  ? 23.91845 26.18907  -33.02512 1.000 67.91910  ? 813 DT  P O2    1 
ATOM   7711 N  N3    . DT  C 3 12  ? 25.45051 27.76113  -33.52403 1.000 58.48365  ? 813 DT  P N3    1 
ATOM   7712 C  C4    . DT  C 3 12  ? 26.42690 28.68957  -33.22962 1.000 62.85182  ? 813 DT  P C4    1 
ATOM   7713 O  O4    . DT  C 3 12  ? 26.99272 29.35071  -34.11110 1.000 60.00491  ? 813 DT  P O4    1 
ATOM   7714 C  C5    . DT  C 3 12  ? 26.73717 28.83124  -31.81858 1.000 60.96474  ? 813 DT  P C5    1 
ATOM   7715 C  C7    . DT  C 3 12  ? 27.78750 29.80580  -31.37863 1.000 62.27685  ? 813 DT  P C7    1 
ATOM   7716 C  C6    . DT  C 3 12  ? 26.06215 28.06262  -30.93973 1.000 63.05004  ? 813 DT  P C6    1 
ATOM   7717 P  P     . DC  C 3 13  ? 24.06683 23.33369  -27.38904 1.000 77.54213  ? 814 DC  P P     1 
ATOM   7718 O  OP1   . DC  C 3 13  ? 23.09415 22.70879  -26.46336 1.000 70.52481  ? 814 DC  P OP1   1 
ATOM   7719 O  OP2   . DC  C 3 13  ? 25.48127 23.53759  -26.99014 1.000 72.81791  ? 814 DC  P OP2   1 
ATOM   7720 O  "O5'" . DC  C 3 13  ? 24.08691 22.50378  -28.74222 1.000 69.82102  ? 814 DC  P "O5'" 1 
ATOM   7721 C  "C5'" . DC  C 3 13  ? 23.09564 22.74633  -29.71199 1.000 72.11915  ? 814 DC  P "C5'" 1 
ATOM   7722 C  "C4'" . DC  C 3 13  ? 23.41189 21.97819  -30.96935 1.000 72.65799  ? 814 DC  P "C4'" 1 
ATOM   7723 O  "O4'" . DC  C 3 13  ? 24.04953 22.84222  -31.95024 1.000 70.09453  ? 814 DC  P "O4'" 1 
ATOM   7724 C  "C3'" . DC  C 3 13  ? 24.35733 20.81077  -30.75999 1.000 74.54875  ? 814 DC  P "C3'" 1 
ATOM   7725 O  "O3'" . DC  C 3 13  ? 23.93922 19.76070  -31.57407 1.000 78.94012  ? 814 DC  P "O3'" 1 
ATOM   7726 C  "C2'" . DC  C 3 13  ? 25.70796 21.37260  -31.20335 1.000 67.87123  ? 814 DC  P "C2'" 1 
ATOM   7727 C  "C1'" . DC  C 3 13  ? 25.28893 22.28975  -32.33898 1.000 67.97076  ? 814 DC  P "C1'" 1 
ATOM   7728 N  N1    . DC  C 3 13  ? 26.23616 23.40702  -32.58033 1.000 65.62144  ? 814 DC  P N1    1 
ATOM   7729 C  C2    . DC  C 3 13  ? 26.48861 23.82520  -33.88647 1.000 64.34468  ? 814 DC  P C2    1 
ATOM   7730 O  O2    . DC  C 3 13  ? 25.91453 23.24521  -34.82256 1.000 65.17051  ? 814 DC  P O2    1 
ATOM   7731 N  N3    . DC  C 3 13  ? 27.35470 24.85155  -34.08827 1.000 60.21906  ? 814 DC  P N3    1 
ATOM   7732 C  C4    . DC  C 3 13  ? 27.94345 25.44060  -33.04688 1.000 61.71094  ? 814 DC  P C4    1 
ATOM   7733 N  N4    . DC  C 3 13  ? 28.78999 26.45265  -33.28596 1.000 62.75399  ? 814 DC  P N4    1 
ATOM   7734 C  C5    . DC  C 3 13  ? 27.69094 25.02470  -31.71189 1.000 61.24542  ? 814 DC  P C5    1 
ATOM   7735 C  C6    . DC  C 3 13  ? 26.84194 24.01497  -31.52702 1.000 64.48086  ? 814 DC  P C6    1 
ATOM   7736 P  P     . DG  C 3 14  ? 24.38311 18.25789  -31.25948 1.000 80.97323  ? 815 DG  P P     1 
ATOM   7737 O  OP1   . DG  C 3 14  ? 23.16792 17.54017  -30.80807 1.000 74.49261  ? 815 DG  P OP1   1 
ATOM   7738 O  OP2   . DG  C 3 14  ? 25.59493 18.29864  -30.40020 1.000 74.41838  ? 815 DG  P OP2   1 
ATOM   7739 O  "O5'" . DG  C 3 14  ? 24.77060 17.72811  -32.70769 1.000 74.32539  ? 815 DG  P "O5'" 1 
ATOM   7740 C  "C5'" . DG  C 3 14  ? 24.05345 18.22497  -33.83930 1.000 72.94274  ? 815 DG  P "C5'" 1 
ATOM   7741 C  "C4'" . DG  C 3 14  ? 24.94132 18.22036  -35.06100 1.000 75.54357  ? 815 DG  P "C4'" 1 
ATOM   7742 O  "O4'" . DG  C 3 14  ? 25.71815 19.44672  -35.09794 1.000 73.19557  ? 815 DG  P "O4'" 1 
ATOM   7743 C  "C3'" . DG  C 3 14  ? 25.95270 17.07497  -35.09108 1.000 70.58752  ? 815 DG  P "C3'" 1 
ATOM   7744 O  "O3'" . DG  C 3 14  ? 25.92760 16.42460  -36.35492 1.000 69.41524  ? 815 DG  P "O3'" 1 
ATOM   7745 C  "C2'" . DG  C 3 14  ? 27.29104 17.76754  -34.82476 1.000 68.31123  ? 815 DG  P "C2'" 1 
ATOM   7746 C  "C1'" . DG  C 3 14  ? 27.04665 19.13775  -35.42545 1.000 69.24422  ? 815 DG  P "C1'" 1 
ATOM   7747 N  N9    . DG  C 3 14  ? 27.90511 20.18353  -34.88211 1.000 64.71959  ? 815 DG  P N9    1 
ATOM   7748 C  C8    . DG  C 3 14  ? 28.12205 20.46669  -33.55593 1.000 66.99209  ? 815 DG  P C8    1 
ATOM   7749 N  N7    . DG  C 3 14  ? 28.93478 21.46636  -33.36352 1.000 63.52906  ? 815 DG  P N7    1 
ATOM   7750 C  C5    . DG  C 3 14  ? 29.27495 21.87591  -34.64593 1.000 61.50446  ? 815 DG  P C5    1 
ATOM   7751 C  C6    . DG  C 3 14  ? 30.12158 22.92624  -35.06750 1.000 61.43148  ? 815 DG  P C6    1 
ATOM   7752 O  O6    . DG  C 3 14  ? 30.76031 23.72211  -34.36244 1.000 60.58595  ? 815 DG  P O6    1 
ATOM   7753 N  N1    . DG  C 3 14  ? 30.19581 23.00176  -36.45861 1.000 60.90811  ? 815 DG  P N1    1 
ATOM   7754 C  C2    . DG  C 3 14  ? 29.52487 22.17278  -37.33032 1.000 60.41791  ? 815 DG  P C2    1 
ATOM   7755 N  N2    . DG  C 3 14  ? 29.71618 22.39865  -38.63326 1.000 59.86720  ? 815 DG  P N2    1 
ATOM   7756 N  N3    . DG  C 3 14  ? 28.72397 21.18581  -36.94604 1.000 61.33383  ? 815 DG  P N3    1 
ATOM   7757 C  C4    . DG  C 3 14  ? 28.64549 21.09906  -35.59316 1.000 61.14033  ? 815 DG  P C4    1 
ATOM   7758 P  P     . DG  C 3 15  ? 26.59922 14.96745  -36.51749 1.000 90.18648  ? 816 DG  P P     1 
ATOM   7759 O  OP1   . DG  C 3 15  ? 25.60666 14.08853  -37.18145 1.000 81.84181  ? 816 DG  P OP1   1 
ATOM   7760 O  OP2   . DG  C 3 15  ? 27.18024 14.56672  -35.20537 1.000 71.95096  ? 816 DG  P OP2   1 
ATOM   7761 O  "O5'" . DG  C 3 15  ? 27.80824 15.22245  -37.53839 1.000 71.55059  ? 816 DG  P "O5'" 1 
ATOM   7762 C  "C5'" . DG  C 3 15  ? 27.53239 15.65943  -38.85875 1.000 65.85337  ? 816 DG  P "C5'" 1 
ATOM   7763 C  "C4'" . DG  C 3 15  ? 28.77753 16.23923  -39.48317 1.000 66.83812  ? 816 DG  P "C4'" 1 
ATOM   7764 O  "O4'" . DG  C 3 15  ? 28.99270 17.55894  -38.95642 1.000 71.50187  ? 816 DG  P "O4'" 1 
ATOM   7765 C  "C3'" . DG  C 3 15  ? 30.05534 15.47831  -39.17201 1.000 64.38744  ? 816 DG  P "C3'" 1 
ATOM   7766 O  "O3'" . DG  C 3 15  ? 30.25383 14.47415  -40.15028 1.000 70.15349  ? 816 DG  P "O3'" 1 
ATOM   7767 C  "C2'" . DG  C 3 15  ? 31.12888 16.55526  -39.27476 1.000 66.20753  ? 816 DG  P "C2'" 1 
ATOM   7768 C  "C1'" . DG  C 3 15  ? 30.37509 17.85209  -38.96382 1.000 69.19320  ? 816 DG  P "C1'" 1 
ATOM   7769 N  N9    . DG  C 3 15  ? 30.73024 18.46178  -37.68116 1.000 65.37286  ? 816 DG  P N9    1 
ATOM   7770 C  C8    . DG  C 3 15  ? 30.22805 18.15212  -36.44197 1.000 63.31340  ? 816 DG  P C8    1 
ATOM   7771 N  N7    . DG  C 3 15  ? 30.72833 18.88146  -35.48320 1.000 61.32202  ? 816 DG  P N7    1 
ATOM   7772 C  C5    . DG  C 3 15  ? 31.61583 19.73257  -36.13201 1.000 58.46534  ? 816 DG  P C5    1 
ATOM   7773 C  C6    . DG  C 3 15  ? 32.46108 20.74838  -35.61496 1.000 55.17701  ? 816 DG  P C6    1 
ATOM   7774 O  O6    . DG  C 3 15  ? 32.60007 21.11814  -34.43584 1.000 52.94969  ? 816 DG  P O6    1 
ATOM   7775 N  N1    . DG  C 3 15  ? 33.19452 21.36557  -36.62676 1.000 55.14805  ? 816 DG  P N1    1 
ATOM   7776 C  C2    . DG  C 3 15  ? 33.12102 21.03212  -37.96290 1.000 58.76490  ? 816 DG  P C2    1 
ATOM   7777 N  N2    . DG  C 3 15  ? 33.90520 21.71330  -38.80064 1.000 60.50794  ? 816 DG  P N2    1 
ATOM   7778 N  N3    . DG  C 3 15  ? 32.34217 20.08612  -38.45085 1.000 59.42458  ? 816 DG  P N3    1 
ATOM   7779 C  C4    . DG  C 3 15  ? 31.62169 19.48245  -37.48472 1.000 61.07569  ? 816 DG  P C4    1 
HETATM 7780 P  P     . G47 C 3 16  ? 31.57994 13.56680  -40.14267 1.000 76.85598  ? 817 G47 P P     1 
HETATM 7781 O  O1P   . G47 C 3 16  ? 32.13892 13.49209  -38.74058 1.000 72.01983  ? 817 G47 P O1P   1 
HETATM 7782 O  O2P   . G47 C 3 16  ? 31.23867 12.26801  -40.83470 1.000 77.57652  ? 817 G47 P O2P   1 
HETATM 7783 O  "O5'" . G47 C 3 16  ? 32.60546 14.39112  -41.06341 1.000 66.91655  ? 817 G47 P "O5'" 1 
HETATM 7784 C  "C5'" . G47 C 3 16  ? 34.00110 14.24478  -40.85959 1.000 64.46760  ? 817 G47 P "C5'" 1 
HETATM 7785 C  "C4'" . G47 C 3 16  ? 34.73786 15.39330  -41.52544 1.000 66.84132  ? 817 G47 P "C4'" 1 
HETATM 7786 O  "O4'" . G47 C 3 16  ? 34.19195 16.66932  -41.17405 1.000 63.29218  ? 817 G47 P "O4'" 1 
HETATM 7787 C  "C3'" . G47 C 3 16  ? 36.14646 15.41350  -40.98132 1.000 67.15261  ? 817 G47 P "C3'" 1 
HETATM 7788 O  "O3'" . G47 C 3 16  ? 36.99900 14.58284  -41.75314 1.000 68.19634  ? 817 G47 P "O3'" 1 
HETATM 7789 C  "C2'" . G47 C 3 16  ? 36.55927 16.87091  -40.91847 1.000 61.20953  ? 817 G47 P "C2'" 1 
HETATM 7790 C  "C1'" . G47 C 3 16  ? 35.21605 17.53295  -40.65560 1.000 59.89867  ? 817 G47 P "C1'" 1 
HETATM 7791 N  N9    . G47 C 3 16  ? 34.96738 17.71915  -39.19552 1.000 58.73392  ? 817 G47 P N9    1 
HETATM 7792 C  C8    . G47 C 3 16  ? 34.11685 17.01360  -38.42635 1.000 60.73789  ? 817 G47 P C8    1 
HETATM 7793 N  N7    . G47 C 3 16  ? 34.09700 17.43096  -37.13361 1.000 55.35579  ? 817 G47 P N7    1 
HETATM 7794 C  C5    . G47 C 3 16  ? 34.96999 18.44225  -37.06447 1.000 55.42707  ? 817 G47 P C5    1 
HETATM 7795 C  C6    . G47 C 3 16  ? 35.45036 19.35572  -36.00886 1.000 55.26877  ? 817 G47 P C6    1 
HETATM 7796 O  O6    . G47 C 3 16  ? 35.01315 19.24683  -34.84130 1.000 56.00330  ? 817 G47 P O6    1 
HETATM 7797 N  N1    . G47 C 3 16  ? 36.35935 20.28451  -36.35641 1.000 54.10315  ? 817 G47 P N1    1 
HETATM 7798 C  C2    . G47 C 3 16  ? 36.84642 20.40487  -37.61079 1.000 54.05720  ? 817 G47 P C2    1 
HETATM 7799 N  N2    . G47 C 3 16  ? 37.76193 21.36618  -37.87639 1.000 58.42464  ? 817 G47 P N2    1 
HETATM 7800 N  N3    . G47 C 3 16  ? 36.43972 19.60407  -38.61676 1.000 56.66420  ? 817 G47 P N3    1 
HETATM 7801 C  C4    . G47 C 3 16  ? 35.52931 18.63090  -38.41321 1.000 58.33212  ? 817 G47 P C4    1 
HETATM 7802 C  C6A   . G47 C 3 16  ? 38.60788 21.35314  -39.06301 1.000 60.72027  ? 817 G47 P C6A   1 
HETATM 7803 C  C7A   . G47 C 3 16  ? 37.87395 21.66860  -40.36710 1.000 66.56474  ? 817 G47 P C7A   1 
HETATM 7804 S  SG    . G47 C 3 16  ? 39.04276 21.94065  -41.73047 1.000 83.72080  ? 817 G47 P SG    1 
ATOM   7805 P  P     . DC  C 3 17  ? 37.84949 13.46669  -40.98861 1.000 67.43386  ? 818 DC  P P     1 
ATOM   7806 O  OP1   . DC  C 3 17  ? 38.35577 12.46994  -41.96792 1.000 60.69387  ? 818 DC  P OP1   1 
ATOM   7807 O  OP2   . DC  C 3 17  ? 37.01931 13.07354  -39.82697 1.000 59.79703  ? 818 DC  P OP2   1 
ATOM   7808 O  "O5'" . DC  C 3 17  ? 39.10271 14.28655  -40.46952 1.000 59.69334  ? 818 DC  P "O5'" 1 
ATOM   7809 C  "C5'" . DC  C 3 17  ? 39.92003 14.94720  -41.40838 1.000 59.36947  ? 818 DC  P "C5'" 1 
ATOM   7810 C  "C4'" . DC  C 3 17  ? 40.64382 16.08502  -40.74641 1.000 58.54999  ? 818 DC  P "C4'" 1 
ATOM   7811 O  "O4'" . DC  C 3 17  ? 39.66711 16.96173  -40.14590 1.000 59.62660  ? 818 DC  P "O4'" 1 
ATOM   7812 C  "C3'" . DC  C 3 17  ? 41.51941 15.68240  -39.57907 1.000 56.86830  ? 818 DC  P "C3'" 1 
ATOM   7813 O  "O3'" . DC  C 3 17  ? 42.77426 15.20495  -40.02253 1.000 55.13340  ? 818 DC  P "O3'" 1 
ATOM   7814 C  "C2'" . DC  C 3 17  ? 41.64600 16.99965  -38.83633 1.000 52.39182  ? 818 DC  P "C2'" 1 
ATOM   7815 C  "C1'" . DC  C 3 17  ? 40.22961 17.55962  -38.98515 1.000 58.20431  ? 818 DC  P "C1'" 1 
ATOM   7816 N  N1    . DC  C 3 17  ? 39.34619 17.28086  -37.79447 1.000 56.89317  ? 818 DC  P N1    1 
ATOM   7817 C  C2    . DC  C 3 17  ? 39.50161 18.04879  -36.63970 1.000 52.99495  ? 818 DC  P C2    1 
ATOM   7818 O  O2    . DC  C 3 17  ? 40.35796 18.94308  -36.62059 1.000 50.82975  ? 818 DC  P O2    1 
ATOM   7819 N  N3    . DC  C 3 17  ? 38.71602 17.78840  -35.56817 1.000 51.99838  ? 818 DC  P N3    1 
ATOM   7820 C  C4    . DC  C 3 17  ? 37.80312 16.83656  -35.62513 1.000 49.73531  ? 818 DC  P C4    1 
ATOM   7821 N  N4    . DC  C 3 17  ? 37.04933 16.63862  -34.54164 1.000 52.36052  ? 818 DC  P N4    1 
ATOM   7822 C  C5    . DC  C 3 17  ? 37.61322 16.04729  -36.79688 1.000 50.28217  ? 818 DC  P C5    1 
ATOM   7823 C  C6    . DC  C 3 17  ? 38.40250 16.29527  -37.84765 1.000 54.84127  ? 818 DC  P C6    1 
ATOM   7824 P  P     . DG  C 3 18  ? 43.60624 14.21355  -39.07417 1.000 57.49010  ? 819 DG  P P     1 
ATOM   7825 O  OP1   . DG  C 3 18  ? 44.74585 13.64237  -39.83303 1.000 56.88176  ? 819 DG  P OP1   1 
ATOM   7826 O  OP2   . DG  C 3 18  ? 42.61908 13.28323  -38.47922 1.000 54.11629  ? 819 DG  P OP2   1 
ATOM   7827 O  "O5'" . DG  C 3 18  ? 44.16361 15.18246  -37.91940 1.000 51.16958  ? 819 DG  P "O5'" 1 
ATOM   7828 C  "C5'" . DG  C 3 18  ? 45.09091 16.22042  -38.24175 1.000 49.87253  ? 819 DG  P "C5'" 1 
ATOM   7829 C  "C4'" . DG  C 3 18  ? 45.49329 17.00611  -37.00016 1.000 46.45107  ? 819 DG  P "C4'" 1 
ATOM   7830 O  "O4'" . DG  C 3 18  ? 44.33591 17.67423  -36.46325 1.000 46.61070  ? 819 DG  P "O4'" 1 
ATOM   7831 C  "C3'" . DG  C 3 18  ? 46.02536 16.16961  -35.86062 1.000 44.54580  ? 819 DG  P "C3'" 1 
ATOM   7832 O  "O3'" . DG  C 3 18  ? 47.41781 16.02370  -35.97892 1.000 44.52833  ? 819 DG  P "O3'" 1 
ATOM   7833 C  "C2'" . DG  C 3 18  ? 45.66916 16.99727  -34.63651 1.000 40.98213  ? 819 DG  P "C2'" 1 
ATOM   7834 C  "C1'" . DG  C 3 18  ? 44.35428 17.62271  -35.05133 1.000 46.19147  ? 819 DG  P "C1'" 1 
ATOM   7835 N  N9    . DG  C 3 18  ? 43.13581 16.93007  -34.60025 1.000 49.15253  ? 819 DG  P N9    1 
ATOM   7836 C  C8    . DG  C 3 18  ? 42.33178 16.10516  -35.35003 1.000 48.17017  ? 819 DG  P C8    1 
ATOM   7837 N  N7    . DG  C 3 18  ? 41.28253 15.67973  -34.70723 1.000 47.51574  ? 819 DG  P N7    1 
ATOM   7838 C  C5    . DG  C 3 18  ? 41.38380 16.27380  -33.45217 1.000 44.67624  ? 819 DG  P C5    1 
ATOM   7839 C  C6    . DG  C 3 18  ? 40.52724 16.17712  -32.32303 1.000 45.96382  ? 819 DG  P C6    1 
ATOM   7840 O  O6    . DG  C 3 18  ? 39.47114 15.53267  -32.21395 1.000 47.53205  ? 819 DG  P O6    1 
ATOM   7841 N  N1    . DG  C 3 18  ? 40.99553 16.92964  -31.24805 1.000 45.07708  ? 819 DG  P N1    1 
ATOM   7842 C  C2    . DG  C 3 18  ? 42.14989 17.69114  -31.26214 1.000 49.08301  ? 819 DG  P C2    1 
ATOM   7843 N  N2    . DG  C 3 18  ? 42.44732 18.36595  -30.13322 1.000 41.75596  ? 819 DG  P N2    1 
ATOM   7844 N  N3    . DG  C 3 18  ? 42.95730 17.78847  -32.31794 1.000 51.46483  ? 819 DG  P N3    1 
ATOM   7845 C  C4    . DG  C 3 18  ? 42.51107 17.05282  -33.37291 1.000 46.37915  ? 819 DG  P C4    1 
ATOM   7846 P  P     . DC  C 3 19  ? 48.10187 14.63196  -35.56641 1.000 42.01612  ? 820 DC  P P     1 
ATOM   7847 O  OP1   . DC  C 3 19  ? 49.54317 14.73321  -35.89351 1.000 43.54023  ? 820 DC  P OP1   1 
ATOM   7848 O  OP2   . DC  C 3 19  ? 47.19875 13.57601  -36.09498 1.000 33.98040  ? 820 DC  P OP2   1 
ATOM   7849 O  "O5'" . DC  C 3 19  ? 47.96588 14.56937  -33.97091 1.000 42.08035  ? 820 DC  P "O5'" 1 
ATOM   7850 C  "C5'" . DC  C 3 19  ? 48.54965 15.57636  -33.15844 1.000 39.76059  ? 820 DC  P "C5'" 1 
ATOM   7851 C  "C4'" . DC  C 3 19  ? 48.02642 15.48122  -31.73570 1.000 44.45529  ? 820 DC  P "C4'" 1 
ATOM   7852 O  "O4'" . DC  C 3 19  ? 46.65135 15.93641  -31.67749 1.000 44.70295  ? 820 DC  P "O4'" 1 
ATOM   7853 C  "C3'" . DC  C 3 19  ? 47.96785 14.08388  -31.14973 1.000 41.15619  ? 820 DC  P "C3'" 1 
ATOM   7854 O  "O3'" . DC  C 3 19  ? 49.25158 13.69297  -30.66863 1.000 43.81977  ? 820 DC  P "O3'" 1 
ATOM   7855 C  "C2'" . DC  C 3 19  ? 46.99309 14.29166  -30.00031 1.000 41.04284  ? 820 DC  P "C2'" 1 
ATOM   7856 C  "C1'" . DC  C 3 19  ? 46.00848 15.30963  -30.58062 1.000 44.20582  ? 820 DC  P "C1'" 1 
ATOM   7857 N  N1    . DC  C 3 19  ? 44.72896 14.68967  -31.04240 1.000 48.40481  ? 820 DC  P N1    1 
ATOM   7858 C  C2    . DC  C 3 19  ? 43.67761 14.53730  -30.12877 1.000 49.84972  ? 820 DC  P C2    1 
ATOM   7859 O  O2    . DC  C 3 19  ? 43.83237 14.92792  -28.95428 1.000 48.12133  ? 820 DC  P O2    1 
ATOM   7860 N  N3    . DC  C 3 19  ? 42.51649 13.95678  -30.55058 1.000 46.00044  ? 820 DC  P N3    1 
ATOM   7861 C  C4    . DC  C 3 19  ? 42.39907 13.54443  -31.80754 1.000 43.54453  ? 820 DC  P C4    1 
ATOM   7862 N  N4    . DC  C 3 19  ? 41.24146 12.98733  -32.17376 1.000 43.27089  ? 820 DC  P N4    1 
ATOM   7863 C  C5    . DC  C 3 19  ? 43.46134 13.68726  -32.74996 1.000 42.10998  ? 820 DC  P C5    1 
ATOM   7864 C  C6    . DC  C 3 19  ? 44.59872 14.25119  -32.32998 1.000 42.51244  ? 820 DC  P C6    1 
ATOM   7865 P  P     . DC  C 3 20  ? 49.55105 12.14935  -30.34778 1.000 39.71789  ? 821 DC  P P     1 
ATOM   7866 O  OP1   . DC  C 3 20  ? 50.95204 11.99208  -29.91180 1.000 40.03435  ? 821 DC  P OP1   1 
ATOM   7867 O  OP2   . DC  C 3 20  ? 49.01512 11.39305  -31.49699 1.000 35.26945  ? 821 DC  P OP2   1 
ATOM   7868 O  "O5'" . DC  C 3 20  ? 48.60252 11.83152  -29.11349 1.000 40.97215  ? 821 DC  P "O5'" 1 
ATOM   7869 C  "C5'" . DC  C 3 20  ? 48.90159 12.33113  -27.83676 1.000 38.31682  ? 821 DC  P "C5'" 1 
ATOM   7870 C  "C4'" . DC  C 3 20  ? 47.86163 11.85275  -26.84115 1.000 43.98379  ? 821 DC  P "C4'" 1 
ATOM   7871 O  "O4'" . DC  C 3 20  ? 46.55725 12.37220  -27.20864 1.000 43.40013  ? 821 DC  P "O4'" 1 
ATOM   7872 C  "C3'" . DC  C 3 20  ? 47.65011 10.34668  -26.79824 1.000 42.19147  ? 821 DC  P "C3'" 1 
ATOM   7873 O  "O3'" . DC  C 3 20  ? 48.64747 9.72833   -25.99221 1.000 37.73517  ? 821 DC  P "O3'" 1 
ATOM   7874 C  "C2'" . DC  C 3 20  ? 46.26710 10.26242  -26.15129 1.000 42.95576  ? 821 DC  P "C2'" 1 
ATOM   7875 C  "C1'" . DC  C 3 20  ? 45.55597 11.50406  -26.71662 1.000 40.89279  ? 821 DC  P "C1'" 1 
ATOM   7876 N  N1    . DC  C 3 20  ? 44.62810 11.16599  -27.80631 1.000 44.90355  ? 821 DC  P N1    1 
ATOM   7877 C  C2    . DC  C 3 20  ? 43.32639 10.78658  -27.48635 1.000 45.87969  ? 821 DC  P C2    1 
ATOM   7878 O  O2    . DC  C 3 20  ? 42.98418 10.78784  -26.29946 1.000 46.64561  ? 821 DC  P O2    1 
ATOM   7879 N  N3    . DC  C 3 20  ? 42.47869 10.43470  -28.48453 1.000 43.04716  ? 821 DC  P N3    1 
ATOM   7880 C  C4    . DC  C 3 20  ? 42.90187 10.44800  -29.75043 1.000 41.37804  ? 821 DC  P C4    1 
ATOM   7881 N  N4    . DC  C 3 20  ? 42.03369 10.10640  -30.70301 1.000 37.83227  ? 821 DC  P N4    1 
ATOM   7882 C  C5    . DC  C 3 20  ? 44.23687 10.81437  -30.09472 1.000 41.23029  ? 821 DC  P C5    1 
ATOM   7883 C  C6    . DC  C 3 20  ? 45.06087 11.15349  -29.09827 1.000 42.84834  ? 821 DC  P C6    1 
HETATM 7884 P  P     . DDG C 3 21  ? 49.15081 8.28325   -26.28093 1.000 38.41106  ? 822 DDG P P     1 
HETATM 7885 O  OP1   . DDG C 3 21  ? 50.25433 7.99146   -25.30073 1.000 38.80337  ? 822 DDG P OP1   1 
HETATM 7886 O  OP2   . DDG C 3 21  ? 49.24686 7.66201   -27.64315 1.000 45.60774  ? 822 DDG P OP2   1 
HETATM 7887 O  "O5'" . DDG C 3 21  ? 47.78889 7.74750   -25.60490 1.000 38.53556  ? 822 DDG P "O5'" 1 
HETATM 7888 C  "C5'" . DDG C 3 21  ? 47.81438 7.24663   -24.27853 1.000 37.25326  ? 822 DDG P "C5'" 1 
HETATM 7889 C  "C4'" . DDG C 3 21  ? 46.40415 6.85484   -23.87462 1.000 39.13381  ? 822 DDG P "C4'" 1 
HETATM 7890 O  "O4'" . DDG C 3 21  ? 45.42236 7.64079   -24.55301 1.000 39.67590  ? 822 DDG P "O4'" 1 
HETATM 7891 C  "C3'" . DDG C 3 21  ? 46.14865 5.40117   -24.25650 1.000 37.87991  ? 822 DDG P "C3'" 1 
HETATM 7892 C  "C2'" . DDG C 3 21  ? 44.68137 5.37742   -24.65538 1.000 40.41011  ? 822 DDG P "C2'" 1 
HETATM 7893 C  "C1'" . DDG C 3 21  ? 44.30263 6.82697   -24.94371 1.000 40.11149  ? 822 DDG P "C1'" 1 
HETATM 7894 N  N9    . DDG C 3 21  ? 43.97388 6.95213   -26.39454 1.000 40.88905  ? 822 DDG P N9    1 
HETATM 7895 C  C8    . DDG C 3 21  ? 44.82549 7.26499   -27.40181 1.000 45.64607  ? 822 DDG P C8    1 
HETATM 7896 N  N7    . DDG C 3 21  ? 44.21410 7.29304   -28.62155 1.000 40.40199  ? 822 DDG P N7    1 
HETATM 7897 C  C5    . DDG C 3 21  ? 42.92280 6.98427   -28.39204 1.000 39.68102  ? 822 DDG P C5    1 
HETATM 7898 C  C6    . DDG C 3 21  ? 41.71254 6.83328   -29.22409 1.000 37.73164  ? 822 DDG P C6    1 
HETATM 7899 O  O6    . DDG C 3 21  ? 41.75465 7.00276   -30.46325 1.000 40.45850  ? 822 DDG P O6    1 
HETATM 7900 N  N1    . DDG C 3 21  ? 40.56772 6.50902   -28.61295 1.000 41.71280  ? 822 DDG P N1    1 
HETATM 7901 C  C2    . DDG C 3 21  ? 40.47489 6.31904   -27.28115 1.000 43.53020  ? 822 DDG P C2    1 
HETATM 7902 N  N2    . DDG C 3 21  ? 39.26344 6.00403   -26.76765 1.000 41.38658  ? 822 DDG P N2    1 
HETATM 7903 N  N3    . DDG C 3 21  ? 41.54447 6.43930   -26.44828 1.000 43.22394  ? 822 DDG P N3    1 
HETATM 7904 C  C4    . DDG C 3 21  ? 42.77088 6.76057   -26.93804 1.000 41.12716  ? 822 DDG P C4    1 
ATOM   7905 P  P     . DG  D 4 3   ? 45.45485 1.01447   -44.48454 1.000 124.66214 ? 703 DG  T P     1 
ATOM   7906 O  OP1   . DG  D 4 3   ? 46.65903 1.87798   -44.43010 1.000 115.39773 ? 703 DG  T OP1   1 
ATOM   7907 O  OP2   . DG  D 4 3   ? 45.55413 -0.44242  -44.22916 1.000 117.49252 ? 703 DG  T OP2   1 
ATOM   7908 O  "O5'" . DG  D 4 3   ? 44.35517 1.62028   -43.49258 1.000 113.42058 ? 703 DG  T "O5'" 1 
ATOM   7909 C  "C5'" . DG  D 4 3   ? 43.02214 1.15681   -43.55664 1.000 103.89211 ? 703 DG  T "C5'" 1 
ATOM   7910 C  "C4'" . DG  D 4 3   ? 42.04935 2.31411   -43.69047 1.000 100.20405 ? 703 DG  T "C4'" 1 
ATOM   7911 O  "O4'" . DG  D 4 3   ? 40.98098 1.93762   -44.58275 1.000 95.90931  ? 703 DG  T "O4'" 1 
ATOM   7912 C  "C3'" . DG  D 4 3   ? 41.35399 2.70760   -42.40201 1.000 101.28593 ? 703 DG  T "C3'" 1 
ATOM   7913 O  "O3'" . DG  D 4 3   ? 40.93509 4.08256   -42.45348 1.000 102.42977 ? 703 DG  T "O3'" 1 
ATOM   7914 C  "C2'" . DG  D 4 3   ? 40.16580 1.74298   -42.35637 1.000 94.38113  ? 703 DG  T "C2'" 1 
ATOM   7915 C  "C1'" . DG  D 4 3   ? 39.88609 1.44043   -43.83392 1.000 93.01334  ? 703 DG  T "C1'" 1 
ATOM   7916 N  N9    . DG  D 4 3   ? 39.72805 0.00693   -44.13172 1.000 92.25624  ? 703 DG  T N9    1 
ATOM   7917 C  C8    . DG  D 4 3   ? 40.66768 -0.98665  -43.95944 1.000 92.14734  ? 703 DG  T C8    1 
ATOM   7918 N  N7    . DG  D 4 3   ? 40.25545 -2.16839  -44.32442 1.000 88.12901  ? 703 DG  T N7    1 
ATOM   7919 C  C5    . DG  D 4 3   ? 38.95729 -1.95376  -44.76724 1.000 86.57891  ? 703 DG  T C5    1 
ATOM   7920 C  C6    . DG  D 4 3   ? 38.00906 -2.87157  -45.28097 1.000 89.08044  ? 703 DG  T C6    1 
ATOM   7921 O  O6    . DG  D 4 3   ? 38.13580 -4.09261  -45.45014 1.000 90.19747  ? 703 DG  T O6    1 
ATOM   7922 N  N1    . DG  D 4 3   ? 36.80968 -2.24289  -45.61768 1.000 93.48399  ? 703 DG  T N1    1 
ATOM   7923 C  C2    . DG  D 4 3   ? 36.55564 -0.89519  -45.47580 1.000 89.82959  ? 703 DG  T C2    1 
ATOM   7924 N  N2    . DG  D 4 3   ? 35.33252 -0.47863  -45.85403 1.000 81.32824  ? 703 DG  T N2    1 
ATOM   7925 N  N3    . DG  D 4 3   ? 37.43802 -0.02011  -44.99385 1.000 84.60487  ? 703 DG  T N3    1 
ATOM   7926 C  C4    . DG  D 4 3   ? 38.61396 -0.61936  -44.65964 1.000 87.25200  ? 703 DG  T C4    1 
ATOM   7927 P  P     . DG  D 4 4   ? 40.62090 4.90036   -41.09638 1.000 104.70989 ? 704 DG  T P     1 
ATOM   7928 O  OP1   . DG  D 4 4   ? 40.36246 6.29861   -41.50607 1.000 104.38442 ? 704 DG  T OP1   1 
ATOM   7929 O  OP2   . DG  D 4 4   ? 41.66487 4.62569   -40.07796 1.000 91.79977  ? 704 DG  T OP2   1 
ATOM   7930 O  "O5'" . DG  D 4 4   ? 39.23715 4.27008   -40.57988 1.000 99.66513  ? 704 DG  T "O5'" 1 
ATOM   7931 C  "C5'" . DG  D 4 4   ? 38.01258 4.59709   -41.24875 1.000 94.85903  ? 704 DG  T "C5'" 1 
ATOM   7932 C  "C4'" . DG  D 4 4   ? 36.88118 3.65626   -40.84717 1.000 89.33603  ? 704 DG  T "C4'" 1 
ATOM   7933 O  "O4'" . DG  D 4 4   ? 37.06639 2.37801   -41.47862 1.000 84.96679  ? 704 DG  T "O4'" 1 
ATOM   7934 C  "C3'" . DG  D 4 4   ? 36.78435 3.34509   -39.36340 1.000 80.87938  ? 704 DG  T "C3'" 1 
ATOM   7935 O  "O3'" . DG  D 4 4   ? 36.04492 4.39723   -38.68010 1.000 75.56598  ? 704 DG  T "O3'" 1 
ATOM   7936 C  "C2'" . DG  D 4 4   ? 36.07589 1.98395   -39.34167 1.000 74.12604  ? 704 DG  T "C2'" 1 
ATOM   7937 C  "C1'" . DG  D 4 4   ? 36.41277 1.38055   -40.71717 1.000 82.30010  ? 704 DG  T "C1'" 1 
ATOM   7938 N  N9    . DG  D 4 4   ? 37.28222 0.20469   -40.66071 1.000 82.24900  ? 704 DG  T N9    1 
ATOM   7939 C  C8    . DG  D 4 4   ? 38.55481 0.13622   -40.14126 1.000 78.34619  ? 704 DG  T C8    1 
ATOM   7940 N  N7    . DG  D 4 4   ? 39.09811 -1.04607  -40.25208 1.000 77.80950  ? 704 DG  T N7    1 
ATOM   7941 C  C5    . DG  D 4 4   ? 38.11773 -1.81548  -40.87703 1.000 78.26999  ? 704 DG  T C5    1 
ATOM   7942 C  C6    . DG  D 4 4   ? 38.12549 -3.18778  -41.24805 1.000 80.22618  ? 704 DG  T C6    1 
ATOM   7943 O  O6    . DG  D 4 4   ? 39.03368 -4.02331  -41.09681 1.000 79.73144  ? 704 DG  T O6    1 
ATOM   7944 N  N1    . DG  D 4 4   ? 36.93064 -3.56502  -41.86002 1.000 78.80435  ? 704 DG  T N1    1 
ATOM   7945 C  C2    . DG  D 4 4   ? 35.86286 -2.72645  -42.08257 1.000 80.37985  ? 704 DG  T C2    1 
ATOM   7946 N  N2    . DG  D 4 4   ? 34.79761 -3.26867  -42.69722 1.000 76.59295  ? 704 DG  T N2    1 
ATOM   7947 N  N3    . DG  D 4 4   ? 35.84037 -1.44262  -41.73309 1.000 78.73537  ? 704 DG  T N3    1 
ATOM   7948 C  C4    . DG  D 4 4   ? 36.99738 -1.05826  -41.13861 1.000 78.79747  ? 704 DG  T C4    1 
ATOM   7949 P  P     . DA  D 4 5   ? 34.49327 4.24355   -38.27652 1.000 72.67925  ? 705 DA  T P     1 
ATOM   7950 O  OP1   . DA  D 4 5   ? 33.70805 3.78271   -39.43660 1.000 81.24433  ? 705 DA  T OP1   1 
ATOM   7951 O  OP2   . DA  D 4 5   ? 34.08226 5.52607   -37.66455 1.000 73.40752  ? 705 DA  T OP2   1 
ATOM   7952 O  "O5'" . DA  D 4 5   ? 34.50632 3.15132   -37.10264 1.000 64.14110  ? 705 DA  T "O5'" 1 
ATOM   7953 C  "C5'" . DA  D 4 5   ? 33.35294 2.37663   -36.85023 1.000 60.64219  ? 705 DA  T "C5'" 1 
ATOM   7954 C  "C4'" . DA  D 4 5   ? 33.25710 1.99385   -35.38293 1.000 58.58190  ? 705 DA  T "C4'" 1 
ATOM   7955 O  "O4'" . DA  D 4 5   ? 34.31512 1.06135   -35.01927 1.000 59.61654  ? 705 DA  T "O4'" 1 
ATOM   7956 C  "C3'" . DA  D 4 5   ? 33.41136 3.13024   -34.40470 1.000 51.76962  ? 705 DA  T "C3'" 1 
ATOM   7957 O  "O3'" . DA  D 4 5   ? 32.18865 3.80280   -34.29031 1.000 52.88265  ? 705 DA  T "O3'" 1 
ATOM   7958 C  "C2'" . DA  D 4 5   ? 33.75099 2.34780   -33.14115 1.000 52.99539  ? 705 DA  T "C2'" 1 
ATOM   7959 C  "C1'" . DA  D 4 5   ? 34.73543 1.32603   -33.69037 1.000 48.59790  ? 705 DA  T "C1'" 1 
ATOM   7960 N  N9    . DA  D 4 5   ? 36.09775 1.84155   -33.74106 1.000 49.88486  ? 705 DA  T N9    1 
ATOM   7961 C  C8    . DA  D 4 5   ? 36.80508 2.19305   -34.85710 1.000 51.54951  ? 705 DA  T C8    1 
ATOM   7962 N  N7    . DA  D 4 5   ? 38.00837 2.64979   -34.59671 1.000 52.44628  ? 705 DA  T N7    1 
ATOM   7963 C  C5    . DA  D 4 5   ? 38.09302 2.60165   -33.20850 1.000 47.28260  ? 705 DA  T C5    1 
ATOM   7964 C  C6    . DA  D 4 5   ? 39.11848 2.94929   -32.29422 1.000 46.70243  ? 705 DA  T C6    1 
ATOM   7965 N  N6    . DA  D 4 5   ? 40.32014 3.43353   -32.65773 1.000 40.18786  ? 705 DA  T N6    1 
ATOM   7966 N  N1    . DA  D 4 5   ? 38.85918 2.78006   -30.98072 1.000 49.62658  ? 705 DA  T N1    1 
ATOM   7967 C  C2    . DA  D 4 5   ? 37.67088 2.29671   -30.60836 1.000 43.95556  ? 705 DA  T C2    1 
ATOM   7968 N  N3    . DA  D 4 5   ? 36.64580 1.93456   -31.36684 1.000 48.34775  ? 705 DA  T N3    1 
ATOM   7969 C  C4    . DA  D 4 5   ? 36.92225 2.11134   -32.66883 1.000 47.73703  ? 705 DA  T C4    1 
ATOM   7970 P  P     . DC  D 4 6   ? 32.12720 5.29084   -33.69445 1.000 52.73739  ? 706 DC  T P     1 
ATOM   7971 O  OP1   . DC  D 4 6   ? 30.70726 5.70016   -33.64477 1.000 46.36191  ? 706 DC  T OP1   1 
ATOM   7972 O  OP2   . DC  D 4 6   ? 33.11370 6.12469   -34.42535 1.000 56.98136  ? 706 DC  T OP2   1 
ATOM   7973 O  "O5'" . DC  D 4 6   ? 32.64844 5.10861   -32.20394 1.000 50.27113  ? 706 DC  T "O5'" 1 
ATOM   7974 C  "C5'" . DC  D 4 6   ? 31.87084 4.40166   -31.25579 1.000 47.51709  ? 706 DC  T "C5'" 1 
ATOM   7975 C  "C4'" . DC  D 4 6   ? 32.53005 4.47862   -29.89365 1.000 48.41944  ? 706 DC  T "C4'" 1 
ATOM   7976 O  "O4'" . DC  D 4 6   ? 33.86916 3.94025   -29.97217 1.000 46.14594  ? 706 DC  T "O4'" 1 
ATOM   7977 C  "C3'" . DC  D 4 6   ? 32.73879 5.88438   -29.38212 1.000 40.35776  ? 706 DC  T "C3'" 1 
ATOM   7978 O  "O3'" . DC  D 4 6   ? 31.54654 6.36253   -28.80682 1.000 39.34551  ? 706 DC  T "O3'" 1 
ATOM   7979 C  "C2'" . DC  D 4 6   ? 33.83585 5.67567   -28.34447 1.000 37.31339  ? 706 DC  T "C2'" 1 
ATOM   7980 C  "C1'" . DC  D 4 6   ? 34.68680 4.59060   -29.00812 1.000 44.06154  ? 706 DC  T "C1'" 1 
ATOM   7981 N  N1    . DC  D 4 6   ? 35.87744 5.10771   -29.69616 1.000 40.09088  ? 706 DC  T N1    1 
ATOM   7982 C  C2    . DC  D 4 6   ? 36.99943 5.49846   -28.95221 1.000 40.91080  ? 706 DC  T C2    1 
ATOM   7983 O  O2    . DC  D 4 6   ? 36.97235 5.40868   -27.72364 1.000 43.27550  ? 706 DC  T O2    1 
ATOM   7984 N  N3    . DC  D 4 6   ? 38.08615 5.96422   -29.60548 1.000 41.12864  ? 706 DC  T N3    1 
ATOM   7985 C  C4    . DC  D 4 6   ? 38.07786 6.03885   -30.94387 1.000 41.94781  ? 706 DC  T C4    1 
ATOM   7986 N  N4    . DC  D 4 6   ? 39.16742 6.51133   -31.55237 1.000 42.06296  ? 706 DC  T N4    1 
ATOM   7987 C  C5    . DC  D 4 6   ? 36.94619 5.64193   -31.71362 1.000 41.07299  ? 706 DC  T C5    1 
ATOM   7988 C  C6    . DC  D 4 6   ? 35.87887 5.18465   -31.05202 1.000 41.60326  ? 706 DC  T C6    1 
ATOM   7989 P  P     . DG  D 4 7   ? 31.24609 7.93634   -28.80749 1.000 39.69493  ? 707 DG  T P     1 
ATOM   7990 O  OP1   . DG  D 4 7   ? 29.84424 8.12458   -28.40225 1.000 40.28087  ? 707 DG  T OP1   1 
ATOM   7991 O  OP2   . DG  D 4 7   ? 31.78211 8.50014   -30.06271 1.000 39.55787  ? 707 DG  T OP2   1 
ATOM   7992 O  "O5'" . DG  D 4 7   ? 32.19589 8.50353   -27.66212 1.000 39.81233  ? 707 DG  T "O5'" 1 
ATOM   7993 C  "C5'" . DG  D 4 7   ? 31.76319 8.52871   -26.32596 1.000 36.54670  ? 707 DG  T "C5'" 1 
ATOM   7994 C  "C4'" . DG  D 4 7   ? 32.90866 8.95561   -25.44239 1.000 42.08219  ? 707 DG  T "C4'" 1 
ATOM   7995 O  "O4'" . DG  D 4 7   ? 34.08319 8.22051   -25.84442 1.000 41.30891  ? 707 DG  T "O4'" 1 
ATOM   7996 C  "C3'" . DG  D 4 7   ? 33.34248 10.39124  -25.62167 1.000 46.18664  ? 707 DG  T "C3'" 1 
ATOM   7997 O  "O3'" . DG  D 4 7   ? 32.51109 11.28399  -24.90566 1.000 39.98723  ? 707 DG  T "O3'" 1 
ATOM   7998 C  "C2'" . DG  D 4 7   ? 34.76726 10.35331  -25.07514 1.000 40.96270  ? 707 DG  T "C2'" 1 
ATOM   7999 C  "C1'" . DG  D 4 7   ? 35.23775 9.00509   -25.60812 1.000 41.08118  ? 707 DG  T "C1'" 1 
ATOM   8000 N  N9    . DG  D 4 7   ? 35.99287 9.07546   -26.84442 1.000 36.53848  ? 707 DG  T N9    1 
ATOM   8001 C  C8    . DG  D 4 7   ? 35.51804 8.89103   -28.11466 1.000 38.27206  ? 707 DG  T C8    1 
ATOM   8002 N  N7    . DG  D 4 7   ? 36.44469 8.97378   -29.03517 1.000 35.99782  ? 707 DG  T N7    1 
ATOM   8003 C  C5    . DG  D 4 7   ? 37.60754 9.21780   -28.31531 1.000 38.74506  ? 707 DG  T C5    1 
ATOM   8004 C  C6    . DG  D 4 7   ? 38.93390 9.41025   -28.76432 1.000 41.39138  ? 707 DG  T C6    1 
ATOM   8005 O  O6    . DG  D 4 7   ? 39.35678 9.38817   -29.93137 1.000 41.71888  ? 707 DG  T O6    1 
ATOM   8006 N  N1    . DG  D 4 7   ? 39.81288 9.62755   -27.70338 1.000 39.13905  ? 707 DG  T N1    1 
ATOM   8007 C  C2    . DG  D 4 7   ? 39.45524 9.65721   -26.38102 1.000 38.13319  ? 707 DG  T C2    1 
ATOM   8008 N  N2    . DG  D 4 7   ? 40.42911 9.87896   -25.51040 1.000 39.06955  ? 707 DG  T N2    1 
ATOM   8009 N  N3    . DG  D 4 7   ? 38.21894 9.48808   -25.94442 1.000 42.44740  ? 707 DG  T N3    1 
ATOM   8010 C  C4    . DG  D 4 7   ? 37.34699 9.27251   -26.96721 1.000 40.62949  ? 707 DG  T C4    1 
ATOM   8011 P  P     . DG  D 4 8   ? 32.48639 12.81663  -25.37442 1.000 39.92138  ? 708 DG  T P     1 
ATOM   8012 O  OP1   . DG  D 4 8   ? 31.34543 13.47940  -24.69346 1.000 38.51162  ? 708 DG  T OP1   1 
ATOM   8013 O  OP2   . DG  D 4 8   ? 32.54323 12.79017  -26.84436 1.000 38.77234  ? 708 DG  T OP2   1 
ATOM   8014 O  "O5'" . DG  D 4 8   ? 33.91633 13.39118  -24.89773 1.000 37.42688  ? 708 DG  T "O5'" 1 
ATOM   8015 C  "C5'" . DG  D 4 8   ? 34.25622 13.38584  -23.50594 1.000 36.43659  ? 708 DG  T "C5'" 1 
ATOM   8016 C  "C4'" . DG  D 4 8   ? 35.68375 13.84051  -23.27241 1.000 36.04115  ? 708 DG  T "C4'" 1 
ATOM   8017 O  "O4'" . DG  D 4 8   ? 36.59501 12.85429  -23.79118 1.000 40.65794  ? 708 DG  T "O4'" 1 
ATOM   8018 C  "C3'" . DG  D 4 8   ? 36.08105 15.13281  -23.96753 1.000 37.22566  ? 708 DG  T "C3'" 1 
ATOM   8019 O  "O3'" . DG  D 4 8   ? 35.70638 16.20989  -23.18095 1.000 37.90454  ? 708 DG  T "O3'" 1 
ATOM   8020 C  "C2'" . DG  D 4 8   ? 37.58962 14.99334  -24.01722 1.000 36.47258  ? 708 DG  T "C2'" 1 
ATOM   8021 C  "C1'" . DG  D 4 8   ? 37.73546 13.50203  -24.33701 1.000 38.48817  ? 708 DG  T "C1'" 1 
ATOM   8022 N  N9    . DG  D 4 8   ? 37.77192 13.21960  -25.76489 1.000 37.95933  ? 708 DG  T N9    1 
ATOM   8023 C  C8    . DG  D 4 8   ? 36.71574 12.85098  -26.56159 1.000 36.81004  ? 708 DG  T C8    1 
ATOM   8024 N  N7    . DG  D 4 8   ? 37.04642 12.67570  -27.81280 1.000 39.68905  ? 708 DG  T N7    1 
ATOM   8025 C  C5    . DG  D 4 8   ? 38.40460 12.95105  -27.84564 1.000 40.46754  ? 708 DG  T C5    1 
ATOM   8026 C  C6    . DG  D 4 8   ? 39.31085 12.93344  -28.93120 1.000 41.55122  ? 708 DG  T C6    1 
ATOM   8027 O  O6    . DG  D 4 8   ? 39.08340 12.65169  -30.11036 1.000 41.58071  ? 708 DG  T O6    1 
ATOM   8028 N  N1    . DG  D 4 8   ? 40.60938 13.28287  -28.53433 1.000 41.39241  ? 708 DG  T N1    1 
ATOM   8029 C  C2    . DG  D 4 8   ? 40.97265 13.60116  -27.24534 1.000 42.27984  ? 708 DG  T C2    1 
ATOM   8030 N  N2    . DG  D 4 8   ? 42.26034 13.88981  -27.04862 1.000 43.74515  ? 708 DG  T N2    1 
ATOM   8031 N  N3    . DG  D 4 8   ? 40.12790 13.62306  -26.21554 1.000 41.05962  ? 708 DG  T N3    1 
ATOM   8032 C  C4    . DG  D 4 8   ? 38.86645 13.28849  -26.59027 1.000 40.72177  ? 708 DG  T C4    1 
ATOM   8033 P  P     . DC  D 4 9   ? 34.91586 17.45317  -23.81006 1.000 35.95408  ? 709 DC  T P     1 
ATOM   8034 O  OP1   . DC  D 4 9   ? 34.21179 17.97989  -22.64200 1.000 35.51692  ? 709 DC  T OP1   1 
ATOM   8035 O  OP2   . DC  D 4 9   ? 34.17564 17.09870  -25.03479 1.000 37.78034  ? 709 DC  T OP2   1 
ATOM   8036 O  "O5'" . DC  D 4 9   ? 36.08484 18.46913  -24.22873 1.000 36.52318  ? 709 DC  T "O5'" 1 
ATOM   8037 C  "C5'" . DC  D 4 9   ? 36.91740 19.01025  -23.22300 1.000 32.13173  ? 709 DC  T "C5'" 1 
ATOM   8038 C  "C4'" . DC  D 4 9   ? 38.27286 19.32019  -23.78140 1.000 33.94587  ? 709 DC  T "C4'" 1 
ATOM   8039 O  "O4'" . DC  D 4 9   ? 38.85490 18.11622  -24.33200 1.000 41.16469  ? 709 DC  T "O4'" 1 
ATOM   8040 C  "C3'" . DC  D 4 9   ? 38.26238 20.28122  -24.94062 1.000 39.17017  ? 709 DC  T "C3'" 1 
ATOM   8041 O  "O3'" . DC  D 4 9   ? 38.20983 21.58499  -24.46052 1.000 40.55433  ? 709 DC  T "O3'" 1 
ATOM   8042 C  "C2'" . DC  D 4 9   ? 39.59945 19.97041  -25.60336 1.000 38.96976  ? 709 DC  T "C2'" 1 
ATOM   8043 C  "C1'" . DC  D 4 9   ? 39.64174 18.45125  -25.47447 1.000 39.06216  ? 709 DC  T "C1'" 1 
ATOM   8044 N  N1    . DC  D 4 9   ? 39.08320 17.74045  -26.66621 1.000 41.69477  ? 709 DC  T N1    1 
ATOM   8045 C  C2    . DC  D 4 9   ? 39.88532 17.56363  -27.78733 1.000 40.57974  ? 709 DC  T C2    1 
ATOM   8046 O  O2    . DC  D 4 9   ? 41.03294 18.00761  -27.76750 1.000 44.53459  ? 709 DC  T O2    1 
ATOM   8047 N  N3    . DC  D 4 9   ? 39.37689 16.91782  -28.86852 1.000 42.92718  ? 709 DC  T N3    1 
ATOM   8048 C  C4    . DC  D 4 9   ? 38.11826 16.45159  -28.83983 1.000 44.09374  ? 709 DC  T C4    1 
ATOM   8049 N  N4    . DC  D 4 9   ? 37.65530 15.80875  -29.92460 1.000 42.11135  ? 709 DC  T N4    1 
ATOM   8050 C  C5    . DC  D 4 9   ? 37.28394 16.61758  -27.69432 1.000 38.96924  ? 709 DC  T C5    1 
ATOM   8051 C  C6    . DC  D 4 9   ? 37.79889 17.26057  -26.64192 1.000 40.41875  ? 709 DC  T C6    1 
ATOM   8052 P  P     . DG  D 4 10  ? 37.63840 22.75452  -25.38608 1.000 40.42547  ? 710 DG  T P     1 
ATOM   8053 O  OP1   . DG  D 4 10  ? 37.78918 23.98331  -24.56317 1.000 39.13693  ? 710 DG  T OP1   1 
ATOM   8054 O  OP2   . DG  D 4 10  ? 36.28485 22.37104  -25.86590 1.000 30.66564  ? 710 DG  T OP2   1 
ATOM   8055 O  "O5'" . DG  D 4 10  ? 38.71412 22.82001  -26.57335 1.000 42.21595  ? 710 DG  T "O5'" 1 
ATOM   8056 C  "C5'" . DG  D 4 10  ? 40.05271 23.25768  -26.28090 1.000 37.35438  ? 710 DG  T "C5'" 1 
ATOM   8057 C  "C4'" . DG  D 4 10  ? 40.91578 23.31187  -27.52998 1.000 37.55027  ? 710 DG  T "C4'" 1 
ATOM   8058 O  "O4'" . DG  D 4 10  ? 41.14743 21.98016  -28.00746 1.000 43.22996  ? 710 DG  T "O4'" 1 
ATOM   8059 C  "C3'" . DG  D 4 10  ? 40.32844 24.06929  -28.70792 1.000 41.78154  ? 710 DG  T "C3'" 1 
ATOM   8060 O  "O3'" . DG  D 4 10  ? 40.74803 25.40121  -28.65320 1.000 47.45382  ? 710 DG  T "O3'" 1 
ATOM   8061 C  "C2'" . DG  D 4 10  ? 40.97116 23.37992  -29.89717 1.000 46.15412  ? 710 DG  T "C2'" 1 
ATOM   8062 C  "C1'" . DG  D 4 10  ? 41.11088 21.95402  -29.41487 1.000 43.96417  ? 710 DG  T "C1'" 1 
ATOM   8063 N  N9    . DG  D 4 10  ? 40.01413 21.10247  -29.84166 1.000 44.87193  ? 710 DG  T N9    1 
ATOM   8064 C  C8    . DG  D 4 10  ? 38.91384 20.71248  -29.11546 1.000 39.19419  ? 710 DG  T C8    1 
ATOM   8065 N  N7    . DG  D 4 10  ? 38.10865 19.93812  -29.78965 1.000 40.45042  ? 710 DG  T N7    1 
ATOM   8066 C  C5    . DG  D 4 10  ? 38.71348 19.81917  -31.03338 1.000 40.97509  ? 710 DG  T C5    1 
ATOM   8067 C  C6    . DG  D 4 10  ? 38.31374 19.10706  -32.18509 1.000 45.67825  ? 710 DG  T C6    1 
ATOM   8068 O  O6    . DG  D 4 10  ? 37.30430 18.40504  -32.35044 1.000 47.26244  ? 710 DG  T O6    1 
ATOM   8069 N  N1    . DG  D 4 10  ? 39.22313 19.26907  -33.22905 1.000 47.40710  ? 710 DG  T N1    1 
ATOM   8070 C  C2    . DG  D 4 10  ? 40.37294 20.01538  -33.16725 1.000 46.41871  ? 710 DG  T C2    1 
ATOM   8071 N  N2    . DG  D 4 10  ? 41.13701 20.04193  -34.26637 1.000 44.73155  ? 710 DG  T N2    1 
ATOM   8072 N  N3    . DG  D 4 10  ? 40.75247 20.68542  -32.09803 1.000 47.50778  ? 710 DG  T N3    1 
ATOM   8073 C  C4    . DG  D 4 10  ? 39.88059 20.53745  -31.07469 1.000 45.36178  ? 710 DG  T C4    1 
ATOM   8074 P  P     . DC  D 4 11  ? 39.87036 26.55363  -29.32140 1.000 44.62084  ? 711 DC  T P     1 
ATOM   8075 O  OP1   . DC  D 4 11  ? 40.56825 27.81327  -28.98119 1.000 51.90823  ? 711 DC  T OP1   1 
ATOM   8076 O  OP2   . DC  D 4 11  ? 38.46034 26.34389  -28.91718 1.000 37.75133  ? 711 DC  T OP2   1 
ATOM   8077 O  "O5'" . DC  D 4 11  ? 40.02426 26.30336  -30.88890 1.000 44.89997  ? 711 DC  T "O5'" 1 
ATOM   8078 C  "C5'" . DC  D 4 11  ? 41.28291 26.52197  -31.52208 1.000 49.07155  ? 711 DC  T "C5'" 1 
ATOM   8079 C  "C4'" . DC  D 4 11  ? 41.19093 26.14287  -32.97971 1.000 50.71859  ? 711 DC  T "C4'" 1 
ATOM   8080 O  "O4'" . DC  D 4 11  ? 40.80185 24.76018  -33.06054 1.000 54.98385  ? 711 DC  T "O4'" 1 
ATOM   8081 C  "C3'" . DC  D 4 11  ? 40.14286 26.92825  -33.74716 1.000 52.48557  ? 711 DC  T "C3'" 1 
ATOM   8082 O  "O3'" . DC  D 4 11  ? 40.76709 27.82599  -34.62314 1.000 57.73950  ? 711 DC  T "O3'" 1 
ATOM   8083 C  "C2'" . DC  D 4 11  ? 39.34086 25.89762  -34.53291 1.000 51.97474  ? 711 DC  T "C2'" 1 
ATOM   8084 C  "C1'" . DC  D 4 11  ? 39.87047 24.54853  -34.08791 1.000 51.13211  ? 711 DC  T "C1'" 1 
ATOM   8085 N  N1    . DC  D 4 11  ? 38.80329 23.67292  -33.56327 1.000 50.90395  ? 711 DC  T N1    1 
ATOM   8086 C  C2    . DC  D 4 11  ? 38.24181 22.69115  -34.38909 1.000 51.32185  ? 711 DC  T C2    1 
ATOM   8087 O  O2    . DC  D 4 11  ? 38.66116 22.56836  -35.54852 1.000 49.18555  ? 711 DC  T O2    1 
ATOM   8088 N  N3    . DC  D 4 11  ? 37.25027 21.90078  -33.88941 1.000 50.05656  ? 711 DC  T N3    1 
ATOM   8089 C  C4    . DC  D 4 11  ? 36.82714 22.07550  -32.63286 1.000 46.46314  ? 711 DC  T C4    1 
ATOM   8090 N  N4    . DC  D 4 11  ? 35.84557 21.28537  -32.18245 1.000 42.93767  ? 711 DC  T N4    1 
ATOM   8091 C  C5    . DC  D 4 11  ? 37.38936 23.07647  -31.78504 1.000 47.55421  ? 711 DC  T C5    1 
ATOM   8092 C  C6    . DC  D 4 11  ? 38.36083 23.84592  -32.28781 1.000 47.05936  ? 711 DC  T C6    1 
ATOM   8093 P  P     . DC  D 4 12  ? 39.98430 29.14936  -35.07462 1.000 68.79796  ? 712 DC  T P     1 
ATOM   8094 O  OP1   . DC  D 4 12  ? 41.06128 30.12380  -35.35755 1.000 56.23176  ? 712 DC  T OP1   1 
ATOM   8095 O  OP2   . DC  D 4 12  ? 38.83653 29.40102  -34.15407 1.000 52.10539  ? 712 DC  T OP2   1 
ATOM   8096 O  "O5'" . DC  D 4 12  ? 39.20590 28.73424  -36.40562 1.000 64.91246  ? 712 DC  T "O5'" 1 
ATOM   8097 C  "C5'" . DC  D 4 12  ? 39.82468 27.97075  -37.41533 1.000 60.96530  ? 712 DC  T "C5'" 1 
ATOM   8098 C  "C4'" . DC  D 4 12  ? 38.75058 27.44198  -38.33573 1.000 61.42066  ? 712 DC  T "C4'" 1 
ATOM   8099 O  "O4'" . DC  D 4 12  ? 38.18076 26.24344  -37.75708 1.000 61.94693  ? 712 DC  T "O4'" 1 
ATOM   8100 C  "C3'" . DC  D 4 12  ? 37.59475 28.41824  -38.53867 1.000 58.19574  ? 712 DC  T "C3'" 1 
ATOM   8101 O  "O3'" . DC  D 4 12  ? 37.63144 28.92944  -39.86777 1.000 64.09917  ? 712 DC  T "O3'" 1 
ATOM   8102 C  "C2'" . DC  D 4 12  ? 36.32081 27.60068  -38.27835 1.000 59.56468  ? 712 DC  T "C2'" 1 
ATOM   8103 C  "C1'" . DC  D 4 12  ? 36.80805 26.17203  -38.04271 1.000 60.28206  ? 712 DC  T "C1'" 1 
ATOM   8104 N  N1    . DC  D 4 12  ? 36.11696 25.49579  -36.88275 1.000 57.26693  ? 712 DC  T N1    1 
ATOM   8105 C  C2    . DC  D 4 12  ? 35.29915 24.38613  -37.10972 1.000 54.69855  ? 712 DC  T C2    1 
ATOM   8106 O  O2    . DC  D 4 12  ? 35.17025 23.97397  -38.26179 1.000 58.30363  ? 712 DC  T O2    1 
ATOM   8107 N  N3    . DC  D 4 12  ? 34.67599 23.79750  -36.05713 1.000 51.91808  ? 712 DC  T N3    1 
ATOM   8108 C  C4    . DC  D 4 12  ? 34.85354 24.28222  -34.82787 1.000 52.39471  ? 712 DC  T C4    1 
ATOM   8109 N  N4    . DC  D 4 12  ? 34.22137 23.68253  -33.81279 1.000 47.61589  ? 712 DC  T N4    1 
ATOM   8110 C  C5    . DC  D 4 12  ? 35.68494 25.41135  -34.58310 1.000 51.69553  ? 712 DC  T C5    1 
ATOM   8111 C  C6    . DC  D 4 12  ? 36.27787 25.98616  -35.63012 1.000 51.10831  ? 712 DC  T C6    1 
ATOM   8112 P  P     . DC  D 4 13  ? 36.54227 29.99709  -40.38615 1.000 65.39248  ? 713 DC  T P     1 
ATOM   8113 O  OP1   . DC  D 4 13  ? 37.20115 30.64444  -41.54875 1.000 58.49552  ? 713 DC  T OP1   1 
ATOM   8114 O  OP2   . DC  D 4 13  ? 35.99703 30.78493  -39.25271 1.000 57.71879  ? 713 DC  T OP2   1 
ATOM   8115 O  "O5'" . DC  D 4 13  ? 35.31484 29.10468  -40.89687 1.000 61.20885  ? 713 DC  T "O5'" 1 
ATOM   8116 C  "C5'" . DC  D 4 13  ? 35.50389 28.18387  -41.95083 1.000 61.83172  ? 713 DC  T "C5'" 1 
ATOM   8117 C  "C4'" . DC  D 4 13  ? 34.20679 27.47414  -42.25745 1.000 66.71427  ? 713 DC  T "C4'" 1 
ATOM   8118 O  "O4'" . DC  D 4 13  ? 33.90089 26.56819  -41.18012 1.000 66.51571  ? 713 DC  T "O4'" 1 
ATOM   8119 C  "C3'" . DC  D 4 13  ? 33.00980 28.39745  -42.41440 1.000 68.82842  ? 713 DC  T "C3'" 1 
ATOM   8120 O  "O3'" . DC  D 4 13  ? 32.47452 28.26805  -43.72442 1.000 75.76739  ? 713 DC  T "O3'" 1 
ATOM   8121 C  "C2'" . DC  D 4 13  ? 32.01054 27.94999  -41.34475 1.000 63.91985  ? 713 DC  T "C2'" 1 
ATOM   8122 C  "C1'" . DC  D 4 13  ? 32.53700 26.60528  -40.86838 1.000 63.87413  ? 713 DC  T "C1'" 1 
ATOM   8123 N  N1    . DC  D 4 13  ? 32.42539 26.44348  -39.39399 1.000 65.83193  ? 713 DC  T N1    1 
ATOM   8124 C  C2    . DC  D 4 13  ? 31.69249 25.37904  -38.84733 1.000 63.84630  ? 713 DC  T C2    1 
ATOM   8125 O  O2    . DC  D 4 13  ? 31.13371 24.57205  -39.60787 1.000 61.27161  ? 713 DC  T O2    1 
ATOM   8126 N  N3    . DC  D 4 13  ? 31.61389 25.27576  -37.49113 1.000 64.42859  ? 713 DC  T N3    1 
ATOM   8127 C  C4    . DC  D 4 13  ? 32.23187 26.18078  -36.70955 1.000 61.96272  ? 713 DC  T C4    1 
ATOM   8128 N  N4    . DC  D 4 13  ? 32.13180 26.05063  -35.37725 1.000 57.89302  ? 713 DC  T N4    1 
ATOM   8129 C  C5    . DC  D 4 13  ? 32.97848 27.25429  -37.25911 1.000 57.72917  ? 713 DC  T C5    1 
ATOM   8130 C  C6    . DC  D 4 13  ? 33.04384 27.34814  -38.58435 1.000 61.35519  ? 713 DC  T C6    1 
ATOM   8131 P  P     . DG  D 4 14  ? 31.18669 29.12232  -44.15976 1.000 79.64642  ? 714 DG  T P     1 
ATOM   8132 O  OP1   . DG  D 4 14  ? 31.24395 29.21377  -45.63681 1.000 80.34064  ? 714 DG  T OP1   1 
ATOM   8133 O  OP2   . DG  D 4 14  ? 31.09453 30.35285  -43.32544 1.000 70.82857  ? 714 DG  T OP2   1 
ATOM   8134 O  "O5'" . DG  D 4 14  ? 29.96927 28.16732  -43.79234 1.000 67.52789  ? 714 DG  T "O5'" 1 
ATOM   8135 C  "C5'" . DG  D 4 14  ? 29.90751 26.87941  -44.36111 1.000 65.95962  ? 714 DG  T "C5'" 1 
ATOM   8136 C  "C4'" . DG  D 4 14  ? 28.64366 26.17452  -43.93801 1.000 66.91714  ? 714 DG  T "C4'" 1 
ATOM   8137 O  "O4'" . DG  D 4 14  ? 28.71165 25.86985  -42.51953 1.000 77.13980  ? 714 DG  T "O4'" 1 
ATOM   8138 C  "C3'" . DG  D 4 14  ? 27.36441 26.97188  -44.13652 1.000 70.02558  ? 714 DG  T "C3'" 1 
ATOM   8139 O  "O3'" . DG  D 4 14  ? 26.32518 26.07969  -44.53400 1.000 80.60454  ? 714 DG  T "O3'" 1 
ATOM   8140 C  "C2'" . DG  D 4 14  ? 27.11816 27.58509  -42.74708 1.000 70.10083  ? 714 DG  T "C2'" 1 
ATOM   8141 C  "C1'" . DG  D 4 14  ? 27.63843 26.48851  -41.82639 1.000 70.24471  ? 714 DG  T "C1'" 1 
ATOM   8142 N  N9    . DG  D 4 14  ? 28.14234 26.95765  -40.52224 1.000 66.71972  ? 714 DG  T N9    1 
ATOM   8143 C  C8    . DG  D 4 14  ? 28.95363 28.04756  -40.27614 1.000 65.17008  ? 714 DG  T C8    1 
ATOM   8144 N  N7    . DG  D 4 14  ? 29.26618 28.19863  -39.00988 1.000 61.45946  ? 714 DG  T N7    1 
ATOM   8145 C  C5    . DG  D 4 14  ? 28.62804 27.13336  -38.37344 1.000 64.56593  ? 714 DG  T C5    1 
ATOM   8146 C  C6    . DG  D 4 14  ? 28.60314 26.76276  -36.99890 1.000 60.83689  ? 714 DG  T C6    1 
ATOM   8147 O  O6    . DG  D 4 14  ? 29.15755 27.32188  -36.03934 1.000 59.45010  ? 714 DG  T O6    1 
ATOM   8148 N  N1    . DG  D 4 14  ? 27.83274 25.61783  -36.78670 1.000 59.37053  ? 714 DG  T N1    1 
ATOM   8149 C  C2    . DG  D 4 14  ? 27.17446 24.91224  -37.77512 1.000 63.93584  ? 714 DG  T C2    1 
ATOM   8150 N  N2    . DG  D 4 14  ? 26.48588 23.82921  -37.38504 1.000 60.62475  ? 714 DG  T N2    1 
ATOM   8151 N  N3    . DG  D 4 14  ? 27.19394 25.24144  -39.06431 1.000 65.32918  ? 714 DG  T N3    1 
ATOM   8152 C  C4    . DG  D 4 14  ? 27.93512 26.35888  -39.29149 1.000 66.98762  ? 714 DG  T C4    1 
ATOM   8153 P  P     . DA  D 4 15  ? 24.84353 26.61412  -44.85733 1.000 86.95059  ? 715 DA  T P     1 
ATOM   8154 O  OP1   . DA  D 4 15  ? 24.42416 26.00157  -46.13631 1.000 82.56760  ? 715 DA  T OP1   1 
ATOM   8155 O  OP2   . DA  D 4 15  ? 24.82109 28.08478  -44.69070 1.000 73.27500  ? 715 DA  T OP2   1 
ATOM   8156 O  "O5'" . DA  D 4 15  ? 23.95545 25.93532  -43.71766 1.000 72.70364  ? 715 DA  T "O5'" 1 
ATOM   8157 C  "C5'" . DA  D 4 15  ? 23.99581 24.53664  -43.55437 1.000 68.60078  ? 715 DA  T "C5'" 1 
ATOM   8158 C  "C4'" . DA  D 4 15  ? 23.08134 24.09965  -42.42762 1.000 74.64654  ? 715 DA  T "C4'" 1 
ATOM   8159 O  "O4'" . DA  D 4 15  ? 23.64726 24.48955  -41.15028 1.000 79.84317  ? 715 DA  T "O4'" 1 
ATOM   8160 C  "C3'" . DA  D 4 15  ? 21.68736 24.69057  -42.46014 1.000 79.82248  ? 715 DA  T "C3'" 1 
ATOM   8161 O  "O3'" . DA  D 4 15  ? 20.76951 23.73019  -41.98788 1.000 79.52597  ? 715 DA  T "O3'" 1 
ATOM   8162 C  "C2'" . DA  D 4 15  ? 21.79586 25.89518  -41.51424 1.000 79.35072  ? 715 DA  T "C2'" 1 
ATOM   8163 C  "C1'" . DA  D 4 15  ? 22.78954 25.39171  -40.47560 1.000 73.84096  ? 715 DA  T "C1'" 1 
ATOM   8164 N  N9    . DA  D 4 15  ? 23.63247 26.43518  -39.88143 1.000 67.48234  ? 715 DA  T N9    1 
ATOM   8165 C  C8    . DA  D 4 15  ? 24.29148 27.43829  -40.53586 1.000 64.66281  ? 715 DA  T C8    1 
ATOM   8166 N  N7    . DA  D 4 15  ? 25.00544 28.20672  -39.74723 1.000 62.00652  ? 715 DA  T N7    1 
ATOM   8167 C  C5    . DA  D 4 15  ? 24.81267 27.66304  -38.48727 1.000 63.60029  ? 715 DA  T C5    1 
ATOM   8168 C  C6    . DA  D 4 15  ? 25.30373 28.01612  -37.20651 1.000 63.50309  ? 715 DA  T C6    1 
ATOM   8169 N  N6    . DA  D 4 15  ? 26.12591 29.05780  -36.98575 1.000 61.11439  ? 715 DA  T N6    1 
ATOM   8170 N  N1    . DA  D 4 15  ? 24.91515 27.25429  -36.15722 1.000 61.28116  ? 715 DA  T N1    1 
ATOM   8171 C  C2    . DA  D 4 15  ? 24.09638 26.21964  -36.37797 1.000 62.35977  ? 715 DA  T C2    1 
ATOM   8172 N  N3    . DA  D 4 15  ? 23.57412 25.79302  -37.52801 1.000 65.28049  ? 715 DA  T N3    1 
ATOM   8173 C  C4    . DA  D 4 15  ? 23.97467 26.56555  -38.55343 1.000 65.94416  ? 715 DA  T C4    1 
ATOM   8174 P  P     . DA  D 4 16  ? 19.21222 23.83927  -42.36611 1.000 96.38443  ? 716 DA  T P     1 
ATOM   8175 O  OP1   . DA  D 4 16  ? 18.79674 22.46955  -42.75635 1.000 88.14788  ? 716 DA  T OP1   1 
ATOM   8176 O  OP2   . DA  D 4 16  ? 19.00492 24.98045  -43.29157 1.000 81.98624  ? 716 DA  T OP2   1 
ATOM   8177 O  "O5'" . DA  D 4 16  ? 18.52033 24.24235  -40.97869 1.000 88.32434  ? 716 DA  T "O5'" 1 
ATOM   8178 C  "C5'" . DA  D 4 16  ? 18.59275 23.35006  -39.87366 1.000 84.94510  ? 716 DA  T "C5'" 1 
ATOM   8179 C  "C4'" . DA  D 4 16  ? 18.45825 24.09655  -38.56151 1.000 85.62507  ? 716 DA  T "C4'" 1 
ATOM   8180 O  "O4'" . DA  D 4 16  ? 19.56515 25.01700  -38.40697 1.000 84.09425  ? 716 DA  T "O4'" 1 
ATOM   8181 C  "C3'" . DA  D 4 16  ? 17.18627 24.94588  -38.41557 1.000 86.22784  ? 716 DA  T "C3'" 1 
ATOM   8182 O  "O3'" . DA  D 4 16  ? 16.38013 24.44950  -37.34367 1.000 90.42169  ? 716 DA  T "O3'" 1 
ATOM   8183 C  "C2'" . DA  D 4 16  ? 17.71636 26.35861  -38.11373 1.000 83.89717  ? 716 DA  T "C2'" 1 
ATOM   8184 C  "C1'" . DA  D 4 16  ? 19.12048 26.08307  -37.61572 1.000 75.20107  ? 716 DA  T "C1'" 1 
ATOM   8185 N  N9    . DA  D 4 16  ? 20.02917 27.21078  -37.78490 1.000 70.17638  ? 716 DA  T N9    1 
ATOM   8186 C  C8    . DA  D 4 16  ? 20.32376 27.85980  -38.95071 1.000 69.75094  ? 716 DA  T C8    1 
ATOM   8187 N  N7    . DA  D 4 16  ? 21.18225 28.84189  -38.80775 1.000 65.82863  ? 716 DA  T N7    1 
ATOM   8188 C  C5    . DA  D 4 16  ? 21.47064 28.83933  -37.45459 1.000 65.42703  ? 716 DA  T C5    1 
ATOM   8189 C  C6    . DA  D 4 16  ? 22.31642 29.64494  -36.66474 1.000 65.29234  ? 716 DA  T C6    1 
ATOM   8190 N  N6    . DA  D 4 16  ? 23.04626 30.64424  -37.16264 1.000 57.82070  ? 716 DA  T N6    1 
ATOM   8191 N  N1    . DA  D 4 16  ? 22.37781 29.38068  -35.33636 1.000 66.13688  ? 716 DA  T N1    1 
ATOM   8192 C  C2    . DA  D 4 16  ? 21.63825 28.37298  -34.84264 1.000 64.51001  ? 716 DA  T C2    1 
ATOM   8193 N  N3    . DA  D 4 16  ? 20.80718 27.55026  -35.48849 1.000 66.63600  ? 716 DA  T N3    1 
ATOM   8194 C  C4    . DA  D 4 16  ? 20.76762 27.84144  -36.80431 1.000 67.11217  ? 716 DA  T C4    1 
ATOM   8195 P  P     . DC  D 4 17  ? 14.85169 24.93341  -37.16713 1.000 107.59864 ? 717 DC  T P     1 
ATOM   8196 O  OP1   . DC  D 4 17  ? 14.32739 24.31540  -35.92335 1.000 100.63174 ? 717 DC  T OP1   1 
ATOM   8197 O  OP2   . DC  D 4 17  ? 14.16409 24.68084  -38.45456 1.000 103.67148 ? 717 DC  T OP2   1 
ATOM   8198 O  "O5'" . DC  D 4 17  ? 14.95460 26.52990  -36.96343 1.000 98.57585  ? 717 DC  T "O5'" 1 
ATOM   8199 C  "C5'" . DC  D 4 17  ? 14.35531 27.16946  -35.81621 1.000 94.15040  ? 717 DC  T "C5'" 1 
ATOM   8200 C  "C4'" . DC  D 4 17  ? 15.35381 27.31423  -34.67060 1.000 85.57845  ? 717 DC  T "C4'" 1 
ATOM   8201 O  "O4'" . DC  D 4 17  ? 16.67780 27.46767  -35.20846 1.000 81.25047  ? 717 DC  T "O4'" 1 
ATOM   8202 C  "C3'" . DC  D 4 17  ? 15.12025 28.51869  -33.76582 1.000 77.37260  ? 717 DC  T "C3'" 1 
ATOM   8203 O  "O3'" . DC  D 4 17  ? 14.41345 28.11875  -32.62668 1.000 80.51084  ? 717 DC  T "O3'" 1 
ATOM   8204 C  "C2'" . DC  D 4 17  ? 16.51461 28.97086  -33.36962 1.000 75.46146  ? 717 DC  T "C2'" 1 
ATOM   8205 C  "C1'" . DC  D 4 17  ? 17.41096 28.41162  -34.46075 1.000 77.94641  ? 717 DC  T "C1'" 1 
ATOM   8206 N  N1    . DC  D 4 17  ? 17.95538 29.44588  -35.39445 1.000 76.65958  ? 717 DC  T N1    1 
ATOM   8207 C  C2    . DC  D 4 17  ? 18.85652 30.40095  -34.91705 1.000 69.02423  ? 717 DC  T C2    1 
ATOM   8208 O  O2    . DC  D 4 17  ? 19.16934 30.39312  -33.71632 1.000 70.88553  ? 717 DC  T O2    1 
ATOM   8209 N  N3    . DC  D 4 17  ? 19.35999 31.31082  -35.78397 1.000 65.30308  ? 717 DC  T N3    1 
ATOM   8210 C  C4    . DC  D 4 17  ? 19.00016 31.28655  -37.06795 1.000 64.78020  ? 717 DC  T C4    1 
ATOM   8211 N  N4    . DC  D 4 17  ? 19.52766 32.20809  -37.87885 1.000 62.83377  ? 717 DC  T N4    1 
ATOM   8212 C  C5    . DC  D 4 17  ? 18.08911 30.31865  -37.57443 1.000 65.43151  ? 717 DC  T C5    1 
ATOM   8213 C  C6    . DC  D 4 17  ? 17.59706 29.42650  -36.71307 1.000 74.05433  ? 717 DC  T C6    1 
ATOM   8214 P  P     . DA  D 4 18  ? 13.37456 29.12413  -31.93666 1.000 92.56701  ? 718 DA  T P     1 
ATOM   8215 O  OP1   . DA  D 4 18  ? 12.74703 28.39514  -30.80876 1.000 81.09689  ? 718 DA  T OP1   1 
ATOM   8216 O  OP2   . DA  D 4 18  ? 12.55081 29.68910  -33.03497 1.000 86.49527  ? 718 DA  T OP2   1 
ATOM   8217 O  "O5'" . DA  D 4 18  ? 14.28976 30.31086  -31.35980 1.000 81.58316  ? 718 DA  T "O5'" 1 
ATOM   8218 C  "C5'" . DA  D 4 18  ? 15.24167 30.05434  -30.32341 1.000 79.55324  ? 718 DA  T "C5'" 1 
ATOM   8219 C  "C4'" . DA  D 4 18  ? 15.83709 31.35147  -29.79027 1.000 80.03810  ? 718 DA  T "C4'" 1 
ATOM   8220 O  "O4'" . DA  D 4 18  ? 16.73235 31.94025  -30.77309 1.000 80.08160  ? 718 DA  T "O4'" 1 
ATOM   8221 C  "C3'" . DA  D 4 18  ? 14.82703 32.43213  -29.46064 1.000 79.09299  ? 718 DA  T "C3'" 1 
ATOM   8222 O  "O3'" . DA  D 4 18  ? 15.29503 33.19734  -28.35909 1.000 81.10059  ? 718 DA  T "O3'" 1 
ATOM   8223 C  "C2'" . DA  D 4 18  ? 14.77745 33.25244  -30.75116 1.000 75.10354  ? 718 DA  T "C2'" 1 
ATOM   8224 C  "C1'" . DA  D 4 18  ? 16.22694 33.19411  -31.20731 1.000 73.67876  ? 718 DA  T "C1'" 1 
ATOM   8225 N  N9    . DA  D 4 18  ? 16.41057 33.28053  -32.66242 1.000 71.91946  ? 718 DA  T N9    1 
ATOM   8226 C  C8    . DA  D 4 18  ? 15.83087 32.49034  -33.61959 1.000 73.71085  ? 718 DA  T C8    1 
ATOM   8227 N  N7    . DA  D 4 18  ? 16.19867 32.78414  -34.84957 1.000 69.36853  ? 718 DA  T N7    1 
ATOM   8228 C  C5    . DA  D 4 18  ? 17.08623 33.83946  -34.68919 1.000 65.72841  ? 718 DA  T C5    1 
ATOM   8229 C  C6    . DA  D 4 18  ? 17.84037 34.60397  -35.61129 1.000 61.46210  ? 718 DA  T C6    1 
ATOM   8230 N  N6    . DA  D 4 18  ? 17.81260 34.41700  -36.94359 1.000 55.23113  ? 718 DA  T N6    1 
ATOM   8231 N  N1    . DA  D 4 18  ? 18.62987 35.56849  -35.11129 1.000 60.55131  ? 718 DA  T N1    1 
ATOM   8232 C  C2    . DA  D 4 18  ? 18.66823 35.75842  -33.78745 1.000 63.14651  ? 718 DA  T C2    1 
ATOM   8233 N  N3    . DA  D 4 18  ? 18.01711 35.11252  -32.82606 1.000 65.01515  ? 718 DA  T N3    1 
ATOM   8234 C  C4    . DA  D 4 18  ? 17.23508 34.15264  -33.34688 1.000 68.07178  ? 718 DA  T C4    1 
ATOM   8235 P  P     . DG  D 4 19  ? 14.24775 34.01975  -27.45469 1.000 93.66721  ? 719 DG  T P     1 
ATOM   8236 O  OP1   . DG  D 4 19  ? 14.98475 34.87978  -26.49340 1.000 80.52578  ? 719 DG  T OP1   1 
ATOM   8237 O  OP2   . DG  D 4 19  ? 13.24963 33.05737  -26.94457 1.000 95.75336  ? 719 DG  T OP2   1 
ATOM   8238 O  "O5'" . DG  D 4 19  ? 13.48670 34.92826  -28.51858 1.000 80.79972  ? 719 DG  T "O5'" 1 
ATOM   8239 C  "C5'" . DG  D 4 19  ? 13.27289 36.29343  -28.24878 1.000 84.76504  ? 719 DG  T "C5'" 1 
ATOM   8240 C  "C4'" . DG  D 4 19  ? 14.50984 37.12838  -28.54222 1.000 77.84184  ? 719 DG  T "C4'" 1 
ATOM   8241 O  "O4'" . DG  D 4 19  ? 15.16077 36.63935  -29.73262 1.000 74.34142  ? 719 DG  T "O4'" 1 
ATOM   8242 C  "C3'" . DG  D 4 19  ? 14.19408 38.59023  -28.77871 1.000 74.56449  ? 719 DG  T "C3'" 1 
ATOM   8243 O  "O3'" . DG  D 4 19  ? 14.81012 39.38603  -27.81000 1.000 73.83174  ? 719 DG  T "O3'" 1 
ATOM   8244 C  "C2'" . DG  D 4 19  ? 14.68587 38.90592  -30.19316 1.000 73.90235  ? 719 DG  T "C2'" 1 
ATOM   8245 C  "C1'" . DG  D 4 19  ? 15.52247 37.70596  -30.57908 1.000 72.57840  ? 719 DG  T "C1'" 1 
ATOM   8246 N  N9    . DG  D 4 19  ? 15.35365 37.26998  -31.97241 1.000 67.33162  ? 719 DG  T N9    1 
ATOM   8247 C  C8    . DG  D 4 19  ? 14.60359 36.20909  -32.42154 1.000 72.99834  ? 719 DG  T C8    1 
ATOM   8248 N  N7    . DG  D 4 19  ? 14.67532 36.02093  -33.71258 1.000 69.70075  ? 719 DG  T N7    1 
ATOM   8249 C  C5    . DG  D 4 19  ? 15.53100 37.01802  -34.14771 1.000 65.18663  ? 719 DG  T C5    1 
ATOM   8250 C  C6    . DG  D 4 19  ? 15.97980 37.31074  -35.44558 1.000 60.97560  ? 719 DG  T C6    1 
ATOM   8251 O  O6    . DG  D 4 19  ? 15.69411 36.73167  -36.50044 1.000 61.80965  ? 719 DG  T O6    1 
ATOM   8252 N  N1    . DG  D 4 19  ? 16.84463 38.39272  -35.45555 1.000 60.61643  ? 719 DG  T N1    1 
ATOM   8253 C  C2    . DG  D 4 19  ? 17.22473 39.11137  -34.34393 1.000 63.31323  ? 719 DG  T C2    1 
ATOM   8254 N  N2    . DG  D 4 19  ? 18.06422 40.13575  -34.54959 1.000 62.18325  ? 719 DG  T N2    1 
ATOM   8255 N  N3    . DG  D 4 19  ? 16.80842 38.84794  -33.11569 1.000 65.66626  ? 719 DG  T N3    1 
ATOM   8256 C  C4    . DG  D 4 19  ? 15.96389 37.79300  -33.09175 1.000 65.61364  ? 719 DG  T C4    1 
ATOM   8257 P  P     . DG  D 4 20  ? 13.98622 40.62810  -27.22325 1.000 90.18936  ? 720 DG  T P     1 
ATOM   8258 O  OP1   . DG  D 4 20  ? 14.58849 41.03150  -25.92637 1.000 77.70297  ? 720 DG  T OP1   1 
ATOM   8259 O  OP2   . DG  D 4 20  ? 12.55440 40.25735  -27.38253 1.000 71.50272  ? 720 DG  T OP2   1 
ATOM   8260 O  "O5'" . DG  D 4 20  ? 14.25692 41.80406  -28.27004 1.000 76.02552  ? 720 DG  T "O5'" 1 
ATOM   8261 C  "C5'" . DG  D 4 20  ? 15.55563 42.31413  -28.42349 1.000 70.17989  ? 720 DG  T "C5'" 1 
ATOM   8262 C  "C4'" . DG  D 4 20  ? 15.62368 43.22436  -29.62738 1.000 70.90986  ? 720 DG  T "C4'" 1 
ATOM   8263 O  "O4'" . DG  D 4 20  ? 15.62303 42.43993  -30.84481 1.000 69.14083  ? 720 DG  T "O4'" 1 
ATOM   8264 C  "C3'" . DG  D 4 20  ? 14.47100 44.21301  -29.76126 1.000 71.52328  ? 720 DG  T "C3'" 1 
ATOM   8265 O  "O3'" . DG  D 4 20  ? 15.00898 45.46730  -30.11303 1.000 73.37228  ? 720 DG  T "O3'" 1 
ATOM   8266 C  "C2'" . DG  D 4 20  ? 13.62955 43.61756  -30.89802 1.000 69.09400  ? 720 DG  T "C2'" 1 
ATOM   8267 C  "C1'" . DG  D 4 20  ? 14.70948 42.99425  -31.75976 1.000 65.23387  ? 720 DG  T "C1'" 1 
ATOM   8268 N  N9    . DG  D 4 20  ? 14.24267 41.91506  -32.62065 1.000 65.53866  ? 720 DG  T N9    1 
ATOM   8269 C  C8    . DG  D 4 20  ? 13.45899 40.85587  -32.25244 1.000 66.87810  ? 720 DG  T C8    1 
ATOM   8270 N  N7    . DG  D 4 20  ? 13.22897 40.01015  -33.21928 1.000 69.22079  ? 720 DG  T N7    1 
ATOM   8271 C  C5    . DG  D 4 20  ? 13.89590 40.55082  -34.30877 1.000 65.29577  ? 720 DG  T C5    1 
ATOM   8272 C  C6    . DG  D 4 20  ? 13.99598 40.08133  -35.63999 1.000 61.09401  ? 720 DG  T C6    1 
ATOM   8273 O  O6    . DG  D 4 20  ? 13.49683 39.06400  -36.13579 1.000 61.00817  ? 720 DG  T O6    1 
ATOM   8274 N  N1    . DG  D 4 20  ? 14.76600 40.93362  -36.43029 1.000 62.30167  ? 720 DG  T N1    1 
ATOM   8275 C  C2    . DG  D 4 20  ? 15.37174 42.08205  -35.98541 1.000 57.70822  ? 720 DG  T C2    1 
ATOM   8276 N  N2    . DG  D 4 20  ? 16.07727 42.76574  -36.88865 1.000 57.63858  ? 720 DG  T N2    1 
ATOM   8277 N  N3    . DG  D 4 20  ? 15.29216 42.53193  -34.73714 1.000 57.62892  ? 720 DG  T N3    1 
ATOM   8278 C  C4    . DG  D 4 20  ? 14.53609 41.72178  -33.95745 1.000 63.89619  ? 720 DG  T C4    1 
ATOM   8279 P  P     . DG  D 4 21  ? 14.14967 46.80866  -29.96541 1.000 74.62785  ? 721 DG  T P     1 
ATOM   8280 O  OP1   . DG  D 4 21  ? 14.95881 47.73596  -29.14154 1.000 74.18945  ? 721 DG  T OP1   1 
ATOM   8281 O  OP2   . DG  D 4 21  ? 12.75256 46.46806  -29.60891 1.000 69.66400  ? 721 DG  T OP2   1 
ATOM   8282 O  "O5'" . DG  D 4 21  ? 14.14130 47.38503  -31.44439 1.000 71.97327  ? 721 DG  T "O5'" 1 
ATOM   8283 C  "C5'" . DG  D 4 21  ? 15.35473 47.71522  -32.06026 1.000 66.26722  ? 721 DG  T "C5'" 1 
ATOM   8284 C  "C4'" . DG  D 4 21  ? 15.11344 48.00485  -33.51345 1.000 71.40921  ? 721 DG  T "C4'" 1 
ATOM   8285 O  "O4'" . DG  D 4 21  ? 14.89169 46.75243  -34.21292 1.000 68.57129  ? 721 DG  T "O4'" 1 
ATOM   8286 C  "C3'" . DG  D 4 21  ? 13.88180 48.87443  -33.78041 1.000 72.08411  ? 721 DG  T "C3'" 1 
ATOM   8287 O  "O3'" . DG  D 4 21  ? 14.20624 49.88608  -34.71069 1.000 74.92655  ? 721 DG  T "O3'" 1 
ATOM   8288 C  "C2'" . DG  D 4 21  ? 12.86279 47.88657  -34.35485 1.000 72.06375  ? 721 DG  T "C2'" 1 
ATOM   8289 C  "C1'" . DG  D 4 21  ? 13.76237 46.87016  -35.04032 1.000 68.65652  ? 721 DG  T "C1'" 1 
ATOM   8290 N  N9    . DG  D 4 21  ? 13.15125 45.55264  -35.16465 1.000 62.76612  ? 721 DG  T N9    1 
ATOM   8291 C  C8    . DG  D 4 21  ? 12.61489 44.80715  -34.15067 1.000 61.02372  ? 721 DG  T C8    1 
ATOM   8292 N  N7    . DG  D 4 21  ? 12.14018 43.65865  -34.54476 1.000 62.77792  ? 721 DG  T N7    1 
ATOM   8293 C  C5    . DG  D 4 21  ? 12.37478 43.63984  -35.91495 1.000 61.26416  ? 721 DG  T C5    1 
ATOM   8294 C  C6    . DG  D 4 21  ? 12.06855 42.64854  -36.87027 1.000 60.86810  ? 721 DG  T C6    1 
ATOM   8295 O  O6    . DG  D 4 21  ? 11.51042 41.55887  -36.67956 1.000 61.37024  ? 721 DG  T O6    1 
ATOM   8296 N  N1    . DG  D 4 21  ? 12.47595 43.01733  -38.15732 1.000 59.85637  ? 721 DG  T N1    1 
ATOM   8297 C  C2    . DG  D 4 21  ? 13.09859 44.20283  -38.47908 1.000 58.45072  ? 721 DG  T C2    1 
ATOM   8298 N  N2    . DG  D 4 21  ? 13.41502 44.38420  -39.78134 1.000 57.97398  ? 721 DG  T N2    1 
ATOM   8299 N  N3    . DG  D 4 21  ? 13.39170 45.14642  -37.58565 1.000 59.92778  ? 721 DG  T N3    1 
ATOM   8300 C  C4    . DG  D 4 21  ? 12.99918 44.79512  -36.32187 1.000 62.69249  ? 721 DG  T C4    1 
ATOM   8301 P  P     . DA  D 4 22  ? 13.20456 51.11685  -34.96873 1.000 81.69466  ? 722 DA  T P     1 
ATOM   8302 O  OP1   . DA  D 4 22  ? 13.96870 52.36537  -34.70853 1.000 71.56944  ? 722 DA  T OP1   1 
ATOM   8303 O  OP2   . DA  D 4 22  ? 11.92117 50.86203  -34.26894 1.000 74.72468  ? 722 DA  T OP2   1 
ATOM   8304 O  "O5'" . DA  D 4 22  ? 12.91015 51.02340  -36.52556 1.000 67.42282  ? 722 DA  T "O5'" 1 
ATOM   8305 C  "C5'" . DA  D 4 22  ? 13.93501 50.63935  -37.40804 1.000 63.36580  ? 722 DA  T "C5'" 1 
ATOM   8306 C  "C4'" . DA  D 4 22  ? 13.32774 50.21248  -38.71712 1.000 69.93584  ? 722 DA  T "C4'" 1 
ATOM   8307 O  "O4'" . DA  D 4 22  ? 12.93293 48.81713  -38.63093 1.000 74.01434  ? 722 DA  T "O4'" 1 
ATOM   8308 C  "C3'" . DA  D 4 22  ? 12.07657 51.00278  -39.09983 1.000 72.04175  ? 722 DA  T "C3'" 1 
ATOM   8309 O  "O3'" . DA  D 4 22  ? 12.17261 51.43242  -40.43679 1.000 77.01442  ? 722 DA  T "O3'" 1 
ATOM   8310 C  "C2'" . DA  D 4 22  ? 10.92294 50.01847  -38.89192 1.000 70.65844  ? 722 DA  T "C2'" 1 
ATOM   8311 C  "C1'" . DA  D 4 22  ? 11.59741 48.66034  -39.05741 1.000 72.11638  ? 722 DA  T "C1'" 1 
ATOM   8312 N  N9    . DA  D 4 22  ? 10.97153 47.61553  -38.24597 1.000 64.55426  ? 722 DA  T N9    1 
ATOM   8313 C  C8    . DA  D 4 22  ? 10.77055 47.63571  -36.89621 1.000 65.76412  ? 722 DA  T C8    1 
ATOM   8314 N  N7    . DA  D 4 22  ? 10.16715 46.56449  -36.43086 1.000 63.72388  ? 722 DA  T N7    1 
ATOM   8315 C  C5    . DA  D 4 22  ? 9.95294  45.79185  -37.55720 1.000 59.96178  ? 722 DA  T C5    1 
ATOM   8316 C  C6    . DA  D 4 22  ? 9.35830  44.53178  -37.73924 1.000 58.22078  ? 722 DA  T C6    1 
ATOM   8317 N  N6    . DA  D 4 22  ? 8.84657  43.81319  -36.74014 1.000 53.12906  ? 722 DA  T N6    1 
ATOM   8318 N  N1    . DA  D 4 22  ? 9.30780  44.03913  -38.99845 1.000 61.92540  ? 722 DA  T N1    1 
ATOM   8319 C  C2    . DA  D 4 22  ? 9.82213  44.77100  -40.00043 1.000 63.27988  ? 722 DA  T C2    1 
ATOM   8320 N  N3    . DA  D 4 22  ? 10.40750 45.96607  -39.94970 1.000 62.88319  ? 722 DA  T N3    1 
ATOM   8321 C  C4    . DA  D 4 22  ? 10.44141 46.42528  -38.68686 1.000 61.66863  ? 722 DA  T C4    1 
ATOM   8322 P  P     . DC  D 4 23  ? 10.92981 52.15172  -41.15262 1.000 85.03792  ? 723 DC  T P     1 
ATOM   8323 O  OP1   . DC  D 4 23  ? 11.48709 52.98254  -42.24358 1.000 77.39065  ? 723 DC  T OP1   1 
ATOM   8324 O  OP2   . DC  D 4 23  ? 10.03676 52.75483  -40.13448 1.000 79.26178  ? 723 DC  T OP2   1 
ATOM   8325 O  "O5'" . DC  D 4 23  ? 10.15068 50.94786  -41.83699 1.000 75.92643  ? 723 DC  T "O5'" 1 
ATOM   8326 C  "C5'" . DC  D 4 23  ? 9.42836  51.18290  -43.00394 1.000 74.84755  ? 723 DC  T "C5'" 1 
ATOM   8327 C  "C4'" . DC  D 4 23  ? 9.02470  49.88218  -43.63476 1.000 78.31331  ? 723 DC  T "C4'" 1 
ATOM   8328 O  "O4'" . DC  D 4 23  ? 9.10401  48.83476  -42.64859 1.000 81.25920  ? 723 DC  T "O4'" 1 
ATOM   8329 C  "C3'" . DC  D 4 23  ? 7.61267  49.87396  -44.18111 1.000 82.57243  ? 723 DC  T "C3'" 1 
ATOM   8330 O  "O3'" . DC  D 4 23  ? 7.62929  49.42483  -45.50638 1.000 92.22039  ? 723 DC  T "O3'" 1 
ATOM   8331 C  "C2'" . DC  D 4 23  ? 6.83881  48.92716  -43.26539 1.000 83.36699  ? 723 DC  T "C2'" 1 
ATOM   8332 C  "C1'" . DC  D 4 23  ? 7.92757  48.06476  -42.64470 1.000 79.53091  ? 723 DC  T "C1'" 1 
ATOM   8333 N  N1    . DC  D 4 23  ? 7.63257  47.70704  -41.23107 1.000 72.39168  ? 723 DC  T N1    1 
ATOM   8334 C  C2    . DC  D 4 23  ? 7.00777  46.48536  -40.92719 1.000 66.14332  ? 723 DC  T C2    1 
ATOM   8335 O  O2    . DC  D 4 23  ? 6.71713  45.70235  -41.84773 1.000 60.95080  ? 723 DC  T O2    1 
ATOM   8336 N  N3    . DC  D 4 23  ? 6.74541  46.20058  -39.62556 1.000 65.43842  ? 723 DC  T N3    1 
ATOM   8337 C  C4    . DC  D 4 23  ? 7.08141  47.08334  -38.66522 1.000 65.07916  ? 723 DC  T C4    1 
ATOM   8338 N  N4    . DC  D 4 23  ? 6.80816  46.77134  -37.39779 1.000 64.84575  ? 723 DC  T N4    1 
ATOM   8339 C  C5    . DC  D 4 23  ? 7.71195  48.31932  -38.96463 1.000 62.46346  ? 723 DC  T C5    1 
ATOM   8340 C  C6    . DC  D 4 23  ? 7.96069  48.59014  -40.24372 1.000 66.95849  ? 723 DC  T C6    1 
ATOM   8341 P  P     . DT  D 4 24  ? 6.87456  50.29076  -46.62395 1.000 107.28594 ? 724 DT  T P     1 
ATOM   8342 O  OP1   . DT  D 4 24  ? 7.63293  50.16876  -47.89768 1.000 90.39812  ? 724 DT  T OP1   1 
ATOM   8343 O  OP2   . DT  D 4 24  ? 6.59380  51.61352  -45.99589 1.000 89.63416  ? 724 DT  T OP2   1 
ATOM   8344 O  "O5'" . DT  D 4 24  ? 5.47712  49.53858  -46.77218 1.000 103.29178 ? 724 DT  T "O5'" 1 
ATOM   8345 C  "C5'" . DT  D 4 24  ? 5.39387  48.14064  -46.48083 1.000 100.40276 ? 724 DT  T "C5'" 1 
ATOM   8346 C  "C4'" . DT  D 4 24  ? 3.95345  47.68965  -46.51086 1.000 100.70426 ? 724 DT  T "C4'" 1 
ATOM   8347 O  "O4'" . DT  D 4 24  ? 3.40536  47.70970  -45.16726 1.000 97.73934  ? 724 DT  T "O4'" 1 
ATOM   8348 C  "C3'" . DT  D 4 24  ? 3.04751  48.57565  -47.35728 1.000 103.52151 ? 724 DT  T "C3'" 1 
ATOM   8349 O  "O3'" . DT  D 4 24  ? 2.19577  47.77018  -48.14637 1.000 108.34928 ? 724 DT  T "O3'" 1 
ATOM   8350 C  "C2'" . DT  D 4 24  ? 2.27597  49.40256  -46.32084 1.000 101.59256 ? 724 DT  T "C2'" 1 
ATOM   8351 C  "C1'" . DT  D 4 24  ? 2.19552  48.43676  -45.15264 1.000 96.00684  ? 724 DT  T "C1'" 1 
ATOM   8352 N  N1    . DT  D 4 24  ? 2.07477  49.09666  -43.82574 1.000 88.01930  ? 724 DT  T N1    1 
ATOM   8353 C  C2    . DT  D 4 24  ? 1.15193  48.62177  -42.93058 1.000 86.11024  ? 724 DT  T C2    1 
ATOM   8354 O  O2    . DT  D 4 24  ? 0.40979  47.68765  -43.17303 1.000 83.13285  ? 724 DT  T O2    1 
ATOM   8355 N  N3    . DT  D 4 24  ? 1.12294  49.28437  -41.73093 1.000 83.32365  ? 724 DT  T N3    1 
ATOM   8356 C  C4    . DT  D 4 24  ? 1.91415  50.35194  -41.34435 1.000 81.95858  ? 724 DT  T C4    1 
ATOM   8357 O  O4    . DT  D 4 24  ? 1.81371  50.87858  -40.24030 1.000 77.51507  ? 724 DT  T O4    1 
ATOM   8358 C  C5    . DT  D 4 24  ? 2.86983  50.79649  -42.32782 1.000 83.90839  ? 724 DT  T C5    1 
ATOM   8359 C  C7    . DT  D 4 24  ? 3.78339  51.94494  -42.01913 1.000 80.98923  ? 724 DT  T C7    1 
ATOM   8360 C  C6    . DT  D 4 24  ? 2.90506  50.15395  -43.50963 1.000 87.03764  ? 724 DT  T C6    1 
ATOM   8361 P  P     . DG  D 4 25  ? 1.37117  48.42729  -49.35479 1.000 119.62171 ? 725 DG  T P     1 
ATOM   8362 O  OP1   . DG  D 4 25  ? 1.60340  47.58612  -50.55500 1.000 115.85252 ? 725 DG  T OP1   1 
ATOM   8363 O  OP2   . DG  D 4 25  ? 1.70446  49.87670  -49.39274 1.000 106.59334 ? 725 DG  T OP2   1 
ATOM   8364 O  "O5'" . DG  D 4 25  ? -0.15078 48.26360  -48.88098 1.000 115.76966 ? 725 DG  T "O5'" 1 
ATOM   8365 C  "C5'" . DG  D 4 25  ? -1.06534 49.35300  -48.99867 1.000 115.83363 ? 725 DG  T "C5'" 1 
ATOM   8366 C  "C4'" . DG  D 4 25  ? -2.05158 49.34833  -47.84217 1.000 112.71397 ? 725 DG  T "C4'" 1 
ATOM   8367 O  "O4'" . DG  D 4 25  ? -1.31883 49.46443  -46.59703 1.000 106.46889 ? 725 DG  T "O4'" 1 
ATOM   8368 C  "C3'" . DG  D 4 25  ? -3.05812 50.48919  -47.85732 1.000 110.50558 ? 725 DG  T "C3'" 1 
ATOM   8369 O  "O3'" . DG  D 4 25  ? -4.26612 50.06852  -48.53161 1.000 89.77706  ? 725 DG  T "O3'" 1 
ATOM   8370 C  "C2'" . DG  D 4 25  ? -3.30542 50.77439  -46.36778 1.000 113.34674 ? 725 DG  T "C2'" 1 
ATOM   8371 C  "C1'" . DG  D 4 25  ? -2.02545 50.26883  -45.67207 1.000 109.27501 ? 725 DG  T "C1'" 1 
ATOM   8372 N  N9    . DG  D 4 25  ? -1.12601 51.33817  -45.19773 1.000 107.00617 ? 725 DG  T N9    1 
ATOM   8373 C  C8    . DG  D 4 25  ? -0.22865 52.05845  -45.95466 1.000 104.89413 ? 725 DG  T C8    1 
ATOM   8374 N  N7    . DG  D 4 25  ? 0.44413  52.94454  -45.26800 1.000 97.79471  ? 725 DG  T N7    1 
ATOM   8375 C  C5    . DG  D 4 25  ? -0.03574 52.81061  -43.96914 1.000 96.34502  ? 725 DG  T C5    1 
ATOM   8376 C  C6    . DG  D 4 25  ? 0.32186  53.51196  -42.78470 1.000 96.17055  ? 725 DG  T C6    1 
ATOM   8377 O  O6    . DG  D 4 25  ? 1.15949  54.41902  -42.64645 1.000 98.62110  ? 725 DG  T O6    1 
ATOM   8378 N  N1    . DG  D 4 25  ? -0.40233 53.06843  -41.68375 1.000 92.34015  ? 725 DG  T N1    1 
ATOM   8379 C  C2    . DG  D 4 25  ? -1.35255 52.07575  -41.71548 1.000 93.94880  ? 725 DG  T C2    1 
ATOM   8380 N  N2    . DG  D 4 25  ? -1.94431 51.78805  -40.54424 1.000 86.20387  ? 725 DG  T N2    1 
ATOM   8381 N  N3    . DG  D 4 25  ? -1.69851 51.40715  -42.81621 1.000 95.77807  ? 725 DG  T N3    1 
ATOM   8382 C  C4    . DG  D 4 25  ? -1.00198 51.82644  -43.90348 1.000 97.29557  ? 725 DG  T C4    1 
HETATM 8383 P  PC    . D4T E 5 .   ? 48.05135 -2.58378  -24.39628 1.000 38.65404  ? 601 D4T A PC    1 
HETATM 8384 O  O1C   . D4T E 5 .   ? 48.40094 -3.77845  -23.50053 1.000 38.02068  ? 601 D4T A O1C   1 
HETATM 8385 O  O2C   . D4T E 5 .   ? 48.31651 -1.32257  -23.57647 1.000 40.68122  ? 601 D4T A O2C   1 
HETATM 8386 O  O3C   . D4T E 5 .   ? 48.89045 -2.63915  -25.64387 1.000 42.33716  ? 601 D4T A O3C   1 
HETATM 8387 O  "O7'" . D4T E 5 .   ? 46.51995 -2.63059  -24.82084 1.000 42.84606  ? 601 D4T A "O7'" 1 
HETATM 8388 P  PB    . D4T E 5 .   ? 45.38403 -1.66531  -24.33672 1.000 39.43919  ? 601 D4T A PB    1 
HETATM 8389 O  O1B   . D4T E 5 .   ? 43.97575 -2.27044  -24.46908 1.000 42.81983  ? 601 D4T A O1B   1 
HETATM 8390 O  O2B   . D4T E 5 .   ? 45.59358 -1.28623  -22.89542 1.000 37.43627  ? 601 D4T A O2B   1 
HETATM 8391 O  "O6'" . D4T E 5 .   ? 45.47601 -0.41311  -25.32738 1.000 44.87436  ? 601 D4T A "O6'" 1 
HETATM 8392 P  PA    . D4T E 5 .   ? 46.00028 1.03445   -24.97890 1.000 38.59993  ? 601 D4T A PA    1 
HETATM 8393 O  O1A   . D4T E 5 .   ? 46.81606 1.54673   -26.17291 1.000 37.73164  ? 601 D4T A O1A   1 
HETATM 8394 O  O2A   . D4T E 5 .   ? 46.86514 1.01548   -23.72772 1.000 32.81248  ? 601 D4T A O2A   1 
HETATM 8395 O  "O5'" . D4T E 5 .   ? 44.64849 1.90156   -24.79980 1.000 35.34739  ? 601 D4T A "O5'" 1 
HETATM 8396 C  "C5'" . D4T E 5 .   ? 44.06118 1.95824   -23.52854 1.000 37.17662  ? 601 D4T A "C5'" 1 
HETATM 8397 C  "C4'" . D4T E 5 .   ? 42.58291 1.72656   -23.64009 1.000 45.79868  ? 601 D4T A "C4'" 1 
HETATM 8398 O  "O4'" . D4T E 5 .   ? 41.91006 2.88401   -24.48362 1.000 42.10192  ? 601 D4T A "O4'" 1 
HETATM 8399 C  "C1'" . D4T E 5 .   ? 40.96165 2.12870   -25.41178 1.000 43.96788  ? 601 D4T A "C1'" 1 
HETATM 8400 N  N1    . D4T E 5 .   ? 41.30015 2.54239   -26.77641 1.000 43.52674  ? 601 D4T A N1    1 
HETATM 8401 C  C6    . D4T E 5 .   ? 42.56127 2.95443   -27.04852 1.000 44.57479  ? 601 D4T A C6    1 
HETATM 8402 C  C2    . D4T E 5 .   ? 40.35605 2.52500   -27.77328 1.000 43.57130  ? 601 D4T A C2    1 
HETATM 8403 O  O2    . D4T E 5 .   ? 39.24298 2.16823   -27.54584 1.000 45.32438  ? 601 D4T A O2    1 
HETATM 8404 N  N3    . D4T E 5 .   ? 40.70191 2.93650   -29.03747 1.000 42.82337  ? 601 D4T A N3    1 
HETATM 8405 C  C4    . D4T E 5 .   ? 41.97096 3.35292   -29.31879 1.000 46.23722  ? 601 D4T A C4    1 
HETATM 8406 O  O4    . D4T E 5 .   ? 42.26371 3.70332   -30.44253 1.000 45.77230  ? 601 D4T A O4    1 
HETATM 8407 C  C5    . D4T E 5 .   ? 42.91757 3.36510   -28.32342 1.000 43.29648  ? 601 D4T A C5    1 
HETATM 8408 C  C5A   . D4T E 5 .   ? 44.35573 3.83009   -28.62064 1.000 30.55305  ? 601 D4T A C5A   1 
HETATM 8409 C  "C2'" . D4T E 5 .   ? 41.17058 0.85798   -25.16533 1.000 43.11276  ? 601 D4T A "C2'" 1 
HETATM 8410 C  "C3'" . D4T E 5 .   ? 42.33268 0.66360   -24.29736 1.000 43.55951  ? 601 D4T A "C3'" 1 
HETATM 8411 MG MG    . MG  F 6 .   ? 47.51971 -0.08874  -22.01291 1.000 35.49631  ? 602 MG  A MG    1 
HETATM 8412 MG MG    . MG  G 6 .   ? 15.48869 56.44555  -41.95610 1.000 17.87282  ? 603 MG  A MG    1 
HETATM 8413 S  S     . SO4 H 7 .   ? 27.60607 76.29203  -40.00920 1.000 59.13098  ? 604 SO4 A S     1 
HETATM 8414 O  O1    . SO4 H 7 .   ? 27.24371 77.71195  -39.99704 1.000 43.26239  ? 604 SO4 A O1    1 
HETATM 8415 O  O2    . SO4 H 7 .   ? 27.97473 75.79534  -41.34342 1.000 46.38655  ? 604 SO4 A O2    1 
HETATM 8416 O  O3    . SO4 H 7 .   ? 26.43091 75.50973  -39.62807 1.000 54.28278  ? 604 SO4 A O3    1 
HETATM 8417 O  O4    . SO4 H 7 .   ? 28.70996 76.09054  -39.05484 1.000 50.01799  ? 604 SO4 A O4    1 
HETATM 8418 O  O     . HOH I 8 .   ? 57.82837 23.06135  -9.86780  1.000 40.43982  ? 701 HOH A O     1 
HETATM 8419 O  O     . HOH I 8 .   ? 26.59085 72.95709  -38.56071 1.000 39.12488  ? 702 HOH A O     1 
HETATM 8420 O  O     . HOH I 8 .   ? 33.01074 72.92362  -31.63449 1.000 42.18096  ? 703 HOH A O     1 
HETATM 8421 O  O     . HOH I 8 .   ? 51.62435 30.26925  -31.76105 1.000 39.17886  ? 704 HOH A O     1 
HETATM 8422 O  O     . HOH I 8 .   ? 41.75585 -3.85103  -23.38087 1.000 36.03387  ? 705 HOH A O     1 
HETATM 8423 O  O     . HOH J 8 .   ? 33.94356 29.60714  -10.88601 1.000 38.47267  ? 501 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   PRO 2   1   1   PRO PRO A . n 
A 1 3   ILE 3   2   2   ILE ILE A . n 
A 1 4   SER 4   3   3   SER SER A . n 
A 1 5   PRO 5   4   4   PRO PRO A . n 
A 1 6   ILE 6   5   5   ILE ILE A . n 
A 1 7   GLU 7   6   6   GLU GLU A . n 
A 1 8   THR 8   7   7   THR THR A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  PRO 10  9   9   PRO PRO A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  LYS 12  11  11  LYS LYS A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  LYS 14  13  13  LYS LYS A . n 
A 1 15  PRO 15  14  14  PRO PRO A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  MET 17  16  16  MET MET A . n 
A 1 18  ASP 18  17  17  ASP ASP A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  PRO 20  19  19  PRO PRO A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  VAL 22  21  21  VAL VAL A . n 
A 1 23  LYS 23  22  22  LYS LYS A . n 
A 1 24  GLN 24  23  23  GLN GLN A . n 
A 1 25  TRP 25  24  24  TRP TRP A . n 
A 1 26  PRO 26  25  25  PRO PRO A . n 
A 1 27  LEU 27  26  26  LEU LEU A . n 
A 1 28  THR 28  27  27  THR THR A . n 
A 1 29  GLU 29  28  28  GLU GLU A . n 
A 1 30  GLU 30  29  29  GLU GLU A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  ILE 32  31  31  ILE ILE A . n 
A 1 33  LYS 33  32  32  LYS LYS A . n 
A 1 34  ALA 34  33  33  ALA ALA A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  GLU 37  36  36  GLU GLU A . n 
A 1 38  ILE 38  37  37  ILE ILE A . n 
A 1 39  CYS 39  38  38  CYS CYS A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  MET 42  41  41  MET MET A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  LYS 44  43  43  LYS LYS A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  ILE 48  47  47  ILE ILE A . n 
A 1 49  SER 49  48  48  SER SER A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  ILE 51  50  50  ILE ILE A . n 
A 1 52  GLY 52  51  51  GLY GLY A . n 
A 1 53  PRO 53  52  52  PRO PRO A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  ASN 55  54  54  ASN ASN A . n 
A 1 56  PRO 56  55  55  PRO PRO A . n 
A 1 57  TYR 57  56  56  TYR TYR A . n 
A 1 58  ASN 58  57  57  ASN ASN A . n 
A 1 59  THR 59  58  58  THR THR A . n 
A 1 60  PRO 60  59  59  PRO PRO A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  PHE 62  61  61  PHE PHE A . n 
A 1 63  ALA 63  62  62  ALA ALA A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  LYS 65  64  64  LYS LYS A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  LYS 67  66  66  LYS LYS A . n 
A 1 68  ASP 68  67  67  ASP ASP A . n 
A 1 69  SER 69  68  68  SER SER A . n 
A 1 70  THR 70  69  69  THR THR A . n 
A 1 71  LYS 71  70  70  LYS LYS A . n 
A 1 72  TRP 72  71  71  TRP TRP A . n 
A 1 73  ARG 73  72  72  ARG ARG A . n 
A 1 74  LYS 74  73  73  LYS LYS A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  VAL 76  75  75  VAL VAL A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  PHE 78  77  77  PHE PHE A . n 
A 1 79  ARG 79  78  78  ARG ARG A . n 
A 1 80  GLU 80  79  79  GLU GLU A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  ASN 82  81  81  ASN ASN A . n 
A 1 83  LYS 83  82  82  LYS LYS A . n 
A 1 84  ARG 84  83  83  ARG ARG A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  ASP 87  86  86  ASP ASP A . n 
A 1 88  PHE 88  87  87  PHE PHE A . n 
A 1 89  TRP 89  88  88  TRP TRP A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  GLN 92  91  91  GLN GLN A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  GLY 94  93  93  GLY GLY A . n 
A 1 95  ILE 95  94  94  ILE ILE A . n 
A 1 96  PRO 96  95  95  PRO PRO A . n 
A 1 97  HIS 97  96  96  HIS HIS A . n 
A 1 98  PRO 98  97  97  PRO PRO A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 LYS 102 101 101 LYS LYS A . n 
A 1 103 LYS 103 102 102 LYS LYS A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 LYS 105 104 104 LYS LYS A . n 
A 1 106 SER 106 105 105 SER SER A . n 
A 1 107 VAL 107 106 106 VAL VAL A . n 
A 1 108 THR 108 107 107 THR THR A . n 
A 1 109 VAL 109 108 108 VAL VAL A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 ASP 111 110 110 ASP ASP A . n 
A 1 112 VAL 112 111 111 VAL VAL A . n 
A 1 113 GLY 113 112 112 GLY GLY A . n 
A 1 114 ASP 114 113 113 ASP ASP A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 TYR 116 115 115 TYR TYR A . n 
A 1 117 PHE 117 116 116 PHE PHE A . n 
A 1 118 SER 118 117 117 SER SER A . n 
A 1 119 VAL 119 118 118 VAL VAL A . n 
A 1 120 PRO 120 119 119 PRO PRO A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 ASP 122 121 121 ASP ASP A . n 
A 1 123 GLU 123 122 122 GLU GLU A . n 
A 1 124 ASP 124 123 123 ASP ASP A . n 
A 1 125 PHE 125 124 124 PHE PHE A . n 
A 1 126 ARG 126 125 125 ARG ARG A . n 
A 1 127 LYS 127 126 126 LYS LYS A . n 
A 1 128 TYR 128 127 127 TYR TYR A . n 
A 1 129 THR 129 128 128 THR THR A . n 
A 1 130 ALA 130 129 129 ALA ALA A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 THR 132 131 131 THR THR A . n 
A 1 133 ILE 133 132 132 ILE ILE A . n 
A 1 134 PRO 134 133 133 PRO PRO A . n 
A 1 135 SER 135 134 134 SER SER A . n 
A 1 136 ILE 136 135 135 ILE ILE A . n 
A 1 137 ASN 137 136 136 ASN ASN A . n 
A 1 138 ASN 138 137 137 ASN ASN A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 THR 140 139 139 THR THR A . n 
A 1 141 PRO 141 140 140 PRO PRO A . n 
A 1 142 GLY 142 141 141 GLY GLY A . n 
A 1 143 ILE 143 142 142 ILE ILE A . n 
A 1 144 ARG 144 143 143 ARG ARG A . n 
A 1 145 TYR 145 144 144 TYR TYR A . n 
A 1 146 GLN 146 145 145 GLN GLN A . n 
A 1 147 TYR 147 146 146 TYR TYR A . n 
A 1 148 ASN 148 147 147 ASN ASN A . n 
A 1 149 VAL 149 148 148 VAL VAL A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 PRO 151 150 150 PRO PRO A . n 
A 1 152 GLN 152 151 151 GLN GLN A . n 
A 1 153 GLY 153 152 152 GLY GLY A . n 
A 1 154 TRP 154 153 153 TRP TRP A . n 
A 1 155 LYS 155 154 154 LYS LYS A . n 
A 1 156 GLY 156 155 155 GLY GLY A . n 
A 1 157 SER 157 156 156 SER SER A . n 
A 1 158 PRO 158 157 157 PRO PRO A . n 
A 1 159 ALA 159 158 158 ALA ALA A . n 
A 1 160 ILE 160 159 159 ILE ILE A . n 
A 1 161 PHE 161 160 160 PHE PHE A . n 
A 1 162 GLN 162 161 161 GLN GLN A . n 
A 1 163 SER 163 162 162 SER SER A . n 
A 1 164 SER 164 163 163 SER SER A . n 
A 1 165 MET 165 164 164 MET MET A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 ILE 168 167 167 ILE ILE A . n 
A 1 169 LEU 169 168 168 LEU LEU A . n 
A 1 170 GLU 170 169 169 GLU GLU A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 PHE 172 171 171 PHE PHE A . n 
A 1 173 ARG 173 172 172 ARG ARG A . n 
A 1 174 LYS 174 173 173 LYS LYS A . n 
A 1 175 GLN 175 174 174 GLN GLN A . n 
A 1 176 ASN 176 175 175 ASN ASN A . n 
A 1 177 PRO 177 176 176 PRO PRO A . n 
A 1 178 ASP 178 177 177 ASP ASP A . n 
A 1 179 ILE 179 178 178 ILE ILE A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 ILE 181 180 180 ILE ILE A . n 
A 1 182 TYR 182 181 181 TYR TYR A . n 
A 1 183 GLN 183 182 182 GLN GLN A . n 
A 1 184 TYR 184 183 183 TYR TYR A . n 
A 1 185 MET 185 184 184 MET MET A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 ASP 187 186 186 ASP ASP A . n 
A 1 188 LEU 188 187 187 LEU LEU A . n 
A 1 189 TYR 189 188 188 TYR TYR A . n 
A 1 190 VAL 190 189 189 VAL VAL A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 SER 192 191 191 SER SER A . n 
A 1 193 ASP 193 192 192 ASP ASP A . n 
A 1 194 LEU 194 193 193 LEU LEU A . n 
A 1 195 GLU 195 194 194 GLU GLU A . n 
A 1 196 ILE 196 195 195 ILE ILE A . n 
A 1 197 GLY 197 196 196 GLY GLY A . n 
A 1 198 GLN 198 197 197 GLN GLN A . n 
A 1 199 HIS 199 198 198 HIS HIS A . n 
A 1 200 ARG 200 199 199 ARG ARG A . n 
A 1 201 THR 201 200 200 THR THR A . n 
A 1 202 LYS 202 201 201 LYS LYS A . n 
A 1 203 ILE 203 202 202 ILE ILE A . n 
A 1 204 GLU 204 203 203 GLU GLU A . n 
A 1 205 GLU 205 204 204 GLU GLU A . n 
A 1 206 LEU 206 205 205 LEU LEU A . n 
A 1 207 ARG 207 206 206 ARG ARG A . n 
A 1 208 GLN 208 207 207 GLN GLN A . n 
A 1 209 HIS 209 208 208 HIS HIS A . n 
A 1 210 LEU 210 209 209 LEU LEU A . n 
A 1 211 LEU 211 210 210 LEU LEU A . n 
A 1 212 ARG 212 211 211 ARG ARG A . n 
A 1 213 TRP 213 212 212 TRP TRP A . n 
A 1 214 GLY 214 213 213 GLY GLY A . n 
A 1 215 LEU 215 214 214 LEU LEU A . n 
A 1 216 THR 216 215 215 THR THR A . n 
A 1 217 THR 217 216 216 THR THR A . n 
A 1 218 PRO 218 217 217 PRO PRO A . n 
A 1 219 ASP 219 218 218 ASP ASP A . n 
A 1 220 LYS 220 219 219 LYS LYS A . n 
A 1 221 LYS 221 220 220 LYS LYS A . n 
A 1 222 HIS 222 221 221 HIS HIS A . n 
A 1 223 GLN 223 222 222 GLN GLN A . n 
A 1 224 LYS 224 223 223 LYS LYS A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 PRO 226 225 225 PRO PRO A . n 
A 1 227 PRO 227 226 226 PRO PRO A . n 
A 1 228 PHE 228 227 227 PHE PHE A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 TRP 230 229 229 TRP TRP A . n 
A 1 231 MET 231 230 230 MET MET A . n 
A 1 232 GLY 232 231 231 GLY GLY A . n 
A 1 233 TYR 233 232 232 TYR TYR A . n 
A 1 234 GLU 234 233 233 GLU GLU A . n 
A 1 235 LEU 235 234 234 LEU LEU A . n 
A 1 236 HIS 236 235 235 HIS HIS A . n 
A 1 237 PRO 237 236 236 PRO PRO A . n 
A 1 238 ASP 238 237 237 ASP ASP A . n 
A 1 239 LYS 239 238 238 LYS LYS A . n 
A 1 240 TRP 240 239 239 TRP TRP A . n 
A 1 241 THR 241 240 240 THR THR A . n 
A 1 242 VAL 242 241 241 VAL VAL A . n 
A 1 243 GLN 243 242 242 GLN GLN A . n 
A 1 244 PRO 244 243 243 PRO PRO A . n 
A 1 245 ILE 245 244 244 ILE ILE A . n 
A 1 246 VAL 246 245 245 VAL VAL A . n 
A 1 247 LEU 247 246 246 LEU LEU A . n 
A 1 248 PRO 248 247 247 PRO PRO A . n 
A 1 249 GLU 249 248 248 GLU GLU A . n 
A 1 250 LYS 250 249 249 LYS LYS A . n 
A 1 251 ASP 251 250 250 ASP ASP A . n 
A 1 252 SER 252 251 251 SER SER A . n 
A 1 253 TRP 253 252 252 TRP TRP A . n 
A 1 254 THR 254 253 253 THR THR A . n 
A 1 255 VAL 255 254 254 VAL VAL A . n 
A 1 256 ASN 256 255 255 ASN ASN A . n 
A 1 257 ASP 257 256 256 ASP ASP A . n 
A 1 258 ILE 258 257 257 ILE ILE A . n 
A 1 259 CYS 259 258 258 CYS CYS A . n 
A 1 260 LYS 260 259 259 LYS LYS A . n 
A 1 261 LEU 261 260 260 LEU LEU A . n 
A 1 262 VAL 262 261 261 VAL VAL A . n 
A 1 263 GLY 263 262 262 GLY GLY A . n 
A 1 264 LYS 264 263 263 LYS LYS A . n 
A 1 265 LEU 265 264 264 LEU LEU A . n 
A 1 266 ASN 266 265 265 ASN ASN A . n 
A 1 267 TRP 267 266 266 TRP TRP A . n 
A 1 268 ALA 268 267 267 ALA ALA A . n 
A 1 269 SER 269 268 268 SER SER A . n 
A 1 270 GLN 270 269 269 GLN GLN A . n 
A 1 271 ILE 271 270 270 ILE ILE A . n 
A 1 272 TYR 272 271 271 TYR TYR A . n 
A 1 273 PRO 273 272 272 PRO PRO A . n 
A 1 274 GLY 274 273 273 GLY GLY A . n 
A 1 275 ILE 275 274 274 ILE ILE A . n 
A 1 276 LYS 276 275 275 LYS LYS A . n 
A 1 277 VAL 277 276 276 VAL VAL A . n 
A 1 278 ARG 278 277 277 ARG ARG A . n 
A 1 279 GLN 279 278 278 GLN GLN A . n 
A 1 280 LEU 280 279 279 LEU LEU A . n 
A 1 281 SER 281 280 280 SER SER A . n 
A 1 282 LYS 282 281 281 LYS LYS A . n 
A 1 283 LEU 283 282 282 LEU LEU A . n 
A 1 284 LEU 284 283 283 LEU LEU A . n 
A 1 285 ARG 285 284 284 ARG ARG A . n 
A 1 286 GLY 286 285 285 GLY GLY A . n 
A 1 287 THR 287 286 286 THR THR A . n 
A 1 288 LYS 288 287 287 LYS LYS A . n 
A 1 289 ALA 289 288 288 ALA ALA A . n 
A 1 290 LEU 290 289 289 LEU LEU A . n 
A 1 291 THR 291 290 290 THR THR A . n 
A 1 292 GLU 292 291 291 GLU GLU A . n 
A 1 293 VAL 293 292 292 VAL VAL A . n 
A 1 294 ILE 294 293 293 ILE ILE A . n 
A 1 295 PRO 295 294 294 PRO PRO A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 THR 297 296 296 THR THR A . n 
A 1 298 GLU 298 297 297 GLU GLU A . n 
A 1 299 GLU 299 298 298 GLU GLU A . n 
A 1 300 ALA 300 299 299 ALA ALA A . n 
A 1 301 GLU 301 300 300 GLU GLU A . n 
A 1 302 LEU 302 301 301 LEU LEU A . n 
A 1 303 GLU 303 302 302 GLU GLU A . n 
A 1 304 LEU 304 303 303 LEU LEU A . n 
A 1 305 ALA 305 304 304 ALA ALA A . n 
A 1 306 GLU 306 305 305 GLU GLU A . n 
A 1 307 ASN 307 306 306 ASN ASN A . n 
A 1 308 ARG 308 307 307 ARG ARG A . n 
A 1 309 GLU 309 308 308 GLU GLU A . n 
A 1 310 ILE 310 309 309 ILE ILE A . n 
A 1 311 LEU 311 310 310 LEU LEU A . n 
A 1 312 LYS 312 311 311 LYS LYS A . n 
A 1 313 GLU 313 312 312 GLU GLU A . n 
A 1 314 PRO 314 313 313 PRO PRO A . n 
A 1 315 VAL 315 314 314 VAL VAL A . n 
A 1 316 HIS 316 315 315 HIS HIS A . n 
A 1 317 GLY 317 316 316 GLY GLY A . n 
A 1 318 VAL 318 317 317 VAL VAL A . n 
A 1 319 TYR 319 318 318 TYR TYR A . n 
A 1 320 TYR 320 319 319 TYR TYR A . n 
A 1 321 ASP 321 320 320 ASP ASP A . n 
A 1 322 PRO 322 321 321 PRO PRO A . n 
A 1 323 SER 323 322 322 SER SER A . n 
A 1 324 LYS 324 323 323 LYS LYS A . n 
A 1 325 ASP 325 324 324 ASP ASP A . n 
A 1 326 LEU 326 325 325 LEU LEU A . n 
A 1 327 ILE 327 326 326 ILE ILE A . n 
A 1 328 ALA 328 327 327 ALA ALA A . n 
A 1 329 GLU 329 328 328 GLU GLU A . n 
A 1 330 ILE 330 329 329 ILE ILE A . n 
A 1 331 GLN 331 330 330 GLN GLN A . n 
A 1 332 LYS 332 331 331 LYS LYS A . n 
A 1 333 GLN 333 332 332 GLN GLN A . n 
A 1 334 GLY 334 333 333 GLY GLY A . n 
A 1 335 GLN 335 334 334 GLN GLN A . n 
A 1 336 GLY 336 335 335 GLY GLY A . n 
A 1 337 GLN 337 336 336 GLN GLN A . n 
A 1 338 TRP 338 337 337 TRP TRP A . n 
A 1 339 THR 339 338 338 THR THR A . n 
A 1 340 TYR 340 339 339 TYR TYR A . n 
A 1 341 GLN 341 340 340 GLN GLN A . n 
A 1 342 ILE 342 341 341 ILE ILE A . n 
A 1 343 TYR 343 342 342 TYR TYR A . n 
A 1 344 GLN 344 343 343 GLN GLN A . n 
A 1 345 GLU 345 344 344 GLU GLU A . n 
A 1 346 PRO 346 345 345 PRO PRO A . n 
A 1 347 PHE 347 346 346 PHE PHE A . n 
A 1 348 LYS 348 347 347 LYS LYS A . n 
A 1 349 ASN 349 348 348 ASN ASN A . n 
A 1 350 LEU 350 349 349 LEU LEU A . n 
A 1 351 LYS 351 350 350 LYS LYS A . n 
A 1 352 THR 352 351 351 THR THR A . n 
A 1 353 GLY 353 352 352 GLY GLY A . n 
A 1 354 LYS 354 353 353 LYS LYS A . n 
A 1 355 TYR 355 354 354 TYR TYR A . n 
A 1 356 ALA 356 355 355 ALA ALA A . n 
A 1 357 ARG 357 356 356 ARG ARG A . n 
A 1 358 MET 358 357 357 MET MET A . n 
A 1 359 ARG 359 358 358 ARG ARG A . n 
A 1 360 GLY 360 359 359 GLY GLY A . n 
A 1 361 ALA 361 360 360 ALA ALA A . n 
A 1 362 HIS 362 361 361 HIS HIS A . n 
A 1 363 THR 363 362 362 THR THR A . n 
A 1 364 ASN 364 363 363 ASN ASN A . n 
A 1 365 ASP 365 364 364 ASP ASP A . n 
A 1 366 VAL 366 365 365 VAL VAL A . n 
A 1 367 LYS 367 366 366 LYS LYS A . n 
A 1 368 GLN 368 367 367 GLN GLN A . n 
A 1 369 LEU 369 368 368 LEU LEU A . n 
A 1 370 THR 370 369 369 THR THR A . n 
A 1 371 GLU 371 370 370 GLU GLU A . n 
A 1 372 ALA 372 371 371 ALA ALA A . n 
A 1 373 VAL 373 372 372 VAL VAL A . n 
A 1 374 GLN 374 373 373 GLN GLN A . n 
A 1 375 LYS 375 374 374 LYS LYS A . n 
A 1 376 ILE 376 375 375 ILE ILE A . n 
A 1 377 THR 377 376 376 THR THR A . n 
A 1 378 THR 378 377 377 THR THR A . n 
A 1 379 GLU 379 378 378 GLU GLU A . n 
A 1 380 SER 380 379 379 SER SER A . n 
A 1 381 ILE 381 380 380 ILE ILE A . n 
A 1 382 VAL 382 381 381 VAL VAL A . n 
A 1 383 ILE 383 382 382 ILE ILE A . n 
A 1 384 TRP 384 383 383 TRP TRP A . n 
A 1 385 GLY 385 384 384 GLY GLY A . n 
A 1 386 LYS 386 385 385 LYS LYS A . n 
A 1 387 THR 387 386 386 THR THR A . n 
A 1 388 PRO 388 387 387 PRO PRO A . n 
A 1 389 LYS 389 388 388 LYS LYS A . n 
A 1 390 PHE 390 389 389 PHE PHE A . n 
A 1 391 LYS 391 390 390 LYS LYS A . n 
A 1 392 LEU 392 391 391 LEU LEU A . n 
A 1 393 PRO 393 392 392 PRO PRO A . n 
A 1 394 ILE 394 393 393 ILE ILE A . n 
A 1 395 GLN 395 394 394 GLN GLN A . n 
A 1 396 LYS 396 395 395 LYS LYS A . n 
A 1 397 GLU 397 396 396 GLU GLU A . n 
A 1 398 THR 398 397 397 THR THR A . n 
A 1 399 TRP 399 398 398 TRP TRP A . n 
A 1 400 GLU 400 399 399 GLU GLU A . n 
A 1 401 THR 401 400 400 THR THR A . n 
A 1 402 TRP 402 401 401 TRP TRP A . n 
A 1 403 TRP 403 402 402 TRP TRP A . n 
A 1 404 THR 404 403 403 THR THR A . n 
A 1 405 GLU 405 404 404 GLU GLU A . n 
A 1 406 TYR 406 405 405 TYR TYR A . n 
A 1 407 TRP 407 406 406 TRP TRP A . n 
A 1 408 GLN 408 407 407 GLN GLN A . n 
A 1 409 ALA 409 408 408 ALA ALA A . n 
A 1 410 THR 410 409 409 THR THR A . n 
A 1 411 TRP 411 410 410 TRP TRP A . n 
A 1 412 ILE 412 411 411 ILE ILE A . n 
A 1 413 PRO 413 412 412 PRO PRO A . n 
A 1 414 GLU 414 413 413 GLU GLU A . n 
A 1 415 TRP 415 414 414 TRP TRP A . n 
A 1 416 GLU 416 415 415 GLU GLU A . n 
A 1 417 PHE 417 416 416 PHE PHE A . n 
A 1 418 VAL 418 417 417 VAL VAL A . n 
A 1 419 ASN 419 418 418 ASN ASN A . n 
A 1 420 THR 420 419 419 THR THR A . n 
A 1 421 PRO 421 420 420 PRO PRO A . n 
A 1 422 PRO 422 421 421 PRO PRO A . n 
A 1 423 LEU 423 422 422 LEU LEU A . n 
A 1 424 VAL 424 423 423 VAL VAL A . n 
A 1 425 LYS 425 424 424 LYS LYS A . n 
A 1 426 LEU 426 425 425 LEU LEU A . n 
A 1 427 TRP 427 426 426 TRP TRP A . n 
A 1 428 TYR 428 427 427 TYR TYR A . n 
A 1 429 GLN 429 428 428 GLN GLN A . n 
A 1 430 LEU 430 429 429 LEU LEU A . n 
A 1 431 GLU 431 430 430 GLU GLU A . n 
A 1 432 LYS 432 431 431 LYS LYS A . n 
A 1 433 GLU 433 432 432 GLU GLU A . n 
A 1 434 PRO 434 433 433 PRO PRO A . n 
A 1 435 ILE 435 434 434 ILE ILE A . n 
A 1 436 VAL 436 435 435 VAL VAL A . n 
A 1 437 GLY 437 436 436 GLY GLY A . n 
A 1 438 ALA 438 437 437 ALA ALA A . n 
A 1 439 GLU 439 438 438 GLU GLU A . n 
A 1 440 THR 440 439 439 THR THR A . n 
A 1 441 PHE 441 440 440 PHE PHE A . n 
A 1 442 TYR 442 441 441 TYR TYR A . n 
A 1 443 VAL 443 442 442 VAL VAL A . n 
A 1 444 ASP 444 443 443 ASP ASP A . n 
A 1 445 GLY 445 444 444 GLY GLY A . n 
A 1 446 ALA 446 445 445 ALA ALA A . n 
A 1 447 ALA 447 446 446 ALA ALA A . n 
A 1 448 ASN 448 447 447 ASN ASN A . n 
A 1 449 ARG 449 448 448 ARG ARG A . n 
A 1 450 GLU 450 449 449 GLU GLU A . n 
A 1 451 THR 451 450 450 THR THR A . n 
A 1 452 LYS 452 451 451 LYS LYS A . n 
A 1 453 LEU 453 452 452 LEU LEU A . n 
A 1 454 GLY 454 453 453 GLY GLY A . n 
A 1 455 LYS 455 454 454 LYS LYS A . n 
A 1 456 ALA 456 455 455 ALA ALA A . n 
A 1 457 GLY 457 456 456 GLY GLY A . n 
A 1 458 TYR 458 457 457 TYR TYR A . n 
A 1 459 VAL 459 458 458 VAL VAL A . n 
A 1 460 THR 460 459 459 THR THR A . n 
A 1 461 ASN 461 460 460 ASN ASN A . n 
A 1 462 ARG 462 461 461 ARG ARG A . n 
A 1 463 GLY 463 462 462 GLY GLY A . n 
A 1 464 ARG 464 463 463 ARG ARG A . n 
A 1 465 GLN 465 464 464 GLN GLN A . n 
A 1 466 LYS 466 465 465 LYS LYS A . n 
A 1 467 VAL 467 466 466 VAL VAL A . n 
A 1 468 VAL 468 467 467 VAL VAL A . n 
A 1 469 THR 469 468 468 THR THR A . n 
A 1 470 LEU 470 469 469 LEU LEU A . n 
A 1 471 THR 471 470 470 THR THR A . n 
A 1 472 ASP 472 471 471 ASP ASP A . n 
A 1 473 THR 473 472 472 THR THR A . n 
A 1 474 THR 474 473 473 THR THR A . n 
A 1 475 ASN 475 474 474 ASN ASN A . n 
A 1 476 GLN 476 475 475 GLN GLN A . n 
A 1 477 LYS 477 476 476 LYS LYS A . n 
A 1 478 THR 478 477 477 THR THR A . n 
A 1 479 GLU 479 478 478 GLU GLU A . n 
A 1 480 LEU 480 479 479 LEU LEU A . n 
A 1 481 GLN 481 480 480 GLN GLN A . n 
A 1 482 ALA 482 481 481 ALA ALA A . n 
A 1 483 ILE 483 482 482 ILE ILE A . n 
A 1 484 TYR 484 483 483 TYR TYR A . n 
A 1 485 LEU 485 484 484 LEU LEU A . n 
A 1 486 ALA 486 485 485 ALA ALA A . n 
A 1 487 LEU 487 486 486 LEU LEU A . n 
A 1 488 GLN 488 487 487 GLN GLN A . n 
A 1 489 ASP 489 488 488 ASP ASP A . n 
A 1 490 SER 490 489 489 SER SER A . n 
A 1 491 GLY 491 490 490 GLY GLY A . n 
A 1 492 LEU 492 491 491 LEU LEU A . n 
A 1 493 GLU 493 492 492 GLU GLU A . n 
A 1 494 VAL 494 493 493 VAL VAL A . n 
A 1 495 ASN 495 494 494 ASN ASN A . n 
A 1 496 ILE 496 495 495 ILE ILE A . n 
A 1 497 VAL 497 496 496 VAL VAL A . n 
A 1 498 THR 498 497 497 THR THR A . n 
A 1 499 ASP 499 498 498 ASP ASP A . n 
A 1 500 SER 500 499 499 SER SER A . n 
A 1 501 GLN 501 500 500 GLN GLN A . n 
A 1 502 TYR 502 501 501 TYR TYR A . n 
A 1 503 ALA 503 502 502 ALA ALA A . n 
A 1 504 LEU 504 503 503 LEU LEU A . n 
A 1 505 GLY 505 504 504 GLY GLY A . n 
A 1 506 ILE 506 505 505 ILE ILE A . n 
A 1 507 ILE 507 506 506 ILE ILE A . n 
A 1 508 GLN 508 507 507 GLN GLN A . n 
A 1 509 ALA 509 508 508 ALA ALA A . n 
A 1 510 GLN 510 509 509 GLN GLN A . n 
A 1 511 PRO 511 510 510 PRO PRO A . n 
A 1 512 ASP 512 511 511 ASP ASP A . n 
A 1 513 GLN 513 512 512 GLN GLN A . n 
A 1 514 SER 514 513 513 SER SER A . n 
A 1 515 GLU 515 514 514 GLU GLU A . n 
A 1 516 SER 516 515 515 SER SER A . n 
A 1 517 GLU 517 516 516 GLU GLU A . n 
A 1 518 LEU 518 517 517 LEU LEU A . n 
A 1 519 VAL 519 518 518 VAL VAL A . n 
A 1 520 ASN 520 519 519 ASN ASN A . n 
A 1 521 GLN 521 520 520 GLN GLN A . n 
A 1 522 ILE 522 521 521 ILE ILE A . n 
A 1 523 ILE 523 522 522 ILE ILE A . n 
A 1 524 GLU 524 523 523 GLU GLU A . n 
A 1 525 GLN 525 524 524 GLN GLN A . n 
A 1 526 LEU 526 525 525 LEU LEU A . n 
A 1 527 ILE 527 526 526 ILE ILE A . n 
A 1 528 LYS 528 527 527 LYS LYS A . n 
A 1 529 LYS 529 528 528 LYS LYS A . n 
A 1 530 GLU 530 529 529 GLU GLU A . n 
A 1 531 LYS 531 530 530 LYS LYS A . n 
A 1 532 VAL 532 531 531 VAL VAL A . n 
A 1 533 TYR 533 532 532 TYR TYR A . n 
A 1 534 LEU 534 533 533 LEU LEU A . n 
A 1 535 ALA 535 534 534 ALA ALA A . n 
A 1 536 TRP 536 535 535 TRP TRP A . n 
A 1 537 VAL 537 536 536 VAL VAL A . n 
A 1 538 PRO 538 537 537 PRO PRO A . n 
A 1 539 ALA 539 538 538 ALA ALA A . n 
A 1 540 HIS 540 539 539 HIS HIS A . n 
A 1 541 LYS 541 540 540 LYS LYS A . n 
A 1 542 GLY 542 541 541 GLY GLY A . n 
A 1 543 ILE 543 542 542 ILE ILE A . n 
A 1 544 GLY 544 543 543 GLY GLY A . n 
A 1 545 GLY 545 544 544 GLY GLY A . n 
A 1 546 ASN 546 545 545 ASN ASN A . n 
A 1 547 GLU 547 546 546 GLU GLU A . n 
A 1 548 GLN 548 547 547 GLN GLN A . n 
A 1 549 VAL 549 548 548 VAL VAL A . n 
A 1 550 ASP 550 549 549 ASP ASP A . n 
A 1 551 LYS 551 550 550 LYS LYS A . n 
A 1 552 LEU 552 551 551 LEU LEU A . n 
A 1 553 VAL 553 552 552 VAL VAL A . n 
A 1 554 SER 554 553 553 SER SER A . n 
A 1 555 ALA 555 554 554 ALA ALA A . n 
A 1 556 GLY 556 555 555 GLY GLY A . n 
A 1 557 ILE 557 556 556 ILE ILE A . n 
A 1 558 ARG 558 557 557 ARG ARG A . n 
A 1 559 LYS 559 558 ?   ?   ?   A . n 
A 1 560 VAL 560 559 ?   ?   ?   A . n 
A 1 561 LEU 561 560 ?   ?   ?   A . n 
B 2 1   MET 1   -11 ?   ?   ?   B . n 
B 2 2   GLY 2   -10 ?   ?   ?   B . n 
B 2 3   SER 3   -9  ?   ?   ?   B . n 
B 2 4   SER 4   -8  ?   ?   ?   B . n 
B 2 5   HIS 5   -7  ?   ?   ?   B . n 
B 2 6   HIS 6   -6  ?   ?   ?   B . n 
B 2 7   HIS 7   -5  ?   ?   ?   B . n 
B 2 8   HIS 8   -4  ?   ?   ?   B . n 
B 2 9   HIS 9   -3  ?   ?   ?   B . n 
B 2 10  HIS 10  -2  ?   ?   ?   B . n 
B 2 11  SER 11  -1  ?   ?   ?   B . n 
B 2 12  SER 12  0   ?   ?   ?   B . n 
B 2 13  PRO 13  1   ?   ?   ?   B . n 
B 2 14  ILE 14  2   ?   ?   ?   B . n 
B 2 15  SER 15  3   ?   ?   ?   B . n 
B 2 16  PRO 16  4   ?   ?   ?   B . n 
B 2 17  ILE 17  5   ?   ?   ?   B . n 
B 2 18  GLU 18  6   6   GLU GLU B . n 
B 2 19  THR 19  7   7   THR THR B . n 
B 2 20  VAL 20  8   8   VAL VAL B . n 
B 2 21  PRO 21  9   9   PRO PRO B . n 
B 2 22  VAL 22  10  10  VAL VAL B . n 
B 2 23  LYS 23  11  11  LYS LYS B . n 
B 2 24  LEU 24  12  12  LEU LEU B . n 
B 2 25  LYS 25  13  13  LYS LYS B . n 
B 2 26  PRO 26  14  14  PRO PRO B . n 
B 2 27  GLY 27  15  15  GLY GLY B . n 
B 2 28  MET 28  16  16  MET MET B . n 
B 2 29  ASP 29  17  17  ASP ASP B . n 
B 2 30  GLY 30  18  18  GLY GLY B . n 
B 2 31  PRO 31  19  19  PRO PRO B . n 
B 2 32  LYS 32  20  20  LYS LYS B . n 
B 2 33  VAL 33  21  21  VAL VAL B . n 
B 2 34  LYS 34  22  22  LYS LYS B . n 
B 2 35  GLN 35  23  23  GLN GLN B . n 
B 2 36  TRP 36  24  24  TRP TRP B . n 
B 2 37  PRO 37  25  25  PRO PRO B . n 
B 2 38  LEU 38  26  26  LEU LEU B . n 
B 2 39  THR 39  27  27  THR THR B . n 
B 2 40  GLU 40  28  28  GLU GLU B . n 
B 2 41  GLU 41  29  29  GLU GLU B . n 
B 2 42  LYS 42  30  30  LYS LYS B . n 
B 2 43  ILE 43  31  31  ILE ILE B . n 
B 2 44  LYS 44  32  32  LYS LYS B . n 
B 2 45  ALA 45  33  33  ALA ALA B . n 
B 2 46  LEU 46  34  34  LEU LEU B . n 
B 2 47  VAL 47  35  35  VAL VAL B . n 
B 2 48  GLU 48  36  36  GLU GLU B . n 
B 2 49  ILE 49  37  37  ILE ILE B . n 
B 2 50  CYS 50  38  38  CYS CYS B . n 
B 2 51  THR 51  39  39  THR THR B . n 
B 2 52  GLU 52  40  40  GLU GLU B . n 
B 2 53  MET 53  41  41  MET MET B . n 
B 2 54  GLU 54  42  42  GLU GLU B . n 
B 2 55  LYS 55  43  43  LYS LYS B . n 
B 2 56  GLU 56  44  44  GLU GLU B . n 
B 2 57  GLY 57  45  45  GLY GLY B . n 
B 2 58  LYS 58  46  46  LYS LYS B . n 
B 2 59  ILE 59  47  47  ILE ILE B . n 
B 2 60  SER 60  48  48  SER SER B . n 
B 2 61  LYS 61  49  49  LYS LYS B . n 
B 2 62  ILE 62  50  50  ILE ILE B . n 
B 2 63  GLY 63  51  51  GLY GLY B . n 
B 2 64  PRO 64  52  52  PRO PRO B . n 
B 2 65  GLU 65  53  53  GLU GLU B . n 
B 2 66  ASN 66  54  54  ASN ASN B . n 
B 2 67  PRO 67  55  55  PRO PRO B . n 
B 2 68  TYR 68  56  56  TYR TYR B . n 
B 2 69  ASN 69  57  57  ASN ASN B . n 
B 2 70  THR 70  58  58  THR THR B . n 
B 2 71  PRO 71  59  59  PRO PRO B . n 
B 2 72  VAL 72  60  60  VAL VAL B . n 
B 2 73  PHE 73  61  61  PHE PHE B . n 
B 2 74  ALA 74  62  62  ALA ALA B . n 
B 2 75  ILE 75  63  63  ILE ILE B . n 
B 2 76  LYS 76  64  64  LYS LYS B . n 
B 2 77  LYS 77  65  65  LYS LYS B . n 
B 2 78  LYS 78  66  66  LYS LYS B . n 
B 2 79  ASP 79  67  67  ASP ASP B . n 
B 2 80  SER 80  68  68  SER SER B . n 
B 2 81  THR 81  69  69  THR THR B . n 
B 2 82  LYS 82  70  70  LYS LYS B . n 
B 2 83  TRP 83  71  71  TRP TRP B . n 
B 2 84  ARG 84  72  72  ARG ARG B . n 
B 2 85  LYS 85  73  73  LYS LYS B . n 
B 2 86  LEU 86  74  74  LEU LEU B . n 
B 2 87  VAL 87  75  75  VAL VAL B . n 
B 2 88  ASP 88  76  76  ASP ASP B . n 
B 2 89  PHE 89  77  77  PHE PHE B . n 
B 2 90  ARG 90  78  78  ARG ARG B . n 
B 2 91  GLU 91  79  79  GLU GLU B . n 
B 2 92  LEU 92  80  80  LEU LEU B . n 
B 2 93  ASN 93  81  81  ASN ASN B . n 
B 2 94  LYS 94  82  82  LYS LYS B . n 
B 2 95  ARG 95  83  83  ARG ARG B . n 
B 2 96  THR 96  84  84  THR THR B . n 
B 2 97  GLN 97  85  85  GLN GLN B . n 
B 2 98  ASP 98  86  86  ASP ASP B . n 
B 2 99  PHE 99  87  ?   ?   ?   B . n 
B 2 100 TRP 100 88  ?   ?   ?   B . n 
B 2 101 GLU 101 89  ?   ?   ?   B . n 
B 2 102 VAL 102 90  ?   ?   ?   B . n 
B 2 103 GLN 103 91  ?   ?   ?   B . n 
B 2 104 LEU 104 92  ?   ?   ?   B . n 
B 2 105 GLY 105 93  ?   ?   ?   B . n 
B 2 106 ILE 106 94  ?   ?   ?   B . n 
B 2 107 PRO 107 95  ?   ?   ?   B . n 
B 2 108 HIS 108 96  96  HIS HIS B . n 
B 2 109 PRO 109 97  97  PRO PRO B . n 
B 2 110 ALA 110 98  98  ALA ALA B . n 
B 2 111 GLY 111 99  99  GLY GLY B . n 
B 2 112 LEU 112 100 100 LEU LEU B . n 
B 2 113 LYS 113 101 101 LYS LYS B . n 
B 2 114 LYS 114 102 102 LYS LYS B . n 
B 2 115 LYS 115 103 103 LYS LYS B . n 
B 2 116 LYS 116 104 104 LYS LYS B . n 
B 2 117 SER 117 105 105 SER SER B . n 
B 2 118 VAL 118 106 106 VAL VAL B . n 
B 2 119 THR 119 107 107 THR THR B . n 
B 2 120 VAL 120 108 108 VAL VAL B . n 
B 2 121 LEU 121 109 109 LEU LEU B . n 
B 2 122 ASP 122 110 110 ASP ASP B . n 
B 2 123 VAL 123 111 111 VAL VAL B . n 
B 2 124 GLY 124 112 112 GLY GLY B . n 
B 2 125 ASP 125 113 113 ASP ASP B . n 
B 2 126 ALA 126 114 114 ALA ALA B . n 
B 2 127 TYR 127 115 115 TYR TYR B . n 
B 2 128 PHE 128 116 116 PHE PHE B . n 
B 2 129 SER 129 117 117 SER SER B . n 
B 2 130 VAL 130 118 118 VAL VAL B . n 
B 2 131 PRO 131 119 119 PRO PRO B . n 
B 2 132 LEU 132 120 120 LEU LEU B . n 
B 2 133 ASP 133 121 121 ASP ASP B . n 
B 2 134 GLU 134 122 122 GLU GLU B . n 
B 2 135 ASP 135 123 123 ASP ASP B . n 
B 2 136 PHE 136 124 124 PHE PHE B . n 
B 2 137 ARG 137 125 125 ARG ARG B . n 
B 2 138 LYS 138 126 126 LYS LYS B . n 
B 2 139 TYR 139 127 127 TYR TYR B . n 
B 2 140 THR 140 128 128 THR THR B . n 
B 2 141 ALA 141 129 129 ALA ALA B . n 
B 2 142 PHE 142 130 130 PHE PHE B . n 
B 2 143 THR 143 131 131 THR THR B . n 
B 2 144 ILE 144 132 132 ILE ILE B . n 
B 2 145 PRO 145 133 133 PRO PRO B . n 
B 2 146 SER 146 134 134 SER SER B . n 
B 2 147 ILE 147 135 135 ILE ILE B . n 
B 2 148 ASN 148 136 136 ASN ASN B . n 
B 2 149 ASN 149 137 137 ASN ASN B . n 
B 2 150 GLU 150 138 138 GLU GLU B . n 
B 2 151 THR 151 139 139 THR THR B . n 
B 2 152 PRO 152 140 140 PRO PRO B . n 
B 2 153 GLY 153 141 141 GLY GLY B . n 
B 2 154 ILE 154 142 142 ILE ILE B . n 
B 2 155 ARG 155 143 143 ARG ARG B . n 
B 2 156 TYR 156 144 144 TYR TYR B . n 
B 2 157 GLN 157 145 145 GLN GLN B . n 
B 2 158 TYR 158 146 146 TYR TYR B . n 
B 2 159 ASN 159 147 147 ASN ASN B . n 
B 2 160 VAL 160 148 148 VAL VAL B . n 
B 2 161 LEU 161 149 149 LEU LEU B . n 
B 2 162 PRO 162 150 150 PRO PRO B . n 
B 2 163 GLN 163 151 151 GLN GLN B . n 
B 2 164 GLY 164 152 152 GLY GLY B . n 
B 2 165 TRP 165 153 153 TRP TRP B . n 
B 2 166 LYS 166 154 154 LYS LYS B . n 
B 2 167 GLY 167 155 155 GLY GLY B . n 
B 2 168 SER 168 156 156 SER SER B . n 
B 2 169 PRO 169 157 157 PRO PRO B . n 
B 2 170 ALA 170 158 158 ALA ALA B . n 
B 2 171 ILE 171 159 159 ILE ILE B . n 
B 2 172 PHE 172 160 160 PHE PHE B . n 
B 2 173 GLN 173 161 161 GLN GLN B . n 
B 2 174 SER 174 162 162 SER SER B . n 
B 2 175 SER 175 163 163 SER SER B . n 
B 2 176 MET 176 164 164 MET MET B . n 
B 2 177 THR 177 165 165 THR THR B . n 
B 2 178 LYS 178 166 166 LYS LYS B . n 
B 2 179 ILE 179 167 167 ILE ILE B . n 
B 2 180 LEU 180 168 168 LEU LEU B . n 
B 2 181 GLU 181 169 169 GLU GLU B . n 
B 2 182 PRO 182 170 170 PRO PRO B . n 
B 2 183 PHE 183 171 171 PHE PHE B . n 
B 2 184 ARG 184 172 172 ARG ARG B . n 
B 2 185 LYS 185 173 173 LYS LYS B . n 
B 2 186 GLN 186 174 174 GLN GLN B . n 
B 2 187 ASN 187 175 175 ASN ASN B . n 
B 2 188 PRO 188 176 176 PRO PRO B . n 
B 2 189 ASP 189 177 177 ASP ASP B . n 
B 2 190 ILE 190 178 178 ILE ILE B . n 
B 2 191 VAL 191 179 179 VAL VAL B . n 
B 2 192 ILE 192 180 180 ILE ILE B . n 
B 2 193 TYR 193 181 181 TYR TYR B . n 
B 2 194 GLN 194 182 182 GLN GLN B . n 
B 2 195 TYR 195 183 183 TYR TYR B . n 
B 2 196 MET 196 184 184 MET MET B . n 
B 2 197 ASP 197 185 185 ASP ASP B . n 
B 2 198 ASP 198 186 186 ASP ASP B . n 
B 2 199 LEU 199 187 187 LEU LEU B . n 
B 2 200 TYR 200 188 188 TYR TYR B . n 
B 2 201 VAL 201 189 189 VAL VAL B . n 
B 2 202 GLY 202 190 190 GLY GLY B . n 
B 2 203 SER 203 191 191 SER SER B . n 
B 2 204 ASP 204 192 192 ASP ASP B . n 
B 2 205 LEU 205 193 193 LEU LEU B . n 
B 2 206 GLU 206 194 194 GLU GLU B . n 
B 2 207 ILE 207 195 195 ILE ILE B . n 
B 2 208 GLY 208 196 196 GLY GLY B . n 
B 2 209 GLN 209 197 197 GLN GLN B . n 
B 2 210 HIS 210 198 198 HIS HIS B . n 
B 2 211 ARG 211 199 199 ARG ARG B . n 
B 2 212 THR 212 200 200 THR THR B . n 
B 2 213 LYS 213 201 201 LYS LYS B . n 
B 2 214 ILE 214 202 202 ILE ILE B . n 
B 2 215 GLU 215 203 203 GLU GLU B . n 
B 2 216 GLU 216 204 204 GLU GLU B . n 
B 2 217 LEU 217 205 205 LEU LEU B . n 
B 2 218 ARG 218 206 206 ARG ARG B . n 
B 2 219 GLN 219 207 207 GLN GLN B . n 
B 2 220 HIS 220 208 208 HIS HIS B . n 
B 2 221 LEU 221 209 209 LEU LEU B . n 
B 2 222 LEU 222 210 210 LEU LEU B . n 
B 2 223 ARG 223 211 211 ARG ARG B . n 
B 2 224 TRP 224 212 ?   ?   ?   B . n 
B 2 225 GLY 225 213 ?   ?   ?   B . n 
B 2 226 LEU 226 214 ?   ?   ?   B . n 
B 2 227 THR 227 215 ?   ?   ?   B . n 
B 2 228 THR 228 216 ?   ?   ?   B . n 
B 2 229 PRO 229 217 ?   ?   ?   B . n 
B 2 230 ASP 230 218 ?   ?   ?   B . n 
B 2 231 LYS 231 219 ?   ?   ?   B . n 
B 2 232 LYS 232 220 ?   ?   ?   B . n 
B 2 233 HIS 233 221 ?   ?   ?   B . n 
B 2 234 GLN 234 222 ?   ?   ?   B . n 
B 2 235 LYS 235 223 ?   ?   ?   B . n 
B 2 236 GLU 236 224 ?   ?   ?   B . n 
B 2 237 PRO 237 225 ?   ?   ?   B . n 
B 2 238 PRO 238 226 ?   ?   ?   B . n 
B 2 239 PHE 239 227 ?   ?   ?   B . n 
B 2 240 LEU 240 228 ?   ?   ?   B . n 
B 2 241 TRP 241 229 ?   ?   ?   B . n 
B 2 242 MET 242 230 ?   ?   ?   B . n 
B 2 243 GLY 243 231 ?   ?   ?   B . n 
B 2 244 TYR 244 232 ?   ?   ?   B . n 
B 2 245 GLU 245 233 233 GLU GLU B . n 
B 2 246 LEU 246 234 234 LEU LEU B . n 
B 2 247 HIS 247 235 235 HIS HIS B . n 
B 2 248 PRO 248 236 236 PRO PRO B . n 
B 2 249 ASP 249 237 237 ASP ASP B . n 
B 2 250 LYS 250 238 238 LYS LYS B . n 
B 2 251 TRP 251 239 239 TRP TRP B . n 
B 2 252 THR 252 240 240 THR THR B . n 
B 2 253 VAL 253 241 241 VAL VAL B . n 
B 2 254 GLN 254 242 242 GLN GLN B . n 
B 2 255 PRO 255 243 243 PRO PRO B . n 
B 2 256 ILE 256 244 244 ILE ILE B . n 
B 2 257 VAL 257 245 245 VAL VAL B . n 
B 2 258 LEU 258 246 246 LEU LEU B . n 
B 2 259 PRO 259 247 247 PRO PRO B . n 
B 2 260 GLU 260 248 248 GLU GLU B . n 
B 2 261 LYS 261 249 249 LYS LYS B . n 
B 2 262 ASP 262 250 250 ASP ASP B . n 
B 2 263 SER 263 251 251 SER SER B . n 
B 2 264 TRP 264 252 252 TRP TRP B . n 
B 2 265 THR 265 253 253 THR THR B . n 
B 2 266 VAL 266 254 254 VAL VAL B . n 
B 2 267 ASN 267 255 255 ASN ASN B . n 
B 2 268 ASP 268 256 256 ASP ASP B . n 
B 2 269 ILE 269 257 257 ILE ILE B . n 
B 2 270 GLN 270 258 258 GLN GLN B . n 
B 2 271 LYS 271 259 259 LYS LYS B . n 
B 2 272 LEU 272 260 260 LEU LEU B . n 
B 2 273 VAL 273 261 261 VAL VAL B . n 
B 2 274 GLY 274 262 262 GLY GLY B . n 
B 2 275 LYS 275 263 263 LYS LYS B . n 
B 2 276 LEU 276 264 264 LEU LEU B . n 
B 2 277 ASN 277 265 265 ASN ASN B . n 
B 2 278 TRP 278 266 266 TRP TRP B . n 
B 2 279 ALA 279 267 267 ALA ALA B . n 
B 2 280 SER 280 268 268 SER SER B . n 
B 2 281 GLN 281 269 269 GLN GLN B . n 
B 2 282 ILE 282 270 270 ILE ILE B . n 
B 2 283 TYR 283 271 271 TYR TYR B . n 
B 2 284 PRO 284 272 272 PRO PRO B . n 
B 2 285 GLY 285 273 273 GLY GLY B . n 
B 2 286 ILE 286 274 274 ILE ILE B . n 
B 2 287 LYS 287 275 275 LYS LYS B . n 
B 2 288 VAL 288 276 276 VAL VAL B . n 
B 2 289 ARG 289 277 277 ARG ARG B . n 
B 2 290 GLN 290 278 278 GLN GLN B . n 
B 2 291 LEU 291 279 279 LEU LEU B . n 
B 2 292 SER 292 280 280 SER SER B . n 
B 2 293 LYS 293 281 281 LYS LYS B . n 
B 2 294 LEU 294 282 282 LEU LEU B . n 
B 2 295 LEU 295 283 283 LEU LEU B . n 
B 2 296 ARG 296 284 284 ARG ARG B . n 
B 2 297 GLY 297 285 285 GLY GLY B . n 
B 2 298 THR 298 286 286 THR THR B . n 
B 2 299 LYS 299 287 287 LYS LYS B . n 
B 2 300 ALA 300 288 288 ALA ALA B . n 
B 2 301 LEU 301 289 289 LEU LEU B . n 
B 2 302 THR 302 290 290 THR THR B . n 
B 2 303 GLU 303 291 291 GLU GLU B . n 
B 2 304 VAL 304 292 292 VAL VAL B . n 
B 2 305 ILE 305 293 293 ILE ILE B . n 
B 2 306 PRO 306 294 294 PRO PRO B . n 
B 2 307 LEU 307 295 295 LEU LEU B . n 
B 2 308 THR 308 296 296 THR THR B . n 
B 2 309 GLU 309 297 297 GLU GLU B . n 
B 2 310 GLU 310 298 298 GLU GLU B . n 
B 2 311 ALA 311 299 299 ALA ALA B . n 
B 2 312 GLU 312 300 300 GLU GLU B . n 
B 2 313 LEU 313 301 301 LEU LEU B . n 
B 2 314 GLU 314 302 302 GLU GLU B . n 
B 2 315 LEU 315 303 303 LEU LEU B . n 
B 2 316 ALA 316 304 304 ALA ALA B . n 
B 2 317 GLU 317 305 305 GLU GLU B . n 
B 2 318 ASN 318 306 306 ASN ASN B . n 
B 2 319 ARG 319 307 307 ARG ARG B . n 
B 2 320 GLU 320 308 308 GLU GLU B . n 
B 2 321 ILE 321 309 309 ILE ILE B . n 
B 2 322 LEU 322 310 310 LEU LEU B . n 
B 2 323 LYS 323 311 311 LYS LYS B . n 
B 2 324 GLU 324 312 312 GLU GLU B . n 
B 2 325 PRO 325 313 313 PRO PRO B . n 
B 2 326 VAL 326 314 314 VAL VAL B . n 
B 2 327 HIS 327 315 315 HIS HIS B . n 
B 2 328 GLY 328 316 316 GLY GLY B . n 
B 2 329 VAL 329 317 317 VAL VAL B . n 
B 2 330 TYR 330 318 318 TYR TYR B . n 
B 2 331 TYR 331 319 319 TYR TYR B . n 
B 2 332 ASP 332 320 320 ASP ASP B . n 
B 2 333 PRO 333 321 321 PRO PRO B . n 
B 2 334 SER 334 322 322 SER SER B . n 
B 2 335 LYS 335 323 323 LYS LYS B . n 
B 2 336 ASP 336 324 324 ASP ASP B . n 
B 2 337 LEU 337 325 325 LEU LEU B . n 
B 2 338 ILE 338 326 326 ILE ILE B . n 
B 2 339 ALA 339 327 327 ALA ALA B . n 
B 2 340 GLU 340 328 328 GLU GLU B . n 
B 2 341 ILE 341 329 329 ILE ILE B . n 
B 2 342 GLN 342 330 330 GLN GLN B . n 
B 2 343 LYS 343 331 331 LYS LYS B . n 
B 2 344 GLN 344 332 332 GLN GLN B . n 
B 2 345 GLY 345 333 333 GLY GLY B . n 
B 2 346 GLN 346 334 334 GLN GLN B . n 
B 2 347 GLY 347 335 335 GLY GLY B . n 
B 2 348 GLN 348 336 336 GLN GLN B . n 
B 2 349 TRP 349 337 337 TRP TRP B . n 
B 2 350 THR 350 338 338 THR THR B . n 
B 2 351 TYR 351 339 339 TYR TYR B . n 
B 2 352 GLN 352 340 340 GLN GLN B . n 
B 2 353 ILE 353 341 341 ILE ILE B . n 
B 2 354 TYR 354 342 342 TYR TYR B . n 
B 2 355 GLN 355 343 343 GLN GLN B . n 
B 2 356 GLU 356 344 344 GLU GLU B . n 
B 2 357 PRO 357 345 345 PRO PRO B . n 
B 2 358 PHE 358 346 346 PHE PHE B . n 
B 2 359 LYS 359 347 347 LYS LYS B . n 
B 2 360 ASN 360 348 348 ASN ASN B . n 
B 2 361 LEU 361 349 349 LEU LEU B . n 
B 2 362 LYS 362 350 350 LYS LYS B . n 
B 2 363 THR 363 351 351 THR THR B . n 
B 2 364 GLY 364 352 352 GLY GLY B . n 
B 2 365 LYS 365 353 353 LYS LYS B . n 
B 2 366 TYR 366 354 354 TYR TYR B . n 
B 2 367 ALA 367 355 355 ALA ALA B . n 
B 2 368 ARG 368 356 356 ARG ARG B . n 
B 2 369 MET 369 357 357 MET MET B . n 
B 2 370 ARG 370 358 358 ARG ARG B . n 
B 2 371 GLY 371 359 359 GLY GLY B . n 
B 2 372 ALA 372 360 360 ALA ALA B . n 
B 2 373 HIS 373 361 361 HIS HIS B . n 
B 2 374 THR 374 362 362 THR THR B . n 
B 2 375 ASN 375 363 363 ASN ASN B . n 
B 2 376 ASP 376 364 364 ASP ASP B . n 
B 2 377 VAL 377 365 365 VAL VAL B . n 
B 2 378 LYS 378 366 366 LYS LYS B . n 
B 2 379 GLN 379 367 367 GLN GLN B . n 
B 2 380 LEU 380 368 368 LEU LEU B . n 
B 2 381 THR 381 369 369 THR THR B . n 
B 2 382 GLU 382 370 370 GLU GLU B . n 
B 2 383 ALA 383 371 371 ALA ALA B . n 
B 2 384 VAL 384 372 372 VAL VAL B . n 
B 2 385 GLN 385 373 373 GLN GLN B . n 
B 2 386 LYS 386 374 374 LYS LYS B . n 
B 2 387 ILE 387 375 375 ILE ILE B . n 
B 2 388 THR 388 376 376 THR THR B . n 
B 2 389 THR 389 377 377 THR THR B . n 
B 2 390 GLU 390 378 378 GLU GLU B . n 
B 2 391 SER 391 379 379 SER SER B . n 
B 2 392 ILE 392 380 380 ILE ILE B . n 
B 2 393 VAL 393 381 381 VAL VAL B . n 
B 2 394 ILE 394 382 382 ILE ILE B . n 
B 2 395 TRP 395 383 383 TRP TRP B . n 
B 2 396 GLY 396 384 384 GLY GLY B . n 
B 2 397 LYS 397 385 385 LYS LYS B . n 
B 2 398 THR 398 386 386 THR THR B . n 
B 2 399 PRO 399 387 387 PRO PRO B . n 
B 2 400 LYS 400 388 388 LYS LYS B . n 
B 2 401 PHE 401 389 389 PHE PHE B . n 
B 2 402 LYS 402 390 390 LYS LYS B . n 
B 2 403 LEU 403 391 391 LEU LEU B . n 
B 2 404 PRO 404 392 392 PRO PRO B . n 
B 2 405 ILE 405 393 393 ILE ILE B . n 
B 2 406 GLN 406 394 394 GLN GLN B . n 
B 2 407 LYS 407 395 395 LYS LYS B . n 
B 2 408 GLU 408 396 396 GLU GLU B . n 
B 2 409 THR 409 397 397 THR THR B . n 
B 2 410 TRP 410 398 398 TRP TRP B . n 
B 2 411 GLU 411 399 399 GLU GLU B . n 
B 2 412 THR 412 400 400 THR THR B . n 
B 2 413 TRP 413 401 401 TRP TRP B . n 
B 2 414 TRP 414 402 402 TRP TRP B . n 
B 2 415 THR 415 403 403 THR THR B . n 
B 2 416 GLU 416 404 404 GLU GLU B . n 
B 2 417 TYR 417 405 405 TYR TYR B . n 
B 2 418 TRP 418 406 406 TRP TRP B . n 
B 2 419 GLN 419 407 407 GLN GLN B . n 
B 2 420 ALA 420 408 408 ALA ALA B . n 
B 2 421 THR 421 409 409 THR THR B . n 
B 2 422 TRP 422 410 410 TRP TRP B . n 
B 2 423 ILE 423 411 411 ILE ILE B . n 
B 2 424 PRO 424 412 412 PRO PRO B . n 
B 2 425 GLU 425 413 413 GLU GLU B . n 
B 2 426 TRP 426 414 414 TRP TRP B . n 
B 2 427 GLU 427 415 415 GLU GLU B . n 
B 2 428 PHE 428 416 416 PHE PHE B . n 
B 2 429 VAL 429 417 417 VAL VAL B . n 
B 2 430 ASN 430 418 418 ASN ASN B . n 
B 2 431 THR 431 419 419 THR THR B . n 
B 2 432 PRO 432 420 420 PRO PRO B . n 
B 2 433 PRO 433 421 421 PRO PRO B . n 
B 2 434 LEU 434 422 422 LEU LEU B . n 
B 2 435 VAL 435 423 423 VAL VAL B . n 
B 2 436 LYS 436 424 424 LYS LYS B . n 
B 2 437 LEU 437 425 425 LEU LEU B . n 
B 2 438 TRP 438 426 426 TRP TRP B . n 
B 2 439 TYR 439 427 427 TYR TYR B . n 
B 2 440 GLN 440 428 428 GLN GLN B . n 
B 2 441 LEU 441 429 429 LEU LEU B . n 
B 2 442 GLU 442 430 ?   ?   ?   B . n 
B 2 443 LYS 443 431 ?   ?   ?   B . n 
B 2 444 GLU 444 432 ?   ?   ?   B . n 
B 2 445 PRO 445 433 ?   ?   ?   B . n 
B 2 446 ILE 446 434 ?   ?   ?   B . n 
B 2 447 VAL 447 435 ?   ?   ?   B . n 
B 2 448 GLY 448 436 ?   ?   ?   B . n 
B 2 449 ALA 449 437 ?   ?   ?   B . n 
B 2 450 GLU 450 438 ?   ?   ?   B . n 
B 2 451 THR 451 439 ?   ?   ?   B . n 
B 2 452 PHE 452 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  DG  P . n 
C 3 5   DT  5   806 806 DT  DT  P . n 
C 3 6   DC  6   807 807 DC  DC  P . n 
C 3 7   DC  7   808 808 DC  DC  P . n 
C 3 8   DC  8   809 809 DC  DC  P . n 
C 3 9   DT  9   810 810 DT  DT  P . n 
C 3 10  DG  10  811 811 DG  DG  P . n 
C 3 11  DT  11  812 812 DT  DT  P . n 
C 3 12  DT  12  813 813 DT  DT  P . n 
C 3 13  DC  13  814 814 DC  DC  P . n 
C 3 14  DG  14  815 815 DG  DG  P . n 
C 3 15  DG  15  816 816 DG  DG  P . n 
C 3 16  G47 16  817 817 G47 G47 P . n 
C 3 17  DC  17  818 818 DC  DC  P . n 
C 3 18  DG  18  819 819 DG  DG  P . n 
C 3 19  DC  19  820 820 DC  DC  P . n 
C 3 20  DC  20  821 821 DC  DC  P . n 
C 3 21  DDG 21  822 822 DDG DDG P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 ?   ?   ?   T . n 
D 4 3   DG  3   703 703 DG  DG  T . n 
D 4 4   DG  4   704 704 DG  DG  T . n 
D 4 5   DA  5   705 705 DA  DA  T . n 
D 4 6   DC  6   706 706 DC  DC  T . n 
D 4 7   DG  7   707 707 DG  DG  T . n 
D 4 8   DG  8   708 708 DG  DG  T . n 
D 4 9   DC  9   709 709 DC  DC  T . n 
D 4 10  DG  10  710 710 DG  DG  T . n 
D 4 11  DC  11  711 711 DC  DC  T . n 
D 4 12  DC  12  712 712 DC  DC  T . n 
D 4 13  DC  13  713 713 DC  DC  T . n 
D 4 14  DG  14  714 714 DG  DG  T . n 
D 4 15  DA  15  715 715 DA  DA  T . n 
D 4 16  DA  16  716 716 DA  DA  T . n 
D 4 17  DC  17  717 717 DC  DC  T . n 
D 4 18  DA  18  718 718 DA  DA  T . n 
D 4 19  DG  19  719 719 DG  DG  T . n 
D 4 20  DG  20  720 720 DG  DG  T . n 
D 4 21  DG  21  721 721 DG  DG  T . n 
D 4 22  DA  22  722 722 DA  DA  T . n 
D 4 23  DC  23  723 723 DC  DC  T . n 
D 4 24  DT  24  724 724 DT  DT  T . n 
D 4 25  DG  25  725 725 DG  DG  T . n 
D 4 26  DT  26  726 ?   ?   ?   T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 D4T 1 601 1   D4T D4T A . 
F 6 MG  1 602 6   MG  MG  A . 
G 6 MG  1 603 7   MG  MG  A . 
H 7 SO4 1 604 601 SO4 SO4 A . 
I 8 HOH 1 701 1   HOH HOH A . 
I 8 HOH 2 702 5   HOH HOH A . 
I 8 HOH 3 703 4   HOH HOH A . 
I 8 HOH 4 704 3   HOH HOH A . 
I 8 HOH 5 705 2   HOH HOH A . 
J 8 HOH 1 501 6   HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14720 ? 
1 MORE         -83   ? 
1 'SSA (A^2)'  45230 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 111 ? A ASP 110 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O   ? A VAL 112 ? A VAL 111 ? 1_555 104.7 ? 
2  OD2 ? A ASP 111 ? A ASP 110 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2 ? A ASP 186 ? A ASP 185 ? 1_555 110.2 ? 
3  O   ? A VAL 112 ? A VAL 111 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2 ? A ASP 186 ? A ASP 185 ? 1_555 81.2  ? 
4  OD2 ? A ASP 111 ? A ASP 110 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2C ? E D4T .   ? A D4T 601 ? 1_555 83.0  ? 
5  O   ? A VAL 112 ? A VAL 111 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2C ? E D4T .   ? A D4T 601 ? 1_555 100.2 ? 
6  OD2 ? A ASP 186 ? A ASP 185 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2C ? E D4T .   ? A D4T 601 ? 1_555 166.1 ? 
7  OD2 ? A ASP 111 ? A ASP 110 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B ? E D4T .   ? A D4T 601 ? 1_555 155.4 ? 
8  O   ? A VAL 112 ? A VAL 111 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B ? E D4T .   ? A D4T 601 ? 1_555 90.6  ? 
9  OD2 ? A ASP 186 ? A ASP 185 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B ? E D4T .   ? A D4T 601 ? 1_555 90.9  ? 
10 O2C ? E D4T .   ? A D4T 601 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B ? E D4T .   ? A D4T 601 ? 1_555 75.3  ? 
11 OD2 ? A ASP 111 ? A ASP 110 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2A ? E D4T .   ? A D4T 601 ? 1_555 91.2  ? 
12 O   ? A VAL 112 ? A VAL 111 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2A ? E D4T .   ? A D4T 601 ? 1_555 164.0 ? 
13 OD2 ? A ASP 186 ? A ASP 185 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2A ? E D4T .   ? A D4T 601 ? 1_555 94.9  ? 
14 O2C ? E D4T .   ? A D4T 601 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2A ? E D4T .   ? A D4T 601 ? 1_555 80.0  ? 
15 O2B ? E D4T .   ? A D4T 601 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2A ? E D4T .   ? A D4T 601 ? 1_555 73.8  ? 
16 OD1 ? A ASP 444 ? A ASP 443 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OE2 ? A GLU 479 ? A GLU 478 ? 1_555 93.8  ? 
17 OD1 ? A ASP 444 ? A ASP 443 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD1 ? A ASP 499 ? A ASP 498 ? 1_555 93.1  ? 
18 OE2 ? A GLU 479 ? A GLU 478 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD1 ? A ASP 499 ? A ASP 498 ? 1_555 83.8  ? 
19 OD1 ? A ASP 444 ? A ASP 443 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 499 ? A ASP 498 ? 1_555 93.3  ? 
20 OE2 ? A GLU 479 ? A GLU 478 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 499 ? A ASP 498 ? 1_555 146.5 ? 
21 OD1 ? A ASP 499 ? A ASP 498 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 499 ? A ASP 498 ? 1_555 63.1  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2020-11-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         4 
# 
_pdbx_entry_details.entry_id                 6WPJ 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O3'" P DC 821 ? ? P P DDG 822 ? ? "O5'" P DDG 822 ? ? 87.57  104.00 -16.43 1.90 Y 
2 1 "O3'" P DC 821 ? ? P P DDG 822 ? ? OP2   P DDG 822 ? ? 124.98 110.50 14.48  1.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 184 ? ? 65.72   -55.34  
2  1 ASP A 185 ? ? -154.97 0.74    
3  1 ASP A 192 ? ? -97.65  33.44   
4  1 LYS A 311 ? ? -67.68  4.77    
5  1 PRO A 412 ? ? -68.60  -174.55 
6  1 ASN A 418 ? ? -89.16  33.90   
7  1 LYS A 540 ? ? -140.19 11.97   
8  1 LYS B 101 ? ? -69.35  0.56    
9  1 PHE B 346 ? ? 78.71   -0.47   
10 1 LYS B 347 ? ? -103.54 76.33   
11 1 PRO B 421 ? ? -55.05  -6.57   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    183 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   MET 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    184 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -129.05 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 6   ? CG  ? A GLU 7   CG  
2   1 Y 1 A GLU 6   ? CD  ? A GLU 7   CD  
3   1 Y 1 A GLU 6   ? OE1 ? A GLU 7   OE1 
4   1 Y 1 A GLU 6   ? OE2 ? A GLU 7   OE2 
5   1 Y 1 A LYS 11  ? CG  ? A LYS 12  CG  
6   1 Y 1 A LYS 11  ? CD  ? A LYS 12  CD  
7   1 Y 1 A LYS 11  ? CE  ? A LYS 12  CE  
8   1 Y 1 A LYS 11  ? NZ  ? A LYS 12  NZ  
9   1 Y 1 A LYS 22  ? CG  ? A LYS 23  CG  
10  1 Y 1 A LYS 22  ? CD  ? A LYS 23  CD  
11  1 Y 1 A LYS 22  ? CE  ? A LYS 23  CE  
12  1 Y 1 A LYS 22  ? NZ  ? A LYS 23  NZ  
13  1 Y 1 A LEU 26  ? CG  ? A LEU 27  CG  
14  1 Y 1 A LEU 26  ? CD1 ? A LEU 27  CD1 
15  1 Y 1 A LEU 26  ? CD2 ? A LEU 27  CD2 
16  1 Y 1 A LYS 32  ? CG  ? A LYS 33  CG  
17  1 Y 1 A LYS 32  ? CD  ? A LYS 33  CD  
18  1 Y 1 A LYS 32  ? CE  ? A LYS 33  CE  
19  1 Y 1 A LYS 32  ? NZ  ? A LYS 33  NZ  
20  1 Y 1 A LYS 64  ? CG  ? A LYS 65  CG  
21  1 Y 1 A LYS 64  ? CD  ? A LYS 65  CD  
22  1 Y 1 A LYS 64  ? CE  ? A LYS 65  CE  
23  1 Y 1 A LYS 64  ? NZ  ? A LYS 65  NZ  
24  1 Y 1 A SER 68  ? OG  ? A SER 69  OG  
25  1 Y 1 A THR 69  ? OG1 ? A THR 70  OG1 
26  1 Y 1 A THR 69  ? CG2 ? A THR 70  CG2 
27  1 Y 1 A LYS 102 ? CG  ? A LYS 103 CG  
28  1 Y 1 A LYS 102 ? CD  ? A LYS 103 CD  
29  1 Y 1 A LYS 102 ? CE  ? A LYS 103 CE  
30  1 Y 1 A LYS 102 ? NZ  ? A LYS 103 NZ  
31  1 Y 1 A SER 134 ? OG  ? A SER 135 OG  
32  1 Y 1 A ILE 135 ? CG1 ? A ILE 136 CG1 
33  1 Y 1 A ILE 135 ? CG2 ? A ILE 136 CG2 
34  1 Y 1 A ILE 135 ? CD1 ? A ILE 136 CD1 
35  1 Y 1 A ASN 137 ? CG  ? A ASN 138 CG  
36  1 Y 1 A ASN 137 ? OD1 ? A ASN 138 OD1 
37  1 Y 1 A ASN 137 ? ND2 ? A ASN 138 ND2 
38  1 Y 1 A GLU 138 ? CG  ? A GLU 139 CG  
39  1 Y 1 A GLU 138 ? CD  ? A GLU 139 CD  
40  1 Y 1 A GLU 138 ? OE1 ? A GLU 139 OE1 
41  1 Y 1 A GLU 138 ? OE2 ? A GLU 139 OE2 
42  1 Y 1 A THR 139 ? OG1 ? A THR 140 OG1 
43  1 Y 1 A THR 139 ? CG2 ? A THR 140 CG2 
44  1 Y 1 A GLU 194 ? CG  ? A GLU 195 CG  
45  1 Y 1 A GLU 194 ? CD  ? A GLU 195 CD  
46  1 Y 1 A GLU 194 ? OE1 ? A GLU 195 OE1 
47  1 Y 1 A GLU 194 ? OE2 ? A GLU 195 OE2 
48  1 Y 1 A LYS 249 ? CG  ? A LYS 250 CG  
49  1 Y 1 A LYS 249 ? CD  ? A LYS 250 CD  
50  1 Y 1 A LYS 249 ? CE  ? A LYS 250 CE  
51  1 Y 1 A LYS 249 ? NZ  ? A LYS 250 NZ  
52  1 Y 1 A LYS 281 ? CG  ? A LYS 282 CG  
53  1 Y 1 A LYS 281 ? CD  ? A LYS 282 CD  
54  1 Y 1 A LYS 281 ? CE  ? A LYS 282 CE  
55  1 Y 1 A LYS 281 ? NZ  ? A LYS 282 NZ  
56  1 Y 1 A ARG 284 ? CG  ? A ARG 285 CG  
57  1 Y 1 A ARG 284 ? CD  ? A ARG 285 CD  
58  1 Y 1 A ARG 284 ? NE  ? A ARG 285 NE  
59  1 Y 1 A ARG 284 ? CZ  ? A ARG 285 CZ  
60  1 Y 1 A ARG 284 ? NH1 ? A ARG 285 NH1 
61  1 Y 1 A ARG 284 ? NH2 ? A ARG 285 NH2 
62  1 Y 1 A THR 286 ? OG1 ? A THR 287 OG1 
63  1 Y 1 A THR 286 ? CG2 ? A THR 287 CG2 
64  1 Y 1 A LYS 287 ? CG  ? A LYS 288 CG  
65  1 Y 1 A LYS 287 ? CD  ? A LYS 288 CD  
66  1 Y 1 A LYS 287 ? CE  ? A LYS 288 CE  
67  1 Y 1 A LYS 287 ? NZ  ? A LYS 288 NZ  
68  1 Y 1 A GLU 291 ? CG  ? A GLU 292 CG  
69  1 Y 1 A GLU 291 ? CD  ? A GLU 292 CD  
70  1 Y 1 A GLU 291 ? OE1 ? A GLU 292 OE1 
71  1 Y 1 A GLU 291 ? OE2 ? A GLU 292 OE2 
72  1 Y 1 A ILE 293 ? CG1 ? A ILE 294 CG1 
73  1 Y 1 A ILE 293 ? CG2 ? A ILE 294 CG2 
74  1 Y 1 A ILE 293 ? CD1 ? A ILE 294 CD1 
75  1 Y 1 A GLU 305 ? CG  ? A GLU 306 CG  
76  1 Y 1 A GLU 305 ? CD  ? A GLU 306 CD  
77  1 Y 1 A GLU 305 ? OE1 ? A GLU 306 OE1 
78  1 Y 1 A GLU 305 ? OE2 ? A GLU 306 OE2 
79  1 Y 1 A GLU 344 ? CG  ? A GLU 345 CG  
80  1 Y 1 A GLU 344 ? CD  ? A GLU 345 CD  
81  1 Y 1 A GLU 344 ? OE1 ? A GLU 345 OE1 
82  1 Y 1 A GLU 344 ? OE2 ? A GLU 345 OE2 
83  1 Y 1 A LYS 353 ? CE  ? A LYS 354 CE  
84  1 Y 1 A LYS 353 ? NZ  ? A LYS 354 NZ  
85  1 Y 1 A LYS 374 ? CE  ? A LYS 375 CE  
86  1 Y 1 A LYS 374 ? NZ  ? A LYS 375 NZ  
87  1 Y 1 A GLU 396 ? CG  ? A GLU 397 CG  
88  1 Y 1 A GLU 396 ? CD  ? A GLU 397 CD  
89  1 Y 1 A GLU 396 ? OE1 ? A GLU 397 OE1 
90  1 Y 1 A GLU 396 ? OE2 ? A GLU 397 OE2 
91  1 Y 1 A GLU 404 ? CG  ? A GLU 405 CG  
92  1 Y 1 A GLU 404 ? CD  ? A GLU 405 CD  
93  1 Y 1 A GLU 404 ? OE1 ? A GLU 405 OE1 
94  1 Y 1 A GLU 404 ? OE2 ? A GLU 405 OE2 
95  1 Y 1 A GLU 449 ? CG  ? A GLU 450 CG  
96  1 Y 1 A GLU 449 ? CD  ? A GLU 450 CD  
97  1 Y 1 A GLU 449 ? OE1 ? A GLU 450 OE1 
98  1 Y 1 A GLU 449 ? OE2 ? A GLU 450 OE2 
99  1 Y 1 A GLU 516 ? CG  ? A GLU 517 CG  
100 1 Y 1 A GLU 516 ? CD  ? A GLU 517 CD  
101 1 Y 1 A GLU 516 ? OE1 ? A GLU 517 OE1 
102 1 Y 1 A GLU 516 ? OE2 ? A GLU 517 OE2 
103 1 Y 1 A ILE 556 ? CG1 ? A ILE 557 CG1 
104 1 Y 1 A ILE 556 ? CG2 ? A ILE 557 CG2 
105 1 Y 1 A ILE 556 ? CD1 ? A ILE 557 CD1 
106 1 Y 1 B GLU 6   ? CG  ? B GLU 18  CG  
107 1 Y 1 B GLU 6   ? CD  ? B GLU 18  CD  
108 1 Y 1 B GLU 6   ? OE1 ? B GLU 18  OE1 
109 1 Y 1 B GLU 6   ? OE2 ? B GLU 18  OE2 
110 1 Y 1 B LYS 11  ? CG  ? B LYS 23  CG  
111 1 Y 1 B LYS 11  ? CD  ? B LYS 23  CD  
112 1 Y 1 B LYS 11  ? CE  ? B LYS 23  CE  
113 1 Y 1 B LYS 11  ? NZ  ? B LYS 23  NZ  
114 1 Y 1 B GLU 40  ? CG  ? B GLU 52  CG  
115 1 Y 1 B GLU 40  ? CD  ? B GLU 52  CD  
116 1 Y 1 B GLU 40  ? OE1 ? B GLU 52  OE1 
117 1 Y 1 B GLU 40  ? OE2 ? B GLU 52  OE2 
118 1 Y 1 B LYS 43  ? CG  ? B LYS 55  CG  
119 1 Y 1 B LYS 43  ? CD  ? B LYS 55  CD  
120 1 Y 1 B LYS 43  ? CE  ? B LYS 55  CE  
121 1 Y 1 B LYS 43  ? NZ  ? B LYS 55  NZ  
122 1 Y 1 B LYS 46  ? CE  ? B LYS 58  CE  
123 1 Y 1 B LYS 46  ? NZ  ? B LYS 58  NZ  
124 1 Y 1 B LYS 66  ? CG  ? B LYS 78  CG  
125 1 Y 1 B LYS 66  ? CD  ? B LYS 78  CD  
126 1 Y 1 B LYS 66  ? CE  ? B LYS 78  CE  
127 1 Y 1 B LYS 66  ? NZ  ? B LYS 78  NZ  
128 1 Y 1 B ASP 67  ? CG  ? B ASP 79  CG  
129 1 Y 1 B ASP 67  ? OD1 ? B ASP 79  OD1 
130 1 Y 1 B ASP 67  ? OD2 ? B ASP 79  OD2 
131 1 Y 1 B SER 68  ? OG  ? B SER 80  OG  
132 1 Y 1 B LYS 70  ? CG  ? B LYS 82  CG  
133 1 Y 1 B LYS 70  ? CD  ? B LYS 82  CD  
134 1 Y 1 B LYS 70  ? CE  ? B LYS 82  CE  
135 1 Y 1 B LYS 70  ? NZ  ? B LYS 82  NZ  
136 1 Y 1 B GLN 85  ? CG  ? B GLN 97  CG  
137 1 Y 1 B GLN 85  ? CD  ? B GLN 97  CD  
138 1 Y 1 B GLN 85  ? OE1 ? B GLN 97  OE1 
139 1 Y 1 B GLN 85  ? NE2 ? B GLN 97  NE2 
140 1 Y 1 B LYS 103 ? CE  ? B LYS 115 CE  
141 1 Y 1 B LYS 103 ? NZ  ? B LYS 115 NZ  
142 1 Y 1 B LYS 104 ? CG  ? B LYS 116 CG  
143 1 Y 1 B LYS 104 ? CD  ? B LYS 116 CD  
144 1 Y 1 B LYS 104 ? CE  ? B LYS 116 CE  
145 1 Y 1 B LYS 104 ? NZ  ? B LYS 116 NZ  
146 1 Y 1 B GLU 122 ? CG  ? B GLU 134 CG  
147 1 Y 1 B GLU 122 ? CD  ? B GLU 134 CD  
148 1 Y 1 B GLU 122 ? OE1 ? B GLU 134 OE1 
149 1 Y 1 B GLU 122 ? OE2 ? B GLU 134 OE2 
150 1 Y 1 B LYS 166 ? CG  ? B LYS 178 CG  
151 1 Y 1 B LYS 166 ? CD  ? B LYS 178 CD  
152 1 Y 1 B LYS 166 ? CE  ? B LYS 178 CE  
153 1 Y 1 B LYS 166 ? NZ  ? B LYS 178 NZ  
154 1 Y 1 B GLU 169 ? CG  ? B GLU 181 CG  
155 1 Y 1 B GLU 169 ? CD  ? B GLU 181 CD  
156 1 Y 1 B GLU 169 ? OE1 ? B GLU 181 OE1 
157 1 Y 1 B GLU 169 ? OE2 ? B GLU 181 OE2 
158 1 Y 1 B LYS 173 ? CG  ? B LYS 185 CG  
159 1 Y 1 B LYS 173 ? CD  ? B LYS 185 CD  
160 1 Y 1 B LYS 173 ? CE  ? B LYS 185 CE  
161 1 Y 1 B LYS 173 ? NZ  ? B LYS 185 NZ  
162 1 Y 1 B GLN 174 ? CG  ? B GLN 186 CG  
163 1 Y 1 B GLN 174 ? CD  ? B GLN 186 CD  
164 1 Y 1 B GLN 174 ? OE1 ? B GLN 186 OE1 
165 1 Y 1 B GLN 174 ? NE2 ? B GLN 186 NE2 
166 1 Y 1 B GLU 194 ? CG  ? B GLU 206 CG  
167 1 Y 1 B GLU 194 ? CD  ? B GLU 206 CD  
168 1 Y 1 B GLU 194 ? OE1 ? B GLU 206 OE1 
169 1 Y 1 B GLU 194 ? OE2 ? B GLU 206 OE2 
170 1 Y 1 B GLN 197 ? CG  ? B GLN 209 CG  
171 1 Y 1 B GLN 197 ? CD  ? B GLN 209 CD  
172 1 Y 1 B GLN 197 ? OE1 ? B GLN 209 OE1 
173 1 Y 1 B GLN 197 ? NE2 ? B GLN 209 NE2 
174 1 Y 1 B ARG 199 ? CG  ? B ARG 211 CG  
175 1 Y 1 B ARG 199 ? CD  ? B ARG 211 CD  
176 1 Y 1 B ARG 199 ? NE  ? B ARG 211 NE  
177 1 Y 1 B ARG 199 ? CZ  ? B ARG 211 CZ  
178 1 Y 1 B ARG 199 ? NH1 ? B ARG 211 NH1 
179 1 Y 1 B ARG 199 ? NH2 ? B ARG 211 NH2 
180 1 Y 1 B LYS 201 ? CE  ? B LYS 213 CE  
181 1 Y 1 B LYS 201 ? NZ  ? B LYS 213 NZ  
182 1 Y 1 B GLU 233 ? CG  ? B GLU 245 CG  
183 1 Y 1 B GLU 233 ? CD  ? B GLU 245 CD  
184 1 Y 1 B GLU 233 ? OE1 ? B GLU 245 OE1 
185 1 Y 1 B GLU 233 ? OE2 ? B GLU 245 OE2 
186 1 Y 1 B LYS 238 ? CG  ? B LYS 250 CG  
187 1 Y 1 B LYS 238 ? CD  ? B LYS 250 CD  
188 1 Y 1 B LYS 238 ? CE  ? B LYS 250 CE  
189 1 Y 1 B LYS 238 ? NZ  ? B LYS 250 NZ  
190 1 Y 1 B LYS 275 ? CG  ? B LYS 287 CG  
191 1 Y 1 B LYS 275 ? CD  ? B LYS 287 CD  
192 1 Y 1 B LYS 275 ? CE  ? B LYS 287 CE  
193 1 Y 1 B LYS 275 ? NZ  ? B LYS 287 NZ  
194 1 Y 1 B GLU 297 ? CG  ? B GLU 309 CG  
195 1 Y 1 B GLU 297 ? CD  ? B GLU 309 CD  
196 1 Y 1 B GLU 297 ? OE1 ? B GLU 309 OE1 
197 1 Y 1 B GLU 297 ? OE2 ? B GLU 309 OE2 
198 1 Y 1 B LEU 301 ? CG  ? B LEU 313 CG  
199 1 Y 1 B LEU 301 ? CD1 ? B LEU 313 CD1 
200 1 Y 1 B LEU 301 ? CD2 ? B LEU 313 CD2 
201 1 Y 1 B GLU 308 ? CG  ? B GLU 320 CG  
202 1 Y 1 B GLU 308 ? CD  ? B GLU 320 CD  
203 1 Y 1 B GLU 308 ? OE1 ? B GLU 320 OE1 
204 1 Y 1 B GLU 308 ? OE2 ? B GLU 320 OE2 
205 1 Y 1 B GLN 334 ? CG  ? B GLN 346 CG  
206 1 Y 1 B GLN 334 ? CD  ? B GLN 346 CD  
207 1 Y 1 B GLN 334 ? OE1 ? B GLN 346 OE1 
208 1 Y 1 B GLN 334 ? NE2 ? B GLN 346 NE2 
209 1 Y 1 B GLU 344 ? CG  ? B GLU 356 CG  
210 1 Y 1 B GLU 344 ? CD  ? B GLU 356 CD  
211 1 Y 1 B GLU 344 ? OE1 ? B GLU 356 OE1 
212 1 Y 1 B GLU 344 ? OE2 ? B GLU 356 OE2 
213 1 Y 1 B LYS 347 ? CG  ? B LYS 359 CG  
214 1 Y 1 B LYS 347 ? CD  ? B LYS 359 CD  
215 1 Y 1 B LYS 347 ? CE  ? B LYS 359 CE  
216 1 Y 1 B LYS 347 ? NZ  ? B LYS 359 NZ  
217 1 Y 1 B ARG 356 ? CG  ? B ARG 368 CG  
218 1 Y 1 B ARG 356 ? CD  ? B ARG 368 CD  
219 1 Y 1 B ARG 356 ? NE  ? B ARG 368 NE  
220 1 Y 1 B ARG 356 ? CZ  ? B ARG 368 CZ  
221 1 Y 1 B ARG 356 ? NH1 ? B ARG 368 NH1 
222 1 Y 1 B ARG 356 ? NH2 ? B ARG 368 NH2 
223 1 Y 1 B MET 357 ? CG  ? B MET 369 CG  
224 1 Y 1 B MET 357 ? SD  ? B MET 369 SD  
225 1 Y 1 B MET 357 ? CE  ? B MET 369 CE  
226 1 Y 1 B ARG 358 ? CG  ? B ARG 370 CG  
227 1 Y 1 B ARG 358 ? CD  ? B ARG 370 CD  
228 1 Y 1 B ARG 358 ? NE  ? B ARG 370 NE  
229 1 Y 1 B ARG 358 ? CZ  ? B ARG 370 CZ  
230 1 Y 1 B ARG 358 ? NH1 ? B ARG 370 NH1 
231 1 Y 1 B ARG 358 ? NH2 ? B ARG 370 NH2 
232 1 Y 1 B HIS 361 ? CG  ? B HIS 373 CG  
233 1 Y 1 B HIS 361 ? ND1 ? B HIS 373 ND1 
234 1 Y 1 B HIS 361 ? CD2 ? B HIS 373 CD2 
235 1 Y 1 B HIS 361 ? CE1 ? B HIS 373 CE1 
236 1 Y 1 B HIS 361 ? NE2 ? B HIS 373 NE2 
237 1 Y 1 B THR 419 ? OG1 ? B THR 431 OG1 
238 1 Y 1 B THR 419 ? CG2 ? B THR 431 CG2 
239 1 Y 1 B LYS 424 ? CG  ? B LYS 436 CG  
240 1 Y 1 B LYS 424 ? CD  ? B LYS 436 CD  
241 1 Y 1 B LYS 424 ? CE  ? B LYS 436 CE  
242 1 Y 1 B LYS 424 ? NZ  ? B LYS 436 NZ  
243 1 Y 1 B GLN 428 ? CG  ? B GLN 440 CG  
244 1 Y 1 B GLN 428 ? CD  ? B GLN 440 CD  
245 1 Y 1 B GLN 428 ? OE1 ? B GLN 440 OE1 
246 1 Y 1 B GLN 428 ? NE2 ? B GLN 440 NE2 
247 1 Y 1 B LEU 429 ? CG  ? B LEU 441 CG  
248 1 Y 1 B LEU 429 ? CD1 ? B LEU 441 CD1 
249 1 Y 1 B LEU 429 ? CD2 ? B LEU 441 CD2 
250 1 Y 1 P DG  805 ? P   ? C DG  4   P   
251 1 Y 1 P DG  805 ? OP1 ? C DG  4   OP1 
252 1 Y 1 P DG  805 ? OP2 ? C DG  4   OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A LYS 558 ? A LYS 559 
3  1 Y 1 A VAL 559 ? A VAL 560 
4  1 Y 1 A LEU 560 ? A LEU 561 
5  1 Y 1 B MET -11 ? B MET 1   
6  1 Y 1 B GLY -10 ? B GLY 2   
7  1 Y 1 B SER -9  ? B SER 3   
8  1 Y 1 B SER -8  ? B SER 4   
9  1 Y 1 B HIS -7  ? B HIS 5   
10 1 Y 1 B HIS -6  ? B HIS 6   
11 1 Y 1 B HIS -5  ? B HIS 7   
12 1 Y 1 B HIS -4  ? B HIS 8   
13 1 Y 1 B HIS -3  ? B HIS 9   
14 1 Y 1 B HIS -2  ? B HIS 10  
15 1 Y 1 B SER -1  ? B SER 11  
16 1 Y 1 B SER 0   ? B SER 12  
17 1 Y 1 B PRO 1   ? B PRO 13  
18 1 Y 1 B ILE 2   ? B ILE 14  
19 1 Y 1 B SER 3   ? B SER 15  
20 1 Y 1 B PRO 4   ? B PRO 16  
21 1 Y 1 B ILE 5   ? B ILE 17  
22 1 Y 1 B PHE 87  ? B PHE 99  
23 1 Y 1 B TRP 88  ? B TRP 100 
24 1 Y 1 B GLU 89  ? B GLU 101 
25 1 Y 1 B VAL 90  ? B VAL 102 
26 1 Y 1 B GLN 91  ? B GLN 103 
27 1 Y 1 B LEU 92  ? B LEU 104 
28 1 Y 1 B GLY 93  ? B GLY 105 
29 1 Y 1 B ILE 94  ? B ILE 106 
30 1 Y 1 B PRO 95  ? B PRO 107 
31 1 Y 1 B TRP 212 ? B TRP 224 
32 1 Y 1 B GLY 213 ? B GLY 225 
33 1 Y 1 B LEU 214 ? B LEU 226 
34 1 Y 1 B THR 215 ? B THR 227 
35 1 Y 1 B THR 216 ? B THR 228 
36 1 Y 1 B PRO 217 ? B PRO 229 
37 1 Y 1 B ASP 218 ? B ASP 230 
38 1 Y 1 B LYS 219 ? B LYS 231 
39 1 Y 1 B LYS 220 ? B LYS 232 
40 1 Y 1 B HIS 221 ? B HIS 233 
41 1 Y 1 B GLN 222 ? B GLN 234 
42 1 Y 1 B LYS 223 ? B LYS 235 
43 1 Y 1 B GLU 224 ? B GLU 236 
44 1 Y 1 B PRO 225 ? B PRO 237 
45 1 Y 1 B PRO 226 ? B PRO 238 
46 1 Y 1 B PHE 227 ? B PHE 239 
47 1 Y 1 B LEU 228 ? B LEU 240 
48 1 Y 1 B TRP 229 ? B TRP 241 
49 1 Y 1 B MET 230 ? B MET 242 
50 1 Y 1 B GLY 231 ? B GLY 243 
51 1 Y 1 B TYR 232 ? B TYR 244 
52 1 Y 1 B GLU 430 ? B GLU 442 
53 1 Y 1 B LYS 431 ? B LYS 443 
54 1 Y 1 B GLU 432 ? B GLU 444 
55 1 Y 1 B PRO 433 ? B PRO 445 
56 1 Y 1 B ILE 434 ? B ILE 446 
57 1 Y 1 B VAL 435 ? B VAL 447 
58 1 Y 1 B GLY 436 ? B GLY 448 
59 1 Y 1 B ALA 437 ? B ALA 449 
60 1 Y 1 B GLU 438 ? B GLU 450 
61 1 Y 1 B THR 439 ? B THR 451 
62 1 Y 1 B PHE 440 ? B PHE 452 
63 1 Y 1 P DA  802 ? C DA  1   
64 1 Y 1 P DC  803 ? C DC  2   
65 1 Y 1 P DA  804 ? C DA  3   
66 1 Y 1 T DA  701 ? D DA  1   
67 1 Y 1 T DT  702 ? D DT  2   
68 1 Y 1 T DT  726 ? D DT  26  
69 1 Y 1 T DG  727 ? D DG  27  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6WPJ 'double helix'        
6WPJ 'a-form double helix' 
6WPJ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG  4  1_555 D DC 23 1_555 -0.274 -0.144 -0.138 -2.506 -7.766  -2.378 1  P_DG805:DC723_T  P 805 ? T 723 ? 19 1 
1 C DT  5  1_555 D DA 22 1_555 -0.130 -0.151 -0.117 -1.760 -9.442  2.946  2  P_DT806:DA722_T  P 806 ? T 722 ? 20 1 
1 C DC  6  1_555 D DG 21 1_555 0.093  -0.096 -0.106 -4.422 -3.052  -3.235 3  P_DC807:DG721_T  P 807 ? T 721 ? 19 1 
1 C DC  7  1_555 D DG 20 1_555 0.171  -0.098 0.018  -6.060 -2.432  1.732  4  P_DC808:DG720_T  P 808 ? T 720 ? 19 1 
1 C DC  8  1_555 D DG 19 1_555 0.212  -0.137 0.095  3.593  -2.589  -0.387 5  P_DC809:DG719_T  P 809 ? T 719 ? 19 1 
1 C DT  9  1_555 D DA 18 1_555 0.137  -0.142 0.179  6.421  -4.906  7.423  6  P_DT810:DA718_T  P 810 ? T 718 ? 20 1 
1 C DG  10 1_555 D DC 17 1_555 -0.221 -0.201 0.275  -0.890 -15.132 0.465  7  P_DG811:DC717_T  P 811 ? T 717 ? 19 1 
1 C DT  11 1_555 D DA 16 1_555 -0.186 -0.123 -0.089 -2.698 -9.996  -3.711 8  P_DT812:DA716_T  P 812 ? T 716 ? 20 1 
1 C DT  12 1_555 D DA 15 1_555 -0.030 -0.180 -0.117 -1.663 -8.588  4.781  9  P_DT813:DA715_T  P 813 ? T 715 ? 20 1 
1 C DC  13 1_555 D DG 14 1_555 0.172  -0.154 -0.050 -6.462 -2.958  1.548  10 P_DC814:DG714_T  P 814 ? T 714 ? 19 1 
1 C DG  14 1_555 D DC 13 1_555 -0.207 -0.174 0.192  -3.812 -2.326  -0.822 11 P_DG815:DC713_T  P 815 ? T 713 ? 19 1 
1 C DG  15 1_555 D DC 12 1_555 -0.171 -0.076 0.269  -4.905 0.381   4.880  12 P_DG816:DC712_T  P 816 ? T 712 ? 19 1 
1 C G47 16 1_555 D DC 11 1_555 -0.878 0.039  -0.191 -1.278 -6.532  7.733  13 P_G47817:DC711_T P 817 ? T 711 ? 19 1 
1 C DC  17 1_555 D DG 10 1_555 0.171  -0.218 0.041  5.183  -11.500 0.218  14 P_DC818:DG710_T  P 818 ? T 710 ? 19 1 
1 C DG  18 1_555 D DC 9  1_555 -0.236 -0.134 -0.154 -6.230 -10.311 0.856  15 P_DG819:DC709_T  P 819 ? T 709 ? 19 1 
1 C DC  19 1_555 D DG 8  1_555 0.153  -0.155 -0.384 -5.022 -9.314  4.390  16 P_DC820:DG708_T  P 820 ? T 708 ? 19 1 
1 C DC  20 1_555 D DG 7  1_555 0.213  -0.152 -0.125 -7.471 -1.863  -0.582 17 P_DC821:DG707_T  P 821 ? T 707 ? 19 1 
1 C DDG 21 1_555 D DC 6  1_555 0.415  -0.166 0.258  10.078 -0.116  1.635  18 P_DDG822:DC706_T P 822 ? T 706 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG  4  1_555 D DC 23 1_555 C DT  5  1_555 D DA 22 1_555 -0.146 -0.634 3.273 2.949  1.312  43.253 -0.985 0.483  3.237 1.777  
-3.995 43.367 1  PP_DG805DT806:DA722DC723_TT  P 805 ? T 723 ? P 806 ? T 722 ? 
1 C DT  5  1_555 D DA 22 1_555 C DC  6  1_555 D DG 21 1_555 -0.050 -0.132 3.412 2.148  2.591  35.207 -0.615 0.412  3.386 4.272  
-3.542 35.362 2  PP_DT806DC807:DG721DA722_TT  P 806 ? T 722 ? P 807 ? T 721 ? 
1 C DC  6  1_555 D DG 21 1_555 C DC  7  1_555 D DG 20 1_555 0.786  -0.568 3.261 3.062  6.733  33.923 -1.975 -0.853 3.151 11.372 
-5.171 34.697 3  PP_DC807DC808:DG720DG721_TT  P 807 ? T 721 ? P 808 ? T 720 ? 
1 C DC  7  1_555 D DG 20 1_555 C DC  8  1_555 D DG 19 1_555 0.408  -0.187 3.170 0.859  7.168  33.242 -1.426 -0.565 3.073 12.349 
-1.479 33.995 4  PP_DC808DC809:DG719DG720_TT  P 808 ? T 720 ? P 809 ? T 719 ? 
1 C DC  8  1_555 D DG 19 1_555 C DT  9  1_555 D DA 18 1_555 0.468  -0.441 3.185 1.999  4.380  28.767 -1.801 -0.507 3.110 8.739  
-3.988 29.159 5  PP_DC809DT810:DA718DG719_TT  P 809 ? T 719 ? P 810 ? T 718 ? 
1 C DT  9  1_555 D DA 18 1_555 C DG  10 1_555 D DC 17 1_555 -0.228 -0.534 3.292 -3.869 11.466 37.437 -2.146 -0.117 3.015 17.318 
5.844  39.277 6  PP_DT810DG811:DC717DA718_TT  P 810 ? T 718 ? P 811 ? T 717 ? 
1 C DG  10 1_555 D DC 17 1_555 C DT  11 1_555 D DA 16 1_555 -0.876 -0.629 3.372 2.572  -0.585 32.344 -1.020 2.029  3.305 -1.048 
-4.608 32.449 7  PP_DG811DT812:DA716DC717_TT  P 811 ? T 717 ? P 812 ? T 716 ? 
1 C DT  11 1_555 D DA 16 1_555 C DT  12 1_555 D DA 15 1_555 0.172  -0.085 3.342 0.747  2.038  35.089 -0.451 -0.172 3.335 3.377  
-1.237 35.154 8  PP_DT812DT813:DA715DA716_TT  P 812 ? T 716 ? P 813 ? T 715 ? 
1 C DT  12 1_555 D DA 15 1_555 C DC  13 1_555 D DG 14 1_555 0.343  0.232  3.394 -0.258 3.453  37.491 -0.107 -0.567 3.399 5.359  
0.401  37.645 9  PP_DT813DC814:DG714DA715_TT  P 813 ? T 715 ? P 814 ? T 714 ? 
1 C DC  13 1_555 D DG 14 1_555 C DG  14 1_555 D DC 13 1_555 -0.135 0.157  3.314 -3.578 4.741  30.530 -0.633 -0.447 3.295 8.897  
6.716  31.089 10 PP_DC814DG815:DC713DG714_TT  P 814 ? T 714 ? P 815 ? T 713 ? 
1 C DG  14 1_555 D DC 13 1_555 C DG  15 1_555 D DC 12 1_555 0.112  -0.180 3.263 -4.715 6.108  35.665 -1.128 -0.827 3.151 9.831  
7.589  36.463 11 PP_DG815DG816:DC712DC713_TT  P 815 ? T 713 ? P 816 ? T 712 ? 
1 C DG  15 1_555 D DC 12 1_555 C G47 16 1_555 D DC 11 1_555 -0.105 -0.568 3.193 0.360  8.792  29.052 -2.771 0.270  2.899 17.039 
-0.697 30.328 12 PP_DG816G47817:DC711DC712_TT P 816 ? T 712 ? P 817 ? T 711 ? 
1 C G47 16 1_555 D DC 11 1_555 C DC  17 1_555 D DG 10 1_555 -0.162 -0.935 3.176 -2.112 8.860  35.357 -2.648 -0.016 2.871 14.297 
3.409  36.475 13 PP_G47817DC818:DG710DC711_TT P 817 ? T 711 ? P 818 ? T 710 ? 
1 C DC  17 1_555 D DG 10 1_555 C DG  18 1_555 D DC 9  1_555 -0.185 -1.430 3.499 1.321  10.915 34.076 -3.911 0.492  2.909 18.052 
-2.185 35.756 14 PP_DC818DG819:DC709DG710_TT  P 818 ? T 710 ? P 819 ? T 709 ? 
1 C DG  18 1_555 D DC 9  1_555 C DC  19 1_555 D DG 8  1_555 0.340  -0.872 3.366 0.102  12.628 31.582 -3.482 -0.565 2.821 22.127 
-0.179 33.954 15 PP_DG819DC820:DG708DC709_TT  P 819 ? T 709 ? P 820 ? T 708 ? 
1 C DC  19 1_555 D DG 8  1_555 C DC  20 1_555 D DG 7  1_555 -0.005 -1.248 3.495 0.412  8.956  30.302 -3.984 0.087  3.012 16.680 
-0.767 31.570 16 PP_DC820DC821:DG707DG708_TT  P 820 ? T 708 ? P 821 ? T 707 ? 
1 C DC  20 1_555 D DG 7  1_555 C DDG 21 1_555 D DC 6  1_555 0.535  -0.912 2.924 -1.909 10.369 29.162 -3.396 -1.313 2.426 19.795 
3.644  30.971 17 PP_DC821DDG822:DC706DG707_TT P 821 ? T 707 ? P 822 ? T 706 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049551 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 DDG ? ? DDG ? ? 'SUBJECT OF INVESTIGATION' ? 
2 D4T ? ? D4T ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 
;2',3'-DEHYDRO-2',3'-DEOXY-THYMIDINE 5'-TRIPHOSPHATE
;
D4T 
6 'MAGNESIUM ION'                                       MG  
7 'SULFATE ION'                                         SO4 
8 water                                                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'C 2 2 21' 
_space_group.name_Hall        'C 2c 2' 
_space_group.IT_number        20 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 x,-y,-z             
3 -x,y,-z+1/2         
4 -x,-y,z+1/2         
5 x+1/2,y+1/2,z       
6 x+1/2,-y+1/2,-z     
7 -x+1/2,y+1/2,-z+1/2 
8 -x+1/2,-y+1/2,z+1/2 
#