data_6WUY
# 
_entry.id   6WUY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WUY         
WWPDB D_1000249034 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          6WUV 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WUY 
_pdbx_database_status.recvd_initial_deposition_date   2020-05-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'McGuire, J.R.' 1 ? 
'Bester, S.M.'  2 ? 
'Pegan, S.D.'   3 ? 
'Height, J.J.'  4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Chem.Res.Toxicol. 
_citation.journal_id_ASTM           CRTOEC 
_citation.journal_id_CSD            2140 
_citation.journal_id_ISSN           0893-228X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            34 
_citation.language                  ? 
_citation.page_first                804 
_citation.page_last                 816 
_citation.title                     
;Structural and Biochemical Insights into the Inhibition of Human Acetylcholinesterase by G-Series Nerve Agents and Subsequent Reactivation by HI-6.
;
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.chemrestox.0c00406 
_citation.pdbx_database_id_PubMed   33538594 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'McGuire, J.R.'    1  ? 
primary 'Bester, S.M.'     2  ? 
primary 'Guelta, M.A.'     3  ? 
primary 'Cheung, J.'       4  ? 
primary 'Langley, C.'      5  ? 
primary 'Winemiller, M.D.' 6  ? 
primary 'Bae, S.Y.'        7  ? 
primary 'Funk, V.'         8  ? 
primary 'Myslinski, J.M.'  9  ? 
primary 'Pegan, S.D.'      10 ? 
primary 'Height, J.J.'     11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WUY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.331 
_cell.length_a_esd                 ? 
_cell.length_b                     105.331 
_cell.length_b_esd                 ? 
_cell.length_c                     324.866 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WUY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? ? ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ? ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ?       
? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ? ? 
5 non-polymer syn 'ethoxy-~{N},~{N}-dimethyl-phosphonamidic acid' 153.117   2   ?       ? ? ? 
6 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
? ? 
7 water       nat water 18.015    273 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WUY A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6WUY B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                                        
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                                                       
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                                     
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                                                
? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                                                       
? 'C3 H7 N O2 S'    121.158 
ELT non-polymer                   . 'ethoxy-~{N},~{N}-dimethyl-phosphonamidic acid'                                                
? 'C4 H12 N O3 P'   153.117 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                                           
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'       164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                                                      
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                                                
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                                                        
? 'C2 H5 N O2'      75.067  
HI6 non-polymer                   . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'           y HISTIDINE                                                                                      
? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                                                                          
? 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                                                     
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                                        
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                                                         
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                                                                     
? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                                                  
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                                                        
? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                                                         
? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'           y THREONINE                                                                                      
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                                     
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                                       
? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                                                         
? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WUY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.89 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.435 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, KNO3' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-08-11 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            55.530 
_reflns.entry_id                         6WUY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.460 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       77513 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.000 
_reflns.pdbx_Rmerge_I_obs                0.071 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.400 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.749 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.078 
_reflns.pdbx_Rpim_I_all                  0.031 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.460 2.500  ? ? ? ? ? ? 3788 99.400  ? ? ? ? 0.639 ? ? ? ? ? ? ? ? 5.200 ? 0.606 ? ? 0.710 0.306 ? 1  1 0.896 ? ? 
2.500 2.550  ? ? ? ? ? ? 3810 99.900  ? ? ? ? 0.614 ? ? ? ? ? ? ? ? 6.000 ? 0.589 ? ? 0.672 0.272 ? 2  1 0.931 ? ? 
2.550 2.600  ? ? ? ? ? ? 3828 100.000 ? ? ? ? 0.539 ? ? ? ? ? ? ? ? 6.100 ? 0.610 ? ? 0.590 0.237 ? 3  1 0.951 ? ? 
2.600 2.650  ? ? ? ? ? ? 3858 100.000 ? ? ? ? 0.463 ? ? ? ? ? ? ? ? 6.100 ? 0.651 ? ? 0.507 0.205 ? 4  1 0.962 ? ? 
2.650 2.710  ? ? ? ? ? ? 3837 100.000 ? ? ? ? 0.463 ? ? ? ? ? ? ? ? 6.000 ? 0.896 ? ? 0.508 0.207 ? 5  1 0.956 ? ? 
2.710 2.770  ? ? ? ? ? ? 3809 100.000 ? ? ? ? 0.330 ? ? ? ? ? ? ? ? 6.100 ? 0.715 ? ? 0.361 0.146 ? 6  1 0.976 ? ? 
2.770 2.840  ? ? ? ? ? ? 3824 100.000 ? ? ? ? 0.273 ? ? ? ? ? ? ? ? 6.000 ? 0.734 ? ? 0.299 0.121 ? 7  1 0.980 ? ? 
2.840 2.920  ? ? ? ? ? ? 3859 99.900  ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 6.000 ? 0.776 ? ? 0.239 0.097 ? 8  1 0.988 ? ? 
2.920 3.000  ? ? ? ? ? ? 3844 99.900  ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 6.000 ? 0.795 ? ? 0.193 0.079 ? 9  1 0.992 ? ? 
3.000 3.100  ? ? ? ? ? ? 3857 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 6.000 ? 0.879 ? ? 0.155 0.063 ? 10 1 0.994 ? ? 
3.100 3.210  ? ? ? ? ? ? 3847 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 6.100 ? 0.882 ? ? 0.134 0.054 ? 11 1 0.995 ? ? 
3.210 3.340  ? ? ? ? ? ? 3838 99.900  ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 6.200 ? 0.934 ? ? 0.114 0.046 ? 12 1 0.994 ? ? 
3.340 3.490  ? ? ? ? ? ? 3877 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 6.200 ? 1.028 ? ? 0.113 0.045 ? 13 1 0.996 ? ? 
3.490 3.670  ? ? ? ? ? ? 3890 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 6.200 ? 0.862 ? ? 0.092 0.037 ? 14 1 0.996 ? ? 
3.670 3.900  ? ? ? ? ? ? 3856 99.800  ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 6.200 ? 0.812 ? ? 0.079 0.032 ? 15 1 0.997 ? ? 
3.900 4.210  ? ? ? ? ? ? 3900 99.400  ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 6.100 ? 0.644 ? ? 0.063 0.025 ? 16 1 0.997 ? ? 
4.210 4.630  ? ? ? ? ? ? 3902 99.600  ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 6.100 ? 0.616 ? ? 0.058 0.023 ? 17 1 0.998 ? ? 
4.630 5.300  ? ? ? ? ? ? 3935 99.500  ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 6.100 ? 0.598 ? ? 0.056 0.023 ? 18 1 0.997 ? ? 
5.300 6.670  ? ? ? ? ? ? 4004 99.900  ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 6.000 ? 0.688 ? ? 0.048 0.020 ? 19 1 0.998 ? ? 
6.670 50.000 ? ? ? ? ? ? 4150 98.500  ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 5.700 ? 0.643 ? ? 0.038 0.016 ? 20 1 0.999 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                152.130 
_refine.B_iso_mean                               66.1735 
_refine.B_iso_min                                30.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WUY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.460 
_refine.ls_d_res_low                             41.3640 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     77310 
_refine.ls_number_reflns_R_free                  3770 
_refine.ls_number_reflns_R_work                  73540 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.5000 
_refine.ls_percent_reflns_R_free                 4.8800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1807 
_refine.ls_R_factor_R_free                       0.2144 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1790 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.5400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.460 
_refine_hist.d_res_low                        41.3640 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               8720 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1061 
_refine_hist.pdbx_B_iso_mean_ligand           109.40 
_refine_hist.pdbx_B_iso_mean_solvent          63.19 
_refine_hist.pdbx_number_atoms_protein        8250 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         197 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005 ? 8847  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.896 ? 12120 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.053 ? 1303  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 1587  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 7.404 ? 7018  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.460  2.4832  . . 134 2543 95.0000  . . . 0.3600 0.0000 0.2899 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4832 2.5158  . . 142 2695 100.0000 . . . 0.2982 0.0000 0.2638 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5158 2.5503  . . 138 2709 100.0000 . . . 0.2959 0.0000 0.2443 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5503 2.5867  . . 134 2665 100.0000 . . . 0.2771 0.0000 0.2400 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5867 2.6253  . . 140 2716 100.0000 . . . 0.2731 0.0000 0.2345 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6253 2.6663  . . 140 2644 99.0000  . . . 0.3110 0.0000 0.2413 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6663 2.7101  . . 167 2689 100.0000 . . . 0.2865 0.0000 0.2431 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7101 2.7568  . . 158 2676 100.0000 . . . 0.2877 0.0000 0.2312 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7568 2.8069  . . 138 2695 100.0000 . . . 0.2732 0.0000 0.2318 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8069 2.8609  . . 145 2695 100.0000 . . . 0.3131 0.0000 0.2264 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8609 2.9192  . . 146 2700 100.0000 . . . 0.2878 0.0000 0.2353 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9192 2.9827  . . 131 2706 100.0000 . . . 0.2907 0.0000 0.2281 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9827 3.0521  . . 142 2701 100.0000 . . . 0.2738 0.0000 0.2215 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0521 3.1284  . . 120 2734 100.0000 . . . 0.3171 0.0000 0.2124 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1284 3.2129  . . 126 2738 100.0000 . . . 0.2810 0.0000 0.2072 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2129 3.3074  . . 135 2714 100.0000 . . . 0.2387 0.0000 0.2072 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3074 3.4141  . . 149 2709 100.0000 . . . 0.2228 0.0000 0.2030 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4141 3.5361  . . 114 2755 100.0000 . . . 0.2642 0.0000 0.2004 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5361 3.6776  . . 119 2737 100.0000 . . . 0.2352 0.0000 0.1773 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6776 3.8449  . . 158 2716 100.0000 . . . 0.2069 0.0000 0.1662 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8449 4.0474  . . 127 2777 99.0000  . . . 0.1809 0.0000 0.1504 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0474 4.3007  . . 130 2721 100.0000 . . . 0.1604 0.0000 0.1462 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3007 4.6324  . . 159 2752 100.0000 . . . 0.1580 0.0000 0.1302 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6324 5.0978  . . 148 2771 99.0000  . . . 0.1683 0.0000 0.1350 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0978 5.8337  . . 165 2783 100.0000 . . . 0.1860 0.0000 0.1554 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.8337 7.3432  . . 124 2850 100.0000 . . . 0.1956 0.0000 0.1709 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.3432 41.3640 . . 141 2949 98.0000  . . . 0.1745 0.0000 0.1657 . . . . . . . . . . . 
# 
_struct.entry_id                     6WUY 
_struct.title                        'Crystal Structure of Recombinant Human Acetylcholinesterase In Complex with GA and HI-6' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WUY 
_struct_keywords.text            'nerve agent, acetylcholinesterase, tabun, GA, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 239 ? VAL A 254 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASP A 265 ? ARG A 275 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? TRP A 285 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 AB5 HIS A 286 ? LEU A 288 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 AB6 THR A 310 ? GLY A 318 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 AB7 GLY A 334 ? GLY A 341 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 LEU A 372 ? THR A 382 ? LEU A 373 THR A 383 1 ? 11 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? ALA A 419 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 GLY B 153 ? LEU B 158 ? GLY B 154 LEU B 159 1 ? 6  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? SER B 214 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 MET B 240 ? GLY B 255 ? MET B 241 GLY B 256 1 ? 16 
HELX_P HELX_P38 AE2 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 THR B 310 ? GLY B 318 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 AE5 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 AE6 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 AE7 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 AE8 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 AE9 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 AF1 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 AF2 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 AF3 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P49 AF4 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 AF5 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 AF6 ARG B 533 ? ALA B 541 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
covale1 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale2 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale3 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale4 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.459 ? ?               
covale5 covale both ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.449 ? ?               
covale6 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -3.86 
2 PRO 257 A . ? PRO 258 A PRO 258 A ? PRO 259 A 1 0.69  
3 GLN 368 A . ? GLN 369 A VAL 369 A ? VAL 370 A 1 3.54  
4 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 4.72  
5 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -3.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
AA2 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA4 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA4 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA5 1  ILE B 19  ? LYS B 22  ? ILE B 20  LYS B 23  
AA5 2  PRO B 27  ? PRO B 35  ? PRO B 28  PRO B 36  
AA5 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA5 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA5 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA5 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA5 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA5 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA5 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA5 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA5 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA6 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA6 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
AA7 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
AA7 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 11  ? N VAL A 12  O GLY A 14  ? O GLY A 15  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 144 ? O VAL A 145 N LEU A 114 ? N LEU A 115 
AA2 5  6  N VAL A 113 ? N VAL A 114 O SER A 195 ? O SER A 196 
AA2 6  7  N LEU A 198 ? N LEU A 199 O ARG A 223 ? O ARG A 224 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA4 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA5 1  2  N ILE B 19  ? N ILE B 20  O ALA B 30  ? O ALA B 31  
AA5 2  3  N SER B 29  ? N SER B 30  O THR B 102 ? O THR B 103 
AA5 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA5 4  5  O VAL B 146 ? O VAL B 147 N TRP B 116 ? N TRP B 117 
AA5 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA5 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
AA5 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA5 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA5 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA5 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA6 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
AA7 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    6WUY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009494 
_atom_sites.fract_transf_matrix[1][2]   0.005481 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010963 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003078 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 54.703  55.960 394.613 1.00 108.34 ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 54.472  55.681 393.201 1.00 106.65 ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 55.753  55.204 392.520 1.00 104.61 ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 56.822  55.182 393.131 1.00 109.74 ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 53.923  56.920 392.488 1.00 106.62 ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 52.454  56.808 392.097 1.00 128.04 ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 51.976  57.975 391.249 1.00 128.10 ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? 52.576  58.225 390.181 1.00 105.75 ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? 50.994  58.639 391.646 1.00 133.53 ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 55.636  54.825 391.250 1.00 99.60  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 56.749  54.288 390.478 1.00 93.73  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 57.403  55.412 389.680 1.00 87.01  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 56.773  55.991 388.789 1.00 82.25  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 56.269  53.174 389.549 1.00 64.89  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 57.393  52.269 389.097 1.00 84.52  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 58.568  52.688 389.186 1.00 89.58  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 57.101  51.136 388.653 1.00 81.66  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 58.665  55.714 389.999 1.00 86.56  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 59.376  56.780 389.301 1.00 84.65  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 59.661  56.430 387.848 1.00 89.52  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 59.832  57.338 387.027 1.00 75.21  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 60.688  57.108 390.018 1.00 74.61  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 59.725  55.138 387.516 1.00 80.26  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 59.939  54.745 386.129 1.00 73.10  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 58.771  55.158 385.248 1.00 75.90  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 58.951  55.396 384.048 1.00 65.99  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 60.159  53.236 386.041 1.00 69.39  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 61.402  52.758 386.756 1.00 66.26  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 62.674  53.302 386.133 1.00 88.64  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 62.704  53.492 384.896 1.00 77.17  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 63.644  53.540 386.884 1.00 89.92  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 57.577  55.256 385.822 1.00 59.13  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 56.372  55.581 385.079 1.00 62.48  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 56.059  57.069 385.074 1.00 56.10  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 54.961  57.457 384.661 1.00 65.63  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 55.189  54.799 385.646 1.00 59.35  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 55.392  53.285 385.604 1.00 67.92  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 54.217  52.591 386.269 1.00 68.01  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 55.597  52.787 384.166 1.00 55.49  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 56.991  57.909 385.511 1.00 65.43  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 56.818  59.354 385.473 1.00 67.18  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 57.900  59.941 384.580 1.00 64.08  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 59.089  59.671 384.779 1.00 68.90  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 56.866  59.946 386.881 1.00 53.70  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 55.660  59.521 387.723 1.00 71.27  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 55.944  59.640 389.209 1.00 68.14  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 54.437  60.340 387.341 1.00 75.47  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 57.483  60.704 383.573 1.00 55.81  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 58.395  61.339 382.630 1.00 62.77  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 57.870  62.747 382.396 1.00 56.44  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 56.661  62.995 382.444 1.00 52.45  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 58.517  60.553 381.288 1.00 57.50  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 59.428  61.258 380.294 1.00 55.70  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 58.972  59.118 381.517 1.00 67.69  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 58.791  63.679 382.181 1.00 59.95  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 58.454  65.057 381.859 1.00 51.71  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 58.905  65.343 380.437 1.00 56.12  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 60.053  65.065 380.075 1.00 64.84  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 59.109  66.032 382.843 1.00 59.13  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 58.518  65.868 384.142 1.00 79.87  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 58.923  67.471 382.386 1.00 47.94  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 57.989  65.865 379.629 1.00 51.63  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 58.280  66.239 378.252 1.00 59.53  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 58.079  67.744 378.159 1.00 61.36  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 57.674  68.376 379.141 1.00 66.10  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 57.388  65.468 377.260 1.00 57.98  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 57.663  63.973 377.368 1.00 44.06  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 55.909  65.751 377.529 1.00 48.54  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 58.366  68.326 376.992 1.00 55.46  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 58.283  69.778 376.842 1.00 52.29  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 56.946  70.319 377.327 1.00 60.86  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 56.889  71.374 377.969 1.00 73.63  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 58.499  70.175 375.383 1.00 55.74  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 59.826  69.740 374.806 1.00 73.96  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 60.849  70.858 374.828 1.00 88.97  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 62.082  70.452 374.160 1.00 98.85  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 62.358  70.708 372.885 1.00 95.93  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 61.491  71.379 372.139 1.00 90.49  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 63.504  70.298 372.356 1.00 86.86  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 55.856  69.607 377.038 1.00 68.75  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 54.540  70.126 377.364 1.00 55.05  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 54.150  69.989 378.817 1.00 70.13  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 53.260  70.712 379.279 1.00 57.51  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 54.782  69.083 379.542 1.00 53.32  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 54.433  68.862 380.924 1.00 58.12  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 54.719  67.430 381.324 1.00 65.17  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 55.517  66.739 380.694 1.00 54.12  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 54.038  67.012 382.382 1.00 57.66  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 54.289  65.740 383.034 1.00 61.53  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 53.272  64.698 382.583 1.00 64.44  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? 52.109  65.014 382.312 1.00 50.27  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 54.233  65.907 384.556 1.00 71.04  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 55.265  66.887 385.109 1.00 80.46  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 55.170  67.015 386.630 1.00 77.82  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 53.998  67.778 387.052 1.00 77.39  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 53.356  67.589 388.199 1.00 79.19  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 53.767  66.655 389.046 1.00 77.98  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? 52.298  68.331 388.498 1.00 83.22  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 53.721  63.447 382.509 1.00 49.18  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 52.852  62.327 382.187 1.00 60.57  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 53.086  61.201 383.180 1.00 54.46  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 54.173  61.054 383.748 1.00 52.91  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 53.088  61.787 380.766 1.00 55.66  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 53.308  62.712 379.574 1.00 54.85  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 54.151  62.022 378.491 1.00 59.47  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? 51.966  63.113 379.020 1.00 63.52  ? 17  LEU A CD2 1 
ATOM   107  N N   . ARG A 1 17  ? 52.087  60.358 383.336 1.00 47.44  ? 18  ARG A N   1 
ATOM   108  C CA  . ARG A 1 17  ? 52.180  59.177 384.155 1.00 59.93  ? 18  ARG A CA  1 
ATOM   109  C C   . ARG A 1 17  ? 51.868  57.976 383.283 1.00 60.75  ? 18  ARG A C   1 
ATOM   110  O O   . ARG A 1 17  ? 50.852  57.934 382.692 1.00 52.52  ? 18  ARG A O   1 
ATOM   111  C CB  . ARG A 1 17  ? 51.197  59.211 385.291 1.00 56.80  ? 18  ARG A CB  1 
ATOM   112  C CG  . ARG A 1 17  ? 51.184  57.913 386.052 1.00 72.42  ? 18  ARG A CG  1 
ATOM   113  C CD  . ARG A 1 17  ? 50.121  57.905 387.110 1.00 91.96  ? 18  ARG A CD  1 
ATOM   114  N NE  . ARG A 1 17  ? 50.260  59.063 387.960 1.00 94.94  ? 18  ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 17  ? 49.402  60.063 387.970 1.00 106.57 ? 18  ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 17  ? 48.341  60.026 387.180 1.00 71.67  ? 18  ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 17  ? 49.615  61.090 388.769 1.00 93.67  ? 18  ARG A NH2 1 
ATOM   118  N N   . GLY A 1 18  ? 52.758  57.007 383.223 1.00 54.89  ? 19  GLY A N   1 
ATOM   119  C CA  . GLY A 1 18  ? 52.607  55.816 382.420 1.00 55.83  ? 19  GLY A CA  1 
ATOM   120  C C   . GLY A 1 18  ? 52.022  54.646 383.185 1.00 61.65  ? 19  GLY A C   1 
ATOM   121  O O   . GLY A 1 18  ? 51.408  54.800 384.246 1.00 70.40  ? 19  GLY A O   1 
ATOM   122  N N   . ILE A 1 19  ? 52.215  53.454 382.630 1.00 66.48  ? 20  ILE A N   1 
ATOM   123  C CA  . ILE A 1 19  ? 51.689  52.226 383.213 1.00 50.98  ? 20  ILE A CA  1 
ATOM   124  C C   . ILE A 1 19  ? 52.639  51.083 382.879 1.00 63.59  ? 20  ILE A C   1 
ATOM   125  O O   . ILE A 1 19  ? 53.194  51.015 381.777 1.00 66.13  ? 20  ILE A O   1 
ATOM   126  C CB  . ILE A 1 19  ? 50.255  51.931 382.720 1.00 54.20  ? 20  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 19  ? 49.680  50.709 383.438 1.00 55.96  ? 20  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 19  ? 50.221  51.723 381.198 1.00 58.35  ? 20  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 19  ? 48.253  50.394 383.033 1.00 47.45  ? 20  ILE A CD1 1 
ATOM   130  N N   . ARG A 1 20  ? 52.842  50.199 383.852 1.00 70.47  ? 21  ARG A N   1 
ATOM   131  C CA  . ARG A 1 20  ? 53.606  48.982 383.631 1.00 60.70  ? 21  ARG A CA  1 
ATOM   132  C C   . ARG A 1 20  ? 52.703  47.953 382.968 1.00 69.11  ? 21  ARG A C   1 
ATOM   133  O O   . ARG A 1 20  ? 51.553  47.771 383.382 1.00 62.60  ? 21  ARG A O   1 
ATOM   134  C CB  . ARG A 1 20  ? 54.148  48.442 384.956 1.00 69.13  ? 21  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 20  ? 55.642  48.169 384.970 1.00 55.72  ? 21  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 20  ? 56.111  47.638 386.332 1.00 75.45  ? 21  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 20  ? 55.484  48.318 387.466 1.00 85.03  ? 21  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 20  ? 54.625  47.739 388.298 1.00 84.14  ? 21  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 20  ? 54.279  46.470 388.114 1.00 68.79  ? 21  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 20  ? 54.101  48.428 389.305 1.00 93.56  ? 21  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 21  ? 53.209  47.307 381.922 1.00 56.77  ? 22  LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 52.495  46.243 381.235 1.00 59.78  ? 22  LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 53.306  44.962 381.329 1.00 58.09  ? 22  LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 54.537  44.997 381.401 1.00 67.63  ? 22  LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? 52.232  46.581 379.756 1.00 49.46  ? 22  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? 51.421  47.823 379.374 1.00 59.29  ? 22  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? 51.303  47.908 377.857 1.00 59.31  ? 22  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? 50.042  47.824 380.009 1.00 50.08  ? 22  LEU A CD2 1 
ATOM   149  N N   . LYS A 1 22  ? 52.629  43.836 381.308 1.00 70.07  ? 23  LYS A N   1 
ATOM   150  C CA  . LYS A 1 22  ? 53.277  42.551 381.402 1.00 72.43  ? 23  LYS A CA  1 
ATOM   151  C C   . LYS A 1 22  ? 53.512  41.834 380.105 1.00 60.51  ? 23  LYS A C   1 
ATOM   152  O O   . LYS A 1 22  ? 52.867  42.069 379.143 1.00 62.14  ? 23  LYS A O   1 
ATOM   153  C CB  . LYS A 1 22  ? 52.485  41.665 382.313 1.00 55.45  ? 23  LYS A CB  1 
ATOM   154  C CG  . LYS A 1 22  ? 52.260  42.282 383.654 1.00 81.96  ? 23  LYS A CG  1 
ATOM   155  C CD  . LYS A 1 22  ? 51.940  41.221 384.656 1.00 77.38  ? 23  LYS A CD  1 
ATOM   156  C CE  . LYS A 1 22  ? 50.566  40.707 384.375 1.00 76.13  ? 23  LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 22  ? 49.674  41.877 384.427 1.00 95.94  ? 23  LYS A NZ  1 
ATOM   158  N N   . THR A 1 23  ? 54.473  40.942 380.135 1.00 66.26  ? 24  THR A N   1 
ATOM   159  C CA  . THR A 1 23  ? 54.885  40.165 379.014 1.00 65.57  ? 24  THR A CA  1 
ATOM   160  C C   . THR A 1 23  ? 55.411  38.880 379.567 1.00 72.51  ? 24  THR A C   1 
ATOM   161  O O   . THR A 1 23  ? 55.891  38.830 380.664 1.00 71.54  ? 24  THR A O   1 
ATOM   162  C CB  . THR A 1 23  ? 56.020  40.902 378.279 1.00 60.85  ? 24  THR A CB  1 
ATOM   163  O OG1 . THR A 1 23  ? 55.455  41.901 377.454 1.00 61.06  ? 24  THR A OG1 1 
ATOM   164  C CG2 . THR A 1 23  ? 56.831  40.016 377.403 1.00 65.15  ? 24  THR A CG2 1 
ATOM   165  N N   . PRO A 1 24  ? 55.288  37.800 378.717 1.00 63.86  ? 25  PRO A N   1 
ATOM   166  C CA  . PRO A 1 24  ? 55.867  36.560 379.234 1.00 66.49  ? 25  PRO A CA  1 
ATOM   167  C C   . PRO A 1 24  ? 57.365  36.613 379.475 1.00 71.10  ? 25  PRO A C   1 
ATOM   168  O O   . PRO A 1 24  ? 57.878  35.742 380.100 1.00 79.46  ? 25  PRO A O   1 
ATOM   169  C CB  . PRO A 1 24  ? 55.488  35.507 378.223 1.00 62.17  ? 25  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 24  ? 55.052  36.210 377.044 1.00 60.14  ? 25  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 24  ? 54.439  37.442 377.503 1.00 55.04  ? 25  PRO A CD  1 
ATOM   172  N N   . GLY A 1 25  ? 58.044  37.616 378.974 1.00 57.88  ? 26  GLY A N   1 
ATOM   173  C CA  . GLY A 1 25  ? 59.445  37.903 379.215 1.00 68.98  ? 26  GLY A CA  1 
ATOM   174  C C   . GLY A 1 25  ? 59.751  39.024 380.186 1.00 65.62  ? 26  GLY A C   1 
ATOM   175  O O   . GLY A 1 25  ? 60.918  39.425 380.288 1.00 58.57  ? 26  GLY A O   1 
ATOM   176  N N   . GLY A 1 26  ? 58.767  39.545 380.920 1.00 58.60  ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 26  ? 59.009  40.634 381.840 1.00 65.41  ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 26  ? 58.256  41.890 381.451 1.00 63.00  ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 26  ? 57.693  41.987 380.365 1.00 76.79  ? 27  GLY A O   1 
ATOM   180  N N   . PRO A 1 27  ? 58.239  42.885 382.324 1.00 64.23  ? 28  PRO A N   1 
ATOM   181  C CA  . PRO A 1 27  ? 57.428  44.081 382.074 1.00 57.16  ? 28  PRO A CA  1 
ATOM   182  C C   . PRO A 1 27  ? 58.070  45.024 381.063 1.00 62.70  ? 28  PRO A C   1 
ATOM   183  O O   . PRO A 1 27  ? 59.235  44.896 380.685 1.00 52.21  ? 28  PRO A O   1 
ATOM   184  C CB  . PRO A 1 27  ? 57.347  44.734 383.454 1.00 55.48  ? 28  PRO A CB  1 
ATOM   185  C CG  . PRO A 1 27  ? 58.630  44.330 384.109 1.00 60.04  ? 28  PRO A CG  1 
ATOM   186  C CD  . PRO A 1 27  ? 58.935  42.942 383.618 1.00 46.94  ? 28  PRO A CD  1 
ATOM   187  N N   . VAL A 1 28  ? 57.261  45.981 380.606 1.00 48.08  ? 29  VAL A N   1 
ATOM   188  C CA  . VAL A 1 28  ? 57.731  47.142 379.860 1.00 50.88  ? 29  VAL A CA  1 
ATOM   189  C C   . VAL A 1 28  ? 56.895  48.329 380.319 1.00 47.74  ? 29  VAL A C   1 
ATOM   190  O O   . VAL A 1 28  ? 55.857  48.170 380.965 1.00 50.52  ? 29  VAL A O   1 
ATOM   191  C CB  . VAL A 1 28  ? 57.630  46.977 378.322 1.00 57.39  ? 29  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 28  ? 58.219  45.653 377.828 1.00 47.18  ? 29  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 28  ? 56.200  47.096 377.886 1.00 41.33  ? 29  VAL A CG2 1 
ATOM   194  N N   . SER A 1 29  ? 57.351  49.530 379.965 1.00 58.55  ? 30  SER A N   1 
ATOM   195  C CA  . SER A 1 29  ? 56.670  50.769 380.321 1.00 45.68  ? 30  SER A CA  1 
ATOM   196  C C   . SER A 1 29  ? 55.909  51.315 379.120 1.00 59.96  ? 30  SER A C   1 
ATOM   197  O O   . SER A 1 29  ? 56.443  51.357 378.005 1.00 49.61  ? 30  SER A O   1 
ATOM   198  C CB  . SER A 1 29  ? 57.665  51.816 380.818 1.00 52.01  ? 30  SER A CB  1 
ATOM   199  O OG  . SER A 1 29  ? 58.712  51.218 381.560 1.00 69.08  ? 30  SER A OG  1 
ATOM   200  N N   . ALA A 1 30  ? 54.674  51.746 379.353 1.00 59.07  ? 31  ALA A N   1 
ATOM   201  C CA  . ALA A 1 30  ? 53.832  52.320 378.315 1.00 49.78  ? 31  ALA A CA  1 
ATOM   202  C C   . ALA A 1 30  ? 53.461  53.743 378.684 1.00 60.18  ? 31  ALA A C   1 
ATOM   203  O O   . ALA A 1 30  ? 53.222  54.054 379.855 1.00 56.94  ? 31  ALA A O   1 
ATOM   204  C CB  . ALA A 1 30  ? 52.541  51.518 378.105 1.00 57.85  ? 31  ALA A CB  1 
ATOM   205  N N   . PHE A 1 31  ? 53.394  54.597 377.671 1.00 50.79  ? 32  PHE A N   1 
ATOM   206  C CA  . PHE A 1 31  ? 52.861  55.944 377.815 1.00 54.50  ? 32  PHE A CA  1 
ATOM   207  C C   . PHE A 1 31  ? 51.908  56.108 376.642 1.00 52.85  ? 32  PHE A C   1 
ATOM   208  O O   . PHE A 1 31  ? 52.324  56.419 375.523 1.00 60.09  ? 32  PHE A O   1 
ATOM   209  C CB  . PHE A 1 31  ? 53.972  56.972 377.844 1.00 56.52  ? 32  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 31  ? 54.935  56.763 378.973 1.00 59.29  ? 32  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 31  ? 56.005  55.888 378.840 1.00 55.58  ? 32  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 31  ? 54.754  57.421 380.178 1.00 51.85  ? 32  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 31  ? 56.883  55.689 379.878 1.00 50.32  ? 32  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 31  ? 55.633  57.226 381.227 1.00 58.38  ? 32  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 31  ? 56.696  56.360 381.078 1.00 56.89  ? 32  PHE A CZ  1 
ATOM   216  N N   . LEU A 1 32  ? 50.633  55.841 376.905 1.00 49.28  ? 33  LEU A N   1 
ATOM   217  C CA  . LEU A 1 32  ? 49.602  55.778 375.883 1.00 55.81  ? 33  LEU A CA  1 
ATOM   218  C C   . LEU A 1 32  ? 48.693  56.986 376.012 1.00 52.91  ? 33  LEU A C   1 
ATOM   219  O O   . LEU A 1 32  ? 48.331  57.382 377.122 1.00 53.67  ? 33  LEU A O   1 
ATOM   220  C CB  . LEU A 1 32  ? 48.777  54.496 376.014 1.00 47.46  ? 33  LEU A CB  1 
ATOM   221  C CG  . LEU A 1 32  ? 49.515  53.222 376.428 1.00 53.31  ? 33  LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 32  ? 48.523  52.087 376.649 1.00 54.80  ? 33  LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 32  ? 50.548  52.836 375.374 1.00 57.70  ? 33  LEU A CD2 1 
ATOM   224  N N   . GLY A 1 33  ? 48.316  57.565 374.879 1.00 44.79  ? 34  GLY A N   1 
ATOM   225  C CA  . GLY A 1 33  ? 47.437  58.715 374.913 1.00 41.33  ? 34  GLY A CA  1 
ATOM   226  C C   . GLY A 1 33  ? 48.128  60.024 375.213 1.00 49.85  ? 34  GLY A C   1 
ATOM   227  O O   . GLY A 1 33  ? 47.507  60.926 375.779 1.00 57.78  ? 34  GLY A O   1 
ATOM   228  N N   . ILE A 1 34  ? 49.401  60.155 374.854 1.00 48.17  ? 35  ILE A N   1 
ATOM   229  C CA  . ILE A 1 34  ? 50.112  61.424 374.976 1.00 44.78  ? 35  ILE A CA  1 
ATOM   230  C C   . ILE A 1 34  ? 49.587  62.385 373.914 1.00 48.03  ? 35  ILE A C   1 
ATOM   231  O O   . ILE A 1 34  ? 49.639  62.069 372.717 1.00 51.17  ? 35  ILE A O   1 
ATOM   232  C CB  . ILE A 1 34  ? 51.628  61.229 374.825 1.00 50.28  ? 35  ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 34  ? 52.139  60.142 375.772 1.00 51.92  ? 35  ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 34  ? 52.356  62.539 375.051 1.00 45.28  ? 35  ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 34  ? 53.573  59.738 375.481 1.00 45.83  ? 35  ILE A CD1 1 
ATOM   236  N N   . PRO A 1 35  ? 49.083  63.562 374.288 1.00 58.33  ? 36  PRO A N   1 
ATOM   237  C CA  . PRO A 1 35  ? 48.610  64.522 373.277 1.00 40.23  ? 36  PRO A CA  1 
ATOM   238  C C   . PRO A 1 35  ? 49.783  65.230 372.614 1.00 58.60  ? 36  PRO A C   1 
ATOM   239  O O   . PRO A 1 35  ? 50.633  65.811 373.292 1.00 53.61  ? 36  PRO A O   1 
ATOM   240  C CB  . PRO A 1 35  ? 47.747  65.493 374.090 1.00 55.29  ? 36  PRO A CB  1 
ATOM   241  C CG  . PRO A 1 35  ? 48.364  65.455 375.476 1.00 57.39  ? 36  PRO A CG  1 
ATOM   242  C CD  . PRO A 1 35  ? 48.903  64.056 375.668 1.00 52.69  ? 36  PRO A CD  1 
ATOM   243  N N   . PHE A 1 36  ? 49.844  65.167 371.282 1.00 52.62  ? 37  PHE A N   1 
ATOM   244  C CA  . PHE A 1 36  ? 50.890  65.869 370.555 1.00 54.34  ? 37  PHE A CA  1 
ATOM   245  C C   . PHE A 1 36  ? 50.369  67.022 369.710 1.00 58.96  ? 37  PHE A C   1 
ATOM   246  O O   . PHE A 1 36  ? 51.178  67.756 369.134 1.00 50.42  ? 37  PHE A O   1 
ATOM   247  C CB  . PHE A 1 36  ? 51.693  64.893 369.675 1.00 53.70  ? 37  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 36  ? 50.941  64.368 368.477 1.00 66.36  ? 37  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 36  ? 51.043  64.997 367.242 1.00 54.88  ? 37  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 36  ? 50.164  63.224 368.578 1.00 53.93  ? 37  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 36  ? 50.362  64.505 366.130 1.00 55.73  ? 37  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 36  ? 49.486  62.729 367.477 1.00 46.34  ? 37  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 36  ? 49.583  63.374 366.251 1.00 55.74  ? 37  PHE A CZ  1 
ATOM   254  N N   . ALA A 1 37  ? 49.055  67.219 369.640 1.00 51.53  ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 37  ? 48.488  68.340 368.912 1.00 50.05  ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 37  ? 47.284  68.886 369.664 1.00 47.06  ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 37  ? 46.653  68.188 370.462 1.00 51.69  ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 37  ? 48.071  67.942 367.487 1.00 57.48  ? 38  ALA A CB  1 
ATOM   259  N N   . GLU A 1 38  ? 46.975  70.151 369.399 1.00 56.14  ? 39  GLU A N   1 
ATOM   260  C CA  . GLU A 1 38  ? 45.693  70.692 369.817 1.00 58.57  ? 39  GLU A CA  1 
ATOM   261  C C   . GLU A 1 38  ? 44.578  69.937 369.100 1.00 63.12  ? 39  GLU A C   1 
ATOM   262  O O   . GLU A 1 38  ? 44.708  69.626 367.910 1.00 63.81  ? 39  GLU A O   1 
ATOM   263  C CB  . GLU A 1 38  ? 45.599  72.185 369.499 1.00 59.47  ? 39  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 38  ? 46.399  73.072 370.439 1.00 75.48  ? 39  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 38  ? 45.931  72.973 371.881 1.00 65.58  ? 39  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 38  ? 44.752  73.290 372.153 1.00 77.19  ? 39  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 38  ? 46.744  72.573 372.741 1.00 71.62  ? 39  GLU A OE2 1 
ATOM   268  N N   . PRO A 1 39  ? 43.500  69.676 369.776 1.00 68.91  ? 40  PRO A N   1 
ATOM   269  C CA  . PRO A 1 39  ? 42.444  68.929 369.142 1.00 56.61  ? 40  PRO A CA  1 
ATOM   270  C C   . PRO A 1 39  ? 41.965  69.658 367.945 1.00 69.51  ? 40  PRO A C   1 
ATOM   271  O O   . PRO A 1 39  ? 41.585  70.797 368.043 1.00 74.34  ? 40  PRO A O   1 
ATOM   272  C CB  . PRO A 1 39  ? 41.382  68.940 370.196 1.00 59.28  ? 40  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 39  ? 42.150  68.923 371.439 1.00 52.26  ? 40  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 39  ? 43.284  69.820 371.205 1.00 43.23  ? 40  PRO A CD  1 
ATOM   275  N N   . PRO A 1 40  ? 41.960  68.923 366.778 1.00 59.43  ? 41  PRO A N   1 
ATOM   276  C CA  . PRO A 1 40  ? 41.512  69.666 365.607 1.00 64.58  ? 41  PRO A CA  1 
ATOM   277  C C   . PRO A 1 40  ? 40.027  69.610 365.436 1.00 74.37  ? 41  PRO A C   1 
ATOM   278  O O   . PRO A 1 40  ? 39.527  68.891 364.617 1.00 69.46  ? 41  PRO A O   1 
ATOM   279  C CB  . PRO A 1 40  ? 42.225  68.982 364.475 1.00 56.94  ? 41  PRO A CB  1 
ATOM   280  C CG  . PRO A 1 40  ? 42.265  67.593 364.852 1.00 61.78  ? 41  PRO A CG  1 
ATOM   281  C CD  . PRO A 1 40  ? 42.310  67.513 366.319 1.00 56.71  ? 41  PRO A CD  1 
ATOM   282  N N   . MET A 1 41  ? 39.331  70.407 366.209 1.00 70.28  ? 42  MET A N   1 
ATOM   283  C CA  . MET A 1 41  ? 37.907  70.402 366.185 1.00 65.23  ? 42  MET A CA  1 
ATOM   284  C C   . MET A 1 41  ? 37.369  71.741 365.866 1.00 74.57  ? 42  MET A C   1 
ATOM   285  O O   . MET A 1 41  ? 38.086  72.698 365.852 1.00 64.16  ? 42  MET A O   1 
ATOM   286  C CB  . MET A 1 41  ? 37.396  69.992 367.527 1.00 75.60  ? 42  MET A CB  1 
ATOM   287  C CG  . MET A 1 41  ? 38.126  68.823 368.078 1.00 62.01  ? 42  MET A CG  1 
ATOM   288  S SD  . MET A 1 41  ? 37.072  68.027 369.248 1.00 103.07 ? 42  MET A SD  1 
ATOM   289  C CE  . MET A 1 41  ? 36.506  69.424 370.178 1.00 101.49 ? 42  MET A CE  1 
ATOM   290  N N   . GLY A 1 42  ? 36.091  71.773 365.569 1.00 55.82  ? 43  GLY A N   1 
ATOM   291  C CA  . GLY A 1 42  ? 35.425  73.007 365.233 1.00 60.84  ? 43  GLY A CA  1 
ATOM   292  C C   . GLY A 1 42  ? 36.101  73.721 364.081 1.00 77.06  ? 43  GLY A C   1 
ATOM   293  O O   . GLY A 1 42  ? 36.242  73.184 362.977 1.00 65.58  ? 43  GLY A O   1 
ATOM   294  N N   . PRO A 1 43  ? 36.556  74.952 364.329 1.00 74.53  ? 44  PRO A N   1 
ATOM   295  C CA  . PRO A 1 43  ? 37.259  75.700 363.277 1.00 62.99  ? 44  PRO A CA  1 
ATOM   296  C C   . PRO A 1 43  ? 38.592  75.088 362.883 1.00 78.86  ? 44  PRO A C   1 
ATOM   297  O O   . PRO A 1 43  ? 39.144  75.477 361.844 1.00 64.70  ? 44  PRO A O   1 
ATOM   298  C CB  . PRO A 1 43  ? 37.445  77.088 363.902 1.00 66.98  ? 44  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 43  ? 37.452  76.827 365.368 1.00 62.58  ? 44  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 43  ? 36.464  75.715 365.585 1.00 59.04  ? 44  PRO A CD  1 
ATOM   301  N N   . ARG A 1 44  ? 39.122  74.146 363.664 1.00 73.92  ? 45  ARG A N   1 
ATOM   302  C CA  . ARG A 1 44  ? 40.375  73.485 363.325 1.00 74.32  ? 45  ARG A CA  1 
ATOM   303  C C   . ARG A 1 44  ? 40.188  72.272 362.422 1.00 66.90  ? 45  ARG A C   1 
ATOM   304  O O   . ARG A 1 44  ? 41.184  71.700 361.968 1.00 60.27  ? 45  ARG A O   1 
ATOM   305  C CB  . ARG A 1 44  ? 41.116  73.071 364.600 1.00 58.95  ? 45  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 44  ? 41.874  74.216 365.247 1.00 83.70  ? 45  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 44  ? 42.882  73.727 366.271 1.00 92.86  ? 45  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 44  ? 44.023  74.633 366.375 1.00 114.46 ? 45  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 44  ? 44.202  75.500 367.367 1.00 107.45 ? 45  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 44  ? 43.313  75.584 368.347 1.00 91.08  ? 45  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 44  ? 45.272  76.285 367.376 1.00 110.95 ? 45  ARG A NH2 1 
ATOM   312  N N   . ARG A 1 45  ? 38.949  71.869 362.147 1.00 63.08  ? 46  ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? 38.714  70.781 361.208 1.00 70.52  ? 46  ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? 39.253  71.147 359.825 1.00 60.65  ? 46  ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? 39.079  72.272 359.349 1.00 57.57  ? 46  ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? 37.219  70.462 361.139 1.00 65.18  ? 46  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? 36.871  69.267 360.261 1.00 69.95  ? 46  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? 35.366  69.138 360.084 1.00 60.26  ? 46  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? 34.763  68.272 361.093 1.00 79.07  ? 46  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? 33.453  68.090 361.235 1.00 65.35  ? 46  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? 32.606  68.720 360.432 1.00 72.14  ? 46  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? 32.988  67.281 362.176 1.00 58.27  ? 46  ARG A NH2 1 
ATOM   323  N N   . PHE A 1 46  ? 39.931  70.186 359.193 1.00 53.65  ? 47  PHE A N   1 
ATOM   324  C CA  . PHE A 1 46  ? 40.652  70.303 357.923 1.00 63.67  ? 47  PHE A CA  1 
ATOM   325  C C   . PHE A 1 46  ? 41.890  71.194 358.001 1.00 66.98  ? 47  PHE A C   1 
ATOM   326  O O   . PHE A 1 46  ? 42.545  71.399 356.971 1.00 54.74  ? 47  PHE A O   1 
ATOM   327  C CB  . PHE A 1 46  ? 39.771  70.818 356.774 1.00 55.59  ? 47  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 46  ? 38.418  70.171 356.710 1.00 57.46  ? 47  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 46  ? 38.299  68.805 356.524 1.00 54.22  ? 47  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 46  ? 37.265  70.932 356.820 1.00 58.41  ? 47  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 46  ? 37.057  68.203 356.461 1.00 50.95  ? 47  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 46  ? 36.016  70.337 356.756 1.00 62.78  ? 47  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 46  ? 35.913  68.969 356.578 1.00 58.67  ? 47  PHE A CZ  1 
ATOM   334  N N   . LEU A 1 47  ? 42.241  71.726 359.170 1.00 57.49  ? 48  LEU A N   1 
ATOM   335  C CA  . LEU A 1 47  ? 43.406  72.590 359.226 1.00 63.37  ? 48  LEU A CA  1 
ATOM   336  C C   . LEU A 1 47  ? 44.646  71.812 359.653 1.00 64.05  ? 48  LEU A C   1 
ATOM   337  O O   . LEU A 1 47  ? 44.545  70.753 360.283 1.00 58.80  ? 48  LEU A O   1 
ATOM   338  C CB  . LEU A 1 47  ? 43.157  73.762 360.183 1.00 64.11  ? 48  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 47  ? 42.322  74.883 359.559 1.00 73.33  ? 48  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 47  ? 42.048  75.946 360.600 1.00 61.84  ? 48  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 47  ? 43.000  75.477 358.320 1.00 68.38  ? 48  LEU A CD2 1 
ATOM   342  N N   . PRO A 1 48  ? 45.835  72.290 359.283 1.00 54.90  ? 49  PRO A N   1 
ATOM   343  C CA  . PRO A 1 48  ? 47.056  71.621 359.723 1.00 55.96  ? 49  PRO A CA  1 
ATOM   344  C C   . PRO A 1 48  ? 47.110  71.554 361.234 1.00 56.41  ? 49  PRO A C   1 
ATOM   345  O O   . PRO A 1 48  ? 46.611  72.458 361.932 1.00 61.22  ? 49  PRO A O   1 
ATOM   346  C CB  . PRO A 1 48  ? 48.169  72.516 359.159 1.00 53.42  ? 49  PRO A CB  1 
ATOM   347  C CG  . PRO A 1 48  ? 47.549  73.165 357.958 1.00 53.84  ? 49  PRO A CG  1 
ATOM   348  C CD  . PRO A 1 48  ? 46.112  73.387 358.337 1.00 51.28  ? 49  PRO A CD  1 
ATOM   349  N N   . PRO A 1 49  ? 47.703  70.499 361.789 1.00 55.04  ? 50  PRO A N   1 
ATOM   350  C CA  . PRO A 1 49  ? 47.720  70.351 363.247 1.00 64.26  ? 50  PRO A CA  1 
ATOM   351  C C   . PRO A 1 49  ? 48.527  71.459 363.911 1.00 67.42  ? 50  PRO A C   1 
ATOM   352  O O   . PRO A 1 49  ? 49.559  71.898 363.397 1.00 62.39  ? 50  PRO A O   1 
ATOM   353  C CB  . PRO A 1 49  ? 48.370  68.978 363.454 1.00 55.31  ? 50  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 49  ? 49.238  68.804 362.250 1.00 53.13  ? 50  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 49  ? 48.460  69.427 361.118 1.00 57.67  ? 50  PRO A CD  1 
ATOM   356  N N   . GLU A 1 50  ? 48.124  71.866 365.094 1.00 61.61  ? 51  GLU A N   1 
ATOM   357  C CA  . GLU A 1 50  ? 48.871  72.843 365.845 1.00 76.79  ? 51  GLU A CA  1 
ATOM   358  C C   . GLU A 1 50  ? 49.482  72.109 367.000 1.00 62.47  ? 51  GLU A C   1 
ATOM   359  O O   . GLU A 1 50  ? 48.862  71.268 367.566 1.00 62.80  ? 51  GLU A O   1 
ATOM   360  C CB  . GLU A 1 50  ? 47.966  73.947 366.354 1.00 63.78  ? 51  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 50  ? 47.638  75.013 365.328 1.00 97.17  ? 51  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 50  ? 48.865  75.615 364.638 1.00 120.10 ? 51  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 50  ? 48.904  75.683 363.395 1.00 98.24  ? 51  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 50  ? 49.799  76.038 365.335 1.00 119.82 ? 51  GLU A OE2 1 
ATOM   365  N N   . PRO A 1 51  ? 50.701  72.430 367.355 1.00 60.17  ? 52  PRO A N   1 
ATOM   366  C CA  . PRO A 1 51  ? 51.372  71.744 368.468 1.00 61.17  ? 52  PRO A CA  1 
ATOM   367  C C   . PRO A 1 51  ? 50.589  71.890 369.766 1.00 62.05  ? 52  PRO A C   1 
ATOM   368  O O   . PRO A 1 51  ? 49.993  72.933 370.042 1.00 55.28  ? 52  PRO A O   1 
ATOM   369  C CB  . PRO A 1 51  ? 52.733  72.446 368.547 1.00 54.06  ? 52  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 51  ? 52.941  73.012 367.174 1.00 59.49  ? 52  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 51  ? 51.573  73.422 366.706 1.00 45.46  ? 52  PRO A CD  1 
ATOM   372  N N   . LYS A 1 52  ? 50.580  70.820 370.556 1.00 56.10  ? 53  LYS A N   1 
ATOM   373  C CA  . LYS A 1 52  ? 49.865  70.818 371.825 1.00 61.29  ? 53  LYS A CA  1 
ATOM   374  C C   . LYS A 1 52  ? 50.473  71.847 372.771 1.00 71.60  ? 53  LYS A C   1 
ATOM   375  O O   . LYS A 1 52  ? 51.675  71.809 373.055 1.00 59.01  ? 53  LYS A O   1 
ATOM   376  C CB  . LYS A 1 52  ? 49.917  69.420 372.445 1.00 63.12  ? 53  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 52  ? 49.315  69.305 373.845 1.00 60.61  ? 53  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 52  ? 47.794  69.435 373.834 1.00 67.55  ? 53  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 52  ? 47.226  69.369 375.251 1.00 70.62  ? 53  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 52  ? 45.753  69.604 375.281 1.00 68.07  ? 53  LYS A NZ  1 
ATOM   381  N N   . GLN A 1 53  ? 49.646  72.767 373.258 1.00 57.33  ? 54  GLN A N   1 
ATOM   382  C CA  . GLN A 1 53  ? 50.150  73.787 374.161 1.00 80.52  ? 54  GLN A CA  1 
ATOM   383  C C   . GLN A 1 53  ? 50.455  73.180 375.533 1.00 62.82  ? 54  GLN A C   1 
ATOM   384  O O   . GLN A 1 53  ? 49.787  72.235 375.965 1.00 66.06  ? 54  GLN A O   1 
ATOM   385  C CB  . GLN A 1 53  ? 49.146  74.932 374.292 1.00 74.86  ? 54  GLN A CB  1 
ATOM   386  C CG  . GLN A 1 53  ? 49.025  75.803 373.035 1.00 81.47  ? 54  GLN A CG  1 
ATOM   387  C CD  . GLN A 1 53  ? 50.213  76.743 372.822 1.00 101.29 ? 54  GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 53  ? 51.289  76.559 373.396 1.00 97.19  ? 54  GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 53  ? 50.015  77.758 371.988 1.00 98.93  ? 54  GLN A NE2 1 
ATOM   390  N N   . PRO A 1 54  ? 51.477  73.689 376.224 1.00 70.11  ? 55  PRO A N   1 
ATOM   391  C CA  . PRO A 1 54  ? 51.864  73.105 377.516 1.00 67.06  ? 55  PRO A CA  1 
ATOM   392  C C   . PRO A 1 54  ? 50.705  73.061 378.498 1.00 60.28  ? 55  PRO A C   1 
ATOM   393  O O   . PRO A 1 54  ? 49.794  73.891 378.462 1.00 58.41  ? 55  PRO A O   1 
ATOM   394  C CB  . PRO A 1 54  ? 52.974  74.037 378.010 1.00 61.67  ? 55  PRO A CB  1 
ATOM   395  C CG  . PRO A 1 54  ? 53.561  74.600 376.763 1.00 74.09  ? 55  PRO A CG  1 
ATOM   396  C CD  . PRO A 1 54  ? 52.420  74.734 375.787 1.00 67.37  ? 55  PRO A CD  1 
ATOM   397  N N   . TRP A 1 55  ? 50.777  72.076 379.366 1.00 51.09  ? 56  TRP A N   1 
ATOM   398  C CA  . TRP A 1 55  ? 49.775  71.809 380.361 1.00 62.99  ? 56  TRP A CA  1 
ATOM   399  C C   . TRP A 1 55  ? 50.368  71.728 381.744 1.00 71.51  ? 56  TRP A C   1 
ATOM   400  O O   . TRP A 1 55  ? 51.533  71.485 381.903 1.00 58.01  ? 56  TRP A O   1 
ATOM   401  C CB  . TRP A 1 55  ? 49.070  70.484 380.049 1.00 63.57  ? 56  TRP A CB  1 
ATOM   402  C CG  . TRP A 1 55  ? 49.931  69.273 380.180 1.00 60.51  ? 56  TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 55  ? 50.181  68.596 381.287 1.00 63.20  ? 56  TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 55  ? 50.634  68.613 379.147 1.00 65.85  ? 56  TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 55  ? 51.011  67.577 381.039 1.00 64.21  ? 56  TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 55  ? 51.295  67.557 379.715 1.00 52.46  ? 56  TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 55  ? 50.774  68.828 377.790 1.00 60.71  ? 56  TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 55  ? 52.076  66.719 378.999 1.00 45.40  ? 56  TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 55  ? 51.551  68.004 377.094 1.00 53.20  ? 56  TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 55  ? 52.197  66.964 377.689 1.00 53.84  ? 56  TRP A CH2 1 
ATOM   411  N N   . SER A 1 56  ? 49.548  71.936 382.746 1.00 57.53  ? 57  SER A N   1 
ATOM   412  C CA  . SER A 1 56  ? 50.013  71.851 384.096 1.00 74.60  ? 57  SER A CA  1 
ATOM   413  C C   . SER A 1 56  ? 49.358  70.629 384.621 1.00 74.69  ? 57  SER A C   1 
ATOM   414  O O   . SER A 1 56  ? 48.353  70.215 384.109 1.00 76.29  ? 57  SER A O   1 
ATOM   415  C CB  . SER A 1 56  ? 49.613  73.064 384.894 1.00 67.14  ? 57  SER A CB  1 
ATOM   416  O OG  . SER A 1 56  ? 48.226  73.170 384.952 1.00 81.66  ? 57  SER A OG  1 
ATOM   417  N N   . GLY A 1 57  ? 49.941  70.039 385.633 1.00 67.09  ? 58  GLY A N   1 
ATOM   418  C CA  . GLY A 1 57  ? 49.392  68.837 386.177 1.00 65.59  ? 58  GLY A CA  1 
ATOM   419  C C   . GLY A 1 57  ? 50.024  67.663 385.511 1.00 72.59  ? 58  GLY A C   1 
ATOM   420  O O   . GLY A 1 57  ? 50.998  67.800 384.827 1.00 67.68  ? 58  GLY A O   1 
ATOM   421  N N   . VAL A 1 58  ? 49.466  66.498 385.745 1.00 67.92  ? 59  VAL A N   1 
ATOM   422  C CA  . VAL A 1 58  ? 49.995  65.260 385.188 1.00 74.89  ? 59  VAL A CA  1 
ATOM   423  C C   . VAL A 1 58  ? 48.956  64.692 384.234 1.00 76.96  ? 59  VAL A C   1 
ATOM   424  O O   . VAL A 1 58  ? 47.808  64.455 384.633 1.00 64.39  ? 59  VAL A O   1 
ATOM   425  C CB  . VAL A 1 58  ? 50.342  64.244 386.288 1.00 74.60  ? 59  VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 58  ? 50.798  62.923 385.678 1.00 54.29  ? 59  VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 58  ? 51.405  64.813 387.212 1.00 75.09  ? 59  VAL A CG2 1 
ATOM   428  N N   . VAL A 1 59  ? 49.355  64.478 382.981 1.00 63.07  ? 60  VAL A N   1 
ATOM   429  C CA  . VAL A 1 59  ? 48.488  63.829 382.004 1.00 54.62  ? 60  VAL A CA  1 
ATOM   430  C C   . VAL A 1 59  ? 48.462  62.332 382.283 1.00 58.52  ? 60  VAL A C   1 
ATOM   431  O O   . VAL A 1 59  ? 49.511  61.697 382.447 1.00 55.15  ? 60  VAL A O   1 
ATOM   432  C CB  . VAL A 1 59  ? 48.965  64.118 380.570 1.00 64.10  ? 60  VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 59  ? 48.499  63.019 379.617 1.00 55.21  ? 60  VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 59  ? 48.472  65.485 380.097 1.00 52.18  ? 60  VAL A CG2 1 
ATOM   435  N N   . ASP A 1 60  ? 47.258  61.767 382.350 1.00 56.83  ? 61  ASP A N   1 
ATOM   436  C CA  . ASP A 1 60  ? 47.084  60.325 382.491 1.00 60.18  ? 61  ASP A CA  1 
ATOM   437  C C   . ASP A 1 60  ? 47.438  59.641 381.176 1.00 66.18  ? 61  ASP A C   1 
ATOM   438  O O   . ASP A 1 60  ? 46.695  59.747 380.197 1.00 61.63  ? 61  ASP A O   1 
ATOM   439  C CB  . ASP A 1 60  ? 45.645  60.014 382.895 1.00 76.06  ? 61  ASP A CB  1 
ATOM   440  C CG  . ASP A 1 60  ? 45.377  58.526 383.014 1.00 81.35  ? 61  ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 60  ? 46.346  57.744 383.106 1.00 87.93  ? 61  ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 60  ? 44.190  58.137 383.025 1.00 103.58 ? 61  ASP A OD2 1 
ATOM   443  N N   . ALA A 1 61  ? 48.564  58.930 381.152 1.00 57.69  ? 62  ALA A N   1 
ATOM   444  C CA  . ALA A 1 61  ? 49.004  58.231 379.951 1.00 52.79  ? 62  ALA A CA  1 
ATOM   445  C C   . ALA A 1 61  ? 49.024  56.723 380.169 1.00 54.95  ? 62  ALA A C   1 
ATOM   446  O O   . ALA A 1 61  ? 50.039  56.066 379.918 1.00 53.99  ? 62  ALA A O   1 
ATOM   447  C CB  . ALA A 1 61  ? 50.388  58.719 379.519 1.00 49.97  ? 62  ALA A CB  1 
ATOM   448  N N   . THR A 1 62  ? 47.905  56.164 380.625 1.00 55.31  ? 63  THR A N   1 
ATOM   449  C CA  . THR A 1 62  ? 47.832  54.749 380.960 1.00 59.84  ? 63  THR A CA  1 
ATOM   450  C C   . THR A 1 62  ? 46.907  53.945 380.056 1.00 70.88  ? 63  THR A C   1 
ATOM   451  O O   . THR A 1 62  ? 46.884  52.714 380.170 1.00 61.76  ? 63  THR A O   1 
ATOM   452  C CB  . THR A 1 62  ? 47.365  54.570 382.412 1.00 69.83  ? 63  THR A CB  1 
ATOM   453  O OG1 . THR A 1 62  ? 46.070  55.163 382.559 1.00 58.44  ? 63  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 62  ? 48.336  55.234 383.379 1.00 50.33  ? 63  THR A CG2 1 
ATOM   455  N N   . THR A 1 63  ? 46.135  54.593 379.183 1.00 57.18  ? 64  THR A N   1 
ATOM   456  C CA  . THR A 1 63  ? 45.251  53.882 378.269 1.00 67.22  ? 64  THR A CA  1 
ATOM   457  C C   . THR A 1 63  ? 45.240  54.583 376.917 1.00 58.63  ? 64  THR A C   1 
ATOM   458  O O   . THR A 1 63  ? 45.576  55.764 376.802 1.00 60.35  ? 64  THR A O   1 
ATOM   459  C CB  . THR A 1 63  ? 43.818  53.778 378.819 1.00 68.50  ? 64  THR A CB  1 
ATOM   460  O OG1 . THR A 1 63  ? 42.990  53.090 377.869 1.00 96.20  ? 64  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 63  ? 43.243  55.160 379.079 1.00 49.13  ? 64  THR A CG2 1 
ATOM   462  N N   . PHE A 1 64  ? 44.843  53.839 375.890 1.00 55.83  ? 65  PHE A N   1 
ATOM   463  C CA  . PHE A 1 64  ? 44.771  54.401 374.550 1.00 49.79  ? 65  PHE A CA  1 
ATOM   464  C C   . PHE A 1 64  ? 43.703  55.487 374.489 1.00 54.19  ? 65  PHE A C   1 
ATOM   465  O O   . PHE A 1 64  ? 42.697  55.444 375.201 1.00 54.25  ? 65  PHE A O   1 
ATOM   466  C CB  . PHE A 1 64  ? 44.467  53.310 373.525 1.00 48.82  ? 65  PHE A CB  1 
ATOM   467  C CG  . PHE A 1 64  ? 45.634  52.409 373.232 1.00 49.30  ? 65  PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 64  ? 46.762  52.900 372.595 1.00 47.53  ? 65  PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 64  ? 45.600  51.069 373.581 1.00 48.20  ? 65  PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 64  ? 47.840  52.073 372.320 1.00 50.75  ? 65  PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 64  ? 46.676  50.234 373.308 1.00 43.27  ? 65  PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 64  ? 47.798  50.738 372.676 1.00 43.62  ? 65  PHE A CZ  1 
ATOM   473  N N   . GLN A 1 65  ? 43.936  56.475 373.633 1.00 52.07  ? 66  GLN A N   1 
ATOM   474  C CA  . GLN A 1 65  ? 42.979  57.553 373.459 1.00 50.95  ? 66  GLN A CA  1 
ATOM   475  C C   . GLN A 1 65  ? 42.015  57.218 372.322 1.00 57.38  ? 66  GLN A C   1 
ATOM   476  O O   . GLN A 1 65  ? 42.096  56.162 371.690 1.00 50.49  ? 66  GLN A O   1 
ATOM   477  C CB  . GLN A 1 65  ? 43.708  58.871 373.215 1.00 57.86  ? 66  GLN A CB  1 
ATOM   478  C CG  . GLN A 1 65  ? 43.844  59.732 374.470 1.00 56.22  ? 66  GLN A CG  1 
ATOM   479  C CD  . GLN A 1 65  ? 42.514  60.298 374.941 1.00 69.87  ? 66  GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 65  ? 41.532  60.323 374.193 1.00 67.67  ? 66  GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 65  ? 42.480  60.767 376.183 1.00 62.42  ? 66  GLN A NE2 1 
ATOM   482  N N   . SER A 1 66  ? 41.095  58.140 372.049 1.00 41.54  ? 67  SER A N   1 
ATOM   483  C CA  . SER A 1 66  ? 40.057  57.902 371.057 1.00 60.10  ? 67  SER A CA  1 
ATOM   484  C C   . SER A 1 66  ? 40.641  57.660 369.666 1.00 60.68  ? 67  SER A C   1 
ATOM   485  O O   . SER A 1 66  ? 41.738  58.116 369.333 1.00 53.46  ? 67  SER A O   1 
ATOM   486  C CB  . SER A 1 66  ? 39.106  59.089 371.024 1.00 55.33  ? 67  SER A CB  1 
ATOM   487  O OG  . SER A 1 66  ? 38.905  59.560 372.340 1.00 56.18  ? 67  SER A OG  1 
ATOM   488  N N   . VAL A 1 67  ? 39.884  56.926 368.854 1.00 57.32  ? 68  VAL A N   1 
ATOM   489  C CA  . VAL A 1 67  ? 40.210  56.668 367.456 1.00 55.58  ? 68  VAL A CA  1 
ATOM   490  C C   . VAL A 1 67  ? 39.671  57.818 366.616 1.00 56.55  ? 68  VAL A C   1 
ATOM   491  O O   . VAL A 1 67  ? 38.609  58.374 366.916 1.00 50.94  ? 68  VAL A O   1 
ATOM   492  C CB  . VAL A 1 67  ? 39.620  55.316 367.011 1.00 58.96  ? 68  VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 67  ? 39.862  55.064 365.530 1.00 49.08  ? 68  VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 67  ? 40.198  54.185 367.854 1.00 50.26  ? 68  VAL A CG2 1 
ATOM   495  N N   . CYS A 1 68  ? 40.414  58.200 365.578 1.00 43.94  ? 69  CYS A N   1 
ATOM   496  C CA  . CYS A 1 68  ? 39.951  59.261 364.696 1.00 53.17  ? 69  CYS A CA  1 
ATOM   497  C C   . CYS A 1 68  ? 38.721  58.794 363.930 1.00 57.08  ? 69  CYS A C   1 
ATOM   498  O O   . CYS A 1 68  ? 38.616  57.624 363.550 1.00 52.43  ? 69  CYS A O   1 
ATOM   499  C CB  . CYS A 1 68  ? 41.057  59.677 363.722 1.00 49.94  ? 69  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 68  ? 42.517  60.431 364.484 1.00 57.98  ? 69  CYS A SG  1 
ATOM   501  N N   . TYR A 1 69  ? 37.786  59.718 363.706 1.00 43.26  ? 70  TYR A N   1 
ATOM   502  C CA  . TYR A 1 69  ? 36.528  59.379 363.047 1.00 60.19  ? 70  TYR A CA  1 
ATOM   503  C C   . TYR A 1 69  ? 36.764  58.695 361.709 1.00 47.70  ? 70  TYR A C   1 
ATOM   504  O O   . TYR A 1 69  ? 37.493  59.204 360.854 1.00 53.69  ? 70  TYR A O   1 
ATOM   505  C CB  . TYR A 1 69  ? 35.689  60.634 362.835 1.00 61.03  ? 70  TYR A CB  1 
ATOM   506  C CG  . TYR A 1 69  ? 34.497  60.717 363.738 1.00 69.39  ? 70  TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 69  ? 33.335  60.017 363.449 1.00 67.10  ? 70  TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 69  ? 34.534  61.489 364.889 1.00 60.75  ? 70  TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 69  ? 32.236  60.090 364.280 1.00 79.27  ? 70  TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 69  ? 33.441  61.572 365.726 1.00 72.70  ? 70  TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 69  ? 32.296  60.870 365.418 1.00 69.00  ? 70  TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 69  ? 31.203  60.949 366.247 1.00 89.54  ? 70  TYR A OH  1 
ATOM   513  N N   . GLN A 1 70  ? 36.110  57.551 361.523 1.00 58.79  ? 71  GLN A N   1 
ATOM   514  C CA  . GLN A 1 70  ? 36.335  56.728 360.347 1.00 48.96  ? 71  GLN A CA  1 
ATOM   515  C C   . GLN A 1 70  ? 35.144  55.808 360.122 1.00 60.71  ? 71  GLN A C   1 
ATOM   516  O O   . GLN A 1 70  ? 34.359  55.536 361.035 1.00 59.53  ? 71  GLN A O   1 
ATOM   517  C CB  . GLN A 1 70  ? 37.615  55.905 360.498 1.00 50.30  ? 71  GLN A CB  1 
ATOM   518  C CG  . GLN A 1 70  ? 37.665  55.087 361.775 1.00 44.94  ? 71  GLN A CG  1 
ATOM   519  C CD  . GLN A 1 70  ? 38.979  54.359 361.921 1.00 52.02  ? 71  GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 70  ? 39.062  53.152 361.697 1.00 46.91  ? 71  GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 70  ? 40.024  55.094 362.288 1.00 51.18  ? 71  GLN A NE2 1 
ATOM   522  N N   . TYR A 1 71  ? 35.030  55.332 358.882 1.00 53.22  ? 72  TYR A N   1 
ATOM   523  C CA  . TYR A 1 71  ? 34.090  54.274 358.538 1.00 49.61  ? 72  TYR A CA  1 
ATOM   524  C C   . TYR A 1 71  ? 34.418  53.002 359.315 1.00 54.22  ? 72  TYR A C   1 
ATOM   525  O O   . TYR A 1 71  ? 35.583  52.694 359.578 1.00 57.79  ? 72  TYR A O   1 
ATOM   526  C CB  . TYR A 1 71  ? 34.144  54.011 357.024 1.00 59.41  ? 72  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 71  ? 33.397  52.780 356.541 1.00 64.02  ? 72  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 71  ? 32.034  52.834 356.259 1.00 55.28  ? 72  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 71  ? 34.058  51.568 356.351 1.00 61.77  ? 72  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 71  ? 31.347  51.712 355.820 1.00 64.14  ? 72  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 71  ? 33.380  50.443 355.911 1.00 66.25  ? 72  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 71  ? 32.026  50.520 355.648 1.00 70.91  ? 72  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 71  ? 31.350  49.401 355.214 1.00 81.45  ? 72  TYR A OH  1 
ATOM   534  N N   . VAL A 1 72  ? 33.376  52.260 359.693 1.00 52.23  ? 73  VAL A N   1 
ATOM   535  C CA  . VAL A 1 72  ? 33.518  50.979 360.379 1.00 60.41  ? 73  VAL A CA  1 
ATOM   536  C C   . VAL A 1 72  ? 33.010  49.885 359.452 1.00 59.83  ? 73  VAL A C   1 
ATOM   537  O O   . VAL A 1 72  ? 31.908  49.994 358.905 1.00 64.95  ? 73  VAL A O   1 
ATOM   538  C CB  . VAL A 1 72  ? 32.760  50.959 361.719 1.00 62.34  ? 73  VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 72  ? 32.948  49.619 362.425 1.00 50.08  ? 73  VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 72  ? 33.231  52.097 362.595 1.00 52.37  ? 73  VAL A CG2 1 
ATOM   541  N N   . ASP A 1 73  ? 33.808  48.832 359.286 1.00 69.78  ? 74  ASP A N   1 
ATOM   542  C CA  . ASP A 1 73  ? 33.500  47.770 358.335 1.00 63.46  ? 74  ASP A CA  1 
ATOM   543  C C   . ASP A 1 73  ? 32.417  46.850 358.890 1.00 73.06  ? 74  ASP A C   1 
ATOM   544  O O   . ASP A 1 73  ? 32.631  46.159 359.890 1.00 69.75  ? 74  ASP A O   1 
ATOM   545  C CB  . ASP A 1 73  ? 34.758  46.973 358.007 1.00 73.42  ? 74  ASP A CB  1 
ATOM   546  C CG  . ASP A 1 73  ? 34.506  45.890 356.984 1.00 72.61  ? 74  ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 73  ? 35.222  44.873 357.018 1.00 76.77  ? 74  ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 73  ? 33.590  46.051 356.151 1.00 89.33  ? 74  ASP A OD2 1 
ATOM   549  N N   . THR A 1 74  ? 31.268  46.818 358.214 1.00 86.79  ? 75  THR A N   1 
ATOM   550  C CA  . THR A 1 74  ? 30.094  46.078 358.660 1.00 92.92  ? 75  THR A CA  1 
ATOM   551  C C   . THR A 1 74  ? 29.772  44.894 357.757 1.00 89.82  ? 75  THR A C   1 
ATOM   552  O O   . THR A 1 74  ? 28.647  44.383 357.783 1.00 88.61  ? 75  THR A O   1 
ATOM   553  C CB  . THR A 1 74  ? 28.890  47.015 358.731 1.00 91.01  ? 75  THR A CB  1 
ATOM   554  O OG1 . THR A 1 74  ? 28.865  47.840 357.557 1.00 81.30  ? 75  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 74  ? 28.982  47.892 359.960 1.00 77.15  ? 75  THR A CG2 1 
ATOM   556  N N   . LEU A 1 75  ? 30.742  44.439 356.967 1.00 81.82  ? 76  LEU A N   1 
ATOM   557  C CA  . LEU A 1 75  ? 30.465  43.475 355.907 1.00 92.21  ? 76  LEU A CA  1 
ATOM   558  C C   . LEU A 1 75  ? 30.258  42.064 356.458 1.00 85.86  ? 76  LEU A C   1 
ATOM   559  O O   . LEU A 1 75  ? 29.321  41.370 356.045 1.00 84.05  ? 76  LEU A O   1 
ATOM   560  C CB  . LEU A 1 75  ? 31.599  43.536 354.878 1.00 89.92  ? 76  LEU A CB  1 
ATOM   561  C CG  . LEU A 1 75  ? 31.611  42.731 353.579 1.00 95.06  ? 76  LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 75  ? 32.280  41.407 353.809 1.00 95.79  ? 76  LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 75  ? 30.198  42.538 353.037 1.00 85.21  ? 76  LEU A CD2 1 
ATOM   564  N N   . TYR A 1 76  ? 31.059  41.639 357.426 1.00 89.06  ? 77  TYR A N   1 
ATOM   565  C CA  . TYR A 1 76  ? 30.902  40.344 358.091 1.00 73.26  ? 77  TYR A CA  1 
ATOM   566  C C   . TYR A 1 76  ? 30.905  40.615 359.596 1.00 79.34  ? 77  TYR A C   1 
ATOM   567  O O   . TYR A 1 76  ? 31.878  40.410 360.259 1.00 74.87  ? 77  TYR A O   1 
ATOM   568  C CB  . TYR A 1 76  ? 32.058  39.426 357.768 1.00 79.05  ? 77  TYR A CB  1 
ATOM   569  C CG  . TYR A 1 76  ? 32.217  38.975 356.352 1.00 95.70  ? 77  TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 76  ? 31.299  38.175 355.748 1.00 96.93  ? 77  TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 76  ? 33.330  39.302 355.650 1.00 88.01  ? 77  TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 76  ? 31.477  37.755 354.460 1.00 110.32 ? 77  TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 76  ? 33.515  38.883 354.371 1.00 96.54  ? 77  TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 76  ? 32.587  38.109 353.782 1.00 108.43 ? 77  TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 76  ? 32.794  37.706 352.498 1.00 97.75  ? 77  TYR A OH  1 
ATOM   576  N N   . PRO A 1 77  ? 29.810  41.076 360.151 1.00 84.28  ? 78  PRO A N   1 
ATOM   577  C CA  . PRO A 1 77  ? 29.783  41.485 361.566 1.00 68.73  ? 78  PRO A CA  1 
ATOM   578  C C   . PRO A 1 77  ? 30.172  40.347 362.498 1.00 74.00  ? 78  PRO A C   1 
ATOM   579  O O   . PRO A 1 77  ? 29.695  39.218 362.361 1.00 70.54  ? 78  PRO A O   1 
ATOM   580  C CB  . PRO A 1 77  ? 28.328  41.917 361.783 1.00 63.21  ? 78  PRO A CB  1 
ATOM   581  C CG  . PRO A 1 77  ? 27.810  42.228 360.406 1.00 88.03  ? 78  PRO A CG  1 
ATOM   582  C CD  . PRO A 1 77  ? 28.503  41.258 359.497 1.00 70.55  ? 78  PRO A CD  1 
ATOM   583  N N   . GLY A 1 78  ? 31.047  40.659 363.457 1.00 69.90  ? 79  GLY A N   1 
ATOM   584  C CA  . GLY A 1 78  ? 31.527  39.685 364.416 1.00 50.40  ? 79  GLY A CA  1 
ATOM   585  C C   . GLY A 1 78  ? 32.645  38.788 363.928 1.00 67.71  ? 79  GLY A C   1 
ATOM   586  O O   . GLY A 1 78  ? 33.193  38.019 364.728 1.00 56.18  ? 79  GLY A O   1 
ATOM   587  N N   . PHE A 1 79  ? 33.004  38.854 362.649 1.00 61.67  ? 80  PHE A N   1 
ATOM   588  C CA  . PHE A 1 79  ? 34.082  38.024 362.125 1.00 64.22  ? 80  PHE A CA  1 
ATOM   589  C C   . PHE A 1 79  ? 35.430  38.564 362.605 1.00 58.02  ? 80  PHE A C   1 
ATOM   590  O O   . PHE A 1 79  ? 35.687  39.768 362.520 1.00 66.05  ? 80  PHE A O   1 
ATOM   591  C CB  . PHE A 1 79  ? 33.998  37.995 360.592 1.00 60.11  ? 80  PHE A CB  1 
ATOM   592  C CG  . PHE A 1 79  ? 35.081  37.194 359.932 1.00 63.52  ? 80  PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 79  ? 35.315  35.878 360.302 1.00 58.20  ? 80  PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 79  ? 35.863  37.756 358.933 1.00 60.33  ? 80  PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 79  ? 36.319  35.136 359.696 1.00 67.29  ? 80  PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 79  ? 36.870  37.021 358.320 1.00 58.54  ? 80  PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 79  ? 37.101  35.708 358.707 1.00 71.53  ? 80  PHE A CZ  1 
ATOM   598  N N   . GLU A 1 80  ? 36.297  37.702 363.122 1.00 64.51  ? 81  GLU A N   1 
ATOM   599  C CA  . GLU A 1 80  ? 37.606  38.117 363.624 1.00 57.20  ? 81  GLU A CA  1 
ATOM   600  C C   . GLU A 1 80  ? 38.403  38.814 362.586 1.00 70.72  ? 81  GLU A C   1 
ATOM   601  O O   . GLU A 1 80  ? 38.881  39.884 362.796 1.00 58.12  ? 81  GLU A O   1 
ATOM   602  C CB  . GLU A 1 80  ? 38.458  36.952 364.127 1.00 59.71  ? 81  GLU A CB  1 
ATOM   603  C CG  . GLU A 1 80  ? 39.840  37.404 364.609 1.00 94.25  ? 81  GLU A CG  1 
ATOM   604  C CD  . GLU A 1 80  ? 41.027  36.540 364.165 1.00 113.76 ? 81  GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 80  ? 41.612  36.747 363.074 1.00 102.49 ? 81  GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 80  ? 41.420  35.656 364.943 1.00 114.73 ? 81  GLU A OE2 1 
ATOM   607  N N   . GLY A 1 81  ? 38.568  38.172 361.460 1.00 65.18  ? 82  GLY A N   1 
ATOM   608  C CA  . GLY A 1 81  ? 39.334  38.761 360.375 1.00 54.95  ? 82  GLY A CA  1 
ATOM   609  C C   . GLY A 1 81  ? 38.893  40.161 360.006 1.00 62.76  ? 82  GLY A C   1 
ATOM   610  O O   . GLY A 1 81  ? 39.697  40.942 359.489 1.00 56.90  ? 82  GLY A O   1 
ATOM   611  N N   . THR A 1 82  ? 37.639  40.504 360.280 1.00 68.81  ? 83  THR A N   1 
ATOM   612  C CA  . THR A 1 82  ? 37.119  41.848 360.079 1.00 62.97  ? 83  THR A CA  1 
ATOM   613  C C   . THR A 1 82  ? 37.357  42.758 361.282 1.00 70.55  ? 83  THR A C   1 
ATOM   614  O O   . THR A 1 82  ? 37.911  43.852 361.140 1.00 57.87  ? 83  THR A O   1 
ATOM   615  C CB  . THR A 1 82  ? 35.621  41.774 359.790 1.00 79.18  ? 83  THR A CB  1 
ATOM   616  O OG1 . THR A 1 82  ? 35.413  41.225 358.486 1.00 88.27  ? 83  THR A OG1 1 
ATOM   617  C CG2 . THR A 1 82  ? 35.003  43.157 359.873 1.00 92.48  ? 83  THR A CG2 1 
ATOM   618  N N   . GLU A 1 83  ? 36.928  42.324 362.468 1.00 58.00  ? 84  GLU A N   1 
ATOM   619  C CA  . GLU A 1 83  ? 36.875  43.220 363.614 1.00 65.73  ? 84  GLU A CA  1 
ATOM   620  C C   . GLU A 1 83  ? 38.253  43.615 364.131 1.00 52.58  ? 84  GLU A C   1 
ATOM   621  O O   . GLU A 1 83  ? 38.365  44.632 364.821 1.00 62.40  ? 84  GLU A O   1 
ATOM   622  C CB  . GLU A 1 83  ? 36.055  42.578 364.733 1.00 54.38  ? 84  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 83  ? 34.658  42.148 364.312 1.00 60.55  ? 84  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 83  ? 33.701  43.318 364.107 1.00 80.10  ? 84  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 83  ? 34.074  44.468 364.422 1.00 75.77  ? 84  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 83  ? 32.569  43.086 363.627 1.00 82.11  ? 84  GLU A OE2 1 
ATOM   627  N N   . MET A 1 84  ? 39.301  42.851 363.809 1.00 57.66  ? 85  MET A N   1 
ATOM   628  C CA  . MET A 1 84  ? 40.632  43.191 364.302 1.00 52.60  ? 85  MET A CA  1 
ATOM   629  C C   . MET A 1 84  ? 41.122  44.531 363.763 1.00 57.23  ? 85  MET A C   1 
ATOM   630  O O   . MET A 1 84  ? 41.990  45.152 364.384 1.00 62.61  ? 85  MET A O   1 
ATOM   631  C CB  . MET A 1 84  ? 41.623  42.083 363.949 1.00 45.42  ? 85  MET A CB  1 
ATOM   632  C CG  . MET A 1 84  ? 41.834  41.895 362.452 1.00 57.44  ? 85  MET A CG  1 
ATOM   633  S SD  . MET A 1 84  ? 42.926  40.501 362.091 1.00 61.07  ? 85  MET A SD  1 
ATOM   634  C CE  . MET A 1 84  ? 44.496  41.154 362.684 1.00 50.88  ? 85  MET A CE  1 
ATOM   635  N N   . TRP A 1 85  ? 40.580  44.994 362.634 1.00 58.18  ? 86  TRP A N   1 
ATOM   636  C CA  . TRP A 1 85  ? 40.913  46.297 362.070 1.00 54.95  ? 86  TRP A CA  1 
ATOM   637  C C   . TRP A 1 85  ? 39.920  47.384 362.449 1.00 51.60  ? 86  TRP A C   1 
ATOM   638  O O   . TRP A 1 85  ? 40.197  48.566 362.211 1.00 50.15  ? 86  TRP A O   1 
ATOM   639  C CB  . TRP A 1 85  ? 40.997  46.214 360.537 1.00 46.96  ? 86  TRP A CB  1 
ATOM   640  C CG  . TRP A 1 85  ? 41.751  45.024 360.071 1.00 48.03  ? 86  TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 85  ? 41.235  43.895 359.509 1.00 60.50  ? 86  TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 85  ? 43.166  44.820 360.159 1.00 52.71  ? 86  TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 85  ? 42.243  43.004 359.226 1.00 55.69  ? 86  TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 85  ? 43.439  43.546 359.618 1.00 58.35  ? 86  TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 85  ? 44.230  45.592 360.635 1.00 43.21  ? 86  TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 85  ? 44.732  43.026 359.541 1.00 55.88  ? 86  TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 85  ? 45.515  45.072 360.563 1.00 49.73  ? 86  TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 85  ? 45.754  43.803 360.017 1.00 69.20  ? 86  TRP A CH2 1 
ATOM   649  N N   . ASN A 1 86  ? 38.773  47.023 363.010 1.00 51.75  ? 87  ASN A N   1 
ATOM   650  C CA  . ASN A 1 86  ? 37.793  48.024 363.367 1.00 56.97  ? 87  ASN A CA  1 
ATOM   651  C C   . ASN A 1 86  ? 38.234  48.753 364.632 1.00 60.41  ? 87  ASN A C   1 
ATOM   652  O O   . ASN A 1 86  ? 39.007  48.214 365.433 1.00 48.02  ? 87  ASN A O   1 
ATOM   653  C CB  . ASN A 1 86  ? 36.423  47.381 363.567 1.00 58.94  ? 87  ASN A CB  1 
ATOM   654  C CG  . ASN A 1 86  ? 35.664  47.199 362.261 1.00 68.97  ? 87  ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 86  ? 35.711  48.051 361.367 1.00 57.20  ? 87  ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 86  ? 34.944  46.089 362.154 1.00 67.79  ? 87  ASN A ND2 1 
ATOM   657  N N   . PRO A 1 87  ? 37.771  49.990 364.821 1.00 48.01  ? 88  PRO A N   1 
ATOM   658  C CA  . PRO A 1 87  ? 38.119  50.729 366.039 1.00 55.52  ? 88  PRO A CA  1 
ATOM   659  C C   . PRO A 1 87  ? 37.811  49.917 367.288 1.00 59.15  ? 88  PRO A C   1 
ATOM   660  O O   . PRO A 1 87  ? 36.768  49.268 367.388 1.00 66.57  ? 88  PRO A O   1 
ATOM   661  C CB  . PRO A 1 87  ? 37.240  51.980 365.954 1.00 46.55  ? 88  PRO A CB  1 
ATOM   662  C CG  . PRO A 1 87  ? 37.011  52.175 364.493 1.00 48.81  ? 88  PRO A CG  1 
ATOM   663  C CD  . PRO A 1 87  ? 36.950  50.796 363.898 1.00 50.88  ? 88  PRO A CD  1 
ATOM   664  N N   . ASN A 1 88  ? 38.749  49.934 368.235 1.00 55.76  ? 89  ASN A N   1 
ATOM   665  C CA  . ASN A 1 88  ? 38.544  49.359 369.558 1.00 49.15  ? 89  ASN A CA  1 
ATOM   666  C C   . ASN A 1 88  ? 38.506  50.432 370.638 1.00 53.31  ? 89  ASN A C   1 
ATOM   667  O O   . ASN A 1 88  ? 38.689  50.131 371.821 1.00 64.53  ? 89  ASN A O   1 
ATOM   668  C CB  . ASN A 1 88  ? 39.625  48.324 369.864 1.00 54.93  ? 89  ASN A CB  1 
ATOM   669  C CG  . ASN A 1 88  ? 41.017  48.922 369.884 1.00 59.02  ? 89  ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 88  ? 41.227  50.064 369.463 1.00 55.07  ? 89  ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 88  ? 41.984  48.146 370.358 1.00 68.70  ? 89  ASN A ND2 1 
ATOM   672  N N   . ARG A 1 89  ? 38.309  51.686 370.245 1.00 65.93  ? 90  ARG A N   1 
ATOM   673  C CA  . ARG A 1 89  ? 38.019  52.776 371.164 1.00 55.59  ? 90  ARG A CA  1 
ATOM   674  C C   . ARG A 1 89  ? 36.968  53.659 370.510 1.00 60.96  ? 90  ARG A C   1 
ATOM   675  O O   . ARG A 1 89  ? 36.686  53.548 369.312 1.00 76.33  ? 90  ARG A O   1 
ATOM   676  C CB  . ARG A 1 89  ? 39.271  53.599 371.516 1.00 42.82  ? 90  ARG A CB  1 
ATOM   677  C CG  . ARG A 1 89  ? 40.348  52.842 372.282 1.00 58.98  ? 90  ARG A CG  1 
ATOM   678  C CD  . ARG A 1 89  ? 39.922  52.589 373.721 1.00 54.33  ? 90  ARG A CD  1 
ATOM   679  N NE  . ARG A 1 89  ? 41.001  52.036 374.533 1.00 70.04  ? 90  ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 89  ? 41.408  50.771 374.481 1.00 73.66  ? 90  ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 89  ? 40.830  49.915 373.649 1.00 66.14  ? 90  ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 89  ? 42.400  50.360 375.264 1.00 58.58  ? 90  ARG A NH2 1 
ATOM   683  N N   . GLU A 1 90  ? 36.398  54.544 371.285 1.00 58.62  ? 91  GLU A N   1 
ATOM   684  C CA  . GLU A 1 90  ? 35.394  55.408 370.762 1.00 59.83  ? 91  GLU A CA  1 
ATOM   685  C C   . GLU A 1 90  ? 35.939  56.364 369.758 1.00 65.03  ? 91  GLU A C   1 
ATOM   686  O O   . GLU A 1 90  ? 37.040  56.761 369.854 1.00 57.89  ? 91  GLU A O   1 
ATOM   687  C CB  . GLU A 1 90  ? 34.682  56.134 371.889 1.00 56.23  ? 91  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 90  ? 35.302  57.434 372.321 1.00 96.86  ? 91  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 90  ? 34.335  58.326 373.089 1.00 118.87 ? 91  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 90  ? 33.253  57.846 373.489 1.00 106.26 ? 91  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 90  ? 34.658  59.515 373.303 1.00 114.03 ? 91  GLU A OE2 1 
ATOM   692  N N   . LEU A 1 91  ? 35.131  56.708 368.781 1.00 59.10  ? 92  LEU A N   1 
ATOM   693  C CA  . LEU A 1 91  ? 35.517  57.643 367.744 1.00 58.95  ? 92  LEU A CA  1 
ATOM   694  C C   . LEU A 1 91  ? 35.427  59.071 368.261 1.00 45.77  ? 92  LEU A C   1 
ATOM   695  O O   . LEU A 1 91  ? 34.558  59.411 369.065 1.00 61.36  ? 92  LEU A O   1 
ATOM   696  C CB  . LEU A 1 91  ? 34.627  57.478 366.512 1.00 53.52  ? 92  LEU A CB  1 
ATOM   697  C CG  . LEU A 1 91  ? 34.576  56.107 365.834 1.00 58.01  ? 92  LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 91  ? 33.765  56.194 364.551 1.00 47.27  ? 92  LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 91  ? 35.973  55.589 365.553 1.00 61.82  ? 92  LEU A CD2 1 
ATOM   700  N N   . SER A 1 92  ? 36.332  59.912 367.776 1.00 63.62  ? 93  SER A N   1 
ATOM   701  C CA  . SER A 1 92  ? 36.314  61.325 368.119 1.00 53.62  ? 93  SER A CA  1 
ATOM   702  C C   . SER A 1 92  ? 37.248  62.063 367.176 1.00 46.62  ? 93  SER A C   1 
ATOM   703  O O   . SER A 1 92  ? 38.245  61.502 366.707 1.00 60.20  ? 93  SER A O   1 
ATOM   704  C CB  . SER A 1 92  ? 36.738  61.554 369.577 1.00 53.35  ? 93  SER A CB  1 
ATOM   705  O OG  . SER A 1 92  ? 36.954  62.933 369.817 1.00 49.88  ? 93  SER A OG  1 
ATOM   706  N N   . GLU A 1 93  ? 36.912  63.322 366.892 1.00 59.98  ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 93  ? 37.863  64.187 366.208 1.00 48.40  ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 93  ? 39.012  64.580 367.124 1.00 62.88  ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 93  ? 40.080  64.957 366.633 1.00 70.56  ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 93  ? 37.163  65.436 365.675 1.00 50.55  ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 93  ? 36.141  65.156 364.582 1.00 51.64  ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 93  ? 35.728  66.416 363.837 1.00 66.89  ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 93  ? 36.503  66.881 362.977 1.00 58.55  ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 93  ? 34.629  66.946 364.110 1.00 66.47  ? 94  GLU A OE2 1 
ATOM   715  N N   . ASP A 1 94  ? 38.808  64.509 368.439 1.00 58.89  ? 95  ASP A N   1 
ATOM   716  C CA  . ASP A 1 94  ? 39.873  64.653 369.429 1.00 52.30  ? 95  ASP A CA  1 
ATOM   717  C C   . ASP A 1 94  ? 40.595  63.315 369.499 1.00 55.05  ? 95  ASP A C   1 
ATOM   718  O O   . ASP A 1 94  ? 40.276  62.451 370.317 1.00 55.24  ? 95  ASP A O   1 
ATOM   719  C CB  . ASP A 1 94  ? 39.299  65.061 370.781 1.00 50.96  ? 95  ASP A CB  1 
ATOM   720  C CG  . ASP A 1 94  ? 40.373  65.452 371.789 1.00 59.88  ? 95  ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 94  ? 41.574  65.429 371.445 1.00 69.53  ? 95  ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 94  ? 40.012  65.786 372.937 1.00 69.91  ? 95  ASP A OD2 1 
ATOM   723  N N   . CYS A 1 95  ? 41.584  63.141 368.622 1.00 49.74  ? 96  CYS A N   1 
ATOM   724  C CA  . CYS A 1 95  ? 42.240  61.851 368.458 1.00 46.11  ? 96  CYS A CA  1 
ATOM   725  C C   . CYS A 1 95  ? 43.734  61.943 368.190 1.00 38.10  ? 96  CYS A C   1 
ATOM   726  O O   . CYS A 1 95  ? 44.358  60.904 367.954 1.00 56.20  ? 96  CYS A O   1 
ATOM   727  C CB  . CYS A 1 95  ? 41.588  61.067 367.309 1.00 46.58  ? 96  CYS A CB  1 
ATOM   728  S SG  . CYS A 1 95  ? 41.753  61.888 365.689 1.00 54.24  ? 96  CYS A SG  1 
ATOM   729  N N   . LEU A 1 96  ? 44.326  63.138 368.200 1.00 43.17  ? 97  LEU A N   1 
ATOM   730  C CA  . LEU A 1 96  ? 45.743  63.302 367.874 1.00 47.93  ? 97  LEU A CA  1 
ATOM   731  C C   . LEU A 1 96  ? 46.564  63.043 369.134 1.00 55.22  ? 97  LEU A C   1 
ATOM   732  O O   . LEU A 1 96  ? 47.012  63.954 369.834 1.00 53.64  ? 97  LEU A O   1 
ATOM   733  C CB  . LEU A 1 96  ? 46.005  64.682 367.284 1.00 43.17  ? 97  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 96  ? 45.400  64.859 365.884 1.00 61.10  ? 97  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 96  ? 45.874  66.140 365.212 1.00 42.41  ? 97  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 96  ? 45.699  63.649 365.001 1.00 41.04  ? 97  LEU A CD2 1 
ATOM   737  N N   . TYR A 1 97  ? 46.753  61.758 369.419 1.00 48.79  ? 98  TYR A N   1 
ATOM   738  C CA  . TYR A 1 97  ? 47.570  61.290 370.527 1.00 49.73  ? 98  TYR A CA  1 
ATOM   739  C C   . TYR A 1 97  ? 48.532  60.228 370.013 1.00 46.49  ? 98  TYR A C   1 
ATOM   740  O O   . TYR A 1 97  ? 48.253  59.549 369.019 1.00 52.54  ? 98  TYR A O   1 
ATOM   741  C CB  . TYR A 1 97  ? 46.700  60.715 371.670 1.00 48.42  ? 98  TYR A CB  1 
ATOM   742  C CG  . TYR A 1 97  ? 45.658  61.684 372.194 1.00 54.09  ? 98  TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 97  ? 45.879  62.411 373.359 1.00 55.48  ? 98  TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 97  ? 44.453  61.876 371.524 1.00 52.16  ? 98  TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 97  ? 44.932  63.301 373.844 1.00 47.89  ? 98  TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 97  ? 43.499  62.766 371.999 1.00 53.14  ? 98  TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 97  ? 43.746  63.476 373.161 1.00 66.51  ? 98  TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 97  ? 42.808  64.362 373.642 1.00 61.40  ? 98  TYR A OH  1 
ATOM   749  N N   . LEU A 1 98  ? 49.674  60.093 370.684 1.00 44.76  ? 99  LEU A N   1 
ATOM   750  C CA  . LEU A 1 98  ? 50.643  59.061 370.338 1.00 47.51  ? 99  LEU A CA  1 
ATOM   751  C C   . LEU A 1 98  ? 50.963  58.223 371.571 1.00 49.71  ? 99  LEU A C   1 
ATOM   752  O O   . LEU A 1 98  ? 50.532  58.522 372.686 1.00 48.09  ? 99  LEU A O   1 
ATOM   753  C CB  . LEU A 1 98  ? 51.924  59.659 369.731 1.00 42.92  ? 99  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 98  ? 52.622  60.822 370.440 1.00 54.70  ? 99  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 98  ? 53.534  60.311 371.555 1.00 38.36  ? 99  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 98  ? 53.400  61.652 369.421 1.00 42.48  ? 99  LEU A CD2 1 
ATOM   757  N N   . ASN A 1 99  ? 51.725  57.155 371.352 1.00 46.06  ? 100 ASN A N   1 
ATOM   758  C CA  . ASN A 1 99  ? 52.035  56.177 372.380 1.00 40.81  ? 100 ASN A CA  1 
ATOM   759  C C   . ASN A 1 99  ? 53.520  55.857 372.340 1.00 47.15  ? 100 ASN A C   1 
ATOM   760  O O   . ASN A 1 99  ? 54.120  55.804 371.264 1.00 51.75  ? 100 ASN A O   1 
ATOM   761  C CB  . ASN A 1 99  ? 51.220  54.889 372.192 1.00 51.61  ? 100 ASN A CB  1 
ATOM   762  C CG  . ASN A 1 99  ? 49.799  55.158 371.737 1.00 52.09  ? 100 ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 99  ? 48.955  55.603 372.517 1.00 46.08  ? 100 ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 99  ? 49.525  54.881 370.467 1.00 54.46  ? 100 ASN A ND2 1 
ATOM   765  N N   . VAL A 1 100 ? 54.111  55.657 373.517 1.00 51.67  ? 101 VAL A N   1 
ATOM   766  C CA  . VAL A 1 100 ? 55.520  55.303 373.645 1.00 43.53  ? 101 VAL A CA  1 
ATOM   767  C C   . VAL A 1 100 ? 55.625  54.051 374.503 1.00 48.00  ? 101 VAL A C   1 
ATOM   768  O O   . VAL A 1 100 ? 54.996  53.964 375.562 1.00 51.01  ? 101 VAL A O   1 
ATOM   769  C CB  . VAL A 1 100 ? 56.356  56.443 374.262 1.00 48.81  ? 101 VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 100 ? 57.840  56.135 374.147 1.00 46.61  ? 101 VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 100 ? 56.040  57.777 373.594 1.00 37.22  ? 101 VAL A CG2 1 
ATOM   772  N N   . TRP A 1 101 ? 56.400  53.082 374.034 1.00 49.55  ? 102 TRP A N   1 
ATOM   773  C CA  . TRP A 1 101 ? 56.743  51.885 374.787 1.00 44.07  ? 102 TRP A CA  1 
ATOM   774  C C   . TRP A 1 101 ? 58.249  51.902 374.985 1.00 58.42  ? 102 TRP A C   1 
ATOM   775  O O   . TRP A 1 101 ? 58.994  52.085 374.018 1.00 49.05  ? 102 TRP A O   1 
ATOM   776  C CB  . TRP A 1 101 ? 56.340  50.604 374.040 1.00 49.17  ? 102 TRP A CB  1 
ATOM   777  C CG  . TRP A 1 101 ? 54.862  50.316 373.934 1.00 53.95  ? 102 TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 101 ? 54.115  49.552 374.783 1.00 46.49  ? 102 TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 101 ? 53.966  50.747 372.896 1.00 56.12  ? 102 TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 101 ? 52.807  49.498 374.356 1.00 49.91  ? 102 TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 101 ? 52.691  50.222 373.198 1.00 62.37  ? 102 TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 101 ? 54.115  51.534 371.748 1.00 53.28  ? 102 TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 101 ? 51.575  50.456 372.394 1.00 60.40  ? 102 TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 101 ? 53.000  51.767 370.951 1.00 54.42  ? 102 TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 101 ? 51.750  51.229 371.280 1.00 53.86  ? 102 TRP A CH2 1 
ATOM   786  N N   . THR A 1 102 ? 58.697  51.736 376.222 1.00 53.21  ? 103 THR A N   1 
ATOM   787  C CA  . THR A 1 102 ? 60.113  51.618 376.529 1.00 51.81  ? 103 THR A CA  1 
ATOM   788  C C   . THR A 1 102 ? 60.335  50.359 377.349 1.00 51.89  ? 103 THR A C   1 
ATOM   789  O O   . THR A 1 102 ? 59.400  49.847 377.976 1.00 62.62  ? 103 THR A O   1 
ATOM   790  C CB  . THR A 1 102 ? 60.648  52.843 377.287 1.00 51.49  ? 103 THR A CB  1 
ATOM   791  O OG1 . THR A 1 102 ? 59.979  52.962 378.550 1.00 72.12  ? 103 THR A OG1 1 
ATOM   792  C CG2 . THR A 1 102 ? 60.425  54.100 376.474 1.00 60.99  ? 103 THR A CG2 1 
ATOM   793  N N   . PRO A 1 103 ? 61.553  49.815 377.341 1.00 45.56  ? 104 PRO A N   1 
ATOM   794  C CA  . PRO A 1 103 ? 61.894  48.763 378.303 1.00 56.65  ? 104 PRO A CA  1 
ATOM   795  C C   . PRO A 1 103 ? 61.677  49.230 379.737 1.00 59.92  ? 104 PRO A C   1 
ATOM   796  O O   . PRO A 1 103 ? 61.606  50.426 380.031 1.00 55.45  ? 104 PRO A O   1 
ATOM   797  C CB  . PRO A 1 103 ? 63.378  48.497 378.025 1.00 54.80  ? 104 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 103 ? 63.561  48.893 376.595 1.00 55.27  ? 104 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 103 ? 62.661  50.083 376.406 1.00 53.60  ? 104 PRO A CD  1 
ATOM   800  N N   . TYR A 1 104 ? 61.549  48.255 380.635 1.00 62.86  ? 105 TYR A N   1 
ATOM   801  C CA  . TYR A 1 104 ? 61.451  48.509 382.070 1.00 61.51  ? 105 TYR A CA  1 
ATOM   802  C C   . TYR A 1 104 ? 62.654  47.879 382.757 1.00 67.95  ? 105 TYR A C   1 
ATOM   803  O O   . TYR A 1 104 ? 62.898  46.672 382.573 1.00 58.26  ? 105 TYR A O   1 
ATOM   804  C CB  . TYR A 1 104 ? 60.151  47.949 382.648 1.00 57.16  ? 105 TYR A CB  1 
ATOM   805  C CG  . TYR A 1 104 ? 59.854  48.412 384.062 1.00 64.61  ? 105 TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 104 ? 60.469  47.813 385.158 1.00 57.89  ? 105 TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 104 ? 58.956  49.446 384.300 1.00 65.13  ? 105 TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 104 ? 60.198  48.234 386.450 1.00 56.64  ? 105 TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 104 ? 58.679  49.875 385.586 1.00 68.76  ? 105 TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 104 ? 59.302  49.262 386.658 1.00 78.59  ? 105 TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 104 ? 59.033  49.678 387.942 1.00 70.18  ? 105 TYR A OH  1 
ATOM   812  N N   . PRO A 1 105 ? 63.448  48.637 383.531 1.00 78.07  ? 106 PRO A N   1 
ATOM   813  C CA  . PRO A 1 105 ? 63.290  50.086 383.711 1.00 70.33  ? 106 PRO A CA  1 
ATOM   814  C C   . PRO A 1 105 ? 63.752  50.859 382.474 1.00 55.08  ? 106 PRO A C   1 
ATOM   815  O O   . PRO A 1 105 ? 64.424  50.258 381.635 1.00 60.41  ? 106 PRO A O   1 
ATOM   816  C CB  . PRO A 1 105 ? 64.187  50.381 384.912 1.00 61.18  ? 106 PRO A CB  1 
ATOM   817  C CG  . PRO A 1 105 ? 65.269  49.346 384.815 1.00 52.72  ? 106 PRO A CG  1 
ATOM   818  C CD  . PRO A 1 105 ? 64.590  48.107 384.301 1.00 67.88  ? 106 PRO A CD  1 
ATOM   819  N N   . ARG A 1 106 ? 63.404  52.142 382.372 1.00 64.80  ? 107 ARG A N   1 
ATOM   820  C CA  . ARG A 1 106 ? 63.748  52.931 381.195 1.00 61.25  ? 107 ARG A CA  1 
ATOM   821  C C   . ARG A 1 106 ? 65.238  52.808 380.887 1.00 67.93  ? 107 ARG A C   1 
ATOM   822  O O   . ARG A 1 106 ? 66.060  52.734 381.811 1.00 78.95  ? 107 ARG A O   1 
ATOM   823  C CB  . ARG A 1 106 ? 63.390  54.404 381.404 1.00 54.43  ? 107 ARG A CB  1 
ATOM   824  C CG  . ARG A 1 106 ? 61.931  54.648 381.675 1.00 69.25  ? 107 ARG A CG  1 
ATOM   825  C CD  . ARG A 1 106 ? 61.449  55.941 381.040 1.00 73.91  ? 107 ARG A CD  1 
ATOM   826  N NE  . ARG A 1 106 ? 62.214  57.110 381.469 1.00 77.71  ? 107 ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 106 ? 61.953  57.814 382.564 1.00 78.85  ? 107 ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 106 ? 60.951  57.463 383.359 1.00 80.56  ? 107 ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 106 ? 62.697  58.869 382.870 1.00 96.56  ? 107 ARG A NH2 1 
ATOM   830  N N   . PRO A 1 107 ? 65.620  52.776 379.613 1.00 63.68  ? 108 PRO A N   1 
ATOM   831  C CA  . PRO A 1 107 ? 67.042  52.658 379.272 1.00 75.76  ? 108 PRO A CA  1 
ATOM   832  C C   . PRO A 1 107 ? 67.845  53.840 379.799 1.00 73.65  ? 108 PRO A C   1 
ATOM   833  O O   . PRO A 1 107 ? 67.357  54.971 379.863 1.00 64.82  ? 108 PRO A O   1 
ATOM   834  C CB  . PRO A 1 107 ? 67.037  52.618 377.739 1.00 76.51  ? 108 PRO A CB  1 
ATOM   835  C CG  . PRO A 1 107 ? 65.647  52.215 377.365 1.00 60.39  ? 108 PRO A CG  1 
ATOM   836  C CD  . PRO A 1 107 ? 64.756  52.772 378.421 1.00 56.80  ? 108 PRO A CD  1 
ATOM   837  N N   . THR A 1 108 ? 69.100  53.620 380.137 1.00 84.08  ? 109 THR A N   1 
ATOM   838  C CA  . THR A 1 108 ? 69.948  54.711 380.600 1.00 99.60  ? 109 THR A CA  1 
ATOM   839  C C   . THR A 1 108 ? 70.727  55.322 379.446 1.00 82.65  ? 109 THR A C   1 
ATOM   840  O O   . THR A 1 108 ? 71.063  56.478 379.469 1.00 92.91  ? 109 THR A O   1 
ATOM   841  C CB  . THR A 1 108 ? 70.896  54.264 381.708 1.00 81.80  ? 109 THR A CB  1 
ATOM   842  O OG1 . THR A 1 108 ? 71.666  53.163 381.250 1.00 95.34  ? 109 THR A OG1 1 
ATOM   843  C CG2 . THR A 1 108 ? 70.124  53.828 382.876 1.00 54.70  ? 109 THR A CG2 1 
ATOM   844  N N   . SER A 1 109 ? 70.985  54.520 378.433 1.00 66.02  ? 110 SER A N   1 
ATOM   845  C CA  . SER A 1 109 ? 71.678  54.934 377.225 1.00 84.80  ? 110 SER A CA  1 
ATOM   846  C C   . SER A 1 109 ? 70.684  55.176 376.094 1.00 76.53  ? 110 SER A C   1 
ATOM   847  O O   . SER A 1 109 ? 69.593  54.599 376.087 1.00 72.29  ? 110 SER A O   1 
ATOM   848  C CB  . SER A 1 109 ? 72.684  53.863 376.797 1.00 70.99  ? 110 SER A CB  1 
ATOM   849  O OG  . SER A 1 109 ? 73.300  53.271 377.924 1.00 92.07  ? 110 SER A OG  1 
ATOM   850  N N   . PRO A 1 110 ? 71.025  56.026 375.125 1.00 78.33  ? 111 PRO A N   1 
ATOM   851  C CA  . PRO A 1 110 ? 70.107  56.264 374.001 1.00 79.31  ? 111 PRO A CA  1 
ATOM   852  C C   . PRO A 1 110 ? 69.821  54.978 373.235 1.00 77.76  ? 111 PRO A C   1 
ATOM   853  O O   . PRO A 1 110 ? 70.734  54.268 372.807 1.00 74.49  ? 111 PRO A O   1 
ATOM   854  C CB  . PRO A 1 110 ? 70.855  57.289 373.141 1.00 69.59  ? 111 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 110 ? 71.837  57.939 374.079 1.00 68.45  ? 111 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 110 ? 72.225  56.879 375.059 1.00 72.02  ? 111 PRO A CD  1 
ATOM   857  N N   . THR A 1 111 ? 68.532  54.679 373.074 1.00 57.62  ? 112 THR A N   1 
ATOM   858  C CA  . THR A 1 111 ? 68.043  53.451 372.472 1.00 67.24  ? 112 THR A CA  1 
ATOM   859  C C   . THR A 1 111 ? 67.403  53.735 371.110 1.00 67.81  ? 112 THR A C   1 
ATOM   860  O O   . THR A 1 111 ? 66.698  54.741 370.962 1.00 63.74  ? 112 THR A O   1 
ATOM   861  C CB  . THR A 1 111 ? 67.020  52.797 373.411 1.00 77.59  ? 112 THR A CB  1 
ATOM   862  O OG1 . THR A 1 111 ? 67.688  52.324 374.590 1.00 75.88  ? 112 THR A OG1 1 
ATOM   863  C CG2 . THR A 1 111 ? 66.316  51.635 372.741 1.00 62.82  ? 112 THR A CG2 1 
ATOM   864  N N   . PRO A 1 112 ? 67.651  52.899 370.093 1.00 69.13  ? 113 PRO A N   1 
ATOM   865  C CA  . PRO A 1 112 ? 67.043  53.139 368.774 1.00 71.39  ? 113 PRO A CA  1 
ATOM   866  C C   . PRO A 1 112 ? 65.521  53.097 368.830 1.00 60.29  ? 113 PRO A C   1 
ATOM   867  O O   . PRO A 1 112 ? 64.922  52.319 369.579 1.00 62.66  ? 113 PRO A O   1 
ATOM   868  C CB  . PRO A 1 112 ? 67.601  52.000 367.910 1.00 64.77  ? 113 PRO A CB  1 
ATOM   869  C CG  . PRO A 1 112 ? 68.056  50.963 368.886 1.00 68.95  ? 113 PRO A CG  1 
ATOM   870  C CD  . PRO A 1 112 ? 68.549  51.733 370.071 1.00 64.76  ? 113 PRO A CD  1 
ATOM   871  N N   . VAL A 1 113 ? 64.898  53.946 368.015 1.00 52.96  ? 114 VAL A N   1 
ATOM   872  C CA  . VAL A 1 113 ? 63.461  54.198 368.056 1.00 39.96  ? 114 VAL A CA  1 
ATOM   873  C C   . VAL A 1 113 ? 62.818  53.669 366.779 1.00 51.00  ? 114 VAL A C   1 
ATOM   874  O O   . VAL A 1 113 ? 63.314  53.917 365.673 1.00 44.25  ? 114 VAL A O   1 
ATOM   875  C CB  . VAL A 1 113 ? 63.172  55.697 368.236 1.00 45.98  ? 114 VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 113 ? 61.672  55.966 368.280 1.00 43.09  ? 114 VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 113 ? 63.858  56.213 369.494 1.00 53.78  ? 114 VAL A CG2 1 
ATOM   878  N N   . LEU A 1 114 ? 61.720  52.933 366.939 1.00 47.20  ? 115 LEU A N   1 
ATOM   879  C CA  . LEU A 1 114 ? 60.838  52.537 365.850 1.00 50.59  ? 115 LEU A CA  1 
ATOM   880  C C   . LEU A 1 114 ? 59.561  53.363 365.934 1.00 52.18  ? 115 LEU A C   1 
ATOM   881  O O   . LEU A 1 114 ? 58.977  53.494 367.016 1.00 45.47  ? 115 LEU A O   1 
ATOM   882  C CB  . LEU A 1 114 ? 60.500  51.046 365.929 1.00 43.19  ? 115 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 114 ? 61.573  50.077 365.445 1.00 51.49  ? 115 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 114 ? 61.387  48.717 366.094 1.00 52.21  ? 115 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 114 ? 61.515  49.967 363.926 1.00 56.55  ? 115 LEU A CD2 1 
ATOM   886  N N   . VAL A 1 115 ? 59.136  53.925 364.805 1.00 40.70  ? 116 VAL A N   1 
ATOM   887  C CA  . VAL A 1 115 ? 57.888  54.674 364.725 1.00 45.36  ? 116 VAL A CA  1 
ATOM   888  C C   . VAL A 1 115 ? 56.967  53.956 363.752 1.00 49.05  ? 116 VAL A C   1 
ATOM   889  O O   . VAL A 1 115 ? 57.349  53.690 362.608 1.00 48.39  ? 116 VAL A O   1 
ATOM   890  C CB  . VAL A 1 115 ? 58.108  56.135 364.293 1.00 44.12  ? 116 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 115 ? 56.797  56.902 364.374 1.00 43.30  ? 116 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 115 ? 59.156  56.800 365.166 1.00 42.19  ? 116 VAL A CG2 1 
ATOM   893  N N   . TRP A 1 116 ? 55.762  53.643 364.210 1.00 49.96  ? 117 TRP A N   1 
ATOM   894  C CA  . TRP A 1 116 ? 54.795  52.870 363.446 1.00 42.57  ? 117 TRP A CA  1 
ATOM   895  C C   . TRP A 1 116 ? 53.710  53.795 362.914 1.00 46.55  ? 117 TRP A C   1 
ATOM   896  O O   . TRP A 1 116 ? 53.128  54.577 363.673 1.00 47.34  ? 117 TRP A O   1 
ATOM   897  C CB  . TRP A 1 116 ? 54.180  51.774 364.321 1.00 46.75  ? 117 TRP A CB  1 
ATOM   898  C CG  . TRP A 1 116 ? 53.022  51.059 363.684 1.00 50.56  ? 117 TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 116 ? 51.699  51.179 364.014 1.00 53.47  ? 117 TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 116 ? 53.084  50.103 362.623 1.00 49.28  ? 117 TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 116 ? 50.936  50.365 363.217 1.00 48.21  ? 117 TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 116 ? 51.761  49.692 362.354 1.00 48.63  ? 117 TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 116 ? 54.128  49.560 361.867 1.00 44.36  ? 117 TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 116 ? 51.457  48.760 361.365 1.00 47.92  ? 117 TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 116 ? 53.823  48.634 360.882 1.00 54.28  ? 117 TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 116 ? 52.499  48.244 360.640 1.00 48.35  ? 117 TRP A CH2 1 
ATOM   907  N N   . ILE A 1 117 ? 53.451  53.713 361.610 1.00 51.28  ? 118 ILE A N   1 
ATOM   908  C CA  . ILE A 1 117 ? 52.364  54.441 360.963 1.00 50.37  ? 118 ILE A CA  1 
ATOM   909  C C   . ILE A 1 117 ? 51.391  53.398 360.432 1.00 43.53  ? 118 ILE A C   1 
ATOM   910  O O   . ILE A 1 117 ? 51.734  52.633 359.523 1.00 49.22  ? 118 ILE A O   1 
ATOM   911  C CB  . ILE A 1 117 ? 52.869  55.357 359.840 1.00 47.04  ? 118 ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 117 ? 53.915  56.337 360.390 1.00 45.89  ? 118 ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 117 ? 51.704  56.087 359.175 1.00 46.84  ? 118 ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 117 ? 54.614  57.152 359.324 1.00 50.24  ? 118 ILE A CD1 1 
ATOM   915  N N   . TYR A 1 118 ? 50.188  53.355 361.002 1.00 45.55  ? 119 TYR A N   1 
ATOM   916  C CA  . TYR A 1 118 ? 49.222  52.334 360.619 1.00 51.81  ? 119 TYR A CA  1 
ATOM   917  C C   . TYR A 1 118 ? 48.654  52.612 359.228 1.00 53.87  ? 119 TYR A C   1 
ATOM   918  O O   . TYR A 1 118 ? 48.719  53.729 358.703 1.00 44.44  ? 119 TYR A O   1 
ATOM   919  C CB  . TYR A 1 118 ? 48.081  52.237 361.646 1.00 39.36  ? 119 TYR A CB  1 
ATOM   920  C CG  . TYR A 1 118 ? 47.295  53.519 361.887 1.00 48.45  ? 119 TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 118 ? 46.464  54.052 360.908 1.00 46.76  ? 119 TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 118 ? 47.368  54.182 363.110 1.00 50.83  ? 119 TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 118 ? 45.746  55.217 361.131 1.00 43.41  ? 119 TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 118 ? 46.653  55.348 363.340 1.00 40.85  ? 119 TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 118 ? 45.847  55.862 362.348 1.00 45.35  ? 119 TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 118 ? 45.136  57.022 362.575 1.00 48.97  ? 119 TYR A OH  1 
ATOM   927  N N   . GLY A 1 119 ? 48.087  51.564 358.628 1.00 48.82  ? 120 GLY A N   1 
ATOM   928  C CA  . GLY A 1 119 ? 47.366  51.681 357.382 1.00 49.49  ? 120 GLY A CA  1 
ATOM   929  C C   . GLY A 1 119 ? 45.863  51.708 357.600 1.00 53.13  ? 120 GLY A C   1 
ATOM   930  O O   . GLY A 1 119 ? 45.364  51.855 358.718 1.00 56.24  ? 120 GLY A O   1 
ATOM   931  N N   . GLY A 1 120 ? 45.166  51.519 356.506 1.00 49.17  ? 121 GLY A N   1 
ATOM   932  C CA  . GLY A 1 120 ? 43.739  51.542 356.460 1.00 40.68  ? 121 GLY A CA  1 
ATOM   933  C C   . GLY A 1 120 ? 43.171  52.412 355.385 1.00 46.93  ? 121 GLY A C   1 
ATOM   934  O O   . GLY A 1 120 ? 42.175  53.028 355.572 1.00 48.80  ? 121 GLY A O   1 
ATOM   935  N N   . GLY A 1 121 ? 43.826  52.414 354.241 1.00 49.04  ? 122 GLY A N   1 
ATOM   936  C CA  . GLY A 1 121 ? 43.381  53.084 353.032 1.00 44.23  ? 122 GLY A CA  1 
ATOM   937  C C   . GLY A 1 121 ? 43.273  54.587 353.128 1.00 52.40  ? 122 GLY A C   1 
ATOM   938  O O   . GLY A 1 121 ? 42.622  55.203 352.280 1.00 47.32  ? 122 GLY A O   1 
ATOM   939  N N   . PHE A 1 122 ? 43.902  55.198 354.133 1.00 46.06  ? 123 PHE A N   1 
ATOM   940  C CA  . PHE A 1 122 ? 43.782  56.621 354.452 1.00 48.03  ? 123 PHE A CA  1 
ATOM   941  C C   . PHE A 1 122 ? 42.375  57.002 354.898 1.00 47.99  ? 123 PHE A C   1 
ATOM   942  O O   . PHE A 1 122 ? 42.087  58.192 355.075 1.00 49.29  ? 123 PHE A O   1 
ATOM   943  C CB  . PHE A 1 122 ? 44.213  57.521 353.280 1.00 42.41  ? 123 PHE A CB  1 
ATOM   944  C CG  . PHE A 1 122 ? 45.684  57.455 352.969 1.00 49.52  ? 123 PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 122 ? 46.621  57.954 353.866 1.00 43.89  ? 123 PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 122 ? 46.132  56.897 351.777 1.00 43.82  ? 123 PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 122 ? 47.982  57.892 353.587 1.00 47.11  ? 123 PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 122 ? 47.493  56.835 351.486 1.00 49.74  ? 123 PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 122 ? 48.417  57.334 352.393 1.00 54.18  ? 123 PHE A CZ  1 
ATOM   950  N N   . TYR A 1 123 ? 41.484  56.027 355.084 1.00 43.42  ? 124 TYR A N   1 
ATOM   951  C CA  . TYR A 1 123 ? 40.140  56.305 355.564 1.00 55.24  ? 124 TYR A CA  1 
ATOM   952  C C   . TYR A 1 123 ? 39.846  55.667 356.911 1.00 51.16  ? 124 TYR A C   1 
ATOM   953  O O   . TYR A 1 123 ? 38.766  55.905 357.463 1.00 48.73  ? 124 TYR A O   1 
ATOM   954  C CB  . TYR A 1 123 ? 39.083  55.836 354.543 1.00 45.08  ? 124 TYR A CB  1 
ATOM   955  C CG  . TYR A 1 123 ? 39.003  54.331 354.398 1.00 48.22  ? 124 TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 123 ? 38.183  53.568 355.228 1.00 53.58  ? 124 TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 123 ? 39.750  53.671 353.431 1.00 56.93  ? 124 TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 123 ? 38.122  52.190 355.105 1.00 55.33  ? 124 TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 123 ? 39.692  52.296 353.297 1.00 47.84  ? 124 TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 123 ? 38.877  51.562 354.136 1.00 57.98  ? 124 TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 123 ? 38.819  50.195 354.000 1.00 68.60  ? 124 TYR A OH  1 
ATOM   962  N N   . SER A 1 124 ? 40.761  54.864 357.448 1.00 50.89  ? 125 SER A N   1 
ATOM   963  C CA  . SER A 1 124 ? 40.543  54.166 358.707 1.00 47.99  ? 125 SER A CA  1 
ATOM   964  C C   . SER A 1 124 ? 41.904  53.848 359.318 1.00 51.95  ? 125 SER A C   1 
ATOM   965  O O   . SER A 1 124 ? 42.951  54.188 358.763 1.00 49.31  ? 125 SER A O   1 
ATOM   966  C CB  . SER A 1 124 ? 39.722  52.892 358.494 1.00 55.72  ? 125 SER A CB  1 
ATOM   967  O OG  . SER A 1 124 ? 40.413  51.989 357.644 1.00 50.42  ? 125 SER A OG  1 
ATOM   968  N N   . GLY A 1 125 ? 41.876  53.161 360.458 1.00 50.33  ? 126 GLY A N   1 
ATOM   969  C CA  . GLY A 1 125 ? 43.088  52.802 361.165 1.00 47.79  ? 126 GLY A CA  1 
ATOM   970  C C   . GLY A 1 125 ? 43.144  53.406 362.555 1.00 45.99  ? 126 GLY A C   1 
ATOM   971  O O   . GLY A 1 125 ? 42.464  54.399 362.839 1.00 41.85  ? 126 GLY A O   1 
ATOM   972  N N   . ALA A 1 126 ? 43.946  52.810 363.434 1.00 40.68  ? 127 ALA A N   1 
ATOM   973  C CA  . ALA A 1 126 ? 44.126  53.335 364.779 1.00 45.99  ? 127 ALA A CA  1 
ATOM   974  C C   . ALA A 1 126 ? 45.377  52.715 365.380 1.00 45.56  ? 127 ALA A C   1 
ATOM   975  O O   . ALA A 1 126 ? 45.683  51.548 365.123 1.00 50.40  ? 127 ALA A O   1 
ATOM   976  C CB  . ALA A 1 126 ? 42.911  53.051 365.669 1.00 45.45  ? 127 ALA A CB  1 
ATOM   977  N N   . SER A 1 127 ? 46.101  53.504 366.173 1.00 50.40  ? 128 SER A N   1 
ATOM   978  C CA  . SER A 1 127 ? 47.291  52.988 366.838 1.00 51.25  ? 128 SER A CA  1 
ATOM   979  C C   . SER A 1 127 ? 46.960  52.105 368.033 1.00 51.55  ? 128 SER A C   1 
ATOM   980  O O   . SER A 1 127 ? 47.865  51.463 368.579 1.00 52.50  ? 128 SER A O   1 
ATOM   981  C CB  . SER A 1 127 ? 48.184  54.150 367.282 1.00 59.61  ? 128 SER A CB  1 
ATOM   982  O OG  . SER A 1 127 ? 47.464  55.051 368.105 1.00 56.58  ? 128 SER A OG  1 
ATOM   983  N N   . SER A 1 128 ? 45.692  52.047 368.438 1.00 47.81  ? 129 SER A N   1 
ATOM   984  C CA  . SER A 1 128 ? 45.255  51.329 369.629 1.00 47.89  ? 129 SER A CA  1 
ATOM   985  C C   . SER A 1 128 ? 44.876  49.878 369.365 1.00 53.16  ? 129 SER A C   1 
ATOM   986  O O   . SER A 1 128 ? 44.507  49.173 370.307 1.00 57.39  ? 129 SER A O   1 
ATOM   987  C CB  . SER A 1 128 ? 44.059  52.046 370.250 1.00 41.54  ? 129 SER A CB  1 
ATOM   988  O OG  . SER A 1 128 ? 43.063  52.311 369.281 1.00 41.39  ? 129 SER A OG  1 
ATOM   989  N N   . LEU A 1 129 ? 44.951  49.419 368.121 1.00 55.07  ? 130 LEU A N   1 
ATOM   990  C CA  . LEU A 1 129 ? 44.493  48.082 367.779 1.00 50.94  ? 130 LEU A CA  1 
ATOM   991  C C   . LEU A 1 129 ? 45.404  47.022 368.402 1.00 51.11  ? 130 LEU A C   1 
ATOM   992  O O   . LEU A 1 129 ? 46.615  47.217 368.534 1.00 52.38  ? 130 LEU A O   1 
ATOM   993  C CB  . LEU A 1 129 ? 44.449  47.922 366.260 1.00 37.67  ? 130 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 129 ? 43.541  48.833 365.434 1.00 61.83  ? 130 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 129 ? 43.597  48.407 363.975 1.00 39.19  ? 130 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 129 ? 42.118  48.799 365.953 1.00 54.06  ? 130 LEU A CD2 1 
ATOM   997  N N   . ASP A 1 130 ? 44.805  45.881 368.768 1.00 47.04  ? 131 ASP A N   1 
ATOM   998  C CA  . ASP A 1 130 ? 45.550  44.831 369.462 1.00 45.02  ? 131 ASP A CA  1 
ATOM   999  C C   . ASP A 1 130 ? 46.735  44.340 368.637 1.00 51.22  ? 131 ASP A C   1 
ATOM   1000 O O   . ASP A 1 130 ? 47.785  44.002 369.192 1.00 59.86  ? 131 ASP A O   1 
ATOM   1001 C CB  . ASP A 1 130 ? 44.633  43.652 369.805 1.00 61.07  ? 131 ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 130 ? 43.452  44.056 370.676 1.00 61.01  ? 131 ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 130 ? 43.592  45.011 371.469 1.00 60.95  ? 131 ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 130 ? 42.383  43.415 370.571 1.00 80.08  ? 131 ASP A OD2 1 
ATOM   1005 N N   . VAL A 1 131 ? 46.585  44.296 367.309 1.00 50.75  ? 132 VAL A N   1 
ATOM   1006 C CA  . VAL A 1 131 ? 47.640  43.771 366.448 1.00 48.50  ? 132 VAL A CA  1 
ATOM   1007 C C   . VAL A 1 131 ? 48.848  44.696 366.397 1.00 47.12  ? 132 VAL A C   1 
ATOM   1008 O O   . VAL A 1 131 ? 49.932  44.268 365.985 1.00 50.33  ? 132 VAL A O   1 
ATOM   1009 C CB  . VAL A 1 131 ? 47.089  43.496 365.026 1.00 58.08  ? 132 VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 131 ? 46.798  44.768 364.282 1.00 48.76  ? 132 VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 131 ? 48.020  42.597 364.240 1.00 61.28  ? 132 VAL A CG2 1 
ATOM   1012 N N   . TYR A 1 132 ? 48.696  45.952 366.819 1.00 51.25  ? 133 TYR A N   1 
ATOM   1013 C CA  . TYR A 1 132 ? 49.791  46.909 366.880 1.00 58.85  ? 133 TYR A CA  1 
ATOM   1014 C C   . TYR A 1 132 ? 50.376  47.066 368.286 1.00 58.96  ? 133 TYR A C   1 
ATOM   1015 O O   . TYR A 1 132 ? 51.097  48.039 368.537 1.00 56.58  ? 133 TYR A O   1 
ATOM   1016 C CB  . TYR A 1 132 ? 49.331  48.282 366.383 1.00 44.06  ? 133 TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 132 ? 48.707  48.308 365.008 1.00 43.26  ? 133 TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 132 ? 49.040  47.370 364.040 1.00 42.32  ? 133 TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 132 ? 47.782  49.286 364.679 1.00 43.78  ? 133 TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 132 ? 48.466  47.409 362.789 1.00 38.85  ? 133 TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 132 ? 47.203  49.334 363.433 1.00 46.24  ? 133 TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 132 ? 47.545  48.396 362.492 1.00 48.04  ? 133 TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 132 ? 46.962  48.453 361.249 1.00 52.37  ? 133 TYR A OH  1 
ATOM   1024 N N   . ASP A 1 133 ? 50.075  46.150 369.207 1.00 68.38  ? 134 ASP A N   1 
ATOM   1025 C CA  . ASP A 1 133 ? 50.556  46.265 370.582 1.00 44.22  ? 134 ASP A CA  1 
ATOM   1026 C C   . ASP A 1 133 ? 52.076  46.141 370.606 1.00 54.05  ? 134 ASP A C   1 
ATOM   1027 O O   . ASP A 1 133 ? 52.630  45.121 370.182 1.00 53.58  ? 134 ASP A O   1 
ATOM   1028 C CB  . ASP A 1 133 ? 49.904  45.189 371.451 1.00 57.20  ? 134 ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 133 ? 50.392  45.209 372.895 1.00 68.49  ? 134 ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 133 ? 50.216  44.184 373.589 1.00 65.57  ? 134 ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 133 ? 50.948  46.238 373.339 1.00 59.34  ? 134 ASP A OD2 1 
ATOM   1032 N N   . GLY A 1 134 ? 52.751  47.176 371.105 1.00 52.90  ? 135 GLY A N   1 
ATOM   1033 C CA  . GLY A 1 134 ? 54.198  47.208 371.084 1.00 57.98  ? 135 GLY A CA  1 
ATOM   1034 C C   . GLY A 1 134 ? 54.933  46.491 372.201 1.00 53.58  ? 135 GLY A C   1 
ATOM   1035 O O   . GLY A 1 134 ? 56.168  46.481 372.189 1.00 50.14  ? 135 GLY A O   1 
ATOM   1036 N N   . ARG A 1 135 ? 54.237  45.867 373.152 1.00 50.70  ? 136 ARG A N   1 
ATOM   1037 C CA  . ARG A 1 135 ? 54.927  45.368 374.341 1.00 50.39  ? 136 ARG A CA  1 
ATOM   1038 C C   . ARG A 1 135 ? 55.905  44.242 374.017 1.00 56.90  ? 136 ARG A C   1 
ATOM   1039 O O   . ARG A 1 135 ? 56.962  44.148 374.652 1.00 57.11  ? 136 ARG A O   1 
ATOM   1040 C CB  . ARG A 1 135 ? 53.910  44.910 375.391 1.00 52.00  ? 136 ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 135 ? 53.283  43.544 375.122 1.00 53.52  ? 136 ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 135 ? 52.213  43.214 376.146 1.00 55.31  ? 136 ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 135 ? 51.061  44.097 376.009 1.00 60.87  ? 136 ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 135 ? 50.210  44.368 376.990 1.00 57.04  ? 136 ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 135 ? 50.383  43.825 378.187 1.00 57.42  ? 136 ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 135 ? 49.193  45.190 376.775 1.00 57.88  ? 136 ARG A NH2 1 
ATOM   1047 N N   . PHE A 1 136 ? 55.595  43.399 373.064 1.00 53.13  ? 137 PHE A N   1 
ATOM   1048 C CA  . PHE A 1 136 ? 56.453  42.285 372.755 1.00 51.85  ? 137 PHE A CA  1 
ATOM   1049 C C   . PHE A 1 136 ? 57.690  42.641 372.014 1.00 51.23  ? 137 PHE A C   1 
ATOM   1050 O O   . PHE A 1 136 ? 58.735  42.148 372.291 1.00 55.80  ? 137 PHE A O   1 
ATOM   1051 C CB  . PHE A 1 136 ? 55.691  41.255 371.972 1.00 57.74  ? 137 PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 136 ? 54.421  40.851 372.610 1.00 72.18  ? 137 PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 136 ? 54.430  40.040 373.689 1.00 59.55  ? 137 PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 136 ? 53.234  41.307 372.142 1.00 56.60  ? 137 PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 136 ? 53.280  39.689 374.292 1.00 68.68  ? 137 PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 136 ? 52.078  40.947 372.734 1.00 65.51  ? 137 PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 136 ? 52.100  40.137 373.812 1.00 70.07  ? 137 PHE A CZ  1 
ATOM   1058 N N   . LEU A 1 137 ? 57.551  43.493 371.036 1.00 58.54  ? 138 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 137 ? 58.696  43.941 370.256 1.00 60.98  ? 138 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 137 ? 59.736  44.597 371.148 1.00 51.78  ? 138 LEU A C   1 
ATOM   1061 O O   . LEU A 1 137 ? 60.937  44.331 371.028 1.00 54.59  ? 138 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 137 ? 58.220  44.913 369.175 1.00 58.00  ? 138 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 137 ? 59.142  45.320 368.033 1.00 54.26  ? 138 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 137 ? 59.949  44.134 367.546 1.00 48.91  ? 138 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 137 ? 58.293  45.897 366.904 1.00 53.84  ? 138 LEU A CD2 1 
ATOM   1066 N N   . VAL A 1 138 ? 59.288  45.447 372.068 1.00 50.70  ? 139 VAL A N   1 
ATOM   1067 C CA  . VAL A 1 138 ? 60.233  46.213 372.861 1.00 63.76  ? 139 VAL A CA  1 
ATOM   1068 C C   . VAL A 1 138 ? 60.814  45.406 374.011 1.00 62.51  ? 139 VAL A C   1 
ATOM   1069 O O   . VAL A 1 138 ? 61.925  45.701 374.461 1.00 58.33  ? 139 VAL A O   1 
ATOM   1070 C CB  . VAL A 1 138 ? 59.556  47.493 373.363 1.00 54.99  ? 139 VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 138 ? 58.813  48.153 372.228 1.00 57.77  ? 139 VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 138 ? 58.632  47.219 374.523 1.00 65.45  ? 139 VAL A CG2 1 
ATOM   1073 N N   . GLN A 1 139 ? 60.107  44.389 374.497 1.00 54.78  ? 140 GLN A N   1 
ATOM   1074 C CA  . GLN A 1 139 ? 60.709  43.506 375.483 1.00 57.63  ? 140 GLN A CA  1 
ATOM   1075 C C   . GLN A 1 139 ? 61.772  42.628 374.836 1.00 56.97  ? 140 GLN A C   1 
ATOM   1076 O O   . GLN A 1 139 ? 62.874  42.473 375.374 1.00 58.67  ? 140 GLN A O   1 
ATOM   1077 C CB  . GLN A 1 139 ? 59.629  42.662 376.161 1.00 57.88  ? 140 GLN A CB  1 
ATOM   1078 C CG  . GLN A 1 139 ? 60.089  41.926 377.411 1.00 50.89  ? 140 GLN A CG  1 
ATOM   1079 C CD  . GLN A 1 139 ? 60.953  40.714 377.094 1.00 62.52  ? 140 GLN A CD  1 
ATOM   1080 O OE1 . GLN A 1 139 ? 60.651  39.943 376.182 1.00 58.14  ? 140 GLN A OE1 1 
ATOM   1081 N NE2 . GLN A 1 139 ? 62.047  40.555 377.836 1.00 61.34  ? 140 GLN A NE2 1 
ATOM   1082 N N   . ALA A 1 140 ? 61.464  42.058 373.667 1.00 60.57  ? 141 ALA A N   1 
ATOM   1083 C CA  . ALA A 1 140 ? 62.377  41.099 373.053 1.00 57.44  ? 141 ALA A CA  1 
ATOM   1084 C C   . ALA A 1 140 ? 63.587  41.778 372.431 1.00 58.03  ? 141 ALA A C   1 
ATOM   1085 O O   . ALA A 1 140 ? 64.681  41.202 372.418 1.00 60.66  ? 141 ALA A O   1 
ATOM   1086 C CB  . ALA A 1 140 ? 61.647  40.276 371.993 1.00 63.82  ? 141 ALA A CB  1 
ATOM   1087 N N   . GLU A 1 141 ? 63.416  42.983 371.899 1.00 50.02  ? 142 GLU A N   1 
ATOM   1088 C CA  . GLU A 1 141 ? 64.484  43.636 371.162 1.00 62.05  ? 142 GLU A CA  1 
ATOM   1089 C C   . GLU A 1 141 ? 64.962  44.938 371.786 1.00 64.20  ? 142 GLU A C   1 
ATOM   1090 O O   . GLU A 1 141 ? 65.961  45.491 371.315 1.00 59.73  ? 142 GLU A O   1 
ATOM   1091 C CB  . GLU A 1 141 ? 64.052  43.896 369.708 1.00 55.44  ? 142 GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 141 ? 63.793  42.626 368.898 1.00 45.11  ? 142 GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 141 ? 65.019  41.732 368.793 1.00 67.86  ? 142 GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 141 ? 66.151  42.263 368.767 1.00 59.35  ? 142 GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 141 ? 64.852  40.493 368.743 1.00 67.02  ? 142 GLU A OE2 1 
ATOM   1096 N N   . ARG A 1 142 ? 64.287  45.444 372.819 1.00 51.03  ? 143 ARG A N   1 
ATOM   1097 C CA  . ARG A 1 142 ? 64.786  46.574 373.603 1.00 71.22  ? 143 ARG A CA  1 
ATOM   1098 C C   . ARG A 1 142 ? 65.052  47.797 372.726 1.00 61.65  ? 143 ARG A C   1 
ATOM   1099 O O   . ARG A 1 142 ? 66.122  48.405 372.765 1.00 63.49  ? 143 ARG A O   1 
ATOM   1100 C CB  . ARG A 1 142 ? 66.031  46.173 374.399 1.00 51.43  ? 143 ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 142 ? 65.787  44.975 375.307 1.00 56.40  ? 143 ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 142 ? 66.958  44.718 376.241 1.00 66.09  ? 143 ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 142 ? 67.299  45.901 377.026 1.00 72.51  ? 143 ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 142 ? 66.707  46.244 378.167 1.00 79.57  ? 143 ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 142 ? 65.739  45.489 378.671 1.00 55.73  ? 143 ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 142 ? 67.088  47.343 378.807 1.00 72.57  ? 143 ARG A NH2 1 
ATOM   1107 N N   . THR A 1 143 ? 64.065  48.141 371.916 1.00 60.51  ? 144 THR A N   1 
ATOM   1108 C CA  . THR A 1 143 ? 63.998  49.428 371.249 1.00 55.99  ? 144 THR A CA  1 
ATOM   1109 C C   . THR A 1 143 ? 62.900  50.252 371.904 1.00 52.22  ? 144 THR A C   1 
ATOM   1110 O O   . THR A 1 143 ? 62.103  49.743 372.691 1.00 55.02  ? 144 THR A O   1 
ATOM   1111 C CB  . THR A 1 143 ? 63.709  49.263 369.754 1.00 64.49  ? 144 THR A CB  1 
ATOM   1112 O OG1 . THR A 1 143 ? 62.441  48.619 369.600 1.00 60.34  ? 144 THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 143 ? 64.785  48.421 369.076 1.00 60.55  ? 144 THR A CG2 1 
ATOM   1114 N N   . VAL A 1 144 ? 62.859  51.526 371.579 1.00 54.24  ? 145 VAL A N   1 
ATOM   1115 C CA  . VAL A 1 144 ? 61.699  52.342 371.903 1.00 44.02  ? 145 VAL A CA  1 
ATOM   1116 C C   . VAL A 1 144 ? 60.753  52.303 370.712 1.00 57.17  ? 145 VAL A C   1 
ATOM   1117 O O   . VAL A 1 144 ? 61.191  52.337 369.554 1.00 51.95  ? 145 VAL A O   1 
ATOM   1118 C CB  . VAL A 1 144 ? 62.117  53.778 372.260 1.00 56.67  ? 145 VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 144 ? 60.893  54.657 372.431 1.00 54.62  ? 145 VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 144 ? 62.960  53.772 373.537 1.00 51.99  ? 145 VAL A CG2 1 
ATOM   1121 N N   . LEU A 1 145 ? 59.457  52.177 370.986 1.00 41.72  ? 146 LEU A N   1 
ATOM   1122 C CA  . LEU A 1 145 ? 58.441  52.098 369.946 1.00 47.55  ? 146 LEU A CA  1 
ATOM   1123 C C   . LEU A 1 145 ? 57.453  53.236 370.131 1.00 51.01  ? 146 LEU A C   1 
ATOM   1124 O O   . LEU A 1 145 ? 56.973  53.476 371.245 1.00 50.73  ? 146 LEU A O   1 
ATOM   1125 C CB  . LEU A 1 145 ? 57.709  50.754 369.967 1.00 47.69  ? 146 LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 145 ? 56.600  50.579 368.926 1.00 47.79  ? 146 LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 145 ? 57.102  50.887 367.534 1.00 54.57  ? 146 LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 145 ? 56.077  49.172 368.976 1.00 72.12  ? 146 LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 146 ? 57.164  53.937 369.040 1.00 47.57  ? 147 VAL A N   1 
ATOM   1130 C CA  . VAL A 1 146 ? 56.215  55.039 369.026 1.00 45.62  ? 147 VAL A CA  1 
ATOM   1131 C C   . VAL A 1 146 ? 55.201  54.760 367.929 1.00 53.61  ? 147 VAL A C   1 
ATOM   1132 O O   . VAL A 1 146 ? 55.554  54.254 366.858 1.00 50.38  ? 147 VAL A O   1 
ATOM   1133 C CB  . VAL A 1 146 ? 56.910  56.407 368.804 1.00 51.00  ? 147 VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 146 ? 55.917  57.555 368.944 1.00 38.52  ? 147 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 146 ? 58.064  56.596 369.789 1.00 51.31  ? 147 VAL A CG2 1 
ATOM   1136 N N   . SER A 1 147 ? 53.937  55.054 368.211 1.00 49.11  ? 148 SER A N   1 
ATOM   1137 C CA  . SER A 1 147 ? 52.899  55.062 367.197 1.00 41.28  ? 148 SER A CA  1 
ATOM   1138 C C   . SER A 1 147 ? 52.007  56.258 367.462 1.00 47.53  ? 148 SER A C   1 
ATOM   1139 O O   . SER A 1 147 ? 51.831  56.672 368.610 1.00 46.37  ? 148 SER A O   1 
ATOM   1140 C CB  . SER A 1 147 ? 52.077  53.767 367.200 1.00 55.94  ? 148 SER A CB  1 
ATOM   1141 O OG  . SER A 1 147 ? 51.457  53.565 368.456 1.00 49.40  ? 148 SER A OG  1 
ATOM   1142 N N   . MET A 1 148 ? 51.468  56.830 366.393 1.00 40.45  ? 149 MET A N   1 
ATOM   1143 C CA  . MET A 1 148 ? 50.582  57.976 366.511 1.00 41.83  ? 149 MET A CA  1 
ATOM   1144 C C   . MET A 1 148 ? 49.273  57.696 365.789 1.00 49.93  ? 149 MET A C   1 
ATOM   1145 O O   . MET A 1 148 ? 49.213  56.885 364.859 1.00 51.38  ? 149 MET A O   1 
ATOM   1146 C CB  . MET A 1 148 ? 51.222  59.261 365.937 1.00 51.16  ? 149 MET A CB  1 
ATOM   1147 C CG  . MET A 1 148 ? 51.052  59.455 364.426 1.00 52.50  ? 149 MET A CG  1 
ATOM   1148 S SD  . MET A 1 148 ? 51.942  58.201 363.490 1.00 51.72  ? 149 MET A SD  1 
ATOM   1149 C CE  . MET A 1 148 ? 53.641  58.727 363.728 1.00 46.90  ? 149 MET A CE  1 
ATOM   1150 N N   . ASN A 1 149 ? 48.223  58.370 366.235 1.00 44.28  ? 150 ASN A N   1 
ATOM   1151 C CA  . ASN A 1 149 ? 47.014  58.486 365.442 1.00 53.95  ? 150 ASN A CA  1 
ATOM   1152 C C   . ASN A 1 149 ? 47.152  59.687 364.518 1.00 52.11  ? 150 ASN A C   1 
ATOM   1153 O O   . ASN A 1 149 ? 47.667  60.737 364.915 1.00 54.45  ? 150 ASN A O   1 
ATOM   1154 C CB  . ASN A 1 149 ? 45.782  58.651 366.330 1.00 39.78  ? 150 ASN A CB  1 
ATOM   1155 C CG  . ASN A 1 149 ? 45.275  57.332 366.884 1.00 51.85  ? 150 ASN A CG  1 
ATOM   1156 O OD1 . ASN A 1 149 ? 45.874  56.274 366.672 1.00 42.64  ? 150 ASN A OD1 1 
ATOM   1157 N ND2 . ASN A 1 149 ? 44.157  57.390 367.598 1.00 50.97  ? 150 ASN A ND2 1 
ATOM   1158 N N   . TYR A 1 150 ? 46.708  59.524 363.279 1.00 47.75  ? 151 TYR A N   1 
ATOM   1159 C CA  . TYR A 1 150 ? 46.597  60.640 362.356 1.00 49.28  ? 151 TYR A CA  1 
ATOM   1160 C C   . TYR A 1 150 ? 45.201  60.650 361.756 1.00 51.14  ? 151 TYR A C   1 
ATOM   1161 O O   . TYR A 1 150 ? 44.549  59.605 361.644 1.00 46.24  ? 151 TYR A O   1 
ATOM   1162 C CB  . TYR A 1 150 ? 47.645  60.571 361.253 1.00 43.64  ? 151 TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 150 ? 47.581  59.320 360.413 1.00 51.41  ? 151 TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 150 ? 48.272  58.172 360.786 1.00 43.10  ? 151 TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 150 ? 46.836  59.289 359.242 1.00 44.18  ? 151 TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 150 ? 48.225  57.033 360.016 1.00 44.46  ? 151 TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 150 ? 46.779  58.155 358.467 1.00 40.34  ? 151 TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 150 ? 47.475  57.029 358.857 1.00 53.09  ? 151 TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 150 ? 47.422  55.893 358.081 1.00 46.53  ? 151 TYR A OH  1 
ATOM   1170 N N   . ARG A 1 151 ? 44.742  61.840 361.382 1.00 42.76  ? 152 ARG A N   1 
ATOM   1171 C CA  . ARG A 1 151 ? 43.397  61.980 360.840 1.00 53.05  ? 152 ARG A CA  1 
ATOM   1172 C C   . ARG A 1 151 ? 43.272  61.249 359.508 1.00 62.22  ? 152 ARG A C   1 
ATOM   1173 O O   . ARG A 1 151 ? 44.167  61.308 358.659 1.00 51.16  ? 152 ARG A O   1 
ATOM   1174 C CB  . ARG A 1 151 ? 43.046  63.455 360.663 1.00 47.22  ? 152 ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 151 ? 42.700  64.166 361.952 1.00 52.03  ? 152 ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 151 ? 42.608  65.658 361.730 1.00 47.30  ? 152 ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 151 ? 43.930  66.249 361.564 1.00 47.58  ? 152 ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 151 ? 44.141  67.537 361.327 1.00 57.63  ? 152 ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 151 ? 43.110  68.369 361.223 1.00 49.41  ? 152 ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 151 ? 45.378  67.995 361.191 1.00 48.85  ? 152 ARG A NH2 1 
ATOM   1181 N N   . VAL A 1 152 ? 42.146  60.561 359.327 1.00 52.90  ? 153 VAL A N   1 
ATOM   1182 C CA  . VAL A 1 152 ? 41.888  59.782 358.126 1.00 43.62  ? 153 VAL A CA  1 
ATOM   1183 C C   . VAL A 1 152 ? 40.604  60.288 357.474 1.00 58.84  ? 153 VAL A C   1 
ATOM   1184 O O   . VAL A 1 152 ? 39.889  61.130 358.019 1.00 45.51  ? 153 VAL A O   1 
ATOM   1185 C CB  . VAL A 1 152 ? 41.803  58.272 358.421 1.00 44.68  ? 153 VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 152 ? 43.177  57.729 358.801 1.00 41.39  ? 153 VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 152 ? 40.790  57.996 359.521 1.00 46.01  ? 153 VAL A CG2 1 
ATOM   1188 N N   . GLY A 1 153 ? 40.327  59.766 356.279 1.00 62.15  ? 154 GLY A N   1 
ATOM   1189 C CA  . GLY A 1 153 ? 39.139  60.166 355.548 1.00 45.67  ? 154 GLY A CA  1 
ATOM   1190 C C   . GLY A 1 153 ? 39.163  61.644 355.204 1.00 47.39  ? 154 GLY A C   1 
ATOM   1191 O O   . GLY A 1 153 ? 40.221  62.251 355.008 1.00 54.99  ? 154 GLY A O   1 
ATOM   1192 N N   . ALA A 1 154 ? 37.969  62.241 355.146 1.00 49.07  ? 155 ALA A N   1 
ATOM   1193 C CA  . ALA A 1 154 ? 37.875  63.662 354.823 1.00 62.13  ? 155 ALA A CA  1 
ATOM   1194 C C   . ALA A 1 154 ? 38.590  64.526 355.854 1.00 58.09  ? 155 ALA A C   1 
ATOM   1195 O O   . ALA A 1 154 ? 39.166  65.562 355.500 1.00 48.40  ? 155 ALA A O   1 
ATOM   1196 C CB  . ALA A 1 154 ? 36.409  64.080 354.702 1.00 53.48  ? 155 ALA A CB  1 
ATOM   1197 N N   . PHE A 1 155 ? 38.573  64.114 357.128 1.00 50.13  ? 156 PHE A N   1 
ATOM   1198 C CA  . PHE A 1 155 ? 39.216  64.899 358.180 1.00 55.50  ? 156 PHE A CA  1 
ATOM   1199 C C   . PHE A 1 155 ? 40.722  65.007 357.977 1.00 50.18  ? 156 PHE A C   1 
ATOM   1200 O O   . PHE A 1 155 ? 41.329  65.999 358.396 1.00 60.64  ? 156 PHE A O   1 
ATOM   1201 C CB  . PHE A 1 155 ? 38.904  64.293 359.551 1.00 50.37  ? 156 PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 155 ? 37.452  63.999 359.746 1.00 55.03  ? 156 PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 155 ? 36.582  64.991 360.168 1.00 52.75  ? 156 PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 155 ? 36.944  62.740 359.462 1.00 57.13  ? 156 PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 155 ? 35.235  64.727 360.327 1.00 62.14  ? 156 PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 155 ? 35.599  62.470 359.619 1.00 53.68  ? 156 PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 155 ? 34.743  63.463 360.050 1.00 55.98  ? 156 PHE A CZ  1 
ATOM   1208 N N   . GLY A 1 156 ? 41.342  64.021 357.334 1.00 53.19  ? 157 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 156 ? 42.771  64.088 357.106 1.00 55.39  ? 157 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 156 ? 43.182  64.539 355.717 1.00 64.53  ? 157 GLY A C   1 
ATOM   1211 O O   . GLY A 1 156 ? 44.247  65.148 355.551 1.00 55.73  ? 157 GLY A O   1 
ATOM   1212 N N   . PHE A 1 157 ? 42.352  64.258 354.704 1.00 52.23  ? 158 PHE A N   1 
ATOM   1213 C CA  . PHE A 1 157 ? 42.815  64.413 353.332 1.00 53.94  ? 158 PHE A CA  1 
ATOM   1214 C C   . PHE A 1 157 ? 41.819  65.081 352.392 1.00 57.38  ? 158 PHE A C   1 
ATOM   1215 O O   . PHE A 1 157 ? 42.078  65.125 351.183 1.00 59.13  ? 158 PHE A O   1 
ATOM   1216 C CB  . PHE A 1 157 ? 43.225  63.045 352.784 1.00 48.02  ? 158 PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 157 ? 44.330  62.416 353.568 1.00 51.75  ? 158 PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 157 ? 45.644  62.814 353.374 1.00 42.94  ? 158 PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 157 ? 44.053  61.478 354.548 1.00 48.07  ? 158 PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 157 ? 46.668  62.259 354.118 1.00 59.63  ? 158 PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 157 ? 45.074  60.919 355.302 1.00 49.73  ? 158 PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 157 ? 46.384  61.310 355.084 1.00 48.86  ? 158 PHE A CZ  1 
ATOM   1223 N N   . LEU A 1 158 ? 40.702  65.607 352.887 1.00 52.63  ? 159 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 158 ? 39.880  66.462 352.042 1.00 60.15  ? 159 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 158 ? 40.677  67.698 351.647 1.00 63.87  ? 159 LEU A C   1 
ATOM   1226 O O   . LEU A 1 158 ? 41.249  68.380 352.501 1.00 59.06  ? 159 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 158 ? 38.593  66.866 352.759 1.00 64.21  ? 159 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 158 ? 37.682  67.846 352.016 1.00 56.94  ? 159 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 158 ? 36.229  67.423 352.150 1.00 54.69  ? 159 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 158 ? 37.879  69.262 352.537 1.00 61.18  ? 159 LEU A CD2 1 
ATOM   1231 N N   . ALA A 1 159 ? 40.714  67.986 350.349 1.00 61.82  ? 160 ALA A N   1 
ATOM   1232 C CA  . ALA A 1 159 ? 41.545  69.057 349.821 1.00 59.86  ? 160 ALA A CA  1 
ATOM   1233 C C   . ALA A 1 159 ? 40.737  69.938 348.880 1.00 70.25  ? 160 ALA A C   1 
ATOM   1234 O O   . ALA A 1 159 ? 40.054  69.437 347.982 1.00 68.64  ? 160 ALA A O   1 
ATOM   1235 C CB  . ALA A 1 159 ? 42.770  68.489 349.093 1.00 59.66  ? 160 ALA A CB  1 
ATOM   1236 N N   . LEU A 1 160 ? 40.803  71.247 349.110 1.00 78.14  ? 161 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 160 ? 40.393  72.259 348.146 1.00 69.97  ? 161 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 160 ? 41.657  73.008 347.748 1.00 73.25  ? 161 LEU A C   1 
ATOM   1239 O O   . LEU A 1 160 ? 41.955  74.067 348.316 1.00 69.51  ? 161 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 160 ? 39.344  73.206 348.733 1.00 69.51  ? 161 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 160 ? 37.921  72.649 348.818 1.00 72.72  ? 161 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 160 ? 36.976  73.683 349.398 1.00 74.51  ? 161 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 160 ? 37.440  72.193 347.448 1.00 63.96  ? 161 LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 161 ? 42.423  72.483 346.789 1.00 78.40  ? 162 PRO A N   1 
ATOM   1245 C CA  . PRO A 1 161 ? 43.782  72.993 346.556 1.00 71.00  ? 162 PRO A CA  1 
ATOM   1246 C C   . PRO A 1 161 ? 43.797  74.491 346.292 1.00 68.10  ? 162 PRO A C   1 
ATOM   1247 O O   . PRO A 1 161 ? 42.926  75.033 345.610 1.00 66.44  ? 162 PRO A O   1 
ATOM   1248 C CB  . PRO A 1 161 ? 44.254  72.199 345.332 1.00 78.23  ? 162 PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 161 ? 43.393  70.974 345.312 1.00 72.85  ? 162 PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 161 ? 42.064  71.407 345.849 1.00 76.43  ? 162 PRO A CD  1 
ATOM   1251 N N   . GLY A 1 162 ? 44.798  75.156 346.854 1.00 71.28  ? 163 GLY A N   1 
ATOM   1252 C CA  . GLY A 1 162 ? 44.912  76.601 346.796 1.00 75.23  ? 163 GLY A CA  1 
ATOM   1253 C C   . GLY A 1 162 ? 44.297  77.289 347.996 1.00 83.72  ? 163 GLY A C   1 
ATOM   1254 O O   . GLY A 1 162 ? 44.820  78.300 348.468 1.00 91.63  ? 163 GLY A O   1 
ATOM   1255 N N   . SER A 1 163 ? 43.194  76.747 348.507 1.00 79.01  ? 164 SER A N   1 
ATOM   1256 C CA  . SER A 1 163 ? 42.528  77.344 349.654 1.00 80.58  ? 164 SER A CA  1 
ATOM   1257 C C   . SER A 1 163 ? 43.339  77.117 350.922 1.00 82.93  ? 164 SER A C   1 
ATOM   1258 O O   . SER A 1 163 ? 44.058  76.125 351.063 1.00 82.96  ? 164 SER A O   1 
ATOM   1259 C CB  . SER A 1 163 ? 41.129  76.757 349.834 1.00 89.21  ? 164 SER A CB  1 
ATOM   1260 O OG  . SER A 1 163 ? 41.167  75.604 350.658 1.00 77.22  ? 164 SER A OG  1 
ATOM   1261 N N   . ARG A 1 164 ? 43.153  77.999 351.876 1.00 91.13  ? 165 ARG A N   1 
ATOM   1262 C CA  . ARG A 1 164 ? 43.823  77.887 353.133 1.00 82.56  ? 165 ARG A CA  1 
ATOM   1263 C C   . ARG A 1 164 ? 42.973  77.185 354.139 1.00 73.54  ? 165 ARG A C   1 
ATOM   1264 O O   . ARG A 1 164 ? 43.477  76.673 355.093 1.00 83.47  ? 165 ARG A O   1 
ATOM   1265 C CB  . ARG A 1 164 ? 44.175  79.257 353.650 1.00 83.06  ? 165 ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 164 ? 45.575  79.685 353.274 1.00 98.01  ? 165 ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 164 ? 46.523  79.544 354.449 1.00 116.67 ? 165 ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 164 ? 47.888  79.323 354.002 1.00 136.05 ? 165 ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 164 ? 48.950  79.319 354.799 1.00 138.98 ? 165 ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 164 ? 50.154  79.115 354.288 1.00 126.16 ? 165 ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 164 ? 48.809  79.510 356.103 1.00 130.12 ? 165 ARG A NH2 1 
ATOM   1272 N N   . GLU A 1 165 ? 41.678  77.159 353.924 1.00 73.77  ? 166 GLU A N   1 
ATOM   1273 C CA  A GLU A 1 165 ? 40.786  76.528 354.885 0.48 73.01  ? 166 GLU A CA  1 
ATOM   1274 C CA  B GLU A 1 165 ? 40.737  76.533 354.845 0.52 73.01  ? 166 GLU A CA  1 
ATOM   1275 C C   . GLU A 1 165 ? 40.712  75.015 354.726 1.00 71.79  ? 166 GLU A C   1 
ATOM   1276 O O   . GLU A 1 165 ? 40.202  74.343 355.627 1.00 66.90  ? 166 GLU A O   1 
ATOM   1277 C CB  A GLU A 1 165 ? 39.382  77.132 354.788 0.48 71.33  ? 166 GLU A CB  1 
ATOM   1278 C CB  B GLU A 1 165 ? 39.325  77.077 354.605 0.52 71.13  ? 166 GLU A CB  1 
ATOM   1279 C CG  A GLU A 1 165 ? 39.242  78.489 355.481 0.48 76.90  ? 166 GLU A CG  1 
ATOM   1280 C CG  B GLU A 1 165 ? 39.192  78.586 354.740 0.52 77.11  ? 166 GLU A CG  1 
ATOM   1281 C CD  A GLU A 1 165 ? 39.767  78.495 356.916 0.48 79.29  ? 166 GLU A CD  1 
ATOM   1282 C CD  B GLU A 1 165 ? 39.348  79.313 353.417 0.52 83.71  ? 166 GLU A CD  1 
ATOM   1283 O OE1 A GLU A 1 165 ? 40.930  78.904 357.131 0.48 73.06  ? 166 GLU A OE1 1 
ATOM   1284 O OE1 B GLU A 1 165 ? 39.832  78.694 352.443 0.52 74.80  ? 166 GLU A OE1 1 
ATOM   1285 O OE2 A GLU A 1 165 ? 39.015  78.101 357.834 0.48 66.34  ? 166 GLU A OE2 1 
ATOM   1286 O OE2 B GLU A 1 165 ? 38.983  80.506 353.352 0.52 79.83  ? 166 GLU A OE2 1 
ATOM   1287 N N   . ALA A 1 166 ? 41.221  74.463 353.623 1.00 76.00  ? 167 ALA A N   1 
ATOM   1288 C CA  . ALA A 1 166 ? 41.268  73.013 353.422 1.00 72.61  ? 167 ALA A CA  1 
ATOM   1289 C C   . ALA A 1 166 ? 42.389  72.687 352.445 1.00 63.50  ? 167 ALA A C   1 
ATOM   1290 O O   . ALA A 1 166 ? 42.147  72.287 351.301 1.00 71.15  ? 167 ALA A O   1 
ATOM   1291 C CB  . ALA A 1 166 ? 39.925  72.485 352.921 1.00 69.20  ? 167 ALA A CB  1 
ATOM   1292 N N   . PRO A 1 167 ? 43.645  72.844 352.873 1.00 63.41  ? 168 PRO A N   1 
ATOM   1293 C CA  . PRO A 1 167 ? 44.770  72.631 351.952 1.00 63.88  ? 168 PRO A CA  1 
ATOM   1294 C C   . PRO A 1 167 ? 45.055  71.175 351.646 1.00 64.69  ? 168 PRO A C   1 
ATOM   1295 O O   . PRO A 1 167 ? 45.816  70.902 350.710 1.00 59.85  ? 168 PRO A O   1 
ATOM   1296 C CB  . PRO A 1 167 ? 45.947  73.270 352.695 1.00 68.96  ? 168 PRO A CB  1 
ATOM   1297 C CG  . PRO A 1 167 ? 45.595  73.091 354.128 1.00 65.86  ? 168 PRO A CG  1 
ATOM   1298 C CD  . PRO A 1 167 ? 44.103  73.267 354.208 1.00 67.94  ? 168 PRO A CD  1 
ATOM   1299 N N   . GLY A 1 168 ? 44.495  70.237 352.400 1.00 60.51  ? 169 GLY A N   1 
ATOM   1300 C CA  . GLY A 1 168 ? 44.769  68.834 352.187 1.00 61.34  ? 169 GLY A CA  1 
ATOM   1301 C C   . GLY A 1 168 ? 46.071  68.387 352.829 1.00 61.33  ? 169 GLY A C   1 
ATOM   1302 O O   . GLY A 1 168 ? 46.910  69.185 353.258 1.00 60.67  ? 169 GLY A O   1 
ATOM   1303 N N   . ASN A 1 169 ? 46.224  67.064 352.904 1.00 53.86  ? 170 ASN A N   1 
ATOM   1304 C CA  . ASN A 1 169 ? 47.412  66.403 353.437 1.00 49.03  ? 170 ASN A CA  1 
ATOM   1305 C C   . ASN A 1 169 ? 47.642  66.684 354.918 1.00 51.74  ? 170 ASN A C   1 
ATOM   1306 O O   . ASN A 1 169 ? 48.767  66.520 355.404 1.00 50.45  ? 170 ASN A O   1 
ATOM   1307 C CB  . ASN A 1 169 ? 48.671  66.788 352.652 1.00 44.29  ? 170 ASN A CB  1 
ATOM   1308 C CG  . ASN A 1 169 ? 48.619  66.348 351.215 1.00 56.67  ? 170 ASN A CG  1 
ATOM   1309 O OD1 . ASN A 1 169 ? 47.996  65.341 350.884 1.00 50.79  ? 170 ASN A OD1 1 
ATOM   1310 N ND2 . ASN A 1 169 ? 49.277  67.103 350.345 1.00 53.80  ? 170 ASN A ND2 1 
ATOM   1311 N N   . VAL A 1 170 ? 46.610  67.099 355.664 1.00 46.38  ? 171 VAL A N   1 
ATOM   1312 C CA  . VAL A 1 170 ? 46.843  67.419 357.071 1.00 61.46  ? 171 VAL A CA  1 
ATOM   1313 C C   . VAL A 1 170 ? 47.057  66.151 357.887 1.00 57.47  ? 171 VAL A C   1 
ATOM   1314 O O   . VAL A 1 170 ? 47.755  66.175 358.907 1.00 53.05  ? 171 VAL A O   1 
ATOM   1315 C CB  . VAL A 1 170 ? 45.704  68.285 357.649 1.00 53.68  ? 171 VAL A CB  1 
ATOM   1316 C CG1 . VAL A 1 170 ? 45.526  69.548 356.815 1.00 41.88  ? 171 VAL A CG1 1 
ATOM   1317 C CG2 . VAL A 1 170 ? 44.396  67.494 357.782 1.00 50.65  ? 171 VAL A CG2 1 
ATOM   1318 N N   . GLY A 1 171 ? 46.477  65.025 357.459 1.00 54.70  ? 172 GLY A N   1 
ATOM   1319 C CA  . GLY A 1 171 ? 46.789  63.761 358.105 1.00 46.38  ? 172 GLY A CA  1 
ATOM   1320 C C   . GLY A 1 171 ? 48.255  63.391 357.982 1.00 46.90  ? 172 GLY A C   1 
ATOM   1321 O O   . GLY A 1 171 ? 48.833  62.806 358.903 1.00 50.44  ? 172 GLY A O   1 
ATOM   1322 N N   . LEU A 1 172 ? 48.871  63.713 356.841 1.00 55.93  ? 173 LEU A N   1 
ATOM   1323 C CA  . LEU A 1 172 ? 50.314  63.559 356.702 1.00 51.86  ? 173 LEU A CA  1 
ATOM   1324 C C   . LEU A 1 172 ? 51.061  64.528 357.604 1.00 53.51  ? 173 LEU A C   1 
ATOM   1325 O O   . LEU A 1 172 ? 52.130  64.187 358.127 1.00 50.08  ? 173 LEU A O   1 
ATOM   1326 C CB  . LEU A 1 172 ? 50.728  63.772 355.247 1.00 43.66  ? 173 LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 172 ? 50.450  62.602 354.316 1.00 53.23  ? 173 LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 172 ? 50.722  63.013 352.880 1.00 50.21  ? 173 LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 172 ? 51.299  61.405 354.713 1.00 46.43  ? 173 LEU A CD2 1 
ATOM   1330 N N   . LEU A 1 173 ? 50.516  65.735 357.794 1.00 44.67  ? 174 LEU A N   1 
ATOM   1331 C CA  . LEU A 1 173 ? 51.125  66.693 358.710 1.00 55.16  ? 174 LEU A CA  1 
ATOM   1332 C C   . LEU A 1 173 ? 50.970  66.258 360.162 1.00 50.69  ? 174 LEU A C   1 
ATOM   1333 O O   . LEU A 1 173 ? 51.867  66.507 360.976 1.00 55.48  ? 174 LEU A O   1 
ATOM   1334 C CB  . LEU A 1 173 ? 50.521  68.080 358.491 1.00 43.10  ? 174 LEU A CB  1 
ATOM   1335 C CG  . LEU A 1 173 ? 50.786  68.680 357.106 1.00 62.25  ? 174 LEU A CG  1 
ATOM   1336 C CD1 . LEU A 1 173 ? 50.156  70.056 356.970 1.00 46.82  ? 174 LEU A CD1 1 
ATOM   1337 C CD2 . LEU A 1 173 ? 52.282  68.741 356.820 1.00 47.92  ? 174 LEU A CD2 1 
ATOM   1338 N N   . ASP A 1 174 ? 49.845  65.620 360.505 1.00 51.31  ? 175 ASP A N   1 
ATOM   1339 C CA  . ASP A 1 174 ? 49.724  64.976 361.811 1.00 49.14  ? 175 ASP A CA  1 
ATOM   1340 C C   . ASP A 1 174 ? 50.891  64.029 362.046 1.00 57.25  ? 175 ASP A C   1 
ATOM   1341 O O   . ASP A 1 174 ? 51.530  64.059 363.103 1.00 52.14  ? 175 ASP A O   1 
ATOM   1342 C CB  . ASP A 1 174 ? 48.407  64.199 361.918 1.00 49.83  ? 175 ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 174 ? 47.178  65.085 361.832 1.00 55.36  ? 175 ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 174 ? 46.087  64.536 361.563 1.00 52.83  ? 175 ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 174 ? 47.291  66.312 362.027 1.00 45.31  ? 175 ASP A OD2 1 
ATOM   1346 N N   . GLN A 1 175 ? 51.180  63.170 361.060 1.00 50.08  ? 176 GLN A N   1 
ATOM   1347 C CA  . GLN A 1 175 ? 52.286  62.231 361.209 1.00 48.61  ? 176 GLN A CA  1 
ATOM   1348 C C   . GLN A 1 175 ? 53.607  62.971 361.350 1.00 47.17  ? 176 GLN A C   1 
ATOM   1349 O O   . GLN A 1 175 ? 54.441  62.616 362.193 1.00 51.38  ? 176 GLN A O   1 
ATOM   1350 C CB  . GLN A 1 175 ? 52.345  61.277 360.017 1.00 47.61  ? 176 GLN A CB  1 
ATOM   1351 C CG  . GLN A 1 175 ? 51.134  60.383 359.798 1.00 41.35  ? 176 GLN A CG  1 
ATOM   1352 C CD  . GLN A 1 175 ? 51.183  59.703 358.434 1.00 50.48  ? 176 GLN A CD  1 
ATOM   1353 O OE1 . GLN A 1 175 ? 52.185  59.798 357.723 1.00 43.31  ? 176 GLN A OE1 1 
ATOM   1354 N NE2 . GLN A 1 175 ? 50.100  59.029 358.059 1.00 41.22  ? 176 GLN A NE2 1 
ATOM   1355 N N   . ARG A 1 176 ? 53.813  64.009 360.535 1.00 43.16  ? 177 ARG A N   1 
ATOM   1356 C CA  . ARG A 1 176 ? 55.047  64.779 360.629 1.00 56.54  ? 177 ARG A CA  1 
ATOM   1357 C C   . ARG A 1 176 ? 55.179  65.431 361.997 1.00 56.08  ? 177 ARG A C   1 
ATOM   1358 O O   . ARG A 1 176 ? 56.266  65.429 362.590 1.00 44.03  ? 177 ARG A O   1 
ATOM   1359 C CB  . ARG A 1 176 ? 55.103  65.835 359.529 1.00 47.48  ? 177 ARG A CB  1 
ATOM   1360 C CG  . ARG A 1 176 ? 56.393  66.641 359.539 1.00 53.78  ? 177 ARG A CG  1 
ATOM   1361 C CD  . ARG A 1 176 ? 56.380  67.719 358.481 1.00 47.46  ? 177 ARG A CD  1 
ATOM   1362 N NE  . ARG A 1 176 ? 56.645  67.171 357.156 1.00 51.01  ? 177 ARG A NE  1 
ATOM   1363 C CZ  . ARG A 1 176 ? 56.467  67.843 356.024 1.00 63.19  ? 177 ARG A CZ  1 
ATOM   1364 N NH1 . ARG A 1 176 ? 56.020  69.094 356.057 1.00 58.33  ? 177 ARG A NH1 1 
ATOM   1365 N NH2 . ARG A 1 176 ? 56.737  67.268 354.859 1.00 54.12  ? 177 ARG A NH2 1 
ATOM   1366 N N   . LEU A 1 177 ? 54.077  65.979 362.520 1.00 48.68  ? 178 LEU A N   1 
ATOM   1367 C CA  . LEU A 1 177 ? 54.108  66.625 363.829 1.00 53.49  ? 178 LEU A CA  1 
ATOM   1368 C C   . LEU A 1 177 ? 54.500  65.635 364.916 1.00 55.27  ? 178 LEU A C   1 
ATOM   1369 O O   . LEU A 1 177 ? 55.352  65.933 365.763 1.00 54.60  ? 178 LEU A O   1 
ATOM   1370 C CB  . LEU A 1 177 ? 52.750  67.257 364.137 1.00 43.80  ? 178 LEU A CB  1 
ATOM   1371 C CG  . LEU A 1 177 ? 52.635  67.921 365.509 1.00 56.30  ? 178 LEU A CG  1 
ATOM   1372 C CD1 . LEU A 1 177 ? 53.711  68.978 365.678 1.00 54.38  ? 178 LEU A CD1 1 
ATOM   1373 C CD2 . LEU A 1 177 ? 51.261  68.532 365.691 1.00 52.44  ? 178 LEU A CD2 1 
ATOM   1374 N N   . ALA A 1 178 ? 53.883  64.449 364.908 1.00 51.13  ? 179 ALA A N   1 
ATOM   1375 C CA  . ALA A 1 178 ? 54.294  63.393 365.828 1.00 49.47  ? 179 ALA A CA  1 
ATOM   1376 C C   . ALA A 1 178 ? 55.766  63.053 365.642 1.00 41.59  ? 179 ALA A C   1 
ATOM   1377 O O   . ALA A 1 178 ? 56.494  62.835 366.616 1.00 52.57  ? 179 ALA A O   1 
ATOM   1378 C CB  . ALA A 1 178 ? 53.427  62.150 365.625 1.00 41.09  ? 179 ALA A CB  1 
ATOM   1379 N N   . LEU A 1 179 ? 56.224  63.012 364.393 1.00 46.39  ? 180 LEU A N   1 
ATOM   1380 C CA  . LEU A 1 179 ? 57.638  62.779 364.128 1.00 46.50  ? 180 LEU A CA  1 
ATOM   1381 C C   . LEU A 1 179 ? 58.501  63.884 364.734 1.00 65.72  ? 180 LEU A C   1 
ATOM   1382 O O   . LEU A 1 179 ? 59.569  63.614 365.303 1.00 45.52  ? 180 LEU A O   1 
ATOM   1383 C CB  . LEU A 1 179 ? 57.863  62.671 362.619 1.00 49.50  ? 180 LEU A CB  1 
ATOM   1384 C CG  . LEU A 1 179 ? 57.537  61.303 362.015 1.00 45.90  ? 180 LEU A CG  1 
ATOM   1385 C CD1 . LEU A 1 179 ? 57.921  61.256 360.551 1.00 40.82  ? 180 LEU A CD1 1 
ATOM   1386 C CD2 . LEU A 1 179 ? 58.241  60.207 362.791 1.00 49.79  ? 180 LEU A CD2 1 
ATOM   1387 N N   . GLN A 1 180 ? 58.062  65.139 364.616 1.00 57.91  ? 181 GLN A N   1 
ATOM   1388 C CA  . GLN A 1 180 ? 58.778  66.228 365.274 1.00 50.34  ? 181 GLN A CA  1 
ATOM   1389 C C   . GLN A 1 180 ? 58.761  66.048 366.786 1.00 57.48  ? 181 GLN A C   1 
ATOM   1390 O O   . GLN A 1 180 ? 59.772  66.286 367.460 1.00 59.85  ? 181 GLN A O   1 
ATOM   1391 C CB  . GLN A 1 180 ? 58.162  67.573 364.881 1.00 49.51  ? 181 GLN A CB  1 
ATOM   1392 C CG  . GLN A 1 180 ? 58.312  67.912 363.400 1.00 69.76  ? 181 GLN A CG  1 
ATOM   1393 C CD  . GLN A 1 180 ? 57.456  69.094 362.953 1.00 80.24  ? 181 GLN A CD  1 
ATOM   1394 O OE1 . GLN A 1 180 ? 56.521  69.506 363.641 1.00 75.67  ? 181 GLN A OE1 1 
ATOM   1395 N NE2 . GLN A 1 180 ? 57.777  69.640 361.785 1.00 73.81  ? 181 GLN A NE2 1 
ATOM   1396 N N   . TRP A 1 181 ? 57.619  65.618 367.331 1.00 50.51  ? 182 TRP A N   1 
ATOM   1397 C CA  . TRP A 1 181 ? 57.508  65.356 368.765 1.00 54.13  ? 182 TRP A CA  1 
ATOM   1398 C C   . TRP A 1 181 ? 58.549  64.341 369.222 1.00 47.83  ? 182 TRP A C   1 
ATOM   1399 O O   . TRP A 1 181 ? 59.152  64.496 370.289 1.00 56.34  ? 182 TRP A O   1 
ATOM   1400 C CB  . TRP A 1 181 ? 56.093  64.869 369.086 1.00 49.20  ? 182 TRP A CB  1 
ATOM   1401 C CG  . TRP A 1 181 ? 55.755  64.767 370.544 1.00 56.51  ? 182 TRP A CG  1 
ATOM   1402 C CD1 . TRP A 1 181 ? 55.070  65.683 371.293 1.00 48.73  ? 182 TRP A CD1 1 
ATOM   1403 C CD2 . TRP A 1 181 ? 56.058  63.677 371.426 1.00 44.91  ? 182 TRP A CD2 1 
ATOM   1404 N NE1 . TRP A 1 181 ? 54.942  65.238 372.583 1.00 53.47  ? 182 TRP A NE1 1 
ATOM   1405 C CE2 . TRP A 1 181 ? 55.537  64.009 372.693 1.00 44.83  ? 182 TRP A CE2 1 
ATOM   1406 C CE3 . TRP A 1 181 ? 56.723  62.457 371.269 1.00 47.28  ? 182 TRP A CE3 1 
ATOM   1407 C CZ2 . TRP A 1 181 ? 55.665  63.168 373.799 1.00 48.17  ? 182 TRP A CZ2 1 
ATOM   1408 C CZ3 . TRP A 1 181 ? 56.847  61.622 372.366 1.00 44.59  ? 182 TRP A CZ3 1 
ATOM   1409 C CH2 . TRP A 1 181 ? 56.322  61.982 373.616 1.00 49.93  ? 182 TRP A CH2 1 
ATOM   1410 N N   . VAL A 1 182 ? 58.792  63.307 368.413 1.00 61.26  ? 183 VAL A N   1 
ATOM   1411 C CA  . VAL A 1 182 ? 59.777  62.291 368.775 1.00 52.41  ? 183 VAL A CA  1 
ATOM   1412 C C   . VAL A 1 182 ? 61.167  62.910 368.873 1.00 58.85  ? 183 VAL A C   1 
ATOM   1413 O O   . VAL A 1 182 ? 61.892  62.693 369.851 1.00 59.98  ? 183 VAL A O   1 
ATOM   1414 C CB  . VAL A 1 182 ? 59.735  61.126 367.768 1.00 48.51  ? 183 VAL A CB  1 
ATOM   1415 C CG1 . VAL A 1 182 ? 61.022  60.323 367.809 1.00 40.61  ? 183 VAL A CG1 1 
ATOM   1416 C CG2 . VAL A 1 182 ? 58.561  60.224 368.080 1.00 40.49  ? 183 VAL A CG2 1 
ATOM   1417 N N   . GLN A 1 183 ? 61.553  63.703 367.867 1.00 56.35  ? 184 GLN A N   1 
ATOM   1418 C CA  . GLN A 1 183 ? 62.856  64.366 367.898 1.00 57.55  ? 184 GLN A CA  1 
ATOM   1419 C C   . GLN A 1 183 ? 63.039  65.188 369.171 1.00 59.32  ? 184 GLN A C   1 
ATOM   1420 O O   . GLN A 1 183 ? 64.113  65.171 369.784 1.00 55.25  ? 184 GLN A O   1 
ATOM   1421 C CB  . GLN A 1 183 ? 63.025  65.257 366.664 1.00 52.78  ? 184 GLN A CB  1 
ATOM   1422 C CG  . GLN A 1 183 ? 63.434  64.509 365.403 1.00 53.38  ? 184 GLN A CG  1 
ATOM   1423 C CD  . GLN A 1 183 ? 64.735  63.754 365.577 1.00 60.64  ? 184 GLN A CD  1 
ATOM   1424 O OE1 . GLN A 1 183 ? 65.783  64.350 365.826 1.00 73.36  ? 184 GLN A OE1 1 
ATOM   1425 N NE2 . GLN A 1 183 ? 64.674  62.434 365.450 1.00 55.53  ? 184 GLN A NE2 1 
ATOM   1426 N N   . GLU A 1 184 ? 61.991  65.890 369.601 1.00 45.09  ? 185 GLU A N   1 
ATOM   1427 C CA  . GLU A 1 184 ? 62.108  66.765 370.761 1.00 57.17  ? 185 GLU A CA  1 
ATOM   1428 C C   . GLU A 1 184 ? 62.016  66.023 372.093 1.00 57.69  ? 185 GLU A C   1 
ATOM   1429 O O   . GLU A 1 184 ? 62.602  66.478 373.079 1.00 64.40  ? 185 GLU A O   1 
ATOM   1430 C CB  . GLU A 1 184 ? 61.031  67.846 370.702 1.00 60.50  ? 185 GLU A CB  1 
ATOM   1431 C CG  . GLU A 1 184 ? 61.251  68.853 369.585 1.00 78.33  ? 185 GLU A CG  1 
ATOM   1432 C CD  . GLU A 1 184 ? 60.139  69.882 369.491 1.00 97.27  ? 185 GLU A CD  1 
ATOM   1433 O OE1 . GLU A 1 184 ? 59.883  70.381 368.373 1.00 104.70 ? 185 GLU A OE1 1 
ATOM   1434 O OE2 . GLU A 1 184 ? 59.520  70.190 370.531 1.00 89.38  ? 185 GLU A OE2 1 
ATOM   1435 N N   . ASN A 1 185 ? 61.296  64.898 372.162 1.00 59.88  ? 186 ASN A N   1 
ATOM   1436 C CA  . ASN A 1 185 ? 60.943  64.320 373.455 1.00 50.78  ? 186 ASN A CA  1 
ATOM   1437 C C   . ASN A 1 185 ? 61.297  62.854 373.643 1.00 52.40  ? 186 ASN A C   1 
ATOM   1438 O O   . ASN A 1 185 ? 61.150  62.357 374.767 1.00 56.89  ? 186 ASN A O   1 
ATOM   1439 C CB  . ASN A 1 185 ? 59.435  64.471 373.722 1.00 46.72  ? 186 ASN A CB  1 
ATOM   1440 C CG  . ASN A 1 185 ? 58.982  65.915 373.742 1.00 50.35  ? 186 ASN A CG  1 
ATOM   1441 O OD1 . ASN A 1 185 ? 59.165  66.622 374.729 1.00 65.80  ? 186 ASN A OD1 1 
ATOM   1442 N ND2 . ASN A 1 185 ? 58.365  66.355 372.654 1.00 61.52  ? 186 ASN A ND2 1 
ATOM   1443 N N   . VAL A 1 186 ? 61.739  62.140 372.606 1.00 47.24  ? 187 VAL A N   1 
ATOM   1444 C CA  . VAL A 1 186 ? 61.928  60.702 372.790 1.00 56.39  ? 187 VAL A CA  1 
ATOM   1445 C C   . VAL A 1 186 ? 63.071  60.427 373.760 1.00 51.75  ? 187 VAL A C   1 
ATOM   1446 O O   . VAL A 1 186 ? 63.070  59.401 374.455 1.00 50.68  ? 187 VAL A O   1 
ATOM   1447 C CB  . VAL A 1 186 ? 62.137  59.992 371.436 1.00 49.94  ? 187 VAL A CB  1 
ATOM   1448 C CG1 . VAL A 1 186 ? 63.549  60.209 370.909 1.00 38.29  ? 187 VAL A CG1 1 
ATOM   1449 C CG2 . VAL A 1 186 ? 61.834  58.505 371.573 1.00 37.90  ? 187 VAL A CG2 1 
ATOM   1450 N N   . ALA A 1 187 ? 64.043  61.340 373.848 1.00 56.56  ? 188 ALA A N   1 
ATOM   1451 C CA  . ALA A 1 187 ? 65.169  61.143 374.754 1.00 54.76  ? 188 ALA A CA  1 
ATOM   1452 C C   . ALA A 1 187 ? 64.712  61.052 376.203 1.00 55.56  ? 188 ALA A C   1 
ATOM   1453 O O   . ALA A 1 187 ? 65.333  60.341 377.002 1.00 54.73  ? 188 ALA A O   1 
ATOM   1454 C CB  . ALA A 1 187 ? 66.185  62.272 374.584 1.00 48.02  ? 188 ALA A CB  1 
ATOM   1455 N N   . ALA A 1 188 ? 63.621  61.740 376.554 1.00 48.56  ? 189 ALA A N   1 
ATOM   1456 C CA  . ALA A 1 188 ? 63.090  61.675 377.914 1.00 49.95  ? 189 ALA A CA  1 
ATOM   1457 C C   . ALA A 1 188 ? 62.601  60.281 378.285 1.00 56.86  ? 189 ALA A C   1 
ATOM   1458 O O   . ALA A 1 188 ? 62.400  60.006 379.474 1.00 71.27  ? 189 ALA A O   1 
ATOM   1459 C CB  . ALA A 1 188 ? 61.951  62.682 378.091 1.00 39.38  ? 189 ALA A CB  1 
ATOM   1460 N N   . PHE A 1 189 ? 62.398  59.403 377.305 1.00 59.26  ? 190 PHE A N   1 
ATOM   1461 C CA  . PHE A 1 189 ? 62.013  58.022 377.553 1.00 45.40  ? 190 PHE A CA  1 
ATOM   1462 C C   . PHE A 1 189 ? 63.175  57.058 377.373 1.00 53.65  ? 190 PHE A C   1 
ATOM   1463 O O   . PHE A 1 189 ? 62.979  55.843 377.473 1.00 53.68  ? 190 PHE A O   1 
ATOM   1464 C CB  . PHE A 1 189 ? 60.857  57.619 376.631 1.00 48.99  ? 190 PHE A CB  1 
ATOM   1465 C CG  . PHE A 1 189 ? 59.635  58.482 376.770 1.00 43.47  ? 190 PHE A CG  1 
ATOM   1466 C CD1 . PHE A 1 189 ? 59.505  59.643 376.030 1.00 45.72  ? 190 PHE A CD1 1 
ATOM   1467 C CD2 . PHE A 1 189 ? 58.611  58.127 377.640 1.00 53.81  ? 190 PHE A CD2 1 
ATOM   1468 C CE1 . PHE A 1 189 ? 58.380  60.439 376.155 1.00 52.65  ? 190 PHE A CE1 1 
ATOM   1469 C CE2 . PHE A 1 189 ? 57.484  58.918 377.768 1.00 46.84  ? 190 PHE A CE2 1 
ATOM   1470 C CZ  . PHE A 1 189 ? 57.370  60.077 377.026 1.00 42.73  ? 190 PHE A CZ  1 
ATOM   1471 N N   . GLY A 1 190 ? 64.380  57.570 377.116 1.00 42.54  ? 191 GLY A N   1 
ATOM   1472 C CA  . GLY A 1 190 ? 65.513  56.739 376.775 1.00 44.35  ? 191 GLY A CA  1 
ATOM   1473 C C   . GLY A 1 190 ? 65.716  56.537 375.288 1.00 61.50  ? 191 GLY A C   1 
ATOM   1474 O O   . GLY A 1 190 ? 66.588  55.751 374.896 1.00 59.21  ? 191 GLY A O   1 
ATOM   1475 N N   . GLY A 1 191 ? 64.940  57.210 374.447 1.00 51.85  ? 192 GLY A N   1 
ATOM   1476 C CA  . GLY A 1 191 ? 65.113  57.060 373.024 1.00 60.64  ? 192 GLY A CA  1 
ATOM   1477 C C   . GLY A 1 191 ? 66.285  57.859 372.493 1.00 61.18  ? 192 GLY A C   1 
ATOM   1478 O O   . GLY A 1 191 ? 66.780  58.795 373.121 1.00 71.56  ? 192 GLY A O   1 
ATOM   1479 N N   . ASP A 1 192 ? 66.736  57.462 371.307 1.00 53.95  ? 193 ASP A N   1 
ATOM   1480 C CA  . ASP A 1 192 ? 67.811  58.143 370.595 1.00 51.29  ? 193 ASP A CA  1 
ATOM   1481 C C   . ASP A 1 192 ? 67.219  58.830 369.375 1.00 57.60  ? 193 ASP A C   1 
ATOM   1482 O O   . ASP A 1 192 ? 66.963  58.165 368.360 1.00 59.79  ? 193 ASP A O   1 
ATOM   1483 C CB  . ASP A 1 192 ? 68.890  57.136 370.181 1.00 51.80  ? 193 ASP A CB  1 
ATOM   1484 C CG  . ASP A 1 192 ? 70.065  57.778 369.446 1.00 65.81  ? 193 ASP A CG  1 
ATOM   1485 O OD1 . ASP A 1 192 ? 70.023  58.988 369.124 1.00 61.90  ? 193 ASP A OD1 1 
ATOM   1486 O OD2 . ASP A 1 192 ? 71.051  57.052 369.191 1.00 58.37  ? 193 ASP A OD2 1 
ATOM   1487 N N   . PRO A 1 193 ? 66.997  60.149 369.403 1.00 57.03  ? 194 PRO A N   1 
ATOM   1488 C CA  . PRO A 1 193 ? 66.411  60.818 368.229 1.00 56.14  ? 194 PRO A CA  1 
ATOM   1489 C C   . PRO A 1 193 ? 67.297  60.783 366.992 1.00 53.13  ? 194 PRO A C   1 
ATOM   1490 O O   . PRO A 1 193 ? 66.827  61.161 365.913 1.00 59.37  ? 194 PRO A O   1 
ATOM   1491 C CB  . PRO A 1 193 ? 66.191  62.257 368.713 1.00 55.70  ? 194 PRO A CB  1 
ATOM   1492 C CG  . PRO A 1 193 ? 67.191  62.443 369.805 1.00 51.24  ? 194 PRO A CG  1 
ATOM   1493 C CD  . PRO A 1 193 ? 67.314  61.101 370.480 1.00 53.39  ? 194 PRO A CD  1 
ATOM   1494 N N   . THR A 1 194 ? 68.551  60.351 367.107 1.00 58.93  ? 195 THR A N   1 
ATOM   1495 C CA  . THR A 1 194 ? 69.437  60.217 365.959 1.00 58.43  ? 195 THR A CA  1 
ATOM   1496 C C   . THR A 1 194 ? 69.352  58.836 365.320 1.00 62.68  ? 195 THR A C   1 
ATOM   1497 O O   . THR A 1 194 ? 70.138  58.532 364.416 1.00 73.83  ? 195 THR A O   1 
ATOM   1498 C CB  . THR A 1 194 ? 70.888  60.518 366.362 1.00 62.47  ? 195 THR A CB  1 
ATOM   1499 O OG1 . THR A 1 194 ? 71.449  59.384 367.034 1.00 57.20  ? 195 THR A OG1 1 
ATOM   1500 C CG2 . THR A 1 194 ? 70.953  61.733 367.287 1.00 51.41  ? 195 THR A CG2 1 
ATOM   1501 N N   . SER A 1 195 ? 68.405  57.996 365.761 1.00 58.12  ? 196 SER A N   1 
ATOM   1502 C CA  . SER A 1 195 ? 68.223  56.657 365.195 1.00 57.81  ? 196 SER A CA  1 
ATOM   1503 C C   . SER A 1 195 ? 66.722  56.345 365.216 1.00 56.83  ? 196 SER A C   1 
ATOM   1504 O O   . SER A 1 195 ? 66.218  55.596 366.054 1.00 59.35  ? 196 SER A O   1 
ATOM   1505 C CB  . SER A 1 195 ? 69.029  55.605 365.955 1.00 64.65  ? 196 SER A CB  1 
ATOM   1506 O OG  . SER A 1 195 ? 69.020  54.362 365.275 1.00 63.02  ? 196 SER A OG  1 
ATOM   1507 N N   . VAL A 1 196 ? 65.997  56.930 364.266 1.00 56.39  ? 197 VAL A N   1 
ATOM   1508 C CA  . VAL A 1 196 ? 64.553  56.769 364.155 1.00 43.55  ? 197 VAL A CA  1 
ATOM   1509 C C   . VAL A 1 196 ? 64.247  56.031 362.855 1.00 61.09  ? 197 VAL A C   1 
ATOM   1510 O O   . VAL A 1 196 ? 64.568  56.513 361.759 1.00 47.36  ? 197 VAL A O   1 
ATOM   1511 C CB  . VAL A 1 196 ? 63.829  58.122 364.212 1.00 47.12  ? 197 VAL A CB  1 
ATOM   1512 C CG1 . VAL A 1 196 ? 62.351  57.944 363.901 1.00 52.19  ? 197 VAL A CG1 1 
ATOM   1513 C CG2 . VAL A 1 196 ? 64.017  58.767 365.586 1.00 47.34  ? 197 VAL A CG2 1 
ATOM   1514 N N   . THR A 1 197 ? 63.629  54.861 362.978 1.00 56.46  ? 198 THR A N   1 
ATOM   1515 C CA  . THR A 1 197 ? 63.211  54.063 361.834 1.00 50.85  ? 198 THR A CA  1 
ATOM   1516 C C   . THR A 1 197 ? 61.697  54.144 361.703 1.00 52.23  ? 198 THR A C   1 
ATOM   1517 O O   . THR A 1 197 ? 60.969  53.756 362.624 1.00 52.87  ? 198 THR A O   1 
ATOM   1518 C CB  . THR A 1 197 ? 63.646  52.605 361.980 1.00 57.99  ? 198 THR A CB  1 
ATOM   1519 O OG1 . THR A 1 197 ? 65.068  52.539 362.151 1.00 52.14  ? 198 THR A OG1 1 
ATOM   1520 C CG2 . THR A 1 197 ? 63.238  51.803 360.741 1.00 43.70  ? 198 THR A CG2 1 
ATOM   1521 N N   . LEU A 1 198 ? 61.230  54.660 360.572 1.00 47.69  ? 199 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 198 ? 59.815  54.591 360.251 1.00 47.22  ? 199 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 198 ? 59.482  53.207 359.715 1.00 50.90  ? 199 LEU A C   1 
ATOM   1524 O O   . LEU A 1 198 ? 60.235  52.637 358.921 1.00 50.92  ? 199 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 198 ? 59.444  55.647 359.213 1.00 47.47  ? 199 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 198 ? 59.577  57.111 359.610 1.00 51.67  ? 199 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 198 ? 58.877  58.003 358.587 1.00 42.51  ? 199 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 198 ? 58.991  57.304 360.989 1.00 50.02  ? 199 LEU A CD2 1 
ATOM   1529 N N   . PHE A 1 199 ? 58.356  52.656 360.162 1.00 40.19  ? 200 PHE A N   1 
ATOM   1530 C CA  . PHE A 1 199 ? 57.825  51.476 359.500 1.00 40.21  ? 200 PHE A CA  1 
ATOM   1531 C C   . PHE A 1 199 ? 56.307  51.531 359.513 1.00 52.12  ? 200 PHE A C   1 
ATOM   1532 O O   . PHE A 1 199 ? 55.698  52.002 360.477 1.00 45.21  ? 200 PHE A O   1 
ATOM   1533 C CB  . PHE A 1 199 ? 58.387  50.174 360.098 1.00 53.95  ? 200 PHE A CB  1 
ATOM   1534 C CG  . PHE A 1 199 ? 57.823  49.758 361.432 1.00 50.86  ? 200 PHE A CG  1 
ATOM   1535 C CD1 . PHE A 1 199 ? 57.399  48.447 361.615 1.00 51.21  ? 200 PHE A CD1 1 
ATOM   1536 C CD2 . PHE A 1 199 ? 57.799  50.619 362.518 1.00 51.56  ? 200 PHE A CD2 1 
ATOM   1537 C CE1 . PHE A 1 199 ? 56.916  48.011 362.833 1.00 62.81  ? 200 PHE A CE1 1 
ATOM   1538 C CE2 . PHE A 1 199 ? 57.313  50.187 363.752 1.00 53.65  ? 200 PHE A CE2 1 
ATOM   1539 C CZ  . PHE A 1 199 ? 56.872  48.882 363.907 1.00 48.92  ? 200 PHE A CZ  1 
ATOM   1540 N N   . GLY A 1 200 ? 55.710  51.111 358.396 1.00 55.66  ? 201 GLY A N   1 
ATOM   1541 C CA  . GLY A 1 200 ? 54.273  51.166 358.229 1.00 46.93  ? 201 GLY A CA  1 
ATOM   1542 C C   . GLY A 1 200 ? 53.813  50.131 357.227 1.00 58.10  ? 201 GLY A C   1 
ATOM   1543 O O   . GLY A 1 200 ? 54.607  49.555 356.478 1.00 45.63  ? 201 GLY A O   1 
ATOM   1544 N N   . GLU A 1 201 ? 52.504  49.897 357.226 1.00 54.01  ? 202 GLU A N   1 
ATOM   1545 C CA  . GLU A 1 201 ? 51.899  48.897 356.365 1.00 51.46  ? 202 GLU A CA  1 
ATOM   1546 C C   . GLU A 1 201 ? 50.785  49.526 355.541 1.00 59.22  ? 202 GLU A C   1 
ATOM   1547 O O   . GLU A 1 201 ? 50.017  50.355 356.043 1.00 47.87  ? 202 GLU A O   1 
ATOM   1548 C CB  . GLU A 1 201 ? 51.354  47.722 357.182 1.00 53.04  ? 202 GLU A CB  1 
ATOM   1549 C CG  . GLU A 1 201 ? 51.118  46.470 356.363 1.00 50.77  ? 202 GLU A CG  1 
ATOM   1550 C CD  . GLU A 1 201 ? 49.657  46.252 356.049 1.00 72.39  ? 202 GLU A CD  1 
ATOM   1551 O OE1 . GLU A 1 201 ? 48.828  47.077 356.495 1.00 57.69  ? 202 GLU A OE1 1 
ATOM   1552 O OE2 . GLU A 1 201 ? 49.342  45.260 355.356 1.00 65.00  ? 202 GLU A OE2 1 
ATOM   1553 N N   . SER A 1 202 ? 50.713  49.131 354.268 1.00 49.21  ? 203 SER A N   1 
ATOM   1554 C CA  . SER A 1 202 ? 49.654  49.555 353.348 1.00 46.76  ? 203 SER A CA  1 
ATOM   1555 C C   . SER A 1 202 ? 49.680  51.076 353.262 1.00 40.28  ? 203 SER A C   1 
ATOM   1556 O O   . SER A 1 202 ? 50.729  51.630 352.891 1.00 51.44  ? 203 SER A O   1 
ATOM   1557 C CB  . SER A 1 202 ? 48.342  48.927 353.811 1.00 45.01  ? 203 SER A CB  1 
ATOM   1558 O OG  . SER A 1 202 ? 47.440  48.785 352.740 1.00 60.75  ? 203 SER A OG  1 
ATOM   1559 N N   . ALA A 1 203 ? 48.592  51.786 353.584 1.00 44.15  ? 204 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 203 ? 48.615  53.246 353.527 1.00 44.03  ? 204 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 203 ? 49.672  53.829 354.456 1.00 53.34  ? 204 ALA A C   1 
ATOM   1562 O O   . ALA A 1 203 ? 50.157  54.944 354.227 1.00 46.95  ? 204 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 203 ? 47.241  53.809 353.883 1.00 41.39  ? 204 ALA A CB  1 
ATOM   1564 N N   . GLY A 1 204 ? 50.023  53.098 355.518 1.00 48.35  ? 205 GLY A N   1 
ATOM   1565 C CA  . GLY A 1 204 ? 51.121  53.523 356.366 1.00 46.24  ? 205 GLY A CA  1 
ATOM   1566 C C   . GLY A 1 204 ? 52.457  53.414 355.661 1.00 50.29  ? 205 GLY A C   1 
ATOM   1567 O O   . GLY A 1 204 ? 53.316  54.288 355.805 1.00 48.44  ? 205 GLY A O   1 
ATOM   1568 N N   . ALA A 1 205 ? 52.649  52.340 354.886 1.00 47.39  ? 206 ALA A N   1 
ATOM   1569 C CA  . ALA A 1 205 ? 53.844  52.226 354.060 1.00 53.13  ? 206 ALA A CA  1 
ATOM   1570 C C   . ALA A 1 205 ? 53.902  53.347 353.030 1.00 48.85  ? 206 ALA A C   1 
ATOM   1571 O O   . ALA A 1 205 ? 54.963  53.940 352.804 1.00 53.31  ? 206 ALA A O   1 
ATOM   1572 C CB  . ALA A 1 205 ? 53.885  50.860 353.374 1.00 42.41  ? 206 ALA A CB  1 
ATOM   1573 N N   . ALA A 1 206 ? 52.769  53.661 352.403 1.00 45.30  ? 207 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 206 ? 52.740  54.779 351.469 1.00 48.12  ? 207 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 206 ? 53.035  56.093 352.183 1.00 46.11  ? 207 ALA A C   1 
ATOM   1576 O O   . ALA A 1 206 ? 53.709  56.971 351.632 1.00 48.11  ? 207 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 206 ? 51.387  54.835 350.763 1.00 37.27  ? 207 ALA A CB  1 
ATOM   1578 N N   . SER A 1 207 ? 52.539  56.243 353.413 1.00 46.09  ? 208 SER A N   1 
ATOM   1579 C CA  . SER A 1 207 ? 52.876  57.415 354.217 1.00 46.80  ? 208 SER A CA  1 
ATOM   1580 C C   . SER A 1 207 ? 54.380  57.504 354.453 1.00 46.56  ? 208 SER A C   1 
ATOM   1581 O O   . SER A 1 207 ? 54.990  58.564 354.258 1.00 46.04  ? 208 SER A O   1 
ATOM   1582 C CB  . SER A 1 207 ? 52.121  57.370 355.546 1.00 43.82  ? 208 SER A CB  1 
ATOM   1583 O OG  . SER A 1 207 ? 50.717  57.457 355.343 1.00 43.24  ? 208 SER A OG  1 
ATOM   1584 N N   . VAL A 1 208 ? 54.996  56.391 354.869 1.00 43.82  ? 209 VAL A N   1 
ATOM   1585 C CA  . VAL A 1 208 ? 56.446  56.354 355.064 1.00 43.99  ? 209 VAL A CA  1 
ATOM   1586 C C   . VAL A 1 208 ? 57.158  56.820 353.801 1.00 51.90  ? 209 VAL A C   1 
ATOM   1587 O O   . VAL A 1 208 ? 58.037  57.688 353.845 1.00 45.57  ? 209 VAL A O   1 
ATOM   1588 C CB  . VAL A 1 208 ? 56.899  54.942 355.480 1.00 44.70  ? 209 VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 208 ? 58.418  54.819 355.403 1.00 41.06  ? 209 VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 208 ? 56.413  54.617 356.892 1.00 45.36  ? 209 VAL A CG2 1 
ATOM   1591 N N   . GLY A 1 209 ? 56.765  56.268 352.651 1.00 49.72  ? 210 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 209 ? 57.391  56.669 351.404 1.00 43.33  ? 210 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 209 ? 57.234  58.150 351.125 1.00 52.32  ? 210 GLY A C   1 
ATOM   1594 O O   . GLY A 1 209 ? 58.143  58.794 350.600 1.00 46.08  ? 210 GLY A O   1 
ATOM   1595 N N   . MET A 1 210 ? 56.083  58.717 351.485 1.00 51.37  ? 211 MET A N   1 
ATOM   1596 C CA  . MET A 1 210 ? 55.872  60.137 351.241 1.00 42.08  ? 211 MET A CA  1 
ATOM   1597 C C   . MET A 1 210 ? 56.749  60.990 352.146 1.00 58.55  ? 211 MET A C   1 
ATOM   1598 O O   . MET A 1 210 ? 57.254  62.036 351.720 1.00 50.84  ? 211 MET A O   1 
ATOM   1599 C CB  . MET A 1 210 ? 54.392  60.478 351.406 1.00 50.22  ? 211 MET A CB  1 
ATOM   1600 C CG  . MET A 1 210 ? 53.567  59.971 350.234 1.00 54.55  ? 211 MET A CG  1 
ATOM   1601 S SD  . MET A 1 210 ? 51.795  60.187 350.402 1.00 59.27  ? 211 MET A SD  1 
ATOM   1602 C CE  . MET A 1 210 ? 51.202  58.872 349.336 1.00 45.78  ? 211 MET A CE  1 
ATOM   1603 N N   . HIS A 1 211 ? 56.954  60.562 353.395 1.00 48.20  ? 212 HIS A N   1 
ATOM   1604 C CA  . HIS A 1 211 ? 57.922  61.255 354.238 1.00 50.56  ? 212 HIS A CA  1 
ATOM   1605 C C   . HIS A 1 211 ? 59.336  61.130 353.673 1.00 48.52  ? 212 HIS A C   1 
ATOM   1606 O O   . HIS A 1 211 ? 60.142  62.054 353.824 1.00 52.24  ? 212 HIS A O   1 
ATOM   1607 C CB  . HIS A 1 211 ? 57.857  60.724 355.676 1.00 42.56  ? 212 HIS A CB  1 
ATOM   1608 C CG  . HIS A 1 211 ? 56.576  61.053 356.384 1.00 46.85  ? 212 HIS A CG  1 
ATOM   1609 N ND1 . HIS A 1 211 ? 56.197  62.346 356.678 1.00 38.03  ? 212 HIS A ND1 1 
ATOM   1610 C CD2 . HIS A 1 211 ? 55.583  60.255 356.846 1.00 41.12  ? 212 HIS A CD2 1 
ATOM   1611 C CE1 . HIS A 1 211 ? 55.029  62.330 357.296 1.00 45.13  ? 212 HIS A CE1 1 
ATOM   1612 N NE2 . HIS A 1 211 ? 54.634  61.074 357.410 1.00 49.25  ? 212 HIS A NE2 1 
ATOM   1613 N N   . LEU A 1 212 ? 59.652  60.007 353.020 1.00 46.07  ? 213 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 212 ? 60.928  59.881 352.319 1.00 65.30  ? 213 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 212 ? 61.087  60.962 351.257 1.00 56.72  ? 213 LEU A C   1 
ATOM   1616 O O   . LEU A 1 212 ? 62.188  61.486 351.052 1.00 64.35  ? 213 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 212 ? 61.044  58.500 351.667 1.00 53.54  ? 213 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 212 ? 61.637  57.346 352.479 1.00 70.21  ? 213 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 212 ? 61.800  56.127 351.594 1.00 67.77  ? 213 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 212 ? 62.972  57.727 353.104 1.00 60.55  ? 213 LEU A CD2 1 
ATOM   1621 N N   . LEU A 1 213 ? 60.000  61.306 350.571 1.00 54.80  ? 214 LEU A N   1 
ATOM   1622 C CA  . LEU A 1 213 ? 60.039  62.194 349.417 1.00 52.73  ? 214 LEU A CA  1 
ATOM   1623 C C   . LEU A 1 213 ? 59.690  63.634 349.753 1.00 56.33  ? 214 LEU A C   1 
ATOM   1624 O O   . LEU A 1 213 ? 59.595  64.460 348.839 1.00 49.01  ? 214 LEU A O   1 
ATOM   1625 C CB  . LEU A 1 213 ? 59.088  61.679 348.335 1.00 45.64  ? 214 LEU A CB  1 
ATOM   1626 C CG  . LEU A 1 213 ? 59.371  60.231 347.940 1.00 47.59  ? 214 LEU A CG  1 
ATOM   1627 C CD1 . LEU A 1 213 ? 58.282  59.685 347.032 1.00 43.34  ? 214 LEU A CD1 1 
ATOM   1628 C CD2 . LEU A 1 213 ? 60.743  60.130 347.288 1.00 50.91  ? 214 LEU A CD2 1 
ATOM   1629 N N   . SER A 1 214 ? 59.479  63.951 351.026 1.00 47.07  ? 215 SER A N   1 
ATOM   1630 C CA  . SER A 1 214 ? 59.185  65.317 351.444 1.00 55.59  ? 215 SER A CA  1 
ATOM   1631 C C   . SER A 1 214 ? 60.321  65.820 352.323 1.00 62.11  ? 215 SER A C   1 
ATOM   1632 O O   . SER A 1 214 ? 60.499  65.317 353.446 1.00 67.38  ? 215 SER A O   1 
ATOM   1633 C CB  . SER A 1 214 ? 57.854  65.388 352.193 1.00 60.60  ? 215 SER A CB  1 
ATOM   1634 O OG  . SER A 1 214 ? 57.391  66.725 352.281 1.00 54.20  ? 215 SER A OG  1 
ATOM   1635 N N   . PRO A 1 215 ? 61.097  66.798 351.863 1.00 68.99  ? 216 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 215 ? 62.303  67.231 352.591 1.00 64.73  ? 216 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 215 ? 62.038  67.602 354.044 1.00 52.02  ? 216 PRO A C   1 
ATOM   1638 O O   . PRO A 1 215 ? 62.842  67.232 354.913 1.00 64.32  ? 216 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 215 ? 62.784  68.440 351.774 1.00 62.23  ? 216 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 215 ? 62.344  68.110 350.378 1.00 57.38  ? 216 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 215 ? 61.009  67.418 350.527 1.00 67.88  ? 216 PRO A CD  1 
ATOM   1642 N N   . PRO A 1 216 ? 60.953  68.325 354.373 1.00 62.77  ? 217 PRO A N   1 
ATOM   1643 C CA  . PRO A 1 216 ? 60.729  68.639 355.801 1.00 51.21  ? 217 PRO A CA  1 
ATOM   1644 C C   . PRO A 1 216 ? 60.550  67.411 356.690 1.00 64.56  ? 217 PRO A C   1 
ATOM   1645 O O   . PRO A 1 216 ? 60.848  67.486 357.890 1.00 67.26  ? 217 PRO A O   1 
ATOM   1646 C CB  . PRO A 1 216 ? 59.466  69.511 355.786 1.00 50.94  ? 217 PRO A CB  1 
ATOM   1647 C CG  . PRO A 1 216 ? 59.406  70.077 354.404 1.00 53.44  ? 217 PRO A CG  1 
ATOM   1648 C CD  . PRO A 1 216 ? 59.959  69.007 353.516 1.00 49.35  ? 217 PRO A CD  1 
ATOM   1649 N N   . SER A 1 217 ? 60.072  66.286 356.152 1.00 58.82  ? 218 SER A N   1 
ATOM   1650 C CA  . SER A 1 217 ? 60.004  65.053 356.931 1.00 64.06  ? 218 SER A CA  1 
ATOM   1651 C C   . SER A 1 217 ? 61.314  64.280 356.915 1.00 62.88  ? 218 SER A C   1 
ATOM   1652 O O   . SER A 1 217 ? 61.618  63.566 357.878 1.00 58.94  ? 218 SER A O   1 
ATOM   1653 C CB  . SER A 1 217 ? 58.889  64.134 356.410 1.00 41.65  ? 218 SER A CB  1 
ATOM   1654 O OG  . SER A 1 217 ? 57.625  64.772 356.415 1.00 51.80  ? 218 SER A OG  1 
ATOM   1655 N N   . ARG A 1 218 ? 62.100  64.419 355.846 1.00 54.41  ? 219 ARG A N   1 
ATOM   1656 C CA  . ARG A 1 218 ? 63.238  63.530 355.634 1.00 68.53  ? 219 ARG A CA  1 
ATOM   1657 C C   . ARG A 1 218 ? 64.294  63.696 356.721 1.00 49.17  ? 219 ARG A C   1 
ATOM   1658 O O   . ARG A 1 218 ? 64.961  62.727 357.102 1.00 54.62  ? 219 ARG A O   1 
ATOM   1659 C CB  . ARG A 1 218 ? 63.831  63.776 354.245 1.00 60.12  ? 219 ARG A CB  1 
ATOM   1660 C CG  . ARG A 1 218 ? 64.972  62.854 353.858 1.00 62.87  ? 219 ARG A CG  1 
ATOM   1661 C CD  . ARG A 1 218 ? 64.527  61.416 353.712 1.00 66.18  ? 219 ARG A CD  1 
ATOM   1662 N NE  . ARG A 1 218 ? 65.672  60.510 353.658 1.00 76.30  ? 219 ARG A NE  1 
ATOM   1663 C CZ  . ARG A 1 218 ? 66.312  60.042 354.728 1.00 82.87  ? 219 ARG A CZ  1 
ATOM   1664 N NH1 . ARG A 1 218 ? 65.923  60.387 355.953 1.00 59.86  ? 219 ARG A NH1 1 
ATOM   1665 N NH2 . ARG A 1 218 ? 67.344  59.222 354.575 1.00 69.08  ? 219 ARG A NH2 1 
ATOM   1666 N N   . GLY A 1 219 ? 64.450  64.906 357.248 1.00 51.34  ? 220 GLY A N   1 
ATOM   1667 C CA  . GLY A 1 219 ? 65.465  65.127 358.261 1.00 48.36  ? 220 GLY A CA  1 
ATOM   1668 C C   . GLY A 1 219 ? 65.009  64.701 359.639 1.00 62.32  ? 220 GLY A C   1 
ATOM   1669 O O   . GLY A 1 219 ? 65.670  64.986 360.642 1.00 67.75  ? 220 GLY A O   1 
ATOM   1670 N N   . LEU A 1 220 ? 63.880  64.002 359.700 1.00 62.92  ? 221 LEU A N   1 
ATOM   1671 C CA  . LEU A 1 220 ? 63.255  63.637 360.960 1.00 49.71  ? 221 LEU A CA  1 
ATOM   1672 C C   . LEU A 1 220 ? 63.330  62.147 361.259 1.00 60.90  ? 221 LEU A C   1 
ATOM   1673 O O   . LEU A 1 220 ? 62.835  61.715 362.304 1.00 51.74  ? 221 LEU A O   1 
ATOM   1674 C CB  . LEU A 1 220 ? 61.795  64.087 360.953 1.00 48.83  ? 221 LEU A CB  1 
ATOM   1675 C CG  . LEU A 1 220 ? 61.534  65.588 360.957 1.00 61.08  ? 221 LEU A CG  1 
ATOM   1676 C CD1 . LEU A 1 220 ? 60.045  65.847 360.944 1.00 51.92  ? 221 LEU A CD1 1 
ATOM   1677 C CD2 . LEU A 1 220 ? 62.170  66.227 362.162 1.00 57.65  ? 221 LEU A CD2 1 
ATOM   1678 N N   . PHE A 1 221 ? 63.913  61.348 360.370 1.00 51.42  ? 222 PHE A N   1 
ATOM   1679 C CA  . PHE A 1 221 ? 64.098  59.924 360.608 1.00 51.69  ? 222 PHE A CA  1 
ATOM   1680 C C   . PHE A 1 221 ? 65.291  59.477 359.779 1.00 56.72  ? 222 PHE A C   1 
ATOM   1681 O O   . PHE A 1 221 ? 65.836  60.246 358.983 1.00 64.04  ? 222 PHE A O   1 
ATOM   1682 C CB  . PHE A 1 221 ? 62.832  59.113 360.273 1.00 43.40  ? 222 PHE A CB  1 
ATOM   1683 C CG  . PHE A 1 221 ? 62.405  59.200 358.827 1.00 42.92  ? 222 PHE A CG  1 
ATOM   1684 C CD1 . PHE A 1 221 ? 61.656  60.279 358.374 1.00 51.43  ? 222 PHE A CD1 1 
ATOM   1685 C CD2 . PHE A 1 221 ? 62.736  58.198 357.925 1.00 55.72  ? 222 PHE A CD2 1 
ATOM   1686 C CE1 . PHE A 1 221 ? 61.258  60.368 357.042 1.00 53.84  ? 222 PHE A CE1 1 
ATOM   1687 C CE2 . PHE A 1 221 ? 62.334  58.276 356.590 1.00 45.80  ? 222 PHE A CE2 1 
ATOM   1688 C CZ  . PHE A 1 221 ? 61.596  59.363 356.152 1.00 51.84  ? 222 PHE A CZ  1 
ATOM   1689 N N   . HIS A 1 222 ? 65.687  58.218 359.952 1.00 52.05  ? 223 HIS A N   1 
ATOM   1690 C CA  . HIS A 1 222 ? 66.931  57.767 359.344 1.00 49.48  ? 223 HIS A CA  1 
ATOM   1691 C C   . HIS A 1 222 ? 66.762  56.532 358.469 1.00 52.23  ? 223 HIS A C   1 
ATOM   1692 O O   . HIS A 1 222 ? 67.480  56.374 357.478 1.00 66.94  ? 223 HIS A O   1 
ATOM   1693 C CB  . HIS A 1 222 ? 67.958  57.527 360.449 1.00 59.70  ? 223 HIS A CB  1 
ATOM   1694 C CG  . HIS A 1 222 ? 68.137  58.718 361.336 1.00 82.69  ? 223 HIS A CG  1 
ATOM   1695 N ND1 . HIS A 1 222 ? 67.320  58.971 362.418 1.00 53.89  ? 223 HIS A ND1 1 
ATOM   1696 C CD2 . HIS A 1 222 ? 68.993  59.764 361.257 1.00 71.71  ? 223 HIS A CD2 1 
ATOM   1697 C CE1 . HIS A 1 222 ? 67.682  60.109 362.981 1.00 68.11  ? 223 HIS A CE1 1 
ATOM   1698 N NE2 . HIS A 1 222 ? 68.699  60.607 362.299 1.00 73.56  ? 223 HIS A NE2 1 
ATOM   1699 N N   . ARG A 1 223 ? 65.824  55.657 358.812 1.00 57.03  ? 224 ARG A N   1 
ATOM   1700 C CA  . ARG A 1 223 ? 65.592  54.452 358.032 1.00 53.60  ? 224 ARG A CA  1 
ATOM   1701 C C   . ARG A 1 223 ? 64.094  54.259 357.845 1.00 52.85  ? 224 ARG A C   1 
ATOM   1702 O O   . ARG A 1 223 ? 63.282  54.837 358.569 1.00 56.32  ? 224 ARG A O   1 
ATOM   1703 C CB  . ARG A 1 223 ? 66.240  53.236 358.697 1.00 44.76  ? 224 ARG A CB  1 
ATOM   1704 C CG  . ARG A 1 223 ? 67.732  53.168 358.431 1.00 62.23  ? 224 ARG A CG  1 
ATOM   1705 C CD  . ARG A 1 223 ? 68.433  52.186 359.341 1.00 56.31  ? 224 ARG A CD  1 
ATOM   1706 N NE  . ARG A 1 223 ? 68.384  52.614 360.729 1.00 73.32  ? 224 ARG A NE  1 
ATOM   1707 C CZ  . ARG A 1 223 ? 69.374  53.247 361.346 1.00 79.62  ? 224 ARG A CZ  1 
ATOM   1708 N NH1 . ARG A 1 223 ? 70.493  53.529 360.692 1.00 82.85  ? 224 ARG A NH1 1 
ATOM   1709 N NH2 . ARG A 1 223 ? 69.243  53.602 362.617 1.00 74.54  ? 224 ARG A NH2 1 
ATOM   1710 N N   . ALA A 1 224 ? 63.728  53.447 356.854 1.00 48.45  ? 225 ALA A N   1 
ATOM   1711 C CA  . ALA A 1 224 ? 62.322  53.276 356.508 1.00 61.36  ? 225 ALA A CA  1 
ATOM   1712 C C   . ALA A 1 224 ? 62.006  51.822 356.188 1.00 51.72  ? 225 ALA A C   1 
ATOM   1713 O O   . ALA A 1 224 ? 62.806  51.125 355.558 1.00 47.91  ? 225 ALA A O   1 
ATOM   1714 C CB  . ALA A 1 224 ? 61.936  54.158 355.315 1.00 44.54  ? 225 ALA A CB  1 
ATOM   1715 N N   . VAL A 1 225 ? 60.827  51.375 356.618 1.00 44.56  ? 226 VAL A N   1 
ATOM   1716 C CA  . VAL A 1 225 ? 60.296  50.063 356.266 1.00 38.02  ? 226 VAL A CA  1 
ATOM   1717 C C   . VAL A 1 225 ? 58.932  50.269 355.627 1.00 48.23  ? 226 VAL A C   1 
ATOM   1718 O O   . VAL A 1 225 ? 58.049  50.892 356.227 1.00 48.22  ? 226 VAL A O   1 
ATOM   1719 C CB  . VAL A 1 225 ? 60.181  49.127 357.482 1.00 50.09  ? 226 VAL A CB  1 
ATOM   1720 C CG1 . VAL A 1 225 ? 59.771  47.727 357.042 1.00 44.32  ? 226 VAL A CG1 1 
ATOM   1721 C CG2 . VAL A 1 225 ? 61.477  49.095 358.271 1.00 48.96  ? 226 VAL A CG2 1 
ATOM   1722 N N   . LEU A 1 226 ? 58.763  49.745 354.412 1.00 44.55  ? 227 LEU A N   1 
ATOM   1723 C CA  . LEU A 1 226 ? 57.509  49.847 353.674 1.00 45.59  ? 227 LEU A CA  1 
ATOM   1724 C C   . LEU A 1 226 ? 56.964  48.438 353.485 1.00 47.14  ? 227 LEU A C   1 
ATOM   1725 O O   . LEU A 1 226 ? 57.502  47.660 352.690 1.00 55.68  ? 227 LEU A O   1 
ATOM   1726 C CB  . LEU A 1 226 ? 57.717  50.552 352.335 1.00 47.59  ? 227 LEU A CB  1 
ATOM   1727 C CG  . LEU A 1 226 ? 58.065  52.038 352.433 1.00 49.66  ? 227 LEU A CG  1 
ATOM   1728 C CD1 . LEU A 1 226 ? 59.565  52.225 352.566 1.00 41.58  ? 227 LEU A CD1 1 
ATOM   1729 C CD2 . LEU A 1 226 ? 57.545  52.789 351.219 1.00 53.50  ? 227 LEU A CD2 1 
ATOM   1730 N N   . GLN A 1 227 ? 55.898  48.112 354.213 1.00 48.42  ? 228 GLN A N   1 
ATOM   1731 C CA  . GLN A 1 227 ? 55.293  46.784 354.191 1.00 49.89  ? 228 GLN A CA  1 
ATOM   1732 C C   . GLN A 1 227 ? 53.980  46.851 353.402 1.00 61.50  ? 228 GLN A C   1 
ATOM   1733 O O   . GLN A 1 227 ? 52.996  47.440 353.866 1.00 45.99  ? 228 GLN A O   1 
ATOM   1734 C CB  . GLN A 1 227 ? 55.090  46.280 355.622 1.00 39.48  ? 228 GLN A CB  1 
ATOM   1735 C CG  . GLN A 1 227 ? 56.371  46.350 356.500 1.00 43.87  ? 228 GLN A CG  1 
ATOM   1736 C CD  . GLN A 1 227 ? 56.112  46.159 357.999 1.00 61.22  ? 228 GLN A CD  1 
ATOM   1737 O OE1 . GLN A 1 227 ? 56.882  46.614 358.851 1.00 55.69  ? 228 GLN A OE1 1 
ATOM   1738 N NE2 . GLN A 1 227 ? 55.029  45.484 358.321 1.00 50.32  ? 228 GLN A NE2 1 
ATOM   1739 N N   . SER A 1 228 ? 53.982  46.282 352.189 1.00 47.34  ? 229 SER A N   1 
ATOM   1740 C CA  . SER A 1 228 ? 52.777  46.141 351.362 1.00 41.10  ? 229 SER A CA  1 
ATOM   1741 C C   . SER A 1 228 ? 52.164  47.499 351.011 1.00 41.02  ? 229 SER A C   1 
ATOM   1742 O O   . SER A 1 228 ? 50.958  47.715 351.142 1.00 43.66  ? 229 SER A O   1 
ATOM   1743 C CB  . SER A 1 228 ? 51.736  45.246 352.049 1.00 42.80  ? 229 SER A CB  1 
ATOM   1744 O OG  . SER A 1 228 ? 52.314  44.061 352.570 1.00 49.87  ? 229 SER A OG  1 
ATOM   1745 N N   . GLY A 1 229 ? 53.000  48.420 350.554 1.00 45.17  ? 230 GLY A N   1 
ATOM   1746 C CA  . GLY A 1 229 ? 52.510  49.732 350.170 1.00 34.36  ? 230 GLY A CA  1 
ATOM   1747 C C   . GLY A 1 229 ? 53.659  50.597 349.703 1.00 49.21  ? 230 GLY A C   1 
ATOM   1748 O O   . GLY A 1 229 ? 54.823  50.359 350.046 1.00 50.67  ? 230 GLY A O   1 
ATOM   1749 N N   . ALA A 1 230 ? 53.304  51.613 348.917 1.00 44.17  ? 231 ALA A N   1 
ATOM   1750 C CA  . ALA A 1 230 ? 54.247  52.506 348.259 1.00 39.11  ? 231 ALA A CA  1 
ATOM   1751 C C   . ALA A 1 230 ? 53.594  53.860 348.073 1.00 46.95  ? 231 ALA A C   1 
ATOM   1752 O O   . ALA A 1 230 ? 52.376  53.934 347.876 1.00 47.99  ? 231 ALA A O   1 
ATOM   1753 C CB  . ALA A 1 230 ? 54.673  51.979 346.883 1.00 49.44  ? 231 ALA A CB  1 
ATOM   1754 N N   . PRO A 1 231 ? 54.373  54.943 348.073 1.00 49.18  ? 232 PRO A N   1 
ATOM   1755 C CA  . PRO A 1 231 ? 53.797  56.242 347.713 1.00 51.19  ? 232 PRO A CA  1 
ATOM   1756 C C   . PRO A 1 231 ? 53.445  56.347 346.231 1.00 56.79  ? 232 PRO A C   1 
ATOM   1757 O O   . PRO A 1 231 ? 52.665  57.236 345.867 1.00 57.36  ? 232 PRO A O   1 
ATOM   1758 C CB  . PRO A 1 231 ? 54.898  57.229 348.118 1.00 40.02  ? 232 PRO A CB  1 
ATOM   1759 C CG  . PRO A 1 231 ? 56.167  56.447 347.878 1.00 46.64  ? 232 PRO A CG  1 
ATOM   1760 C CD  . PRO A 1 231 ? 55.835  55.020 348.267 1.00 47.88  ? 232 PRO A CD  1 
ATOM   1761 N N   . ASN A 1 232 ? 53.960  55.455 345.378 1.00 49.94  ? 233 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 232 ? 53.668  55.468 343.947 1.00 51.17  ? 233 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 232 ? 52.537  54.520 343.552 1.00 60.72  ? 233 ASN A C   1 
ATOM   1764 O O   . ASN A 1 232 ? 52.342  54.275 342.357 1.00 60.32  ? 233 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 232 ? 54.925  55.130 343.134 1.00 47.16  ? 233 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 232 ? 55.699  53.959 343.709 1.00 60.89  ? 233 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 232 ? 56.010  53.937 344.896 1.00 50.00  ? 233 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 232 ? 56.017  52.980 342.867 1.00 53.87  ? 233 ASN A ND2 1 
ATOM   1769 N N   . GLY A 1 233 ? 51.781  53.987 344.510 1.00 67.15  ? 234 GLY A N   1 
ATOM   1770 C CA  . GLY A 1 233 ? 50.591  53.234 344.177 1.00 85.92  ? 234 GLY A CA  1 
ATOM   1771 C C   . GLY A 1 233 ? 49.586  54.073 343.402 1.00 92.83  ? 234 GLY A C   1 
ATOM   1772 O O   . GLY A 1 233 ? 49.472  55.284 343.617 1.00 97.64  ? 234 GLY A O   1 
ATOM   1773 N N   . PRO A 1 234 ? 48.828  53.442 342.473 1.00 71.33  ? 235 PRO A N   1 
ATOM   1774 C CA  . PRO A 1 234 ? 47.772  54.172 341.750 1.00 56.61  ? 235 PRO A CA  1 
ATOM   1775 C C   . PRO A 1 234 ? 46.638  54.647 342.646 1.00 60.99  ? 235 PRO A C   1 
ATOM   1776 O O   . PRO A 1 234 ? 45.720  55.334 342.190 1.00 66.02  ? 235 PRO A O   1 
ATOM   1777 C CB  . PRO A 1 234 ? 47.268  53.137 340.737 1.00 52.13  ? 235 PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 234 ? 47.557  51.820 341.387 1.00 52.03  ? 235 PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 234 ? 48.885  52.026 342.069 1.00 61.68  ? 235 PRO A CD  1 
ATOM   1780 N N   . TRP A 1 235 ? 46.698  54.285 343.929 1.00 59.80  ? 236 TRP A N   1 
ATOM   1781 C CA  . TRP A 1 235 ? 45.664  54.609 344.900 1.00 55.97  ? 236 TRP A CA  1 
ATOM   1782 C C   . TRP A 1 235 ? 46.111  55.599 345.965 1.00 57.30  ? 236 TRP A C   1 
ATOM   1783 O O   . TRP A 1 235 ? 45.256  56.161 346.656 1.00 55.23  ? 236 TRP A O   1 
ATOM   1784 C CB  . TRP A 1 235 ? 45.197  53.330 345.608 1.00 48.90  ? 236 TRP A CB  1 
ATOM   1785 C CG  . TRP A 1 235 ? 46.364  52.555 346.140 1.00 56.88  ? 236 TRP A CG  1 
ATOM   1786 C CD1 . TRP A 1 235 ? 47.088  51.601 345.481 1.00 57.84  ? 236 TRP A CD1 1 
ATOM   1787 C CD2 . TRP A 1 235 ? 46.985  52.716 347.419 1.00 45.91  ? 236 TRP A CD2 1 
ATOM   1788 N NE1 . TRP A 1 235 ? 48.098  51.134 346.286 1.00 54.19  ? 236 TRP A NE1 1 
ATOM   1789 C CE2 . TRP A 1 235 ? 48.058  51.806 347.481 1.00 55.94  ? 236 TRP A CE2 1 
ATOM   1790 C CE3 . TRP A 1 235 ? 46.728  53.532 348.526 1.00 53.66  ? 236 TRP A CE3 1 
ATOM   1791 C CZ2 . TRP A 1 235 ? 48.877  51.693 348.605 1.00 45.74  ? 236 TRP A CZ2 1 
ATOM   1792 C CZ3 . TRP A 1 235 ? 47.539  53.417 349.637 1.00 52.06  ? 236 TRP A CZ3 1 
ATOM   1793 C CH2 . TRP A 1 235 ? 48.600  52.504 349.669 1.00 55.05  ? 236 TRP A CH2 1 
ATOM   1794 N N   . ALA A 1 236 ? 47.419  55.815 346.127 1.00 50.23  ? 237 ALA A N   1 
ATOM   1795 C CA  . ALA A 1 236 ? 47.915  56.533 347.296 1.00 52.44  ? 237 ALA A CA  1 
ATOM   1796 C C   . ALA A 1 236 ? 47.854  58.043 347.143 1.00 51.06  ? 237 ALA A C   1 
ATOM   1797 O O   . ALA A 1 236 ? 47.862  58.752 348.154 1.00 53.57  ? 237 ALA A O   1 
ATOM   1798 C CB  . ALA A 1 236 ? 49.350  56.108 347.609 1.00 46.00  ? 237 ALA A CB  1 
ATOM   1799 N N   . THR A 1 237 ? 47.797  58.553 345.917 1.00 46.43  ? 238 THR A N   1 
ATOM   1800 C CA  . THR A 1 237 ? 47.740  59.987 345.688 1.00 66.84  ? 238 THR A CA  1 
ATOM   1801 C C   . THR A 1 237 ? 46.616  60.315 344.715 1.00 57.43  ? 238 THR A C   1 
ATOM   1802 O O   . THR A 1 237 ? 46.044  59.442 344.056 1.00 55.75  ? 238 THR A O   1 
ATOM   1803 C CB  . THR A 1 237 ? 49.070  60.538 345.152 1.00 53.52  ? 238 THR A CB  1 
ATOM   1804 O OG1 . THR A 1 237 ? 49.515  59.733 344.056 1.00 60.89  ? 238 THR A OG1 1 
ATOM   1805 C CG2 . THR A 1 237 ? 50.129  60.540 346.245 1.00 55.04  ? 238 THR A CG2 1 
ATOM   1806 N N   . VAL A 1 238 ? 46.313  61.605 344.633 1.00 58.09  ? 239 VAL A N   1 
ATOM   1807 C CA  . VAL A 1 238 ? 45.259  62.106 343.767 1.00 56.64  ? 239 VAL A CA  1 
ATOM   1808 C C   . VAL A 1 238 ? 45.685  63.479 343.268 1.00 60.65  ? 239 VAL A C   1 
ATOM   1809 O O   . VAL A 1 238 ? 46.401  64.215 343.954 1.00 63.36  ? 239 VAL A O   1 
ATOM   1810 C CB  . VAL A 1 238 ? 43.898  62.151 344.506 1.00 63.37  ? 239 VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 238 ? 43.834  63.332 345.472 1.00 58.68  ? 239 VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 238 ? 42.763  62.206 343.520 1.00 65.87  ? 239 VAL A CG2 1 
ATOM   1813 N N   . GLY A 1 239 ? 45.265  63.813 342.050 1.00 58.80  ? 240 GLY A N   1 
ATOM   1814 C CA  . GLY A 1 239 ? 45.581  65.109 341.492 1.00 49.06  ? 240 GLY A CA  1 
ATOM   1815 C C   . GLY A 1 239 ? 44.791  66.233 342.141 1.00 65.72  ? 240 GLY A C   1 
ATOM   1816 O O   . GLY A 1 239 ? 43.794  66.019 342.830 1.00 63.45  ? 240 GLY A O   1 
ATOM   1817 N N   . MET A 1 240 ? 45.258  67.461 341.905 1.00 61.78  ? 241 MET A N   1 
ATOM   1818 C CA  . MET A 1 240 ? 44.581  68.628 342.465 1.00 58.55  ? 241 MET A CA  1 
ATOM   1819 C C   . MET A 1 240 ? 43.154  68.747 341.944 1.00 76.49  ? 241 MET A C   1 
ATOM   1820 O O   . MET A 1 240 ? 42.221  68.993 342.718 1.00 56.28  ? 241 MET A O   1 
ATOM   1821 C CB  . MET A 1 240 ? 45.374  69.890 342.142 1.00 54.05  ? 241 MET A CB  1 
ATOM   1822 C CG  . MET A 1 240 ? 46.489  70.164 343.120 1.00 74.28  ? 241 MET A CG  1 
ATOM   1823 S SD  . MET A 1 240 ? 47.218  71.787 342.876 1.00 80.41  ? 241 MET A SD  1 
ATOM   1824 C CE  . MET A 1 240 ? 48.378  71.440 341.559 1.00 85.78  ? 241 MET A CE  1 
ATOM   1825 N N   . GLY A 1 241 ? 42.964  68.568 340.634 1.00 74.91  ? 242 GLY A N   1 
ATOM   1826 C CA  . GLY A 1 241 ? 41.633  68.701 340.064 1.00 53.72  ? 242 GLY A CA  1 
ATOM   1827 C C   . GLY A 1 241 ? 40.665  67.653 340.584 1.00 76.11  ? 242 GLY A C   1 
ATOM   1828 O O   . GLY A 1 241 ? 39.534  67.971 340.968 1.00 67.06  ? 242 GLY A O   1 
ATOM   1829 N N   . GLU A 1 242 ? 41.094  66.388 340.598 1.00 59.86  ? 243 GLU A N   1 
ATOM   1830 C CA  . GLU A 1 242 ? 40.230  65.324 341.099 1.00 52.34  ? 243 GLU A CA  1 
ATOM   1831 C C   . GLU A 1 242 ? 39.972  65.471 342.593 1.00 70.91  ? 243 GLU A C   1 
ATOM   1832 O O   . GLU A 1 242 ? 38.871  65.160 343.063 1.00 63.46  ? 243 GLU A O   1 
ATOM   1833 C CB  . GLU A 1 242 ? 40.844  63.957 340.779 1.00 51.59  ? 243 GLU A CB  1 
ATOM   1834 C CG  . GLU A 1 242 ? 40.075  62.756 341.322 1.00 55.21  ? 243 GLU A CG  1 
ATOM   1835 C CD  . GLU A 1 242 ? 38.700  62.585 340.702 1.00 66.33  ? 243 GLU A CD  1 
ATOM   1836 O OE1 . GLU A 1 242 ? 38.374  63.314 339.740 1.00 73.61  ? 243 GLU A OE1 1 
ATOM   1837 O OE2 . GLU A 1 242 ? 37.940  61.719 341.188 1.00 63.95  ? 243 GLU A OE2 1 
ATOM   1838 N N   . ALA A 1 243 ? 40.962  65.952 343.349 1.00 64.02  ? 244 ALA A N   1 
ATOM   1839 C CA  . ALA A 1 243 ? 40.736  66.232 344.762 1.00 69.83  ? 244 ALA A CA  1 
ATOM   1840 C C   . ALA A 1 243 ? 39.654  67.289 344.933 1.00 66.02  ? 244 ALA A C   1 
ATOM   1841 O O   . ALA A 1 243 ? 38.732  67.126 345.741 1.00 60.81  ? 244 ALA A O   1 
ATOM   1842 C CB  . ALA A 1 243 ? 42.040  66.675 345.431 1.00 51.96  ? 244 ALA A CB  1 
ATOM   1843 N N   . ARG A 1 244 ? 39.744  68.377 344.162 1.00 57.77  ? 245 ARG A N   1 
ATOM   1844 C CA  . ARG A 1 244 ? 38.746  69.439 344.261 1.00 71.90  ? 245 ARG A CA  1 
ATOM   1845 C C   . ARG A 1 244 ? 37.359  68.928 343.897 1.00 64.64  ? 245 ARG A C   1 
ATOM   1846 O O   . ARG A 1 244 ? 36.376  69.255 344.568 1.00 73.72  ? 245 ARG A O   1 
ATOM   1847 C CB  . ARG A 1 244 ? 39.126  70.622 343.368 1.00 76.48  ? 245 ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 244 ? 38.029  71.676 343.255 1.00 65.72  ? 245 ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 244 ? 38.539  72.973 342.644 1.00 63.21  ? 245 ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 244 ? 39.458  73.690 343.524 1.00 76.19  ? 245 ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 244 ? 39.074  74.509 344.499 1.00 75.17  ? 245 ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 244 ? 37.784  74.709 344.730 1.00 70.55  ? 245 ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 244 ? 39.980  75.123 345.249 1.00 69.80  ? 245 ARG A NH2 1 
ATOM   1854 N N   . ARG A 1 245 ? 37.257  68.114 342.848 1.00 56.43  ? 246 ARG A N   1 
ATOM   1855 C CA  . ARG A 1 245 ? 35.950  67.591 342.471 1.00 63.23  ? 246 ARG A CA  1 
ATOM   1856 C C   . ARG A 1 245 ? 35.359  66.737 343.583 1.00 63.83  ? 246 ARG A C   1 
ATOM   1857 O O   . ARG A 1 245 ? 34.160  66.824 343.873 1.00 68.86  ? 246 ARG A O   1 
ATOM   1858 C CB  . ARG A 1 245 ? 36.051  66.783 341.176 1.00 67.55  ? 246 ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 245 ? 34.707  66.283 340.684 1.00 64.07  ? 246 ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 245 ? 34.832  65.086 339.758 1.00 71.39  ? 246 ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 245 ? 35.225  63.857 340.447 1.00 69.37  ? 246 ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 245 ? 34.383  63.035 341.072 1.00 80.27  ? 246 ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 245 ? 33.083  63.307 341.125 1.00 83.52  ? 246 ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 245 ? 34.844  61.937 341.654 1.00 71.10  ? 246 ARG A NH2 1 
ATOM   1865 N N   . ARG A 1 246 ? 36.188  65.908 344.224 1.00 66.24  ? 247 ARG A N   1 
ATOM   1866 C CA  . ARG A 1 246 ? 35.685  65.028 345.273 1.00 59.88  ? 247 ARG A CA  1 
ATOM   1867 C C   . ARG A 1 246 ? 35.239  65.819 346.495 1.00 59.84  ? 247 ARG A C   1 
ATOM   1868 O O   . ARG A 1 246 ? 34.236  65.477 347.130 1.00 59.44  ? 247 ARG A O   1 
ATOM   1869 C CB  . ARG A 1 246 ? 36.750  64.005 345.656 1.00 68.84  ? 247 ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 246 ? 37.033  62.979 344.575 1.00 56.65  ? 247 ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 246 ? 38.069  61.979 345.044 1.00 53.88  ? 247 ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 246 ? 38.506  61.100 343.969 1.00 64.60  ? 247 ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 246 ? 39.348  60.088 344.132 1.00 67.03  ? 247 ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 246 ? 39.843  59.823 345.333 1.00 63.99  ? 247 ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 246 ? 39.695  59.340 343.094 1.00 55.55  ? 247 ARG A NH2 1 
ATOM   1876 N N   . ALA A 1 247 ? 35.965  66.885 346.835 1.00 62.44  ? 248 ALA A N   1 
ATOM   1877 C CA  . ALA A 1 247 ? 35.563  67.709 347.969 1.00 60.23  ? 248 ALA A CA  1 
ATOM   1878 C C   . ALA A 1 247 ? 34.219  68.386 347.712 1.00 74.61  ? 248 ALA A C   1 
ATOM   1879 O O   . ALA A 1 247 ? 33.366  68.438 348.606 1.00 63.69  ? 248 ALA A O   1 
ATOM   1880 C CB  . ALA A 1 247 ? 36.649  68.740 348.280 1.00 51.38  ? 248 ALA A CB  1 
ATOM   1881 N N   . THR A 1 248 ? 33.991  68.881 346.487 1.00 75.61  ? 249 THR A N   1 
ATOM   1882 C CA  . THR A 1 248 ? 32.742  69.595 346.214 1.00 69.07  ? 249 THR A CA  1 
ATOM   1883 C C   . THR A 1 248 ? 31.539  68.658 346.154 1.00 67.57  ? 249 THR A C   1 
ATOM   1884 O O   . THR A 1 248 ? 30.439  69.052 346.568 1.00 73.47  ? 249 THR A O   1 
ATOM   1885 C CB  . THR A 1 248 ? 32.834  70.401 344.914 1.00 74.65  ? 249 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 248 ? 32.719  69.524 343.788 1.00 83.51  ? 249 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 248 ? 34.127  71.172 344.836 1.00 55.46  ? 249 THR A CG2 1 
ATOM   1888 N N   . GLN A 1 249 ? 31.735  67.436 345.704 1.00 55.88  ? 250 GLN A N   1 
ATOM   1889 C CA  . GLN A 1 249 ? 30.664  66.476 345.622 1.00 64.52  ? 250 GLN A CA  1 
ATOM   1890 C C   . GLN A 1 249 ? 30.260  66.050 347.005 1.00 63.87  ? 250 GLN A C   1 
ATOM   1891 O O   . GLN A 1 249 ? 29.116  65.862 347.302 1.00 68.72  ? 250 GLN A O   1 
ATOM   1892 C CB  . GLN A 1 249 ? 31.084  65.287 344.788 1.00 51.54  ? 250 GLN A CB  1 
ATOM   1893 C CG  . GLN A 1 249 ? 30.122  64.123 344.781 1.00 71.71  ? 250 GLN A CG  1 
ATOM   1894 C CD  . GLN A 1 249 ? 28.818  64.441 344.092 1.00 81.50  ? 250 GLN A CD  1 
ATOM   1895 O OE1 . GLN A 1 249 ? 28.651  65.502 343.512 1.00 86.59  ? 250 GLN A OE1 1 
ATOM   1896 N NE2 . GLN A 1 249 ? 27.889  63.520 344.149 1.00 71.59  ? 250 GLN A NE2 1 
ATOM   1897 N N   . LEU A 1 250 ? 31.221  65.889 347.866 1.00 60.53  ? 251 LEU A N   1 
ATOM   1898 C CA  . LEU A 1 250 ? 30.940  65.547 349.258 1.00 83.38  ? 251 LEU A CA  1 
ATOM   1899 C C   . LEU A 1 250 ? 30.158  66.658 349.944 1.00 65.44  ? 251 LEU A C   1 
ATOM   1900 O O   . LEU A 1 250 ? 29.251  66.385 350.732 1.00 68.85  ? 251 LEU A O   1 
ATOM   1901 C CB  . LEU A 1 250 ? 32.247  65.265 349.992 1.00 63.79  ? 251 LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 250 ? 32.150  65.018 351.485 1.00 63.86  ? 251 LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 250 ? 31.504  63.661 351.788 1.00 52.13  ? 251 LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 250 ? 33.553  65.084 352.015 1.00 68.38  ? 251 LEU A CD2 1 
ATOM   1905 N N   . ALA A 1 251 ? 30.486  67.918 349.645 1.00 63.97  ? 252 ALA A N   1 
ATOM   1906 C CA  . ALA A 1 251 ? 29.675  69.017 350.154 1.00 65.77  ? 252 ALA A CA  1 
ATOM   1907 C C   . ALA A 1 251 ? 28.242  68.921 349.646 1.00 72.87  ? 252 ALA A C   1 
ATOM   1908 O O   . ALA A 1 251 ? 27.292  69.097 350.416 1.00 65.49  ? 252 ALA A O   1 
ATOM   1909 C CB  . ALA A 1 251 ? 30.296  70.355 349.762 1.00 53.17  ? 252 ALA A CB  1 
ATOM   1910 N N   . HIS A 1 252 ? 28.068  68.640 348.351 1.00 62.65  ? 253 HIS A N   1 
ATOM   1911 C CA  . HIS A 1 252 ? 26.727  68.499 347.792 1.00 73.69  ? 253 HIS A CA  1 
ATOM   1912 C C   . HIS A 1 252 ? 25.970  67.363 348.466 1.00 66.84  ? 253 HIS A C   1 
ATOM   1913 O O   . HIS A 1 252 ? 24.785  67.502 348.791 1.00 68.03  ? 253 HIS A O   1 
ATOM   1914 C CB  . HIS A 1 252 ? 26.813  68.266 346.282 1.00 76.79  ? 253 HIS A CB  1 
ATOM   1915 C CG  . HIS A 1 252 ? 25.530  67.802 345.664 1.00 86.25  ? 253 HIS A CG  1 
ATOM   1916 N ND1 . HIS A 1 252 ? 24.528  68.670 345.286 1.00 84.49  ? 253 HIS A ND1 1 
ATOM   1917 C CD2 . HIS A 1 252 ? 25.085  66.559 345.361 1.00 76.76  ? 253 HIS A CD2 1 
ATOM   1918 C CE1 . HIS A 1 252 ? 23.522  67.983 344.774 1.00 90.00  ? 253 HIS A CE1 1 
ATOM   1919 N NE2 . HIS A 1 252 ? 23.834  66.699 344.808 1.00 82.21  ? 253 HIS A NE2 1 
ATOM   1920 N N   . LEU A 1 253 ? 26.642  66.233 348.690 1.00 66.34  ? 254 LEU A N   1 
ATOM   1921 C CA  . LEU A 1 253 ? 25.994  65.092 349.321 1.00 65.60  ? 254 LEU A CA  1 
ATOM   1922 C C   . LEU A 1 253 ? 25.565  65.373 350.758 1.00 69.44  ? 254 LEU A C   1 
ATOM   1923 O O   . LEU A 1 253 ? 24.644  64.708 351.245 1.00 60.17  ? 254 LEU A O   1 
ATOM   1924 C CB  . LEU A 1 253 ? 26.921  63.874 349.294 1.00 67.47  ? 254 LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 253 ? 27.248  63.261 347.930 1.00 70.27  ? 254 LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 253 ? 28.103  62.006 348.100 1.00 55.13  ? 254 LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 253 ? 25.975  62.960 347.156 1.00 63.97  ? 254 LEU A CD2 1 
ATOM   1928 N N   . VAL A 1 254 ? 26.205  66.324 351.446 1.00 66.85  ? 255 VAL A N   1 
ATOM   1929 C CA  . VAL A 1 254 ? 25.867  66.642 352.835 1.00 66.94  ? 255 VAL A CA  1 
ATOM   1930 C C   . VAL A 1 254 ? 24.994  67.889 352.942 1.00 66.69  ? 255 VAL A C   1 
ATOM   1931 O O   . VAL A 1 254 ? 24.764  68.385 354.050 1.00 61.10  ? 255 VAL A O   1 
ATOM   1932 C CB  . VAL A 1 254 ? 27.124  66.782 353.717 1.00 53.40  ? 255 VAL A CB  1 
ATOM   1933 C CG1 . VAL A 1 254 ? 28.039  65.577 353.569 1.00 53.35  ? 255 VAL A CG1 1 
ATOM   1934 C CG2 . VAL A 1 254 ? 27.869  68.071 353.412 1.00 55.63  ? 255 VAL A CG2 1 
ATOM   1935 N N   . GLY A 1 255 ? 24.491  68.399 351.820 1.00 66.23  ? 256 GLY A N   1 
ATOM   1936 C CA  . GLY A 1 255 ? 23.656  69.581 351.852 1.00 65.36  ? 256 GLY A CA  1 
ATOM   1937 C C   . GLY A 1 255 ? 24.396  70.894 351.936 1.00 55.45  ? 256 GLY A C   1 
ATOM   1938 O O   . GLY A 1 255 ? 23.792  71.908 352.294 1.00 68.41  ? 256 GLY A O   1 
ATOM   1939 N N   . CYS A 1 256 ? 25.685  70.914 351.616 1.00 78.30  ? 257 CYS A N   1 
ATOM   1940 C CA  . CYS A 1 256 ? 26.433  72.159 351.591 1.00 70.26  ? 257 CYS A CA  1 
ATOM   1941 C C   . CYS A 1 256 ? 26.582  72.661 350.160 1.00 94.54  ? 257 CYS A C   1 
ATOM   1942 O O   . CYS A 1 256 ? 26.584  71.868 349.214 1.00 89.81  ? 257 CYS A O   1 
ATOM   1943 C CB  . CYS A 1 256 ? 27.814  71.966 352.219 1.00 70.78  ? 257 CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 256 ? 27.728  71.833 354.008 1.00 79.22  ? 257 CYS A SG  1 
ATOM   1945 N N   . PRO A 1 257 ? 26.693  73.973 349.971 1.00 109.71 ? 258 PRO A N   1 
ATOM   1946 C CA  . PRO A 1 257 ? 26.695  74.528 348.619 1.00 117.18 ? 258 PRO A CA  1 
ATOM   1947 C C   . PRO A 1 257 ? 28.093  74.930 348.180 1.00 131.66 ? 258 PRO A C   1 
ATOM   1948 O O   . PRO A 1 257 ? 28.836  75.572 348.938 1.00 134.35 ? 258 PRO A O   1 
ATOM   1949 C CB  . PRO A 1 257 ? 25.778  75.748 348.765 1.00 126.53 ? 258 PRO A CB  1 
ATOM   1950 C CG  . PRO A 1 257 ? 26.129  76.255 350.146 1.00 114.52 ? 258 PRO A CG  1 
ATOM   1951 C CD  . PRO A 1 257 ? 26.473  75.024 350.983 1.00 109.58 ? 258 PRO A CD  1 
ATOM   1952 N N   . PRO A 1 258 ? 28.487  74.512 346.989 1.00 138.65 ? 259 PRO A N   1 
ATOM   1953 C CA  . PRO A 1 258 ? 27.626  73.721 346.132 1.00 134.77 ? 259 PRO A CA  1 
ATOM   1954 C C   . PRO A 1 258 ? 28.360  72.427 345.766 1.00 115.56 ? 259 PRO A C   1 
ATOM   1955 O O   . PRO A 1 258 ? 27.782  71.462 345.265 1.00 115.58 ? 259 PRO A O   1 
ATOM   1956 C CB  . PRO A 1 258 ? 27.468  74.624 344.919 1.00 123.10 ? 259 PRO A CB  1 
ATOM   1957 C CG  . PRO A 1 258 ? 28.738  75.401 344.869 1.00 121.37 ? 259 PRO A CG  1 
ATOM   1958 C CD  . PRO A 1 258 ? 29.437  75.290 346.187 1.00 123.40 ? 259 PRO A CD  1 
ATOM   1959 N N   . ASN A 1 264 ? 32.590  79.305 346.014 1.00 97.12  ? 265 ASN A N   1 
ATOM   1960 C CA  . ASN A 1 264 ? 33.518  79.887 346.981 1.00 101.06 ? 265 ASN A CA  1 
ATOM   1961 C C   . ASN A 1 264 ? 34.057  78.818 347.939 1.00 97.76  ? 265 ASN A C   1 
ATOM   1962 O O   . ASN A 1 264 ? 33.294  78.124 348.617 1.00 84.83  ? 265 ASN A O   1 
ATOM   1963 C CB  . ASN A 1 264 ? 32.837  81.019 347.764 1.00 104.07 ? 265 ASN A CB  1 
ATOM   1964 C CG  . ASN A 1 264 ? 33.820  81.844 348.591 1.00 105.03 ? 265 ASN A CG  1 
ATOM   1965 O OD1 . ASN A 1 264 ? 34.988  81.484 348.742 1.00 112.03 ? 265 ASN A OD1 1 
ATOM   1966 N ND2 . ASN A 1 264 ? 33.343  82.964 349.128 1.00 101.01 ? 265 ASN A ND2 1 
ATOM   1967 N N   . ASP A 1 265 ? 35.388  78.702 347.989 1.00 100.52 ? 266 ASP A N   1 
ATOM   1968 C CA  . ASP A 1 265 ? 36.018  77.700 348.844 1.00 84.04  ? 266 ASP A CA  1 
ATOM   1969 C C   . ASP A 1 265 ? 35.749  77.982 350.318 1.00 90.33  ? 266 ASP A C   1 
ATOM   1970 O O   . ASP A 1 265 ? 35.546  77.054 351.110 1.00 82.55  ? 266 ASP A O   1 
ATOM   1971 C CB  . ASP A 1 265 ? 37.525  77.652 348.576 1.00 84.00  ? 266 ASP A CB  1 
ATOM   1972 C CG  . ASP A 1 265 ? 37.880  76.895 347.298 1.00 94.93  ? 266 ASP A CG  1 
ATOM   1973 O OD1 . ASP A 1 265 ? 36.963  76.394 346.611 1.00 86.50  ? 266 ASP A OD1 1 
ATOM   1974 O OD2 . ASP A 1 265 ? 39.088  76.804 346.979 1.00 80.35  ? 266 ASP A OD2 1 
ATOM   1975 N N   . THR A 1 266 ? 35.740  79.257 350.708 1.00 92.17  ? 267 THR A N   1 
ATOM   1976 C CA  . THR A 1 266 ? 35.563  79.588 352.118 1.00 82.95  ? 267 THR A CA  1 
ATOM   1977 C C   . THR A 1 266 ? 34.173  79.207 352.609 1.00 81.38  ? 267 THR A C   1 
ATOM   1978 O O   . THR A 1 266 ? 34.028  78.639 353.697 1.00 85.37  ? 267 THR A O   1 
ATOM   1979 C CB  . THR A 1 266 ? 35.818  81.075 352.342 1.00 85.97  ? 267 THR A CB  1 
ATOM   1980 O OG1 . THR A 1 266 ? 37.082  81.430 351.768 1.00 93.39  ? 267 THR A OG1 1 
ATOM   1981 C CG2 . THR A 1 266 ? 35.825  81.392 353.832 1.00 75.97  ? 267 THR A CG2 1 
ATOM   1982 N N   . GLU A 1 267 ? 33.139  79.508 351.820 1.00 90.21  ? 268 GLU A N   1 
ATOM   1983 C CA  . GLU A 1 267 ? 31.778  79.215 352.256 1.00 88.67  ? 268 GLU A CA  1 
ATOM   1984 C C   . GLU A 1 267 ? 31.523  77.716 352.334 1.00 75.33  ? 268 GLU A C   1 
ATOM   1985 O O   . GLU A 1 267 ? 30.736  77.269 353.178 1.00 87.85  ? 268 GLU A O   1 
ATOM   1986 C CB  . GLU A 1 267 ? 30.766  79.890 351.324 1.00 89.86  ? 268 GLU A CB  1 
ATOM   1987 C CG  . GLU A 1 267 ? 30.130  78.953 350.295 1.00 125.88 ? 268 GLU A CG  1 
ATOM   1988 C CD  . GLU A 1 267 ? 29.048  79.622 349.462 1.00 131.34 ? 268 GLU A CD  1 
ATOM   1989 O OE1 . GLU A 1 267 ? 27.903  79.734 349.949 1.00 129.86 ? 268 GLU A OE1 1 
ATOM   1990 O OE2 . GLU A 1 267 ? 29.343  80.035 348.319 1.00 123.08 ? 268 GLU A OE2 1 
ATOM   1991 N N   . LEU A 1 268 ? 32.190  76.924 351.485 1.00 88.74  ? 269 LEU A N   1 
ATOM   1992 C CA  . LEU A 1 268 ? 31.916  75.493 351.442 1.00 86.26  ? 269 LEU A CA  1 
ATOM   1993 C C   . LEU A 1 268 ? 32.600  74.777 352.602 1.00 73.65  ? 269 LEU A C   1 
ATOM   1994 O O   . LEU A 1 268 ? 32.002  73.903 353.235 1.00 77.89  ? 269 LEU A O   1 
ATOM   1995 C CB  . LEU A 1 268 ? 32.344  74.908 350.090 1.00 83.01  ? 269 LEU A CB  1 
ATOM   1996 C CG  . LEU A 1 268 ? 32.287  73.394 349.823 1.00 82.51  ? 269 LEU A CG  1 
ATOM   1997 C CD1 . LEU A 1 268 ? 32.201  73.132 348.332 1.00 73.24  ? 269 LEU A CD1 1 
ATOM   1998 C CD2 . LEU A 1 268 ? 33.498  72.654 350.352 1.00 88.11  ? 269 LEU A CD2 1 
ATOM   1999 N N   . VAL A 1 269 ? 33.856  75.132 352.884 1.00 72.97  ? 270 VAL A N   1 
ATOM   2000 C CA  . VAL A 1 269 ? 34.531  74.574 354.054 1.00 77.75  ? 270 VAL A CA  1 
ATOM   2001 C C   . VAL A 1 269 ? 33.788  74.971 355.321 1.00 80.12  ? 270 VAL A C   1 
ATOM   2002 O O   . VAL A 1 269 ? 33.614  74.159 356.236 1.00 71.81  ? 270 VAL A O   1 
ATOM   2003 C CB  . VAL A 1 269 ? 36.006  75.022 354.099 1.00 79.11  ? 270 VAL A CB  1 
ATOM   2004 C CG1 . VAL A 1 269 ? 36.682  74.463 355.340 1.00 64.21  ? 270 VAL A CG1 1 
ATOM   2005 C CG2 . VAL A 1 269 ? 36.745  74.579 352.852 1.00 62.05  ? 270 VAL A CG2 1 
ATOM   2006 N N   . ALA A 1 270 ? 33.331  76.226 355.388 1.00 71.83  ? 271 ALA A N   1 
ATOM   2007 C CA  . ALA A 1 270 ? 32.587  76.675 356.558 1.00 80.34  ? 271 ALA A CA  1 
ATOM   2008 C C   . ALA A 1 270 ? 31.345  75.824 356.776 1.00 77.25  ? 271 ALA A C   1 
ATOM   2009 O O   . ALA A 1 270 ? 31.045  75.433 357.910 1.00 71.50  ? 271 ALA A O   1 
ATOM   2010 C CB  . ALA A 1 270 ? 32.208  78.149 356.412 1.00 69.35  ? 271 ALA A CB  1 
ATOM   2011 N N   . CYS A 1 271 ? 30.617  75.514 355.701 1.00 64.98  ? 272 CYS A N   1 
ATOM   2012 C CA  . CYS A 1 271 ? 29.400  74.723 355.850 1.00 72.39  ? 272 CYS A CA  1 
ATOM   2013 C C   . CYS A 1 271 ? 29.716  73.294 356.276 1.00 69.91  ? 272 CYS A C   1 
ATOM   2014 O O   . CYS A 1 271 ? 28.995  72.714 357.096 1.00 74.25  ? 272 CYS A O   1 
ATOM   2015 C CB  . CYS A 1 271 ? 28.596  74.729 354.549 1.00 67.52  ? 272 CYS A CB  1 
ATOM   2016 S SG  . CYS A 1 271 ? 27.102  73.686 354.592 1.00 87.42  ? 272 CYS A SG  1 
ATOM   2017 N N   . LEU A 1 272 ? 30.785  72.708 355.725 1.00 64.99  ? 273 LEU A N   1 
ATOM   2018 C CA  . LEU A 1 272 ? 31.177  71.360 356.127 1.00 63.23  ? 273 LEU A CA  1 
ATOM   2019 C C   . LEU A 1 272 ? 31.586  71.309 357.594 1.00 74.17  ? 273 LEU A C   1 
ATOM   2020 O O   . LEU A 1 272 ? 31.406  70.277 358.253 1.00 71.57  ? 273 LEU A O   1 
ATOM   2021 C CB  . LEU A 1 272 ? 32.320  70.851 355.252 1.00 64.32  ? 273 LEU A CB  1 
ATOM   2022 C CG  . LEU A 1 272 ? 31.999  70.439 353.814 1.00 69.28  ? 273 LEU A CG  1 
ATOM   2023 C CD1 . LEU A 1 272 ? 33.276  70.375 353.018 1.00 52.80  ? 273 LEU A CD1 1 
ATOM   2024 C CD2 . LEU A 1 272 ? 31.282  69.105 353.761 1.00 69.18  ? 273 LEU A CD2 1 
ATOM   2025 N N   . ARG A 1 273 ? 32.135  72.407 358.121 1.00 58.18  ? 274 ARG A N   1 
ATOM   2026 C CA  . ARG A 1 273 ? 32.528  72.449 359.524 1.00 67.16  ? 274 ARG A CA  1 
ATOM   2027 C C   . ARG A 1 273 ? 31.329  72.387 360.463 1.00 66.53  ? 274 ARG A C   1 
ATOM   2028 O O   . ARG A 1 273 ? 31.501  72.083 361.646 1.00 73.51  ? 274 ARG A O   1 
ATOM   2029 C CB  . ARG A 1 273 ? 33.352  73.710 359.798 1.00 66.22  ? 274 ARG A CB  1 
ATOM   2030 C CG  . ARG A 1 273 ? 34.765  73.670 359.232 1.00 58.23  ? 274 ARG A CG  1 
ATOM   2031 C CD  . ARG A 1 273 ? 35.631  74.754 359.846 1.00 67.06  ? 274 ARG A CD  1 
ATOM   2032 N NE  . ARG A 1 273 ? 37.031  74.614 359.460 1.00 72.72  ? 274 ARG A NE  1 
ATOM   2033 C CZ  . ARG A 1 273 ? 37.655  75.419 358.606 1.00 79.95  ? 274 ARG A CZ  1 
ATOM   2034 N NH1 . ARG A 1 273 ? 37.001  76.430 358.049 1.00 84.21  ? 274 ARG A NH1 1 
ATOM   2035 N NH2 . ARG A 1 273 ? 38.935  75.215 358.314 1.00 65.88  ? 274 ARG A NH2 1 
ATOM   2036 N N   . THR A 1 274 ? 30.121  72.661 359.963 1.00 72.37  ? 275 THR A N   1 
ATOM   2037 C CA  . THR A 1 274 ? 28.917  72.566 360.779 1.00 53.93  ? 275 THR A CA  1 
ATOM   2038 C C   . THR A 1 274 ? 28.368  71.149 360.849 1.00 68.04  ? 275 THR A C   1 
ATOM   2039 O O   . THR A 1 274 ? 27.568  70.848 361.743 1.00 67.91  ? 275 THR A O   1 
ATOM   2040 C CB  . THR A 1 274 ? 27.829  73.489 360.229 1.00 69.19  ? 275 THR A CB  1 
ATOM   2041 O OG1 . THR A 1 274 ? 27.221  72.874 359.086 1.00 66.48  ? 275 THR A OG1 1 
ATOM   2042 C CG2 . THR A 1 274 ? 28.415  74.834 359.820 1.00 50.74  ? 275 THR A CG2 1 
ATOM   2043 N N   . ARG A 1 275 ? 28.774  70.282 359.939 1.00 64.82  ? 276 ARG A N   1 
ATOM   2044 C CA  . ARG A 1 275 ? 28.203  68.946 359.867 1.00 66.39  ? 276 ARG A CA  1 
ATOM   2045 C C   . ARG A 1 275 ? 28.799  68.050 360.952 1.00 62.78  ? 276 ARG A C   1 
ATOM   2046 O O   . ARG A 1 275 ? 30.010  68.076 361.182 1.00 62.87  ? 276 ARG A O   1 
ATOM   2047 C CB  . ARG A 1 275 ? 28.461  68.336 358.491 1.00 73.86  ? 276 ARG A CB  1 
ATOM   2048 C CG  . ARG A 1 275 ? 27.705  69.019 357.358 1.00 59.52  ? 276 ARG A CG  1 
ATOM   2049 C CD  . ARG A 1 275 ? 26.211  68.947 357.586 1.00 66.97  ? 276 ARG A CD  1 
ATOM   2050 N NE  . ARG A 1 275 ? 25.444  69.436 356.445 1.00 67.06  ? 276 ARG A NE  1 
ATOM   2051 C CZ  . ARG A 1 275 ? 25.099  70.707 356.263 1.00 76.93  ? 276 ARG A CZ  1 
ATOM   2052 N NH1 . ARG A 1 275 ? 25.444  71.624 357.157 1.00 72.05  ? 276 ARG A NH1 1 
ATOM   2053 N NH2 . ARG A 1 275 ? 24.387  71.058 355.199 1.00 75.29  ? 276 ARG A NH2 1 
ATOM   2054 N N   . PRO A 1 276 ? 27.974  67.261 361.639 1.00 59.37  ? 277 PRO A N   1 
ATOM   2055 C CA  . PRO A 1 276 ? 28.517  66.254 362.554 1.00 66.91  ? 277 PRO A CA  1 
ATOM   2056 C C   . PRO A 1 276 ? 29.492  65.342 361.823 1.00 68.37  ? 277 PRO A C   1 
ATOM   2057 O O   . PRO A 1 276 ? 29.326  65.048 360.637 1.00 62.17  ? 277 PRO A O   1 
ATOM   2058 C CB  . PRO A 1 276 ? 27.273  65.492 363.027 1.00 54.59  ? 277 PRO A CB  1 
ATOM   2059 C CG  . PRO A 1 276 ? 26.166  66.466 362.873 1.00 64.87  ? 277 PRO A CG  1 
ATOM   2060 C CD  . PRO A 1 276 ? 26.502  67.293 361.662 1.00 63.31  ? 277 PRO A CD  1 
ATOM   2061 N N   . ALA A 1 277 ? 30.526  64.907 362.545 1.00 68.62  ? 278 ALA A N   1 
ATOM   2062 C CA  . ALA A 1 277 ? 31.582  64.123 361.914 1.00 66.93  ? 278 ALA A CA  1 
ATOM   2063 C C   . ALA A 1 277 ? 31.028  62.856 361.281 1.00 73.44  ? 278 ALA A C   1 
ATOM   2064 O O   . ALA A 1 277 ? 31.497  62.427 360.219 1.00 57.11  ? 278 ALA A O   1 
ATOM   2065 C CB  . ALA A 1 277 ? 32.667  63.780 362.934 1.00 65.21  ? 278 ALA A CB  1 
ATOM   2066 N N   . GLN A 1 278 ? 30.018  62.249 361.910 1.00 67.70  ? 279 GLN A N   1 
ATOM   2067 C CA  . GLN A 1 278 ? 29.482  60.997 361.390 1.00 59.47  ? 279 GLN A CA  1 
ATOM   2068 C C   . GLN A 1 278 ? 28.760  61.200 360.065 1.00 62.94  ? 279 GLN A C   1 
ATOM   2069 O O   . GLN A 1 278 ? 28.700  60.277 359.245 1.00 56.35  ? 279 GLN A O   1 
ATOM   2070 C CB  . GLN A 1 278 ? 28.548  60.358 362.414 1.00 47.47  ? 279 GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 278 ? 28.223  58.897 362.125 1.00 80.21  ? 279 GLN A CG  1 
ATOM   2072 C CD  . GLN A 1 278 ? 29.458  57.999 362.094 1.00 86.76  ? 279 GLN A CD  1 
ATOM   2073 O OE1 . GLN A 1 278 ? 30.134  57.803 363.108 1.00 79.90  ? 279 GLN A OE1 1 
ATOM   2074 N NE2 . GLN A 1 278 ? 29.749  57.442 360.922 1.00 72.76  ? 279 GLN A NE2 1 
ATOM   2075 N N   . VAL A 1 279 ? 28.205  62.390 359.837 1.00 54.44  ? 280 VAL A N   1 
ATOM   2076 C CA  . VAL A 1 279 ? 27.586  62.672 358.548 1.00 55.23  ? 280 VAL A CA  1 
ATOM   2077 C C   . VAL A 1 279 ? 28.633  62.621 357.447 1.00 70.39  ? 280 VAL A C   1 
ATOM   2078 O O   . VAL A 1 279 ? 28.412  62.038 356.377 1.00 58.70  ? 280 VAL A O   1 
ATOM   2079 C CB  . VAL A 1 279 ? 26.872  64.035 358.592 1.00 68.60  ? 280 VAL A CB  1 
ATOM   2080 C CG1 . VAL A 1 279 ? 26.453  64.462 357.187 1.00 64.51  ? 280 VAL A CG1 1 
ATOM   2081 C CG2 . VAL A 1 279 ? 25.682  63.975 359.542 1.00 58.21  ? 280 VAL A CG2 1 
ATOM   2082 N N   . LEU A 1 280 ? 29.798  63.216 357.703 1.00 55.68  ? 281 LEU A N   1 
ATOM   2083 C CA  . LEU A 1 280 ? 30.884  63.193 356.734 1.00 56.99  ? 281 LEU A CA  1 
ATOM   2084 C C   . LEU A 1 280 ? 31.317  61.766 356.419 1.00 64.95  ? 281 LEU A C   1 
ATOM   2085 O O   . LEU A 1 280 ? 31.548  61.418 355.255 1.00 64.21  ? 281 LEU A O   1 
ATOM   2086 C CB  . LEU A 1 280 ? 32.056  64.011 357.271 1.00 62.45  ? 281 LEU A CB  1 
ATOM   2087 C CG  . LEU A 1 280 ? 31.837  65.521 357.429 1.00 67.96  ? 281 LEU A CG  1 
ATOM   2088 C CD1 . LEU A 1 280 ? 33.136  66.267 357.180 1.00 59.24  ? 281 LEU A CD1 1 
ATOM   2089 C CD2 . LEU A 1 280 ? 30.737  66.051 356.511 1.00 55.34  ? 281 LEU A CD2 1 
ATOM   2090 N N   . VAL A 1 281 ? 31.418  60.923 357.446 1.00 53.59  ? 282 VAL A N   1 
ATOM   2091 C CA  . VAL A 1 281 ? 31.848  59.541 357.249 1.00 58.12  ? 282 VAL A CA  1 
ATOM   2092 C C   . VAL A 1 281 ? 30.858  58.788 356.366 1.00 63.71  ? 282 VAL A C   1 
ATOM   2093 O O   . VAL A 1 281 ? 31.254  57.965 355.529 1.00 63.41  ? 282 VAL A O   1 
ATOM   2094 C CB  . VAL A 1 281 ? 32.036  58.851 358.617 1.00 56.11  ? 282 VAL A CB  1 
ATOM   2095 C CG1 . VAL A 1 281 ? 32.044  57.337 358.473 1.00 55.98  ? 282 VAL A CG1 1 
ATOM   2096 C CG2 . VAL A 1 281 ? 33.311  59.343 359.310 1.00 54.67  ? 282 VAL A CG2 1 
ATOM   2097 N N   . ASN A 1 282 ? 29.557  59.065 356.525 1.00 52.38  ? 283 ASN A N   1 
ATOM   2098 C CA  . ASN A 1 282 ? 28.529  58.269 355.854 1.00 68.43  ? 283 ASN A CA  1 
ATOM   2099 C C   . ASN A 1 282 ? 28.530  58.452 354.344 1.00 64.81  ? 283 ASN A C   1 
ATOM   2100 O O   . ASN A 1 282 ? 27.954  57.623 353.633 1.00 62.10  ? 283 ASN A O   1 
ATOM   2101 C CB  . ASN A 1 282 ? 27.139  58.615 356.395 1.00 62.15  ? 283 ASN A CB  1 
ATOM   2102 C CG  . ASN A 1 282 ? 26.935  58.155 357.823 1.00 86.40  ? 283 ASN A CG  1 
ATOM   2103 O OD1 . ASN A 1 282 ? 27.686  57.323 358.334 1.00 93.11  ? 283 ASN A OD1 1 
ATOM   2104 N ND2 . ASN A 1 282 ? 25.914  58.700 358.480 1.00 79.84  ? 283 ASN A ND2 1 
ATOM   2105 N N   . HIS A 1 283 ? 29.133  59.505 353.873 1.00 58.50  ? 284 HIS A N   1 
ATOM   2106 C CA  . HIS A 1 283 ? 29.138  59.778 352.481 1.00 80.49  ? 284 HIS A CA  1 
ATOM   2107 C C   . HIS A 1 283 ? 30.451  59.738 351.756 1.00 66.87  ? 284 HIS A C   1 
ATOM   2108 O O   . HIS A 1 283 ? 30.446  59.781 350.566 1.00 81.52  ? 284 HIS A O   1 
ATOM   2109 C CB  . HIS A 1 283 ? 28.608  61.184 352.308 1.00 65.38  ? 284 HIS A CB  1 
ATOM   2110 C CG  . HIS A 1 283 ? 27.152  61.309 352.570 1.00 81.06  ? 284 HIS A CG  1 
ATOM   2111 N ND1 . HIS A 1 283 ? 26.635  61.447 353.830 1.00 88.48  ? 284 HIS A ND1 1 
ATOM   2112 C CD2 . HIS A 1 283 ? 26.097  61.297 351.736 1.00 81.47  ? 284 HIS A CD2 1 
ATOM   2113 C CE1 . HIS A 1 283 ? 25.325  61.517 353.764 1.00 81.48  ? 284 HIS A CE1 1 
ATOM   2114 N NE2 . HIS A 1 283 ? 24.975  61.428 352.504 1.00 76.35  ? 284 HIS A NE2 1 
ATOM   2115 N N   . GLU A 1 284 ? 31.564  59.672 352.458 1.00 68.86  ? 285 GLU A N   1 
ATOM   2116 C CA  . GLU A 1 284 ? 32.877  59.799 351.837 1.00 79.90  ? 285 GLU A CA  1 
ATOM   2117 C C   . GLU A 1 284 ? 33.082  58.751 350.748 1.00 68.51  ? 285 GLU A C   1 
ATOM   2118 O O   . GLU A 1 284 ? 33.676  59.041 349.705 1.00 64.55  ? 285 GLU A O   1 
ATOM   2119 C CB  . GLU A 1 284 ? 33.973  59.717 352.903 1.00 60.26  ? 285 GLU A CB  1 
ATOM   2120 C CG  . GLU A 1 284 ? 34.214  58.322 353.428 1.00 75.07  ? 285 GLU A CG  1 
ATOM   2121 C CD  . GLU A 1 284 ? 35.484  58.197 354.244 1.00 95.03  ? 285 GLU A CD  1 
ATOM   2122 O OE1 . GLU A 1 284 ? 35.650  57.156 354.917 1.00 89.01  ? 285 GLU A OE1 1 
ATOM   2123 O OE2 . GLU A 1 284 ? 36.310  59.137 354.216 1.00 88.95  ? 285 GLU A OE2 1 
ATOM   2124 N N   . TRP A 1 285 ? 32.553  57.541 350.948 1.00 61.20  ? 286 TRP A N   1 
ATOM   2125 C CA  . TRP A 1 285 ? 32.734  56.480 349.967 1.00 68.56  ? 286 TRP A CA  1 
ATOM   2126 C C   . TRP A 1 285 ? 31.896  56.699 348.714 1.00 75.74  ? 286 TRP A C   1 
ATOM   2127 O O   . TRP A 1 285 ? 32.203  56.114 347.670 1.00 87.38  ? 286 TRP A O   1 
ATOM   2128 C CB  . TRP A 1 285 ? 32.399  55.124 350.594 1.00 71.37  ? 286 TRP A CB  1 
ATOM   2129 C CG  . TRP A 1 285 ? 33.021  53.951 349.886 1.00 77.04  ? 286 TRP A CG  1 
ATOM   2130 C CD1 . TRP A 1 285 ? 33.882  53.996 348.829 1.00 76.04  ? 286 TRP A CD1 1 
ATOM   2131 C CD2 . TRP A 1 285 ? 32.825  52.558 350.182 1.00 98.82  ? 286 TRP A CD2 1 
ATOM   2132 N NE1 . TRP A 1 285 ? 34.233  52.725 348.447 1.00 78.28  ? 286 TRP A NE1 1 
ATOM   2133 C CE2 . TRP A 1 285 ? 33.598  51.823 349.260 1.00 90.35  ? 286 TRP A CE2 1 
ATOM   2134 C CE3 . TRP A 1 285 ? 32.072  51.862 351.137 1.00 97.07  ? 286 TRP A CE3 1 
ATOM   2135 C CZ2 . TRP A 1 285 ? 33.641  50.428 349.264 1.00 99.63  ? 286 TRP A CZ2 1 
ATOM   2136 C CZ3 . TRP A 1 285 ? 32.118  50.475 351.140 1.00 82.18  ? 286 TRP A CZ3 1 
ATOM   2137 C CH2 . TRP A 1 285 ? 32.896  49.774 350.208 1.00 92.02  ? 286 TRP A CH2 1 
ATOM   2138 N N   . HIS A 1 286 ? 30.863  57.534 348.782 1.00 78.44  ? 287 HIS A N   1 
ATOM   2139 C CA  . HIS A 1 286 ? 29.965  57.735 347.653 1.00 72.27  ? 287 HIS A CA  1 
ATOM   2140 C C   . HIS A 1 286 ? 30.464  58.781 346.669 1.00 77.41  ? 287 HIS A C   1 
ATOM   2141 O O   . HIS A 1 286 ? 29.813  59.004 345.643 1.00 81.05  ? 287 HIS A O   1 
ATOM   2142 C CB  . HIS A 1 286 ? 28.570  58.113 348.154 1.00 64.05  ? 287 HIS A CB  1 
ATOM   2143 C CG  . HIS A 1 286 ? 27.850  56.981 348.815 1.00 89.12  ? 287 HIS A CG  1 
ATOM   2144 N ND1 . HIS A 1 286 ? 27.177  57.123 350.010 1.00 99.72  ? 287 HIS A ND1 1 
ATOM   2145 C CD2 . HIS A 1 286 ? 27.712  55.683 348.456 1.00 79.28  ? 287 HIS A CD2 1 
ATOM   2146 C CE1 . HIS A 1 286 ? 26.651  55.961 350.355 1.00 100.29 ? 287 HIS A CE1 1 
ATOM   2147 N NE2 . HIS A 1 286 ? 26.961  55.071 349.430 1.00 110.45 ? 287 HIS A NE2 1 
ATOM   2148 N N   . VAL A 1 287 ? 31.601  59.428 346.944 1.00 74.36  ? 288 VAL A N   1 
ATOM   2149 C CA  . VAL A 1 287 ? 32.165  60.376 345.992 1.00 71.74  ? 288 VAL A CA  1 
ATOM   2150 C C   . VAL A 1 287 ? 33.141  59.708 345.035 1.00 70.75  ? 288 VAL A C   1 
ATOM   2151 O O   . VAL A 1 287 ? 33.722  60.386 344.176 1.00 72.22  ? 288 VAL A O   1 
ATOM   2152 C CB  . VAL A 1 287 ? 32.838  61.556 346.725 1.00 74.46  ? 288 VAL A CB  1 
ATOM   2153 C CG1 . VAL A 1 287 ? 31.967  62.022 347.885 1.00 71.55  ? 288 VAL A CG1 1 
ATOM   2154 C CG2 . VAL A 1 287 ? 34.217  61.170 347.216 1.00 61.98  ? 288 VAL A CG2 1 
ATOM   2155 N N   . LEU A 1 288 ? 33.333  58.402 345.149 1.00 77.35  ? 289 LEU A N   1 
ATOM   2156 C CA  . LEU A 1 288 ? 34.181  57.690 344.205 1.00 70.54  ? 289 LEU A CA  1 
ATOM   2157 C C   . LEU A 1 288 ? 33.506  57.668 342.838 1.00 100.15 ? 289 LEU A C   1 
ATOM   2158 O O   . LEU A 1 288 ? 32.303  57.391 342.751 1.00 91.60  ? 289 LEU A O   1 
ATOM   2159 C CB  . LEU A 1 288 ? 34.448  56.269 344.693 1.00 74.35  ? 289 LEU A CB  1 
ATOM   2160 C CG  . LEU A 1 288 ? 35.631  56.102 345.649 1.00 76.39  ? 289 LEU A CG  1 
ATOM   2161 C CD1 . LEU A 1 288 ? 35.913  54.621 345.899 1.00 67.70  ? 289 LEU A CD1 1 
ATOM   2162 C CD2 . LEU A 1 288 ? 36.875  56.840 345.139 1.00 55.35  ? 289 LEU A CD2 1 
ATOM   2163 N N   . PRO A 1 289 ? 34.235  57.951 341.754 1.00 105.19 ? 290 PRO A N   1 
ATOM   2164 C CA  . PRO A 1 289 ? 33.585  58.074 340.441 1.00 106.55 ? 290 PRO A CA  1 
ATOM   2165 C C   . PRO A 1 289 ? 33.124  56.754 339.843 1.00 97.97  ? 290 PRO A C   1 
ATOM   2166 O O   . PRO A 1 289 ? 32.463  56.779 338.798 1.00 112.39 ? 290 PRO A O   1 
ATOM   2167 C CB  . PRO A 1 289 ? 34.670  58.724 339.576 1.00 102.62 ? 290 PRO A CB  1 
ATOM   2168 C CG  . PRO A 1 289 ? 35.950  58.281 340.196 1.00 90.96  ? 290 PRO A CG  1 
ATOM   2169 C CD  . PRO A 1 289 ? 35.689  58.183 341.677 1.00 97.64  ? 290 PRO A CD  1 
ATOM   2170 N N   . GLN A 1 290 ? 33.570  55.653 340.442 1.00 97.74  ? 291 GLN A N   1 
ATOM   2171 C CA  . GLN A 1 290 ? 33.334  54.291 339.973 1.00 109.37 ? 291 GLN A CA  1 
ATOM   2172 C C   . GLN A 1 290 ? 33.035  53.280 341.071 1.00 111.48 ? 291 GLN A C   1 
ATOM   2173 O O   . GLN A 1 290 ? 33.128  53.564 342.233 1.00 123.31 ? 291 GLN A O   1 
ATOM   2174 C CB  . GLN A 1 290 ? 34.606  53.809 339.295 1.00 116.19 ? 291 GLN A CB  1 
ATOM   2175 C CG  . GLN A 1 290 ? 34.471  53.212 337.912 1.00 128.14 ? 291 GLN A CG  1 
ATOM   2176 C CD  . GLN A 1 290 ? 35.740  53.385 337.103 1.00 125.30 ? 291 GLN A CD  1 
ATOM   2177 O OE1 . GLN A 1 290 ? 36.406  54.419 337.193 1.00 118.46 ? 291 GLN A OE1 1 
ATOM   2178 N NE2 . GLN A 1 290 ? 36.083  52.378 336.302 1.00 125.83 ? 291 GLN A NE2 1 
ATOM   2179 N N   . GLU A 1 291 ? 32.701  52.071 340.673 1.00 107.21 ? 292 GLU A N   1 
ATOM   2180 C CA  . GLU A 1 291 ? 32.355  50.978 341.582 1.00 114.38 ? 292 GLU A CA  1 
ATOM   2181 C C   . GLU A 1 291 ? 33.576  50.073 341.628 1.00 108.68 ? 292 GLU A C   1 
ATOM   2182 O O   . GLU A 1 291 ? 33.686  49.131 340.835 1.00 113.29 ? 292 GLU A O   1 
ATOM   2183 C CB  . GLU A 1 291 ? 31.095  50.235 341.120 1.00 112.32 ? 292 GLU A CB  1 
ATOM   2184 C CG  . GLU A 1 291 ? 30.127  49.849 342.246 1.00 131.65 ? 292 GLU A CG  1 
ATOM   2185 C CD  . GLU A 1 291 ? 29.651  51.046 343.076 1.00 137.38 ? 292 GLU A CD  1 
ATOM   2186 O OE1 . GLU A 1 291 ? 29.029  50.829 344.141 1.00 129.73 ? 292 GLU A OE1 1 
ATOM   2187 O OE2 . GLU A 1 291 ? 29.886  52.205 342.666 1.00 140.14 ? 292 GLU A OE2 1 
ATOM   2188 N N   . SER A 1 292 ? 34.479  50.349 342.558 1.00 106.48 ? 293 SER A N   1 
ATOM   2189 C CA  . SER A 1 292 ? 35.827  49.809 342.532 1.00 87.91  ? 293 SER A CA  1 
ATOM   2190 C C   . SER A 1 292 ? 36.152  49.050 343.806 1.00 71.89  ? 293 SER A C   1 
ATOM   2191 O O   . SER A 1 292 ? 35.426  49.094 344.803 1.00 89.07  ? 293 SER A O   1 
ATOM   2192 C CB  . SER A 1 292 ? 36.859  50.927 342.347 1.00 81.88  ? 293 SER A CB  1 
ATOM   2193 O OG  . SER A 1 292 ? 36.604  51.999 343.237 1.00 92.14  ? 293 SER A OG  1 
ATOM   2194 N N   . VAL A 1 293 ? 37.267  48.339 343.741 1.00 73.19  ? 294 VAL A N   1 
ATOM   2195 C CA  . VAL A 1 293 ? 38.008  47.921 344.920 1.00 81.81  ? 294 VAL A CA  1 
ATOM   2196 C C   . VAL A 1 293 ? 39.340  48.650 344.894 1.00 77.53  ? 294 VAL A C   1 
ATOM   2197 O O   . VAL A 1 293 ? 39.842  49.034 343.829 1.00 78.39  ? 294 VAL A O   1 
ATOM   2198 C CB  . VAL A 1 293 ? 38.220  46.396 344.995 1.00 69.76  ? 294 VAL A CB  1 
ATOM   2199 C CG1 . VAL A 1 293 ? 36.888  45.691 345.026 1.00 72.78  ? 294 VAL A CG1 1 
ATOM   2200 C CG2 . VAL A 1 293 ? 39.057  45.914 343.818 1.00 74.30  ? 294 VAL A CG2 1 
ATOM   2201 N N   . PHE A 1 294 ? 39.926  48.829 346.042 1.00 69.37  ? 295 PHE A N   1 
ATOM   2202 C CA  . PHE A 1 294 ? 41.216  49.443 346.116 1.00 62.39  ? 295 PHE A CA  1 
ATOM   2203 C C   . PHE A 1 294 ? 41.346  50.852 345.648 1.00 50.89  ? 295 PHE A C   1 
ATOM   2204 O O   . PHE A 1 294 ? 42.346  51.201 345.113 1.00 56.17  ? 295 PHE A O   1 
ATOM   2205 C CB  . PHE A 1 294 ? 42.229  48.583 345.416 1.00 48.41  ? 295 PHE A CB  1 
ATOM   2206 C CG  . PHE A 1 294 ? 43.450  48.342 346.212 1.00 66.27  ? 295 PHE A CG  1 
ATOM   2207 C CD1 . PHE A 1 294 ? 43.796  47.090 346.586 1.00 57.67  ? 295 PHE A CD1 1 
ATOM   2208 C CD2 . PHE A 1 294 ? 44.244  49.373 346.588 1.00 65.23  ? 295 PHE A CD2 1 
ATOM   2209 C CE1 . PHE A 1 294 ? 44.916  46.868 347.320 1.00 54.57  ? 295 PHE A CE1 1 
ATOM   2210 C CE2 . PHE A 1 294 ? 45.359  49.164 347.320 1.00 60.99  ? 295 PHE A CE2 1 
ATOM   2211 C CZ  . PHE A 1 294 ? 45.700  47.910 347.685 1.00 58.12  ? 295 PHE A CZ  1 
ATOM   2212 N N   . ARG A 1 295 ? 40.310  51.642 345.807 1.00 64.07  ? 296 ARG A N   1 
ATOM   2213 C CA  . ARG A 1 295 ? 40.400  53.070 345.532 1.00 60.00  ? 296 ARG A CA  1 
ATOM   2214 C C   . ARG A 1 295 ? 39.688  53.803 346.655 1.00 64.49  ? 296 ARG A C   1 
ATOM   2215 O O   . ARG A 1 295 ? 38.654  53.342 347.146 1.00 67.10  ? 296 ARG A O   1 
ATOM   2216 C CB  . ARG A 1 295 ? 39.799  53.450 344.169 1.00 54.98  ? 296 ARG A CB  1 
ATOM   2217 C CG  . ARG A 1 295 ? 40.618  52.963 342.972 1.00 59.26  ? 296 ARG A CG  1 
ATOM   2218 C CD  . ARG A 1 295 ? 41.887  53.802 342.780 1.00 67.64  ? 296 ARG A CD  1 
ATOM   2219 N NE  . ARG A 1 295 ? 42.589  53.499 341.534 1.00 78.82  ? 296 ARG A NE  1 
ATOM   2220 C CZ  . ARG A 1 295 ? 43.227  52.359 341.296 1.00 82.01  ? 296 ARG A CZ  1 
ATOM   2221 N NH1 . ARG A 1 295 ? 43.260  51.427 342.226 1.00 79.57  ? 296 ARG A NH1 1 
ATOM   2222 N NH2 . ARG A 1 295 ? 43.834  52.151 340.136 1.00 73.21  ? 296 ARG A NH2 1 
ATOM   2223 N N   . PHE A 1 296 ? 40.249  54.938 347.065 1.00 58.20  ? 297 PHE A N   1 
ATOM   2224 C CA  . PHE A 1 296 ? 39.832  55.606 348.290 1.00 67.46  ? 297 PHE A CA  1 
ATOM   2225 C C   . PHE A 1 296 ? 39.600  57.085 348.021 1.00 54.97  ? 297 PHE A C   1 
ATOM   2226 O O   . PHE A 1 296 ? 40.362  57.721 347.288 1.00 66.40  ? 297 PHE A O   1 
ATOM   2227 C CB  . PHE A 1 296 ? 40.873  55.365 349.381 1.00 45.07  ? 297 PHE A CB  1 
ATOM   2228 C CG  . PHE A 1 296 ? 41.337  53.942 349.425 1.00 45.03  ? 297 PHE A CG  1 
ATOM   2229 C CD1 . PHE A 1 296 ? 40.481  52.945 349.856 1.00 47.93  ? 297 PHE A CD1 1 
ATOM   2230 C CD2 . PHE A 1 296 ? 42.590  53.587 348.948 1.00 54.55  ? 297 PHE A CD2 1 
ATOM   2231 C CE1 . PHE A 1 296 ? 40.885  51.623 349.865 1.00 65.44  ? 297 PHE A CE1 1 
ATOM   2232 C CE2 . PHE A 1 296 ? 43.002  52.265 348.951 1.00 47.16  ? 297 PHE A CE2 1 
ATOM   2233 C CZ  . PHE A 1 296 ? 42.148  51.282 349.411 1.00 50.03  ? 297 PHE A CZ  1 
ATOM   2234 N N   . SER A 1 297 ? 38.542  57.624 348.632 1.00 52.02  ? 298 SER A N   1 
ATOM   2235 C CA  A SER A 1 297 ? 38.050  58.944 348.247 0.78 55.19  ? 298 SER A CA  1 
ATOM   2236 C CA  B SER A 1 297 ? 38.049  58.943 348.249 0.22 56.18  ? 298 SER A CA  1 
ATOM   2237 C C   . SER A 1 297 ? 39.033  60.046 348.617 1.00 56.17  ? 298 SER A C   1 
ATOM   2238 O O   . SER A 1 297 ? 39.360  60.901 347.787 1.00 53.36  ? 298 SER A O   1 
ATOM   2239 C CB  A SER A 1 297 ? 36.693  59.204 348.896 0.78 61.50  ? 298 SER A CB  1 
ATOM   2240 C CB  B SER A 1 297 ? 36.692  59.199 348.901 0.22 61.72  ? 298 SER A CB  1 
ATOM   2241 O OG  A SER A 1 297 ? 35.757  58.201 348.543 0.78 60.50  ? 298 SER A OG  1 
ATOM   2242 O OG  B SER A 1 297 ? 36.747  58.981 350.299 0.22 64.96  ? 298 SER A OG  1 
ATOM   2243 N N   . PHE A 1 298 ? 39.501  60.057 349.863 1.00 55.64  ? 299 PHE A N   1 
ATOM   2244 C CA  . PHE A 1 298 ? 40.338  61.144 350.364 1.00 61.32  ? 299 PHE A CA  1 
ATOM   2245 C C   . PHE A 1 298 ? 41.703  60.595 350.745 1.00 57.59  ? 299 PHE A C   1 
ATOM   2246 O O   . PHE A 1 298 ? 41.847  59.910 351.765 1.00 51.85  ? 299 PHE A O   1 
ATOM   2247 C CB  . PHE A 1 298 ? 39.643  61.850 351.525 1.00 52.63  ? 299 PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 298 ? 38.338  62.451 351.123 1.00 47.85  ? 299 PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 298 ? 38.312  63.579 350.317 1.00 50.63  ? 299 PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 298 ? 37.141  61.857 351.484 1.00 51.58  ? 299 PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 298 ? 37.118  64.130 349.905 1.00 49.79  ? 299 PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 298 ? 35.936  62.402 351.077 1.00 60.32  ? 299 PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 298 ? 35.928  63.540 350.280 1.00 59.99  ? 299 PHE A CZ  1 
ATOM   2254 N N   . VAL A 1 299 ? 42.691  60.900 349.912 1.00 49.30  ? 300 VAL A N   1 
ATOM   2255 C CA  . VAL A 1 299 ? 44.054  60.396 350.025 1.00 40.89  ? 300 VAL A CA  1 
ATOM   2256 C C   . VAL A 1 299 ? 44.985  61.593 349.861 1.00 53.78  ? 300 VAL A C   1 
ATOM   2257 O O   . VAL A 1 299 ? 44.507  62.694 349.543 1.00 48.62  ? 300 VAL A O   1 
ATOM   2258 C CB  . VAL A 1 299 ? 44.322  59.310 348.971 1.00 52.81  ? 300 VAL A CB  1 
ATOM   2259 C CG1 . VAL A 1 299 ? 43.319  58.180 349.113 1.00 41.16  ? 300 VAL A CG1 1 
ATOM   2260 C CG2 . VAL A 1 299 ? 44.273  59.917 347.565 1.00 45.34  ? 300 VAL A CG2 1 
ATOM   2261 N N   . PRO A 1 300 ? 46.297  61.447 350.072 1.00 48.16  ? 301 PRO A N   1 
ATOM   2262 C CA  . PRO A 1 300 ? 47.203  62.583 349.855 1.00 44.83  ? 301 PRO A CA  1 
ATOM   2263 C C   . PRO A 1 300 ? 47.065  63.174 348.457 1.00 63.91  ? 301 PRO A C   1 
ATOM   2264 O O   . PRO A 1 300 ? 46.859  62.460 347.472 1.00 51.29  ? 301 PRO A O   1 
ATOM   2265 C CB  . PRO A 1 300 ? 48.588  61.966 350.072 1.00 49.54  ? 301 PRO A CB  1 
ATOM   2266 C CG  . PRO A 1 300 ? 48.341  60.890 351.070 1.00 58.01  ? 301 PRO A CG  1 
ATOM   2267 C CD  . PRO A 1 300 ? 46.996  60.312 350.705 1.00 43.68  ? 301 PRO A CD  1 
ATOM   2268 N N   . VAL A 1 301 ? 47.175  64.497 348.377 1.00 55.11  ? 302 VAL A N   1 
ATOM   2269 C CA  . VAL A 1 301 ? 47.017  65.229 347.127 1.00 55.33  ? 302 VAL A CA  1 
ATOM   2270 C C   . VAL A 1 301 ? 48.377  65.754 346.685 1.00 62.61  ? 302 VAL A C   1 
ATOM   2271 O O   . VAL A 1 301 ? 49.165  66.236 347.506 1.00 51.70  ? 302 VAL A O   1 
ATOM   2272 C CB  . VAL A 1 301 ? 46.002  66.382 347.274 1.00 59.58  ? 302 VAL A CB  1 
ATOM   2273 C CG1 . VAL A 1 301 ? 46.432  67.348 348.373 1.00 55.20  ? 302 VAL A CG1 1 
ATOM   2274 C CG2 . VAL A 1 301 ? 45.829  67.113 345.950 1.00 56.89  ? 302 VAL A CG2 1 
ATOM   2275 N N   . VAL A 1 302 ? 48.658  65.691 345.399 1.00 60.49  ? 303 VAL A N   1 
ATOM   2276 C CA  . VAL A 1 302 ? 49.899  66.200 344.893 1.00 59.75  ? 303 VAL A CA  1 
ATOM   2277 C C   . VAL A 1 302 ? 49.637  67.617 344.525 1.00 64.30  ? 303 VAL A C   1 
ATOM   2278 O O   . VAL A 1 302 ? 49.007  67.886 343.552 1.00 66.83  ? 303 VAL A O   1 
ATOM   2279 C CB  . VAL A 1 302 ? 50.299  65.476 343.634 1.00 63.76  ? 303 VAL A CB  1 
ATOM   2280 C CG1 . VAL A 1 302 ? 51.546  66.078 343.064 1.00 47.24  ? 303 VAL A CG1 1 
ATOM   2281 C CG2 . VAL A 1 302 ? 50.510  64.026 343.929 1.00 50.39  ? 303 VAL A CG2 1 
ATOM   2282 N N   . ASP A 1 303 ? 50.121  68.527 345.333 1.00 65.09  ? 304 ASP A N   1 
ATOM   2283 C CA  . ASP A 1 303 ? 49.892  69.925 345.113 1.00 68.12  ? 304 ASP A CA  1 
ATOM   2284 C C   . ASP A 1 303 ? 51.093  70.818 345.109 1.00 67.86  ? 304 ASP A C   1 
ATOM   2285 O O   . ASP A 1 303 ? 50.951  72.011 345.137 1.00 74.11  ? 304 ASP A O   1 
ATOM   2286 C CB  . ASP A 1 303 ? 49.020  70.407 346.222 1.00 72.36  ? 304 ASP A CB  1 
ATOM   2287 C CG  . ASP A 1 303 ? 49.611  70.147 347.537 1.00 74.93  ? 304 ASP A CG  1 
ATOM   2288 O OD1 . ASP A 1 303 ? 50.524  69.320 347.660 1.00 70.33  ? 304 ASP A OD1 1 
ATOM   2289 O OD2 . ASP A 1 303 ? 49.157  70.785 348.468 1.00 91.30  ? 304 ASP A OD2 1 
ATOM   2290 N N   . GLY A 1 304 ? 52.272  70.252 345.108 1.00 65.12  ? 305 GLY A N   1 
ATOM   2291 C CA  . GLY A 1 304 ? 53.471  71.041 345.115 1.00 65.46  ? 305 GLY A CA  1 
ATOM   2292 C C   . GLY A 1 304 ? 53.941  71.454 346.475 1.00 74.78  ? 305 GLY A C   1 
ATOM   2293 O O   . GLY A 1 304 ? 54.975  72.063 346.577 1.00 80.06  ? 305 GLY A O   1 
ATOM   2294 N N   . ASP A 1 305 ? 53.214  71.107 347.521 1.00 68.54  ? 306 ASP A N   1 
ATOM   2295 C CA  . ASP A 1 305 ? 53.636  71.475 348.849 1.00 65.85  ? 306 ASP A CA  1 
ATOM   2296 C C   . ASP A 1 305 ? 54.258  70.322 349.580 1.00 67.21  ? 306 ASP A C   1 
ATOM   2297 O O   . ASP A 1 305 ? 55.446  70.251 349.649 1.00 63.25  ? 306 ASP A O   1 
ATOM   2298 C CB  . ASP A 1 305 ? 52.466  72.008 349.640 1.00 67.15  ? 306 ASP A CB  1 
ATOM   2299 C CG  . ASP A 1 305 ? 52.885  72.702 350.892 1.00 77.63  ? 306 ASP A CG  1 
ATOM   2300 O OD1 . ASP A 1 305 ? 54.064  72.704 351.213 1.00 81.15  ? 306 ASP A OD1 1 
ATOM   2301 O OD2 . ASP A 1 305 ? 52.032  73.267 351.568 1.00 82.73  ? 306 ASP A OD2 1 
ATOM   2302 N N   . PHE A 1 306 ? 53.465  69.403 350.106 1.00 64.81  ? 307 PHE A N   1 
ATOM   2303 C CA  . PHE A 1 306 ? 54.020  68.264 350.806 1.00 58.97  ? 307 PHE A CA  1 
ATOM   2304 C C   . PHE A 1 306 ? 54.814  67.475 349.823 1.00 67.05  ? 307 PHE A C   1 
ATOM   2305 O O   . PHE A 1 306 ? 55.875  67.007 350.113 1.00 58.48  ? 307 PHE A O   1 
ATOM   2306 C CB  . PHE A 1 306 ? 52.936  67.391 351.399 1.00 56.50  ? 307 PHE A CB  1 
ATOM   2307 C CG  . PHE A 1 306 ? 53.433  66.437 352.420 1.00 57.98  ? 307 PHE A CG  1 
ATOM   2308 C CD1 . PHE A 1 306 ? 54.054  65.290 352.052 1.00 48.20  ? 307 PHE A CD1 1 
ATOM   2309 C CD2 . PHE A 1 306 ? 53.281  66.700 353.744 1.00 57.03  ? 307 PHE A CD2 1 
ATOM   2310 C CE1 . PHE A 1 306 ? 54.516  64.423 352.979 1.00 52.65  ? 307 PHE A CE1 1 
ATOM   2311 C CE2 . PHE A 1 306 ? 53.734  65.831 354.682 1.00 47.36  ? 307 PHE A CE2 1 
ATOM   2312 C CZ  . PHE A 1 306 ? 54.356  64.693 354.294 1.00 54.27  ? 307 PHE A CZ  1 
ATOM   2313 N N   . LEU A 1 307 ? 54.269  67.345 348.640 1.00 63.64  ? 308 LEU A N   1 
ATOM   2314 C CA  . LEU A 1 307 ? 54.929  66.660 347.580 1.00 63.14  ? 308 LEU A CA  1 
ATOM   2315 C C   . LEU A 1 307 ? 55.060  67.639 346.453 1.00 65.87  ? 308 LEU A C   1 
ATOM   2316 O O   . LEU A 1 307 ? 54.092  68.025 345.892 1.00 57.50  ? 308 LEU A O   1 
ATOM   2317 C CB  . LEU A 1 307 ? 54.050  65.528 347.125 1.00 61.75  ? 308 LEU A CB  1 
ATOM   2318 C CG  . LEU A 1 307 ? 53.743  64.409 348.081 1.00 68.40  ? 308 LEU A CG  1 
ATOM   2319 C CD1 . LEU A 1 307 ? 52.611  63.609 347.505 1.00 54.74  ? 308 LEU A CD1 1 
ATOM   2320 C CD2 . LEU A 1 307 ? 54.963  63.544 348.217 1.00 64.92  ? 308 LEU A CD2 1 
ATOM   2321 N N   . SER A 1 308 ? 56.274  68.001 346.101 1.00 65.86  ? 309 SER A N   1 
ATOM   2322 C CA  . SER A 1 308 ? 56.536  68.940 345.034 1.00 70.26  ? 309 SER A CA  1 
ATOM   2323 C C   . SER A 1 308 ? 56.126  68.403 343.701 1.00 64.95  ? 309 SER A C   1 
ATOM   2324 O O   . SER A 1 308 ? 55.824  69.131 342.814 1.00 74.88  ? 309 SER A O   1 
ATOM   2325 C CB  . SER A 1 308 ? 57.982  69.351 345.023 1.00 57.93  ? 309 SER A CB  1 
ATOM   2326 O OG  . SER A 1 308 ? 58.805  68.238 345.092 1.00 74.36  ? 309 SER A OG  1 
ATOM   2327 N N   . ASP A 1 309 ? 56.147  67.104 343.559 1.00 71.76  ? 310 ASP A N   1 
ATOM   2328 C CA  . ASP A 1 309 ? 55.755  66.469 342.308 1.00 53.98  ? 310 ASP A CA  1 
ATOM   2329 C C   . ASP A 1 309 ? 55.061  65.156 342.652 1.00 64.63  ? 310 ASP A C   1 
ATOM   2330 O O   . ASP A 1 309 ? 54.828  64.847 343.825 1.00 62.37  ? 310 ASP A O   1 
ATOM   2331 C CB  . ASP A 1 309 ? 56.976  66.267 341.401 1.00 68.49  ? 310 ASP A CB  1 
ATOM   2332 C CG  . ASP A 1 309 ? 56.621  66.284 339.917 1.00 80.87  ? 310 ASP A CG  1 
ATOM   2333 O OD1 . ASP A 1 309 ? 57.402  66.859 339.129 1.00 81.49  ? 310 ASP A OD1 1 
ATOM   2334 O OD2 . ASP A 1 309 ? 55.570  65.722 339.538 1.00 73.04  ? 310 ASP A OD2 1 
ATOM   2335 N N   . THR A 1 310 ? 54.719  64.379 341.628 1.00 64.90  ? 311 THR A N   1 
ATOM   2336 C CA  . THR A 1 310 ? 54.182  63.054 341.874 1.00 65.28  ? 311 THR A CA  1 
ATOM   2337 C C   . THR A 1 310 ? 55.250  62.182 342.528 1.00 64.95  ? 311 THR A C   1 
ATOM   2338 O O   . THR A 1 310 ? 56.444  62.351 342.266 1.00 63.95  ? 311 THR A O   1 
ATOM   2339 C CB  . THR A 1 310 ? 53.720  62.397 340.578 1.00 57.67  ? 311 THR A CB  1 
ATOM   2340 O OG1 . THR A 1 310 ? 54.862  61.898 339.871 1.00 69.07  ? 311 THR A OG1 1 
ATOM   2341 C CG2 . THR A 1 310 ? 52.971  63.390 339.703 1.00 55.34  ? 311 THR A CG2 1 
ATOM   2342 N N   . PRO A 1 311 ? 54.848  61.245 343.390 1.00 63.53  ? 312 PRO A N   1 
ATOM   2343 C CA  . PRO A 1 311 ? 55.840  60.334 343.979 1.00 59.95  ? 312 PRO A CA  1 
ATOM   2344 C C   . PRO A 1 311 ? 56.649  59.586 342.937 1.00 61.12  ? 312 PRO A C   1 
ATOM   2345 O O   . PRO A 1 311 ? 57.827  59.294 343.177 1.00 64.18  ? 312 PRO A O   1 
ATOM   2346 C CB  . PRO A 1 311 ? 54.985  59.387 344.834 1.00 56.67  ? 312 PRO A CB  1 
ATOM   2347 C CG  . PRO A 1 311 ? 53.738  60.177 345.133 1.00 55.22  ? 312 PRO A CG  1 
ATOM   2348 C CD  . PRO A 1 311 ? 53.489  61.004 343.909 1.00 62.79  ? 312 PRO A CD  1 
ATOM   2349 N N   . GLU A 1 312 ? 56.064  59.285 341.773 1.00 74.38  ? 313 GLU A N   1 
ATOM   2350 C CA  . GLU A 1 312 ? 56.831  58.645 340.708 1.00 68.14  ? 313 GLU A CA  1 
ATOM   2351 C C   . GLU A 1 312 ? 57.955  59.551 340.220 1.00 63.45  ? 313 GLU A C   1 
ATOM   2352 O O   . GLU A 1 312 ? 59.103  59.114 340.071 1.00 55.68  ? 313 GLU A O   1 
ATOM   2353 C CB  . GLU A 1 312 ? 55.926  58.263 339.540 1.00 67.36  ? 313 GLU A CB  1 
ATOM   2354 C CG  . GLU A 1 312 ? 56.742  57.716 338.379 1.00 100.84 ? 313 GLU A CG  1 
ATOM   2355 C CD  . GLU A 1 312 ? 56.065  57.835 337.023 1.00 112.84 ? 313 GLU A CD  1 
ATOM   2356 O OE1 . GLU A 1 312 ? 55.314  58.809 336.804 1.00 110.71 ? 313 GLU A OE1 1 
ATOM   2357 O OE2 . GLU A 1 312 ? 56.299  56.950 336.169 1.00 96.93  ? 313 GLU A OE2 1 
ATOM   2358 N N   . ALA A 1 313 ? 57.638  60.819 339.952 1.00 50.71  ? 314 ALA A N   1 
ATOM   2359 C CA  . ALA A 1 313 ? 58.665  61.769 339.537 1.00 50.40  ? 314 ALA A CA  1 
ATOM   2360 C C   . ALA A 1 313 ? 59.752  61.914 340.598 1.00 58.55  ? 314 ALA A C   1 
ATOM   2361 O O   . ALA A 1 313 ? 60.946  61.863 340.285 1.00 59.49  ? 314 ALA A O   1 
ATOM   2362 C CB  . ALA A 1 313 ? 58.029  63.126 339.227 1.00 50.56  ? 314 ALA A CB  1 
ATOM   2363 N N   . LEU A 1 314 ? 59.355  62.088 341.868 1.00 66.04  ? 315 LEU A N   1 
ATOM   2364 C CA  . LEU A 1 314 ? 60.334  62.312 342.933 1.00 50.62  ? 315 LEU A CA  1 
ATOM   2365 C C   . LEU A 1 314 ? 61.210  61.090 343.168 1.00 48.37  ? 315 LEU A C   1 
ATOM   2366 O O   . LEU A 1 314 ? 62.376  61.230 343.559 1.00 61.53  ? 315 LEU A O   1 
ATOM   2367 C CB  . LEU A 1 314 ? 59.624  62.715 344.224 1.00 53.95  ? 315 LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 314 ? 58.914  64.071 344.170 1.00 66.60  ? 315 LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 314 ? 57.893  64.207 345.288 1.00 64.19  ? 315 LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 314 ? 59.916  65.213 344.229 1.00 72.99  ? 315 LEU A CD2 1 
ATOM   2371 N N   . ILE A 1 315 ? 60.675  59.891 342.930 1.00 59.01  ? 316 ILE A N   1 
ATOM   2372 C CA  . ILE A 1 315 ? 61.468  58.675 343.068 1.00 58.86  ? 316 ILE A CA  1 
ATOM   2373 C C   . ILE A 1 315 ? 62.564  58.626 342.009 1.00 59.35  ? 316 ILE A C   1 
ATOM   2374 O O   . ILE A 1 315 ? 63.729  58.346 342.314 1.00 72.00  ? 316 ILE A O   1 
ATOM   2375 C CB  . ILE A 1 315 ? 60.559  57.434 342.998 1.00 59.62  ? 316 ILE A CB  1 
ATOM   2376 C CG1 . ILE A 1 315 ? 59.787  57.260 344.300 1.00 58.90  ? 316 ILE A CG1 1 
ATOM   2377 C CG2 . ILE A 1 315 ? 61.371  56.186 342.738 1.00 47.55  ? 316 ILE A CG2 1 
ATOM   2378 C CD1 . ILE A 1 315 ? 58.580  56.365 344.156 1.00 51.43  ? 316 ILE A CD1 1 
ATOM   2379 N N   . ASN A 1 316 ? 62.210  58.901 340.749 1.00 66.04  ? 317 ASN A N   1 
ATOM   2380 C CA  . ASN A 1 316 ? 63.186  58.799 339.664 1.00 66.81  ? 317 ASN A CA  1 
ATOM   2381 C C   . ASN A 1 316 ? 64.252  59.885 339.746 1.00 66.92  ? 317 ASN A C   1 
ATOM   2382 O O   . ASN A 1 316 ? 65.389  59.666 339.315 1.00 74.48  ? 317 ASN A O   1 
ATOM   2383 C CB  . ASN A 1 316 ? 62.484  58.868 338.308 1.00 67.94  ? 317 ASN A CB  1 
ATOM   2384 C CG  . ASN A 1 316 ? 61.428  57.801 338.146 1.00 65.77  ? 317 ASN A CG  1 
ATOM   2385 O OD1 . ASN A 1 316 ? 61.516  56.726 338.744 1.00 77.62  ? 317 ASN A OD1 1 
ATOM   2386 N ND2 . ASN A 1 316 ? 60.411  58.095 337.345 1.00 61.42  ? 317 ASN A ND2 1 
ATOM   2387 N N   . ALA A 1 317 ? 63.907  61.054 340.286 1.00 57.43  ? 318 ALA A N   1 
ATOM   2388 C CA  . ALA A 1 317 ? 64.856  62.151 340.414 1.00 58.37  ? 318 ALA A CA  1 
ATOM   2389 C C   . ALA A 1 317 ? 65.729  62.055 341.657 1.00 68.58  ? 318 ALA A C   1 
ATOM   2390 O O   . ALA A 1 317 ? 66.712  62.797 341.758 1.00 75.77  ? 318 ALA A O   1 
ATOM   2391 C CB  . ALA A 1 317 ? 64.112  63.488 340.436 1.00 58.14  ? 318 ALA A CB  1 
ATOM   2392 N N   . GLY A 1 318 ? 65.405  61.172 342.598 1.00 70.88  ? 319 GLY A N   1 
ATOM   2393 C CA  . GLY A 1 318 ? 66.015  61.240 343.915 1.00 67.47  ? 319 GLY A CA  1 
ATOM   2394 C C   . GLY A 1 318 ? 67.420  60.653 343.961 1.00 66.94  ? 319 GLY A C   1 
ATOM   2395 O O   . GLY A 1 318 ? 67.742  59.685 343.271 1.00 68.34  ? 319 GLY A O   1 
ATOM   2396 N N   . ASP A 1 319 ? 68.264  61.270 344.784 1.00 66.48  ? 320 ASP A N   1 
ATOM   2397 C CA  . ASP A 1 319 ? 69.537  60.694 345.200 1.00 67.20  ? 320 ASP A CA  1 
ATOM   2398 C C   . ASP A 1 319 ? 69.312  60.040 346.555 1.00 70.43  ? 320 ASP A C   1 
ATOM   2399 O O   . ASP A 1 319 ? 68.986  60.726 347.529 1.00 60.70  ? 320 ASP A O   1 
ATOM   2400 C CB  . ASP A 1 319 ? 70.632  61.761 345.285 1.00 77.93  ? 320 ASP A CB  1 
ATOM   2401 C CG  . ASP A 1 319 ? 72.022  61.173 345.563 1.00 92.73  ? 320 ASP A CG  1 
ATOM   2402 O OD1 . ASP A 1 319 ? 72.126  59.989 345.959 1.00 82.68  ? 320 ASP A OD1 1 
ATOM   2403 O OD2 . ASP A 1 319 ? 73.021  61.908 345.397 1.00 80.62  ? 320 ASP A OD2 1 
ATOM   2404 N N   . PHE A 1 320 ? 69.480  58.721 346.616 1.00 67.50  ? 321 PHE A N   1 
ATOM   2405 C CA  . PHE A 1 320 ? 69.142  57.958 347.811 1.00 75.72  ? 321 PHE A CA  1 
ATOM   2406 C C   . PHE A 1 320 ? 70.355  57.247 348.405 1.00 72.59  ? 321 PHE A C   1 
ATOM   2407 O O   . PHE A 1 320 ? 70.210  56.236 349.091 1.00 70.34  ? 321 PHE A O   1 
ATOM   2408 C CB  . PHE A 1 320 ? 68.021  56.964 347.506 1.00 65.88  ? 321 PHE A CB  1 
ATOM   2409 C CG  . PHE A 1 320 ? 66.735  57.620 347.090 1.00 56.09  ? 321 PHE A CG  1 
ATOM   2410 C CD1 . PHE A 1 320 ? 65.951  58.285 348.021 1.00 45.16  ? 321 PHE A CD1 1 
ATOM   2411 C CD2 . PHE A 1 320 ? 66.319  57.589 345.766 1.00 56.45  ? 321 PHE A CD2 1 
ATOM   2412 C CE1 . PHE A 1 320 ? 64.769  58.899 347.644 1.00 58.85  ? 321 PHE A CE1 1 
ATOM   2413 C CE2 . PHE A 1 320 ? 65.134  58.203 345.379 1.00 53.96  ? 321 PHE A CE2 1 
ATOM   2414 C CZ  . PHE A 1 320 ? 64.359  58.859 346.318 1.00 64.22  ? 321 PHE A CZ  1 
ATOM   2415 N N   . HIS A 1 321 ? 71.554  57.768 348.153 1.00 73.39  ? 322 HIS A N   1 
ATOM   2416 C CA  . HIS A 1 321 ? 72.739  57.285 348.851 1.00 71.80  ? 322 HIS A CA  1 
ATOM   2417 C C   . HIS A 1 321 ? 72.625  57.588 350.340 1.00 59.11  ? 322 HIS A C   1 
ATOM   2418 O O   . HIS A 1 321 ? 72.120  58.642 350.738 1.00 71.98  ? 322 HIS A O   1 
ATOM   2419 C CB  . HIS A 1 321 ? 74.004  57.926 348.273 1.00 69.29  ? 322 HIS A CB  1 
ATOM   2420 C CG  . HIS A 1 321 ? 74.486  57.274 347.015 1.00 64.88  ? 322 HIS A CG  1 
ATOM   2421 N ND1 . HIS A 1 321 ? 74.144  57.731 345.759 1.00 67.23  ? 322 HIS A ND1 1 
ATOM   2422 C CD2 . HIS A 1 321 ? 75.265  56.183 346.819 1.00 69.12  ? 322 HIS A CD2 1 
ATOM   2423 C CE1 . HIS A 1 321 ? 74.700  56.956 344.844 1.00 66.84  ? 322 HIS A CE1 1 
ATOM   2424 N NE2 . HIS A 1 321 ? 75.384  56.008 345.461 1.00 70.53  ? 322 HIS A NE2 1 
ATOM   2425 N N   . GLY A 1 322 ? 73.088  56.654 351.166 1.00 72.34  ? 323 GLY A N   1 
ATOM   2426 C CA  . GLY A 1 322 ? 72.929  56.771 352.601 1.00 77.29  ? 323 GLY A CA  1 
ATOM   2427 C C   . GLY A 1 322 ? 71.581  56.340 353.135 1.00 81.62  ? 323 GLY A C   1 
ATOM   2428 O O   . GLY A 1 322 ? 71.354  56.435 354.350 1.00 65.49  ? 323 GLY A O   1 
ATOM   2429 N N   . LEU A 1 323 ? 70.680  55.872 352.275 1.00 60.23  ? 324 LEU A N   1 
ATOM   2430 C CA  . LEU A 1 323 ? 69.365  55.406 352.687 1.00 56.20  ? 324 LEU A CA  1 
ATOM   2431 C C   . LEU A 1 323 ? 69.344  53.884 352.703 1.00 57.17  ? 324 LEU A C   1 
ATOM   2432 O O   . LEU A 1 323 ? 69.762  53.242 351.733 1.00 61.46  ? 324 LEU A O   1 
ATOM   2433 C CB  . LEU A 1 323 ? 68.277  55.937 351.750 1.00 70.23  ? 324 LEU A CB  1 
ATOM   2434 C CG  . LEU A 1 323 ? 66.835  55.601 352.138 1.00 59.74  ? 324 LEU A CG  1 
ATOM   2435 C CD1 . LEU A 1 323 ? 66.518  56.114 353.537 1.00 56.70  ? 324 LEU A CD1 1 
ATOM   2436 C CD2 . LEU A 1 323 ? 65.847  56.155 351.121 1.00 66.32  ? 324 LEU A CD2 1 
ATOM   2437 N N   . GLN A 1 324 ? 68.873  53.312 353.808 1.00 51.17  ? 325 GLN A N   1 
ATOM   2438 C CA  . GLN A 1 324 ? 68.564  51.889 353.884 1.00 57.09  ? 325 GLN A CA  1 
ATOM   2439 C C   . GLN A 1 324 ? 67.061  51.726 354.052 1.00 56.37  ? 325 GLN A C   1 
ATOM   2440 O O   . GLN A 1 324 ? 66.453  52.385 354.902 1.00 61.59  ? 325 GLN A O   1 
ATOM   2441 C CB  . GLN A 1 324 ? 69.304  51.211 355.035 1.00 57.74  ? 325 GLN A CB  1 
ATOM   2442 C CG  . GLN A 1 324 ? 70.808  51.277 354.916 1.00 54.95  ? 325 GLN A CG  1 
ATOM   2443 C CD  . GLN A 1 324 ? 71.381  52.460 355.655 1.00 64.08  ? 325 GLN A CD  1 
ATOM   2444 O OE1 . GLN A 1 324 ? 70.901  52.831 356.732 1.00 67.22  ? 325 GLN A OE1 1 
ATOM   2445 N NE2 . GLN A 1 324 ? 72.410  53.066 355.083 1.00 66.53  ? 325 GLN A NE2 1 
ATOM   2446 N N   . VAL A 1 325 ? 66.467  50.864 353.233 1.00 54.27  ? 326 VAL A N   1 
ATOM   2447 C CA  A VAL A 1 325 ? 65.028  50.642 353.243 0.35 57.63  ? 326 VAL A CA  1 
ATOM   2448 C CA  B VAL A 1 325 ? 65.027  50.643 353.217 0.65 57.56  ? 326 VAL A CA  1 
ATOM   2449 C C   . VAL A 1 325 ? 64.758  49.146 353.263 1.00 58.66  ? 326 VAL A C   1 
ATOM   2450 O O   . VAL A 1 325 ? 65.452  48.364 352.604 1.00 59.05  ? 326 VAL A O   1 
ATOM   2451 C CB  A VAL A 1 325 ? 64.328  51.296 352.031 0.35 55.18  ? 326 VAL A CB  1 
ATOM   2452 C CB  B VAL A 1 325 ? 64.363  51.259 351.966 0.65 57.25  ? 326 VAL A CB  1 
ATOM   2453 C CG1 A VAL A 1 325 ? 64.164  52.789 352.249 0.35 55.36  ? 326 VAL A CG1 1 
ATOM   2454 C CG1 B VAL A 1 325 ? 62.876  51.233 352.111 0.65 50.30  ? 326 VAL A CG1 1 
ATOM   2455 C CG2 A VAL A 1 325 ? 65.102  51.023 350.760 0.35 54.50  ? 326 VAL A CG2 1 
ATOM   2456 C CG2 B VAL A 1 325 ? 64.820  52.680 351.748 0.65 62.81  ? 326 VAL A CG2 1 
ATOM   2457 N N   . LEU A 1 326 ? 63.744  48.755 354.024 1.00 45.20  ? 327 LEU A N   1 
ATOM   2458 C CA  . LEU A 1 326 ? 63.243  47.388 354.052 1.00 47.19  ? 327 LEU A CA  1 
ATOM   2459 C C   . LEU A 1 326 ? 61.844  47.400 353.441 1.00 56.07  ? 327 LEU A C   1 
ATOM   2460 O O   . LEU A 1 326 ? 60.974  48.149 353.896 1.00 48.70  ? 327 LEU A O   1 
ATOM   2461 C CB  . LEU A 1 326 ? 63.226  46.854 355.484 1.00 53.66  ? 327 LEU A CB  1 
ATOM   2462 C CG  . LEU A 1 326 ? 62.686  45.456 355.767 1.00 53.16  ? 327 LEU A CG  1 
ATOM   2463 C CD1 . LEU A 1 326 ? 63.518  44.433 355.030 1.00 57.15  ? 327 LEU A CD1 1 
ATOM   2464 C CD2 . LEU A 1 326 ? 62.713  45.200 357.271 1.00 53.48  ? 327 LEU A CD2 1 
ATOM   2465 N N   . VAL A 1 327 ? 61.637  46.608 352.388 1.00 48.11  ? 328 VAL A N   1 
ATOM   2466 C CA  . VAL A 1 327 ? 60.356  46.580 351.688 1.00 45.44  ? 328 VAL A CA  1 
ATOM   2467 C C   . VAL A 1 327 ? 59.931  45.137 351.465 1.00 52.32  ? 328 VAL A C   1 
ATOM   2468 O O   . VAL A 1 327 ? 60.762  44.227 351.394 1.00 47.84  ? 328 VAL A O   1 
ATOM   2469 C CB  . VAL A 1 327 ? 60.414  47.323 350.339 1.00 49.00  ? 328 VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 327 ? 60.720  48.790 350.554 1.00 41.80  ? 328 VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 327 ? 61.453  46.683 349.443 1.00 48.11  ? 328 VAL A CG2 1 
ATOM   2472 N N   . GLY A 1 328 ? 58.626  44.930 351.336 1.00 42.05  ? 329 GLY A N   1 
ATOM   2473 C CA  . GLY A 1 328 ? 58.141  43.583 351.099 1.00 43.61  ? 329 GLY A CA  1 
ATOM   2474 C C   . GLY A 1 328 ? 56.637  43.536 350.947 1.00 51.70  ? 329 GLY A C   1 
ATOM   2475 O O   . GLY A 1 328 ? 55.928  44.535 351.120 1.00 37.39  ? 329 GLY A O   1 
ATOM   2476 N N   . VAL A 1 329 ? 56.163  42.338 350.613 1.00 45.73  ? 330 VAL A N   1 
ATOM   2477 C CA  . VAL A 1 329 ? 54.756  42.059 350.374 1.00 47.58  ? 330 VAL A CA  1 
ATOM   2478 C C   . VAL A 1 329 ? 54.453  40.699 350.987 1.00 46.26  ? 330 VAL A C   1 
ATOM   2479 O O   . VAL A 1 329 ? 55.356  39.929 351.319 1.00 57.12  ? 330 VAL A O   1 
ATOM   2480 C CB  . VAL A 1 329 ? 54.413  42.052 348.867 1.00 46.12  ? 330 VAL A CB  1 
ATOM   2481 C CG1 . VAL A 1 329 ? 54.629  43.426 348.240 1.00 44.02  ? 330 VAL A CG1 1 
ATOM   2482 C CG2 . VAL A 1 329 ? 55.262  41.023 348.155 1.00 42.62  ? 330 VAL A CG2 1 
ATOM   2483 N N   . VAL A 1 330 ? 53.164  40.401 351.131 1.00 45.40  ? 331 VAL A N   1 
ATOM   2484 C CA  . VAL A 1 330 ? 52.752  39.044 351.480 1.00 52.41  ? 331 VAL A CA  1 
ATOM   2485 C C   . VAL A 1 330 ? 52.496  38.276 350.186 1.00 60.76  ? 331 VAL A C   1 
ATOM   2486 O O   . VAL A 1 330 ? 52.460  38.864 349.098 1.00 56.18  ? 331 VAL A O   1 
ATOM   2487 C CB  . VAL A 1 330 ? 51.515  39.040 352.394 1.00 50.89  ? 331 VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 330 ? 51.779  39.861 353.659 1.00 50.37  ? 331 VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 330 ? 50.307  39.571 351.642 1.00 42.80  ? 331 VAL A CG2 1 
ATOM   2490 N N   . LYS A 1 331 ? 52.302  36.959 350.304 1.00 59.48  ? 332 LYS A N   1 
ATOM   2491 C CA  . LYS A 1 331 ? 52.239  36.088 349.132 1.00 53.63  ? 332 LYS A CA  1 
ATOM   2492 C C   . LYS A 1 331 ? 51.010  36.365 348.267 1.00 55.33  ? 332 LYS A C   1 
ATOM   2493 O O   . LYS A 1 331 ? 51.088  36.262 347.037 1.00 56.06  ? 332 LYS A O   1 
ATOM   2494 C CB  . LYS A 1 331 ? 52.266  34.624 349.586 1.00 58.72  ? 332 LYS A CB  1 
ATOM   2495 C CG  . LYS A 1 331 ? 52.543  33.625 348.483 1.00 65.44  ? 332 LYS A CG  1 
ATOM   2496 C CD  . LYS A 1 331 ? 51.770  32.334 348.684 1.00 84.71  ? 332 LYS A CD  1 
ATOM   2497 C CE  . LYS A 1 331 ? 52.055  31.348 347.555 1.00 89.52  ? 332 LYS A CE  1 
ATOM   2498 N NZ  . LYS A 1 331 ? 51.653  29.952 347.859 1.00 96.19  ? 332 LYS A NZ  1 
ATOM   2499 N N   . ASP A 1 332 ? 49.875  36.727 348.875 1.00 53.89  ? 333 ASP A N   1 
ATOM   2500 C CA  . ASP A 1 332 ? 48.613  36.879 348.148 1.00 52.38  ? 333 ASP A CA  1 
ATOM   2501 C C   . ASP A 1 332 ? 48.009  38.253 348.453 1.00 53.39  ? 333 ASP A C   1 
ATOM   2502 O O   . ASP A 1 332 ? 46.968  38.362 349.105 1.00 56.55  ? 333 ASP A O   1 
ATOM   2503 C CB  . ASP A 1 332 ? 47.647  35.743 348.494 1.00 48.44  ? 333 ASP A CB  1 
ATOM   2504 C CG  . ASP A 1 332 ? 48.224  34.373 348.179 1.00 68.49  ? 333 ASP A CG  1 
ATOM   2505 O OD1 . ASP A 1 332 ? 48.698  33.698 349.119 1.00 62.23  ? 333 ASP A OD1 1 
ATOM   2506 O OD2 . ASP A 1 332 ? 48.225  33.983 346.987 1.00 65.13  ? 333 ASP A OD2 1 
ATOM   2507 N N   . GLU A 1 333 ? 48.655  39.304 347.940 1.00 58.00  ? 334 GLU A N   1 
ATOM   2508 C CA  . GLU A 1 333 ? 48.252  40.666 348.283 1.00 58.53  ? 334 GLU A CA  1 
ATOM   2509 C C   . GLU A 1 333 ? 46.826  40.976 347.844 1.00 61.50  ? 334 GLU A C   1 
ATOM   2510 O O   . GLU A 1 333 ? 46.146  41.782 348.489 1.00 61.53  ? 334 GLU A O   1 
ATOM   2511 C CB  . GLU A 1 333 ? 49.226  41.679 347.668 1.00 45.64  ? 334 GLU A CB  1 
ATOM   2512 C CG  . GLU A 1 333 ? 50.603  41.712 348.337 1.00 55.41  ? 334 GLU A CG  1 
ATOM   2513 C CD  . GLU A 1 333 ? 50.579  42.402 349.704 1.00 71.04  ? 334 GLU A CD  1 
ATOM   2514 O OE1 . GLU A 1 333 ? 49.556  43.050 350.019 1.00 64.89  ? 334 GLU A OE1 1 
ATOM   2515 O OE2 . GLU A 1 333 ? 51.567  42.286 350.471 1.00 57.68  ? 334 GLU A OE2 1 
ATOM   2516 N N   . GLY A 1 334 ? 46.348  40.336 346.775 1.00 61.89  ? 335 GLY A N   1 
ATOM   2517 C CA  . GLY A 1 334 ? 45.076  40.701 346.182 1.00 43.76  ? 335 GLY A CA  1 
ATOM   2518 C C   . GLY A 1 334 ? 43.829  40.046 346.753 1.00 52.43  ? 335 GLY A C   1 
ATOM   2519 O O   . GLY A 1 334 ? 42.738  40.614 346.651 1.00 45.77  ? 335 GLY A O   1 
ATOM   2520 N N   . SER A 1 335 ? 43.970  38.869 347.370 1.00 47.19  ? 336 SER A N   1 
ATOM   2521 C CA  . SER A 1 335 ? 42.800  38.047 347.681 1.00 64.28  ? 336 SER A CA  1 
ATOM   2522 C C   . SER A 1 335 ? 41.844  38.747 348.644 1.00 71.39  ? 336 SER A C   1 
ATOM   2523 O O   . SER A 1 335 ? 40.620  38.654 348.490 1.00 68.69  ? 336 SER A O   1 
ATOM   2524 C CB  . SER A 1 335 ? 43.248  36.701 348.251 1.00 65.18  ? 336 SER A CB  1 
ATOM   2525 O OG  . SER A 1 335 ? 43.977  36.874 349.454 1.00 64.21  ? 336 SER A OG  1 
ATOM   2526 N N   . TYR A 1 336 ? 42.387  39.458 349.636 1.00 77.41  ? 337 TYR A N   1 
ATOM   2527 C CA  . TYR A 1 336 ? 41.565  40.106 350.658 1.00 52.86  ? 337 TYR A CA  1 
ATOM   2528 C C   . TYR A 1 336 ? 40.579  41.100 350.049 1.00 58.63  ? 337 TYR A C   1 
ATOM   2529 O O   . TYR A 1 336 ? 39.435  41.208 350.502 1.00 55.57  ? 337 TYR A O   1 
ATOM   2530 C CB  . TYR A 1 336 ? 42.486  40.798 351.669 1.00 81.91  ? 337 TYR A CB  1 
ATOM   2531 C CG  . TYR A 1 336 ? 41.814  41.532 352.812 1.00 70.89  ? 337 TYR A CG  1 
ATOM   2532 C CD1 . TYR A 1 336 ? 41.654  40.926 354.051 1.00 84.44  ? 337 TYR A CD1 1 
ATOM   2533 C CD2 . TYR A 1 336 ? 41.375  42.843 352.666 1.00 79.29  ? 337 TYR A CD2 1 
ATOM   2534 C CE1 . TYR A 1 336 ? 41.058  41.598 355.106 1.00 80.59  ? 337 TYR A CE1 1 
ATOM   2535 C CE2 . TYR A 1 336 ? 40.778  43.519 353.718 1.00 74.39  ? 337 TYR A CE2 1 
ATOM   2536 C CZ  . TYR A 1 336 ? 40.621  42.893 354.935 1.00 86.77  ? 337 TYR A CZ  1 
ATOM   2537 O OH  . TYR A 1 336 ? 40.027  43.557 355.990 1.00 90.31  ? 337 TYR A OH  1 
ATOM   2538 N N   . PHE A 1 337 ? 40.997  41.827 349.019 1.00 57.01  ? 338 PHE A N   1 
ATOM   2539 C CA  . PHE A 1 337 ? 40.192  42.922 348.495 1.00 68.36  ? 338 PHE A CA  1 
ATOM   2540 C C   . PHE A 1 337 ? 39.052  42.459 347.598 1.00 66.05  ? 338 PHE A C   1 
ATOM   2541 O O   . PHE A 1 337 ? 38.163  43.262 347.296 1.00 63.95  ? 338 PHE A O   1 
ATOM   2542 C CB  . PHE A 1 337 ? 41.108  43.900 347.752 1.00 54.73  ? 338 PHE A CB  1 
ATOM   2543 C CG  . PHE A 1 337 ? 42.230  44.410 348.607 1.00 63.94  ? 338 PHE A CG  1 
ATOM   2544 C CD1 . PHE A 1 337 ? 43.426  43.712 348.699 1.00 61.23  ? 338 PHE A CD1 1 
ATOM   2545 C CD2 . PHE A 1 337 ? 42.069  45.556 349.366 1.00 56.30  ? 338 PHE A CD2 1 
ATOM   2546 C CE1 . PHE A 1 337 ? 44.451  44.164 349.511 1.00 51.47  ? 338 PHE A CE1 1 
ATOM   2547 C CE2 . PHE A 1 337 ? 43.088  46.016 350.176 1.00 57.01  ? 338 PHE A CE2 1 
ATOM   2548 C CZ  . PHE A 1 337 ? 44.281  45.318 350.250 1.00 55.06  ? 338 PHE A CZ  1 
ATOM   2549 N N   . LEU A 1 338 ? 39.031  41.187 347.201 1.00 63.96  ? 339 LEU A N   1 
ATOM   2550 C CA  . LEU A 1 338 ? 38.025  40.717 346.256 1.00 70.97  ? 339 LEU A CA  1 
ATOM   2551 C C   . LEU A 1 338 ? 36.708  40.328 346.917 1.00 70.75  ? 339 LEU A C   1 
ATOM   2552 O O   . LEU A 1 338 ? 35.695  40.209 346.221 1.00 63.10  ? 339 LEU A O   1 
ATOM   2553 C CB  . LEU A 1 338 ? 38.580  39.535 345.462 1.00 69.47  ? 339 LEU A CB  1 
ATOM   2554 C CG  . LEU A 1 338 ? 39.766  39.923 344.579 1.00 63.73  ? 339 LEU A CG  1 
ATOM   2555 C CD1 . LEU A 1 338 ? 40.328  38.709 343.866 1.00 65.86  ? 339 LEU A CD1 1 
ATOM   2556 C CD2 . LEU A 1 338 ? 39.345  41.001 343.591 1.00 48.48  ? 339 LEU A CD2 1 
ATOM   2557 N N   . VAL A 1 339 ? 36.715  40.130 348.213 1.00 69.19  ? 340 VAL A N   1 
ATOM   2558 C CA  . VAL A 1 339 ? 35.516  39.742 348.899 1.00 70.77  ? 340 VAL A CA  1 
ATOM   2559 C C   . VAL A 1 339 ? 34.703  40.928 349.276 1.00 57.97  ? 340 VAL A C   1 
ATOM   2560 O O   . VAL A 1 339 ? 33.715  40.798 349.904 1.00 83.94  ? 340 VAL A O   1 
ATOM   2561 C CB  . VAL A 1 339 ? 35.806  38.965 350.154 1.00 71.84  ? 340 VAL A CB  1 
ATOM   2562 C CG1 . VAL A 1 339 ? 36.584  37.724 349.823 1.00 64.10  ? 340 VAL A CG1 1 
ATOM   2563 C CG2 . VAL A 1 339 ? 36.571  39.820 351.123 1.00 69.20  ? 340 VAL A CG2 1 
ATOM   2564 N N   . TYR A 1 340 ? 35.148  42.092 348.899 1.00 68.16  ? 341 TYR A N   1 
ATOM   2565 C CA  . TYR A 1 340 ? 34.443  43.299 349.211 1.00 67.12  ? 341 TYR A CA  1 
ATOM   2566 C C   . TYR A 1 340 ? 33.799  43.871 347.990 1.00 96.15  ? 341 TYR A C   1 
ATOM   2567 O O   . TYR A 1 340 ? 33.556  45.064 347.926 1.00 109.27 ? 341 TYR A O   1 
ATOM   2568 C CB  . TYR A 1 340 ? 35.356  44.330 349.841 1.00 83.93  ? 341 TYR A CB  1 
ATOM   2569 C CG  . TYR A 1 340 ? 35.672  44.082 351.283 1.00 83.57  ? 341 TYR A CG  1 
ATOM   2570 C CD1 . TYR A 1 340 ? 36.651  43.205 351.645 1.00 73.44  ? 341 TYR A CD1 1 
ATOM   2571 C CD2 . TYR A 1 340 ? 34.999  44.738 352.275 1.00 90.49  ? 341 TYR A CD2 1 
ATOM   2572 C CE1 . TYR A 1 340 ? 36.945  42.980 352.958 1.00 88.79  ? 341 TYR A CE1 1 
ATOM   2573 C CE2 . TYR A 1 340 ? 35.292  44.515 353.585 1.00 80.41  ? 341 TYR A CE2 1 
ATOM   2574 C CZ  . TYR A 1 340 ? 36.267  43.633 353.910 1.00 82.33  ? 341 TYR A CZ  1 
ATOM   2575 O OH  . TYR A 1 340 ? 36.557  43.403 355.206 1.00 90.00  ? 341 TYR A OH  1 
ATOM   2576 N N   . GLY A 1 341 ? 33.546  43.040 346.995 1.00 102.97 ? 342 GLY A N   1 
ATOM   2577 C CA  . GLY A 1 341 ? 32.898  43.537 345.800 1.00 104.88 ? 342 GLY A CA  1 
ATOM   2578 C C   . GLY A 1 341 ? 33.115  42.956 344.431 1.00 95.63  ? 342 GLY A C   1 
ATOM   2579 O O   . GLY A 1 341 ? 32.349  43.270 343.543 1.00 108.97 ? 342 GLY A O   1 
ATOM   2580 N N   . ALA A 1 342 ? 34.115  42.124 344.244 1.00 89.07  ? 343 ALA A N   1 
ATOM   2581 C CA  . ALA A 1 342 ? 34.313  41.532 342.952 1.00 72.84  ? 343 ALA A CA  1 
ATOM   2582 C C   . ALA A 1 342 ? 33.172  40.572 342.837 1.00 89.78  ? 343 ALA A C   1 
ATOM   2583 O O   . ALA A 1 342 ? 32.842  39.911 343.785 1.00 73.63  ? 343 ALA A O   1 
ATOM   2584 C CB  . ALA A 1 342 ? 35.617  40.798 342.899 1.00 69.33  ? 343 ALA A CB  1 
ATOM   2585 N N   . PRO A 1 343 ? 32.567  40.493 341.671 1.00 87.13  ? 344 PRO A N   1 
ATOM   2586 C CA  . PRO A 1 343 ? 31.459  39.557 341.442 1.00 60.58  ? 344 PRO A CA  1 
ATOM   2587 C C   . PRO A 1 343 ? 31.902  38.106 341.548 1.00 73.99  ? 344 PRO A C   1 
ATOM   2588 O O   . PRO A 1 343 ? 32.935  37.706 341.005 1.00 69.78  ? 344 PRO A O   1 
ATOM   2589 C CB  . PRO A 1 343 ? 30.989  39.901 340.024 1.00 70.58  ? 344 PRO A CB  1 
ATOM   2590 C CG  . PRO A 1 343 ? 32.120  40.670 339.408 1.00 78.76  ? 344 PRO A CG  1 
ATOM   2591 C CD  . PRO A 1 343 ? 32.782  41.395 340.528 1.00 68.79  ? 344 PRO A CD  1 
ATOM   2592 N N   . GLY A 1 344 ? 31.103  37.319 342.266 1.00 76.20  ? 345 GLY A N   1 
ATOM   2593 C CA  . GLY A 1 344 ? 31.355  35.906 342.432 1.00 79.69  ? 345 GLY A CA  1 
ATOM   2594 C C   . GLY A 1 344 ? 32.253  35.534 343.590 1.00 69.72  ? 345 GLY A C   1 
ATOM   2595 O O   . GLY A 1 344 ? 32.495  34.338 343.802 1.00 79.73  ? 345 GLY A O   1 
ATOM   2596 N N   . PHE A 1 345 ? 32.752  36.505 344.349 1.00 76.94  ? 346 PHE A N   1 
ATOM   2597 C CA  . PHE A 1 345 ? 33.651  36.232 345.462 1.00 87.38  ? 346 PHE A CA  1 
ATOM   2598 C C   . PHE A 1 345 ? 32.908  36.293 346.792 1.00 61.57  ? 346 PHE A C   1 
ATOM   2599 O O   . PHE A 1 345 ? 31.967  37.071 346.969 1.00 69.77  ? 346 PHE A O   1 
ATOM   2600 C CB  . PHE A 1 345 ? 34.818  37.223 345.482 1.00 72.26  ? 346 PHE A CB  1 
ATOM   2601 C CG  . PHE A 1 345 ? 35.892  36.921 344.473 1.00 73.08  ? 346 PHE A CG  1 
ATOM   2602 C CD1 . PHE A 1 345 ? 35.783  37.378 343.165 1.00 60.74  ? 346 PHE A CD1 1 
ATOM   2603 C CD2 . PHE A 1 345 ? 37.016  36.188 344.834 1.00 63.13  ? 346 PHE A CD2 1 
ATOM   2604 C CE1 . PHE A 1 345 ? 36.770  37.104 342.233 1.00 70.92  ? 346 PHE A CE1 1 
ATOM   2605 C CE2 . PHE A 1 345 ? 38.008  35.909 343.908 1.00 64.94  ? 346 PHE A CE2 1 
ATOM   2606 C CZ  . PHE A 1 345 ? 37.884  36.367 342.603 1.00 65.02  ? 346 PHE A CZ  1 
ATOM   2607 N N   . SER A 1 346 ? 33.352  35.463 347.731 1.00 73.24  ? 347 SER A N   1 
ATOM   2608 C CA  . SER A 1 346 ? 32.835  35.474 349.093 1.00 79.73  ? 347 SER A CA  1 
ATOM   2609 C C   . SER A 1 346 ? 33.865  34.812 349.996 1.00 74.87  ? 347 SER A C   1 
ATOM   2610 O O   . SER A 1 346 ? 34.708  34.035 349.541 1.00 70.01  ? 347 SER A O   1 
ATOM   2611 C CB  . SER A 1 346 ? 31.483  34.757 349.190 1.00 83.77  ? 347 SER A CB  1 
ATOM   2612 O OG  . SER A 1 346 ? 31.036  34.667 350.532 1.00 89.66  ? 347 SER A OG  1 
ATOM   2613 N N   . LYS A 1 347 ? 33.813  35.011 351.273 1.00 79.28  ? 348 LYS A N   1 
ATOM   2614 C CA  . LYS A 1 347 ? 34.793  34.318 352.033 1.00 80.51  ? 348 LYS A CA  1 
ATOM   2615 C C   . LYS A 1 347 ? 34.310  32.963 352.467 1.00 77.17  ? 348 LYS A C   1 
ATOM   2616 O O   . LYS A 1 347 ? 35.011  32.258 353.126 1.00 69.73  ? 348 LYS A O   1 
ATOM   2617 C CB  . LYS A 1 347 ? 35.148  35.127 353.254 1.00 82.03  ? 348 LYS A CB  1 
ATOM   2618 C CG  . LYS A 1 347 ? 34.106  35.116 354.328 1.00 87.06  ? 348 LYS A CG  1 
ATOM   2619 C CD  . LYS A 1 347 ? 34.739  35.420 355.644 1.00 80.29  ? 348 LYS A CD  1 
ATOM   2620 C CE  . LYS A 1 347 ? 33.697  35.515 356.708 1.00 81.28  ? 348 LYS A CE  1 
ATOM   2621 N NZ  . LYS A 1 347 ? 33.642  34.205 357.361 1.00 86.50  ? 348 LYS A NZ  1 
ATOM   2622 N N   . ASP A 1 348 ? 33.025  32.757 352.255 1.00 78.68  ? 349 ASP A N   1 
ATOM   2623 C CA  . ASP A 1 348 ? 32.314  31.578 352.676 1.00 89.38  ? 349 ASP A CA  1 
ATOM   2624 C C   . ASP A 1 348 ? 32.156  30.492 351.647 1.00 93.08  ? 349 ASP A C   1 
ATOM   2625 O O   . ASP A 1 348 ? 31.599  29.465 351.920 1.00 93.46  ? 349 ASP A O   1 
ATOM   2626 C CB  . ASP A 1 348 ? 30.969  31.996 353.213 1.00 78.29  ? 349 ASP A CB  1 
ATOM   2627 C CG  . ASP A 1 348 ? 31.086  32.810 354.444 1.00 90.34  ? 349 ASP A CG  1 
ATOM   2628 O OD1 . ASP A 1 348 ? 31.856  32.418 355.319 1.00 77.06  ? 349 ASP A OD1 1 
ATOM   2629 O OD2 . ASP A 1 348 ? 30.404  33.831 354.540 1.00 78.52  ? 349 ASP A OD2 1 
ATOM   2630 N N   . ASN A 1 349 ? 32.638  30.742 350.456 1.00 87.78  ? 350 ASN A N   1 
ATOM   2631 C CA  . ASN A 1 349 ? 32.640  29.770 349.382 1.00 101.73 ? 350 ASN A CA  1 
ATOM   2632 C C   . ASN A 1 349 ? 34.020  29.810 348.718 1.00 101.60 ? 350 ASN A C   1 
ATOM   2633 O O   . ASN A 1 349 ? 34.886  30.538 349.124 1.00 123.66 ? 350 ASN A O   1 
ATOM   2634 C CB  . ASN A 1 349 ? 31.429  29.885 348.440 1.00 98.18  ? 350 ASN A CB  1 
ATOM   2635 C CG  . ASN A 1 349 ? 31.520  31.035 347.503 1.00 91.30  ? 350 ASN A CG  1 
ATOM   2636 O OD1 . ASN A 1 349 ? 32.573  31.317 347.013 1.00 95.90  ? 350 ASN A OD1 1 
ATOM   2637 N ND2 . ASN A 1 349 ? 30.403  31.685 347.222 1.00 104.79 ? 350 ASN A ND2 1 
ATOM   2638 N N   . GLU A 1 350 ? 34.250  29.003 347.722 1.00 77.06  ? 351 GLU A N   1 
ATOM   2639 C CA  . GLU A 1 350 ? 35.547  28.966 347.111 1.00 89.58  ? 351 GLU A CA  1 
ATOM   2640 C C   . GLU A 1 350 ? 35.721  30.002 346.074 1.00 69.81  ? 351 GLU A C   1 
ATOM   2641 O O   . GLU A 1 350 ? 36.668  29.982 345.346 1.00 68.41  ? 351 GLU A O   1 
ATOM   2642 C CB  . GLU A 1 350 ? 35.727  27.653 346.448 1.00 77.97  ? 351 GLU A CB  1 
ATOM   2643 C CG  . GLU A 1 350 ? 35.467  26.539 347.381 1.00 84.90  ? 351 GLU A CG  1 
ATOM   2644 C CD  . GLU A 1 350 ? 36.736  25.946 347.843 1.00 120.89 ? 351 GLU A CD  1 
ATOM   2645 O OE1 . GLU A 1 350 ? 37.382  26.540 348.714 1.00 119.62 ? 351 GLU A OE1 1 
ATOM   2646 O OE2 . GLU A 1 350 ? 37.067  24.872 347.319 1.00 127.21 ? 351 GLU A OE2 1 
ATOM   2647 N N   . SER A 1 351 ? 34.772  30.887 345.965 1.00 66.45  ? 352 SER A N   1 
ATOM   2648 C CA  . SER A 1 351 ? 34.872  31.881 344.940 1.00 70.40  ? 352 SER A CA  1 
ATOM   2649 C C   . SER A 1 351 ? 35.318  31.422 343.572 1.00 79.51  ? 352 SER A C   1 
ATOM   2650 O O   . SER A 1 351 ? 36.161  32.015 342.973 1.00 62.90  ? 352 SER A O   1 
ATOM   2651 C CB  . SER A 1 351 ? 35.701  33.029 345.459 1.00 69.38  ? 352 SER A CB  1 
ATOM   2652 O OG  . SER A 1 351 ? 35.139  33.512 346.638 1.00 63.67  ? 352 SER A OG  1 
ATOM   2653 N N   . LEU A 1 352 ? 34.766  30.336 343.096 1.00 77.01  ? 353 LEU A N   1 
ATOM   2654 C CA  . LEU A 1 352 ? 35.116  29.822 341.772 1.00 68.21  ? 353 LEU A CA  1 
ATOM   2655 C C   . LEU A 1 352 ? 34.327  30.610 340.737 1.00 70.32  ? 353 LEU A C   1 
ATOM   2656 O O   . LEU A 1 352 ? 33.168  30.302 340.455 1.00 87.10  ? 353 LEU A O   1 
ATOM   2657 C CB  . LEU A 1 352 ? 34.827  28.330 341.687 1.00 57.00  ? 353 LEU A CB  1 
ATOM   2658 C CG  . LEU A 1 352 ? 35.656  27.525 342.683 1.00 72.64  ? 353 LEU A CG  1 
ATOM   2659 C CD1 . LEU A 1 352 ? 35.127  26.107 342.838 1.00 67.45  ? 353 LEU A CD1 1 
ATOM   2660 C CD2 . LEU A 1 352 ? 37.110  27.528 342.239 1.00 61.26  ? 353 LEU A CD2 1 
ATOM   2661 N N   . ILE A 1 353 ? 34.959  31.635 340.165 1.00 65.35  ? 354 ILE A N   1 
ATOM   2662 C CA  . ILE A 1 353 ? 34.262  32.584 339.309 1.00 67.31  ? 354 ILE A CA  1 
ATOM   2663 C C   . ILE A 1 353 ? 34.312  32.120 337.857 1.00 77.55  ? 354 ILE A C   1 
ATOM   2664 O O   . ILE A 1 353 ? 35.150  31.308 337.453 1.00 63.14  ? 354 ILE A O   1 
ATOM   2665 C CB  . ILE A 1 353 ? 34.842  34.007 339.458 1.00 68.54  ? 354 ILE A CB  1 
ATOM   2666 C CG1 . ILE A 1 353 ? 36.312  34.036 339.029 1.00 58.05  ? 354 ILE A CG1 1 
ATOM   2667 C CG2 . ILE A 1 353 ? 34.669  34.502 340.895 1.00 67.65  ? 354 ILE A CG2 1 
ATOM   2668 C CD1 . ILE A 1 353 ? 36.890  35.430 338.919 1.00 58.88  ? 354 ILE A CD1 1 
ATOM   2669 N N   . SER A 1 354 ? 33.384  32.647 337.065 1.00 76.21  ? 355 SER A N   1 
ATOM   2670 C CA  . SER A 1 354 ? 33.304  32.409 335.634 1.00 67.75  ? 355 SER A CA  1 
ATOM   2671 C C   . SER A 1 354 ? 34.109  33.468 334.887 1.00 75.51  ? 355 SER A C   1 
ATOM   2672 O O   . SER A 1 354 ? 34.531  34.475 335.459 1.00 71.18  ? 355 SER A O   1 
ATOM   2673 C CB  . SER A 1 354 ? 31.845  32.430 335.182 1.00 66.16  ? 355 SER A CB  1 
ATOM   2674 O OG  . SER A 1 354 ? 31.277  33.716 335.390 1.00 67.79  ? 355 SER A OG  1 
ATOM   2675 N N   . ARG A 1 355 ? 34.286  33.258 333.609 1.00 63.96  ? 356 ARG A N   1 
ATOM   2676 C CA  . ARG A 1 355 ? 35.006  34.222 332.856 1.00 65.40  ? 356 ARG A CA  1 
ATOM   2677 C C   . ARG A 1 355 ? 34.293  35.550 332.833 1.00 64.32  ? 356 ARG A C   1 
ATOM   2678 O O   . ARG A 1 355 ? 34.902  36.558 332.983 1.00 71.56  ? 356 ARG A O   1 
ATOM   2679 C CB  . ARG A 1 355 ? 35.290  33.698 331.471 1.00 70.94  ? 356 ARG A CB  1 
ATOM   2680 C CG  . ARG A 1 355 ? 36.109  34.642 330.654 1.00 64.06  ? 356 ARG A CG  1 
ATOM   2681 C CD  . ARG A 1 355 ? 37.178  33.932 329.894 1.00 64.85  ? 356 ARG A CD  1 
ATOM   2682 N NE  . ARG A 1 355 ? 37.970  34.909 329.191 1.00 73.60  ? 356 ARG A NE  1 
ATOM   2683 C CZ  . ARG A 1 355 ? 39.240  35.148 329.432 1.00 69.62  ? 356 ARG A CZ  1 
ATOM   2684 N NH1 . ARG A 1 355 ? 39.877  34.468 330.336 1.00 70.59  ? 356 ARG A NH1 1 
ATOM   2685 N NH2 . ARG A 1 355 ? 39.872  36.052 328.750 1.00 65.01  ? 356 ARG A NH2 1 
ATOM   2686 N N   . ALA A 1 356 ? 32.993  35.559 332.664 1.00 61.09  ? 357 ALA A N   1 
ATOM   2687 C CA  . ALA A 1 356 ? 32.252  36.814 332.667 1.00 63.64  ? 357 ALA A CA  1 
ATOM   2688 C C   . ALA A 1 356 ? 32.465  37.565 333.971 1.00 68.15  ? 357 ALA A C   1 
ATOM   2689 O O   . ALA A 1 356 ? 32.590  38.795 333.974 1.00 71.70  ? 357 ALA A O   1 
ATOM   2690 C CB  . ALA A 1 356 ? 30.766  36.552 332.426 1.00 59.18  ? 357 ALA A CB  1 
ATOM   2691 N N   . GLU A 1 357 ? 32.530  36.838 335.090 1.00 60.67  ? 358 GLU A N   1 
ATOM   2692 C CA  . GLU A 1 357 ? 32.821  37.475 336.371 1.00 81.89  ? 358 GLU A CA  1 
ATOM   2693 C C   . GLU A 1 357 ? 34.260  37.972 336.416 1.00 72.16  ? 358 GLU A C   1 
ATOM   2694 O O   . GLU A 1 357 ? 34.521  39.112 336.819 1.00 66.02  ? 358 GLU A O   1 
ATOM   2695 C CB  . GLU A 1 357 ? 32.544  36.500 337.517 1.00 63.31  ? 358 GLU A CB  1 
ATOM   2696 C CG  . GLU A 1 357 ? 31.066  36.331 337.821 1.00 64.88  ? 358 GLU A CG  1 
ATOM   2697 C CD  . GLU A 1 357 ? 30.782  35.152 338.731 1.00 81.07  ? 358 GLU A CD  1 
ATOM   2698 O OE1 . GLU A 1 357 ? 31.564  34.176 338.708 1.00 65.09  ? 358 GLU A OE1 1 
ATOM   2699 O OE2 . GLU A 1 357 ? 29.772  35.198 339.467 1.00 85.35  ? 358 GLU A OE2 1 
ATOM   2700 N N   . PHE A 1 358 ? 35.206  37.126 335.998 1.00 59.84  ? 359 PHE A N   1 
ATOM   2701 C CA  . PHE A 1 358 ? 36.605  37.536 335.924 1.00 70.66  ? 359 PHE A CA  1 
ATOM   2702 C C   . PHE A 1 358 ? 36.761  38.800 335.092 1.00 62.70  ? 359 PHE A C   1 
ATOM   2703 O O   . PHE A 1 358 ? 37.492  39.720 335.474 1.00 71.33  ? 359 PHE A O   1 
ATOM   2704 C CB  . PHE A 1 358 ? 37.445  36.397 335.341 1.00 70.60  ? 359 PHE A CB  1 
ATOM   2705 C CG  . PHE A 1 358 ? 38.858  36.785 334.997 1.00 67.86  ? 359 PHE A CG  1 
ATOM   2706 C CD1 . PHE A 1 358 ? 39.829  36.867 335.981 1.00 65.50  ? 359 PHE A CD1 1 
ATOM   2707 C CD2 . PHE A 1 358 ? 39.219  37.043 333.685 1.00 61.02  ? 359 PHE A CD2 1 
ATOM   2708 C CE1 . PHE A 1 358 ? 41.129  37.211 335.665 1.00 66.46  ? 359 PHE A CE1 1 
ATOM   2709 C CE2 . PHE A 1 358 ? 40.519  37.389 333.363 1.00 54.84  ? 359 PHE A CE2 1 
ATOM   2710 C CZ  . PHE A 1 358 ? 41.474  37.473 334.352 1.00 66.00  ? 359 PHE A CZ  1 
ATOM   2711 N N   . LEU A 1 359 ? 36.067  38.868 333.957 1.00 61.87  ? 360 LEU A N   1 
ATOM   2712 C CA  . LEU A 1 359 ? 36.138  40.057 333.117 1.00 68.32  ? 360 LEU A CA  1 
ATOM   2713 C C   . LEU A 1 359 ? 35.503  41.249 333.818 1.00 68.17  ? 360 LEU A C   1 
ATOM   2714 O O   . LEU A 1 359 ? 36.047  42.359 333.802 1.00 70.30  ? 360 LEU A O   1 
ATOM   2715 C CB  . LEU A 1 359 ? 35.461  39.788 331.774 1.00 66.55  ? 360 LEU A CB  1 
ATOM   2716 C CG  . LEU A 1 359 ? 36.180  38.792 330.865 1.00 82.02  ? 360 LEU A CG  1 
ATOM   2717 C CD1 . LEU A 1 359 ? 35.295  38.383 329.693 1.00 79.33  ? 360 LEU A CD1 1 
ATOM   2718 C CD2 . LEU A 1 359 ? 37.489  39.388 330.374 1.00 66.47  ? 360 LEU A CD2 1 
ATOM   2719 N N   . ALA A 1 360 ? 34.341  41.038 334.438 1.00 63.86  ? 361 ALA A N   1 
ATOM   2720 C CA  . ALA A 1 360 ? 33.750  42.099 335.245 1.00 71.55  ? 361 ALA A CA  1 
ATOM   2721 C C   . ALA A 1 360 ? 34.692  42.505 336.368 1.00 63.13  ? 361 ALA A C   1 
ATOM   2722 O O   . ALA A 1 360 ? 34.880  43.697 336.635 1.00 69.52  ? 361 ALA A O   1 
ATOM   2723 C CB  . ALA A 1 360 ? 32.403  41.646 335.807 1.00 68.29  ? 361 ALA A CB  1 
ATOM   2724 N N   . GLY A 1 361 ? 35.318  41.521 337.015 1.00 63.22  ? 362 GLY A N   1 
ATOM   2725 C CA  . GLY A 1 361 ? 36.248  41.794 338.093 1.00 66.24  ? 362 GLY A CA  1 
ATOM   2726 C C   . GLY A 1 361 ? 37.504  42.520 337.664 1.00 74.24  ? 362 GLY A C   1 
ATOM   2727 O O   . GLY A 1 361 ? 38.196  43.089 338.513 1.00 63.48  ? 362 GLY A O   1 
ATOM   2728 N N   . VAL A 1 362 ? 37.826  42.510 336.371 1.00 67.83  ? 363 VAL A N   1 
ATOM   2729 C CA  . VAL A 1 362 ? 38.999  43.251 335.923 1.00 58.83  ? 363 VAL A CA  1 
ATOM   2730 C C   . VAL A 1 362 ? 38.701  44.743 335.877 1.00 63.11  ? 363 VAL A C   1 
ATOM   2731 O O   . VAL A 1 362 ? 39.546  45.565 336.248 1.00 72.76  ? 363 VAL A O   1 
ATOM   2732 C CB  . VAL A 1 362 ? 39.488  42.719 334.564 1.00 63.88  ? 363 VAL A CB  1 
ATOM   2733 C CG1 . VAL A 1 362 ? 40.427  43.717 333.912 1.00 61.94  ? 363 VAL A CG1 1 
ATOM   2734 C CG2 . VAL A 1 362 ? 40.191  41.385 334.748 1.00 56.27  ? 363 VAL A CG2 1 
ATOM   2735 N N   . ARG A 1 363 ? 37.498  45.120 335.436 1.00 66.00  ? 364 ARG A N   1 
ATOM   2736 C CA  . ARG A 1 363 ? 37.124  46.529 335.448 1.00 63.30  ? 364 ARG A CA  1 
ATOM   2737 C C   . ARG A 1 363 ? 36.939  47.058 336.864 1.00 70.41  ? 364 ARG A C   1 
ATOM   2738 O O   . ARG A 1 363 ? 37.013  48.275 337.067 1.00 65.59  ? 364 ARG A O   1 
ATOM   2739 C CB  . ARG A 1 363 ? 35.840  46.758 334.647 1.00 57.45  ? 364 ARG A CB  1 
ATOM   2740 C CG  . ARG A 1 363 ? 35.796  46.077 333.291 1.00 68.87  ? 364 ARG A CG  1 
ATOM   2741 C CD  . ARG A 1 363 ? 37.022  46.405 332.444 1.00 83.26  ? 364 ARG A CD  1 
ATOM   2742 N NE  . ARG A 1 363 ? 37.209  47.839 332.234 1.00 92.49  ? 364 ARG A NE  1 
ATOM   2743 C CZ  . ARG A 1 363 ? 36.959  48.470 331.088 1.00 102.51 ? 364 ARG A CZ  1 
ATOM   2744 N NH1 . ARG A 1 363 ? 36.505  47.795 330.036 1.00 84.33  ? 364 ARG A NH1 1 
ATOM   2745 N NH2 . ARG A 1 363 ? 37.167  49.778 330.992 1.00 70.56  ? 364 ARG A NH2 1 
ATOM   2746 N N   . VAL A 1 364 ? 36.704  46.165 337.820 1.00 65.37  ? 365 VAL A N   1 
ATOM   2747 C CA  . VAL A 1 364 ? 36.512  46.563 339.209 1.00 76.17  ? 365 VAL A CA  1 
ATOM   2748 C C   . VAL A 1 364 ? 37.847  46.716 339.929 1.00 73.34  ? 365 VAL A C   1 
ATOM   2749 O O   . VAL A 1 364 ? 37.977  47.520 340.853 1.00 78.19  ? 365 VAL A O   1 
ATOM   2750 C CB  . VAL A 1 364 ? 35.642  45.547 339.972 1.00 75.57  ? 365 VAL A CB  1 
ATOM   2751 C CG1 . VAL A 1 364 ? 36.417  44.260 340.213 1.00 78.46  ? 365 VAL A CG1 1 
ATOM   2752 C CG2 . VAL A 1 364 ? 35.161  46.141 341.287 1.00 78.00  ? 365 VAL A CG2 1 
ATOM   2753 N N   . GLY A 1 365 ? 38.838  45.941 339.500 1.00 65.71  ? 366 GLY A N   1 
ATOM   2754 C CA  . GLY A 1 365 ? 40.158  45.989 340.099 1.00 53.19  ? 366 GLY A CA  1 
ATOM   2755 C C   . GLY A 1 365 ? 41.034  47.065 339.488 1.00 58.86  ? 366 GLY A C   1 
ATOM   2756 O O   . GLY A 1 365 ? 41.783  47.742 340.191 1.00 82.50  ? 366 GLY A O   1 
ATOM   2757 N N   . VAL A 1 366 ? 40.955  47.234 338.189 1.00 63.04  ? 367 VAL A N   1 
ATOM   2758 C CA  . VAL A 1 366 ? 41.749  48.250 337.557 1.00 65.92  ? 367 VAL A CA  1 
ATOM   2759 C C   . VAL A 1 366 ? 40.815  49.267 336.963 1.00 69.75  ? 367 VAL A C   1 
ATOM   2760 O O   . VAL A 1 366 ? 40.557  49.338 335.799 1.00 77.38  ? 367 VAL A O   1 
ATOM   2761 C CB  . VAL A 1 366 ? 42.850  47.685 336.642 1.00 59.00  ? 367 VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 366 ? 42.647  46.241 336.305 1.00 58.45  ? 367 VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 366 ? 43.101  48.522 335.431 1.00 52.59  ? 367 VAL A CG2 1 
ATOM   2764 N N   . PRO A 1 367 ? 40.292  50.100 337.919 1.00 68.01  ? 368 PRO A N   1 
ATOM   2765 C CA  . PRO A 1 367 ? 39.320  51.084 337.450 1.00 65.78  ? 368 PRO A CA  1 
ATOM   2766 C C   . PRO A 1 367 ? 39.409  51.787 336.104 1.00 78.55  ? 368 PRO A C   1 
ATOM   2767 O O   . PRO A 1 367 ? 38.400  52.406 335.820 1.00 109.81 ? 368 PRO A O   1 
ATOM   2768 C CB  . PRO A 1 367 ? 39.345  52.102 338.537 1.00 87.02  ? 368 PRO A CB  1 
ATOM   2769 C CG  . PRO A 1 367 ? 39.391  51.283 339.740 1.00 68.94  ? 368 PRO A CG  1 
ATOM   2770 C CD  . PRO A 1 367 ? 40.442  50.305 339.431 1.00 72.93  ? 368 PRO A CD  1 
ATOM   2771 N N   . GLN A 1 368 ? 40.513  51.731 335.344 1.00 61.01  ? 369 GLN A N   1 
ATOM   2772 C CA  . GLN A 1 368 ? 40.696  52.346 333.978 1.00 92.28  ? 369 GLN A CA  1 
ATOM   2773 C C   . GLN A 1 368 ? 41.902  51.729 333.262 1.00 86.60  ? 369 GLN A C   1 
ATOM   2774 O O   . GLN A 1 368 ? 42.719  51.158 333.922 1.00 91.63  ? 369 GLN A O   1 
ATOM   2775 C CB  . GLN A 1 368 ? 40.856  53.839 334.034 1.00 114.69 ? 369 GLN A CB  1 
ATOM   2776 C CG  . GLN A 1 368 ? 39.700  54.498 334.711 1.00 118.13 ? 369 GLN A CG  1 
ATOM   2777 C CD  . GLN A 1 368 ? 39.903  54.592 336.190 1.00 123.34 ? 369 GLN A CD  1 
ATOM   2778 O OE1 . GLN A 1 368 ? 40.809  53.979 336.732 1.00 123.99 ? 369 GLN A OE1 1 
ATOM   2779 N NE2 . GLN A 1 368 ? 39.032  55.324 336.862 1.00 104.29 ? 369 GLN A NE2 1 
ATOM   2780 N N   . VAL A 1 369 ? 42.086  51.893 331.953 1.00 81.19  ? 370 VAL A N   1 
ATOM   2781 C CA  . VAL A 1 369 ? 41.283  52.690 331.034 1.00 86.25  ? 370 VAL A CA  1 
ATOM   2782 C C   . VAL A 1 369 ? 39.887  52.224 330.662 1.00 80.21  ? 370 VAL A C   1 
ATOM   2783 O O   . VAL A 1 369 ? 39.511  51.067 330.849 1.00 80.11  ? 370 VAL A O   1 
ATOM   2784 C CB  . VAL A 1 369 ? 42.066  52.946 329.725 1.00 75.31  ? 370 VAL A CB  1 
ATOM   2785 C CG1 . VAL A 1 369 ? 41.412  54.057 328.917 1.00 62.51  ? 370 VAL A CG1 1 
ATOM   2786 C CG2 . VAL A 1 369 ? 43.511  53.301 330.038 1.00 73.09  ? 370 VAL A CG2 1 
ATOM   2787 N N   . SER A 1 370 ? 39.132  53.178 330.129 1.00 88.44  ? 371 SER A N   1 
ATOM   2788 C CA  . SER A 1 370 ? 37.761  52.966 329.715 1.00 67.73  ? 371 SER A CA  1 
ATOM   2789 C C   . SER A 1 370 ? 37.612  51.912 328.626 1.00 78.72  ? 371 SER A C   1 
ATOM   2790 O O   . SER A 1 370 ? 36.668  51.124 328.685 1.00 65.50  ? 371 SER A O   1 
ATOM   2791 C CB  . SER A 1 370 ? 37.137  54.285 329.250 1.00 79.87  ? 371 SER A CB  1 
ATOM   2792 O OG  . SER A 1 370 ? 37.142  55.247 330.291 1.00 83.46  ? 371 SER A OG  1 
ATOM   2793 N N   . ASP A 1 371 ? 38.498  51.860 327.629 1.00 81.48  ? 372 ASP A N   1 
ATOM   2794 C CA  . ASP A 1 371 ? 38.250  50.803 326.632 1.00 77.19  ? 372 ASP A CA  1 
ATOM   2795 C C   . ASP A 1 371 ? 39.300  49.704 326.336 1.00 64.34  ? 372 ASP A C   1 
ATOM   2796 O O   . ASP A 1 371 ? 39.024  48.520 326.524 1.00 58.95  ? 372 ASP A O   1 
ATOM   2797 C CB  . ASP A 1 371 ? 37.823  51.443 325.304 1.00 76.76  ? 372 ASP A CB  1 
ATOM   2798 C CG  . ASP A 1 371 ? 36.531  52.228 325.422 1.00 94.70  ? 372 ASP A CG  1 
ATOM   2799 O OD1 . ASP A 1 371 ? 35.866  52.130 326.474 1.00 110.87 ? 372 ASP A OD1 1 
ATOM   2800 O OD2 . ASP A 1 371 ? 36.180  52.943 324.459 1.00 108.21 ? 372 ASP A OD2 1 
ATOM   2801 N N   . LEU A 1 372 ? 40.484  50.094 325.861 1.00 58.12  ? 373 LEU A N   1 
ATOM   2802 C CA  . LEU A 1 372 ? 41.534  49.144 325.485 1.00 82.65  ? 373 LEU A CA  1 
ATOM   2803 C C   . LEU A 1 372 ? 42.461  48.689 326.611 1.00 67.78  ? 373 LEU A C   1 
ATOM   2804 O O   . LEU A 1 372 ? 43.006  47.586 326.562 1.00 68.58  ? 373 LEU A O   1 
ATOM   2805 C CB  . LEU A 1 372 ? 42.367  49.711 324.331 1.00 60.80  ? 373 LEU A CB  1 
ATOM   2806 C CG  . LEU A 1 372 ? 43.511  48.829 323.824 1.00 76.42  ? 373 LEU A CG  1 
ATOM   2807 C CD1 . LEU A 1 372 ? 42.990  47.466 323.396 1.00 63.26  ? 373 LEU A CD1 1 
ATOM   2808 C CD2 . LEU A 1 372 ? 44.248  49.510 322.681 1.00 75.91  ? 373 LEU A CD2 1 
ATOM   2809 N N   . ALA A 1 373 ? 42.706  49.491 327.620 1.00 83.22  ? 374 ALA A N   1 
ATOM   2810 C CA  . ALA A 1 373 ? 43.614  49.050 328.663 1.00 66.85  ? 374 ALA A CA  1 
ATOM   2811 C C   . ALA A 1 373 ? 43.078  47.823 329.329 1.00 55.60  ? 374 ALA A C   1 
ATOM   2812 O O   . ALA A 1 373 ? 43.819  46.966 329.711 1.00 56.45  ? 374 ALA A O   1 
ATOM   2813 C CB  . ALA A 1 373 ? 43.854  50.137 329.663 1.00 61.56  ? 374 ALA A CB  1 
ATOM   2814 N N   . ALA A 1 374 ? 41.774  47.750 329.485 1.00 54.16  ? 375 ALA A N   1 
ATOM   2815 C CA  . ALA A 1 374 ? 41.215  46.551 330.088 1.00 51.89  ? 375 ALA A CA  1 
ATOM   2816 C C   . ALA A 1 374 ? 41.641  45.317 329.292 1.00 64.08  ? 375 ALA A C   1 
ATOM   2817 O O   . ALA A 1 374 ? 41.917  44.264 329.868 1.00 69.06  ? 375 ALA A O   1 
ATOM   2818 C CB  . ALA A 1 374 ? 39.699  46.646 330.155 1.00 50.66  ? 375 ALA A CB  1 
ATOM   2819 N N   . GLU A 1 375 ? 41.689  45.450 327.969 1.00 63.78  ? 376 GLU A N   1 
ATOM   2820 C CA  . GLU A 1 375 ? 42.068  44.337 327.098 1.00 60.81  ? 376 GLU A CA  1 
ATOM   2821 C C   . GLU A 1 375 ? 43.491  43.828 327.347 1.00 59.02  ? 376 GLU A C   1 
ATOM   2822 O O   . GLU A 1 375 ? 43.720  42.619 327.371 1.00 54.95  ? 376 GLU A O   1 
ATOM   2823 C CB  . GLU A 1 375 ? 41.905  44.732 325.628 1.00 81.08  ? 376 GLU A CB  1 
ATOM   2824 C CG  . GLU A 1 375 ? 40.485  45.111 325.241 1.00 79.26  ? 376 GLU A CG  1 
ATOM   2825 C CD  . GLU A 1 375 ? 39.500  43.979 325.458 1.00 103.02 ? 376 GLU A CD  1 
ATOM   2826 O OE1 . GLU A 1 375 ? 38.299  44.171 325.173 1.00 118.11 ? 376 GLU A OE1 1 
ATOM   2827 O OE2 . GLU A 1 375 ? 39.927  42.897 325.913 1.00 95.80  ? 376 GLU A OE2 1 
ATOM   2828 N N   . ALA A 1 376 ? 44.441  44.739 327.539 1.00 56.56  ? 377 ALA A N   1 
ATOM   2829 C CA  . ALA A 1 376 ? 45.817  44.337 327.808 1.00 62.16  ? 377 ALA A CA  1 
ATOM   2830 C C   . ALA A 1 376 ? 45.917  43.541 329.107 1.00 65.03  ? 377 ALA A C   1 
ATOM   2831 O O   . ALA A 1 376 ? 46.688  42.575 329.188 1.00 57.48  ? 377 ALA A O   1 
ATOM   2832 C CB  . ALA A 1 376 ? 46.725  45.565 327.845 1.00 56.18  ? 377 ALA A CB  1 
ATOM   2833 N N   . VAL A 1 377 ? 45.134  43.913 330.130 1.00 50.52  ? 378 VAL A N   1 
ATOM   2834 C CA  . VAL A 1 377 ? 45.169  43.165 331.388 1.00 62.48  ? 378 VAL A CA  1 
ATOM   2835 C C   . VAL A 1 377 ? 44.658  41.745 331.173 1.00 57.25  ? 378 VAL A C   1 
ATOM   2836 O O   . VAL A 1 377 ? 45.308  40.765 331.562 1.00 55.63  ? 378 VAL A O   1 
ATOM   2837 C CB  . VAL A 1 377 ? 44.369  43.886 332.493 1.00 63.62  ? 378 VAL A CB  1 
ATOM   2838 C CG1 . VAL A 1 377 ? 44.466  43.107 333.801 1.00 48.92  ? 378 VAL A CG1 1 
ATOM   2839 C CG2 . VAL A 1 377 ? 44.858  45.323 332.702 1.00 40.97  ? 378 VAL A CG2 1 
ATOM   2840 N N   . VAL A 1 378 ? 43.489  41.609 330.540 1.00 56.59  ? 379 VAL A N   1 
ATOM   2841 C CA  . VAL A 1 378 ? 42.913  40.277 330.385 1.00 64.76  ? 379 VAL A CA  1 
ATOM   2842 C C   . VAL A 1 378 ? 43.803  39.407 329.505 1.00 71.52  ? 379 VAL A C   1 
ATOM   2843 O O   . VAL A 1 378 ? 43.867  38.185 329.691 1.00 66.75  ? 379 VAL A O   1 
ATOM   2844 C CB  . VAL A 1 378 ? 41.473  40.366 329.839 1.00 64.06  ? 379 VAL A CB  1 
ATOM   2845 C CG1 . VAL A 1 378 ? 40.581  41.093 330.828 1.00 53.51  ? 379 VAL A CG1 1 
ATOM   2846 C CG2 . VAL A 1 378 ? 41.444  41.051 328.503 1.00 84.58  ? 379 VAL A CG2 1 
ATOM   2847 N N   . LEU A 1 379 ? 44.526  40.014 328.559 1.00 64.85  ? 380 LEU A N   1 
ATOM   2848 C CA  . LEU A 1 379 ? 45.466  39.250 327.745 1.00 66.90  ? 380 LEU A CA  1 
ATOM   2849 C C   . LEU A 1 379 ? 46.597  38.690 328.593 1.00 61.99  ? 380 LEU A C   1 
ATOM   2850 O O   . LEU A 1 379 ? 46.941  37.507 328.489 1.00 57.22  ? 380 LEU A O   1 
ATOM   2851 C CB  . LEU A 1 379 ? 46.036  40.120 326.624 1.00 68.32  ? 380 LEU A CB  1 
ATOM   2852 C CG  . LEU A 1 379 ? 47.360  39.598 326.053 1.00 64.89  ? 380 LEU A CG  1 
ATOM   2853 C CD1 . LEU A 1 379 ? 47.121  38.477 325.040 1.00 68.42  ? 380 LEU A CD1 1 
ATOM   2854 C CD2 . LEU A 1 379 ? 48.170  40.731 325.445 1.00 62.27  ? 380 LEU A CD2 1 
ATOM   2855 N N   . HIS A 1 380 ? 47.207  39.535 329.426 1.00 60.03  ? 381 HIS A N   1 
ATOM   2856 C CA  . HIS A 1 380 ? 48.361  39.086 330.192 1.00 65.58  ? 381 HIS A CA  1 
ATOM   2857 C C   . HIS A 1 380 ? 47.974  38.050 331.242 1.00 62.94  ? 381 HIS A C   1 
ATOM   2858 O O   . HIS A 1 380 ? 48.757  37.135 331.522 1.00 53.76  ? 381 HIS A O   1 
ATOM   2859 C CB  . HIS A 1 380 ? 49.055  40.284 330.841 1.00 60.35  ? 381 HIS A CB  1 
ATOM   2860 C CG  . HIS A 1 380 ? 50.291  39.925 331.607 1.00 91.95  ? 381 HIS A CG  1 
ATOM   2861 N ND1 . HIS A 1 380 ? 51.550  39.954 331.046 1.00 87.89  ? 381 HIS A ND1 1 
ATOM   2862 C CD2 . HIS A 1 380 ? 50.461  39.529 332.892 1.00 86.52  ? 381 HIS A CD2 1 
ATOM   2863 C CE1 . HIS A 1 380 ? 52.441  39.588 331.951 1.00 92.77  ? 381 HIS A CE1 1 
ATOM   2864 N NE2 . HIS A 1 380 ? 51.807  39.324 333.080 1.00 79.74  ? 381 HIS A NE2 1 
ATOM   2865 N N   . TYR A 1 381 ? 46.775  38.151 331.810 1.00 54.41  ? 382 TYR A N   1 
ATOM   2866 C CA  . TYR A 1 381 ? 46.410  37.316 332.945 1.00 61.03  ? 382 TYR A CA  1 
ATOM   2867 C C   . TYR A 1 381 ? 45.531  36.130 332.577 1.00 64.97  ? 382 TYR A C   1 
ATOM   2868 O O   . TYR A 1 381 ? 45.124  35.378 333.469 1.00 57.77  ? 382 TYR A O   1 
ATOM   2869 C CB  . TYR A 1 381 ? 45.735  38.171 334.019 1.00 66.98  ? 382 TYR A CB  1 
ATOM   2870 C CG  . TYR A 1 381 ? 46.733  39.007 334.793 1.00 59.28  ? 382 TYR A CG  1 
ATOM   2871 C CD1 . TYR A 1 381 ? 47.116  40.266 334.339 1.00 60.95  ? 382 TYR A CD1 1 
ATOM   2872 C CD2 . TYR A 1 381 ? 47.306  38.530 335.962 1.00 59.89  ? 382 TYR A CD2 1 
ATOM   2873 C CE1 . TYR A 1 381 ? 48.033  41.029 335.038 1.00 64.55  ? 382 TYR A CE1 1 
ATOM   2874 C CE2 . TYR A 1 381 ? 48.223  39.287 336.669 1.00 50.91  ? 382 TYR A CE2 1 
ATOM   2875 C CZ  . TYR A 1 381 ? 48.583  40.532 336.205 1.00 59.59  ? 382 TYR A CZ  1 
ATOM   2876 O OH  . TYR A 1 381 ? 49.497  41.281 336.906 1.00 51.43  ? 382 TYR A OH  1 
ATOM   2877 N N   . THR A 1 382 ? 45.252  35.921 331.294 1.00 66.52  ? 383 THR A N   1 
ATOM   2878 C CA  . THR A 1 382 ? 44.530  34.734 330.862 1.00 46.11  ? 383 THR A CA  1 
ATOM   2879 C C   . THR A 1 382 ? 45.521  33.639 330.504 1.00 51.03  ? 383 THR A C   1 
ATOM   2880 O O   . THR A 1 382 ? 46.521  33.897 329.827 1.00 67.48  ? 383 THR A O   1 
ATOM   2881 C CB  . THR A 1 382 ? 43.633  35.037 329.666 1.00 55.93  ? 383 THR A CB  1 
ATOM   2882 O OG1 . THR A 1 382 ? 42.635  35.993 330.043 1.00 56.06  ? 383 THR A OG1 1 
ATOM   2883 C CG2 . THR A 1 382 ? 42.958  33.768 329.185 1.00 56.57  ? 383 THR A CG2 1 
ATOM   2884 N N   . ASP A 1 383 ? 45.260  32.428 330.986 1.00 64.09  ? 384 ASP A N   1 
ATOM   2885 C CA  . ASP A 1 383 ? 45.931  31.234 330.487 1.00 71.62  ? 384 ASP A CA  1 
ATOM   2886 C C   . ASP A 1 383 ? 45.141  30.751 329.278 1.00 61.66  ? 384 ASP A C   1 
ATOM   2887 O O   . ASP A 1 383 ? 44.054  30.188 329.424 1.00 56.94  ? 384 ASP A O   1 
ATOM   2888 C CB  . ASP A 1 383 ? 46.017  30.156 331.562 1.00 65.78  ? 384 ASP A CB  1 
ATOM   2889 C CG  . ASP A 1 383 ? 46.913  28.996 331.156 1.00 74.72  ? 384 ASP A CG  1 
ATOM   2890 O OD1 . ASP A 1 383 ? 47.718  28.538 331.994 1.00 83.77  ? 384 ASP A OD1 1 
ATOM   2891 O OD2 . ASP A 1 383 ? 46.815  28.540 329.996 1.00 78.46  ? 384 ASP A OD2 1 
ATOM   2892 N N   . TRP A 1 384 ? 45.679  30.977 328.085 1.00 62.32  ? 385 TRP A N   1 
ATOM   2893 C CA  . TRP A 1 384 ? 44.904  30.707 326.882 1.00 71.99  ? 385 TRP A CA  1 
ATOM   2894 C C   . TRP A 1 384 ? 44.805  29.225 326.553 1.00 66.88  ? 385 TRP A C   1 
ATOM   2895 O O   . TRP A 1 384 ? 44.060  28.861 325.638 1.00 70.09  ? 385 TRP A O   1 
ATOM   2896 C CB  . TRP A 1 384 ? 45.488  31.499 325.721 1.00 58.90  ? 385 TRP A CB  1 
ATOM   2897 C CG  . TRP A 1 384 ? 45.354  32.958 325.983 1.00 60.22  ? 385 TRP A CG  1 
ATOM   2898 C CD1 . TRP A 1 384 ? 46.327  33.809 326.420 1.00 55.23  ? 385 TRP A CD1 1 
ATOM   2899 C CD2 . TRP A 1 384 ? 44.154  33.734 325.883 1.00 46.07  ? 385 TRP A CD2 1 
ATOM   2900 N NE1 . TRP A 1 384 ? 45.814  35.077 326.569 1.00 55.91  ? 385 TRP A NE1 1 
ATOM   2901 C CE2 . TRP A 1 384 ? 44.481  35.056 326.248 1.00 54.00  ? 385 TRP A CE2 1 
ATOM   2902 C CE3 . TRP A 1 384 ? 42.840  33.443 325.509 1.00 45.38  ? 385 TRP A CE3 1 
ATOM   2903 C CZ2 . TRP A 1 384 ? 43.540  36.087 326.244 1.00 46.00  ? 385 TRP A CZ2 1 
ATOM   2904 C CZ3 . TRP A 1 384 ? 41.906  34.468 325.507 1.00 54.95  ? 385 TRP A CZ3 1 
ATOM   2905 C CH2 . TRP A 1 384 ? 42.262  35.773 325.872 1.00 48.44  ? 385 TRP A CH2 1 
ATOM   2906 N N   . LEU A 1 385 ? 45.514  28.367 327.287 1.00 62.28  ? 386 LEU A N   1 
ATOM   2907 C CA  . LEU A 1 385 ? 45.230  26.940 327.256 1.00 67.08  ? 386 LEU A CA  1 
ATOM   2908 C C   . LEU A 1 385 ? 44.078  26.556 328.178 1.00 75.63  ? 386 LEU A C   1 
ATOM   2909 O O   . LEU A 1 385 ? 43.449  25.513 327.960 1.00 67.55  ? 386 LEU A O   1 
ATOM   2910 C CB  . LEU A 1 385 ? 46.485  26.146 327.632 1.00 63.70  ? 386 LEU A CB  1 
ATOM   2911 C CG  . LEU A 1 385 ? 47.614  26.207 326.598 1.00 82.53  ? 386 LEU A CG  1 
ATOM   2912 C CD1 . LEU A 1 385 ? 48.907  25.633 327.154 1.00 56.47  ? 386 LEU A CD1 1 
ATOM   2913 C CD2 . LEU A 1 385 ? 47.219  25.496 325.306 1.00 63.40  ? 386 LEU A CD2 1 
ATOM   2914 N N   . HIS A 1 386 ? 43.790  27.371 329.198 1.00 77.42  ? 387 HIS A N   1 
ATOM   2915 C CA  . HIS A 1 386 ? 42.704  27.111 330.149 1.00 70.48  ? 387 HIS A CA  1 
ATOM   2916 C C   . HIS A 1 386 ? 41.941  28.403 330.415 1.00 69.08  ? 387 HIS A C   1 
ATOM   2917 O O   . HIS A 1 386 ? 41.875  28.881 331.551 1.00 63.21  ? 387 HIS A O   1 
ATOM   2918 C CB  . HIS A 1 386 ? 43.251  26.531 331.453 1.00 51.00  ? 387 HIS A CB  1 
ATOM   2919 C CG  . HIS A 1 386 ? 44.221  25.411 331.260 1.00 65.44  ? 387 HIS A CG  1 
ATOM   2920 N ND1 . HIS A 1 386 ? 43.828  24.092 331.182 1.00 56.78  ? 387 HIS A ND1 1 
ATOM   2921 C CD2 . HIS A 1 386 ? 45.570  25.410 331.137 1.00 74.26  ? 387 HIS A CD2 1 
ATOM   2922 C CE1 . HIS A 1 386 ? 44.893  23.328 331.012 1.00 72.16  ? 387 HIS A CE1 1 
ATOM   2923 N NE2 . HIS A 1 386 ? 45.963  24.103 330.981 1.00 68.23  ? 387 HIS A NE2 1 
ATOM   2924 N N   . PRO A 1 387 ? 41.342  29.000 329.379 1.00 72.69  ? 388 PRO A N   1 
ATOM   2925 C CA  . PRO A 1 387 ? 40.766  30.344 329.541 1.00 64.05  ? 388 PRO A CA  1 
ATOM   2926 C C   . PRO A 1 387 ? 39.548  30.397 330.441 1.00 67.97  ? 388 PRO A C   1 
ATOM   2927 O O   . PRO A 1 387 ? 39.157  31.503 330.833 1.00 55.90  ? 388 PRO A O   1 
ATOM   2928 C CB  . PRO A 1 387 ? 40.397  30.741 328.106 1.00 62.92  ? 388 PRO A CB  1 
ATOM   2929 C CG  . PRO A 1 387 ? 40.106  29.445 327.443 1.00 55.55  ? 388 PRO A CG  1 
ATOM   2930 C CD  . PRO A 1 387 ? 41.097  28.463 328.027 1.00 62.83  ? 388 PRO A CD  1 
ATOM   2931 N N   . GLU A 1 388 ? 38.933  29.260 330.777 1.00 66.77  ? 389 GLU A N   1 
ATOM   2932 C CA  . GLU A 1 388 ? 37.667  29.254 331.503 1.00 66.37  ? 389 GLU A CA  1 
ATOM   2933 C C   . GLU A 1 388 ? 37.740  28.512 332.834 1.00 70.44  ? 389 GLU A C   1 
ATOM   2934 O O   . GLU A 1 388 ? 36.707  28.346 333.495 1.00 72.65  ? 389 GLU A O   1 
ATOM   2935 C CB  . GLU A 1 388 ? 36.556  28.676 330.619 1.00 70.20  ? 389 GLU A CB  1 
ATOM   2936 C CG  . GLU A 1 388 ? 36.326  29.478 329.331 1.00 76.21  ? 389 GLU A CG  1 
ATOM   2937 C CD  . GLU A 1 388 ? 34.874  29.883 329.125 1.00 91.95  ? 389 GLU A CD  1 
ATOM   2938 O OE1 . GLU A 1 388 ? 34.630  30.896 328.432 1.00 95.61  ? 389 GLU A OE1 1 
ATOM   2939 O OE2 . GLU A 1 388 ? 33.975  29.191 329.649 1.00 97.16  ? 389 GLU A OE2 1 
ATOM   2940 N N   . ASP A 1 389 ? 38.922  28.083 333.247 1.00 52.37  ? 390 ASP A N   1 
ATOM   2941 C CA  . ASP A 1 389 ? 39.089  27.375 334.512 1.00 76.71  ? 390 ASP A CA  1 
ATOM   2942 C C   . ASP A 1 389 ? 38.781  28.305 335.682 1.00 60.09  ? 390 ASP A C   1 
ATOM   2943 O O   . ASP A 1 389 ? 39.496  29.295 335.876 1.00 67.51  ? 390 ASP A O   1 
ATOM   2944 C CB  . ASP A 1 389 ? 40.517  26.839 334.596 1.00 72.58  ? 390 ASP A CB  1 
ATOM   2945 C CG  . ASP A 1 389 ? 40.778  26.056 335.862 1.00 74.25  ? 390 ASP A CG  1 
ATOM   2946 O OD1 . ASP A 1 389 ? 39.818  25.775 336.606 1.00 90.24  ? 390 ASP A OD1 1 
ATOM   2947 O OD2 . ASP A 1 389 ? 41.955  25.721 336.113 1.00 78.84  ? 390 ASP A OD2 1 
ATOM   2948 N N   . PRO A 1 390 ? 37.742  28.035 336.478 1.00 75.71  ? 391 PRO A N   1 
ATOM   2949 C CA  . PRO A 1 390 ? 37.391  28.980 337.557 1.00 81.18  ? 391 PRO A CA  1 
ATOM   2950 C C   . PRO A 1 390 ? 38.482  29.156 338.602 1.00 69.91  ? 391 PRO A C   1 
ATOM   2951 O O   . PRO A 1 390 ? 38.732  30.287 339.034 1.00 63.76  ? 391 PRO A O   1 
ATOM   2952 C CB  . PRO A 1 390 ? 36.117  28.364 338.156 1.00 65.40  ? 391 PRO A CB  1 
ATOM   2953 C CG  . PRO A 1 390 ? 35.552  27.522 337.052 1.00 85.87  ? 391 PRO A CG  1 
ATOM   2954 C CD  . PRO A 1 390 ? 36.753  26.952 336.354 1.00 80.40  ? 391 PRO A CD  1 
ATOM   2955 N N   . ALA A 1 391 ? 39.143  28.072 339.020 1.00 64.78  ? 392 ALA A N   1 
ATOM   2956 C CA  . ALA A 1 391 ? 40.214  28.198 340.006 1.00 61.98  ? 392 ALA A CA  1 
ATOM   2957 C C   . ALA A 1 391 ? 41.337  29.091 339.493 1.00 73.18  ? 392 ALA A C   1 
ATOM   2958 O O   . ALA A 1 391 ? 41.878  29.911 340.242 1.00 68.62  ? 392 ALA A O   1 
ATOM   2959 C CB  . ALA A 1 391 ? 40.756  26.820 340.376 1.00 59.83  ? 392 ALA A CB  1 
ATOM   2960 N N   . ARG A 1 392 ? 41.699  28.945 338.214 1.00 77.03  ? 393 ARG A N   1 
ATOM   2961 C CA  . ARG A 1 392 ? 42.728  29.795 337.622 1.00 56.94  ? 393 ARG A CA  1 
ATOM   2962 C C   . ARG A 1 392 ? 42.273  31.243 337.503 1.00 61.23  ? 393 ARG A C   1 
ATOM   2963 O O   . ARG A 1 392 ? 43.099  32.157 337.606 1.00 62.36  ? 393 ARG A O   1 
ATOM   2964 C CB  . ARG A 1 392 ? 43.119  29.270 336.243 1.00 65.80  ? 393 ARG A CB  1 
ATOM   2965 C CG  . ARG A 1 392 ? 44.170  28.179 336.250 1.00 60.75  ? 393 ARG A CG  1 
ATOM   2966 C CD  . ARG A 1 392 ? 44.539  27.819 334.823 1.00 71.23  ? 393 ARG A CD  1 
ATOM   2967 N NE  . ARG A 1 392 ? 45.581  26.802 334.742 1.00 75.12  ? 393 ARG A NE  1 
ATOM   2968 C CZ  . ARG A 1 392 ? 45.339  25.498 334.667 1.00 61.33  ? 393 ARG A CZ  1 
ATOM   2969 N NH1 . ARG A 1 392 ? 44.088  25.058 334.668 1.00 60.45  ? 393 ARG A NH1 1 
ATOM   2970 N NH2 . ARG A 1 392 ? 46.344  24.636 334.589 1.00 64.53  ? 393 ARG A NH2 1 
ATOM   2971 N N   . LEU A 1 393 ? 40.979  31.475 337.266 1.00 56.47  ? 394 LEU A N   1 
ATOM   2972 C CA  . LEU A 1 393 ? 40.485  32.843 337.149 1.00 60.51  ? 394 LEU A CA  1 
ATOM   2973 C C   . LEU A 1 393 ? 40.409  33.531 338.505 1.00 66.57  ? 394 LEU A C   1 
ATOM   2974 O O   . LEU A 1 393 ? 40.705  34.727 338.610 1.00 59.00  ? 394 LEU A O   1 
ATOM   2975 C CB  . LEU A 1 393 ? 39.111  32.857 336.493 1.00 60.17  ? 394 LEU A CB  1 
ATOM   2976 C CG  . LEU A 1 393 ? 39.010  32.321 335.072 1.00 74.88  ? 394 LEU A CG  1 
ATOM   2977 C CD1 . LEU A 1 393 ? 37.548  32.051 334.790 1.00 61.95  ? 394 LEU A CD1 1 
ATOM   2978 C CD2 . LEU A 1 393 ? 39.609  33.305 334.072 1.00 54.45  ? 394 LEU A CD2 1 
ATOM   2979 N N   . ARG A 1 394 ? 39.979  32.807 339.540 1.00 61.09  ? 395 ARG A N   1 
ATOM   2980 C CA  . ARG A 1 394 ? 40.032  33.357 340.890 1.00 68.60  ? 395 ARG A CA  1 
ATOM   2981 C C   . ARG A 1 394 ? 41.456  33.769 341.236 1.00 60.10  ? 395 ARG A C   1 
ATOM   2982 O O   . ARG A 1 394 ? 41.707  34.918 341.611 1.00 49.33  ? 395 ARG A O   1 
ATOM   2983 C CB  . ARG A 1 394 ? 39.494  32.339 341.900 1.00 64.06  ? 395 ARG A CB  1 
ATOM   2984 C CG  . ARG A 1 394 ? 39.579  32.783 343.360 1.00 65.31  ? 395 ARG A CG  1 
ATOM   2985 C CD  . ARG A 1 394 ? 39.287  31.624 344.302 1.00 56.85  ? 395 ARG A CD  1 
ATOM   2986 N NE  . ARG A 1 394 ? 40.397  30.676 344.356 1.00 67.32  ? 395 ARG A NE  1 
ATOM   2987 C CZ  . ARG A 1 394 ? 40.268  29.383 344.640 1.00 63.99  ? 395 ARG A CZ  1 
ATOM   2988 N NH1 . ARG A 1 394 ? 39.071  28.868 344.894 1.00 67.59  ? 395 ARG A NH1 1 
ATOM   2989 N NH2 . ARG A 1 394 ? 41.340  28.602 344.667 1.00 61.25  ? 395 ARG A NH2 1 
ATOM   2990 N N   . GLU A 1 395 ? 42.410  32.897 341.051 1.00 57.34  ? 396 GLU A N   1 
ATOM   2991 C CA  . GLU A 1 395 ? 43.770  33.242 341.340 1.00 57.32  ? 396 GLU A CA  1 
ATOM   2992 C C   . GLU A 1 395 ? 44.279  34.357 340.459 1.00 67.02  ? 396 GLU A C   1 
ATOM   2993 O O   . GLU A 1 395 ? 45.093  35.135 340.870 1.00 68.02  ? 396 GLU A O   1 
ATOM   2994 C CB  . GLU A 1 395 ? 44.701  32.044 341.257 1.00 54.10  ? 396 GLU A CB  1 
ATOM   2995 C CG  . GLU A 1 395 ? 44.304  30.870 342.121 1.00 78.16  ? 396 GLU A CG  1 
ATOM   2996 C CD  . GLU A 1 395 ? 44.218  31.173 343.596 1.00 92.87  ? 396 GLU A CD  1 
ATOM   2997 O OE1 . GLU A 1 395 ? 45.240  31.116 344.272 1.00 75.04  ? 396 GLU A OE1 1 
ATOM   2998 O OE2 . GLU A 1 395 ? 43.132  31.436 344.106 1.00 98.94  ? 396 GLU A OE2 1 
ATOM   2999 N N   . ALA A 1 396 ? 43.837  34.405 339.224 1.00 54.56  ? 397 ALA A N   1 
ATOM   3000 C CA  . ALA A 1 396 ? 44.358  35.424 338.318 1.00 61.61  ? 397 ALA A CA  1 
ATOM   3001 C C   . ALA A 1 396 ? 43.850  36.807 338.703 1.00 51.37  ? 397 ALA A C   1 
ATOM   3002 O O   . ALA A 1 396 ? 44.625  37.767 338.753 1.00 55.41  ? 397 ALA A O   1 
ATOM   3003 C CB  . ALA A 1 396 ? 43.991  35.092 336.865 1.00 54.39  ? 397 ALA A CB  1 
ATOM   3004 N N   . LEU A 1 397 ? 42.546  36.931 338.970 1.00 50.85  ? 398 LEU A N   1 
ATOM   3005 C CA  . LEU A 1 397 ? 42.013  38.220 339.399 1.00 54.44  ? 398 LEU A CA  1 
ATOM   3006 C C   . LEU A 1 397 ? 42.638  38.669 340.716 1.00 67.69  ? 398 LEU A C   1 
ATOM   3007 O O   . LEU A 1 397 ? 42.800  39.873 340.950 1.00 52.02  ? 398 LEU A O   1 
ATOM   3008 C CB  . LEU A 1 397 ? 40.493  38.147 339.525 1.00 55.71  ? 398 LEU A CB  1 
ATOM   3009 C CG  . LEU A 1 397 ? 39.811  39.500 339.708 1.00 56.15  ? 398 LEU A CG  1 
ATOM   3010 C CD1 . LEU A 1 397 ? 40.122  40.395 338.516 1.00 53.30  ? 398 LEU A CD1 1 
ATOM   3011 C CD2 . LEU A 1 397 ? 38.316  39.325 339.890 1.00 62.69  ? 398 LEU A CD2 1 
ATOM   3012 N N   . SER A 1 398 ? 43.004  37.722 341.581 1.00 43.76  ? 399 SER A N   1 
ATOM   3013 C CA  . SER A 1 398 ? 43.754  38.080 342.778 1.00 67.79  ? 399 SER A CA  1 
ATOM   3014 C C   . SER A 1 398 ? 45.117  38.658 342.408 1.00 60.82  ? 399 SER A C   1 
ATOM   3015 O O   . SER A 1 398 ? 45.550  39.664 342.980 1.00 63.03  ? 399 SER A O   1 
ATOM   3016 C CB  . SER A 1 398 ? 43.894  36.856 343.685 1.00 56.04  ? 399 SER A CB  1 
ATOM   3017 O OG  . SER A 1 398 ? 44.940  37.017 344.623 1.00 72.16  ? 399 SER A OG  1 
ATOM   3018 N N   . ASP A 1 399 ? 45.793  38.051 341.431 1.00 60.46  ? 400 ASP A N   1 
ATOM   3019 C CA  . ASP A 1 399 ? 47.065  38.591 340.957 1.00 64.10  ? 400 ASP A CA  1 
ATOM   3020 C C   . ASP A 1 399 ? 46.887  39.955 340.300 1.00 58.11  ? 400 ASP A C   1 
ATOM   3021 O O   . ASP A 1 399 ? 47.727  40.843 340.475 1.00 55.46  ? 400 ASP A O   1 
ATOM   3022 C CB  . ASP A 1 399 ? 47.725  37.619 339.979 1.00 59.41  ? 400 ASP A CB  1 
ATOM   3023 C CG  . ASP A 1 399 ? 48.308  36.405 340.674 1.00 78.81  ? 400 ASP A CG  1 
ATOM   3024 O OD1 . ASP A 1 399 ? 48.586  36.495 341.890 1.00 84.37  ? 400 ASP A OD1 1 
ATOM   3025 O OD2 . ASP A 1 399 ? 48.487  35.363 340.007 1.00 75.45  ? 400 ASP A OD2 1 
ATOM   3026 N N   . VAL A 1 400 ? 45.809  40.147 339.538 1.00 48.74  ? 401 VAL A N   1 
ATOM   3027 C CA  . VAL A 1 400 ? 45.582  41.454 338.923 1.00 62.17  ? 401 VAL A CA  1 
ATOM   3028 C C   . VAL A 1 400 ? 45.509  42.533 339.997 1.00 55.30  ? 401 VAL A C   1 
ATOM   3029 O O   . VAL A 1 400 ? 46.210  43.551 339.935 1.00 47.38  ? 401 VAL A O   1 
ATOM   3030 C CB  . VAL A 1 400 ? 44.310  41.440 338.057 1.00 55.58  ? 401 VAL A CB  1 
ATOM   3031 C CG1 . VAL A 1 400 ? 43.941  42.864 337.646 1.00 40.03  ? 401 VAL A CG1 1 
ATOM   3032 C CG2 . VAL A 1 400 ? 44.508  40.562 336.839 1.00 49.42  ? 401 VAL A CG2 1 
ATOM   3033 N N   . VAL A 1 401 ? 44.674  42.317 341.009 1.00 58.34  ? 402 VAL A N   1 
ATOM   3034 C CA  . VAL A 1 401 ? 44.505  43.333 342.038 1.00 58.00  ? 402 VAL A CA  1 
ATOM   3035 C C   . VAL A 1 401 ? 45.789  43.499 342.842 1.00 51.05  ? 402 VAL A C   1 
ATOM   3036 O O   . VAL A 1 401 ? 46.229  44.625 343.107 1.00 44.35  ? 402 VAL A O   1 
ATOM   3037 C CB  . VAL A 1 401 ? 43.301  42.976 342.922 1.00 51.72  ? 402 VAL A CB  1 
ATOM   3038 C CG1 . VAL A 1 401 ? 43.238  43.886 344.136 1.00 46.96  ? 402 VAL A CG1 1 
ATOM   3039 C CG2 . VAL A 1 401 ? 42.026  43.077 342.094 1.00 48.97  ? 402 VAL A CG2 1 
ATOM   3040 N N   . GLY A 1 402 ? 46.435  42.388 343.199 1.00 55.51  ? 403 GLY A N   1 
ATOM   3041 C CA  . GLY A 1 402 ? 47.627  42.469 344.028 1.00 40.36  ? 403 GLY A CA  1 
ATOM   3042 C C   . GLY A 1 402 ? 48.824  43.058 343.305 1.00 54.64  ? 403 GLY A C   1 
ATOM   3043 O O   . GLY A 1 402 ? 49.624  43.779 343.906 1.00 51.97  ? 403 GLY A O   1 
ATOM   3044 N N   . ASP A 1 403 ? 48.989  42.730 342.040 1.00 48.74  ? 404 ASP A N   1 
ATOM   3045 C CA  . ASP A 1 403 ? 50.095  43.251 341.279 1.00 46.38  ? 404 ASP A CA  1 
ATOM   3046 C C   . ASP A 1 403 ? 49.979  44.724 340.991 1.00 47.42  ? 404 ASP A C   1 
ATOM   3047 O O   . ASP A 1 403 ? 50.879  45.480 341.188 1.00 47.80  ? 404 ASP A O   1 
ATOM   3048 C CB  . ASP A 1 403 ? 50.216  42.513 339.947 1.00 53.46  ? 404 ASP A CB  1 
ATOM   3049 C CG  . ASP A 1 403 ? 50.543  41.053 340.085 1.00 51.05  ? 404 ASP A CG  1 
ATOM   3050 O OD1 . ASP A 1 403 ? 50.929  40.608 341.137 1.00 60.70  ? 404 ASP A OD1 1 
ATOM   3051 O OD2 . ASP A 1 403 ? 50.437  40.337 339.107 1.00 62.30  ? 404 ASP A OD2 1 
ATOM   3052 N N   . HIS A 1 404 ? 48.820  45.121 340.545 1.00 43.34  ? 405 HIS A N   1 
ATOM   3053 C CA  . HIS A 1 404 ? 48.576  46.481 340.188 1.00 54.36  ? 405 HIS A CA  1 
ATOM   3054 C C   . HIS A 1 404 ? 48.661  47.415 341.337 1.00 43.72  ? 405 HIS A C   1 
ATOM   3055 O O   . HIS A 1 404 ? 49.209  48.464 341.225 1.00 50.48  ? 405 HIS A O   1 
ATOM   3056 C CB  . HIS A 1 404 ? 47.224  46.593 339.520 1.00 49.87  ? 405 HIS A CB  1 
ATOM   3057 C CG  . HIS A 1 404 ? 46.805  47.985 339.204 1.00 47.47  ? 405 HIS A CG  1 
ATOM   3058 N ND1 . HIS A 1 404 ? 47.557  48.834 338.442 1.00 49.76  ? 405 HIS A ND1 1 
ATOM   3059 C CD2 . HIS A 1 404 ? 45.689  48.660 339.516 1.00 50.38  ? 405 HIS A CD2 1 
ATOM   3060 C CE1 . HIS A 1 404 ? 46.934  49.980 338.317 1.00 49.60  ? 405 HIS A CE1 1 
ATOM   3061 N NE2 . HIS A 1 404 ? 45.799  49.901 338.964 1.00 61.93  ? 405 HIS A NE2 1 
ATOM   3062 N N   . ASN A 1 405 ? 48.103  47.019 342.446 1.00 49.14  ? 406 ASN A N   1 
ATOM   3063 C CA  . ASN A 1 405 ? 48.082  47.861 343.600 1.00 50.68  ? 406 ASN A CA  1 
ATOM   3064 C C   . ASN A 1 405 ? 49.194  47.782 344.586 1.00 45.33  ? 406 ASN A C   1 
ATOM   3065 O O   . ASN A 1 405 ? 49.471  48.747 345.221 1.00 45.96  ? 406 ASN A O   1 
ATOM   3066 C CB  . ASN A 1 405 ? 46.771  47.698 344.308 1.00 46.77  ? 406 ASN A CB  1 
ATOM   3067 C CG  . ASN A 1 405 ? 45.627  48.141 343.475 1.00 64.68  ? 406 ASN A CG  1 
ATOM   3068 O OD1 . ASN A 1 405 ? 45.441  49.297 343.265 1.00 53.41  ? 406 ASN A OD1 1 
ATOM   3069 N ND2 . ASN A 1 405 ? 44.865  47.214 342.992 1.00 44.10  ? 406 ASN A ND2 1 
ATOM   3070 N N   . VAL A 1 406 ? 49.816  46.634 344.724 1.00 43.68  ? 407 VAL A N   1 
ATOM   3071 C CA  . VAL A 1 406 ? 50.868  46.498 345.690 1.00 45.40  ? 407 VAL A CA  1 
ATOM   3072 C C   . VAL A 1 406 ? 52.198  45.979 345.255 1.00 55.79  ? 407 VAL A C   1 
ATOM   3073 O O   . VAL A 1 406 ? 53.181  46.592 345.448 1.00 48.10  ? 407 VAL A O   1 
ATOM   3074 C CB  . VAL A 1 406 ? 50.391  45.607 346.845 1.00 50.79  ? 407 VAL A CB  1 
ATOM   3075 C CG1 . VAL A 1 406 ? 51.407  45.512 347.945 1.00 44.83  ? 407 VAL A CG1 1 
ATOM   3076 C CG2 . VAL A 1 406 ? 49.124  46.155 347.408 1.00 41.65  ? 407 VAL A CG2 1 
ATOM   3077 N N   . VAL A 1 407 ? 52.211  44.812 344.684 1.00 49.80  ? 408 VAL A N   1 
ATOM   3078 C CA  . VAL A 1 407 ? 53.479  44.155 344.365 1.00 52.62  ? 408 VAL A CA  1 
ATOM   3079 C C   . VAL A 1 407 ? 54.308  45.002 343.402 1.00 62.90  ? 408 VAL A C   1 
ATOM   3080 O O   . VAL A 1 407 ? 55.496  45.257 343.636 1.00 52.39  ? 408 VAL A O   1 
ATOM   3081 C CB  . VAL A 1 407 ? 53.227  42.747 343.801 1.00 50.55  ? 408 VAL A CB  1 
ATOM   3082 C CG1 . VAL A 1 407 ? 54.547  42.067 343.494 1.00 51.87  ? 408 VAL A CG1 1 
ATOM   3083 C CG2 . VAL A 1 407 ? 52.429  41.922 344.794 1.00 50.93  ? 408 VAL A CG2 1 
ATOM   3084 N N   . CYS A 1 408 ? 53.696  45.466 342.319 1.00 44.69  ? 409 CYS A N   1 
ATOM   3085 C CA  . CYS A 1 408 ? 54.490  46.127 341.291 1.00 59.10  ? 409 CYS A CA  1 
ATOM   3086 C C   . CYS A 1 408 ? 54.844  47.563 341.669 1.00 54.88  ? 409 CYS A C   1 
ATOM   3087 O O   . CYS A 1 408 ? 55.946  48.021 341.333 1.00 50.11  ? 409 CYS A O   1 
ATOM   3088 C CB  . CYS A 1 408 ? 53.769  46.067 339.941 1.00 47.42  ? 409 CYS A CB  1 
ATOM   3089 S SG  . CYS A 1 408 ? 53.593  44.364 339.357 1.00 51.41  ? 409 CYS A SG  1 
ATOM   3090 N N   . PRO A 1 409 ? 53.966  48.321 342.339 1.00 46.15  ? 410 PRO A N   1 
ATOM   3091 C CA  . PRO A 1 409 ? 54.453  49.574 342.944 1.00 48.47  ? 410 PRO A CA  1 
ATOM   3092 C C   . PRO A 1 409 ? 55.624  49.356 343.897 1.00 57.38  ? 410 PRO A C   1 
ATOM   3093 O O   . PRO A 1 409 ? 56.593  50.126 343.846 1.00 45.68  ? 410 PRO A O   1 
ATOM   3094 C CB  . PRO A 1 409 ? 53.211  50.129 343.652 1.00 46.87  ? 410 PRO A CB  1 
ATOM   3095 C CG  . PRO A 1 409 ? 52.073  49.610 342.850 1.00 41.38  ? 410 PRO A CG  1 
ATOM   3096 C CD  . PRO A 1 409 ? 52.492  48.241 342.364 1.00 38.13  ? 410 PRO A CD  1 
ATOM   3097 N N   . VAL A 1 410 ? 55.575  48.317 344.748 1.00 45.69  ? 411 VAL A N   1 
ATOM   3098 C CA  . VAL A 1 410 ? 56.717  48.000 345.611 1.00 54.23  ? 411 VAL A CA  1 
ATOM   3099 C C   . VAL A 1 410 ? 57.955  47.728 344.769 1.00 54.69  ? 411 VAL A C   1 
ATOM   3100 O O   . VAL A 1 410 ? 59.030  48.291 345.014 1.00 49.27  ? 411 VAL A O   1 
ATOM   3101 C CB  . VAL A 1 410 ? 56.411  46.800 346.534 1.00 59.78  ? 411 VAL A CB  1 
ATOM   3102 C CG1 . VAL A 1 410 ? 57.618  46.482 347.394 1.00 43.82  ? 411 VAL A CG1 1 
ATOM   3103 C CG2 . VAL A 1 410 ? 55.215  47.045 347.437 1.00 39.79  ? 411 VAL A CG2 1 
ATOM   3104 N N   . ALA A 1 411 ? 57.824  46.846 343.770 1.00 52.14  ? 412 ALA A N   1 
ATOM   3105 C CA  . ALA A 1 411 ? 58.975  46.457 342.956 1.00 58.73  ? 412 ALA A CA  1 
ATOM   3106 C C   . ALA A 1 411 ? 59.591  47.661 342.260 1.00 46.44  ? 412 ALA A C   1 
ATOM   3107 O O   . ALA A 1 411 ? 60.818  47.764 342.146 1.00 57.07  ? 412 ALA A O   1 
ATOM   3108 C CB  . ALA A 1 411 ? 58.565  45.403 341.927 1.00 56.54  ? 412 ALA A CB  1 
ATOM   3109 N N   . GLN A 1 412 ? 58.733  48.529 341.794 1.00 44.19  ? 413 GLN A N   1 
ATOM   3110 C CA  A GLN A 1 412 ? 59.268  49.770 341.118 0.53 56.99  ? 413 GLN A CA  1 
ATOM   3111 C CA  B GLN A 1 412 ? 59.215  49.776 341.188 0.47 57.81  ? 413 GLN A CA  1 
ATOM   3112 C C   . GLN A 1 412 ? 60.058  50.816 342.087 1.00 56.38  ? 413 GLN A C   1 
ATOM   3113 O O   . GLN A 1 412 ? 61.215  51.302 341.970 1.00 54.31  ? 413 GLN A O   1 
ATOM   3114 C CB  A GLN A 1 412 ? 58.111  50.537 340.494 0.53 54.69  ? 413 GLN A CB  1 
ATOM   3115 C CB  B GLN A 1 412 ? 58.090  50.506 340.467 0.47 55.74  ? 413 GLN A CB  1 
ATOM   3116 C CG  A GLN A 1 412 ? 58.514  51.754 339.719 0.53 52.60  ? 413 GLN A CG  1 
ATOM   3117 C CG  B GLN A 1 412 ? 58.406  51.797 339.757 0.47 52.61  ? 413 GLN A CG  1 
ATOM   3118 C CD  A GLN A 1 412 ? 57.322  52.394 339.067 0.53 55.47  ? 413 GLN A CD  1 
ATOM   3119 C CD  B GLN A 1 412 ? 59.061  51.596 338.414 0.47 67.88  ? 413 GLN A CD  1 
ATOM   3120 O OE1 A GLN A 1 412 ? 56.401  52.847 339.745 0.53 62.08  ? 413 GLN A OE1 1 
ATOM   3121 O OE1 B GLN A 1 412 ? 59.106  50.498 337.871 0.47 59.33  ? 413 GLN A OE1 1 
ATOM   3122 N NE2 A GLN A 1 412 ? 57.316  52.422 337.739 0.53 64.57  ? 413 GLN A NE2 1 
ATOM   3123 N NE2 B GLN A 1 412 ? 59.604  52.663 337.885 0.47 63.04  ? 413 GLN A NE2 1 
ATOM   3124 N N   . LEU A 1 413 ? 59.459  50.917 343.261 1.00 54.16  ? 414 LEU A N   1 
ATOM   3125 C CA  . LEU A 1 413 ? 60.145  51.725 344.261 1.00 49.38  ? 414 LEU A CA  1 
ATOM   3126 C C   . LEU A 1 413 ? 61.480  51.097 344.641 1.00 51.17  ? 414 LEU A C   1 
ATOM   3127 O O   . LEU A 1 413 ? 62.513  51.775 344.664 1.00 44.98  ? 414 LEU A O   1 
ATOM   3128 C CB  . LEU A 1 413 ? 59.258  51.899 345.494 1.00 54.11  ? 414 LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 413 ? 59.931  52.524 346.719 1.00 48.70  ? 414 LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 413 ? 60.110  54.020 346.519 1.00 57.79  ? 414 LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 413 ? 59.122  52.248 347.961 1.00 55.37  ? 414 LEU A CD2 1 
ATOM   3132 N N   . ALA A 1 414 ? 61.476  49.790 344.920 1.00 43.75  ? 415 ALA A N   1 
ATOM   3133 C CA  . ALA A 1 414 ? 62.702  49.100 345.308 1.00 44.52  ? 415 ALA A CA  1 
ATOM   3134 C C   . ALA A 1 414 ? 63.779  49.242 344.239 1.00 50.58  ? 415 ALA A C   1 
ATOM   3135 O O   . ALA A 1 414 ? 64.937  49.551 344.545 1.00 53.79  ? 415 ALA A O   1 
ATOM   3136 C CB  . ALA A 1 414 ? 62.407  47.625 345.578 1.00 49.10  ? 415 ALA A CB  1 
ATOM   3137 N N   . GLY A 1 415 ? 63.412  49.026 342.973 1.00 63.63  ? 416 GLY A N   1 
ATOM   3138 C CA  . GLY A 1 415 ? 64.398  49.097 341.904 1.00 41.53  ? 416 GLY A CA  1 
ATOM   3139 C C   . GLY A 1 415 ? 64.984  50.486 341.741 1.00 51.71  ? 416 GLY A C   1 
ATOM   3140 O O   . GLY A 1 415 ? 66.197  50.651 341.593 1.00 48.96  ? 416 GLY A O   1 
ATOM   3141 N N   . ARG A 1 416 ? 64.129  51.508 341.774 1.00 47.77  ? 417 ARG A N   1 
ATOM   3142 C CA  . ARG A 1 416 ? 64.623  52.867 341.592 1.00 51.96  ? 417 ARG A CA  1 
ATOM   3143 C C   . ARG A 1 416 ? 65.484  53.306 342.765 1.00 58.49  ? 417 ARG A C   1 
ATOM   3144 O O   . ARG A 1 416 ? 66.531  53.935 342.569 1.00 60.11  ? 417 ARG A O   1 
ATOM   3145 C CB  . ARG A 1 416 ? 63.457  53.829 341.396 1.00 50.22  ? 417 ARG A CB  1 
ATOM   3146 C CG  . ARG A 1 416 ? 62.675  53.591 340.117 1.00 72.11  ? 417 ARG A CG  1 
ATOM   3147 C CD  . ARG A 1 416 ? 63.599  53.498 338.907 1.00 70.78  ? 417 ARG A CD  1 
ATOM   3148 N NE  . ARG A 1 416 ? 64.305  54.752 338.660 1.00 78.07  ? 417 ARG A NE  1 
ATOM   3149 C CZ  . ARG A 1 416 ? 64.149  55.500 337.570 1.00 92.35  ? 417 ARG A CZ  1 
ATOM   3150 N NH1 . ARG A 1 416 ? 63.310  55.121 336.613 1.00 82.74  ? 417 ARG A NH1 1 
ATOM   3151 N NH2 . ARG A 1 416 ? 64.835  56.629 337.433 1.00 78.72  ? 417 ARG A NH2 1 
ATOM   3152 N N   . LEU A 1 417 ? 65.054  52.991 343.991 1.00 67.24  ? 418 LEU A N   1 
ATOM   3153 C CA  . LEU A 1 417 ? 65.837  53.341 345.172 1.00 52.88  ? 418 LEU A CA  1 
ATOM   3154 C C   . LEU A 1 417 ? 67.205  52.669 345.134 1.00 60.13  ? 418 LEU A C   1 
ATOM   3155 O O   . LEU A 1 417 ? 68.233  53.313 345.369 1.00 60.73  ? 418 LEU A O   1 
ATOM   3156 C CB  . LEU A 1 417 ? 65.075  52.950 346.442 1.00 57.38  ? 418 LEU A CB  1 
ATOM   3157 C CG  . LEU A 1 417 ? 63.801  53.716 346.831 1.00 61.19  ? 418 LEU A CG  1 
ATOM   3158 C CD1 . LEU A 1 417 ? 63.452  53.505 348.296 1.00 49.78  ? 418 LEU A CD1 1 
ATOM   3159 C CD2 . LEU A 1 417 ? 63.929  55.192 346.542 1.00 64.87  ? 418 LEU A CD2 1 
ATOM   3160 N N   . ALA A 1 418 ? 67.233  51.370 344.822 1.00 49.24  ? 419 ALA A N   1 
ATOM   3161 C CA  . ALA A 1 418 ? 68.493  50.635 344.762 1.00 50.58  ? 419 ALA A CA  1 
ATOM   3162 C C   . ALA A 1 418 ? 69.435  51.229 343.722 1.00 69.66  ? 419 ALA A C   1 
ATOM   3163 O O   . ALA A 1 418 ? 70.610  51.496 344.005 1.00 68.85  ? 419 ALA A O   1 
ATOM   3164 C CB  . ALA A 1 418 ? 68.221  49.164 344.449 1.00 48.65  ? 419 ALA A CB  1 
ATOM   3165 N N   . ALA A 1 419 ? 68.936  51.441 342.508 1.00 59.81  ? 420 ALA A N   1 
ATOM   3166 C CA  . ALA A 1 419 ? 69.765  51.961 341.430 1.00 68.72  ? 420 ALA A CA  1 
ATOM   3167 C C   . ALA A 1 419 ? 70.141  53.423 341.618 1.00 69.74  ? 420 ALA A C   1 
ATOM   3168 O O   . ALA A 1 419 ? 70.852  53.970 340.767 1.00 84.49  ? 420 ALA A O   1 
ATOM   3169 C CB  . ALA A 1 419 ? 69.050  51.775 340.089 1.00 53.49  ? 420 ALA A CB  1 
ATOM   3170 N N   . GLN A 1 420 ? 69.695  54.076 342.690 1.00 61.47  ? 421 GLN A N   1 
ATOM   3171 C CA  . GLN A 1 420 ? 70.047  55.470 342.920 1.00 58.79  ? 421 GLN A CA  1 
ATOM   3172 C C   . GLN A 1 420 ? 70.673  55.676 344.291 1.00 54.72  ? 421 GLN A C   1 
ATOM   3173 O O   . GLN A 1 420 ? 70.572  56.764 344.867 1.00 68.69  ? 421 GLN A O   1 
ATOM   3174 C CB  . GLN A 1 420 ? 68.836  56.377 342.724 1.00 51.48  ? 421 GLN A CB  1 
ATOM   3175 C CG  . GLN A 1 420 ? 68.359  56.349 341.289 1.00 63.31  ? 421 GLN A CG  1 
ATOM   3176 C CD  . GLN A 1 420 ? 66.977  56.920 341.105 1.00 67.78  ? 421 GLN A CD  1 
ATOM   3177 O OE1 . GLN A 1 420 ? 66.250  56.512 340.201 1.00 67.39  ? 421 GLN A OE1 1 
ATOM   3178 N NE2 . GLN A 1 420 ? 66.613  57.883 341.941 1.00 67.37  ? 421 GLN A NE2 1 
ATOM   3179 N N   . GLY A 1 421 ? 71.332  54.646 344.819 1.00 63.82  ? 422 GLY A N   1 
ATOM   3180 C CA  . GLY A 1 421 ? 72.188  54.791 345.980 1.00 65.74  ? 422 GLY A CA  1 
ATOM   3181 C C   . GLY A 1 421 ? 71.688  54.150 347.252 1.00 60.36  ? 422 GLY A C   1 
ATOM   3182 O O   . GLY A 1 421 ? 72.467  54.044 348.208 1.00 78.70  ? 422 GLY A O   1 
ATOM   3183 N N   . ALA A 1 422 ? 70.431  53.723 347.312 1.00 62.06  ? 423 ALA A N   1 
ATOM   3184 C CA  . ALA A 1 422 ? 69.897  53.149 348.539 1.00 62.24  ? 423 ALA A CA  1 
ATOM   3185 C C   . ALA A 1 422 ? 70.263  51.673 348.658 1.00 63.13  ? 423 ALA A C   1 
ATOM   3186 O O   . ALA A 1 422 ? 70.394  50.962 347.658 1.00 61.04  ? 423 ALA A O   1 
ATOM   3187 C CB  . ALA A 1 422 ? 68.378  53.315 348.589 1.00 64.89  ? 423 ALA A CB  1 
ATOM   3188 N N   . ARG A 1 423 ? 70.448  51.219 349.896 1.00 52.42  ? 424 ARG A N   1 
ATOM   3189 C CA  . ARG A 1 423 ? 70.579  49.794 350.171 1.00 56.98  ? 424 ARG A CA  1 
ATOM   3190 C C   . ARG A 1 423 ? 69.199  49.252 350.523 1.00 59.83  ? 424 ARG A C   1 
ATOM   3191 O O   . ARG A 1 423 ? 68.609  49.644 351.535 1.00 58.84  ? 424 ARG A O   1 
ATOM   3192 C CB  . ARG A 1 423 ? 71.577  49.518 351.295 1.00 58.64  ? 424 ARG A CB  1 
ATOM   3193 C CG  . ARG A 1 423 ? 72.005  48.050 351.362 1.00 56.38  ? 424 ARG A CG  1 
ATOM   3194 C CD  . ARG A 1 423 ? 73.313  47.850 352.120 1.00 84.48  ? 424 ARG A CD  1 
ATOM   3195 N NE  . ARG A 1 423 ? 73.131  47.861 353.573 1.00 95.38  ? 424 ARG A NE  1 
ATOM   3196 C CZ  . ARG A 1 423 ? 73.705  48.734 354.396 1.00 76.31  ? 424 ARG A CZ  1 
ATOM   3197 N NH1 . ARG A 1 423 ? 74.511  49.675 353.917 1.00 77.40  ? 424 ARG A NH1 1 
ATOM   3198 N NH2 . ARG A 1 423 ? 73.479  48.661 355.702 1.00 79.13  ? 424 ARG A NH2 1 
ATOM   3199 N N   . VAL A 1 424 ? 68.683  48.369 349.678 1.00 62.49  ? 425 VAL A N   1 
ATOM   3200 C CA  . VAL A 1 424 ? 67.312  47.889 349.769 1.00 53.20  ? 425 VAL A CA  1 
ATOM   3201 C C   . VAL A 1 424 ? 67.334  46.428 350.187 1.00 61.76  ? 425 VAL A C   1 
ATOM   3202 O O   . VAL A 1 424 ? 68.140  45.641 349.681 1.00 56.75  ? 425 VAL A O   1 
ATOM   3203 C CB  . VAL A 1 424 ? 66.571  48.060 348.428 1.00 50.41  ? 425 VAL A CB  1 
ATOM   3204 C CG1 . VAL A 1 424 ? 65.114  47.676 348.580 1.00 41.00  ? 425 VAL A CG1 1 
ATOM   3205 C CG2 . VAL A 1 424 ? 66.699  49.488 347.925 1.00 47.12  ? 425 VAL A CG2 1 
ATOM   3206 N N   . TYR A 1 425 ? 66.450  46.068 351.113 1.00 50.51  ? 426 TYR A N   1 
ATOM   3207 C CA  . TYR A 1 425 ? 66.200  44.677 351.463 1.00 54.31  ? 426 TYR A CA  1 
ATOM   3208 C C   . TYR A 1 425 ? 64.739  44.360 351.174 1.00 57.95  ? 426 TYR A C   1 
ATOM   3209 O O   . TYR A 1 425 ? 63.848  45.112 351.583 1.00 57.91  ? 426 TYR A O   1 
ATOM   3210 C CB  . TYR A 1 425 ? 66.540  44.415 352.930 1.00 49.77  ? 426 TYR A CB  1 
ATOM   3211 C CG  . TYR A 1 425 ? 68.006  44.606 353.231 1.00 50.52  ? 426 TYR A CG  1 
ATOM   3212 C CD1 . TYR A 1 425 ? 68.506  45.853 353.590 1.00 50.76  ? 426 TYR A CD1 1 
ATOM   3213 C CD2 . TYR A 1 425 ? 68.897  43.542 353.138 1.00 54.56  ? 426 TYR A CD2 1 
ATOM   3214 C CE1 . TYR A 1 425 ? 69.855  46.035 353.863 1.00 51.52  ? 426 TYR A CE1 1 
ATOM   3215 C CE2 . TYR A 1 425 ? 70.249  43.712 353.405 1.00 49.78  ? 426 TYR A CE2 1 
ATOM   3216 C CZ  . TYR A 1 425 ? 70.721  44.960 353.768 1.00 58.83  ? 426 TYR A CZ  1 
ATOM   3217 O OH  . TYR A 1 425 ? 72.061  45.128 354.036 1.00 61.04  ? 426 TYR A OH  1 
ATOM   3218 N N   . ALA A 1 426 ? 64.498  43.257 350.463 1.00 52.14  ? 427 ALA A N   1 
ATOM   3219 C CA  . ALA A 1 426 ? 63.165  42.891 350.005 1.00 43.64  ? 427 ALA A CA  1 
ATOM   3220 C C   . ALA A 1 426 ? 62.788  41.506 350.515 1.00 47.85  ? 427 ALA A C   1 
ATOM   3221 O O   . ALA A 1 426 ? 63.634  40.609 350.594 1.00 51.81  ? 427 ALA A O   1 
ATOM   3222 C CB  . ALA A 1 426 ? 63.074  42.923 348.473 1.00 43.26  ? 427 ALA A CB  1 
ATOM   3223 N N   . TYR A 1 427 ? 61.511  41.336 350.852 1.00 42.04  ? 428 TYR A N   1 
ATOM   3224 C CA  . TYR A 1 427 ? 61.004  40.082 351.389 1.00 53.91  ? 428 TYR A CA  1 
ATOM   3225 C C   . TYR A 1 427 ? 59.641  39.795 350.779 1.00 55.68  ? 428 TYR A C   1 
ATOM   3226 O O   . TYR A 1 427 ? 58.923  40.706 350.355 1.00 47.75  ? 428 TYR A O   1 
ATOM   3227 C CB  . TYR A 1 427 ? 60.885  40.104 352.941 1.00 45.10  ? 428 TYR A CB  1 
ATOM   3228 C CG  . TYR A 1 427 ? 59.801  41.040 353.457 1.00 46.14  ? 428 TYR A CG  1 
ATOM   3229 C CD1 . TYR A 1 427 ? 58.472  40.624 353.553 1.00 43.77  ? 428 TYR A CD1 1 
ATOM   3230 C CD2 . TYR A 1 427 ? 60.103  42.345 353.829 1.00 47.83  ? 428 TYR A CD2 1 
ATOM   3231 C CE1 . TYR A 1 427 ? 57.474  41.488 354.002 1.00 39.61  ? 428 TYR A CE1 1 
ATOM   3232 C CE2 . TYR A 1 427 ? 59.115  43.215 354.281 1.00 37.27  ? 428 TYR A CE2 1 
ATOM   3233 C CZ  . TYR A 1 427 ? 57.805  42.784 354.359 1.00 47.10  ? 428 TYR A CZ  1 
ATOM   3234 O OH  . TYR A 1 427 ? 56.831  43.652 354.800 1.00 51.14  ? 428 TYR A OH  1 
ATOM   3235 N N   . VAL A 1 428 ? 59.288  38.516 350.742 1.00 46.89  ? 429 VAL A N   1 
ATOM   3236 C CA  . VAL A 1 428 ? 57.912  38.088 350.544 1.00 41.02  ? 429 VAL A CA  1 
ATOM   3237 C C   . VAL A 1 428 ? 57.533  37.246 351.752 1.00 50.72  ? 429 VAL A C   1 
ATOM   3238 O O   . VAL A 1 428 ? 58.258  36.311 352.115 1.00 52.17  ? 429 VAL A O   1 
ATOM   3239 C CB  . VAL A 1 428 ? 57.727  37.304 349.232 1.00 47.79  ? 429 VAL A CB  1 
ATOM   3240 C CG1 . VAL A 1 428 ? 56.309  36.801 349.132 1.00 47.85  ? 429 VAL A CG1 1 
ATOM   3241 C CG2 . VAL A 1 428 ? 58.037  38.193 348.033 1.00 58.71  ? 429 VAL A CG2 1 
ATOM   3242 N N   . PHE A 1 429 ? 56.422  37.601 352.392 1.00 50.82  ? 430 PHE A N   1 
ATOM   3243 C CA  . PHE A 1 429 ? 55.960  36.924 353.599 1.00 53.70  ? 430 PHE A CA  1 
ATOM   3244 C C   . PHE A 1 429 ? 55.012  35.804 353.184 1.00 55.28  ? 430 PHE A C   1 
ATOM   3245 O O   . PHE A 1 429 ? 53.915  36.063 352.678 1.00 53.97  ? 430 PHE A O   1 
ATOM   3246 C CB  . PHE A 1 429 ? 55.286  37.923 354.535 1.00 47.48  ? 430 PHE A CB  1 
ATOM   3247 C CG  . PHE A 1 429 ? 54.800  37.324 355.821 1.00 54.45  ? 430 PHE A CG  1 
ATOM   3248 C CD1 . PHE A 1 429 ? 55.637  37.244 356.926 1.00 53.09  ? 430 PHE A CD1 1 
ATOM   3249 C CD2 . PHE A 1 429 ? 53.500  36.853 355.931 1.00 58.27  ? 430 PHE A CD2 1 
ATOM   3250 C CE1 . PHE A 1 429 ? 55.185  36.700 358.114 1.00 52.11  ? 430 PHE A CE1 1 
ATOM   3251 C CE2 . PHE A 1 429 ? 53.041  36.307 357.119 1.00 68.17  ? 430 PHE A CE2 1 
ATOM   3252 C CZ  . PHE A 1 429 ? 53.884  36.229 358.210 1.00 56.80  ? 430 PHE A CZ  1 
ATOM   3253 N N   . GLU A 1 430 ? 55.428  34.557 353.402 1.00 55.04  ? 431 GLU A N   1 
ATOM   3254 C CA  . GLU A 1 430 ? 54.726  33.413 352.834 1.00 60.71  ? 431 GLU A CA  1 
ATOM   3255 C C   . GLU A 1 430 ? 54.199  32.438 353.877 1.00 69.05  ? 431 GLU A C   1 
ATOM   3256 O O   . GLU A 1 430 ? 53.835  31.312 353.519 1.00 69.57  ? 431 GLU A O   1 
ATOM   3257 C CB  . GLU A 1 430 ? 55.637  32.665 351.858 1.00 69.43  ? 431 GLU A CB  1 
ATOM   3258 C CG  . GLU A 1 430 ? 56.201  33.521 350.733 1.00 72.26  ? 431 GLU A CG  1 
ATOM   3259 C CD  . GLU A 1 430 ? 56.949  32.696 349.702 1.00 75.83  ? 431 GLU A CD  1 
ATOM   3260 O OE1 . GLU A 1 430 ? 57.453  31.611 350.063 1.00 77.25  ? 431 GLU A OE1 1 
ATOM   3261 O OE2 . GLU A 1 430 ? 57.033  33.129 348.532 1.00 93.18  ? 431 GLU A OE2 1 
ATOM   3262 N N   . HIS A 1 431 ? 54.139  32.818 355.148 1.00 55.45  ? 432 HIS A N   1 
ATOM   3263 C CA  . HIS A 1 431 ? 53.586  31.939 356.168 1.00 69.97  ? 432 HIS A CA  1 
ATOM   3264 C C   . HIS A 1 431 ? 52.130  32.289 356.438 1.00 53.96  ? 432 HIS A C   1 
ATOM   3265 O O   . HIS A 1 431 ? 51.805  33.445 356.716 1.00 57.41  ? 432 HIS A O   1 
ATOM   3266 C CB  . HIS A 1 431 ? 54.373  32.013 357.472 1.00 60.66  ? 432 HIS A CB  1 
ATOM   3267 C CG  . HIS A 1 431 ? 53.748  31.220 358.573 1.00 72.32  ? 432 HIS A CG  1 
ATOM   3268 N ND1 . HIS A 1 431 ? 53.638  29.847 358.524 1.00 78.99  ? 432 HIS A ND1 1 
ATOM   3269 C CD2 . HIS A 1 431 ? 53.161  31.605 359.730 1.00 70.33  ? 432 HIS A CD2 1 
ATOM   3270 C CE1 . HIS A 1 431 ? 53.032  29.418 359.617 1.00 72.50  ? 432 HIS A CE1 1 
ATOM   3271 N NE2 . HIS A 1 431 ? 52.731  30.465 360.364 1.00 71.22  ? 432 HIS A NE2 1 
ATOM   3272 N N   . ARG A 1 432 ? 51.261  31.284 356.363 1.00 67.34  ? 433 ARG A N   1 
ATOM   3273 C CA  . ARG A 1 432 ? 49.868  31.432 356.760 1.00 61.28  ? 433 ARG A CA  1 
ATOM   3274 C C   . ARG A 1 432 ? 49.733  31.030 358.226 1.00 65.83  ? 433 ARG A C   1 
ATOM   3275 O O   . ARG A 1 432 ? 50.094  29.910 358.605 1.00 66.99  ? 433 ARG A O   1 
ATOM   3276 C CB  . ARG A 1 432 ? 48.960  30.581 355.875 1.00 62.00  ? 433 ARG A CB  1 
ATOM   3277 C CG  . ARG A 1 432 ? 47.482  30.760 356.162 1.00 63.51  ? 433 ARG A CG  1 
ATOM   3278 C CD  . ARG A 1 432 ? 46.628  29.827 355.323 1.00 62.23  ? 433 ARG A CD  1 
ATOM   3279 N NE  . ARG A 1 432 ? 45.285  29.713 355.879 1.00 75.00  ? 433 ARG A NE  1 
ATOM   3280 C CZ  . ARG A 1 432 ? 44.235  30.384 355.420 1.00 74.69  ? 433 ARG A CZ  1 
ATOM   3281 N NH1 . ARG A 1 432 ? 44.378  31.205 354.388 1.00 62.77  ? 433 ARG A NH1 1 
ATOM   3282 N NH2 . ARG A 1 432 ? 43.045  30.233 355.989 1.00 68.47  ? 433 ARG A NH2 1 
ATOM   3283 N N   . ALA A 1 433 ? 49.226  31.945 359.045 1.00 62.20  ? 434 ALA A N   1 
ATOM   3284 C CA  . ALA A 1 433 ? 49.101  31.689 360.471 1.00 73.77  ? 434 ALA A CA  1 
ATOM   3285 C C   . ALA A 1 433 ? 48.071  30.599 360.732 1.00 71.65  ? 434 ALA A C   1 
ATOM   3286 O O   . ALA A 1 433 ? 47.006  30.567 360.111 1.00 77.34  ? 434 ALA A O   1 
ATOM   3287 C CB  . ALA A 1 433 ? 48.710  32.970 361.208 1.00 56.84  ? 434 ALA A CB  1 
ATOM   3288 N N   . SER A 1 434 ? 48.402  29.697 361.663 1.00 67.59  ? 435 SER A N   1 
ATOM   3289 C CA  . SER A 1 434 ? 47.448  28.676 362.089 1.00 66.85  ? 435 SER A CA  1 
ATOM   3290 C C   . SER A 1 434 ? 46.164  29.300 362.614 1.00 55.95  ? 435 SER A C   1 
ATOM   3291 O O   . SER A 1 434 ? 45.101  28.672 362.576 1.00 64.15  ? 435 SER A O   1 
ATOM   3292 C CB  . SER A 1 434 ? 48.066  27.798 363.171 1.00 62.51  ? 435 SER A CB  1 
ATOM   3293 O OG  . SER A 1 434 ? 48.542  28.595 364.244 1.00 68.78  ? 435 SER A OG  1 
ATOM   3294 N N   . THR A 1 435 ? 46.216  30.518 363.053 1.00 57.88  ? 436 THR A N   1 
ATOM   3295 C CA  . THR A 1 435 ? 45.021  31.088 363.566 1.00 63.94  ? 436 THR A CA  1 
ATOM   3296 C C   . THR A 1 435 ? 44.209  31.841 362.578 1.00 59.71  ? 436 THR A C   1 
ATOM   3297 O O   . THR A 1 435 ? 43.238  32.432 362.936 1.00 66.42  ? 436 THR A O   1 
ATOM   3298 C CB  . THR A 1 435 ? 45.372  32.064 364.670 1.00 64.77  ? 436 THR A CB  1 
ATOM   3299 O OG1 . THR A 1 435 ? 46.055  33.184 364.111 1.00 87.97  ? 436 THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 435 ? 46.282  31.427 365.620 1.00 80.71  ? 436 THR A CG2 1 
ATOM   3301 N N   . LEU A 1 436 ? 44.608  31.840 361.335 1.00 52.19  ? 437 LEU A N   1 
ATOM   3302 C CA  . LEU A 1 436 ? 43.918  32.630 360.325 1.00 66.45  ? 437 LEU A CA  1 
ATOM   3303 C C   . LEU A 1 436 ? 42.471  32.180 360.159 1.00 67.71  ? 437 LEU A C   1 
ATOM   3304 O O   . LEU A 1 436 ? 42.190  30.997 359.944 1.00 62.33  ? 437 LEU A O   1 
ATOM   3305 C CB  . LEU A 1 436 ? 44.654  32.545 358.990 1.00 70.39  ? 437 LEU A CB  1 
ATOM   3306 C CG  . LEU A 1 436 ? 44.236  33.636 357.999 1.00 63.35  ? 437 LEU A CG  1 
ATOM   3307 C CD1 . LEU A 1 436 ? 44.415  35.015 358.604 1.00 62.55  ? 437 LEU A CD1 1 
ATOM   3308 C CD2 . LEU A 1 436 ? 45.020  33.520 356.713 1.00 68.72  ? 437 LEU A CD2 1 
ATOM   3309 N N   . SER A 1 437 ? 41.555  33.143 360.249 1.00 53.92  ? 438 SER A N   1 
ATOM   3310 C CA  . SER A 1 437 ? 40.127  32.894 360.138 1.00 59.28  ? 438 SER A CA  1 
ATOM   3311 C C   . SER A 1 437 ? 39.600  32.976 358.708 1.00 67.46  ? 438 SER A C   1 
ATOM   3312 O O   . SER A 1 437 ? 38.470  32.542 358.463 1.00 74.37  ? 438 SER A O   1 
ATOM   3313 C CB  . SER A 1 437 ? 39.359  33.885 361.019 1.00 58.79  ? 438 SER A CB  1 
ATOM   3314 O OG  . SER A 1 437 ? 39.809  35.211 360.800 1.00 70.28  ? 438 SER A OG  1 
ATOM   3315 N N   . TRP A 1 438 ? 40.374  33.525 357.768 1.00 67.11  ? 439 TRP A N   1 
ATOM   3316 C CA  . TRP A 1 438 ? 39.965  33.570 356.369 1.00 71.59  ? 439 TRP A CA  1 
ATOM   3317 C C   . TRP A 1 438 ? 40.102  32.191 355.720 1.00 58.43  ? 439 TRP A C   1 
ATOM   3318 O O   . TRP A 1 438 ? 40.880  31.352 356.181 1.00 60.48  ? 439 TRP A O   1 
ATOM   3319 C CB  . TRP A 1 438 ? 40.806  34.589 355.599 1.00 61.62  ? 439 TRP A CB  1 
ATOM   3320 C CG  . TRP A 1 438 ? 40.650  35.998 356.079 1.00 62.15  ? 439 TRP A CG  1 
ATOM   3321 C CD1 . TRP A 1 438 ? 41.502  36.680 356.902 1.00 64.05  ? 439 TRP A CD1 1 
ATOM   3322 C CD2 . TRP A 1 438 ? 39.583  36.904 355.767 1.00 57.32  ? 439 TRP A CD2 1 
ATOM   3323 N NE1 . TRP A 1 438 ? 41.028  37.953 357.123 1.00 53.10  ? 439 TRP A NE1 1 
ATOM   3324 C CE2 . TRP A 1 438 ? 39.852  38.116 356.439 1.00 66.44  ? 439 TRP A CE2 1 
ATOM   3325 C CE3 . TRP A 1 438 ? 38.424  36.808 354.994 1.00 53.59  ? 439 TRP A CE3 1 
ATOM   3326 C CZ2 . TRP A 1 438 ? 39.006  39.225 356.356 1.00 58.86  ? 439 TRP A CZ2 1 
ATOM   3327 C CZ3 . TRP A 1 438 ? 37.584  37.917 354.909 1.00 57.22  ? 439 TRP A CZ3 1 
ATOM   3328 C CH2 . TRP A 1 438 ? 37.881  39.106 355.585 1.00 57.86  ? 439 TRP A CH2 1 
ATOM   3329 N N   . PRO A 1 439 ? 39.363  31.938 354.639 1.00 64.70  ? 440 PRO A N   1 
ATOM   3330 C CA  . PRO A 1 439 ? 39.470  30.640 353.962 1.00 58.16  ? 440 PRO A CA  1 
ATOM   3331 C C   . PRO A 1 439 ? 40.856  30.420 353.379 1.00 66.42  ? 440 PRO A C   1 
ATOM   3332 O O   . PRO A 1 439 ? 41.646  31.350 353.198 1.00 74.00  ? 440 PRO A O   1 
ATOM   3333 C CB  . PRO A 1 439 ? 38.417  30.728 352.855 1.00 56.93  ? 440 PRO A CB  1 
ATOM   3334 C CG  . PRO A 1 439 ? 38.294  32.183 352.587 1.00 71.77  ? 440 PRO A CG  1 
ATOM   3335 C CD  . PRO A 1 439 ? 38.423  32.830 353.938 1.00 71.03  ? 440 PRO A CD  1 
ATOM   3336 N N   . LEU A 1 440 ? 41.137  29.154 353.064 1.00 75.53  ? 441 LEU A N   1 
ATOM   3337 C CA  . LEU A 1 440 ? 42.463  28.782 352.592 1.00 65.43  ? 441 LEU A CA  1 
ATOM   3338 C C   . LEU A 1 440 ? 42.741  29.229 351.165 1.00 68.65  ? 441 LEU A C   1 
ATOM   3339 O O   . LEU A 1 440 ? 43.914  29.375 350.804 1.00 69.18  ? 441 LEU A O   1 
ATOM   3340 C CB  . LEU A 1 440 ? 42.659  27.269 352.708 1.00 66.92  ? 441 LEU A CB  1 
ATOM   3341 C CG  . LEU A 1 440 ? 43.009  26.842 354.138 1.00 101.01 ? 441 LEU A CG  1 
ATOM   3342 C CD1 . LEU A 1 440 ? 42.398  25.492 354.484 1.00 100.37 ? 441 LEU A CD1 1 
ATOM   3343 C CD2 . LEU A 1 440 ? 44.522  26.844 354.364 1.00 91.91  ? 441 LEU A CD2 1 
ATOM   3344 N N   . TRP A 1 441 ? 41.708  29.459 350.346 1.00 61.08  ? 442 TRP A N   1 
ATOM   3345 C CA  . TRP A 1 441 ? 41.963  29.929 348.987 1.00 75.88  ? 442 TRP A CA  1 
ATOM   3346 C C   . TRP A 1 441 ? 42.539  31.335 348.957 1.00 78.48  ? 442 TRP A C   1 
ATOM   3347 O O   . TRP A 1 441 ? 43.054  31.754 347.913 1.00 64.96  ? 442 TRP A O   1 
ATOM   3348 C CB  . TRP A 1 441 ? 40.691  29.869 348.128 1.00 59.04  ? 442 TRP A CB  1 
ATOM   3349 C CG  . TRP A 1 441 ? 39.600  30.858 348.467 1.00 59.33  ? 442 TRP A CG  1 
ATOM   3350 C CD1 . TRP A 1 441 ? 38.471  30.606 349.191 1.00 67.89  ? 442 TRP A CD1 1 
ATOM   3351 C CD2 . TRP A 1 441 ? 39.515  32.236 348.061 1.00 65.92  ? 442 TRP A CD2 1 
ATOM   3352 N NE1 . TRP A 1 441 ? 37.698  31.739 349.276 1.00 75.12  ? 442 TRP A NE1 1 
ATOM   3353 C CE2 . TRP A 1 441 ? 38.315  32.753 348.592 1.00 58.12  ? 442 TRP A CE2 1 
ATOM   3354 C CE3 . TRP A 1 441 ? 40.340  33.084 347.312 1.00 64.38  ? 442 TRP A CE3 1 
ATOM   3355 C CZ2 . TRP A 1 441 ? 37.920  34.079 348.399 1.00 56.65  ? 442 TRP A CZ2 1 
ATOM   3356 C CZ3 . TRP A 1 441 ? 39.945  34.403 347.119 1.00 58.56  ? 442 TRP A CZ3 1 
ATOM   3357 C CH2 . TRP A 1 441 ? 38.746  34.886 347.661 1.00 65.60  ? 442 TRP A CH2 1 
ATOM   3358 N N   . MET A 1 442 ? 42.476  32.064 350.070 1.00 70.49  ? 443 MET A N   1 
ATOM   3359 C CA  . MET A 1 442 ? 43.060  33.392 350.144 1.00 66.88  ? 443 MET A CA  1 
ATOM   3360 C C   . MET A 1 442 ? 44.541  33.375 350.497 1.00 65.51  ? 443 MET A C   1 
ATOM   3361 O O   . MET A 1 442 ? 45.179  34.433 350.452 1.00 69.01  ? 443 MET A O   1 
ATOM   3362 C CB  . MET A 1 442 ? 42.293  34.240 351.154 1.00 53.83  ? 443 MET A CB  1 
ATOM   3363 C CG  . MET A 1 442 ? 40.880  34.545 350.715 1.00 67.10  ? 443 MET A CG  1 
ATOM   3364 S SD  . MET A 1 442 ? 40.072  35.645 351.882 1.00 72.23  ? 443 MET A SD  1 
ATOM   3365 C CE  . MET A 1 442 ? 41.353  36.873 352.082 1.00 69.92  ? 443 MET A CE  1 
ATOM   3366 N N   . GLY A 1 443 ? 45.094  32.213 350.844 1.00 54.71  ? 444 GLY A N   1 
ATOM   3367 C CA  . GLY A 1 443 ? 46.534  32.098 351.042 1.00 56.33  ? 444 GLY A CA  1 
ATOM   3368 C C   . GLY A 1 443 ? 47.003  32.908 352.234 1.00 67.13  ? 444 GLY A C   1 
ATOM   3369 O O   . GLY A 1 443 ? 46.457  32.806 353.339 1.00 63.57  ? 444 GLY A O   1 
ATOM   3370 N N   . VAL A 1 444 ? 48.041  33.712 352.018 1.00 63.36  ? 445 VAL A N   1 
ATOM   3371 C CA  . VAL A 1 444 ? 48.518  34.652 353.027 1.00 59.73  ? 445 VAL A CA  1 
ATOM   3372 C C   . VAL A 1 444 ? 47.992  36.030 352.646 1.00 46.42  ? 445 VAL A C   1 
ATOM   3373 O O   . VAL A 1 444 ? 48.601  36.711 351.810 1.00 60.66  ? 445 VAL A O   1 
ATOM   3374 C CB  . VAL A 1 444 ? 50.051  34.638 353.130 1.00 54.35  ? 445 VAL A CB  1 
ATOM   3375 C CG1 . VAL A 1 444 ? 50.500  35.343 354.398 1.00 64.24  ? 445 VAL A CG1 1 
ATOM   3376 C CG2 . VAL A 1 444 ? 50.581  33.201 353.089 1.00 57.03  ? 445 VAL A CG2 1 
ATOM   3377 N N   . PRO A 1 445 ? 46.874  36.476 353.213 1.00 57.46  ? 446 PRO A N   1 
ATOM   3378 C CA  . PRO A 1 445 ? 46.251  37.720 352.748 1.00 48.46  ? 446 PRO A CA  1 
ATOM   3379 C C   . PRO A 1 445 ? 47.020  38.947 353.210 1.00 59.03  ? 446 PRO A C   1 
ATOM   3380 O O   . PRO A 1 445 ? 47.883  38.902 354.091 1.00 58.30  ? 446 PRO A O   1 
ATOM   3381 C CB  . PRO A 1 445 ? 44.850  37.683 353.371 1.00 49.22  ? 446 PRO A CB  1 
ATOM   3382 C CG  . PRO A 1 445 ? 44.687  36.302 353.930 1.00 48.66  ? 446 PRO A CG  1 
ATOM   3383 C CD  . PRO A 1 445 ? 46.069  35.831 354.258 1.00 58.64  ? 446 PRO A CD  1 
ATOM   3384 N N   . HIS A 1 446 ? 46.673  40.069 352.586 1.00 66.62  ? 447 HIS A N   1 
ATOM   3385 C CA  . HIS A 1 446 ? 47.247  41.357 352.945 1.00 57.89  ? 447 HIS A CA  1 
ATOM   3386 C C   . HIS A 1 446 ? 46.937  41.688 354.399 1.00 61.39  ? 447 HIS A C   1 
ATOM   3387 O O   . HIS A 1 446 ? 45.800  41.544 354.856 1.00 64.49  ? 447 HIS A O   1 
ATOM   3388 C CB  . HIS A 1 446 ? 46.690  42.434 352.014 1.00 53.93  ? 447 HIS A CB  1 
ATOM   3389 C CG  . HIS A 1 446 ? 47.060  43.834 352.398 1.00 65.02  ? 447 HIS A CG  1 
ATOM   3390 N ND1 . HIS A 1 446 ? 48.049  44.544 351.750 1.00 68.39  ? 447 HIS A ND1 1 
ATOM   3391 C CD2 . HIS A 1 446 ? 46.546  44.672 353.329 1.00 59.81  ? 447 HIS A CD2 1 
ATOM   3392 C CE1 . HIS A 1 446 ? 48.144  45.749 352.282 1.00 68.58  ? 447 HIS A CE1 1 
ATOM   3393 N NE2 . HIS A 1 446 ? 47.242  45.853 353.242 1.00 67.93  ? 447 HIS A NE2 1 
ATOM   3394 N N   . GLY A 1 447 ? 47.955  42.128 355.130 1.00 53.40  ? 448 GLY A N   1 
ATOM   3395 C CA  . GLY A 1 447 ? 47.791  42.526 356.507 1.00 50.51  ? 448 GLY A CA  1 
ATOM   3396 C C   . GLY A 1 447 ? 48.186  41.483 357.531 1.00 50.40  ? 448 GLY A C   1 
ATOM   3397 O O   . GLY A 1 447 ? 48.318  41.824 358.710 1.00 60.21  ? 448 GLY A O   1 
ATOM   3398 N N   . TYR A 1 448 ? 48.430  40.242 357.126 1.00 58.33  ? 449 TYR A N   1 
ATOM   3399 C CA  . TYR A 1 448 ? 48.638  39.175 358.092 1.00 56.48  ? 449 TYR A CA  1 
ATOM   3400 C C   . TYR A 1 448 ? 50.103  38.806 358.259 1.00 59.29  ? 449 TYR A C   1 
ATOM   3401 O O   . TYR A 1 448 ? 50.412  37.694 358.698 1.00 57.17  ? 449 TYR A O   1 
ATOM   3402 C CB  . TYR A 1 448 ? 47.772  37.975 357.717 1.00 46.57  ? 449 TYR A CB  1 
ATOM   3403 C CG  . TYR A 1 448 ? 46.345  38.321 358.038 1.00 54.39  ? 449 TYR A CG  1 
ATOM   3404 C CD1 . TYR A 1 448 ? 45.867  38.198 359.333 1.00 52.89  ? 449 TYR A CD1 1 
ATOM   3405 C CD2 . TYR A 1 448 ? 45.506  38.871 357.078 1.00 51.29  ? 449 TYR A CD2 1 
ATOM   3406 C CE1 . TYR A 1 448 ? 44.581  38.553 359.653 1.00 56.16  ? 449 TYR A CE1 1 
ATOM   3407 C CE2 . TYR A 1 448 ? 44.205  39.237 357.392 1.00 55.81  ? 449 TYR A CE2 1 
ATOM   3408 C CZ  . TYR A 1 448 ? 43.753  39.074 358.690 1.00 55.89  ? 449 TYR A CZ  1 
ATOM   3409 O OH  . TYR A 1 448 ? 42.472  39.423 359.048 1.00 54.25  ? 449 TYR A OH  1 
ATOM   3410 N N   . GLU A 1 449 ? 51.011  39.731 357.945 1.00 54.12  ? 450 GLU A N   1 
ATOM   3411 C CA  . GLU A 1 449 ? 52.369  39.656 358.458 1.00 52.71  ? 450 GLU A CA  1 
ATOM   3412 C C   . GLU A 1 449 ? 52.585  40.534 359.687 1.00 58.59  ? 450 GLU A C   1 
ATOM   3413 O O   . GLU A 1 449 ? 53.559  40.315 360.410 1.00 50.22  ? 450 GLU A O   1 
ATOM   3414 C CB  . GLU A 1 449 ? 53.382  40.046 357.371 1.00 46.60  ? 450 GLU A CB  1 
ATOM   3415 C CG  . GLU A 1 449 ? 53.731  41.531 357.313 1.00 40.97  ? 450 GLU A CG  1 
ATOM   3416 C CD  . GLU A 1 449 ? 52.802  42.322 356.412 1.00 63.88  ? 450 GLU A CD  1 
ATOM   3417 O OE1 . GLU A 1 449 ? 51.624  41.927 356.278 1.00 72.09  ? 450 GLU A OE1 1 
ATOM   3418 O OE2 . GLU A 1 449 ? 53.236  43.349 355.848 1.00 81.88  ? 450 GLU A OE2 1 
ATOM   3419 N N   . ILE A 1 450 ? 51.687  41.495 359.952 1.00 50.26  ? 451 ILE A N   1 
ATOM   3420 C CA  . ILE A 1 450 ? 51.886  42.441 361.051 1.00 59.29  ? 451 ILE A CA  1 
ATOM   3421 C C   . ILE A 1 450 ? 51.997  41.706 362.384 1.00 56.79  ? 451 ILE A C   1 
ATOM   3422 O O   . ILE A 1 450 ? 52.950  41.915 363.143 1.00 50.13  ? 451 ILE A O   1 
ATOM   3423 C CB  . ILE A 1 450 ? 50.752  43.484 361.092 1.00 58.84  ? 451 ILE A CB  1 
ATOM   3424 C CG1 . ILE A 1 450 ? 50.945  44.564 360.036 1.00 53.49  ? 451 ILE A CG1 1 
ATOM   3425 C CG2 . ILE A 1 450 ? 50.746  44.202 362.426 1.00 42.74  ? 451 ILE A CG2 1 
ATOM   3426 C CD1 . ILE A 1 450 ? 49.645  45.235 359.617 1.00 46.77  ? 451 ILE A CD1 1 
ATOM   3427 N N   . GLU A 1 451 ? 51.022  40.841 362.691 1.00 52.24  ? 452 GLU A N   1 
ATOM   3428 C CA  . GLU A 1 451 ? 50.972  40.222 364.016 1.00 53.60  ? 452 GLU A CA  1 
ATOM   3429 C C   . GLU A 1 451 ? 52.255  39.466 364.338 1.00 59.39  ? 452 GLU A C   1 
ATOM   3430 O O   . GLU A 1 451 ? 52.642  39.371 365.510 1.00 58.59  ? 452 GLU A O   1 
ATOM   3431 C CB  . GLU A 1 451 ? 49.759  39.289 364.131 1.00 52.61  ? 452 GLU A CB  1 
ATOM   3432 C CG  . GLU A 1 451 ? 49.750  38.125 363.135 1.00 63.02  ? 452 GLU A CG  1 
ATOM   3433 C CD  . GLU A 1 451 ? 48.361  37.536 362.909 1.00 73.51  ? 452 GLU A CD  1 
ATOM   3434 O OE1 . GLU A 1 451 ? 47.418  38.304 362.611 1.00 69.07  ? 452 GLU A OE1 1 
ATOM   3435 O OE2 . GLU A 1 451 ? 48.213  36.299 363.023 1.00 73.61  ? 452 GLU A OE2 1 
ATOM   3436 N N   . PHE A 1 452 ? 52.939  38.939 363.319 1.00 47.11  ? 453 PHE A N   1 
ATOM   3437 C CA  . PHE A 1 452 ? 54.223  38.291 363.562 1.00 52.60  ? 453 PHE A CA  1 
ATOM   3438 C C   . PHE A 1 452 ? 55.334  39.309 363.787 1.00 62.60  ? 453 PHE A C   1 
ATOM   3439 O O   . PHE A 1 452 ? 56.267  39.046 364.556 1.00 55.56  ? 453 PHE A O   1 
ATOM   3440 C CB  . PHE A 1 452 ? 54.569  37.354 362.399 1.00 59.09  ? 453 PHE A CB  1 
ATOM   3441 C CG  . PHE A 1 452 ? 53.769  36.086 362.403 1.00 65.91  ? 453 PHE A CG  1 
ATOM   3442 C CD1 . PHE A 1 452 ? 52.482  36.067 361.893 1.00 57.11  ? 453 PHE A CD1 1 
ATOM   3443 C CD2 . PHE A 1 452 ? 54.284  34.924 362.955 1.00 60.89  ? 453 PHE A CD2 1 
ATOM   3444 C CE1 . PHE A 1 452 ? 51.731  34.912 361.916 1.00 54.77  ? 453 PHE A CE1 1 
ATOM   3445 C CE2 . PHE A 1 452 ? 53.536  33.763 362.979 1.00 60.13  ? 453 PHE A CE2 1 
ATOM   3446 C CZ  . PHE A 1 452 ? 52.257  33.758 362.459 1.00 56.49  ? 453 PHE A CZ  1 
ATOM   3447 N N   . ILE A 1 453 ? 55.235  40.475 363.150 1.00 50.81  ? 454 ILE A N   1 
ATOM   3448 C CA  . ILE A 1 453 ? 56.244  41.511 363.320 1.00 51.29  ? 454 ILE A CA  1 
ATOM   3449 C C   . ILE A 1 453 ? 56.176  42.106 364.721 1.00 62.18  ? 454 ILE A C   1 
ATOM   3450 O O   . ILE A 1 453 ? 57.208  42.417 365.329 1.00 51.97  ? 454 ILE A O   1 
ATOM   3451 C CB  . ILE A 1 453 ? 56.069  42.583 362.234 1.00 49.75  ? 454 ILE A CB  1 
ATOM   3452 C CG1 . ILE A 1 453 ? 56.091  41.917 360.858 1.00 60.80  ? 454 ILE A CG1 1 
ATOM   3453 C CG2 . ILE A 1 453 ? 57.134  43.647 362.370 1.00 47.62  ? 454 ILE A CG2 1 
ATOM   3454 C CD1 . ILE A 1 453 ? 56.215  42.858 359.708 1.00 62.98  ? 454 ILE A CD1 1 
ATOM   3455 N N   . PHE A 1 454 ? 54.968  42.275 365.259 1.00 47.80  ? 455 PHE A N   1 
ATOM   3456 C CA  . PHE A 1 454 ? 54.792  42.761 366.619 1.00 55.72  ? 455 PHE A CA  1 
ATOM   3457 C C   . PHE A 1 454 ? 54.867  41.651 367.654 1.00 44.81  ? 455 PHE A C   1 
ATOM   3458 O O   . PHE A 1 454 ? 54.611  41.905 368.831 1.00 57.77  ? 455 PHE A O   1 
ATOM   3459 C CB  . PHE A 1 454 ? 53.464  43.506 366.751 1.00 41.95  ? 455 PHE A CB  1 
ATOM   3460 C CG  . PHE A 1 454 ? 53.502  44.899 366.198 1.00 53.54  ? 455 PHE A CG  1 
ATOM   3461 C CD1 . PHE A 1 454 ? 53.454  45.116 364.831 1.00 55.40  ? 455 PHE A CD1 1 
ATOM   3462 C CD2 . PHE A 1 454 ? 53.602  45.993 367.041 1.00 51.36  ? 455 PHE A CD2 1 
ATOM   3463 C CE1 . PHE A 1 454 ? 53.497  46.401 364.313 1.00 48.42  ? 455 PHE A CE1 1 
ATOM   3464 C CE2 . PHE A 1 454 ? 53.644  47.283 366.528 1.00 56.05  ? 455 PHE A CE2 1 
ATOM   3465 C CZ  . PHE A 1 454 ? 53.589  47.483 365.161 1.00 55.01  ? 455 PHE A CZ  1 
ATOM   3466 N N   . GLY A 1 455 ? 55.203  40.430 367.243 1.00 58.49  ? 456 GLY A N   1 
ATOM   3467 C CA  . GLY A 1 455 ? 55.388  39.346 368.194 1.00 57.33  ? 456 GLY A CA  1 
ATOM   3468 C C   . GLY A 1 455 ? 54.138  38.935 368.938 1.00 57.33  ? 456 GLY A C   1 
ATOM   3469 O O   . GLY A 1 455 ? 54.235  38.425 370.058 1.00 59.01  ? 456 GLY A O   1 
ATOM   3470 N N   . ILE A 1 456 ? 52.966  39.143 368.347 1.00 49.77  ? 457 ILE A N   1 
ATOM   3471 C CA  . ILE A 1 456 ? 51.691  38.724 368.933 1.00 52.83  ? 457 ILE A CA  1 
ATOM   3472 C C   . ILE A 1 456 ? 51.656  37.222 369.222 1.00 57.20  ? 457 ILE A C   1 
ATOM   3473 O O   . ILE A 1 456 ? 51.027  36.819 370.211 1.00 62.90  ? 457 ILE A O   1 
ATOM   3474 C CB  . ILE A 1 456 ? 50.520  39.136 368.029 1.00 62.07  ? 457 ILE A CB  1 
ATOM   3475 C CG1 . ILE A 1 456 ? 50.584  40.636 367.734 1.00 60.53  ? 457 ILE A CG1 1 
ATOM   3476 C CG2 . ILE A 1 456 ? 49.194  38.766 368.663 1.00 55.39  ? 457 ILE A CG2 1 
ATOM   3477 C CD1 . ILE A 1 456 ? 50.655  41.508 368.966 1.00 48.14  ? 457 ILE A CD1 1 
ATOM   3478 N N   . PRO A 1 457 ? 52.280  36.349 368.418 1.00 67.04  ? 458 PRO A N   1 
ATOM   3479 C CA  . PRO A 1 457 ? 52.355  34.932 368.821 1.00 67.14  ? 458 PRO A CA  1 
ATOM   3480 C C   . PRO A 1 457 ? 52.960  34.701 370.200 1.00 64.23  ? 458 PRO A C   1 
ATOM   3481 O O   . PRO A 1 457 ? 52.685  33.656 370.801 1.00 71.27  ? 458 PRO A O   1 
ATOM   3482 C CB  . PRO A 1 457 ? 53.218  34.300 367.722 1.00 59.06  ? 458 PRO A CB  1 
ATOM   3483 C CG  . PRO A 1 457 ? 52.906  35.088 366.534 1.00 64.21  ? 458 PRO A CG  1 
ATOM   3484 C CD  . PRO A 1 457 ? 52.674  36.506 367.001 1.00 61.73  ? 458 PRO A CD  1 
ATOM   3485 N N   . LEU A 1 458 ? 53.771  35.626 370.722 1.00 63.25  ? 459 LEU A N   1 
ATOM   3486 C CA  . LEU A 1 458 ? 54.331  35.444 372.058 1.00 61.38  ? 459 LEU A CA  1 
ATOM   3487 C C   . LEU A 1 458 ? 53.270  35.501 373.150 1.00 70.24  ? 459 LEU A C   1 
ATOM   3488 O O   . LEU A 1 458 ? 53.507  34.991 374.249 1.00 68.67  ? 459 LEU A O   1 
ATOM   3489 C CB  . LEU A 1 458 ? 55.404  36.495 372.341 1.00 59.56  ? 459 LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 458 ? 56.675  36.431 371.499 1.00 77.95  ? 459 LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 458 ? 57.776  37.226 372.184 1.00 69.62  ? 459 LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 458 ? 57.098  34.987 371.278 1.00 63.91  ? 459 LEU A CD2 1 
ATOM   3493 N N   . ASP A 1 459 ? 52.116  36.067 372.883 1.00 67.90  ? 460 ASP A N   1 
ATOM   3494 C CA  . ASP A 1 459 ? 51.067  36.140 373.875 1.00 64.77  ? 460 ASP A CA  1 
ATOM   3495 C C   . ASP A 1 459 ? 50.471  34.771 374.141 1.00 80.24  ? 460 ASP A C   1 
ATOM   3496 O O   . ASP A 1 459 ? 49.893  34.183 373.268 1.00 62.50  ? 460 ASP A O   1 
ATOM   3497 C CB  . ASP A 1 459 ? 49.992  37.081 373.386 1.00 59.34  ? 460 ASP A CB  1 
ATOM   3498 C CG  . ASP A 1 459 ? 48.916  37.292 374.373 1.00 78.43  ? 460 ASP A CG  1 
ATOM   3499 O OD1 . ASP A 1 459 ? 48.107  38.193 374.161 1.00 81.57  ? 460 ASP A OD1 1 
ATOM   3500 O OD2 . ASP A 1 459 ? 48.862  36.567 375.360 1.00 81.36  ? 460 ASP A OD2 1 
ATOM   3501 N N   . PRO A 1 460 ? 50.607  34.256 375.355 1.00 87.24  ? 461 PRO A N   1 
ATOM   3502 C CA  . PRO A 1 460 ? 50.095  32.902 375.624 1.00 87.17  ? 461 PRO A CA  1 
ATOM   3503 C C   . PRO A 1 460 ? 48.583  32.816 375.531 1.00 78.22  ? 461 PRO A C   1 
ATOM   3504 O O   . PRO A 1 460 ? 48.048  31.737 375.245 1.00 88.16  ? 461 PRO A O   1 
ATOM   3505 C CB  . PRO A 1 460 ? 50.597  32.605 377.047 1.00 84.81  ? 461 PRO A CB  1 
ATOM   3506 C CG  . PRO A 1 460 ? 51.636  33.667 377.339 1.00 87.58  ? 461 PRO A CG  1 
ATOM   3507 C CD  . PRO A 1 460 ? 51.198  34.867 376.554 1.00 70.33  ? 461 PRO A CD  1 
ATOM   3508 N N   . SER A 1 461 ? 47.881  33.928 375.747 1.00 69.69  ? 462 SER A N   1 
ATOM   3509 C CA  . SER A 1 461 ? 46.435  33.956 375.571 1.00 65.57  ? 462 SER A CA  1 
ATOM   3510 C C   . SER A 1 461 ? 46.003  33.628 374.142 1.00 84.56  ? 462 SER A C   1 
ATOM   3511 O O   . SER A 1 461 ? 44.844  33.253 373.931 1.00 93.39  ? 462 SER A O   1 
ATOM   3512 C CB  . SER A 1 461 ? 45.906  35.329 375.993 1.00 57.78  ? 462 SER A CB  1 
ATOM   3513 O OG  . SER A 1 461 ? 44.782  35.714 375.223 1.00 85.13  ? 462 SER A OG  1 
ATOM   3514 N N   . ARG A 1 462 ? 46.894  33.758 373.158 1.00 76.76  ? 463 ARG A N   1 
ATOM   3515 C CA  . ARG A 1 462 ? 46.564  33.403 371.785 1.00 85.20  ? 463 ARG A CA  1 
ATOM   3516 C C   . ARG A 1 462 ? 46.963  31.957 371.500 1.00 85.87  ? 463 ARG A C   1 
ATOM   3517 O O   . ARG A 1 462 ? 47.635  31.300 372.298 1.00 76.77  ? 463 ARG A O   1 
ATOM   3518 C CB  . ARG A 1 462 ? 47.242  34.349 370.795 1.00 71.26  ? 463 ARG A CB  1 
ATOM   3519 C CG  . ARG A 1 462 ? 47.123  35.811 371.163 1.00 72.85  ? 463 ARG A CG  1 
ATOM   3520 C CD  . ARG A 1 462 ? 46.177  36.545 370.242 1.00 69.71  ? 463 ARG A CD  1 
ATOM   3521 N NE  . ARG A 1 462 ? 46.038  37.941 370.636 1.00 82.45  ? 463 ARG A NE  1 
ATOM   3522 C CZ  . ARG A 1 462 ? 45.158  38.781 370.104 1.00 91.41  ? 463 ARG A CZ  1 
ATOM   3523 N NH1 . ARG A 1 462 ? 44.340  38.361 369.151 1.00 95.65  ? 463 ARG A NH1 1 
ATOM   3524 N NH2 . ARG A 1 462 ? 45.094  40.038 370.527 1.00 79.66  ? 463 ARG A NH2 1 
ATOM   3525 N N   . ASN A 1 463 ? 46.550  31.466 370.330 1.00 72.41  ? 464 ASN A N   1 
ATOM   3526 C CA  . ASN A 1 463 ? 46.586  30.040 370.033 1.00 83.35  ? 464 ASN A CA  1 
ATOM   3527 C C   . ASN A 1 463 ? 47.658  29.679 369.005 1.00 67.90  ? 464 ASN A C   1 
ATOM   3528 O O   . ASN A 1 463 ? 47.484  28.735 368.233 1.00 76.01  ? 464 ASN A O   1 
ATOM   3529 C CB  . ASN A 1 463 ? 45.208  29.565 369.564 1.00 84.35  ? 464 ASN A CB  1 
ATOM   3530 C CG  . ASN A 1 463 ? 44.211  29.421 370.713 1.00 102.40 ? 464 ASN A CG  1 
ATOM   3531 O OD1 . ASN A 1 463 ? 44.596  29.424 371.883 1.00 110.09 ? 464 ASN A OD1 1 
ATOM   3532 N ND2 . ASN A 1 463 ? 42.923  29.292 370.381 1.00 117.48 ? 464 ASN A ND2 1 
ATOM   3533 N N   . TYR A 1 464 ? 48.776  30.402 368.997 1.00 61.75  ? 465 TYR A N   1 
ATOM   3534 C CA  . TYR A 1 464 ? 49.836  30.137 368.034 1.00 62.18  ? 465 TYR A CA  1 
ATOM   3535 C C   . TYR A 1 464 ? 50.693  28.950 368.476 1.00 56.19  ? 465 TYR A C   1 
ATOM   3536 O O   . TYR A 1 464 ? 50.746  28.587 369.654 1.00 72.34  ? 465 TYR A O   1 
ATOM   3537 C CB  . TYR A 1 464 ? 50.724  31.372 367.841 1.00 63.90  ? 465 TYR A CB  1 
ATOM   3538 C CG  . TYR A 1 464 ? 50.040  32.563 367.188 1.00 71.82  ? 465 TYR A CG  1 
ATOM   3539 C CD1 . TYR A 1 464 ? 49.279  33.445 367.943 1.00 52.87  ? 465 TYR A CD1 1 
ATOM   3540 C CD2 . TYR A 1 464 ? 50.178  32.818 365.822 1.00 64.38  ? 465 TYR A CD2 1 
ATOM   3541 C CE1 . TYR A 1 464 ? 48.661  34.534 367.367 1.00 62.56  ? 465 TYR A CE1 1 
ATOM   3542 C CE2 . TYR A 1 464 ? 49.560  33.916 365.232 1.00 52.77  ? 465 TYR A CE2 1 
ATOM   3543 C CZ  . TYR A 1 464 ? 48.803  34.768 366.013 1.00 69.11  ? 465 TYR A CZ  1 
ATOM   3544 O OH  . TYR A 1 464 ? 48.179  35.863 365.458 1.00 58.06  ? 465 TYR A OH  1 
ATOM   3545 N N   . THR A 1 465 ? 51.381  28.353 367.506 1.00 66.14  ? 466 THR A N   1 
ATOM   3546 C CA  . THR A 1 465 ? 52.225  27.192 367.742 1.00 68.16  ? 466 THR A CA  1 
ATOM   3547 C C   . THR A 1 465 ? 53.615  27.606 368.221 1.00 70.16  ? 466 THR A C   1 
ATOM   3548 O O   . THR A 1 465 ? 54.023  28.765 368.124 1.00 77.37  ? 466 THR A O   1 
ATOM   3549 C CB  . THR A 1 465 ? 52.347  26.345 366.471 1.00 69.17  ? 466 THR A CB  1 
ATOM   3550 O OG1 . THR A 1 465 ? 53.283  26.955 365.572 1.00 70.59  ? 466 THR A OG1 1 
ATOM   3551 C CG2 . THR A 1 465 ? 50.997  26.222 365.784 1.00 62.69  ? 466 THR A CG2 1 
ATOM   3552 N N   . ALA A 1 466 ? 54.355  26.625 368.741 1.00 83.19  ? 467 ALA A N   1 
ATOM   3553 C CA  . ALA A 1 466 ? 55.734  26.878 369.141 1.00 79.42  ? 467 ALA A CA  1 
ATOM   3554 C C   . ALA A 1 466 ? 56.583  27.307 367.948 1.00 71.01  ? 467 ALA A C   1 
ATOM   3555 O O   . ALA A 1 466 ? 57.432  28.198 368.068 1.00 71.43  ? 467 ALA A O   1 
ATOM   3556 C CB  . ALA A 1 466 ? 56.322  25.635 369.810 1.00 57.43  ? 467 ALA A CB  1 
ATOM   3557 N N   . GLU A 1 467 ? 56.324  26.731 366.807 1.00 69.35  ? 468 GLU A N   1 
ATOM   3558 C CA  . GLU A 1 467 ? 57.075  27.092 365.643 1.00 77.57  ? 468 GLU A CA  1 
ATOM   3559 C C   . GLU A 1 467 ? 56.780  28.523 365.236 1.00 63.97  ? 468 GLU A C   1 
ATOM   3560 O O   . GLU A 1 467 ? 57.625  29.198 364.729 1.00 62.03  ? 468 GLU A O   1 
ATOM   3561 C CB  . GLU A 1 467 ? 56.772  26.130 364.510 1.00 67.94  ? 468 GLU A CB  1 
ATOM   3562 C CG  . GLU A 1 467 ? 57.457  24.792 364.627 1.00 85.59  ? 468 GLU A CG  1 
ATOM   3563 C CD  . GLU A 1 467 ? 56.908  23.920 365.747 1.00 110.71 ? 468 GLU A CD  1 
ATOM   3564 O OE1 . GLU A 1 467 ? 55.679  23.751 365.864 1.00 100.80 ? 468 GLU A OE1 1 
ATOM   3565 O OE2 . GLU A 1 467 ? 57.724  23.393 366.523 1.00 111.52 ? 468 GLU A OE2 1 
ATOM   3566 N N   . GLU A 1 468 ? 55.567  28.974 365.458 1.00 62.17  ? 469 GLU A N   1 
ATOM   3567 C CA  . GLU A 1 468 ? 55.193  30.338 365.106 1.00 60.63  ? 469 GLU A CA  1 
ATOM   3568 C C   . GLU A 1 468 ? 55.778  31.355 366.076 1.00 73.30  ? 469 GLU A C   1 
ATOM   3569 O O   . GLU A 1 468 ? 56.088  32.482 365.671 1.00 61.49  ? 469 GLU A O   1 
ATOM   3570 C CB  . GLU A 1 468 ? 53.675  30.459 365.038 1.00 56.27  ? 469 GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 468 ? 53.069  29.731 363.843 1.00 58.19  ? 469 GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 468 ? 51.559  29.783 363.851 1.00 70.83  ? 469 GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 468 ? 50.967  29.576 364.933 1.00 74.75  ? 469 GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 468 ? 50.965  30.037 362.783 1.00 59.13  ? 469 GLU A OE2 1 
ATOM   3575 N N   . LYS A 1 469 ? 55.941  30.983 367.351 1.00 64.68  ? 470 LYS A N   1 
ATOM   3576 C CA  . LYS A 1 469 ? 56.586  31.882 368.305 1.00 54.46  ? 470 LYS A CA  1 
ATOM   3577 C C   . LYS A 1 469 ? 58.048  32.108 367.938 1.00 70.31  ? 470 LYS A C   1 
ATOM   3578 O O   . LYS A 1 469 ? 58.542  33.241 368.001 1.00 64.47  ? 470 LYS A O   1 
ATOM   3579 C CB  . LYS A 1 469 ? 56.465  31.324 369.726 1.00 62.94  ? 470 LYS A CB  1 
ATOM   3580 C CG  . LYS A 1 469 ? 55.050  31.344 370.290 1.00 66.83  ? 470 LYS A CG  1 
ATOM   3581 C CD  . LYS A 1 469 ? 54.932  30.478 371.535 1.00 76.32  ? 470 LYS A CD  1 
ATOM   3582 C CE  . LYS A 1 469 ? 53.806  30.950 372.448 1.00 90.16  ? 470 LYS A CE  1 
ATOM   3583 N NZ  . LYS A 1 469 ? 52.646  30.015 372.437 1.00 91.93  ? 470 LYS A NZ  1 
ATOM   3584 N N   . ILE A 1 470 ? 58.755  31.044 367.551 1.00 63.15  ? 471 ILE A N   1 
ATOM   3585 C CA  . ILE A 1 470 ? 60.136  31.195 367.103 1.00 70.26  ? 471 ILE A CA  1 
ATOM   3586 C C   . ILE A 1 470 ? 60.185  32.023 365.826 1.00 76.15  ? 471 ILE A C   1 
ATOM   3587 O O   . ILE A 1 470 ? 61.078  32.860 365.642 1.00 72.28  ? 471 ILE A O   1 
ATOM   3588 C CB  . ILE A 1 470 ? 60.790  29.814 366.908 1.00 77.22  ? 471 ILE A CB  1 
ATOM   3589 C CG1 . ILE A 1 470 ? 60.954  29.100 368.247 1.00 65.04  ? 471 ILE A CG1 1 
ATOM   3590 C CG2 . ILE A 1 470 ? 62.139  29.946 366.220 1.00 75.16  ? 471 ILE A CG2 1 
ATOM   3591 C CD1 . ILE A 1 470 ? 60.682  27.620 368.170 1.00 80.75  ? 471 ILE A CD1 1 
ATOM   3592 N N   . PHE A 1 471 ? 59.223  31.801 364.927 1.00 68.02  ? 472 PHE A N   1 
ATOM   3593 C CA  . PHE A 1 471 ? 59.133  32.590 363.701 1.00 65.89  ? 472 PHE A CA  1 
ATOM   3594 C C   . PHE A 1 471 ? 58.947  34.069 364.020 1.00 71.65  ? 472 PHE A C   1 
ATOM   3595 O O   . PHE A 1 471 ? 59.626  34.933 363.449 1.00 59.01  ? 472 PHE A O   1 
ATOM   3596 C CB  . PHE A 1 471 ? 57.982  32.059 362.841 1.00 58.39  ? 472 PHE A CB  1 
ATOM   3597 C CG  . PHE A 1 471 ? 57.801  32.777 361.532 1.00 59.43  ? 472 PHE A CG  1 
ATOM   3598 C CD1 . PHE A 1 471 ? 58.875  32.994 360.685 1.00 63.59  ? 472 PHE A CD1 1 
ATOM   3599 C CD2 . PHE A 1 471 ? 56.546  33.208 361.135 1.00 60.34  ? 472 PHE A CD2 1 
ATOM   3600 C CE1 . PHE A 1 471 ? 58.704  33.650 359.481 1.00 66.56  ? 472 PHE A CE1 1 
ATOM   3601 C CE2 . PHE A 1 471 ? 56.367  33.864 359.926 1.00 59.22  ? 472 PHE A CE2 1 
ATOM   3602 C CZ  . PHE A 1 471 ? 57.447  34.085 359.098 1.00 59.40  ? 472 PHE A CZ  1 
ATOM   3603 N N   . ALA A 1 472 ? 58.041  34.378 364.953 1.00 52.09  ? 473 ALA A N   1 
ATOM   3604 C CA  . ALA A 1 472 ? 57.821  35.766 365.341 1.00 60.83  ? 473 ALA A CA  1 
ATOM   3605 C C   . ALA A 1 472 ? 59.082  36.374 365.944 1.00 64.94  ? 473 ALA A C   1 
ATOM   3606 O O   . ALA A 1 472 ? 59.420  37.531 365.664 1.00 63.63  ? 473 ALA A O   1 
ATOM   3607 C CB  . ALA A 1 472 ? 56.647  35.857 366.318 1.00 45.23  ? 473 ALA A CB  1 
ATOM   3608 N N   . GLN A 1 473 ? 59.806  35.602 366.756 1.00 57.77  ? 474 GLN A N   1 
ATOM   3609 C CA  . GLN A 1 473 ? 61.033  36.117 367.353 1.00 59.81  ? 474 GLN A CA  1 
ATOM   3610 C C   . GLN A 1 473 ? 62.093  36.375 366.291 1.00 54.90  ? 474 GLN A C   1 
ATOM   3611 O O   . GLN A 1 473 ? 62.835  37.361 366.370 1.00 55.82  ? 474 GLN A O   1 
ATOM   3612 C CB  . GLN A 1 473 ? 61.549  35.145 368.412 1.00 58.46  ? 474 GLN A CB  1 
ATOM   3613 C CG  . GLN A 1 473 ? 60.773  35.203 369.721 1.00 55.52  ? 474 GLN A CG  1 
ATOM   3614 C CD  . GLN A 1 473 ? 61.194  34.122 370.695 1.00 80.03  ? 474 GLN A CD  1 
ATOM   3615 O OE1 . GLN A 1 473 ? 61.365  32.962 370.316 1.00 69.86  ? 474 GLN A OE1 1 
ATOM   3616 N NE2 . GLN A 1 473 ? 61.373  34.500 371.960 1.00 74.66  ? 474 GLN A NE2 1 
ATOM   3617 N N   . ARG A 1 474 ? 62.169  35.507 365.283 1.00 64.64  ? 475 ARG A N   1 
ATOM   3618 C CA  . ARG A 1 474 ? 63.102  35.734 364.186 1.00 61.39  ? 475 ARG A CA  1 
ATOM   3619 C C   . ARG A 1 474 ? 62.730  36.991 363.402 1.00 59.21  ? 475 ARG A C   1 
ATOM   3620 O O   . ARG A 1 474 ? 63.612  37.746 362.972 1.00 44.68  ? 475 ARG A O   1 
ATOM   3621 C CB  . ARG A 1 474 ? 63.138  34.507 363.274 1.00 64.47  ? 475 ARG A CB  1 
ATOM   3622 C CG  . ARG A 1 474 ? 64.336  34.463 362.351 1.00 75.41  ? 475 ARG A CG  1 
ATOM   3623 C CD  . ARG A 1 474 ? 64.626  33.053 361.875 1.00 81.47  ? 475 ARG A CD  1 
ATOM   3624 N NE  . ARG A 1 474 ? 63.457  32.427 361.265 1.00 75.01  ? 475 ARG A NE  1 
ATOM   3625 C CZ  . ARG A 1 474 ? 63.192  32.433 359.961 1.00 64.74  ? 475 ARG A CZ  1 
ATOM   3626 N NH1 . ARG A 1 474 ? 64.007  33.041 359.104 1.00 53.04  ? 475 ARG A NH1 1 
ATOM   3627 N NH2 . ARG A 1 474 ? 62.100  31.833 359.514 1.00 51.61  ? 475 ARG A NH2 1 
ATOM   3628 N N   . LEU A 1 475 ? 61.428  37.244 363.229 1.00 49.89  ? 476 LEU A N   1 
ATOM   3629 C CA  . LEU A 1 475 ? 60.998  38.422 362.480 1.00 62.88  ? 476 LEU A CA  1 
ATOM   3630 C C   . LEU A 1 475 ? 61.268  39.707 363.258 1.00 65.60  ? 476 LEU A C   1 
ATOM   3631 O O   . LEU A 1 475 ? 61.765  40.690 362.693 1.00 57.73  ? 476 LEU A O   1 
ATOM   3632 C CB  . LEU A 1 475 ? 59.515  38.304 362.122 1.00 55.99  ? 476 LEU A CB  1 
ATOM   3633 C CG  . LEU A 1 475 ? 59.161  37.365 360.962 1.00 73.02  ? 476 LEU A CG  1 
ATOM   3634 C CD1 . LEU A 1 475 ? 57.773  37.669 360.421 1.00 65.73  ? 476 LEU A CD1 1 
ATOM   3635 C CD2 . LEU A 1 475 ? 60.193  37.442 359.846 1.00 63.92  ? 476 LEU A CD2 1 
ATOM   3636 N N   . MET A 1 476 ? 60.945  39.722 364.555 1.00 64.41  ? 477 MET A N   1 
ATOM   3637 C CA  . MET A 1 476 ? 61.270  40.881 365.379 1.00 53.07  ? 477 MET A CA  1 
ATOM   3638 C C   . MET A 1 476 ? 62.765  41.166 365.367 1.00 48.86  ? 477 MET A C   1 
ATOM   3639 O O   . MET A 1 476 ? 63.177  42.331 365.373 1.00 51.18  ? 477 MET A O   1 
ATOM   3640 C CB  . MET A 1 476 ? 60.783  40.659 366.810 1.00 61.98  ? 477 MET A CB  1 
ATOM   3641 C CG  . MET A 1 476 ? 59.276  40.538 366.937 1.00 64.57  ? 477 MET A CG  1 
ATOM   3642 S SD  . MET A 1 476 ? 58.734  40.547 368.656 1.00 64.31  ? 477 MET A SD  1 
ATOM   3643 C CE  . MET A 1 476 ? 59.546  39.069 369.268 1.00 52.59  ? 477 MET A CE  1 
ATOM   3644 N N   . ARG A 1 477 ? 63.585  40.115 365.333 1.00 52.88  ? 478 ARG A N   1 
ATOM   3645 C CA  . ARG A 1 477 ? 65.032  40.283 365.263 1.00 50.95  ? 478 ARG A CA  1 
ATOM   3646 C C   . ARG A 1 477 ? 65.457  40.949 363.953 1.00 68.49  ? 478 ARG A C   1 
ATOM   3647 O O   . ARG A 1 477 ? 66.269  41.885 363.963 1.00 51.26  ? 478 ARG A O   1 
ATOM   3648 C CB  . ARG A 1 477 ? 65.706  38.921 365.430 1.00 58.35  ? 478 ARG A CB  1 
ATOM   3649 C CG  . ARG A 1 477 ? 67.212  38.971 365.477 1.00 53.12  ? 478 ARG A CG  1 
ATOM   3650 C CD  . ARG A 1 477 ? 67.680  39.890 366.591 1.00 65.73  ? 478 ARG A CD  1 
ATOM   3651 N NE  . ARG A 1 477 ? 67.273  39.453 367.924 1.00 78.92  ? 478 ARG A NE  1 
ATOM   3652 C CZ  . ARG A 1 477 ? 67.970  38.606 368.672 1.00 69.65  ? 478 ARG A CZ  1 
ATOM   3653 N NH1 . ARG A 1 477 ? 69.106  38.103 368.213 1.00 61.95  ? 478 ARG A NH1 1 
ATOM   3654 N NH2 . ARG A 1 477 ? 67.530  38.262 369.875 1.00 64.03  ? 478 ARG A NH2 1 
ATOM   3655 N N   . TYR A 1 478 ? 64.929  40.473 362.814 1.00 53.51  ? 479 TYR A N   1 
ATOM   3656 C CA  . TYR A 1 478 ? 65.240  41.096 361.524 1.00 52.40  ? 479 TYR A CA  1 
ATOM   3657 C C   . TYR A 1 478 ? 64.900  42.582 361.536 1.00 53.99  ? 479 TYR A C   1 
ATOM   3658 O O   . TYR A 1 478 ? 65.738  43.427 361.196 1.00 54.60  ? 479 TYR A O   1 
ATOM   3659 C CB  . TYR A 1 478 ? 64.477  40.410 360.382 1.00 50.29  ? 479 TYR A CB  1 
ATOM   3660 C CG  . TYR A 1 478 ? 64.954  39.022 359.994 1.00 53.76  ? 479 TYR A CG  1 
ATOM   3661 C CD1 . TYR A 1 478 ? 66.307  38.706 359.968 1.00 49.26  ? 479 TYR A CD1 1 
ATOM   3662 C CD2 . TYR A 1 478 ? 64.041  38.027 359.649 1.00 54.04  ? 479 TYR A CD2 1 
ATOM   3663 C CE1 . TYR A 1 478 ? 66.741  37.431 359.612 1.00 50.46  ? 479 TYR A CE1 1 
ATOM   3664 C CE2 . TYR A 1 478 ? 64.463  36.750 359.293 1.00 51.58  ? 479 TYR A CE2 1 
ATOM   3665 C CZ  . TYR A 1 478 ? 65.813  36.457 359.277 1.00 59.83  ? 479 TYR A CZ  1 
ATOM   3666 O OH  . TYR A 1 478 ? 66.231  35.190 358.925 1.00 64.62  ? 479 TYR A OH  1 
ATOM   3667 N N   . TRP A 1 479 ? 63.664  42.918 361.923 1.00 44.34  ? 480 TRP A N   1 
ATOM   3668 C CA  . TRP A 1 479 ? 63.222  44.309 361.884 1.00 47.37  ? 480 TRP A CA  1 
ATOM   3669 C C   . TRP A 1 479 ? 64.068  45.182 362.800 1.00 51.39  ? 480 TRP A C   1 
ATOM   3670 O O   . TRP A 1 479 ? 64.488  46.279 362.413 1.00 51.88  ? 480 TRP A O   1 
ATOM   3671 C CB  . TRP A 1 479 ? 61.744  44.401 362.270 1.00 47.86  ? 480 TRP A CB  1 
ATOM   3672 C CG  . TRP A 1 479 ? 60.782  44.534 361.101 1.00 52.80  ? 480 TRP A CG  1 
ATOM   3673 C CD1 . TRP A 1 479 ? 59.875  45.538 360.899 1.00 47.04  ? 480 TRP A CD1 1 
ATOM   3674 C CD2 . TRP A 1 479 ? 60.627  43.625 359.992 1.00 49.69  ? 480 TRP A CD2 1 
ATOM   3675 N NE1 . TRP A 1 479 ? 59.170  45.313 359.734 1.00 50.22  ? 480 TRP A NE1 1 
ATOM   3676 C CE2 . TRP A 1 479 ? 59.612  44.150 359.159 1.00 46.60  ? 480 TRP A CE2 1 
ATOM   3677 C CE3 . TRP A 1 479 ? 61.249  42.426 359.622 1.00 44.27  ? 480 TRP A CE3 1 
ATOM   3678 C CZ2 . TRP A 1 479 ? 59.205  43.515 357.979 1.00 50.88  ? 480 TRP A CZ2 1 
ATOM   3679 C CZ3 . TRP A 1 479 ? 60.835  41.791 358.451 1.00 50.27  ? 480 TRP A CZ3 1 
ATOM   3680 C CH2 . TRP A 1 479 ? 59.825  42.341 357.645 1.00 42.24  ? 480 TRP A CH2 1 
ATOM   3681 N N   . ALA A 1 480 ? 64.344  44.703 364.015 1.00 61.04  ? 481 ALA A N   1 
ATOM   3682 C CA  . ALA A 1 480 ? 65.118  45.496 364.963 1.00 55.40  ? 481 ALA A CA  1 
ATOM   3683 C C   . ALA A 1 480 ? 66.582  45.595 364.542 1.00 61.13  ? 481 ALA A C   1 
ATOM   3684 O O   . ALA A 1 480 ? 67.197  46.660 364.679 1.00 60.07  ? 481 ALA A O   1 
ATOM   3685 C CB  . ALA A 1 480 ? 64.987  44.904 366.366 1.00 52.85  ? 481 ALA A CB  1 
ATOM   3686 N N   . ASN A 1 481 ? 67.158  44.498 364.034 1.00 50.40  ? 482 ASN A N   1 
ATOM   3687 C CA  . ASN A 1 481 ? 68.491  44.569 363.438 1.00 60.88  ? 482 ASN A CA  1 
ATOM   3688 C C   . ASN A 1 481 ? 68.566  45.701 362.425 1.00 60.96  ? 482 ASN A C   1 
ATOM   3689 O O   . ASN A 1 481 ? 69.499  46.513 362.445 1.00 54.54  ? 482 ASN A O   1 
ATOM   3690 C CB  . ASN A 1 481 ? 68.849  43.243 362.761 1.00 65.25  ? 482 ASN A CB  1 
ATOM   3691 C CG  . ASN A 1 481 ? 69.398  42.225 363.730 1.00 67.00  ? 482 ASN A CG  1 
ATOM   3692 O OD1 . ASN A 1 481 ? 69.771  42.565 364.849 1.00 64.41  ? 482 ASN A OD1 1 
ATOM   3693 N ND2 . ASN A 1 481 ? 69.459  40.970 363.304 1.00 64.73  ? 482 ASN A ND2 1 
ATOM   3694 N N   . PHE A 1 482 ? 67.567  45.770 361.538 1.00 50.19  ? 483 PHE A N   1 
ATOM   3695 C CA  . PHE A 1 482 ? 67.525  46.811 360.519 1.00 57.68  ? 483 PHE A CA  1 
ATOM   3696 C C   . PHE A 1 482 ? 67.415  48.198 361.147 1.00 54.18  ? 483 PHE A C   1 
ATOM   3697 O O   . PHE A 1 482 ? 68.088  49.139 360.711 1.00 59.04  ? 483 PHE A O   1 
ATOM   3698 C CB  . PHE A 1 482 ? 66.358  46.542 359.563 1.00 52.90  ? 483 PHE A CB  1 
ATOM   3699 C CG  . PHE A 1 482 ? 66.152  47.619 358.547 1.00 53.32  ? 483 PHE A CG  1 
ATOM   3700 C CD1 . PHE A 1 482 ? 66.970  47.701 357.432 1.00 46.61  ? 483 PHE A CD1 1 
ATOM   3701 C CD2 . PHE A 1 482 ? 65.146  48.557 358.710 1.00 45.69  ? 483 PHE A CD2 1 
ATOM   3702 C CE1 . PHE A 1 482 ? 66.789  48.699 356.497 1.00 45.58  ? 483 PHE A CE1 1 
ATOM   3703 C CE2 . PHE A 1 482 ? 64.958  49.559 357.778 1.00 48.58  ? 483 PHE A CE2 1 
ATOM   3704 C CZ  . PHE A 1 482 ? 65.782  49.631 356.668 1.00 49.13  ? 483 PHE A CZ  1 
ATOM   3705 N N   . ALA A 1 483 ? 66.586  48.340 362.185 1.00 52.02  ? 484 ALA A N   1 
ATOM   3706 C CA  . ALA A 1 483 ? 66.438  49.636 362.844 1.00 60.43  ? 484 ALA A CA  1 
ATOM   3707 C C   . ALA A 1 483 ? 67.729  50.086 363.520 1.00 63.03  ? 484 ALA A C   1 
ATOM   3708 O O   . ALA A 1 483 ? 67.955  51.292 363.680 1.00 63.73  ? 484 ALA A O   1 
ATOM   3709 C CB  . ALA A 1 483 ? 65.307  49.583 363.869 1.00 49.24  ? 484 ALA A CB  1 
ATOM   3710 N N   . ARG A 1 484 ? 68.579  49.147 363.931 1.00 50.66  ? 485 ARG A N   1 
ATOM   3711 C CA  . ARG A 1 484 ? 69.841  49.495 364.575 1.00 57.99  ? 485 ARG A CA  1 
ATOM   3712 C C   . ARG A 1 484 ? 70.956  49.792 363.583 1.00 60.92  ? 485 ARG A C   1 
ATOM   3713 O O   . ARG A 1 484 ? 71.770  50.688 363.825 1.00 64.49  ? 485 ARG A O   1 
ATOM   3714 C CB  . ARG A 1 484 ? 70.287  48.364 365.499 1.00 53.39  ? 485 ARG A CB  1 
ATOM   3715 C CG  . ARG A 1 484 ? 69.577  48.360 366.823 1.00 59.62  ? 485 ARG A CG  1 
ATOM   3716 C CD  . ARG A 1 484 ? 70.046  47.204 367.657 1.00 51.01  ? 485 ARG A CD  1 
ATOM   3717 N NE  . ARG A 1 484 ? 68.916  46.462 368.186 1.00 61.35  ? 485 ARG A NE  1 
ATOM   3718 C CZ  . ARG A 1 484 ? 68.659  45.202 367.875 1.00 61.58  ? 485 ARG A CZ  1 
ATOM   3719 N NH1 . ARG A 1 484 ? 69.455  44.556 367.038 1.00 58.74  ? 485 ARG A NH1 1 
ATOM   3720 N NH2 . ARG A 1 484 ? 67.605  44.589 368.395 1.00 58.03  ? 485 ARG A NH2 1 
ATOM   3721 N N   . THR A 1 485 ? 71.016  49.052 362.474 1.00 57.24  ? 486 THR A N   1 
ATOM   3722 C CA  . THR A 1 485 ? 72.169  49.092 361.586 1.00 61.13  ? 486 THR A CA  1 
ATOM   3723 C C   . THR A 1 485 ? 71.832  49.330 360.123 1.00 66.69  ? 486 THR A C   1 
ATOM   3724 O O   . THR A 1 485 ? 72.759  49.486 359.320 1.00 84.94  ? 486 THR A O   1 
ATOM   3725 C CB  . THR A 1 485 ? 72.959  47.778 361.683 1.00 62.65  ? 486 THR A CB  1 
ATOM   3726 O OG1 . THR A 1 485 ? 72.145  46.702 361.200 1.00 62.65  ? 486 THR A OG1 1 
ATOM   3727 C CG2 . THR A 1 485 ? 73.360  47.488 363.127 1.00 51.66  ? 486 THR A CG2 1 
ATOM   3728 N N   . GLY A 1 486 ? 70.558  49.361 359.745 1.00 61.48  ? 487 GLY A N   1 
ATOM   3729 C CA  . GLY A 1 486 ? 70.233  49.379 358.335 1.00 57.28  ? 487 GLY A CA  1 
ATOM   3730 C C   . GLY A 1 486 ? 70.458  48.064 357.632 1.00 61.76  ? 487 GLY A C   1 
ATOM   3731 O O   . GLY A 1 486 ? 70.431  48.017 356.398 1.00 60.17  ? 487 GLY A O   1 
ATOM   3732 N N   . ASP A 1 487 ? 70.674  46.995 358.381 1.00 57.79  ? 488 ASP A N   1 
ATOM   3733 C CA  . ASP A 1 487 ? 70.929  45.672 357.837 1.00 67.83  ? 488 ASP A CA  1 
ATOM   3734 C C   . ASP A 1 487 ? 70.188  44.661 358.703 1.00 58.28  ? 488 ASP A C   1 
ATOM   3735 O O   . ASP A 1 487 ? 70.483  44.543 359.898 1.00 71.70  ? 488 ASP A O   1 
ATOM   3736 C CB  . ASP A 1 487 ? 72.437  45.411 357.812 1.00 56.79  ? 488 ASP A CB  1 
ATOM   3737 C CG  . ASP A 1 487 ? 72.809  44.082 357.186 1.00 62.60  ? 488 ASP A CG  1 
ATOM   3738 O OD1 . ASP A 1 487 ? 71.921  43.259 356.879 1.00 64.57  ? 488 ASP A OD1 1 
ATOM   3739 O OD2 . ASP A 1 487 ? 74.024  43.866 357.002 1.00 69.01  ? 488 ASP A OD2 1 
ATOM   3740 N N   . PRO A 1 488 ? 69.215  43.927 358.152 1.00 68.07  ? 489 PRO A N   1 
ATOM   3741 C CA  . PRO A 1 488 ? 68.463  42.961 358.975 1.00 49.34  ? 489 PRO A CA  1 
ATOM   3742 C C   . PRO A 1 488 ? 69.272  41.736 359.367 1.00 62.03  ? 489 PRO A C   1 
ATOM   3743 O O   . PRO A 1 488 ? 68.808  40.949 360.203 1.00 61.19  ? 489 PRO A O   1 
ATOM   3744 C CB  . PRO A 1 488 ? 67.291  42.570 358.066 1.00 63.75  ? 489 PRO A CB  1 
ATOM   3745 C CG  . PRO A 1 488 ? 67.873  42.706 356.656 1.00 47.36  ? 489 PRO A CG  1 
ATOM   3746 C CD  . PRO A 1 488 ? 68.793  43.908 356.735 1.00 54.29  ? 489 PRO A CD  1 
ATOM   3747 N N   . ASN A 1 489 ? 70.459  41.553 358.796 1.00 57.58  ? 490 ASN A N   1 
ATOM   3748 C CA  . ASN A 1 489 ? 71.208  40.322 358.995 1.00 60.68  ? 490 ASN A CA  1 
ATOM   3749 C C   . ASN A 1 489 ? 71.815  40.276 360.385 1.00 73.63  ? 490 ASN A C   1 
ATOM   3750 O O   . ASN A 1 489 ? 72.291  41.287 360.905 1.00 70.47  ? 490 ASN A O   1 
ATOM   3751 C CB  . ASN A 1 489 ? 72.309  40.200 357.952 1.00 61.19  ? 490 ASN A CB  1 
ATOM   3752 C CG  . ASN A 1 489 ? 71.781  39.766 356.623 1.00 63.47  ? 490 ASN A CG  1 
ATOM   3753 O OD1 . ASN A 1 489 ? 71.519  38.585 356.404 1.00 62.86  ? 490 ASN A OD1 1 
ATOM   3754 N ND2 . ASN A 1 489 ? 71.596  40.723 355.723 1.00 62.28  ? 490 ASN A ND2 1 
ATOM   3755 N N   . GLU A 1 490 ? 71.812  39.092 360.976 1.00 76.54  ? 491 GLU A N   1 
ATOM   3756 C CA  . GLU A 1 490 ? 72.374  38.930 362.308 1.00 91.10  ? 491 GLU A CA  1 
ATOM   3757 C C   . GLU A 1 490 ? 73.886  39.109 362.263 1.00 104.78 ? 491 GLU A C   1 
ATOM   3758 O O   . GLU A 1 490 ? 74.573  38.340 361.574 1.00 84.52  ? 491 GLU A O   1 
ATOM   3759 C CB  . GLU A 1 490 ? 72.007  37.566 362.880 1.00 95.43  ? 491 GLU A CB  1 
ATOM   3760 C CG  . GLU A 1 490 ? 70.791  37.599 363.800 1.00 94.17  ? 491 GLU A CG  1 
ATOM   3761 C CD  . GLU A 1 490 ? 71.086  38.233 365.152 1.00 92.11  ? 491 GLU A CD  1 
ATOM   3762 O OE1 . GLU A 1 490 ? 72.243  38.626 365.415 1.00 101.08 ? 491 GLU A OE1 1 
ATOM   3763 O OE2 . GLU A 1 490 ? 70.156  38.330 365.969 1.00 98.36  ? 491 GLU A OE2 1 
ATOM   3764 N N   . PRO A 1 491 ? 74.450  40.100 362.977 1.00 114.63 ? 492 PRO A N   1 
ATOM   3765 C CA  . PRO A 1 491 ? 75.877  40.450 362.940 1.00 109.30 ? 492 PRO A CA  1 
ATOM   3766 C C   . PRO A 1 491 ? 76.798  39.338 363.451 1.00 120.55 ? 492 PRO A C   1 
ATOM   3767 O O   . PRO A 1 491 ? 76.343  38.237 363.773 1.00 113.61 ? 492 PRO A O   1 
ATOM   3768 C CB  . PRO A 1 491 ? 75.967  41.685 363.853 1.00 112.37 ? 492 PRO A CB  1 
ATOM   3769 C CG  . PRO A 1 491 ? 74.561  42.125 364.108 1.00 95.10  ? 492 PRO A CG  1 
ATOM   3770 C CD  . PRO A 1 491 ? 73.694  40.931 363.931 1.00 91.69  ? 492 PRO A CD  1 
ATOM   3771 N N   . ALA A 1 496 ? 74.259  30.984 359.490 1.00 112.20 ? 497 ALA A N   1 
ATOM   3772 C CA  . ALA A 1 496 ? 73.000  31.675 359.225 1.00 120.24 ? 497 ALA A CA  1 
ATOM   3773 C C   . ALA A 1 496 ? 72.918  32.138 357.772 1.00 114.07 ? 497 ALA A C   1 
ATOM   3774 O O   . ALA A 1 496 ? 73.749  32.934 357.330 1.00 109.57 ? 497 ALA A O   1 
ATOM   3775 C CB  . ALA A 1 496 ? 72.841  32.863 360.167 1.00 106.28 ? 497 ALA A CB  1 
ATOM   3776 N N   . PRO A 1 497 ? 71.921  31.647 357.031 1.00 127.98 ? 498 PRO A N   1 
ATOM   3777 C CA  . PRO A 1 497 ? 71.758  32.092 355.641 1.00 118.71 ? 498 PRO A CA  1 
ATOM   3778 C C   . PRO A 1 497 ? 71.476  33.587 355.597 1.00 103.02 ? 498 PRO A C   1 
ATOM   3779 O O   . PRO A 1 497 ? 70.786  34.132 356.462 1.00 94.67  ? 498 PRO A O   1 
ATOM   3780 C CB  . PRO A 1 497 ? 70.569  31.266 355.139 1.00 93.88  ? 498 PRO A CB  1 
ATOM   3781 C CG  . PRO A 1 497 ? 69.783  30.966 356.378 1.00 104.24 ? 498 PRO A CG  1 
ATOM   3782 C CD  . PRO A 1 497 ? 70.804  30.794 357.475 1.00 106.95 ? 498 PRO A CD  1 
ATOM   3783 N N   . GLN A 1 498 ? 72.031  34.253 354.592 1.00 69.97  ? 499 GLN A N   1 
ATOM   3784 C CA  . GLN A 1 498 ? 72.100  35.705 354.590 1.00 62.21  ? 499 GLN A CA  1 
ATOM   3785 C C   . GLN A 1 498 ? 71.048  36.322 353.678 1.00 81.42  ? 499 GLN A C   1 
ATOM   3786 O O   . GLN A 1 498 ? 70.719  35.781 352.617 1.00 66.66  ? 499 GLN A O   1 
ATOM   3787 C CB  . GLN A 1 498 ? 73.493  36.183 354.177 1.00 69.56  ? 499 GLN A CB  1 
ATOM   3788 C CG  . GLN A 1 498 ? 74.556  35.875 355.212 1.00 84.24  ? 499 GLN A CG  1 
ATOM   3789 C CD  . GLN A 1 498 ? 74.575  36.890 356.337 1.00 80.75  ? 499 GLN A CD  1 
ATOM   3790 O OE1 . GLN A 1 498 ? 74.288  36.561 357.488 1.00 75.85  ? 499 GLN A OE1 1 
ATOM   3791 N NE2 . GLN A 1 498 ? 74.914  38.132 356.011 1.00 86.83  ? 499 GLN A NE2 1 
ATOM   3792 N N   . TRP A 1 499 ? 70.531  37.468 354.115 1.00 78.80  ? 500 TRP A N   1 
ATOM   3793 C CA  . TRP A 1 499 ? 69.565  38.248 353.361 1.00 58.64  ? 500 TRP A CA  1 
ATOM   3794 C C   . TRP A 1 499 ? 70.337  39.231 352.490 1.00 65.66  ? 500 TRP A C   1 
ATOM   3795 O O   . TRP A 1 499 ? 70.887  40.209 353.021 1.00 64.97  ? 500 TRP A O   1 
ATOM   3796 C CB  . TRP A 1 499 ? 68.642  38.978 354.328 1.00 58.45  ? 500 TRP A CB  1 
ATOM   3797 C CG  . TRP A 1 499 ? 67.449  39.671 353.757 1.00 65.91  ? 500 TRP A CG  1 
ATOM   3798 C CD1 . TRP A 1 499 ? 67.281  40.119 352.482 1.00 47.45  ? 500 TRP A CD1 1 
ATOM   3799 C CD2 . TRP A 1 499 ? 66.257  40.023 354.468 1.00 57.40  ? 500 TRP A CD2 1 
ATOM   3800 N NE1 . TRP A 1 499 ? 66.050  40.721 352.353 1.00 51.36  ? 500 TRP A NE1 1 
ATOM   3801 C CE2 . TRP A 1 499 ? 65.405  40.676 353.561 1.00 56.51  ? 500 TRP A CE2 1 
ATOM   3802 C CE3 . TRP A 1 499 ? 65.829  39.846 355.787 1.00 56.12  ? 500 TRP A CE3 1 
ATOM   3803 C CZ2 . TRP A 1 499 ? 64.149  41.152 353.928 1.00 57.16  ? 500 TRP A CZ2 1 
ATOM   3804 C CZ3 . TRP A 1 499 ? 64.582  40.318 356.151 1.00 49.01  ? 500 TRP A CZ3 1 
ATOM   3805 C CH2 . TRP A 1 499 ? 63.758  40.962 355.228 1.00 52.69  ? 500 TRP A CH2 1 
ATOM   3806 N N   . PRO A 1 500 ? 70.432  39.015 351.181 1.00 66.49  ? 501 PRO A N   1 
ATOM   3807 C CA  . PRO A 1 500 ? 71.214  39.915 350.340 1.00 54.78  ? 501 PRO A CA  1 
ATOM   3808 C C   . PRO A 1 500 ? 70.404  41.140 349.964 1.00 55.72  ? 501 PRO A C   1 
ATOM   3809 O O   . PRO A 1 500 ? 69.167  41.075 349.881 1.00 55.57  ? 501 PRO A O   1 
ATOM   3810 C CB  . PRO A 1 500 ? 71.521  39.055 349.109 1.00 60.45  ? 501 PRO A CB  1 
ATOM   3811 C CG  . PRO A 1 500 ? 70.304  38.205 348.982 1.00 59.97  ? 501 PRO A CG  1 
ATOM   3812 C CD  . PRO A 1 500 ? 69.811  37.937 350.391 1.00 62.07  ? 501 PRO A CD  1 
ATOM   3813 N N   . PRO A 1 501 ? 71.058  42.275 349.738 1.00 55.82  ? 502 PRO A N   1 
ATOM   3814 C CA  . PRO A 1 501 ? 70.322  43.460 349.293 1.00 49.66  ? 502 PRO A CA  1 
ATOM   3815 C C   . PRO A 1 501 ? 69.671  43.248 347.933 1.00 65.12  ? 502 PRO A C   1 
ATOM   3816 O O   . PRO A 1 501 ? 70.140  42.470 347.098 1.00 53.93  ? 502 PRO A O   1 
ATOM   3817 C CB  . PRO A 1 501 ? 71.397  44.557 349.245 1.00 57.87  ? 502 PRO A CB  1 
ATOM   3818 C CG  . PRO A 1 501 ? 72.706  43.848 349.334 1.00 61.73  ? 502 PRO A CG  1 
ATOM   3819 C CD  . PRO A 1 501 ? 72.451  42.589 350.095 1.00 40.72  ? 502 PRO A CD  1 
ATOM   3820 N N   . TYR A 1 502 ? 68.553  43.939 347.737 1.00 61.66  ? 503 TYR A N   1 
ATOM   3821 C CA  . TYR A 1 502 ? 67.827  43.897 346.478 1.00 60.73  ? 503 TYR A CA  1 
ATOM   3822 C C   . TYR A 1 502 ? 68.443  44.899 345.513 1.00 57.06  ? 503 TYR A C   1 
ATOM   3823 O O   . TYR A 1 502 ? 68.628  46.069 345.862 1.00 57.62  ? 503 TYR A O   1 
ATOM   3824 C CB  . TYR A 1 502 ? 66.350  44.213 346.723 1.00 61.22  ? 503 TYR A CB  1 
ATOM   3825 C CG  . TYR A 1 502 ? 65.479  44.253 345.485 1.00 56.84  ? 503 TYR A CG  1 
ATOM   3826 C CD1 . TYR A 1 502 ? 65.354  45.418 344.734 1.00 50.39  ? 503 TYR A CD1 1 
ATOM   3827 C CD2 . TYR A 1 502 ? 64.760  43.134 345.081 1.00 55.37  ? 503 TYR A CD2 1 
ATOM   3828 C CE1 . TYR A 1 502 ? 64.561  45.462 343.611 1.00 50.58  ? 503 TYR A CE1 1 
ATOM   3829 C CE2 . TYR A 1 502 ? 63.954  43.170 343.950 1.00 62.51  ? 503 TYR A CE2 1 
ATOM   3830 C CZ  . TYR A 1 502 ? 63.860  44.335 343.218 1.00 58.39  ? 503 TYR A CZ  1 
ATOM   3831 O OH  . TYR A 1 502 ? 63.062  44.382 342.093 1.00 70.97  ? 503 TYR A OH  1 
ATOM   3832 N N   . THR A 1 503 ? 68.776  44.441 344.306 1.00 62.78  ? 504 THR A N   1 
ATOM   3833 C CA  . THR A 1 503 ? 69.326  45.300 343.265 1.00 64.87  ? 504 THR A CA  1 
ATOM   3834 C C   . THR A 1 503 ? 68.432  45.259 342.030 1.00 67.56  ? 504 THR A C   1 
ATOM   3835 O O   . THR A 1 503 ? 67.649  44.326 341.830 1.00 63.04  ? 504 THR A O   1 
ATOM   3836 C CB  . THR A 1 503 ? 70.762  44.892 342.886 1.00 64.51  ? 504 THR A CB  1 
ATOM   3837 O OG1 . THR A 1 503 ? 70.753  43.602 342.261 1.00 68.92  ? 504 THR A OG1 1 
ATOM   3838 C CG2 . THR A 1 503 ? 71.660  44.848 344.120 1.00 56.48  ? 504 THR A CG2 1 
ATOM   3839 N N   . ALA A 1 504 ? 68.557  46.291 341.190 1.00 66.58  ? 505 ALA A N   1 
ATOM   3840 C CA  . ALA A 1 504 ? 67.708  46.379 340.004 1.00 83.84  ? 505 ALA A CA  1 
ATOM   3841 C C   . ALA A 1 504 ? 67.958  45.230 339.032 1.00 75.42  ? 505 ALA A C   1 
ATOM   3842 O O   . ALA A 1 504 ? 67.022  44.772 338.363 1.00 67.59  ? 505 ALA A O   1 
ATOM   3843 C CB  . ALA A 1 504 ? 67.915  47.722 339.305 1.00 63.10  ? 505 ALA A CB  1 
ATOM   3844 N N   . GLY A 1 505 ? 69.194  44.745 338.943 1.00 64.44  ? 506 GLY A N   1 
ATOM   3845 C CA  . GLY A 1 505 ? 69.492  43.643 338.050 1.00 57.83  ? 506 GLY A CA  1 
ATOM   3846 C C   . GLY A 1 505 ? 69.208  42.278 338.642 1.00 69.23  ? 506 GLY A C   1 
ATOM   3847 O O   . GLY A 1 505 ? 68.448  41.488 338.069 1.00 56.98  ? 506 GLY A O   1 
ATOM   3848 N N   . ALA A 1 506 ? 69.812  41.989 339.798 1.00 67.82  ? 507 ALA A N   1 
ATOM   3849 C CA  . ALA A 1 506 ? 69.656  40.666 340.395 1.00 59.03  ? 507 ALA A CA  1 
ATOM   3850 C C   . ALA A 1 506 ? 68.264  40.475 340.990 1.00 60.77  ? 507 ALA A C   1 
ATOM   3851 O O   . ALA A 1 506 ? 67.740  39.355 340.976 1.00 60.76  ? 507 ALA A O   1 
ATOM   3852 C CB  . ALA A 1 506 ? 70.740  40.437 341.447 1.00 53.09  ? 507 ALA A CB  1 
ATOM   3853 N N   . GLN A 1 507 ? 67.653  41.547 341.506 1.00 56.53  ? 508 GLN A N   1 
ATOM   3854 C CA  . GLN A 1 507 ? 66.277  41.518 342.015 1.00 61.08  ? 508 GLN A CA  1 
ATOM   3855 C C   . GLN A 1 507 ? 66.084  40.460 343.102 1.00 60.51  ? 508 GLN A C   1 
ATOM   3856 O O   . GLN A 1 507 ? 65.033  39.822 343.193 1.00 61.68  ? 508 GLN A O   1 
ATOM   3857 C CB  . GLN A 1 507 ? 65.275  41.305 340.880 1.00 56.31  ? 508 GLN A CB  1 
ATOM   3858 C CG  . GLN A 1 507 ? 65.134  42.486 339.949 1.00 61.59  ? 508 GLN A CG  1 
ATOM   3859 C CD  . GLN A 1 507 ? 64.502  42.102 338.624 1.00 83.93  ? 508 GLN A CD  1 
ATOM   3860 O OE1 . GLN A 1 507 ? 63.299  41.847 338.549 1.00 77.17  ? 508 GLN A OE1 1 
ATOM   3861 N NE2 . GLN A 1 507 ? 65.314  42.050 337.571 1.00 71.47  ? 508 GLN A NE2 1 
ATOM   3862 N N   . GLN A 1 508 ? 67.098  40.275 343.941 1.00 50.69  ? 509 GLN A N   1 
ATOM   3863 C CA  . GLN A 1 508 ? 67.042  39.240 344.963 1.00 57.35  ? 509 GLN A CA  1 
ATOM   3864 C C   . GLN A 1 508 ? 66.196  39.686 346.150 1.00 61.69  ? 509 GLN A C   1 
ATOM   3865 O O   . GLN A 1 508 ? 66.246  40.845 346.574 1.00 51.78  ? 509 GLN A O   1 
ATOM   3866 C CB  . GLN A 1 508 ? 68.448  38.879 345.441 1.00 53.01  ? 509 GLN A CB  1 
ATOM   3867 C CG  . GLN A 1 508 ? 69.251  38.058 344.459 1.00 54.80  ? 509 GLN A CG  1 
ATOM   3868 C CD  . GLN A 1 508 ? 70.696  37.911 344.888 1.00 66.79  ? 509 GLN A CD  1 
ATOM   3869 O OE1 . GLN A 1 508 ? 71.175  36.802 345.128 1.00 72.90  ? 509 GLN A OE1 1 
ATOM   3870 N NE2 . GLN A 1 508 ? 71.400  39.033 344.993 1.00 60.25  ? 509 GLN A NE2 1 
ATOM   3871 N N   . TYR A 1 509 ? 65.414  38.749 346.681 1.00 56.88  ? 510 TYR A N   1 
ATOM   3872 C CA  . TYR A 1 509 ? 64.638  38.948 347.894 1.00 57.42  ? 510 TYR A CA  1 
ATOM   3873 C C   . TYR A 1 509 ? 64.624  37.624 348.647 1.00 65.49  ? 510 TYR A C   1 
ATOM   3874 O O   . TYR A 1 509 ? 65.101  36.603 348.147 1.00 60.20  ? 510 TYR A O   1 
ATOM   3875 C CB  . TYR A 1 509 ? 63.218  39.431 347.572 1.00 52.69  ? 510 TYR A CB  1 
ATOM   3876 C CG  . TYR A 1 509 ? 62.384  38.383 346.881 1.00 62.05  ? 510 TYR A CG  1 
ATOM   3877 C CD1 . TYR A 1 509 ? 62.413  38.244 345.495 1.00 54.25  ? 510 TYR A CD1 1 
ATOM   3878 C CD2 . TYR A 1 509 ? 61.577  37.516 347.614 1.00 42.70  ? 510 TYR A CD2 1 
ATOM   3879 C CE1 . TYR A 1 509 ? 61.657  37.276 344.861 1.00 47.24  ? 510 TYR A CE1 1 
ATOM   3880 C CE2 . TYR A 1 509 ? 60.825  36.544 346.988 1.00 60.26  ? 510 TYR A CE2 1 
ATOM   3881 C CZ  . TYR A 1 509 ? 60.865  36.432 345.610 1.00 61.09  ? 510 TYR A CZ  1 
ATOM   3882 O OH  . TYR A 1 509 ? 60.111  35.467 344.987 1.00 63.37  ? 510 TYR A OH  1 
ATOM   3883 N N   . VAL A 1 510 ? 64.070  37.637 349.857 1.00 54.24  ? 511 VAL A N   1 
ATOM   3884 C CA  . VAL A 1 510 ? 63.966  36.411 350.638 1.00 48.93  ? 511 VAL A CA  1 
ATOM   3885 C C   . VAL A 1 510 ? 62.502  36.121 350.929 1.00 61.24  ? 511 VAL A C   1 
ATOM   3886 O O   . VAL A 1 510 ? 61.666  37.025 351.021 1.00 55.00  ? 511 VAL A O   1 
ATOM   3887 C CB  . VAL A 1 510 ? 64.774  36.477 351.952 1.00 52.60  ? 511 VAL A CB  1 
ATOM   3888 C CG1 . VAL A 1 510 ? 66.246  36.710 351.655 1.00 51.18  ? 511 VAL A CG1 1 
ATOM   3889 C CG2 . VAL A 1 510 ? 64.218  37.557 352.861 1.00 49.26  ? 511 VAL A CG2 1 
ATOM   3890 N N   . SER A 1 511 ? 62.193  34.838 351.058 1.00 54.91  ? 512 SER A N   1 
ATOM   3891 C CA  . SER A 1 511 ? 60.892  34.414 351.545 1.00 56.82  ? 512 SER A CA  1 
ATOM   3892 C C   . SER A 1 511 ? 60.960  34.291 353.061 1.00 62.43  ? 512 SER A C   1 
ATOM   3893 O O   . SER A 1 511 ? 61.918  33.725 353.599 1.00 59.90  ? 512 SER A O   1 
ATOM   3894 C CB  . SER A 1 511 ? 60.490  33.082 350.916 1.00 59.54  ? 512 SER A CB  1 
ATOM   3895 O OG  . SER A 1 511 ? 61.472  32.100 351.189 1.00 73.08  ? 512 SER A OG  1 
ATOM   3896 N N   . LEU A 1 512 ? 59.959  34.842 353.745 1.00 62.07  ? 513 LEU A N   1 
ATOM   3897 C CA  . LEU A 1 512 ? 59.844  34.756 355.198 1.00 58.30  ? 513 LEU A CA  1 
ATOM   3898 C C   . LEU A 1 512 ? 58.762  33.736 355.534 1.00 53.96  ? 513 LEU A C   1 
ATOM   3899 O O   . LEU A 1 512 ? 57.573  33.981 355.296 1.00 61.33  ? 513 LEU A O   1 
ATOM   3900 C CB  . LEU A 1 512 ? 59.521  36.119 355.808 1.00 46.28  ? 513 LEU A CB  1 
ATOM   3901 C CG  . LEU A 1 512 ? 60.534  37.242 355.576 1.00 47.01  ? 513 LEU A CG  1 
ATOM   3902 C CD1 . LEU A 1 512 ? 60.038  38.554 356.171 1.00 42.49  ? 513 LEU A CD1 1 
ATOM   3903 C CD2 . LEU A 1 512 ? 61.896  36.874 356.145 1.00 48.31  ? 513 LEU A CD2 1 
ATOM   3904 N N   . ASP A 1 513 ? 59.175  32.592 356.068 1.00 56.93  ? 514 ASP A N   1 
ATOM   3905 C CA  . ASP A 1 513 ? 58.249  31.584 356.576 1.00 66.55  ? 514 ASP A CA  1 
ATOM   3906 C C   . ASP A 1 513 ? 58.983  30.779 357.642 1.00 58.02  ? 514 ASP A C   1 
ATOM   3907 O O   . ASP A 1 513 ? 60.064  31.165 358.094 1.00 64.83  ? 514 ASP A O   1 
ATOM   3908 C CB  . ASP A 1 513 ? 57.695  30.705 355.444 1.00 49.62  ? 514 ASP A CB  1 
ATOM   3909 C CG  . ASP A 1 513 ? 58.787  30.066 354.598 1.00 72.12  ? 514 ASP A CG  1 
ATOM   3910 O OD1 . ASP A 1 513 ? 59.980  30.183 354.948 1.00 75.04  ? 514 ASP A OD1 1 
ATOM   3911 O OD2 . ASP A 1 513 ? 58.448  29.444 353.568 1.00 92.00  ? 514 ASP A OD2 1 
ATOM   3912 N N   . LEU A 1 514 ? 58.398  29.648 358.045 1.00 66.19  ? 515 LEU A N   1 
ATOM   3913 C CA  . LEU A 1 514 ? 59.023  28.841 359.086 1.00 68.05  ? 515 LEU A CA  1 
ATOM   3914 C C   . LEU A 1 514 ? 60.301  28.167 358.607 1.00 60.20  ? 515 LEU A C   1 
ATOM   3915 O O   . LEU A 1 514 ? 61.136  27.792 359.437 1.00 68.69  ? 515 LEU A O   1 
ATOM   3916 C CB  . LEU A 1 514 ? 58.031  27.809 359.618 1.00 57.70  ? 515 LEU A CB  1 
ATOM   3917 C CG  . LEU A 1 514 ? 56.620  28.363 359.821 1.00 80.05  ? 515 LEU A CG  1 
ATOM   3918 C CD1 . LEU A 1 514 ? 55.632  27.236 360.018 1.00 62.04  ? 515 LEU A CD1 1 
ATOM   3919 C CD2 . LEU A 1 514 ? 56.571  29.330 360.996 1.00 66.71  ? 515 LEU A CD2 1 
ATOM   3920 N N   . ARG A 1 515 ? 60.473  28.004 357.299 1.00 60.88  ? 516 ARG A N   1 
ATOM   3921 C CA  . ARG A 1 515 ? 61.727  27.506 356.763 1.00 62.32  ? 516 ARG A CA  1 
ATOM   3922 C C   . ARG A 1 515 ? 62.797  28.587 356.873 1.00 65.95  ? 516 ARG A C   1 
ATOM   3923 O O   . ARG A 1 515 ? 62.483  29.774 356.986 1.00 63.23  ? 516 ARG A O   1 
ATOM   3924 C CB  . ARG A 1 515 ? 61.564  27.096 355.301 1.00 73.42  ? 516 ARG A CB  1 
ATOM   3925 C CG  . ARG A 1 515 ? 60.463  26.089 355.024 1.00 74.77  ? 516 ARG A CG  1 
ATOM   3926 C CD  . ARG A 1 515 ? 60.238  25.938 353.519 1.00 77.03  ? 516 ARG A CD  1 
ATOM   3927 N NE  . ARG A 1 515 ? 60.016  27.227 352.865 1.00 73.02  ? 516 ARG A NE  1 
ATOM   3928 C CZ  . ARG A 1 515 ? 60.876  27.809 352.034 1.00 71.32  ? 516 ARG A CZ  1 
ATOM   3929 N NH1 . ARG A 1 515 ? 62.028  27.222 351.742 1.00 75.44  ? 516 ARG A NH1 1 
ATOM   3930 N NH2 . ARG A 1 515 ? 60.583  28.982 351.491 1.00 67.54  ? 516 ARG A NH2 1 
ATOM   3931 N N   . PRO A 1 516 ? 64.073  28.207 356.843 1.00 69.64  ? 517 PRO A N   1 
ATOM   3932 C CA  . PRO A 1 516 ? 65.132  29.225 356.837 1.00 66.62  ? 517 PRO A CA  1 
ATOM   3933 C C   . PRO A 1 516 ? 65.008  30.123 355.614 1.00 77.48  ? 517 PRO A C   1 
ATOM   3934 O O   . PRO A 1 516 ? 64.273  29.838 354.665 1.00 76.60  ? 517 PRO A O   1 
ATOM   3935 C CB  . PRO A 1 516 ? 66.427  28.405 356.806 1.00 57.21  ? 517 PRO A CB  1 
ATOM   3936 C CG  . PRO A 1 516 ? 66.041  27.073 357.361 1.00 67.16  ? 517 PRO A CG  1 
ATOM   3937 C CD  . PRO A 1 516 ? 64.621  26.842 356.938 1.00 51.06  ? 517 PRO A CD  1 
ATOM   3938 N N   . LEU A 1 517 ? 65.744  31.231 355.650 1.00 68.80  ? 518 LEU A N   1 
ATOM   3939 C CA  . LEU A 1 517 ? 65.714  32.186 354.551 1.00 66.42  ? 518 LEU A CA  1 
ATOM   3940 C C   . LEU A 1 517 ? 66.081  31.510 353.237 1.00 75.20  ? 518 LEU A C   1 
ATOM   3941 O O   . LEU A 1 517 ? 67.119  30.848 353.132 1.00 70.97  ? 518 LEU A O   1 
ATOM   3942 C CB  . LEU A 1 517 ? 66.674  33.343 354.825 1.00 59.89  ? 518 LEU A CB  1 
ATOM   3943 C CG  . LEU A 1 517 ? 66.192  34.455 355.756 1.00 64.90  ? 518 LEU A CG  1 
ATOM   3944 C CD1 . LEU A 1 517 ? 67.093  35.673 355.614 1.00 53.57  ? 518 LEU A CD1 1 
ATOM   3945 C CD2 . LEU A 1 517 ? 64.734  34.810 355.476 1.00 54.02  ? 518 LEU A CD2 1 
ATOM   3946 N N   . GLU A 1 518 ? 65.215  31.667 352.240 1.00 61.91  ? 519 GLU A N   1 
ATOM   3947 C CA  . GLU A 1 518 ? 65.475  31.220 350.879 1.00 72.05  ? 519 GLU A CA  1 
ATOM   3948 C C   . GLU A 1 518 ? 65.523  32.442 349.973 1.00 59.34  ? 519 GLU A C   1 
ATOM   3949 O O   . GLU A 1 518 ? 64.608  33.270 349.992 1.00 61.61  ? 519 GLU A O   1 
ATOM   3950 C CB  . GLU A 1 518 ? 64.404  30.235 350.398 1.00 77.42  ? 519 GLU A CB  1 
ATOM   3951 C CG  . GLU A 1 518 ? 64.691  29.629 349.030 1.00 78.19  ? 519 GLU A CG  1 
ATOM   3952 C CD  . GLU A 1 518 ? 63.452  29.047 348.364 1.00 91.25  ? 519 GLU A CD  1 
ATOM   3953 O OE1 . GLU A 1 518 ? 62.519  28.634 349.087 1.00 97.94  ? 519 GLU A OE1 1 
ATOM   3954 O OE2 . GLU A 1 518 ? 63.413  29.002 347.115 1.00 97.11  ? 519 GLU A OE2 1 
ATOM   3955 N N   . VAL A 1 519 ? 66.592  32.558 349.199 1.00 60.09  ? 520 VAL A N   1 
ATOM   3956 C CA  . VAL A 1 519 ? 66.781  33.684 348.293 1.00 59.22  ? 520 VAL A CA  1 
ATOM   3957 C C   . VAL A 1 519 ? 66.124  33.362 346.958 1.00 60.57  ? 520 VAL A C   1 
ATOM   3958 O O   . VAL A 1 519 ? 66.282  32.255 346.429 1.00 58.96  ? 520 VAL A O   1 
ATOM   3959 C CB  . VAL A 1 519 ? 68.275  33.991 348.112 1.00 64.43  ? 520 VAL A CB  1 
ATOM   3960 C CG1 . VAL A 1 519 ? 68.465  35.214 347.228 1.00 59.35  ? 520 VAL A CG1 1 
ATOM   3961 C CG2 . VAL A 1 519 ? 68.937  34.184 349.475 1.00 57.82  ? 520 VAL A CG2 1 
ATOM   3962 N N   . ARG A 1 520 ? 65.424  34.338 346.412 1.00 66.64  ? 521 ARG A N   1 
ATOM   3963 C CA  . ARG A 1 520 ? 64.744  34.223 345.150 1.00 63.83  ? 521 ARG A CA  1 
ATOM   3964 C C   . ARG A 1 520 ? 64.972  35.456 344.349 1.00 69.21  ? 521 ARG A C   1 
ATOM   3965 O O   . ARG A 1 520 ? 65.404  36.430 344.873 1.00 60.66  ? 521 ARG A O   1 
ATOM   3966 C CB  . ARG A 1 520 ? 63.279  34.005 345.359 1.00 62.84  ? 521 ARG A CB  1 
ATOM   3967 C CG  . ARG A 1 520 ? 62.992  32.789 346.170 1.00 63.34  ? 521 ARG A CG  1 
ATOM   3968 C CD  . ARG A 1 520 ? 61.590  32.314 345.928 1.00 70.38  ? 521 ARG A CD  1 
ATOM   3969 N NE  . ARG A 1 520 ? 61.227  31.261 346.853 1.00 88.41  ? 521 ARG A NE  1 
ATOM   3970 C CZ  . ARG A 1 520 ? 60.124  31.253 347.566 1.00 74.42  ? 521 ARG A CZ  1 
ATOM   3971 N NH1 . ARG A 1 520 ? 59.263  32.224 347.436 1.00 72.25  ? 521 ARG A NH1 1 
ATOM   3972 N NH2 . ARG A 1 520 ? 59.882  30.263 348.383 1.00 66.13  ? 521 ARG A NH2 1 
ATOM   3973 N N   . ARG A 1 521 ? 64.708  35.387 343.061 1.00 60.08  ? 522 ARG A N   1 
ATOM   3974 C CA  . ARG A 1 521 ? 64.888  36.499 342.165 1.00 52.88  ? 522 ARG A CA  1 
ATOM   3975 C C   . ARG A 1 521 ? 63.590  36.907 341.564 1.00 63.30  ? 522 ARG A C   1 
ATOM   3976 O O   . ARG A 1 521 ? 62.814  36.085 341.185 1.00 67.68  ? 522 ARG A O   1 
ATOM   3977 C CB  . ARG A 1 521 ? 65.707  36.075 340.980 1.00 70.59  ? 522 ARG A CB  1 
ATOM   3978 C CG  . ARG A 1 521 ? 67.183  35.927 341.176 1.00 77.43  ? 522 ARG A CG  1 
ATOM   3979 C CD  . ARG A 1 521 ? 67.862  35.883 339.832 1.00 53.05  ? 522 ARG A CD  1 
ATOM   3980 N NE  . ARG A 1 521 ? 67.935  37.204 339.245 1.00 80.02  ? 522 ARG A NE  1 
ATOM   3981 C CZ  . ARG A 1 521 ? 67.783  37.461 337.962 1.00 71.65  ? 522 ARG A CZ  1 
ATOM   3982 N NH1 . ARG A 1 521 ? 67.540  36.498 337.128 1.00 72.53  ? 522 ARG A NH1 1 
ATOM   3983 N NH2 . ARG A 1 521 ? 67.859  38.688 337.530 1.00 57.80  ? 522 ARG A NH2 1 
ATOM   3984 N N   . GLY A 1 522 ? 63.350  38.193 341.482 1.00 58.73  ? 523 GLY A N   1 
ATOM   3985 C CA  . GLY A 1 522 ? 62.161  38.688 340.847 1.00 60.75  ? 523 GLY A CA  1 
ATOM   3986 C C   . GLY A 1 522 ? 60.849  38.805 341.552 1.00 61.35  ? 523 GLY A C   1 
ATOM   3987 O O   . GLY A 1 522 ? 60.240  37.823 341.849 1.00 67.42  ? 523 GLY A O   1 
ATOM   3988 N N   . LEU A 1 523 ? 60.405  40.022 341.792 1.00 51.56  ? 524 LEU A N   1 
ATOM   3989 C CA  . LEU A 1 523 ? 59.125  40.221 342.403 1.00 66.03  ? 524 LEU A CA  1 
ATOM   3990 C C   . LEU A 1 523 ? 58.150  40.277 341.270 1.00 57.32  ? 524 LEU A C   1 
ATOM   3991 O O   . LEU A 1 523 ? 57.802  41.326 340.822 1.00 64.65  ? 524 LEU A O   1 
ATOM   3992 C CB  . LEU A 1 523 ? 59.097  41.518 343.178 1.00 49.71  ? 524 LEU A CB  1 
ATOM   3993 C CG  . LEU A 1 523 ? 59.939  41.598 344.427 1.00 71.64  ? 524 LEU A CG  1 
ATOM   3994 C CD1 . LEU A 1 523 ? 60.271  43.021 344.765 1.00 62.49  ? 524 LEU A CD1 1 
ATOM   3995 C CD2 . LEU A 1 523 ? 59.201  40.983 345.573 1.00 64.60  ? 524 LEU A CD2 1 
ATOM   3996 N N   . ARG A 1 524 ? 57.713  39.133 340.784 1.00 72.02  ? 525 ARG A N   1 
ATOM   3997 C CA  . ARG A 1 524 ? 56.793  39.096 339.676 1.00 60.87  ? 525 ARG A CA  1 
ATOM   3998 C C   . ARG A 1 524 ? 57.341  39.925 338.562 1.00 67.36  ? 525 ARG A C   1 
ATOM   3999 O O   . ARG A 1 524 ? 56.710  40.837 338.098 1.00 66.45  ? 525 ARG A O   1 
ATOM   4000 C CB  . ARG A 1 524 ? 55.439  39.567 340.114 1.00 58.94  ? 525 ARG A CB  1 
ATOM   4001 C CG  . ARG A 1 524 ? 54.906  38.667 341.178 1.00 53.76  ? 525 ARG A CG  1 
ATOM   4002 C CD  . ARG A 1 524 ? 53.421  38.712 341.291 1.00 73.87  ? 525 ARG A CD  1 
ATOM   4003 N NE  . ARG A 1 524 ? 53.029  37.715 342.255 1.00 93.76  ? 525 ARG A NE  1 
ATOM   4004 C CZ  . ARG A 1 524 ? 51.801  37.521 342.699 1.00 95.96  ? 525 ARG A CZ  1 
ATOM   4005 N NH1 . ARG A 1 524 ? 50.814  38.277 342.267 1.00 79.64  ? 525 ARG A NH1 1 
ATOM   4006 N NH2 . ARG A 1 524 ? 51.572  36.573 343.584 1.00 91.94  ? 525 ARG A NH2 1 
ATOM   4007 N N   . ALA A 1 525 ? 58.558  39.619 338.170 1.00 55.45  ? 526 ALA A N   1 
ATOM   4008 C CA  . ALA A 1 525 ? 59.228  40.443 337.166 1.00 64.50  ? 526 ALA A CA  1 
ATOM   4009 C C   . ALA A 1 525 ? 58.415  40.546 335.874 1.00 64.28  ? 526 ALA A C   1 
ATOM   4010 O O   . ALA A 1 525 ? 58.297  41.633 335.296 1.00 53.10  ? 526 ALA A O   1 
ATOM   4011 C CB  . ALA A 1 525 ? 60.625  39.887 336.887 1.00 64.55  ? 526 ALA A CB  1 
ATOM   4012 N N   . GLN A 1 526 ? 57.840  39.431 335.412 1.00 52.50  ? 527 GLN A N   1 
ATOM   4013 C CA  . GLN A 1 526 ? 57.073  39.453 334.169 1.00 54.64  ? 527 GLN A CA  1 
ATOM   4014 C C   . GLN A 1 526 ? 55.813  40.299 334.313 1.00 53.78  ? 527 GLN A C   1 
ATOM   4015 O O   . GLN A 1 526 ? 55.557  41.196 333.500 1.00 69.07  ? 527 GLN A O   1 
ATOM   4016 C CB  . GLN A 1 526 ? 56.711  38.029 333.740 1.00 61.86  ? 527 GLN A CB  1 
ATOM   4017 C CG  . GLN A 1 526 ? 57.898  37.099 333.538 1.00 63.41  ? 527 GLN A CG  1 
ATOM   4018 C CD  . GLN A 1 526 ? 58.891  37.614 332.513 1.00 82.00  ? 527 GLN A CD  1 
ATOM   4019 O OE1 . GLN A 1 526 ? 58.512  38.166 331.474 1.00 67.74  ? 527 GLN A OE1 1 
ATOM   4020 N NE2 . GLN A 1 526 ? 60.176  37.431 332.800 1.00 75.46  ? 527 GLN A NE2 1 
ATOM   4021 N N   . ALA A 1 527 ? 55.010  40.023 335.340 1.00 59.43  ? 528 ALA A N   1 
ATOM   4022 C CA  . ALA A 1 527 ? 53.780  40.782 335.545 1.00 55.46  ? 528 ALA A CA  1 
ATOM   4023 C C   . ALA A 1 527 ? 54.063  42.270 335.720 1.00 58.02  ? 528 ALA A C   1 
ATOM   4024 O O   . ALA A 1 527 ? 53.324  43.118 335.202 1.00 58.90  ? 528 ALA A O   1 
ATOM   4025 C CB  . ALA A 1 527 ? 53.029  40.233 336.759 1.00 56.27  ? 528 ALA A CB  1 
ATOM   4026 N N   . CYS A 1 528 ? 55.131  42.612 336.441 1.00 49.10  ? 529 CYS A N   1 
ATOM   4027 C CA  . CYS A 1 528 ? 55.387  44.012 336.751 1.00 51.68  ? 529 CYS A CA  1 
ATOM   4028 C C   . CYS A 1 528 ? 55.975  44.777 335.570 1.00 52.49  ? 529 CYS A C   1 
ATOM   4029 O O   . CYS A 1 528 ? 55.816  46.004 335.501 1.00 48.35  ? 529 CYS A O   1 
ATOM   4030 C CB  . CYS A 1 528 ? 56.296  44.109 337.980 1.00 51.29  ? 529 CYS A CB  1 
ATOM   4031 S SG  . CYS A 1 528 ? 55.460  43.574 339.514 1.00 56.36  ? 529 CYS A SG  1 
ATOM   4032 N N   . ALA A 1 529 ? 56.637  44.088 334.637 1.00 54.43  ? 530 ALA A N   1 
ATOM   4033 C CA  . ALA A 1 529 ? 57.019  44.735 333.385 1.00 53.36  ? 530 ALA A CA  1 
ATOM   4034 C C   . ALA A 1 529 ? 55.795  45.283 332.670 1.00 45.72  ? 530 ALA A C   1 
ATOM   4035 O O   . ALA A 1 529 ? 55.820  46.404 332.147 1.00 49.69  ? 530 ALA A O   1 
ATOM   4036 C CB  . ALA A 1 529 ? 57.768  43.752 332.488 1.00 43.77  ? 530 ALA A CB  1 
ATOM   4037 N N   . PHE A 1 530 ? 54.706  44.511 332.659 1.00 49.15  ? 531 PHE A N   1 
ATOM   4038 C CA  . PHE A 1 530 ? 53.458  44.983 332.066 1.00 55.01  ? 531 PHE A CA  1 
ATOM   4039 C C   . PHE A 1 530 ? 52.949  46.241 332.767 1.00 51.75  ? 531 PHE A C   1 
ATOM   4040 O O   . PHE A 1 530 ? 52.592  47.226 332.114 1.00 66.64  ? 531 PHE A O   1 
ATOM   4041 C CB  . PHE A 1 530 ? 52.400  43.877 332.116 1.00 57.02  ? 531 PHE A CB  1 
ATOM   4042 C CG  . PHE A 1 530 ? 51.003  44.371 331.858 1.00 69.92  ? 531 PHE A CG  1 
ATOM   4043 C CD1 . PHE A 1 530 ? 50.139  44.649 332.910 1.00 52.34  ? 531 PHE A CD1 1 
ATOM   4044 C CD2 . PHE A 1 530 ? 50.562  44.583 330.559 1.00 57.54  ? 531 PHE A CD2 1 
ATOM   4045 C CE1 . PHE A 1 530 ? 48.856  45.123 332.665 1.00 67.87  ? 531 PHE A CE1 1 
ATOM   4046 C CE2 . PHE A 1 530 ? 49.283  45.052 330.308 1.00 57.88  ? 531 PHE A CE2 1 
ATOM   4047 C CZ  . PHE A 1 530 ? 48.428  45.322 331.360 1.00 74.58  ? 531 PHE A CZ  1 
ATOM   4048 N N   . TRP A 1 531 ? 52.905  46.224 334.102 1.00 54.65  ? 532 TRP A N   1 
ATOM   4049 C CA  . TRP A 1 531 ? 52.308  47.334 334.841 1.00 55.86  ? 532 TRP A CA  1 
ATOM   4050 C C   . TRP A 1 531 ? 53.224  48.551 334.890 1.00 52.20  ? 532 TRP A C   1 
ATOM   4051 O O   . TRP A 1 531 ? 52.749  49.690 334.810 1.00 50.11  ? 532 TRP A O   1 
ATOM   4052 C CB  . TRP A 1 531 ? 51.954  46.890 336.260 1.00 38.14  ? 532 TRP A CB  1 
ATOM   4053 C CG  . TRP A 1 531 ? 50.844  45.870 336.325 1.00 54.33  ? 532 TRP A CG  1 
ATOM   4054 C CD1 . TRP A 1 531 ? 50.973  44.526 336.552 1.00 48.62  ? 532 TRP A CD1 1 
ATOM   4055 C CD2 . TRP A 1 531 ? 49.439  46.115 336.171 1.00 39.58  ? 532 TRP A CD2 1 
ATOM   4056 N NE1 . TRP A 1 531 ? 49.738  43.925 336.550 1.00 46.78  ? 532 TRP A NE1 1 
ATOM   4057 C CE2 . TRP A 1 531 ? 48.780  44.878 336.316 1.00 47.72  ? 532 TRP A CE2 1 
ATOM   4058 C CE3 . TRP A 1 531 ? 48.676  47.261 335.928 1.00 39.46  ? 532 TRP A CE3 1 
ATOM   4059 C CZ2 . TRP A 1 531 ? 47.388  44.754 336.222 1.00 41.77  ? 532 TRP A CZ2 1 
ATOM   4060 C CZ3 . TRP A 1 531 ? 47.291  47.138 335.830 1.00 39.25  ? 532 TRP A CZ3 1 
ATOM   4061 C CH2 . TRP A 1 531 ? 46.664  45.892 335.979 1.00 41.22  ? 532 TRP A CH2 1 
ATOM   4062 N N   . ASN A 1 532 ? 54.535  48.334 335.016 1.00 49.17  ? 533 ASN A N   1 
ATOM   4063 C CA  . ASN A 1 532 ? 55.466  49.437 335.210 1.00 56.73  ? 533 ASN A CA  1 
ATOM   4064 C C   . ASN A 1 532 ? 56.066  49.967 333.913 1.00 64.00  ? 533 ASN A C   1 
ATOM   4065 O O   . ASN A 1 532 ? 56.428  51.148 333.854 1.00 65.44  ? 533 ASN A O   1 
ATOM   4066 C CB  . ASN A 1 532 ? 56.586  49.009 336.163 1.00 51.20  ? 533 ASN A CB  1 
ATOM   4067 C CG  . ASN A 1 532 ? 56.080  48.776 337.579 1.00 61.28  ? 533 ASN A CG  1 
ATOM   4068 O OD1 . ASN A 1 532 ? 55.113  49.406 338.009 1.00 50.46  ? 533 ASN A OD1 1 
ATOM   4069 N ND2 . ASN A 1 532 ? 56.729  47.870 338.309 1.00 43.76  ? 533 ASN A ND2 1 
ATOM   4070 N N   . ARG A 1 533 ? 56.163  49.136 332.896 1.00 64.52  ? 534 ARG A N   1 
ATOM   4071 C CA  . ARG A 1 533 ? 56.743  49.554 331.649 1.00 70.13  ? 534 ARG A CA  1 
ATOM   4072 C C   . ARG A 1 533 ? 55.815  49.739 330.483 1.00 71.48  ? 534 ARG A C   1 
ATOM   4073 O O   . ARG A 1 533 ? 55.818  50.773 329.903 1.00 72.45  ? 534 ARG A O   1 
ATOM   4074 C CB  . ARG A 1 533 ? 57.806  48.575 331.233 1.00 69.79  ? 534 ARG A CB  1 
ATOM   4075 C CG  . ARG A 1 533 ? 58.923  48.424 332.221 1.00 69.55  ? 534 ARG A CG  1 
ATOM   4076 C CD  . ARG A 1 533 ? 59.850  47.335 331.768 1.00 72.89  ? 534 ARG A CD  1 
ATOM   4077 N NE  . ARG A 1 533 ? 60.730  46.935 332.834 1.00 88.73  ? 534 ARG A NE  1 
ATOM   4078 C CZ  . ARG A 1 533 ? 61.978  47.343 332.933 1.00 97.51  ? 534 ARG A CZ  1 
ATOM   4079 N NH1 . ARG A 1 533 ? 62.466  48.149 332.015 1.00 88.70  ? 534 ARG A NH1 1 
ATOM   4080 N NH2 . ARG A 1 533 ? 62.730  46.943 333.937 1.00 90.11  ? 534 ARG A NH2 1 
ATOM   4081 N N   . PHE A 1 534 ? 55.033  48.739 330.127 1.00 67.73  ? 535 PHE A N   1 
ATOM   4082 C CA  . PHE A 1 534 ? 54.159  48.859 328.963 1.00 69.62  ? 535 PHE A CA  1 
ATOM   4083 C C   . PHE A 1 534 ? 52.952  49.741 329.256 1.00 74.59  ? 535 PHE A C   1 
ATOM   4084 O O   . PHE A 1 534 ? 52.760  50.783 328.622 1.00 66.01  ? 535 PHE A O   1 
ATOM   4085 C CB  . PHE A 1 534 ? 53.697  47.482 328.485 1.00 51.81  ? 535 PHE A CB  1 
ATOM   4086 C CG  . PHE A 1 534 ? 52.725  47.550 327.341 1.00 71.41  ? 535 PHE A CG  1 
ATOM   4087 C CD1 . PHE A 1 534 ? 51.462  46.989 327.443 1.00 70.08  ? 535 PHE A CD1 1 
ATOM   4088 C CD2 . PHE A 1 534 ? 53.073  48.196 326.163 1.00 72.64  ? 535 PHE A CD2 1 
ATOM   4089 C CE1 . PHE A 1 534 ? 50.563  47.071 326.385 1.00 71.34  ? 535 PHE A CE1 1 
ATOM   4090 C CE2 . PHE A 1 534 ? 52.182  48.288 325.106 1.00 64.08  ? 535 PHE A CE2 1 
ATOM   4091 C CZ  . PHE A 1 534 ? 50.925  47.722 325.215 1.00 59.82  ? 535 PHE A CZ  1 
ATOM   4092 N N   . LEU A 1 535 ? 52.115  49.329 330.202 1.00 70.37  ? 536 LEU A N   1 
ATOM   4093 C CA  . LEU A 1 535 ? 50.836  50.001 330.421 1.00 76.95  ? 536 LEU A CA  1 
ATOM   4094 C C   . LEU A 1 535 ? 50.934  51.525 330.504 1.00 75.08  ? 536 LEU A C   1 
ATOM   4095 O O   . LEU A 1 535 ? 50.125  52.200 329.852 1.00 85.94  ? 536 LEU A O   1 
ATOM   4096 C CB  . LEU A 1 535 ? 50.193  49.407 331.676 1.00 69.15  ? 536 LEU A CB  1 
ATOM   4097 C CG  . LEU A 1 535 ? 48.889  49.999 332.203 1.00 77.34  ? 536 LEU A CG  1 
ATOM   4098 C CD1 . LEU A 1 535 ? 47.771  49.967 331.209 1.00 84.30  ? 536 LEU A CD1 1 
ATOM   4099 C CD2 . LEU A 1 535 ? 48.476  49.204 333.352 1.00 85.95  ? 536 LEU A CD2 1 
ATOM   4100 N N   . PRO A 1 536 ? 51.885  52.044 331.274 1.00 80.06  ? 537 PRO A N   1 
ATOM   4101 C CA  . PRO A 1 536 ? 52.057  53.493 331.415 1.00 84.58  ? 537 PRO A CA  1 
ATOM   4102 C C   . PRO A 1 536 ? 52.178  54.184 330.061 1.00 89.32  ? 537 PRO A C   1 
ATOM   4103 O O   . PRO A 1 536 ? 51.596  55.250 329.859 1.00 85.81  ? 537 PRO A O   1 
ATOM   4104 C CB  . PRO A 1 536 ? 53.373  53.611 332.185 1.00 78.77  ? 537 PRO A CB  1 
ATOM   4105 C CG  . PRO A 1 536 ? 53.456  52.349 332.973 1.00 77.70  ? 537 PRO A CG  1 
ATOM   4106 C CD  . PRO A 1 536 ? 52.833  51.287 332.111 1.00 84.37  ? 537 PRO A CD  1 
ATOM   4107 N N   . LYS A 1 537 ? 52.928  53.577 329.147 1.00 85.09  ? 538 LYS A N   1 
ATOM   4108 C CA  . LYS A 1 537 ? 53.119  54.141 327.816 1.00 90.65  ? 538 LYS A CA  1 
ATOM   4109 C C   . LYS A 1 537 ? 51.831  54.080 327.002 1.00 82.05  ? 538 LYS A C   1 
ATOM   4110 O O   . LYS A 1 537 ? 51.584  54.931 326.147 1.00 94.27  ? 538 LYS A O   1 
ATOM   4111 C CB  . LYS A 1 537 ? 54.242  53.407 327.080 1.00 82.05  ? 538 LYS A CB  1 
ATOM   4112 C CG  . LYS A 1 537 ? 55.639  53.799 327.531 1.00 93.56  ? 538 LYS A CG  1 
ATOM   4113 C CD  . LYS A 1 537 ? 56.697  53.261 326.581 1.00 83.99  ? 538 LYS A CD  1 
ATOM   4114 C CE  . LYS A 1 537 ? 57.297  51.964 327.100 1.00 87.39  ? 538 LYS A CE  1 
ATOM   4115 N NZ  . LYS A 1 537 ? 58.399  52.211 328.069 1.00 102.33 ? 538 LYS A NZ  1 
ATOM   4116 N N   . LEU A 1 538 ? 51.013  53.068 327.273 1.00 78.54  ? 539 LEU A N   1 
ATOM   4117 C CA  . LEU A 1 538 ? 49.749  52.894 326.566 1.00 88.68  ? 539 LEU A CA  1 
ATOM   4118 C C   . LEU A 1 538 ? 48.800  54.055 326.842 1.00 90.44  ? 539 LEU A C   1 
ATOM   4119 O O   . LEU A 1 538 ? 48.149  54.567 325.930 1.00 111.78 ? 539 LEU A O   1 
ATOM   4120 C CB  . LEU A 1 538 ? 49.091  51.571 326.964 1.00 76.62  ? 539 LEU A CB  1 
ATOM   4121 C CG  . LEU A 1 538 ? 47.859  51.157 326.156 1.00 94.68  ? 539 LEU A CG  1 
ATOM   4122 C CD1 . LEU A 1 538 ? 47.825  49.649 325.962 1.00 84.11  ? 539 LEU A CD1 1 
ATOM   4123 C CD2 . LEU A 1 538 ? 46.586  51.644 326.831 1.00 62.87  ? 539 LEU A CD2 1 
ATOM   4124 N N   . LEU A 1 539 ? 48.725  54.465 328.103 1.00 103.19 ? 540 LEU A N   1 
ATOM   4125 C CA  . LEU A 1 539 ? 47.855  55.566 328.501 1.00 103.14 ? 540 LEU A CA  1 
ATOM   4126 C C   . LEU A 1 539 ? 48.231  56.855 327.777 1.00 114.31 ? 540 LEU A C   1 
ATOM   4127 O O   . LEU A 1 539 ? 47.369  57.554 327.246 1.00 132.43 ? 540 LEU A O   1 
ATOM   4128 C CB  . LEU A 1 539 ? 47.916  55.777 330.015 1.00 95.83  ? 540 LEU A CB  1 
ATOM   4129 C CG  . LEU A 1 539 ? 47.358  54.645 330.880 1.00 107.59 ? 540 LEU A CG  1 
ATOM   4130 C CD1 . LEU A 1 539 ? 47.350  55.045 332.348 1.00 99.40  ? 540 LEU A CD1 1 
ATOM   4131 C CD2 . LEU A 1 539 ? 45.962  54.255 330.420 1.00 98.29  ? 540 LEU A CD2 1 
ATOM   4132 N N   . SER A 1 540 ? 49.524  57.162 327.760 1.00 102.22 ? 541 SER A N   1 
ATOM   4133 C CA  . SER A 1 540 ? 50.017  58.366 327.101 1.00 112.60 ? 541 SER A CA  1 
ATOM   4134 C C   . SER A 1 540 ? 49.523  58.448 325.661 1.00 124.70 ? 541 SER A C   1 
ATOM   4135 O O   . SER A 1 540 ? 48.872  59.417 325.271 1.00 118.23 ? 541 SER A O   1 
ATOM   4136 C CB  . SER A 1 540 ? 51.546  58.409 327.137 1.00 102.87 ? 541 SER A CB  1 
ATOM   4137 O OG  . SER A 1 540 ? 52.047  59.430 326.292 1.00 111.12 ? 541 SER A OG  1 
ATOM   4138 N N   . ALA A 1 541 ? 49.837  57.424 324.874 1.00 122.11 ? 542 ALA A N   1 
ATOM   4139 C CA  . ALA A 1 541 ? 49.427  57.378 323.475 1.00 120.60 ? 542 ALA A CA  1 
ATOM   4140 C C   . ALA A 1 541 ? 47.939  57.069 323.347 1.00 111.47 ? 542 ALA A C   1 
ATOM   4141 O O   . ALA A 1 541 ? 47.396  57.030 322.243 1.00 108.84 ? 542 ALA A O   1 
ATOM   4142 C CB  . ALA A 1 541 ? 50.251  56.351 322.714 1.00 100.38 ? 542 ALA A CB  1 
ATOM   4143 N N   . GLU B 1 3   ? -25.771 49.581 379.555 1.00 98.49  ? 4   GLU B N   1 
ATOM   4144 C CA  . GLU B 1 3   ? -24.644 49.662 378.633 1.00 101.82 ? 4   GLU B CA  1 
ATOM   4145 C C   . GLU B 1 3   ? -24.862 48.762 377.418 1.00 109.60 ? 4   GLU B C   1 
ATOM   4146 O O   . GLU B 1 3   ? -25.207 47.590 377.560 1.00 116.60 ? 4   GLU B O   1 
ATOM   4147 C CB  . GLU B 1 3   ? -23.340 49.272 379.341 1.00 90.70  ? 4   GLU B CB  1 
ATOM   4148 C CG  . GLU B 1 3   ? -22.637 50.415 380.059 1.00 114.75 ? 4   GLU B CG  1 
ATOM   4149 C CD  . GLU B 1 3   ? -21.402 50.919 379.326 1.00 109.97 ? 4   GLU B CD  1 
ATOM   4150 O OE1 . GLU B 1 3   ? -20.335 51.044 379.967 1.00 101.69 ? 4   GLU B OE1 1 
ATOM   4151 O OE2 . GLU B 1 3   ? -21.501 51.194 378.112 1.00 106.38 ? 4   GLU B OE2 1 
ATOM   4152 N N   . ASP B 1 4   ? -24.673 49.323 376.225 1.00 103.55 ? 5   ASP B N   1 
ATOM   4153 C CA  . ASP B 1 4   ? -24.764 48.535 375.002 1.00 94.62  ? 5   ASP B CA  1 
ATOM   4154 C C   . ASP B 1 4   ? -23.506 47.694 374.841 1.00 89.52  ? 5   ASP B C   1 
ATOM   4155 O O   . ASP B 1 4   ? -22.392 48.226 374.786 1.00 81.82  ? 5   ASP B O   1 
ATOM   4156 C CB  . ASP B 1 4   ? -24.955 49.443 373.790 1.00 76.34  ? 5   ASP B CB  1 
ATOM   4157 C CG  . ASP B 1 4   ? -25.351 48.674 372.534 1.00 95.66  ? 5   ASP B CG  1 
ATOM   4158 O OD1 . ASP B 1 4   ? -25.070 47.455 372.451 1.00 93.41  ? 5   ASP B OD1 1 
ATOM   4159 O OD2 . ASP B 1 4   ? -25.943 49.288 371.623 1.00 97.01  ? 5   ASP B OD2 1 
ATOM   4160 N N   . ALA B 1 5   ? -23.691 46.377 374.742 1.00 96.13  ? 6   ALA B N   1 
ATOM   4161 C CA  . ALA B 1 5   ? -22.550 45.478 374.645 1.00 89.51  ? 6   ALA B CA  1 
ATOM   4162 C C   . ALA B 1 5   ? -21.800 45.653 373.330 1.00 97.22  ? 6   ALA B C   1 
ATOM   4163 O O   . ALA B 1 5   ? -20.597 45.370 373.266 1.00 93.81  ? 6   ALA B O   1 
ATOM   4164 C CB  . ALA B 1 5   ? -23.012 44.029 374.809 1.00 72.86  ? 6   ALA B CB  1 
ATOM   4165 N N   . GLU B 1 6   ? -22.482 46.123 372.279 1.00 92.66  ? 7   GLU B N   1 
ATOM   4166 C CA  . GLU B 1 6   ? -21.832 46.282 370.981 1.00 90.85  ? 7   GLU B CA  1 
ATOM   4167 C C   . GLU B 1 6   ? -20.791 47.396 370.998 1.00 87.71  ? 7   GLU B C   1 
ATOM   4168 O O   . GLU B 1 6   ? -19.821 47.348 370.232 1.00 75.26  ? 7   GLU B O   1 
ATOM   4169 C CB  . GLU B 1 6   ? -22.879 46.548 369.899 1.00 87.09  ? 7   GLU B CB  1 
ATOM   4170 C CG  . GLU B 1 6   ? -23.778 45.357 369.601 1.00 105.66 ? 7   GLU B CG  1 
ATOM   4171 C CD  . GLU B 1 6   ? -23.005 44.143 369.118 1.00 112.94 ? 7   GLU B CD  1 
ATOM   4172 O OE1 . GLU B 1 6   ? -23.044 43.100 369.808 1.00 116.76 ? 7   GLU B OE1 1 
ATOM   4173 O OE2 . GLU B 1 6   ? -22.363 44.230 368.048 1.00 92.79  ? 7   GLU B OE2 1 
ATOM   4174 N N   . LEU B 1 7   ? -20.962 48.395 371.861 1.00 77.11  ? 8   LEU B N   1 
ATOM   4175 C CA  . LEU B 1 7   ? -20.047 49.525 371.929 1.00 69.17  ? 8   LEU B CA  1 
ATOM   4176 C C   . LEU B 1 7   ? -18.927 49.330 372.939 1.00 64.21  ? 8   LEU B C   1 
ATOM   4177 O O   . LEU B 1 7   ? -18.162 50.268 373.180 1.00 74.44  ? 8   LEU B O   1 
ATOM   4178 C CB  . LEU B 1 7   ? -20.820 50.803 372.249 1.00 50.41  ? 8   LEU B CB  1 
ATOM   4179 C CG  . LEU B 1 7   ? -21.985 51.029 371.285 1.00 68.63  ? 8   LEU B CG  1 
ATOM   4180 C CD1 . LEU B 1 7   ? -22.718 52.313 371.609 1.00 54.06  ? 8   LEU B CD1 1 
ATOM   4181 C CD2 . LEU B 1 7   ? -21.494 51.026 369.833 1.00 58.84  ? 8   LEU B CD2 1 
ATOM   4182 N N   . LEU B 1 8   ? -18.808 48.144 373.530 1.00 63.66  ? 9   LEU B N   1 
ATOM   4183 C CA  . LEU B 1 8   ? -17.741 47.837 374.475 1.00 76.69  ? 9   LEU B CA  1 
ATOM   4184 C C   . LEU B 1 8   ? -16.827 46.798 373.849 1.00 56.17  ? 9   LEU B C   1 
ATOM   4185 O O   . LEU B 1 8   ? -17.285 45.727 373.437 1.00 70.63  ? 9   LEU B O   1 
ATOM   4186 C CB  . LEU B 1 8   ? -18.293 47.326 375.806 1.00 74.19  ? 9   LEU B CB  1 
ATOM   4187 C CG  . LEU B 1 8   ? -19.203 48.283 376.565 1.00 58.92  ? 9   LEU B CG  1 
ATOM   4188 C CD1 . LEU B 1 8   ? -19.821 47.572 377.753 1.00 66.55  ? 9   LEU B CD1 1 
ATOM   4189 C CD2 . LEU B 1 8   ? -18.417 49.509 377.004 1.00 68.67  ? 9   LEU B CD2 1 
ATOM   4190 N N   . VAL B 1 9   ? -15.540 47.112 373.792 1.00 39.49  ? 10  VAL B N   1 
ATOM   4191 C CA  . VAL B 1 9   ? -14.547 46.255 373.166 1.00 55.44  ? 10  VAL B CA  1 
ATOM   4192 C C   . VAL B 1 9   ? -13.287 46.345 374.002 1.00 49.45  ? 10  VAL B C   1 
ATOM   4193 O O   . VAL B 1 9   ? -12.970 47.407 374.548 1.00 59.87  ? 10  VAL B O   1 
ATOM   4194 C CB  . VAL B 1 9   ? -14.280 46.671 371.701 1.00 50.81  ? 10  VAL B CB  1 
ATOM   4195 C CG1 . VAL B 1 9   ? -12.956 46.109 371.200 1.00 54.37  ? 10  VAL B CG1 1 
ATOM   4196 C CG2 . VAL B 1 9   ? -15.416 46.220 370.816 1.00 53.75  ? 10  VAL B CG2 1 
ATOM   4197 N N   . THR B 1 10  ? -12.579 45.231 374.118 1.00 61.63  ? 11  THR B N   1 
ATOM   4198 C CA  . THR B 1 10  ? -11.323 45.183 374.846 1.00 66.31  ? 11  THR B CA  1 
ATOM   4199 C C   . THR B 1 10  ? -10.194 44.932 373.862 1.00 56.84  ? 11  THR B C   1 
ATOM   4200 O O   . THR B 1 10  ? -10.155 43.885 373.206 1.00 60.99  ? 11  THR B O   1 
ATOM   4201 C CB  . THR B 1 10  ? -11.354 44.096 375.916 1.00 69.15  ? 11  THR B CB  1 
ATOM   4202 O OG1 . THR B 1 10  ? -12.414 44.379 376.835 1.00 65.51  ? 11  THR B OG1 1 
ATOM   4203 C CG2 . THR B 1 10  ? -10.016 44.049 376.659 1.00 45.94  ? 11  THR B CG2 1 
ATOM   4204 N N   . VAL B 1 11  ? -9.290  45.896 373.759 1.00 61.44  ? 12  VAL B N   1 
ATOM   4205 C CA  . VAL B 1 11  ? -8.074  45.732 373.008 1.00 55.47  ? 12  VAL B CA  1 
ATOM   4206 C C   . VAL B 1 11  ? -6.945  45.462 373.994 1.00 66.80  ? 12  VAL B C   1 
ATOM   4207 O O   . VAL B 1 11  ? -7.112  45.564 375.207 1.00 69.34  ? 12  VAL B O   1 
ATOM   4208 C CB  . VAL B 1 11  ? -7.778  46.962 372.120 1.00 68.51  ? 12  VAL B CB  1 
ATOM   4209 C CG1 . VAL B 1 11  ? -8.931  47.198 371.168 1.00 58.20  ? 12  VAL B CG1 1 
ATOM   4210 C CG2 . VAL B 1 11  ? -7.531  48.192 372.978 1.00 61.35  ? 12  VAL B CG2 1 
ATOM   4211 N N   . ARG B 1 12  ? -5.768  45.128 373.466 1.00 63.64  ? 13  ARG B N   1 
ATOM   4212 C CA  . ARG B 1 12  ? -4.672  44.692 374.323 1.00 76.90  ? 13  ARG B CA  1 
ATOM   4213 C C   . ARG B 1 12  ? -4.228  45.758 375.320 1.00 73.86  ? 13  ARG B C   1 
ATOM   4214 O O   . ARG B 1 12  ? -3.543  45.426 376.293 1.00 73.98  ? 13  ARG B O   1 
ATOM   4215 C CB  . ARG B 1 12  ? -3.487  44.252 373.465 1.00 60.86  ? 13  ARG B CB  1 
ATOM   4216 C CG  . ARG B 1 12  ? -3.467  42.763 373.179 1.00 80.80  ? 13  ARG B CG  1 
ATOM   4217 C CD  . ARG B 1 12  ? -2.310  42.405 372.272 1.00 98.14  ? 13  ARG B CD  1 
ATOM   4218 N NE  . ARG B 1 12  ? -2.670  41.353 371.330 1.00 107.14 ? 13  ARG B NE  1 
ATOM   4219 C CZ  . ARG B 1 12  ? -1.803  40.746 370.528 1.00 106.57 ? 13  ARG B CZ  1 
ATOM   4220 N NH1 . ARG B 1 12  ? -0.521  41.089 370.555 1.00 104.59 ? 13  ARG B NH1 1 
ATOM   4221 N NH2 . ARG B 1 12  ? -2.216  39.796 369.699 1.00 102.72 ? 13  ARG B NH2 1 
ATOM   4222 N N   . GLY B 1 13  ? -4.608  47.019 375.118 1.00 73.71  ? 14  GLY B N   1 
ATOM   4223 C CA  . GLY B 1 13  ? -4.199  48.081 376.021 1.00 64.56  ? 14  GLY B CA  1 
ATOM   4224 C C   . GLY B 1 13  ? -5.191  48.391 377.127 1.00 70.28  ? 14  GLY B C   1 
ATOM   4225 O O   . GLY B 1 13  ? -4.837  49.015 378.134 1.00 52.12  ? 14  GLY B O   1 
ATOM   4226 N N   . GLY B 1 14  ? -6.434  47.962 376.955 1.00 57.17  ? 15  GLY B N   1 
ATOM   4227 C CA  . GLY B 1 14  ? -7.477  48.301 377.904 1.00 54.93  ? 15  GLY B CA  1 
ATOM   4228 C C   . GLY B 1 14  ? -8.840  48.177 377.249 1.00 58.36  ? 15  GLY B C   1 
ATOM   4229 O O   . GLY B 1 14  ? -8.981  47.566 376.193 1.00 62.21  ? 15  GLY B O   1 
ATOM   4230 N N   . ARG B 1 15  ? -9.830  48.776 377.899 1.00 60.79  ? 16  ARG B N   1 
ATOM   4231 C CA  . ARG B 1 15  ? -11.206 48.717 377.433 1.00 69.08  ? 16  ARG B CA  1 
ATOM   4232 C C   . ARG B 1 15  ? -11.620 50.030 376.783 1.00 65.77  ? 16  ARG B C   1 
ATOM   4233 O O   . ARG B 1 15  ? -11.170 51.114 377.172 1.00 51.93  ? 16  ARG B O   1 
ATOM   4234 C CB  . ARG B 1 15  ? -12.158 48.380 378.580 1.00 63.20  ? 16  ARG B CB  1 
ATOM   4235 C CG  . ARG B 1 15  ? -11.778 47.107 379.312 1.00 81.27  ? 16  ARG B CG  1 
ATOM   4236 C CD  . ARG B 1 15  ? -12.110 47.205 380.785 1.00 81.84  ? 16  ARG B CD  1 
ATOM   4237 N NE  . ARG B 1 15  ? -13.526 47.473 380.999 1.00 86.27  ? 16  ARG B NE  1 
ATOM   4238 C CZ  . ARG B 1 15  ? -14.013 48.017 382.106 1.00 75.28  ? 16  ARG B CZ  1 
ATOM   4239 N NH1 . ARG B 1 15  ? -13.190 48.362 383.086 1.00 77.37  ? 16  ARG B NH1 1 
ATOM   4240 N NH2 . ARG B 1 15  ? -15.317 48.230 382.228 1.00 82.33  ? 16  ARG B NH2 1 
ATOM   4241 N N   . LEU B 1 16  ? -12.496 49.911 375.785 1.00 52.23  ? 17  LEU B N   1 
ATOM   4242 C CA  . LEU B 1 16  ? -12.954 51.034 374.986 1.00 62.39  ? 17  LEU B CA  1 
ATOM   4243 C C   . LEU B 1 16  ? -14.474 51.074 374.978 1.00 56.91  ? 17  LEU B C   1 
ATOM   4244 O O   . LEU B 1 16  ? -15.142 50.037 375.035 1.00 51.87  ? 17  LEU B O   1 
ATOM   4245 C CB  . LEU B 1 16  ? -12.443 50.946 373.532 1.00 62.09  ? 17  LEU B CB  1 
ATOM   4246 C CG  . LEU B 1 16  ? -10.936 50.820 373.313 1.00 59.86  ? 17  LEU B CG  1 
ATOM   4247 C CD1 . LEU B 1 16  ? -10.629 50.396 371.881 1.00 64.76  ? 17  LEU B CD1 1 
ATOM   4248 C CD2 . LEU B 1 16  ? -10.250 52.134 373.653 1.00 53.63  ? 17  LEU B CD2 1 
ATOM   4249 N N   . ARG B 1 17  ? -15.006 52.291 374.892 1.00 51.65  ? 18  ARG B N   1 
ATOM   4250 C CA  . ARG B 1 17  ? -16.428 52.540 374.707 1.00 55.78  ? 18  ARG B CA  1 
ATOM   4251 C C   . ARG B 1 17  ? -16.602 53.360 373.438 1.00 64.11  ? 18  ARG B C   1 
ATOM   4252 O O   . ARG B 1 17  ? -15.919 54.374 373.254 1.00 55.12  ? 18  ARG B O   1 
ATOM   4253 C CB  . ARG B 1 17  ? -17.020 53.276 375.915 1.00 61.44  ? 18  ARG B CB  1 
ATOM   4254 C CG  . ARG B 1 17  ? -18.529 53.490 375.857 1.00 62.44  ? 18  ARG B CG  1 
ATOM   4255 C CD  . ARG B 1 17  ? -19.104 53.775 377.248 1.00 79.16  ? 18  ARG B CD  1 
ATOM   4256 N NE  . ARG B 1 17  ? -18.130 54.462 378.090 1.00 89.36  ? 18  ARG B NE  1 
ATOM   4257 C CZ  . ARG B 1 17  ? -17.696 54.018 379.264 1.00 68.39  ? 18  ARG B CZ  1 
ATOM   4258 N NH1 . ARG B 1 17  ? -18.158 52.882 379.767 1.00 78.54  ? 18  ARG B NH1 1 
ATOM   4259 N NH2 . ARG B 1 17  ? -16.797 54.719 379.939 1.00 76.19  ? 18  ARG B NH2 1 
ATOM   4260 N N   . GLY B 1 18  ? -17.506 52.919 372.561 1.00 61.83  ? 19  GLY B N   1 
ATOM   4261 C CA  . GLY B 1 18  ? -17.739 53.560 371.294 1.00 56.27  ? 19  GLY B CA  1 
ATOM   4262 C C   . GLY B 1 18  ? -19.099 54.221 371.207 1.00 59.58  ? 19  GLY B C   1 
ATOM   4263 O O   . GLY B 1 18  ? -19.763 54.490 372.218 1.00 68.17  ? 19  GLY B O   1 
ATOM   4264 N N   . ILE B 1 19  ? -19.522 54.487 369.973 1.00 55.67  ? 20  ILE B N   1 
ATOM   4265 C CA  . ILE B 1 19  ? -20.789 55.146 369.685 1.00 65.10  ? 20  ILE B CA  1 
ATOM   4266 C C   . ILE B 1 19  ? -21.459 54.433 368.521 1.00 60.31  ? 20  ILE B C   1 
ATOM   4267 O O   . ILE B 1 19  ? -20.794 53.875 367.644 1.00 64.95  ? 20  ILE B O   1 
ATOM   4268 C CB  . ILE B 1 19  ? -20.606 56.639 369.339 1.00 60.36  ? 20  ILE B CB  1 
ATOM   4269 C CG1 . ILE B 1 19  ? -19.448 56.809 368.354 1.00 74.52  ? 20  ILE B CG1 1 
ATOM   4270 C CG2 . ILE B 1 19  ? -20.360 57.448 370.576 1.00 62.70  ? 20  ILE B CG2 1 
ATOM   4271 C CD1 . ILE B 1 19  ? -19.444 58.140 367.651 1.00 84.97  ? 20  ILE B CD1 1 
ATOM   4272 N N   . ARG B 1 20  ? -22.786 54.472 368.511 1.00 61.70  ? 21  ARG B N   1 
ATOM   4273 C CA  . ARG B 1 20  ? -23.585 53.966 367.404 1.00 72.76  ? 21  ARG B CA  1 
ATOM   4274 C C   . ARG B 1 20  ? -23.888 55.139 366.476 1.00 75.40  ? 21  ARG B C   1 
ATOM   4275 O O   . ARG B 1 20  ? -24.620 56.062 366.849 1.00 65.49  ? 21  ARG B O   1 
ATOM   4276 C CB  . ARG B 1 20  ? -24.865 53.306 367.915 1.00 75.54  ? 21  ARG B CB  1 
ATOM   4277 C CG  . ARG B 1 20  ? -25.959 53.151 366.873 1.00 78.04  ? 21  ARG B CG  1 
ATOM   4278 C CD  . ARG B 1 20  ? -27.164 52.427 367.453 1.00 92.09  ? 21  ARG B CD  1 
ATOM   4279 N NE  . ARG B 1 20  ? -28.353 52.593 366.621 1.00 108.36 ? 21  ARG B NE  1 
ATOM   4280 C CZ  . ARG B 1 20  ? -29.398 51.770 366.630 1.00 103.67 ? 21  ARG B CZ  1 
ATOM   4281 N NH1 . ARG B 1 20  ? -29.408 50.712 367.431 1.00 111.14 ? 21  ARG B NH1 1 
ATOM   4282 N NH2 . ARG B 1 20  ? -30.434 52.003 365.834 1.00 98.93  ? 21  ARG B NH2 1 
ATOM   4283 N N   . LEU B 1 21  ? -23.302 55.114 365.281 1.00 78.67  ? 22  LEU B N   1 
ATOM   4284 C CA  . LEU B 1 21  ? -23.563 56.130 364.272 1.00 68.23  ? 22  LEU B CA  1 
ATOM   4285 C C   . LEU B 1 21  ? -24.769 55.747 363.428 1.00 71.55  ? 22  LEU B C   1 
ATOM   4286 O O   . LEU B 1 21  ? -24.898 54.601 362.987 1.00 77.13  ? 22  LEU B O   1 
ATOM   4287 C CB  . LEU B 1 21  ? -22.358 56.325 363.353 1.00 65.68  ? 22  LEU B CB  1 
ATOM   4288 C CG  . LEU B 1 21  ? -21.019 56.766 363.930 1.00 70.37  ? 22  LEU B CG  1 
ATOM   4289 C CD1 . LEU B 1 21  ? -19.991 56.747 362.820 1.00 91.63  ? 22  LEU B CD1 1 
ATOM   4290 C CD2 . LEU B 1 21  ? -21.132 58.153 364.520 1.00 87.39  ? 22  LEU B CD2 1 
ATOM   4291 N N   . LYS B 1 22  ? -25.638 56.721 363.190 1.00 68.47  ? 23  LYS B N   1 
ATOM   4292 C CA  . LYS B 1 22  ? -26.758 56.537 362.282 1.00 73.13  ? 23  LYS B CA  1 
ATOM   4293 C C   . LYS B 1 22  ? -26.327 56.811 360.846 1.00 77.29  ? 23  LYS B C   1 
ATOM   4294 O O   . LYS B 1 22  ? -25.618 57.782 360.568 1.00 72.34  ? 23  LYS B O   1 
ATOM   4295 C CB  . LYS B 1 22  ? -27.915 57.458 362.668 1.00 74.97  ? 23  LYS B CB  1 
ATOM   4296 C CG  . LYS B 1 22  ? -28.560 57.106 363.998 1.00 89.09  ? 23  LYS B CG  1 
ATOM   4297 C CD  . LYS B 1 22  ? -29.452 58.230 364.488 1.00 91.30  ? 23  LYS B CD  1 
ATOM   4298 C CE  . LYS B 1 22  ? -30.917 57.843 364.413 1.00 97.67  ? 23  LYS B CE  1 
ATOM   4299 N NZ  . LYS B 1 22  ? -31.572 57.964 365.744 1.00 98.14  ? 23  LYS B NZ  1 
ATOM   4300 N N   . THR B 1 23  ? -26.738 55.935 359.941 1.00 65.02  ? 24  THR B N   1 
ATOM   4301 C CA  . THR B 1 23  ? -26.597 56.133 358.508 1.00 75.55  ? 24  THR B CA  1 
ATOM   4302 C C   . THR B 1 23  ? -27.963 55.930 357.874 1.00 75.91  ? 24  THR B C   1 
ATOM   4303 O O   . THR B 1 23  ? -28.866 55.367 358.504 1.00 84.52  ? 24  THR B O   1 
ATOM   4304 C CB  . THR B 1 23  ? -25.577 55.164 357.887 1.00 60.25  ? 24  THR B CB  1 
ATOM   4305 O OG1 . THR B 1 23  ? -26.180 53.879 357.710 1.00 70.26  ? 24  THR B OG1 1 
ATOM   4306 C CG2 . THR B 1 23  ? -24.346 55.025 358.766 1.00 71.83  ? 24  THR B CG2 1 
ATOM   4307 N N   . PRO B 1 24  ? -28.163 56.405 356.640 1.00 85.32  ? 25  PRO B N   1 
ATOM   4308 C CA  . PRO B 1 24  ? -29.431 56.108 355.950 1.00 82.88  ? 25  PRO B CA  1 
ATOM   4309 C C   . PRO B 1 24  ? -29.755 54.624 355.892 1.00 78.57  ? 25  PRO B C   1 
ATOM   4310 O O   . PRO B 1 24  ? -30.908 54.241 356.119 1.00 91.49  ? 25  PRO B O   1 
ATOM   4311 C CB  . PRO B 1 24  ? -29.211 56.698 354.551 1.00 86.26  ? 25  PRO B CB  1 
ATOM   4312 C CG  . PRO B 1 24  ? -28.212 57.775 354.753 1.00 89.34  ? 25  PRO B CG  1 
ATOM   4313 C CD  . PRO B 1 24  ? -27.312 57.326 355.864 1.00 76.70  ? 25  PRO B CD  1 
ATOM   4314 N N   . GLY B 1 25  ? -28.763 53.775 355.614 1.00 76.74  ? 26  GLY B N   1 
ATOM   4315 C CA  . GLY B 1 25  ? -29.022 52.350 355.517 1.00 72.41  ? 26  GLY B CA  1 
ATOM   4316 C C   . GLY B 1 25  ? -29.212 51.655 356.848 1.00 84.53  ? 26  GLY B C   1 
ATOM   4317 O O   . GLY B 1 25  ? -29.884 50.621 356.914 1.00 97.61  ? 26  GLY B O   1 
ATOM   4318 N N   . GLY B 1 26  ? -28.634 52.194 357.919 1.00 83.51  ? 27  GLY B N   1 
ATOM   4319 C CA  . GLY B 1 26  ? -28.715 51.565 359.216 1.00 76.59  ? 27  GLY B CA  1 
ATOM   4320 C C   . GLY B 1 26  ? -27.591 51.984 360.143 1.00 79.64  ? 27  GLY B C   1 
ATOM   4321 O O   . GLY B 1 26  ? -26.796 52.874 359.831 1.00 84.68  ? 27  GLY B O   1 
ATOM   4322 N N   . PRO B 1 27  ? -27.498 51.343 361.304 1.00 79.99  ? 28  PRO B N   1 
ATOM   4323 C CA  . PRO B 1 27  ? -26.480 51.731 362.283 1.00 75.65  ? 28  PRO B CA  1 
ATOM   4324 C C   . PRO B 1 27  ? -25.131 51.086 362.006 1.00 77.05  ? 28  PRO B C   1 
ATOM   4325 O O   . PRO B 1 27  ? -25.028 50.020 361.393 1.00 72.30  ? 28  PRO B O   1 
ATOM   4326 C CB  . PRO B 1 27  ? -27.059 51.230 363.615 1.00 71.37  ? 28  PRO B CB  1 
ATOM   4327 C CG  . PRO B 1 27  ? -28.220 50.308 363.255 1.00 82.96  ? 28  PRO B CG  1 
ATOM   4328 C CD  . PRO B 1 27  ? -28.283 50.186 361.759 1.00 93.88  ? 28  PRO B CD  1 
ATOM   4329 N N   . VAL B 1 28  ? -24.081 51.770 362.461 1.00 67.64  ? 29  VAL B N   1 
ATOM   4330 C CA  . VAL B 1 28  ? -22.723 51.236 362.467 1.00 65.25  ? 29  VAL B CA  1 
ATOM   4331 C C   . VAL B 1 28  ? -22.064 51.636 363.781 1.00 68.43  ? 29  VAL B C   1 
ATOM   4332 O O   . VAL B 1 28  ? -22.428 52.640 364.401 1.00 59.45  ? 29  VAL B O   1 
ATOM   4333 C CB  . VAL B 1 28  ? -21.876 51.728 361.269 1.00 64.32  ? 29  VAL B CB  1 
ATOM   4334 C CG1 . VAL B 1 28  ? -22.659 51.667 359.954 1.00 70.38  ? 29  VAL B CG1 1 
ATOM   4335 C CG2 . VAL B 1 28  ? -21.368 53.136 361.532 1.00 66.13  ? 29  VAL B CG2 1 
ATOM   4336 N N   . SER B 1 29  ? -21.084 50.846 364.206 1.00 59.90  ? 30  SER B N   1 
ATOM   4337 C CA  . SER B 1 29  ? -20.382 51.087 365.459 1.00 58.58  ? 30  SER B CA  1 
ATOM   4338 C C   . SER B 1 29  ? -19.073 51.802 365.160 1.00 63.70  ? 30  SER B C   1 
ATOM   4339 O O   . SER B 1 29  ? -18.260 51.305 364.375 1.00 69.12  ? 30  SER B O   1 
ATOM   4340 C CB  . SER B 1 29  ? -20.111 49.779 366.198 1.00 66.88  ? 30  SER B CB  1 
ATOM   4341 O OG  . SER B 1 29  ? -21.315 49.120 366.537 1.00 67.41  ? 30  SER B OG  1 
ATOM   4342 N N   . ALA B 1 30  ? -18.863 52.954 365.792 1.00 64.53  ? 31  ALA B N   1 
ATOM   4343 C CA  . ALA B 1 30  ? -17.653 53.742 365.598 1.00 61.84  ? 31  ALA B CA  1 
ATOM   4344 C C   . ALA B 1 30  ? -16.867 53.824 366.897 1.00 62.12  ? 31  ALA B C   1 
ATOM   4345 O O   . ALA B 1 30  ? -17.442 54.059 367.963 1.00 64.59  ? 31  ALA B O   1 
ATOM   4346 C CB  . ALA B 1 30  ? -17.977 55.152 365.106 1.00 60.98  ? 31  ALA B CB  1 
ATOM   4347 N N   . PHE B 1 31  ? -15.554 53.645 366.793 1.00 61.97  ? 32  PHE B N   1 
ATOM   4348 C CA  . PHE B 1 31  ? -14.617 53.801 367.900 1.00 46.32  ? 32  PHE B CA  1 
ATOM   4349 C C   . PHE B 1 31  ? -13.601 54.862 367.474 1.00 59.91  ? 32  PHE B C   1 
ATOM   4350 O O   . PHE B 1 31  ? -12.536 54.551 366.934 1.00 53.89  ? 32  PHE B O   1 
ATOM   4351 C CB  . PHE B 1 31  ? -13.965 52.471 368.243 1.00 56.42  ? 32  PHE B CB  1 
ATOM   4352 C CG  . PHE B 1 31  ? -14.935 51.440 368.756 1.00 62.03  ? 32  PHE B CG  1 
ATOM   4353 C CD1 . PHE B 1 31  ? -15.622 50.614 367.878 1.00 63.04  ? 32  PHE B CD1 1 
ATOM   4354 C CD2 . PHE B 1 31  ? -15.170 51.307 370.116 1.00 64.55  ? 32  PHE B CD2 1 
ATOM   4355 C CE1 . PHE B 1 31  ? -16.519 49.667 368.348 1.00 64.01  ? 32  PHE B CE1 1 
ATOM   4356 C CE2 . PHE B 1 31  ? -16.066 50.362 370.596 1.00 62.18  ? 32  PHE B CE2 1 
ATOM   4357 C CZ  . PHE B 1 31  ? -16.741 49.540 369.711 1.00 68.24  ? 32  PHE B CZ  1 
ATOM   4358 N N   . LEU B 1 32  ? -13.946 56.124 367.718 1.00 55.29  ? 33  LEU B N   1 
ATOM   4359 C CA  . LEU B 1 32  ? -13.198 57.266 367.213 1.00 59.25  ? 33  LEU B CA  1 
ATOM   4360 C C   . LEU B 1 32  ? -12.286 57.825 368.296 1.00 58.87  ? 33  LEU B C   1 
ATOM   4361 O O   . LEU B 1 32  ? -12.749 58.165 369.388 1.00 61.62  ? 33  LEU B O   1 
ATOM   4362 C CB  . LEU B 1 32  ? -14.154 58.353 366.724 1.00 55.51  ? 33  LEU B CB  1 
ATOM   4363 C CG  . LEU B 1 32  ? -15.322 57.853 365.878 1.00 56.81  ? 33  LEU B CG  1 
ATOM   4364 C CD1 . LEU B 1 32  ? -16.193 59.022 365.458 1.00 53.63  ? 33  LEU B CD1 1 
ATOM   4365 C CD2 . LEU B 1 32  ? -14.801 57.096 364.662 1.00 57.11  ? 33  LEU B CD2 1 
ATOM   4366 N N   . GLY B 1 33  ? -10.999 57.936 367.986 1.00 57.18  ? 34  GLY B N   1 
ATOM   4367 C CA  . GLY B 1 33  ? -10.065 58.528 368.921 1.00 41.43  ? 34  GLY B CA  1 
ATOM   4368 C C   . GLY B 1 33  ? -9.412  57.532 369.857 1.00 57.96  ? 34  GLY B C   1 
ATOM   4369 O O   . GLY B 1 33  ? -9.177  57.841 371.029 1.00 57.76  ? 34  GLY B O   1 
ATOM   4370 N N   . ILE B 1 34  ? -9.111  56.337 369.354 1.00 50.38  ? 35  ILE B N   1 
ATOM   4371 C CA  . ILE B 1 34  ? -8.404  55.318 370.128 1.00 46.70  ? 35  ILE B CA  1 
ATOM   4372 C C   . ILE B 1 34  ? -6.919  55.654 370.160 1.00 52.03  ? 35  ILE B C   1 
ATOM   4373 O O   . ILE B 1 34  ? -6.286  55.737 369.100 1.00 57.13  ? 35  ILE B O   1 
ATOM   4374 C CB  . ILE B 1 34  ? -8.618  53.918 369.539 1.00 47.77  ? 35  ILE B CB  1 
ATOM   4375 C CG1 . ILE B 1 34  ? -10.113 53.617 369.392 1.00 50.50  ? 35  ILE B CG1 1 
ATOM   4376 C CG2 . ILE B 1 34  ? -7.897  52.869 370.377 1.00 52.83  ? 35  ILE B CG2 1 
ATOM   4377 C CD1 . ILE B 1 34  ? -10.403 52.446 368.462 1.00 62.50  ? 35  ILE B CD1 1 
ATOM   4378 N N   . PRO B 1 35  ? -6.320  55.842 371.336 1.00 61.40  ? 36  PRO B N   1 
ATOM   4379 C CA  . PRO B 1 35  ? -4.876  56.115 371.389 1.00 55.59  ? 36  PRO B CA  1 
ATOM   4380 C C   . PRO B 1 35  ? -4.073  54.873 371.025 1.00 59.45  ? 36  PRO B C   1 
ATOM   4381 O O   . PRO B 1 35  ? -4.310  53.785 371.557 1.00 55.88  ? 36  PRO B O   1 
ATOM   4382 C CB  . PRO B 1 35  ? -4.650  56.533 372.847 1.00 60.96  ? 36  PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 35  ? -5.747  55.836 373.603 1.00 60.79  ? 36  PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 35  ? -6.936  55.824 372.674 1.00 61.96  ? 36  PRO B CD  1 
ATOM   4385 N N   . PHE B 1 36  ? -3.130  55.033 370.092 1.00 51.83  ? 37  PHE B N   1 
ATOM   4386 C CA  . PHE B 1 36  ? -2.247  53.935 369.729 1.00 56.34  ? 37  PHE B CA  1 
ATOM   4387 C C   . PHE B 1 36  ? -0.780  54.228 369.996 1.00 55.52  ? 37  PHE B C   1 
ATOM   4388 O O   . PHE B 1 36  ? 0.050   53.321 369.863 1.00 58.35  ? 37  PHE B O   1 
ATOM   4389 C CB  . PHE B 1 36  ? -2.442  53.532 368.255 1.00 54.47  ? 37  PHE B CB  1 
ATOM   4390 C CG  . PHE B 1 36  ? -1.968  54.558 367.256 1.00 60.05  ? 37  PHE B CG  1 
ATOM   4391 C CD1 . PHE B 1 36  ? -0.667  54.524 366.763 1.00 44.51  ? 37  PHE B CD1 1 
ATOM   4392 C CD2 . PHE B 1 36  ? -2.834  55.535 366.781 1.00 50.96  ? 37  PHE B CD2 1 
ATOM   4393 C CE1 . PHE B 1 36  ? -0.231  55.464 365.835 1.00 59.76  ? 37  PHE B CE1 1 
ATOM   4394 C CE2 . PHE B 1 36  ? -2.407  56.478 365.849 1.00 55.88  ? 37  PHE B CE2 1 
ATOM   4395 C CZ  . PHE B 1 36  ? -1.105  56.442 365.375 1.00 58.04  ? 37  PHE B CZ  1 
ATOM   4396 N N   . ALA B 1 37  ? -0.439  55.448 370.391 1.00 53.60  ? 38  ALA B N   1 
ATOM   4397 C CA  . ALA B 1 37  ? 0.923   55.777 370.760 1.00 50.01  ? 38  ALA B CA  1 
ATOM   4398 C C   . ALA B 1 37  ? 0.901   56.735 371.943 1.00 70.68  ? 38  ALA B C   1 
ATOM   4399 O O   . ALA B 1 37  ? -0.095  57.419 372.196 1.00 53.07  ? 38  ALA B O   1 
ATOM   4400 C CB  . ALA B 1 37  ? 1.687   56.400 369.588 1.00 45.93  ? 38  ALA B CB  1 
ATOM   4401 N N   . GLU B 1 38  ? 2.008   56.764 372.676 1.00 65.02  ? 39  GLU B N   1 
ATOM   4402 C CA  . GLU B 1 38  ? 2.190   57.808 373.669 1.00 59.94  ? 39  GLU B CA  1 
ATOM   4403 C C   . GLU B 1 38  ? 2.262   59.162 372.967 1.00 55.30  ? 39  GLU B C   1 
ATOM   4404 O O   . GLU B 1 38  ? 2.822   59.260 371.869 1.00 73.24  ? 39  GLU B O   1 
ATOM   4405 C CB  . GLU B 1 38  ? 3.462   57.570 374.485 1.00 60.93  ? 39  GLU B CB  1 
ATOM   4406 C CG  . GLU B 1 38  ? 3.345   56.434 375.479 1.00 72.32  ? 39  GLU B CG  1 
ATOM   4407 C CD  . GLU B 1 38  ? 2.326   56.721 376.563 1.00 77.39  ? 39  GLU B CD  1 
ATOM   4408 O OE1 . GLU B 1 38  ? 1.419   55.882 376.755 1.00 66.47  ? 39  GLU B OE1 1 
ATOM   4409 O OE2 . GLU B 1 38  ? 2.430   57.784 377.218 1.00 76.31  ? 39  GLU B OE2 1 
ATOM   4410 N N   . PRO B 1 39  ? 1.693   60.211 373.552 1.00 65.27  ? 40  PRO B N   1 
ATOM   4411 C CA  . PRO B 1 39  ? 1.727   61.535 372.915 1.00 61.19  ? 40  PRO B CA  1 
ATOM   4412 C C   . PRO B 1 39  ? 3.149   61.978 372.618 1.00 54.29  ? 40  PRO B C   1 
ATOM   4413 O O   . PRO B 1 39  ? 3.979   62.109 373.528 1.00 61.54  ? 40  PRO B O   1 
ATOM   4414 C CB  . PRO B 1 39  ? 1.059   62.438 373.962 1.00 45.86  ? 40  PRO B CB  1 
ATOM   4415 C CG  . PRO B 1 39  ? 0.068   61.526 374.607 1.00 48.44  ? 40  PRO B CG  1 
ATOM   4416 C CD  . PRO B 1 39  ? 0.782   60.189 374.711 1.00 55.22  ? 40  PRO B CD  1 
ATOM   4417 N N   . PRO B 1 40  ? 3.469   62.219 371.348 1.00 74.77  ? 41  PRO B N   1 
ATOM   4418 C CA  . PRO B 1 40  ? 4.843   62.610 370.962 1.00 67.41  ? 41  PRO B CA  1 
ATOM   4419 C C   . PRO B 1 40  ? 5.130   64.080 371.251 1.00 65.10  ? 41  PRO B C   1 
ATOM   4420 O O   . PRO B 1 40  ? 5.365   64.905 370.360 1.00 72.66  ? 41  PRO B O   1 
ATOM   4421 C CB  . PRO B 1 40  ? 4.863   62.280 369.466 1.00 59.74  ? 41  PRO B CB  1 
ATOM   4422 C CG  . PRO B 1 40  ? 3.462   62.542 369.033 1.00 66.03  ? 41  PRO B CG  1 
ATOM   4423 C CD  . PRO B 1 40  ? 2.582   62.096 370.178 1.00 55.29  ? 41  PRO B CD  1 
ATOM   4424 N N   . MET B 1 41  ? 5.223   64.379 372.519 1.00 76.41  ? 42  MET B N   1 
ATOM   4425 C CA  . MET B 1 41  ? 5.458   65.749 372.929 1.00 77.71  ? 42  MET B CA  1 
ATOM   4426 C C   . MET B 1 41  ? 6.649   65.950 373.804 1.00 73.64  ? 42  MET B C   1 
ATOM   4427 O O   . MET B 1 41  ? 7.156   65.032 374.389 1.00 65.30  ? 42  MET B O   1 
ATOM   4428 C CB  . MET B 1 41  ? 4.290   66.276 373.732 1.00 81.64  ? 42  MET B CB  1 
ATOM   4429 C CG  . MET B 1 41  ? 3.024   65.498 373.627 1.00 66.47  ? 42  MET B CG  1 
ATOM   4430 S SD  . MET B 1 41  ? 1.712   66.577 374.031 1.00 105.88 ? 42  MET B SD  1 
ATOM   4431 C CE  . MET B 1 41  ? 2.139   68.025 373.091 1.00 73.46  ? 42  MET B CE  1 
ATOM   4432 N N   . GLY B 1 42  ? 7.080   67.193 373.882 1.00 64.54  ? 43  GLY B N   1 
ATOM   4433 C CA  . GLY B 1 42  ? 8.198   67.527 374.716 1.00 77.18  ? 43  GLY B CA  1 
ATOM   4434 C C   . GLY B 1 42  ? 9.389   66.768 374.258 1.00 78.15  ? 43  GLY B C   1 
ATOM   4435 O O   . GLY B 1 42  ? 9.819   66.903 373.151 1.00 66.14  ? 43  GLY B O   1 
ATOM   4436 N N   . PRO B 1 43  ? 9.952   65.997 375.150 1.00 75.42  ? 44  PRO B N   1 
ATOM   4437 C CA  . PRO B 1 43  ? 11.116  65.167 374.797 1.00 73.67  ? 44  PRO B CA  1 
ATOM   4438 C C   . PRO B 1 43  ? 10.846  64.170 373.679 1.00 70.07  ? 44  PRO B C   1 
ATOM   4439 O O   . PRO B 1 43  ? 11.804  63.693 373.057 1.00 63.89  ? 44  PRO B O   1 
ATOM   4440 C CB  . PRO B 1 43  ? 11.445  64.448 376.114 1.00 58.61  ? 44  PRO B CB  1 
ATOM   4441 C CG  . PRO B 1 43  ? 10.144  64.454 376.876 1.00 55.31  ? 44  PRO B CG  1 
ATOM   4442 C CD  . PRO B 1 43  ? 9.517   65.781 376.541 1.00 55.44  ? 44  PRO B CD  1 
ATOM   4443 N N   . ARG B 1 44  ? 9.585   63.838 373.406 1.00 68.89  ? 45  ARG B N   1 
ATOM   4444 C CA  . ARG B 1 44  ? 9.237   62.857 372.386 1.00 62.72  ? 45  ARG B CA  1 
ATOM   4445 C C   . ARG B 1 44  ? 9.003   63.474 371.010 1.00 71.04  ? 45  ARG B C   1 
ATOM   4446 O O   . ARG B 1 44  ? 8.699   62.741 370.060 1.00 57.48  ? 45  ARG B O   1 
ATOM   4447 C CB  . ARG B 1 44  ? 7.996   62.073 372.813 1.00 60.60  ? 45  ARG B CB  1 
ATOM   4448 C CG  . ARG B 1 44  ? 8.177   61.257 374.069 1.00 65.66  ? 45  ARG B CG  1 
ATOM   4449 C CD  . ARG B 1 44  ? 7.064   60.237 374.182 1.00 83.72  ? 45  ARG B CD  1 
ATOM   4450 N NE  . ARG B 1 44  ? 6.931   59.711 375.536 1.00 104.39 ? 45  ARG B NE  1 
ATOM   4451 C CZ  . ARG B 1 44  ? 7.425   58.544 375.928 1.00 106.62 ? 45  ARG B CZ  1 
ATOM   4452 N NH1 . ARG B 1 44  ? 8.088   57.783 375.065 1.00 98.29  ? 45  ARG B NH1 1 
ATOM   4453 N NH2 . ARG B 1 44  ? 7.257   58.138 377.179 1.00 105.42 ? 45  ARG B NH2 1 
ATOM   4454 N N   . ARG B 1 45  ? 9.132   64.792 370.884 1.00 61.80  ? 46  ARG B N   1 
ATOM   4455 C CA  . ARG B 1 45  ? 9.023   65.440 369.587 1.00 58.81  ? 46  ARG B CA  1 
ATOM   4456 C C   . ARG B 1 45  ? 10.179  65.010 368.690 1.00 63.58  ? 46  ARG B C   1 
ATOM   4457 O O   . ARG B 1 45  ? 11.320  64.887 369.142 1.00 71.07  ? 46  ARG B O   1 
ATOM   4458 C CB  . ARG B 1 45  ? 9.012   66.960 369.759 1.00 51.39  ? 46  ARG B CB  1 
ATOM   4459 C CG  . ARG B 1 45  ? 8.783   67.745 368.476 1.00 65.30  ? 46  ARG B CG  1 
ATOM   4460 C CD  . ARG B 1 45  ? 9.017   69.232 368.693 1.00 55.36  ? 46  ARG B CD  1 
ATOM   4461 N NE  . ARG B 1 45  ? 7.794   69.937 369.065 1.00 61.69  ? 46  ARG B NE  1 
ATOM   4462 C CZ  . ARG B 1 45  ? 7.731   71.244 369.300 1.00 57.26  ? 46  ARG B CZ  1 
ATOM   4463 N NH1 . ARG B 1 45  ? 8.824   71.987 369.206 1.00 59.36  ? 46  ARG B NH1 1 
ATOM   4464 N NH2 . ARG B 1 45  ? 6.579   71.809 369.627 1.00 64.87  ? 46  ARG B NH2 1 
ATOM   4465 N N   . PHE B 1 46  ? 9.867   64.768 367.413 1.00 66.22  ? 47  PHE B N   1 
ATOM   4466 C CA  . PHE B 1 46  ? 10.779  64.265 366.385 1.00 53.92  ? 47  PHE B CA  1 
ATOM   4467 C C   . PHE B 1 46  ? 11.211  62.822 366.618 1.00 54.87  ? 47  PHE B C   1 
ATOM   4468 O O   . PHE B 1 46  ? 12.069  62.321 365.888 1.00 56.41  ? 47  PHE B O   1 
ATOM   4469 C CB  . PHE B 1 46  ? 12.040  65.126 366.241 1.00 48.89  ? 47  PHE B CB  1 
ATOM   4470 C CG  . PHE B 1 46  ? 11.774  66.601 366.125 1.00 54.08  ? 47  PHE B CG  1 
ATOM   4471 C CD1 . PHE B 1 46  ? 10.998  67.106 365.095 1.00 49.63  ? 47  PHE B CD1 1 
ATOM   4472 C CD2 . PHE B 1 46  ? 12.334  67.488 367.029 1.00 52.32  ? 47  PHE B CD2 1 
ATOM   4473 C CE1 . PHE B 1 46  ? 10.771  68.467 364.979 1.00 52.46  ? 47  PHE B CE1 1 
ATOM   4474 C CE2 . PHE B 1 46  ? 12.112  68.853 366.919 1.00 64.44  ? 47  PHE B CE2 1 
ATOM   4475 C CZ  . PHE B 1 46  ? 11.328  69.342 365.894 1.00 64.81  ? 47  PHE B CZ  1 
ATOM   4476 N N   . LEU B 1 47  ? 10.646  62.139 367.605 1.00 57.98  ? 48  LEU B N   1 
ATOM   4477 C CA  . LEU B 1 47  ? 11.082  60.789 367.926 1.00 59.80  ? 48  LEU B CA  1 
ATOM   4478 C C   . LEU B 1 47  ? 10.117  59.762 367.349 1.00 46.35  ? 48  LEU B C   1 
ATOM   4479 O O   . LEU B 1 47  ? 8.946   60.071 367.105 1.00 50.56  ? 48  LEU B O   1 
ATOM   4480 C CB  . LEU B 1 47  ? 11.170  60.589 369.446 1.00 60.71  ? 48  LEU B CB  1 
ATOM   4481 C CG  . LEU B 1 47  ? 12.367  61.163 370.208 1.00 77.03  ? 48  LEU B CG  1 
ATOM   4482 C CD1 . LEU B 1 47  ? 12.542  60.466 371.559 1.00 66.54  ? 48  LEU B CD1 1 
ATOM   4483 C CD2 . LEU B 1 47  ? 13.626  61.043 369.379 1.00 68.53  ? 48  LEU B CD2 1 
ATOM   4484 N N   . PRO B 1 48  ? 10.579  58.533 367.122 1.00 54.48  ? 49  PRO B N   1 
ATOM   4485 C CA  . PRO B 1 48  ? 9.659   57.480 366.704 1.00 55.27  ? 49  PRO B CA  1 
ATOM   4486 C C   . PRO B 1 48  ? 8.567   57.294 367.738 1.00 64.57  ? 49  PRO B C   1 
ATOM   4487 O O   . PRO B 1 48  ? 8.762   57.587 368.932 1.00 65.63  ? 49  PRO B O   1 
ATOM   4488 C CB  . PRO B 1 48  ? 10.560  56.240 366.608 1.00 50.79  ? 49  PRO B CB  1 
ATOM   4489 C CG  . PRO B 1 48  ? 11.934  56.777 366.403 1.00 57.40  ? 49  PRO B CG  1 
ATOM   4490 C CD  . PRO B 1 48  ? 11.983  58.079 367.144 1.00 51.13  ? 49  PRO B CD  1 
ATOM   4491 N N   . PRO B 1 49  ? 7.402   56.803 367.328 1.00 70.13  ? 50  PRO B N   1 
ATOM   4492 C CA  . PRO B 1 49  ? 6.291   56.673 368.279 1.00 55.61  ? 50  PRO B CA  1 
ATOM   4493 C C   . PRO B 1 49  ? 6.528   55.551 369.280 1.00 56.54  ? 50  PRO B C   1 
ATOM   4494 O O   . PRO B 1 49  ? 6.972   54.456 368.925 1.00 59.06  ? 50  PRO B O   1 
ATOM   4495 C CB  . PRO B 1 49  ? 5.089   56.369 367.378 1.00 51.27  ? 50  PRO B CB  1 
ATOM   4496 C CG  . PRO B 1 49  ? 5.690   55.724 366.161 1.00 48.19  ? 50  PRO B CG  1 
ATOM   4497 C CD  . PRO B 1 49  ? 7.041   56.357 365.972 1.00 44.20  ? 50  PRO B CD  1 
ATOM   4498 N N   . GLU B 1 50  ? 6.225   55.837 370.545 1.00 63.60  ? 51  GLU B N   1 
ATOM   4499 C CA  . GLU B 1 50  ? 6.242   54.752 371.519 1.00 64.66  ? 51  GLU B CA  1 
ATOM   4500 C C   . GLU B 1 50  ? 4.842   54.162 371.648 1.00 66.80  ? 51  GLU B C   1 
ATOM   4501 O O   . GLU B 1 50  ? 3.857   54.908 371.651 1.00 63.09  ? 51  GLU B O   1 
ATOM   4502 C CB  . GLU B 1 50  ? 6.720   55.247 372.881 1.00 58.96  ? 51  GLU B CB  1 
ATOM   4503 C CG  . GLU B 1 50  ? 7.264   54.144 373.788 1.00 107.56 ? 51  GLU B CG  1 
ATOM   4504 C CD  . GLU B 1 50  ? 7.156   54.482 375.269 1.00 116.02 ? 51  GLU B CD  1 
ATOM   4505 O OE1 . GLU B 1 50  ? 6.472   53.740 376.007 1.00 103.36 ? 51  GLU B OE1 1 
ATOM   4506 O OE2 . GLU B 1 50  ? 7.764   55.485 375.696 1.00 124.03 ? 51  GLU B OE2 1 
ATOM   4507 N N   . PRO B 1 51  ? 4.716   52.836 371.719 1.00 58.14  ? 52  PRO B N   1 
ATOM   4508 C CA  . PRO B 1 51  ? 3.384   52.232 371.835 1.00 64.61  ? 52  PRO B CA  1 
ATOM   4509 C C   . PRO B 1 51  ? 2.650   52.728 373.072 1.00 72.40  ? 52  PRO B C   1 
ATOM   4510 O O   . PRO B 1 51  ? 3.253   53.031 374.104 1.00 68.31  ? 52  PRO B O   1 
ATOM   4511 C CB  . PRO B 1 51  ? 3.681   50.730 371.923 1.00 64.41  ? 52  PRO B CB  1 
ATOM   4512 C CG  . PRO B 1 51  ? 5.005   50.572 371.272 1.00 64.65  ? 52  PRO B CG  1 
ATOM   4513 C CD  . PRO B 1 51  ? 5.774   51.819 371.600 1.00 59.41  ? 52  PRO B CD  1 
ATOM   4514 N N   . LYS B 1 52  ? 1.328   52.821 372.948 1.00 66.00  ? 53  LYS B N   1 
ATOM   4515 C CA  . LYS B 1 52  ? 0.493   53.327 374.029 1.00 68.02  ? 53  LYS B CA  1 
ATOM   4516 C C   . LYS B 1 52  ? 0.571   52.400 375.237 1.00 66.41  ? 53  LYS B C   1 
ATOM   4517 O O   . LYS B 1 52  ? 0.278   51.204 375.132 1.00 63.83  ? 53  LYS B O   1 
ATOM   4518 C CB  . LYS B 1 52  ? -0.948  53.457 373.537 1.00 64.05  ? 53  LYS B CB  1 
ATOM   4519 C CG  . LYS B 1 52  ? -1.961  53.911 374.582 1.00 62.52  ? 53  LYS B CG  1 
ATOM   4520 C CD  . LYS B 1 52  ? -1.654  55.295 375.135 1.00 63.23  ? 53  LYS B CD  1 
ATOM   4521 C CE  . LYS B 1 52  ? -2.742  55.746 376.107 1.00 67.27  ? 53  LYS B CE  1 
ATOM   4522 N NZ  . LYS B 1 52  ? -2.400  57.022 376.802 1.00 71.59  ? 53  LYS B NZ  1 
ATOM   4523 N N   . GLN B 1 53  ? 0.981   52.944 376.379 1.00 59.55  ? 54  GLN B N   1 
ATOM   4524 C CA  A GLN B 1 53  ? 1.030   52.147 377.596 0.56 71.31  ? 54  GLN B CA  1 
ATOM   4525 C CA  B GLN B 1 53  ? 1.030   52.137 377.588 0.44 71.26  ? 54  GLN B CA  1 
ATOM   4526 C C   . GLN B 1 53  ? -0.385  51.719 377.983 1.00 63.85  ? 54  GLN B C   1 
ATOM   4527 O O   . GLN B 1 53  ? -1.328  52.510 377.858 1.00 61.06  ? 54  GLN B O   1 
ATOM   4528 C CB  A GLN B 1 53  ? 1.680   52.939 378.734 0.56 62.79  ? 54  GLN B CB  1 
ATOM   4529 C CB  B GLN B 1 53  ? 1.699   52.904 378.729 0.44 62.87  ? 54  GLN B CB  1 
ATOM   4530 C CG  A GLN B 1 53  ? 3.142   53.312 378.482 0.56 68.41  ? 54  GLN B CG  1 
ATOM   4531 C CG  B GLN B 1 53  ? 3.222   52.798 378.742 0.44 69.66  ? 54  GLN B CG  1 
ATOM   4532 C CD  A GLN B 1 53  ? 3.600   54.513 379.297 0.56 81.52  ? 54  GLN B CD  1 
ATOM   4533 C CD  B GLN B 1 53  ? 3.711   51.392 379.043 0.44 74.66  ? 54  GLN B CD  1 
ATOM   4534 O OE1 A GLN B 1 53  ? 2.803   55.160 379.979 0.56 81.75  ? 54  GLN B OE1 1 
ATOM   4535 O OE1 B GLN B 1 53  ? 4.052   50.634 378.134 0.44 62.63  ? 54  GLN B OE1 1 
ATOM   4536 N NE2 A GLN B 1 53  ? 4.893   54.813 379.231 0.56 72.70  ? 54  GLN B NE2 1 
ATOM   4537 N NE2 B GLN B 1 53  ? 3.747   51.037 380.325 0.44 67.73  ? 54  GLN B NE2 1 
ATOM   4538 N N   . PRO B 1 54  ? -0.574  50.480 378.433 1.00 62.69  ? 55  PRO B N   1 
ATOM   4539 C CA  . PRO B 1 54  ? -1.929  50.024 378.771 1.00 60.04  ? 55  PRO B CA  1 
ATOM   4540 C C   . PRO B 1 54  ? -2.554  50.882 379.862 1.00 72.83  ? 55  PRO B C   1 
ATOM   4541 O O   . PRO B 1 54  ? -1.863  51.528 380.654 1.00 54.67  ? 55  PRO B O   1 
ATOM   4542 C CB  . PRO B 1 54  ? -1.718  48.577 379.237 1.00 70.57  ? 55  PRO B CB  1 
ATOM   4543 C CG  . PRO B 1 54  ? -0.240  48.426 379.453 1.00 73.77  ? 55  PRO B CG  1 
ATOM   4544 C CD  . PRO B 1 54  ? 0.429   49.410 378.555 1.00 58.69  ? 55  PRO B CD  1 
ATOM   4545 N N   . TRP B 1 55  ? -3.885  50.899 379.882 1.00 60.44  ? 56  TRP B N   1 
ATOM   4546 C CA  . TRP B 1 55  ? -4.640  51.756 380.782 1.00 57.76  ? 56  TRP B CA  1 
ATOM   4547 C C   . TRP B 1 55  ? -5.659  50.938 381.563 1.00 73.73  ? 56  TRP B C   1 
ATOM   4548 O O   . TRP B 1 55  ? -6.108  49.877 381.114 1.00 57.47  ? 56  TRP B O   1 
ATOM   4549 C CB  . TRP B 1 55  ? -5.364  52.880 380.018 1.00 60.56  ? 56  TRP B CB  1 
ATOM   4550 C CG  . TRP B 1 55  ? -6.371  52.387 379.012 1.00 68.60  ? 56  TRP B CG  1 
ATOM   4551 C CD1 . TRP B 1 55  ? -7.693  52.119 379.231 1.00 67.67  ? 56  TRP B CD1 1 
ATOM   4552 C CD2 . TRP B 1 55  ? -6.132  52.110 377.627 1.00 57.78  ? 56  TRP B CD2 1 
ATOM   4553 N NE1 . TRP B 1 55  ? -8.291  51.688 378.067 1.00 53.89  ? 56  TRP B NE1 1 
ATOM   4554 C CE2 . TRP B 1 55  ? -7.352  51.675 377.068 1.00 68.35  ? 56  TRP B CE2 1 
ATOM   4555 C CE3 . TRP B 1 55  ? -5.003  52.187 376.804 1.00 59.38  ? 56  TRP B CE3 1 
ATOM   4556 C CZ2 . TRP B 1 55  ? -7.474  51.320 375.727 1.00 53.60  ? 56  TRP B CZ2 1 
ATOM   4557 C CZ3 . TRP B 1 55  ? -5.125  51.832 375.472 1.00 56.68  ? 56  TRP B CZ3 1 
ATOM   4558 C CH2 . TRP B 1 55  ? -6.352  51.403 374.949 1.00 62.74  ? 56  TRP B CH2 1 
ATOM   4559 N N   . SER B 1 56  ? -6.015  51.441 382.741 1.00 61.12  ? 57  SER B N   1 
ATOM   4560 C CA  . SER B 1 56  ? -7.116  50.890 383.515 1.00 77.49  ? 57  SER B CA  1 
ATOM   4561 C C   . SER B 1 56  ? -8.402  51.649 383.199 1.00 73.48  ? 57  SER B C   1 
ATOM   4562 O O   . SER B 1 56  ? -8.377  52.779 382.708 1.00 59.81  ? 57  SER B O   1 
ATOM   4563 C CB  . SER B 1 56  ? -6.815  50.961 385.012 1.00 68.25  ? 57  SER B CB  1 
ATOM   4564 O OG  . SER B 1 56  ? -6.449  52.280 385.379 1.00 78.27  ? 57  SER B OG  1 
ATOM   4565 N N   . GLY B 1 57  ? -9.537  51.010 383.486 1.00 62.68  ? 58  GLY B N   1 
ATOM   4566 C CA  . GLY B 1 57  ? -10.823 51.618 383.196 1.00 53.15  ? 58  GLY B CA  1 
ATOM   4567 C C   . GLY B 1 57  ? -11.184 51.551 381.719 1.00 74.56  ? 58  GLY B C   1 
ATOM   4568 O O   . GLY B 1 57  ? -10.658 50.742 380.947 1.00 53.39  ? 58  GLY B O   1 
ATOM   4569 N N   . VAL B 1 58  ? -12.091 52.446 381.319 1.00 55.50  ? 59  VAL B N   1 
ATOM   4570 C CA  . VAL B 1 58  ? -12.660 52.463 379.975 1.00 66.90  ? 59  VAL B CA  1 
ATOM   4571 C C   . VAL B 1 58  ? -12.332 53.796 379.316 1.00 73.70  ? 59  VAL B C   1 
ATOM   4572 O O   . VAL B 1 58  ? -12.698 54.861 379.835 1.00 56.90  ? 59  VAL B O   1 
ATOM   4573 C CB  . VAL B 1 58  ? -14.179 52.242 379.999 1.00 70.25  ? 59  VAL B CB  1 
ATOM   4574 C CG1 . VAL B 1 58  ? -14.705 52.031 378.590 1.00 51.94  ? 59  VAL B CG1 1 
ATOM   4575 C CG2 . VAL B 1 58  ? -14.523 51.067 380.886 1.00 50.62  ? 59  VAL B CG2 1 
ATOM   4576 N N   . VAL B 1 59  ? -11.673 53.735 378.161 1.00 64.26  ? 60  VAL B N   1 
ATOM   4577 C CA  . VAL B 1 59  ? -11.390 54.921 377.362 1.00 61.90  ? 60  VAL B CA  1 
ATOM   4578 C C   . VAL B 1 59  ? -12.560 55.149 376.415 1.00 51.99  ? 60  VAL B C   1 
ATOM   4579 O O   . VAL B 1 59  ? -12.930 54.258 375.644 1.00 53.37  ? 60  VAL B O   1 
ATOM   4580 C CB  . VAL B 1 59  ? -10.070 54.771 376.589 1.00 67.79  ? 60  VAL B CB  1 
ATOM   4581 C CG1 . VAL B 1 59  ? -10.001 55.795 375.457 1.00 53.61  ? 60  VAL B CG1 1 
ATOM   4582 C CG2 . VAL B 1 59  ? -8.877  54.928 377.533 1.00 61.37  ? 60  VAL B CG2 1 
ATOM   4583 N N   . ASP B 1 60  ? -13.155 56.338 376.484 1.00 44.25  ? 61  ASP B N   1 
ATOM   4584 C CA  . ASP B 1 60  ? -14.256 56.701 375.603 1.00 51.87  ? 61  ASP B CA  1 
ATOM   4585 C C   . ASP B 1 60  ? -13.691 57.078 374.238 1.00 60.38  ? 61  ASP B C   1 
ATOM   4586 O O   . ASP B 1 60  ? -13.098 58.150 374.078 1.00 59.30  ? 61  ASP B O   1 
ATOM   4587 C CB  . ASP B 1 60  ? -15.061 57.853 376.195 1.00 57.57  ? 61  ASP B CB  1 
ATOM   4588 C CG  . ASP B 1 60  ? -16.060 57.394 377.246 1.00 74.71  ? 61  ASP B CG  1 
ATOM   4589 O OD1 . ASP B 1 60  ? -15.819 57.637 378.451 1.00 76.04  ? 61  ASP B OD1 1 
ATOM   4590 O OD2 . ASP B 1 60  ? -17.087 56.793 376.867 1.00 66.51  ? 61  ASP B OD2 1 
ATOM   4591 N N   . ALA B 1 61  ? -13.860 56.190 373.255 1.00 63.17  ? 62  ALA B N   1 
ATOM   4592 C CA  . ALA B 1 61  ? -13.530 56.484 371.859 1.00 56.91  ? 62  ALA B CA  1 
ATOM   4593 C C   . ALA B 1 61  ? -14.819 56.906 371.161 1.00 61.48  ? 62  ALA B C   1 
ATOM   4594 O O   . ALA B 1 61  ? -15.434 56.150 370.407 1.00 47.85  ? 62  ALA B O   1 
ATOM   4595 C CB  . ALA B 1 61  ? -12.888 55.280 371.179 1.00 48.74  ? 62  ALA B CB  1 
ATOM   4596 N N   . THR B 1 62  ? -15.231 58.144 371.424 1.00 57.88  ? 63  THR B N   1 
ATOM   4597 C CA  . THR B 1 62  ? -16.545 58.612 371.013 1.00 49.43  ? 63  THR B CA  1 
ATOM   4598 C C   . THR B 1 62  ? -16.507 59.823 370.088 1.00 55.35  ? 63  THR B C   1 
ATOM   4599 O O   . THR B 1 62  ? -17.572 60.277 369.654 1.00 54.00  ? 63  THR B O   1 
ATOM   4600 C CB  . THR B 1 62  ? -17.392 58.938 372.252 1.00 53.11  ? 63  THR B CB  1 
ATOM   4601 O OG1 . THR B 1 62  ? -16.674 59.852 373.088 1.00 52.61  ? 63  THR B OG1 1 
ATOM   4602 C CG2 . THR B 1 62  ? -17.698 57.663 373.051 1.00 42.35  ? 63  THR B CG2 1 
ATOM   4603 N N   . THR B 1 63  ? -15.329 60.360 369.776 1.00 50.11  ? 64  THR B N   1 
ATOM   4604 C CA  . THR B 1 63  ? -15.218 61.508 368.885 1.00 49.95  ? 64  THR B CA  1 
ATOM   4605 C C   . THR B 1 63  ? -13.790 61.585 368.368 1.00 55.79  ? 64  THR B C   1 
ATOM   4606 O O   . THR B 1 63  ? -12.859 61.054 368.980 1.00 53.80  ? 64  THR B O   1 
ATOM   4607 C CB  . THR B 1 63  ? -15.610 62.819 369.584 1.00 53.86  ? 64  THR B CB  1 
ATOM   4608 O OG1 . THR B 1 63  ? -15.965 63.800 368.603 1.00 62.20  ? 64  THR B OG1 1 
ATOM   4609 C CG2 . THR B 1 63  ? -14.450 63.352 370.428 1.00 58.73  ? 64  THR B CG2 1 
ATOM   4610 N N   . PHE B 1 64  ? -13.629 62.250 367.228 1.00 52.80  ? 65  PHE B N   1 
ATOM   4611 C CA  . PHE B 1 64  ? -12.310 62.374 366.626 1.00 48.36  ? 65  PHE B CA  1 
ATOM   4612 C C   . PHE B 1 64  ? -11.395 63.179 367.537 1.00 58.09  ? 65  PHE B C   1 
ATOM   4613 O O   . PHE B 1 64  ? -11.787 64.229 368.056 1.00 53.78  ? 65  PHE B O   1 
ATOM   4614 C CB  . PHE B 1 64  ? -12.408 63.048 365.260 1.00 48.15  ? 65  PHE B CB  1 
ATOM   4615 C CG  . PHE B 1 64  ? -13.010 62.183 364.190 1.00 53.45  ? 65  PHE B CG  1 
ATOM   4616 C CD1 . PHE B 1 64  ? -12.327 61.071 363.712 1.00 54.36  ? 65  PHE B CD1 1 
ATOM   4617 C CD2 . PHE B 1 64  ? -14.242 62.497 363.639 1.00 50.92  ? 65  PHE B CD2 1 
ATOM   4618 C CE1 . PHE B 1 64  ? -12.869 60.278 362.720 1.00 50.11  ? 65  PHE B CE1 1 
ATOM   4619 C CE2 . PHE B 1 64  ? -14.793 61.707 362.642 1.00 55.58  ? 65  PHE B CE2 1 
ATOM   4620 C CZ  . PHE B 1 64  ? -14.104 60.596 362.180 1.00 54.99  ? 65  PHE B CZ  1 
ATOM   4621 N N   . GLN B 1 65  ? -10.172 62.694 367.727 1.00 49.41  ? 66  GLN B N   1 
ATOM   4622 C CA  . GLN B 1 65  ? -9.198  63.412 368.535 1.00 50.59  ? 66  GLN B CA  1 
ATOM   4623 C C   . GLN B 1 65  ? -8.555  64.525 367.708 1.00 55.33  ? 66  GLN B C   1 
ATOM   4624 O O   . GLN B 1 65  ? -8.952  64.805 366.573 1.00 55.46  ? 66  GLN B O   1 
ATOM   4625 C CB  . GLN B 1 65  ? -8.164  62.447 369.102 1.00 46.71  ? 66  GLN B CB  1 
ATOM   4626 C CG  . GLN B 1 65  ? -8.396  62.081 370.563 1.00 57.75  ? 66  GLN B CG  1 
ATOM   4627 C CD  . GLN B 1 65  ? -7.980  63.179 371.527 1.00 66.51  ? 66  GLN B CD  1 
ATOM   4628 O OE1 . GLN B 1 65  ? -7.715  64.315 371.129 1.00 61.79  ? 66  GLN B OE1 1 
ATOM   4629 N NE2 . GLN B 1 65  ? -7.926  62.842 372.808 1.00 63.00  ? 66  GLN B NE2 1 
ATOM   4630 N N   . SER B 1 66  ? -7.529  65.156 368.275 1.00 54.67  ? 67  SER B N   1 
ATOM   4631 C CA  . SER B 1 66  ? -6.963  66.372 367.708 1.00 55.24  ? 67  SER B CA  1 
ATOM   4632 C C   . SER B 1 66  ? -6.257  66.100 366.385 1.00 58.48  ? 67  SER B C   1 
ATOM   4633 O O   . SER B 1 66  ? -5.708  65.020 366.151 1.00 58.25  ? 67  SER B O   1 
ATOM   4634 C CB  . SER B 1 66  ? -5.967  67.012 368.680 1.00 59.92  ? 67  SER B CB  1 
ATOM   4635 O OG  . SER B 1 66  ? -6.579  67.374 369.903 1.00 64.97  ? 67  SER B OG  1 
ATOM   4636 N N   . VAL B 1 67  ? -6.276  67.108 365.524 1.00 47.42  ? 68  VAL B N   1 
ATOM   4637 C CA  . VAL B 1 67  ? -5.505  67.106 364.290 1.00 57.41  ? 68  VAL B CA  1 
ATOM   4638 C C   . VAL B 1 67  ? -4.046  67.372 364.631 1.00 59.77  ? 68  VAL B C   1 
ATOM   4639 O O   . VAL B 1 67  ? -3.737  68.233 365.465 1.00 58.16  ? 68  VAL B O   1 
ATOM   4640 C CB  . VAL B 1 67  ? -6.068  68.164 363.321 1.00 58.25  ? 68  VAL B CB  1 
ATOM   4641 C CG1 . VAL B 1 67  ? -5.207  68.291 362.087 1.00 56.33  ? 68  VAL B CG1 1 
ATOM   4642 C CG2 . VAL B 1 67  ? -7.497  67.822 362.944 1.00 51.19  ? 68  VAL B CG2 1 
ATOM   4643 N N   . CYS B 1 68  ? -3.139  66.618 364.011 1.00 49.98  ? 69  CYS B N   1 
ATOM   4644 C CA  . CYS B 1 68  ? -1.718  66.877 364.209 1.00 58.34  ? 69  CYS B CA  1 
ATOM   4645 C C   . CYS B 1 68  ? -1.364  68.284 363.743 1.00 56.18  ? 69  CYS B C   1 
ATOM   4646 O O   . CYS B 1 68  ? -1.928  68.802 362.773 1.00 69.87  ? 69  CYS B O   1 
ATOM   4647 C CB  . CYS B 1 68  ? -0.869  65.853 363.455 1.00 42.94  ? 69  CYS B CB  1 
ATOM   4648 S SG  . CYS B 1 68  ? -0.978  64.164 364.086 1.00 53.83  ? 69  CYS B SG  1 
ATOM   4649 N N   . TYR B 1 69  ? -0.416  68.902 364.450 1.00 63.05  ? 70  TYR B N   1 
ATOM   4650 C CA  . TYR B 1 69  ? -0.001  70.266 364.143 1.00 57.62  ? 70  TYR B CA  1 
ATOM   4651 C C   . TYR B 1 69  ? 0.409   70.402 362.683 1.00 45.79  ? 70  TYR B C   1 
ATOM   4652 O O   . TYR B 1 69  ? 1.205   69.607 362.174 1.00 56.70  ? 70  TYR B O   1 
ATOM   4653 C CB  . TYR B 1 69  ? 1.153   70.686 365.051 1.00 47.07  ? 70  TYR B CB  1 
ATOM   4654 C CG  . TYR B 1 69  ? 0.707   71.600 366.157 1.00 70.05  ? 70  TYR B CG  1 
ATOM   4655 C CD1 . TYR B 1 69  ? 0.397   72.917 365.898 1.00 65.27  ? 70  TYR B CD1 1 
ATOM   4656 C CD2 . TYR B 1 69  ? 0.579   71.141 367.460 1.00 78.25  ? 70  TYR B CD2 1 
ATOM   4657 C CE1 . TYR B 1 69  ? -0.028  73.769 366.905 1.00 69.45  ? 70  TYR B CE1 1 
ATOM   4658 C CE2 . TYR B 1 69  ? 0.161   71.983 368.475 1.00 78.50  ? 70  TYR B CE2 1 
ATOM   4659 C CZ  . TYR B 1 69  ? -0.143  73.299 368.189 1.00 76.15  ? 70  TYR B CZ  1 
ATOM   4660 O OH  . TYR B 1 69  ? -0.562  74.152 369.190 1.00 98.86  ? 70  TYR B OH  1 
ATOM   4661 N N   . GLN B 1 70  ? -0.126  71.427 362.017 1.00 44.72  ? 71  GLN B N   1 
ATOM   4662 C CA  . GLN B 1 70  ? 0.035   71.562 360.578 1.00 59.32  ? 71  GLN B CA  1 
ATOM   4663 C C   . GLN B 1 70  ? -0.360  72.962 360.127 1.00 58.60  ? 71  GLN B C   1 
ATOM   4664 O O   . GLN B 1 70  ? -1.125  73.665 360.793 1.00 55.03  ? 71  GLN B O   1 
ATOM   4665 C CB  . GLN B 1 70  ? -0.800  70.520 359.831 1.00 51.56  ? 71  GLN B CB  1 
ATOM   4666 C CG  . GLN B 1 70  ? -2.307  70.706 359.964 1.00 47.49  ? 71  GLN B CG  1 
ATOM   4667 C CD  . GLN B 1 70  ? -3.082  69.572 359.317 1.00 59.10  ? 71  GLN B CD  1 
ATOM   4668 O OE1 . GLN B 1 70  ? -3.878  69.791 358.405 1.00 64.94  ? 71  GLN B OE1 1 
ATOM   4669 N NE2 . GLN B 1 70  ? -2.843  68.350 359.782 1.00 51.26  ? 71  GLN B NE2 1 
ATOM   4670 N N   . TYR B 1 71  ? 0.175   73.342 358.970 1.00 48.47  ? 72  TYR B N   1 
ATOM   4671 C CA  . TYR B 1 71  ? -0.213  74.571 358.295 1.00 64.95  ? 72  TYR B CA  1 
ATOM   4672 C C   . TYR B 1 71  ? -1.693  74.529 357.925 1.00 58.73  ? 72  TYR B C   1 
ATOM   4673 O O   . TYR B 1 71  ? -2.248  73.476 357.603 1.00 56.08  ? 72  TYR B O   1 
ATOM   4674 C CB  . TYR B 1 71  ? 0.655   74.759 357.043 1.00 58.06  ? 72  TYR B CB  1 
ATOM   4675 C CG  . TYR B 1 71  ? 0.263   75.903 356.133 1.00 62.60  ? 72  TYR B CG  1 
ATOM   4676 C CD1 . TYR B 1 71  ? 0.726   77.194 356.365 1.00 64.95  ? 72  TYR B CD1 1 
ATOM   4677 C CD2 . TYR B 1 71  ? -0.544  75.686 355.024 1.00 65.70  ? 72  TYR B CD2 1 
ATOM   4678 C CE1 . TYR B 1 71  ? 0.377   78.241 355.530 1.00 68.34  ? 72  TYR B CE1 1 
ATOM   4679 C CE2 . TYR B 1 71  ? -0.897  76.724 354.186 1.00 66.76  ? 72  TYR B CE2 1 
ATOM   4680 C CZ  . TYR B 1 71  ? -0.436  78.002 354.440 1.00 79.40  ? 72  TYR B CZ  1 
ATOM   4681 O OH  . TYR B 1 71  ? -0.789  79.041 353.604 1.00 72.21  ? 72  TYR B OH  1 
ATOM   4682 N N   . VAL B 1 72  ? -2.338  75.692 357.979 1.00 56.08  ? 73  VAL B N   1 
ATOM   4683 C CA  . VAL B 1 72  ? -3.733  75.851 357.580 1.00 63.87  ? 73  VAL B CA  1 
ATOM   4684 C C   . VAL B 1 72  ? -3.773  76.750 356.353 1.00 64.92  ? 73  VAL B C   1 
ATOM   4685 O O   . VAL B 1 72  ? -3.227  77.860 356.374 1.00 80.14  ? 73  VAL B O   1 
ATOM   4686 C CB  . VAL B 1 72  ? -4.578  76.431 358.727 1.00 64.21  ? 73  VAL B CB  1 
ATOM   4687 C CG1 . VAL B 1 72  ? -6.039  76.492 358.339 1.00 61.93  ? 73  VAL B CG1 1 
ATOM   4688 C CG2 . VAL B 1 72  ? -4.400  75.588 359.969 1.00 60.30  ? 73  VAL B CG2 1 
ATOM   4689 N N   . ASP B 1 73  ? -4.407  76.275 355.284 1.00 69.08  ? 74  ASP B N   1 
ATOM   4690 C CA  . ASP B 1 73  ? -4.397  77.008 354.023 1.00 68.76  ? 74  ASP B CA  1 
ATOM   4691 C C   . ASP B 1 73  ? -5.337  78.203 354.088 1.00 69.35  ? 74  ASP B C   1 
ATOM   4692 O O   . ASP B 1 73  ? -6.517  78.066 354.431 1.00 72.34  ? 74  ASP B O   1 
ATOM   4693 C CB  . ASP B 1 73  ? -4.782  76.096 352.859 1.00 73.35  ? 74  ASP B CB  1 
ATOM   4694 C CG  . ASP B 1 73  ? -5.148  76.874 351.604 1.00 79.98  ? 74  ASP B CG  1 
ATOM   4695 O OD1 . ASP B 1 73  ? -6.350  76.964 351.277 1.00 81.49  ? 74  ASP B OD1 1 
ATOM   4696 O OD2 . ASP B 1 73  ? -4.228  77.421 350.960 1.00 95.05  ? 74  ASP B OD2 1 
ATOM   4697 N N   . THR B 1 74  ? -4.817  79.374 353.728 1.00 66.42  ? 75  THR B N   1 
ATOM   4698 C CA  . THR B 1 74  ? -5.529  80.638 353.862 1.00 83.06  ? 75  THR B CA  1 
ATOM   4699 C C   . THR B 1 74  ? -5.847  81.291 352.519 1.00 82.64  ? 75  THR B C   1 
ATOM   4700 O O   . THR B 1 74  ? -6.259  82.455 352.495 1.00 87.98  ? 75  THR B O   1 
ATOM   4701 C CB  . THR B 1 74  ? -4.705  81.601 354.720 1.00 82.54  ? 75  THR B CB  1 
ATOM   4702 O OG1 . THR B 1 74  ? -3.523  81.978 354.002 1.00 84.55  ? 75  THR B OG1 1 
ATOM   4703 C CG2 . THR B 1 74  ? -4.291  80.943 356.031 1.00 77.15  ? 75  THR B CG2 1 
ATOM   4704 N N   . LEU B 1 75  ? -5.685  80.567 351.406 1.00 70.52  ? 76  LEU B N   1 
ATOM   4705 C CA  . LEU B 1 75  ? -5.741  81.198 350.088 1.00 78.75  ? 76  LEU B CA  1 
ATOM   4706 C C   . LEU B 1 75  ? -7.124  81.761 349.787 1.00 83.45  ? 76  LEU B C   1 
ATOM   4707 O O   . LEU B 1 75  ? -7.263  82.935 349.427 1.00 79.97  ? 76  LEU B O   1 
ATOM   4708 C CB  . LEU B 1 75  ? -5.328  80.202 349.007 1.00 80.46  ? 76  LEU B CB  1 
ATOM   4709 C CG  . LEU B 1 75  ? -4.945  80.881 347.689 1.00 81.51  ? 76  LEU B CG  1 
ATOM   4710 C CD1 . LEU B 1 75  ? -3.599  81.571 347.829 1.00 88.85  ? 76  LEU B CD1 1 
ATOM   4711 C CD2 . LEU B 1 75  ? -4.930  79.889 346.538 1.00 72.99  ? 76  LEU B CD2 1 
ATOM   4712 N N   . TYR B 1 76  ? -8.162  80.931 349.904 1.00 69.69  ? 77  TYR B N   1 
ATOM   4713 C CA  . TYR B 1 76  ? -9.542  81.349 349.674 1.00 63.66  ? 77  TYR B CA  1 
ATOM   4714 C C   . TYR B 1 76  ? -10.334 81.130 350.958 1.00 69.32  ? 77  TYR B C   1 
ATOM   4715 O O   . TYR B 1 76  ? -11.017 80.105 351.108 1.00 68.71  ? 77  TYR B O   1 
ATOM   4716 C CB  . TYR B 1 76  ? -10.166 80.582 348.511 1.00 74.11  ? 77  TYR B CB  1 
ATOM   4717 C CG  . TYR B 1 76  ? -9.483  80.780 347.175 1.00 76.39  ? 77  TYR B CG  1 
ATOM   4718 C CD1 . TYR B 1 76  ? -9.592  81.982 346.485 1.00 77.06  ? 77  TYR B CD1 1 
ATOM   4719 C CD2 . TYR B 1 76  ? -8.746  79.755 346.592 1.00 77.10  ? 77  TYR B CD2 1 
ATOM   4720 C CE1 . TYR B 1 76  ? -8.980  82.160 345.257 1.00 77.10  ? 77  TYR B CE1 1 
ATOM   4721 C CE2 . TYR B 1 76  ? -8.132  79.922 345.364 1.00 77.54  ? 77  TYR B CE2 1 
ATOM   4722 C CZ  . TYR B 1 76  ? -8.249  81.127 344.699 1.00 91.33  ? 77  TYR B CZ  1 
ATOM   4723 O OH  . TYR B 1 76  ? -7.636  81.296 343.472 1.00 78.27  ? 77  TYR B OH  1 
ATOM   4724 N N   . PRO B 1 77  ? -10.280 82.073 351.900 1.00 74.29  ? 78  PRO B N   1 
ATOM   4725 C CA  . PRO B 1 77  ? -10.930 81.856 353.202 1.00 83.14  ? 78  PRO B CA  1 
ATOM   4726 C C   . PRO B 1 77  ? -12.441 81.737 353.067 1.00 83.37  ? 78  PRO B C   1 
ATOM   4727 O O   . PRO B 1 77  ? -13.087 82.528 352.375 1.00 69.14  ? 78  PRO B O   1 
ATOM   4728 C CB  . PRO B 1 77  ? -10.531 83.098 354.011 1.00 75.77  ? 78  PRO B CB  1 
ATOM   4729 C CG  . PRO B 1 77  ? -9.344  83.669 353.301 1.00 81.51  ? 78  PRO B CG  1 
ATOM   4730 C CD  . PRO B 1 77  ? -9.559  83.355 351.849 1.00 78.24  ? 78  PRO B CD  1 
ATOM   4731 N N   . GLY B 1 78  ? -13.002 80.734 353.747 1.00 80.87  ? 79  GLY B N   1 
ATOM   4732 C CA  . GLY B 1 78  ? -14.421 80.459 353.697 1.00 71.40  ? 79  GLY B CA  1 
ATOM   4733 C C   . GLY B 1 78  ? -14.883 79.682 352.486 1.00 77.15  ? 79  GLY B C   1 
ATOM   4734 O O   . GLY B 1 78  ? -16.047 79.258 352.449 1.00 71.35  ? 79  GLY B O   1 
ATOM   4735 N N   . PHE B 1 79  ? -14.014 79.472 351.501 1.00 73.51  ? 80  PHE B N   1 
ATOM   4736 C CA  . PHE B 1 79  ? -14.393 78.783 350.276 1.00 67.81  ? 80  PHE B CA  1 
ATOM   4737 C C   . PHE B 1 79  ? -14.397 77.276 350.506 1.00 66.99  ? 80  PHE B C   1 
ATOM   4738 O O   . PHE B 1 79  ? -13.431 76.719 351.034 1.00 68.52  ? 80  PHE B O   1 
ATOM   4739 C CB  . PHE B 1 79  ? -13.429 79.165 349.155 1.00 62.98  ? 80  PHE B CB  1 
ATOM   4740 C CG  . PHE B 1 79  ? -13.595 78.360 347.902 1.00 66.30  ? 80  PHE B CG  1 
ATOM   4741 C CD1 . PHE B 1 79  ? -12.590 77.505 347.478 1.00 61.63  ? 80  PHE B CD1 1 
ATOM   4742 C CD2 . PHE B 1 79  ? -14.748 78.468 347.140 1.00 62.82  ? 80  PHE B CD2 1 
ATOM   4743 C CE1 . PHE B 1 79  ? -12.731 76.772 346.314 1.00 71.75  ? 80  PHE B CE1 1 
ATOM   4744 C CE2 . PHE B 1 79  ? -14.899 77.732 345.974 1.00 71.17  ? 80  PHE B CE2 1 
ATOM   4745 C CZ  . PHE B 1 79  ? -13.890 76.882 345.561 1.00 72.31  ? 80  PHE B CZ  1 
ATOM   4746 N N   . GLU B 1 80  ? -15.486 76.618 350.100 1.00 58.75  ? 81  GLU B N   1 
ATOM   4747 C CA  . GLU B 1 80  ? -15.657 75.201 350.411 1.00 59.29  ? 81  GLU B CA  1 
ATOM   4748 C C   . GLU B 1 80  ? -14.531 74.352 349.833 1.00 72.73  ? 81  GLU B C   1 
ATOM   4749 O O   . GLU B 1 80  ? -14.054 73.418 350.489 1.00 69.41  ? 81  GLU B O   1 
ATOM   4750 C CB  . GLU B 1 80  ? -17.006 74.702 349.893 1.00 68.41  ? 81  GLU B CB  1 
ATOM   4751 C CG  . GLU B 1 80  ? -17.050 73.185 349.737 1.00 95.22  ? 81  GLU B CG  1 
ATOM   4752 C CD  . GLU B 1 80  ? -18.456 72.626 349.679 1.00 119.50 ? 81  GLU B CD  1 
ATOM   4753 O OE1 . GLU B 1 80  ? -19.178 72.909 348.696 1.00 96.32  ? 81  GLU B OE1 1 
ATOM   4754 O OE2 . GLU B 1 80  ? -18.835 71.898 350.623 1.00 120.48 ? 81  GLU B OE2 1 
ATOM   4755 N N   . GLY B 1 81  ? -14.093 74.660 348.608 1.00 63.56  ? 82  GLY B N   1 
ATOM   4756 C CA  . GLY B 1 81  ? -13.122 73.810 347.937 1.00 66.27  ? 82  GLY B CA  1 
ATOM   4757 C C   . GLY B 1 81  ? -11.806 73.681 348.677 1.00 68.35  ? 82  GLY B C   1 
ATOM   4758 O O   . GLY B 1 81  ? -11.115 72.667 348.552 1.00 70.57  ? 82  GLY B O   1 
ATOM   4759 N N   . THR B 1 82  ? -11.441 74.694 349.459 1.00 62.03  ? 83  THR B N   1 
ATOM   4760 C CA  . THR B 1 82  ? -10.246 74.619 350.286 1.00 59.57  ? 83  THR B CA  1 
ATOM   4761 C C   . THR B 1 82  ? -10.539 74.307 351.748 1.00 59.37  ? 83  THR B C   1 
ATOM   4762 O O   . THR B 1 82  ? -9.718  73.656 352.401 1.00 66.47  ? 83  THR B O   1 
ATOM   4763 C CB  . THR B 1 82  ? -9.460  75.931 350.198 1.00 62.96  ? 83  THR B CB  1 
ATOM   4764 O OG1 . THR B 1 82  ? -10.323 77.024 350.528 1.00 70.35  ? 83  THR B OG1 1 
ATOM   4765 C CG2 . THR B 1 82  ? -8.938  76.130 348.792 1.00 69.59  ? 83  THR B CG2 1 
ATOM   4766 N N   . GLU B 1 83  ? -11.687 74.744 352.281 1.00 69.74  ? 84  GLU B N   1 
ATOM   4767 C CA  . GLU B 1 83  ? -11.974 74.537 353.699 1.00 73.91  ? 84  GLU B CA  1 
ATOM   4768 C C   . GLU B 1 83  ? -12.226 73.074 354.041 1.00 71.38  ? 84  GLU B C   1 
ATOM   4769 O O   . GLU B 1 83  ? -12.018 72.678 355.194 1.00 65.43  ? 84  GLU B O   1 
ATOM   4770 C CB  . GLU B 1 83  ? -13.184 75.367 354.142 1.00 59.50  ? 84  GLU B CB  1 
ATOM   4771 C CG  . GLU B 1 83  ? -13.012 76.876 354.063 1.00 68.52  ? 84  GLU B CG  1 
ATOM   4772 C CD  . GLU B 1 83  ? -11.911 77.411 354.959 1.00 87.22  ? 84  GLU B CD  1 
ATOM   4773 O OE1 . GLU B 1 83  ? -11.456 76.683 355.870 1.00 82.99  ? 84  GLU B OE1 1 
ATOM   4774 O OE2 . GLU B 1 83  ? -11.500 78.573 354.744 1.00 80.36  ? 84  GLU B OE2 1 
ATOM   4775 N N   . MET B 1 84  ? -12.674 72.270 353.074 1.00 60.24  ? 85  MET B N   1 
ATOM   4776 C CA  . MET B 1 84  ? -12.939 70.859 353.327 1.00 49.12  ? 85  MET B CA  1 
ATOM   4777 C C   . MET B 1 84  ? -11.683 70.079 353.690 1.00 58.83  ? 85  MET B C   1 
ATOM   4778 O O   . MET B 1 84  ? -11.795 68.981 354.242 1.00 61.48  ? 85  MET B O   1 
ATOM   4779 C CB  . MET B 1 84  ? -13.590 70.224 352.099 1.00 59.46  ? 85  MET B CB  1 
ATOM   4780 C CG  . MET B 1 84  ? -12.719 70.285 350.846 1.00 59.61  ? 85  MET B CG  1 
ATOM   4781 S SD  . MET B 1 84  ? -13.540 69.607 349.392 1.00 66.70  ? 85  MET B SD  1 
ATOM   4782 C CE  . MET B 1 84  ? -13.570 67.868 349.820 1.00 67.43  ? 85  MET B CE  1 
ATOM   4783 N N   . TRP B 1 85  ? -10.496 70.604 353.378 1.00 50.12  ? 86  TRP B N   1 
ATOM   4784 C CA  . TRP B 1 85  ? -9.244  69.916 353.664 1.00 60.09  ? 86  TRP B CA  1 
ATOM   4785 C C   . TRP B 1 85  ? -8.549  70.433 354.917 1.00 56.15  ? 86  TRP B C   1 
ATOM   4786 O O   . TRP B 1 85  ? -7.579  69.815 355.368 1.00 47.50  ? 86  TRP B O   1 
ATOM   4787 C CB  . TRP B 1 85  ? -8.292  70.030 352.464 1.00 50.75  ? 86  TRP B CB  1 
ATOM   4788 C CG  . TRP B 1 85  ? -8.915  69.625 351.158 1.00 51.18  ? 86  TRP B CG  1 
ATOM   4789 C CD1 . TRP B 1 85  ? -9.284  70.449 350.134 1.00 61.22  ? 86  TRP B CD1 1 
ATOM   4790 C CD2 . TRP B 1 85  ? -9.240  68.293 350.736 1.00 68.05  ? 86  TRP B CD2 1 
ATOM   4791 N NE1 . TRP B 1 85  ? -9.817  69.714 349.099 1.00 55.17  ? 86  TRP B NE1 1 
ATOM   4792 C CE2 . TRP B 1 85  ? -9.804  68.389 349.444 1.00 60.77  ? 86  TRP B CE2 1 
ATOM   4793 C CE3 . TRP B 1 85  ? -9.112  67.030 351.324 1.00 51.76  ? 86  TRP B CE3 1 
ATOM   4794 C CZ2 . TRP B 1 85  ? -10.236 67.271 348.734 1.00 54.68  ? 86  TRP B CZ2 1 
ATOM   4795 C CZ3 . TRP B 1 85  ? -9.540  65.921 350.615 1.00 59.46  ? 86  TRP B CZ3 1 
ATOM   4796 C CH2 . TRP B 1 85  ? -10.097 66.049 349.335 1.00 59.48  ? 86  TRP B CH2 1 
ATOM   4797 N N   . ASN B 1 86  ? -9.031  71.535 355.493 1.00 48.50  ? 87  ASN B N   1 
ATOM   4798 C CA  . ASN B 1 86  ? -8.442  72.194 356.642 1.00 50.04  ? 87  ASN B CA  1 
ATOM   4799 C C   . ASN B 1 86  ? -8.888  71.513 357.939 1.00 59.58  ? 87  ASN B C   1 
ATOM   4800 O O   . ASN B 1 86  ? -9.962  70.910 357.993 1.00 52.60  ? 87  ASN B O   1 
ATOM   4801 C CB  . ASN B 1 86  ? -8.840  73.670 356.655 1.00 70.17  ? 87  ASN B CB  1 
ATOM   4802 C CG  . ASN B 1 86  ? -7.886  74.546 355.853 1.00 66.41  ? 87  ASN B CG  1 
ATOM   4803 O OD1 . ASN B 1 86  ? -6.734  74.174 355.607 1.00 60.34  ? 87  ASN B OD1 1 
ATOM   4804 N ND2 . ASN B 1 86  ? -8.361  75.722 355.449 1.00 61.18  ? 87  ASN B ND2 1 
ATOM   4805 N N   . PRO B 1 87  ? -8.080  71.590 358.995 1.00 59.80  ? 88  PRO B N   1 
ATOM   4806 C CA  . PRO B 1 87  ? -8.401  70.851 360.223 1.00 59.08  ? 88  PRO B CA  1 
ATOM   4807 C C   . PRO B 1 87  ? -9.791  71.185 360.745 1.00 66.04  ? 88  PRO B C   1 
ATOM   4808 O O   . PRO B 1 87  ? -10.169 72.353 360.853 1.00 59.40  ? 88  PRO B O   1 
ATOM   4809 C CB  . PRO B 1 87  ? -7.310  71.300 361.197 1.00 48.07  ? 88  PRO B CB  1 
ATOM   4810 C CG  . PRO B 1 87  ? -6.177  71.730 360.328 1.00 59.63  ? 88  PRO B CG  1 
ATOM   4811 C CD  . PRO B 1 87  ? -6.798  72.311 359.098 1.00 50.24  ? 88  PRO B CD  1 
ATOM   4812 N N   . ASN B 1 88  ? -10.572 70.141 361.028 1.00 56.44  ? 89  ASN B N   1 
ATOM   4813 C CA  . ASN B 1 88  ? -11.884 70.286 361.647 1.00 58.46  ? 89  ASN B CA  1 
ATOM   4814 C C   . ASN B 1 88  ? -11.836 69.913 363.119 1.00 63.64  ? 89  ASN B C   1 
ATOM   4815 O O   . ASN B 1 88  ? -12.880 69.723 363.755 1.00 65.11  ? 89  ASN B O   1 
ATOM   4816 C CB  . ASN B 1 88  ? -12.930 69.446 360.913 1.00 50.53  ? 89  ASN B CB  1 
ATOM   4817 C CG  . ASN B 1 88  ? -12.683 67.957 361.046 1.00 64.21  ? 89  ASN B CG  1 
ATOM   4818 O OD1 . ASN B 1 88  ? -11.553 67.516 361.275 1.00 55.24  ? 89  ASN B OD1 1 
ATOM   4819 N ND2 . ASN B 1 88  ? -13.747 67.171 360.914 1.00 58.79  ? 89  ASN B ND2 1 
ATOM   4820 N N   . ARG B 1 89  ? -10.639 69.764 363.657 1.00 62.70  ? 90  ARG B N   1 
ATOM   4821 C CA  . ARG B 1 89  ? -10.415 69.680 365.081 1.00 54.75  ? 90  ARG B CA  1 
ATOM   4822 C C   . ARG B 1 89  ? -9.291  70.639 365.437 1.00 60.56  ? 90  ARG B C   1 
ATOM   4823 O O   . ARG B 1 89  ? -8.740  71.347 364.587 1.00 67.94  ? 90  ARG B O   1 
ATOM   4824 C CB  . ARG B 1 89  ? -10.067 68.254 365.527 1.00 55.69  ? 90  ARG B CB  1 
ATOM   4825 C CG  . ARG B 1 89  ? -11.230 67.277 365.467 1.00 62.05  ? 90  ARG B CG  1 
ATOM   4826 C CD  . ARG B 1 89  ? -12.171 67.444 366.646 1.00 72.16  ? 90  ARG B CD  1 
ATOM   4827 N NE  . ARG B 1 89  ? -13.164 66.377 366.722 1.00 71.00  ? 90  ARG B NE  1 
ATOM   4828 C CZ  . ARG B 1 89  ? -14.261 66.337 365.976 1.00 73.64  ? 90  ARG B CZ  1 
ATOM   4829 N NH1 . ARG B 1 89  ? -14.491 67.296 365.090 1.00 68.68  ? 90  ARG B NH1 1 
ATOM   4830 N NH2 . ARG B 1 89  ? -15.119 65.335 366.108 1.00 81.54  ? 90  ARG B NH2 1 
ATOM   4831 N N   . GLU B 1 90  ? -8.978  70.651 366.722 1.00 64.90  ? 91  GLU B N   1 
ATOM   4832 C CA  . GLU B 1 90  ? -7.931  71.480 367.282 1.00 62.39  ? 91  GLU B CA  1 
ATOM   4833 C C   . GLU B 1 90  ? -6.565  70.942 366.881 1.00 67.83  ? 91  GLU B C   1 
ATOM   4834 O O   . GLU B 1 90  ? -6.354  69.729 366.750 1.00 55.26  ? 91  GLU B O   1 
ATOM   4835 C CB  . GLU B 1 90  ? -8.058  71.509 368.810 1.00 66.39  ? 91  GLU B CB  1 
ATOM   4836 C CG  . GLU B 1 90  ? -9.502  71.805 369.357 1.00 111.50 ? 91  GLU B CG  1 
ATOM   4837 C CD  . GLU B 1 90  ? -10.579 70.705 369.107 1.00 108.11 ? 91  GLU B CD  1 
ATOM   4838 O OE1 . GLU B 1 90  ? -11.735 70.879 369.597 1.00 117.14 ? 91  GLU B OE1 1 
ATOM   4839 O OE2 . GLU B 1 90  ? -10.264 69.704 368.412 1.00 102.11 ? 91  GLU B OE2 1 
ATOM   4840 N N   . LEU B 1 91  ? -5.622  71.856 366.705 1.00 58.84  ? 92  LEU B N   1 
ATOM   4841 C CA  . LEU B 1 91  ? -4.254  71.470 366.419 1.00 60.36  ? 92  LEU B CA  1 
ATOM   4842 C C   . LEU B 1 91  ? -3.548  71.144 367.731 1.00 59.09  ? 92  LEU B C   1 
ATOM   4843 O O   . LEU B 1 91  ? -3.604  71.920 368.688 1.00 64.30  ? 92  LEU B O   1 
ATOM   4844 C CB  . LEU B 1 91  ? -3.547  72.578 365.643 1.00 45.61  ? 92  LEU B CB  1 
ATOM   4845 C CG  . LEU B 1 91  ? -4.430  72.934 364.447 1.00 67.57  ? 92  LEU B CG  1 
ATOM   4846 C CD1 . LEU B 1 91  ? -3.940  74.172 363.721 1.00 54.87  ? 92  LEU B CD1 1 
ATOM   4847 C CD2 . LEU B 1 91  ? -4.528  71.739 363.498 1.00 55.40  ? 92  LEU B CD2 1 
ATOM   4848 N N   . SER B 1 92  ? -2.943  69.964 367.790 1.00 61.94  ? 93  SER B N   1 
ATOM   4849 C CA  . SER B 1 92  ? -2.192  69.544 368.960 1.00 59.96  ? 93  SER B CA  1 
ATOM   4850 C C   . SER B 1 92  ? -1.118  68.569 368.511 1.00 63.08  ? 93  SER B C   1 
ATOM   4851 O O   . SER B 1 92  ? -1.290  67.852 367.523 1.00 64.13  ? 93  SER B O   1 
ATOM   4852 C CB  . SER B 1 92  ? -3.091  68.890 370.016 1.00 50.11  ? 93  SER B CB  1 
ATOM   4853 O OG  . SER B 1 92  ? -2.312  68.286 371.033 1.00 52.31  ? 93  SER B OG  1 
ATOM   4854 N N   . GLU B 1 93  ? 0.004   68.565 369.229 1.00 59.01  ? 94  GLU B N   1 
ATOM   4855 C CA  . GLU B 1 93  ? 0.995   67.520 369.025 1.00 47.03  ? 94  GLU B CA  1 
ATOM   4856 C C   . GLU B 1 93  ? 0.563   66.193 369.635 1.00 56.16  ? 94  GLU B C   1 
ATOM   4857 O O   . GLU B 1 93  ? 1.139   65.155 369.294 1.00 68.67  ? 94  GLU B O   1 
ATOM   4858 C CB  . GLU B 1 93  ? 2.341   67.942 369.609 1.00 45.17  ? 94  GLU B CB  1 
ATOM   4859 C CG  . GLU B 1 93  ? 2.941   69.156 368.937 1.00 50.16  ? 94  GLU B CG  1 
ATOM   4860 C CD  . GLU B 1 93  ? 4.261   69.547 369.553 1.00 78.97  ? 94  GLU B CD  1 
ATOM   4861 O OE1 . GLU B 1 93  ? 4.297   70.556 370.292 1.00 89.99  ? 94  GLU B OE1 1 
ATOM   4862 O OE2 . GLU B 1 93  ? 5.261   68.838 369.304 1.00 58.83  ? 94  GLU B OE2 1 
ATOM   4863 N N   . ASP B 1 94  ? -0.426  66.207 370.531 1.00 59.54  ? 95  ASP B N   1 
ATOM   4864 C CA  . ASP B 1 94  ? -1.039  64.985 371.056 1.00 61.74  ? 95  ASP B CA  1 
ATOM   4865 C C   . ASP B 1 94  ? -2.135  64.576 370.078 1.00 61.02  ? 95  ASP B C   1 
ATOM   4866 O O   . ASP B 1 94  ? -3.311  64.901 370.255 1.00 58.52  ? 95  ASP B O   1 
ATOM   4867 C CB  . ASP B 1 94  ? -1.580  65.214 372.464 1.00 48.00  ? 95  ASP B CB  1 
ATOM   4868 C CG  . ASP B 1 94  ? -2.317  63.997 373.027 1.00 53.33  ? 95  ASP B CG  1 
ATOM   4869 O OD1 . ASP B 1 94  ? -2.180  62.887 372.478 1.00 68.13  ? 95  ASP B OD1 1 
ATOM   4870 O OD2 . ASP B 1 94  ? -3.051  64.158 374.024 1.00 78.26  ? 95  ASP B OD2 1 
ATOM   4871 N N   . CYS B 1 95  ? -1.743  63.844 369.030 1.00 59.68  ? 96  CYS B N   1 
ATOM   4872 C CA  . CYS B 1 95  ? -2.651  63.555 367.931 1.00 57.75  ? 96  CYS B CA  1 
ATOM   4873 C C   . CYS B 1 95  ? -2.611  62.114 367.449 1.00 52.57  ? 96  CYS B C   1 
ATOM   4874 O O   . CYS B 1 95  ? -3.306  61.787 366.482 1.00 55.88  ? 96  CYS B O   1 
ATOM   4875 C CB  . CYS B 1 95  ? -2.350  64.484 366.751 1.00 50.60  ? 96  CYS B CB  1 
ATOM   4876 S SG  . CYS B 1 95  ? -0.665  64.345 366.105 1.00 54.97  ? 96  CYS B SG  1 
ATOM   4877 N N   . LEU B 1 96  ? -1.841  61.240 368.090 1.00 50.06  ? 97  LEU B N   1 
ATOM   4878 C CA  . LEU B 1 96  ? -1.658  59.878 367.597 1.00 46.62  ? 97  LEU B CA  1 
ATOM   4879 C C   . LEU B 1 96  ? -2.824  59.006 368.062 1.00 52.04  ? 97  LEU B C   1 
ATOM   4880 O O   . LEU B 1 96  ? -2.729  58.216 369.005 1.00 54.46  ? 97  LEU B O   1 
ATOM   4881 C CB  . LEU B 1 96  ? -0.303  59.341 368.043 1.00 43.88  ? 97  LEU B CB  1 
ATOM   4882 C CG  . LEU B 1 96  ? 0.846   60.060 367.313 1.00 50.24  ? 97  LEU B CG  1 
ATOM   4883 C CD1 . LEU B 1 96  ? 2.173   59.340 367.491 1.00 53.24  ? 97  LEU B CD1 1 
ATOM   4884 C CD2 . LEU B 1 96  ? 0.529   60.223 365.816 1.00 49.89  ? 97  LEU B CD2 1 
ATOM   4885 N N   . TYR B 1 97  ? -3.952  59.152 367.362 1.00 51.55  ? 98  TYR B N   1 
ATOM   4886 C CA  . TYR B 1 97  ? -5.159  58.376 367.617 1.00 42.01  ? 98  TYR B CA  1 
ATOM   4887 C C   . TYR B 1 97  ? -5.684  57.819 366.302 1.00 59.11  ? 98  TYR B C   1 
ATOM   4888 O O   . TYR B 1 97  ? -5.526  58.436 365.245 1.00 51.12  ? 98  TYR B O   1 
ATOM   4889 C CB  . TYR B 1 97  ? -6.259  59.228 368.293 1.00 44.14  ? 98  TYR B CB  1 
ATOM   4890 C CG  . TYR B 1 97  ? -5.821  59.878 369.585 1.00 54.66  ? 98  TYR B CG  1 
ATOM   4891 C CD1 . TYR B 1 97  ? -5.066  61.047 369.576 1.00 48.53  ? 98  TYR B CD1 1 
ATOM   4892 C CD2 . TYR B 1 97  ? -6.155  59.320 370.814 1.00 60.33  ? 98  TYR B CD2 1 
ATOM   4893 C CE1 . TYR B 1 97  ? -4.657  61.640 370.745 1.00 53.73  ? 98  TYR B CE1 1 
ATOM   4894 C CE2 . TYR B 1 97  ? -5.752  59.909 371.994 1.00 55.91  ? 98  TYR B CE2 1 
ATOM   4895 C CZ  . TYR B 1 97  ? -5.004  61.068 371.952 1.00 63.97  ? 98  TYR B CZ  1 
ATOM   4896 O OH  . TYR B 1 97  ? -4.597  61.661 373.120 1.00 49.22  ? 98  TYR B OH  1 
ATOM   4897 N N   . LEU B 1 98  ? -6.315  56.650 366.371 1.00 51.00  ? 99  LEU B N   1 
ATOM   4898 C CA  . LEU B 1 98  ? -6.893  56.024 365.194 1.00 53.36  ? 99  LEU B CA  1 
ATOM   4899 C C   . LEU B 1 98  ? -8.379  55.774 365.412 1.00 55.83  ? 99  LEU B C   1 
ATOM   4900 O O   . LEU B 1 98  ? -8.890  55.844 366.531 1.00 49.26  ? 99  LEU B O   1 
ATOM   4901 C CB  . LEU B 1 98  ? -6.167  54.715 364.840 1.00 53.50  ? 99  LEU B CB  1 
ATOM   4902 C CG  . LEU B 1 98  ? -5.996  53.603 365.874 1.00 57.39  ? 99  LEU B CG  1 
ATOM   4903 C CD1 . LEU B 1 98  ? -7.230  52.722 365.921 1.00 48.27  ? 99  LEU B CD1 1 
ATOM   4904 C CD2 . LEU B 1 98  ? -4.764  52.772 365.539 1.00 49.69  ? 99  LEU B CD2 1 
ATOM   4905 N N   . ASN B 1 99  ? -9.070  55.469 364.315 1.00 56.13  ? 100 ASN B N   1 
ATOM   4906 C CA  . ASN B 1 99  ? -10.511 55.273 364.310 1.00 45.61  ? 100 ASN B CA  1 
ATOM   4907 C C   . ASN B 1 99  ? -10.848 53.906 363.737 1.00 54.18  ? 100 ASN B C   1 
ATOM   4908 O O   . ASN B 1 99  ? -10.109 53.365 362.910 1.00 57.16  ? 100 ASN B O   1 
ATOM   4909 C CB  . ASN B 1 99  ? -11.197 56.373 363.509 1.00 48.57  ? 100 ASN B CB  1 
ATOM   4910 C CG  . ASN B 1 99  ? -10.622 57.737 363.818 1.00 67.42  ? 100 ASN B CG  1 
ATOM   4911 O OD1 . ASN B 1 99  ? -10.734 58.223 364.947 1.00 55.69  ? 100 ASN B OD1 1 
ATOM   4912 N ND2 . ASN B 1 99  ? -9.975  58.351 362.832 1.00 54.96  ? 100 ASN B ND2 1 
ATOM   4913 N N   . VAL B 1 100 ? -11.957 53.335 364.200 1.00 51.98  ? 101 VAL B N   1 
ATOM   4914 C CA  . VAL B 1 100 ? -12.403 52.025 363.737 1.00 44.75  ? 101 VAL B CA  1 
ATOM   4915 C C   . VAL B 1 100 ? -13.905 52.082 363.510 1.00 58.34  ? 101 VAL B C   1 
ATOM   4916 O O   . VAL B 1 100 ? -14.656 52.514 364.390 1.00 56.85  ? 101 VAL B O   1 
ATOM   4917 C CB  . VAL B 1 100 ? -12.055 50.897 364.731 1.00 59.24  ? 101 VAL B CB  1 
ATOM   4918 C CG1 . VAL B 1 100 ? -12.556 49.565 364.200 1.00 42.37  ? 101 VAL B CG1 1 
ATOM   4919 C CG2 . VAL B 1 100 ? -10.544 50.834 365.002 1.00 42.40  ? 101 VAL B CG2 1 
ATOM   4920 N N   . TRP B 1 101 ? -14.342 51.664 362.328 1.00 58.47  ? 102 TRP B N   1 
ATOM   4921 C CA  . TRP B 1 101 ? -15.754 51.518 362.020 1.00 45.31  ? 102 TRP B CA  1 
ATOM   4922 C C   . TRP B 1 101 ? -16.049 50.049 361.768 1.00 68.54  ? 102 TRP B C   1 
ATOM   4923 O O   . TRP B 1 101 ? -15.261 49.354 361.113 1.00 61.30  ? 102 TRP B O   1 
ATOM   4924 C CB  . TRP B 1 101 ? -16.149 52.322 360.792 1.00 53.14  ? 102 TRP B CB  1 
ATOM   4925 C CG  . TRP B 1 101 ? -16.163 53.798 360.943 1.00 50.64  ? 102 TRP B CG  1 
ATOM   4926 C CD1 . TRP B 1 101 ? -17.245 54.585 361.224 1.00 47.12  ? 102 TRP B CD1 1 
ATOM   4927 C CD2 . TRP B 1 101 ? -15.051 54.684 360.778 1.00 42.72  ? 102 TRP B CD2 1 
ATOM   4928 N NE1 . TRP B 1 101 ? -16.871 55.905 361.253 1.00 48.86  ? 102 TRP B NE1 1 
ATOM   4929 C CE2 . TRP B 1 101 ? -15.530 55.995 360.977 1.00 53.66  ? 102 TRP B CE2 1 
ATOM   4930 C CE3 . TRP B 1 101 ? -13.696 54.497 360.483 1.00 49.74  ? 102 TRP B CE3 1 
ATOM   4931 C CZ2 . TRP B 1 101 ? -14.699 57.116 360.891 1.00 49.38  ? 102 TRP B CZ2 1 
ATOM   4932 C CZ3 . TRP B 1 101 ? -12.872 55.611 360.398 1.00 48.99  ? 102 TRP B CZ3 1 
ATOM   4933 C CH2 . TRP B 1 101 ? -13.377 56.903 360.601 1.00 49.89  ? 102 TRP B CH2 1 
ATOM   4934 N N   . THR B 1 102 ? -17.200 49.588 362.265 1.00 52.41  ? 103 THR B N   1 
ATOM   4935 C CA  . THR B 1 102 ? -17.576 48.189 362.167 1.00 49.67  ? 103 THR B CA  1 
ATOM   4936 C C   . THR B 1 102 ? -19.095 48.064 362.078 1.00 59.81  ? 103 THR B C   1 
ATOM   4937 O O   . THR B 1 102 ? -19.807 48.959 362.556 1.00 56.33  ? 103 THR B O   1 
ATOM   4938 C CB  . THR B 1 102 ? -17.005 47.421 363.371 1.00 68.93  ? 103 THR B CB  1 
ATOM   4939 O OG1 . THR B 1 102 ? -16.888 46.030 363.067 1.00 80.63  ? 103 THR B OG1 1 
ATOM   4940 C CG2 . THR B 1 102 ? -17.838 47.607 364.612 1.00 77.64  ? 103 THR B CG2 1 
ATOM   4941 N N   . PRO B 1 103 ? -19.615 47.022 361.422 1.00 64.86  ? 104 PRO B N   1 
ATOM   4942 C CA  . PRO B 1 103 ? -21.072 46.886 361.296 1.00 61.02  ? 104 PRO B CA  1 
ATOM   4943 C C   . PRO B 1 103 ? -21.767 46.701 362.636 1.00 71.22  ? 104 PRO B C   1 
ATOM   4944 O O   . PRO B 1 103 ? -21.182 46.256 363.625 1.00 59.17  ? 104 PRO B O   1 
ATOM   4945 C CB  . PRO B 1 103 ? -21.239 45.649 360.410 1.00 59.54  ? 104 PRO B CB  1 
ATOM   4946 C CG  . PRO B 1 103 ? -20.008 45.594 359.601 1.00 67.74  ? 104 PRO B CG  1 
ATOM   4947 C CD  . PRO B 1 103 ? -18.909 46.141 360.476 1.00 62.51  ? 104 PRO B CD  1 
ATOM   4948 N N   . TYR B 1 104 ? -23.049 47.050 362.644 1.00 76.70  ? 105 TYR B N   1 
ATOM   4949 C CA  . TYR B 1 104 ? -23.913 46.935 363.816 1.00 77.49  ? 105 TYR B CA  1 
ATOM   4950 C C   . TYR B 1 104 ? -25.054 45.984 363.489 1.00 87.09  ? 105 TYR B C   1 
ATOM   4951 O O   . TYR B 1 104 ? -25.946 46.345 362.698 1.00 101.19 ? 105 TYR B O   1 
ATOM   4952 C CB  . TYR B 1 104 ? -24.458 48.307 364.216 1.00 74.19  ? 105 TYR B CB  1 
ATOM   4953 C CG  . TYR B 1 104 ? -25.063 48.369 365.599 1.00 93.76  ? 105 TYR B CG  1 
ATOM   4954 C CD1 . TYR B 1 104 ? -26.348 47.899 365.839 1.00 96.07  ? 105 TYR B CD1 1 
ATOM   4955 C CD2 . TYR B 1 104 ? -24.355 48.914 366.662 1.00 89.03  ? 105 TYR B CD2 1 
ATOM   4956 C CE1 . TYR B 1 104 ? -26.904 47.961 367.097 1.00 94.16  ? 105 TYR B CE1 1 
ATOM   4957 C CE2 . TYR B 1 104 ? -24.901 48.982 367.923 1.00 91.61  ? 105 TYR B CE2 1 
ATOM   4958 C CZ  . TYR B 1 104 ? -26.178 48.503 368.136 1.00 102.85 ? 105 TYR B CZ  1 
ATOM   4959 O OH  . TYR B 1 104 ? -26.735 48.564 369.392 1.00 84.07  ? 105 TYR B OH  1 
ATOM   4960 N N   . PRO B 1 105 ? -25.093 44.773 364.063 1.00 93.60  ? 106 PRO B N   1 
ATOM   4961 C CA  . PRO B 1 105 ? -24.162 44.287 365.086 1.00 98.64  ? 106 PRO B CA  1 
ATOM   4962 C C   . PRO B 1 105 ? -22.816 43.803 364.540 1.00 89.21  ? 106 PRO B C   1 
ATOM   4963 O O   . PRO B 1 105 ? -22.673 43.593 363.330 1.00 90.58  ? 106 PRO B O   1 
ATOM   4964 C CB  . PRO B 1 105 ? -24.932 43.127 365.713 1.00 100.51 ? 106 PRO B CB  1 
ATOM   4965 C CG  . PRO B 1 105 ? -25.727 42.579 364.575 1.00 84.80  ? 106 PRO B CG  1 
ATOM   4966 C CD  . PRO B 1 105 ? -26.123 43.771 363.738 1.00 93.42  ? 106 PRO B CD  1 
ATOM   4967 N N   . ARG B 1 106 ? -21.861 43.638 365.455 1.00 78.33  ? 107 ARG B N   1 
ATOM   4968 C CA  . ARG B 1 106 ? -20.512 43.211 365.113 1.00 74.90  ? 107 ARG B CA  1 
ATOM   4969 C C   . ARG B 1 106 ? -20.560 41.961 364.238 1.00 76.96  ? 107 ARG B C   1 
ATOM   4970 O O   . ARG B 1 106 ? -21.433 41.105 364.430 1.00 91.92  ? 107 ARG B O   1 
ATOM   4971 C CB  . ARG B 1 106 ? -19.715 42.932 366.392 1.00 76.18  ? 107 ARG B CB  1 
ATOM   4972 C CG  . ARG B 1 106 ? -18.221 43.206 366.296 1.00 78.20  ? 107 ARG B CG  1 
ATOM   4973 C CD  . ARG B 1 106 ? -17.561 43.130 367.662 1.00 80.35  ? 107 ARG B CD  1 
ATOM   4974 N NE  . ARG B 1 106 ? -18.127 44.121 368.567 1.00 82.32  ? 107 ARG B NE  1 
ATOM   4975 C CZ  . ARG B 1 106 ? -17.896 44.161 369.873 1.00 85.13  ? 107 ARG B CZ  1 
ATOM   4976 N NH1 . ARG B 1 106 ? -17.100 43.262 370.436 1.00 90.25  ? 107 ARG B NH1 1 
ATOM   4977 N NH2 . ARG B 1 106 ? -18.463 45.102 370.617 1.00 81.26  ? 107 ARG B NH2 1 
ATOM   4978 N N   . PRO B 1 107 ? -19.661 41.827 363.263 1.00 100.29 ? 108 PRO B N   1 
ATOM   4979 C CA  . PRO B 1 107 ? -19.717 40.663 362.371 1.00 102.93 ? 108 PRO B CA  1 
ATOM   4980 C C   . PRO B 1 107 ? -19.467 39.366 363.125 1.00 99.98  ? 108 PRO B C   1 
ATOM   4981 O O   . PRO B 1 107 ? -18.654 39.307 364.050 1.00 87.81  ? 108 PRO B O   1 
ATOM   4982 C CB  . PRO B 1 107 ? -18.608 40.942 361.349 1.00 96.02  ? 108 PRO B CB  1 
ATOM   4983 C CG  . PRO B 1 107 ? -18.355 42.405 361.440 1.00 91.27  ? 108 PRO B CG  1 
ATOM   4984 C CD  . PRO B 1 107 ? -18.614 42.781 362.862 1.00 78.23  ? 108 PRO B CD  1 
ATOM   4985 N N   . THR B 1 108 ? -20.166 38.299 362.753 1.00 106.16 ? 109 THR B N   1 
ATOM   4986 C CA  . THR B 1 108 ? -19.950 36.990 363.374 1.00 103.30 ? 109 THR B CA  1 
ATOM   4987 C C   . THR B 1 108 ? -18.650 36.332 362.964 1.00 95.52  ? 109 THR B C   1 
ATOM   4988 O O   . THR B 1 108 ? -17.883 35.921 363.793 1.00 94.67  ? 109 THR B O   1 
ATOM   4989 C CB  . THR B 1 108 ? -21.088 36.057 363.031 1.00 107.64 ? 109 THR B CB  1 
ATOM   4990 O OG1 . THR B 1 108 ? -21.076 35.818 361.631 1.00 110.22 ? 109 THR B OG1 1 
ATOM   4991 C CG2 . THR B 1 108 ? -22.372 36.716 363.370 1.00 93.01  ? 109 THR B CG2 1 
ATOM   4992 N N   . SER B 1 109 ? -18.392 36.279 361.669 1.00 97.56  ? 110 SER B N   1 
ATOM   4993 C CA  . SER B 1 109 ? -17.138 35.783 361.127 1.00 94.51  ? 110 SER B CA  1 
ATOM   4994 C C   . SER B 1 109 ? -16.193 36.938 360.825 1.00 93.46  ? 110 SER B C   1 
ATOM   4995 O O   . SER B 1 109 ? -16.630 38.080 360.650 1.00 94.74  ? 110 SER B O   1 
ATOM   4996 C CB  . SER B 1 109 ? -17.410 34.975 359.860 1.00 90.09  ? 110 SER B CB  1 
ATOM   4997 O OG  . SER B 1 109 ? -18.478 35.548 359.126 1.00 92.87  ? 110 SER B OG  1 
ATOM   4998 N N   . PRO B 1 110 ? -14.884 36.677 360.766 1.00 82.36  ? 111 PRO B N   1 
ATOM   4999 C CA  . PRO B 1 110 ? -13.931 37.754 360.466 1.00 77.02  ? 111 PRO B CA  1 
ATOM   5000 C C   . PRO B 1 110 ? -14.207 38.402 359.116 1.00 89.30  ? 111 PRO B C   1 
ATOM   5001 O O   . PRO B 1 110 ? -14.632 37.750 358.159 1.00 86.42  ? 111 PRO B O   1 
ATOM   5002 C CB  . PRO B 1 110 ? -12.575 37.041 360.476 1.00 83.21  ? 111 PRO B CB  1 
ATOM   5003 C CG  . PRO B 1 110 ? -12.786 35.867 361.366 1.00 67.14  ? 111 PRO B CG  1 
ATOM   5004 C CD  . PRO B 1 110 ? -14.194 35.418 361.098 1.00 71.35  ? 111 PRO B CD  1 
ATOM   5005 N N   . THR B 1 111 ? -14.035 39.722 359.071 1.00 85.08  ? 112 THR B N   1 
ATOM   5006 C CA  . THR B 1 111 ? -14.303 40.556 357.904 1.00 82.49  ? 112 THR B CA  1 
ATOM   5007 C C   . THR B 1 111 ? -13.081 41.306 357.475 1.00 75.90  ? 112 THR B C   1 
ATOM   5008 O O   . THR B 1 111 ? -12.276 41.644 358.301 1.00 67.40  ? 112 THR B O   1 
ATOM   5009 C CB  . THR B 1 111 ? -15.359 41.593 358.236 1.00 75.31  ? 112 THR B CB  1 
ATOM   5010 O OG1 . THR B 1 111 ? -16.449 40.944 358.849 1.00 104.25 ? 112 THR B OG1 1 
ATOM   5011 C CG2 . THR B 1 111 ? -15.872 42.210 357.024 1.00 72.69  ? 112 THR B CG2 1 
ATOM   5012 N N   . PRO B 1 112 ? -12.932 41.548 356.180 1.00 80.80  ? 113 PRO B N   1 
ATOM   5013 C CA  . PRO B 1 112 ? -11.731 42.247 355.686 1.00 74.40  ? 113 PRO B CA  1 
ATOM   5014 C C   . PRO B 1 112 ? -11.682 43.713 356.106 1.00 60.16  ? 113 PRO B C   1 
ATOM   5015 O O   . PRO B 1 112 ? -12.704 44.347 356.374 1.00 62.25  ? 113 PRO B O   1 
ATOM   5016 C CB  . PRO B 1 112 ? -11.841 42.111 354.158 1.00 84.54  ? 113 PRO B CB  1 
ATOM   5017 C CG  . PRO B 1 112 ? -13.270 41.721 353.890 1.00 84.87  ? 113 PRO B CG  1 
ATOM   5018 C CD  . PRO B 1 112 ? -13.699 40.930 355.085 1.00 76.53  ? 113 PRO B CD  1 
ATOM   5019 N N   . VAL B 1 113 ? -10.466 44.261 356.160 1.00 59.38  ? 114 VAL B N   1 
ATOM   5020 C CA  . VAL B 1 113 ? -10.259 45.630 356.620 1.00 66.65  ? 114 VAL B CA  1 
ATOM   5021 C C   . VAL B 1 113 ? -9.845  46.503 355.452 1.00 57.64  ? 114 VAL B C   1 
ATOM   5022 O O   . VAL B 1 113 ? -9.076  46.087 354.578 1.00 73.16  ? 114 VAL B O   1 
ATOM   5023 C CB  . VAL B 1 113 ? -9.181  45.761 357.714 1.00 77.22  ? 114 VAL B CB  1 
ATOM   5024 C CG1 . VAL B 1 113 ? -9.384  47.043 358.516 1.00 66.76  ? 114 VAL B CG1 1 
ATOM   5025 C CG2 . VAL B 1 113 ? -9.124  44.545 358.577 1.00 64.41  ? 114 VAL B CG2 1 
ATOM   5026 N N   . LEU B 1 114 ? -10.316 47.744 355.476 1.00 61.53  ? 115 LEU B N   1 
ATOM   5027 C CA  . LEU B 1 114 ? -9.696  48.838 354.745 1.00 53.26  ? 115 LEU B CA  1 
ATOM   5028 C C   . LEU B 1 114 ? -9.025  49.753 355.765 1.00 55.62  ? 115 LEU B C   1 
ATOM   5029 O O   . LEU B 1 114 ? -9.582  49.994 356.839 1.00 63.51  ? 115 LEU B O   1 
ATOM   5030 C CB  . LEU B 1 114 ? -10.729 49.598 353.905 1.00 63.22  ? 115 LEU B CB  1 
ATOM   5031 C CG  . LEU B 1 114 ? -11.299 48.825 352.705 1.00 59.91  ? 115 LEU B CG  1 
ATOM   5032 C CD1 . LEU B 1 114 ? -12.758 49.143 352.440 1.00 61.68  ? 115 LEU B CD1 1 
ATOM   5033 C CD2 . LEU B 1 114 ? -10.480 49.121 351.474 1.00 63.60  ? 115 LEU B CD2 1 
ATOM   5034 N N   . VAL B 1 115 ? -7.813  50.213 355.456 1.00 54.11  ? 116 VAL B N   1 
ATOM   5035 C CA  . VAL B 1 115 ? -7.079  51.135 356.320 1.00 59.45  ? 116 VAL B CA  1 
ATOM   5036 C C   . VAL B 1 115 ? -6.740  52.377 355.505 1.00 56.12  ? 116 VAL B C   1 
ATOM   5037 O O   . VAL B 1 115 ? -5.915  52.320 354.584 1.00 57.28  ? 116 VAL B O   1 
ATOM   5038 C CB  . VAL B 1 115 ? -5.814  50.500 356.916 1.00 68.34  ? 116 VAL B CB  1 
ATOM   5039 C CG1 . VAL B 1 115 ? -5.131  51.483 357.861 1.00 44.66  ? 116 VAL B CG1 1 
ATOM   5040 C CG2 . VAL B 1 115 ? -6.159  49.233 357.670 1.00 58.08  ? 116 VAL B CG2 1 
ATOM   5041 N N   . TRP B 1 116 ? -7.355  53.504 355.857 1.00 53.79  ? 117 TRP B N   1 
ATOM   5042 C CA  . TRP B 1 116 ? -7.200  54.751 355.118 1.00 41.98  ? 117 TRP B CA  1 
ATOM   5043 C C   . TRP B 1 116 ? -5.984  55.525 355.609 1.00 53.61  ? 117 TRP B C   1 
ATOM   5044 O O   . TRP B 1 116 ? -5.787  55.683 356.820 1.00 59.32  ? 117 TRP B O   1 
ATOM   5045 C CB  . TRP B 1 116 ? -8.458  55.607 355.261 1.00 48.83  ? 117 TRP B CB  1 
ATOM   5046 C CG  . TRP B 1 116 ? -8.371  56.968 354.618 1.00 49.38  ? 117 TRP B CG  1 
ATOM   5047 C CD1 . TRP B 1 116 ? -8.367  58.174 355.253 1.00 54.83  ? 117 TRP B CD1 1 
ATOM   5048 C CD2 . TRP B 1 116 ? -8.302  57.257 353.212 1.00 56.77  ? 117 TRP B CD2 1 
ATOM   5049 N NE1 . TRP B 1 116 ? -8.289  59.197 354.335 1.00 50.00  ? 117 TRP B NE1 1 
ATOM   5050 C CE2 . TRP B 1 116 ? -8.246  58.659 353.075 1.00 48.26  ? 117 TRP B CE2 1 
ATOM   5051 C CE3 . TRP B 1 116 ? -8.270  56.466 352.060 1.00 46.84  ? 117 TRP B CE3 1 
ATOM   5052 C CZ2 . TRP B 1 116 ? -8.166  59.287 351.830 1.00 52.63  ? 117 TRP B CZ2 1 
ATOM   5053 C CZ3 . TRP B 1 116 ? -8.191  57.092 350.819 1.00 53.14  ? 117 TRP B CZ3 1 
ATOM   5054 C CH2 . TRP B 1 116 ? -8.141  58.488 350.716 1.00 48.16  ? 117 TRP B CH2 1 
ATOM   5055 N N   . ILE B 1 117 ? -5.177  56.013 354.670 1.00 49.22  ? 118 ILE B N   1 
ATOM   5056 C CA  . ILE B 1 117 ? -4.074  56.925 354.968 1.00 49.32  ? 118 ILE B CA  1 
ATOM   5057 C C   . ILE B 1 117 ? -4.334  58.210 354.198 1.00 52.19  ? 118 ILE B C   1 
ATOM   5058 O O   . ILE B 1 117 ? -4.245  58.229 352.963 1.00 65.40  ? 118 ILE B O   1 
ATOM   5059 C CB  . ILE B 1 117 ? -2.705  56.338 354.601 1.00 46.50  ? 118 ILE B CB  1 
ATOM   5060 C CG1 . ILE B 1 117 ? -2.536  54.942 355.195 1.00 45.77  ? 118 ILE B CG1 1 
ATOM   5061 C CG2 . ILE B 1 117 ? -1.589  57.252 355.081 1.00 50.20  ? 118 ILE B CG2 1 
ATOM   5062 C CD1 . ILE B 1 117 ? -1.156  54.371 354.975 1.00 52.46  ? 118 ILE B CD1 1 
ATOM   5063 N N   . TYR B 1 118 ? -4.650  59.284 354.913 1.00 46.29  ? 119 TYR B N   1 
ATOM   5064 C CA  . TYR B 1 118 ? -4.974  60.531 354.240 1.00 47.17  ? 119 TYR B CA  1 
ATOM   5065 C C   . TYR B 1 118 ? -3.735  61.161 353.609 1.00 52.19  ? 119 TYR B C   1 
ATOM   5066 O O   . TYR B 1 118 ? -2.592  60.899 354.003 1.00 43.61  ? 119 TYR B O   1 
ATOM   5067 C CB  . TYR B 1 118 ? -5.618  61.524 355.206 1.00 49.67  ? 119 TYR B CB  1 
ATOM   5068 C CG  . TYR B 1 118 ? -4.800  61.871 356.441 1.00 49.86  ? 119 TYR B CG  1 
ATOM   5069 C CD1 . TYR B 1 118 ? -3.670  62.681 356.356 1.00 44.58  ? 119 TYR B CD1 1 
ATOM   5070 C CD2 . TYR B 1 118 ? -5.185  61.418 357.701 1.00 55.43  ? 119 TYR B CD2 1 
ATOM   5071 C CE1 . TYR B 1 118 ? -2.935  63.013 357.485 1.00 50.58  ? 119 TYR B CE1 1 
ATOM   5072 C CE2 . TYR B 1 118 ? -4.453  61.746 358.841 1.00 47.37  ? 119 TYR B CE2 1 
ATOM   5073 C CZ  . TYR B 1 118 ? -3.332  62.548 358.726 1.00 51.66  ? 119 TYR B CZ  1 
ATOM   5074 O OH  . TYR B 1 118 ? -2.598  62.877 359.851 1.00 48.03  ? 119 TYR B OH  1 
ATOM   5075 N N   . GLY B 1 119 ? -3.985  62.023 352.622 1.00 51.34  ? 120 GLY B N   1 
ATOM   5076 C CA  . GLY B 1 119 ? -2.950  62.820 352.005 1.00 54.86  ? 120 GLY B CA  1 
ATOM   5077 C C   . GLY B 1 119 ? -2.894  64.231 352.568 1.00 54.81  ? 120 GLY B C   1 
ATOM   5078 O O   . GLY B 1 119 ? -3.481  64.551 353.603 1.00 55.66  ? 120 GLY B O   1 
ATOM   5079 N N   . GLY B 1 120 ? -2.167  65.090 351.857 1.00 54.51  ? 121 GLY B N   1 
ATOM   5080 C CA  . GLY B 1 120 ? -1.960  66.454 352.297 1.00 44.87  ? 121 GLY B CA  1 
ATOM   5081 C C   . GLY B 1 120 ? -0.514  66.902 352.207 1.00 57.53  ? 121 GLY B C   1 
ATOM   5082 O O   . GLY B 1 120 ? -0.060  67.721 353.013 1.00 57.68  ? 121 GLY B O   1 
ATOM   5083 N N   . GLY B 1 121 ? 0.220   66.356 351.237 1.00 52.79  ? 122 GLY B N   1 
ATOM   5084 C CA  . GLY B 1 121 ? 1.582   66.775 350.967 1.00 58.30  ? 122 GLY B CA  1 
ATOM   5085 C C   . GLY B 1 121 ? 2.583   66.496 352.064 1.00 51.35  ? 122 GLY B C   1 
ATOM   5086 O O   . GLY B 1 121 ? 3.639   67.133 352.095 1.00 56.37  ? 122 GLY B O   1 
ATOM   5087 N N   . PHE B 1 122 ? 2.288   65.555 352.960 1.00 51.37  ? 123 PHE B N   1 
ATOM   5088 C CA  . PHE B 1 122 ? 3.079   65.251 354.152 1.00 51.31  ? 123 PHE B CA  1 
ATOM   5089 C C   . PHE B 1 122 ? 3.202   66.434 355.105 1.00 45.84  ? 123 PHE B C   1 
ATOM   5090 O O   . PHE B 1 122 ? 3.945   66.351 356.087 1.00 54.81  ? 123 PHE B O   1 
ATOM   5091 C CB  . PHE B 1 122 ? 4.481   64.731 353.800 1.00 46.87  ? 123 PHE B CB  1 
ATOM   5092 C CG  . PHE B 1 122 ? 4.477   63.384 353.140 1.00 53.43  ? 123 PHE B CG  1 
ATOM   5093 C CD1 . PHE B 1 122 ? 4.726   63.264 351.779 1.00 53.92  ? 123 PHE B CD1 1 
ATOM   5094 C CD2 . PHE B 1 122 ? 4.217   62.239 353.874 1.00 42.24  ? 123 PHE B CD2 1 
ATOM   5095 C CE1 . PHE B 1 122 ? 4.719   62.024 351.164 1.00 46.36  ? 123 PHE B CE1 1 
ATOM   5096 C CE2 . PHE B 1 122 ? 4.205   60.997 353.269 1.00 54.08  ? 123 PHE B CE2 1 
ATOM   5097 C CZ  . PHE B 1 122 ? 4.456   60.888 351.907 1.00 55.33  ? 123 PHE B CZ  1 
ATOM   5098 N N   . TYR B 1 123 ? 2.486   67.531 354.852 1.00 44.71  ? 124 TYR B N   1 
ATOM   5099 C CA  . TYR B 1 123 ? 2.458   68.665 355.766 1.00 58.74  ? 124 TYR B CA  1 
ATOM   5100 C C   . TYR B 1 123 ? 1.082   68.948 356.360 1.00 60.95  ? 124 TYR B C   1 
ATOM   5101 O O   . TYR B 1 123 ? 0.960   69.873 357.171 1.00 48.10  ? 124 TYR B O   1 
ATOM   5102 C CB  . TYR B 1 123 ? 2.962   69.930 355.063 1.00 45.66  ? 124 TYR B CB  1 
ATOM   5103 C CG  . TYR B 1 123 ? 2.026   70.432 353.990 1.00 66.10  ? 124 TYR B CG  1 
ATOM   5104 C CD1 . TYR B 1 123 ? 2.188   70.039 352.670 1.00 52.32  ? 124 TYR B CD1 1 
ATOM   5105 C CD2 . TYR B 1 123 ? 0.985   71.304 354.293 1.00 59.14  ? 124 TYR B CD2 1 
ATOM   5106 C CE1 . TYR B 1 123 ? 1.342   70.492 351.689 1.00 65.24  ? 124 TYR B CE1 1 
ATOM   5107 C CE2 . TYR B 1 123 ? 0.130   71.756 353.319 1.00 58.89  ? 124 TYR B CE2 1 
ATOM   5108 C CZ  . TYR B 1 123 ? 0.317   71.350 352.019 1.00 64.00  ? 124 TYR B CZ  1 
ATOM   5109 O OH  . TYR B 1 123 ? -0.526  71.801 351.039 1.00 71.76  ? 124 TYR B OH  1 
ATOM   5110 N N   . SER B 1 124 ? 0.045   68.209 355.975 1.00 47.88  ? 125 SER B N   1 
ATOM   5111 C CA  . SER B 1 124 ? -1.306  68.516 356.428 1.00 45.60  ? 125 SER B CA  1 
ATOM   5112 C C   . SER B 1 124 ? -2.156  67.259 356.324 1.00 47.57  ? 125 SER B C   1 
ATOM   5113 O O   . SER B 1 124 ? -1.705  66.214 355.845 1.00 46.95  ? 125 SER B O   1 
ATOM   5114 C CB  . SER B 1 124 ? -1.917  69.651 355.606 1.00 50.74  ? 125 SER B CB  1 
ATOM   5115 O OG  . SER B 1 124 ? -1.999  69.271 354.241 1.00 49.93  ? 125 SER B OG  1 
ATOM   5116 N N   . GLY B 1 125 ? -3.410  67.379 356.756 1.00 38.48  ? 126 GLY B N   1 
ATOM   5117 C CA  . GLY B 1 125 ? -4.353  66.281 356.674 1.00 47.49  ? 126 GLY B CA  1 
ATOM   5118 C C   . GLY B 1 125 ? -4.782  65.760 358.028 1.00 53.52  ? 126 GLY B C   1 
ATOM   5119 O O   . GLY B 1 125 ? -4.110  66.001 359.036 1.00 45.60  ? 126 GLY B O   1 
ATOM   5120 N N   . ALA B 1 126 ? -5.904  65.045 358.060 1.00 52.14  ? 127 ALA B N   1 
ATOM   5121 C CA  . ALA B 1 126 ? -6.428  64.509 359.307 1.00 51.37  ? 127 ALA B CA  1 
ATOM   5122 C C   . ALA B 1 126 ? -7.447  63.436 358.973 1.00 58.61  ? 127 ALA B C   1 
ATOM   5123 O O   . ALA B 1 126 ? -8.126  63.506 357.945 1.00 52.77  ? 127 ALA B O   1 
ATOM   5124 C CB  . ALA B 1 126 ? -7.070  65.597 360.171 1.00 43.41  ? 127 ALA B CB  1 
ATOM   5125 N N   . SER B 1 127 ? -7.547  62.441 359.852 1.00 45.51  ? 128 SER B N   1 
ATOM   5126 C CA  . SER B 1 127 ? -8.521  61.383 359.627 1.00 51.56  ? 128 SER B CA  1 
ATOM   5127 C C   . SER B 1 127 ? -9.940  61.818 359.967 1.00 54.02  ? 128 SER B C   1 
ATOM   5128 O O   . SER B 1 127 ? -10.889 61.109 359.615 1.00 57.96  ? 128 SER B O   1 
ATOM   5129 C CB  . SER B 1 127 ? -8.135  60.143 360.432 1.00 46.02  ? 128 SER B CB  1 
ATOM   5130 O OG  . SER B 1 127 ? -8.301  60.370 361.820 1.00 59.08  ? 128 SER B OG  1 
ATOM   5131 N N   . SER B 1 128 ? -10.105 62.971 360.608 1.00 49.01  ? 129 SER B N   1 
ATOM   5132 C CA  . SER B 1 128 ? -11.409 63.440 361.055 1.00 50.57  ? 129 SER B CA  1 
ATOM   5133 C C   . SER B 1 128 ? -12.198 64.178 359.980 1.00 53.69  ? 129 SER B C   1 
ATOM   5134 O O   . SER B 1 128 ? -13.352 64.543 360.233 1.00 56.34  ? 129 SER B O   1 
ATOM   5135 C CB  . SER B 1 128 ? -11.233 64.361 362.255 1.00 37.57  ? 129 SER B CB  1 
ATOM   5136 O OG  . SER B 1 128 ? -10.282 65.366 361.961 1.00 50.17  ? 129 SER B OG  1 
ATOM   5137 N N   . LEU B 1 129 ? -11.618 64.420 358.808 1.00 54.21  ? 130 LEU B N   1 
ATOM   5138 C CA  . LEU B 1 129 ? -12.305 65.211 357.794 1.00 54.72  ? 130 LEU B CA  1 
ATOM   5139 C C   . LEU B 1 129 ? -13.599 64.531 357.359 1.00 55.99  ? 130 LEU B C   1 
ATOM   5140 O O   . LEU B 1 129 ? -13.685 63.302 357.286 1.00 58.97  ? 130 LEU B O   1 
ATOM   5141 C CB  . LEU B 1 129 ? -11.397 65.428 356.583 1.00 63.23  ? 130 LEU B CB  1 
ATOM   5142 C CG  . LEU B 1 129 ? -9.990  65.955 356.868 1.00 68.88  ? 130 LEU B CG  1 
ATOM   5143 C CD1 . LEU B 1 129 ? -9.381  66.551 355.615 1.00 50.42  ? 130 LEU B CD1 1 
ATOM   5144 C CD2 . LEU B 1 129 ? -10.012 66.974 357.986 1.00 53.43  ? 130 LEU B CD2 1 
ATOM   5145 N N   . ASP B 1 130 ? -14.611 65.354 357.057 1.00 52.88  ? 131 ASP B N   1 
ATOM   5146 C CA  . ASP B 1 130 ? -15.933 64.836 356.706 1.00 58.61  ? 131 ASP B CA  1 
ATOM   5147 C C   . ASP B 1 130 ? -15.878 63.897 355.508 1.00 51.01  ? 131 ASP B C   1 
ATOM   5148 O O   . ASP B 1 130 ? -16.621 62.911 355.454 1.00 67.40  ? 131 ASP B O   1 
ATOM   5149 C CB  . ASP B 1 130 ? -16.893 65.989 356.417 1.00 55.83  ? 131 ASP B CB  1 
ATOM   5150 C CG  . ASP B 1 130 ? -17.132 66.857 357.623 1.00 61.99  ? 131 ASP B CG  1 
ATOM   5151 O OD1 . ASP B 1 130 ? -16.899 66.369 358.746 1.00 63.93  ? 131 ASP B OD1 1 
ATOM   5152 O OD2 . ASP B 1 130 ? -17.551 68.022 357.452 1.00 78.25  ? 131 ASP B OD2 1 
ATOM   5153 N N   . VAL B 1 131 ? -15.014 64.189 354.531 1.00 53.62  ? 132 VAL B N   1 
ATOM   5154 C CA  . VAL B 1 131 ? -14.935 63.355 353.336 1.00 60.42  ? 132 VAL B CA  1 
ATOM   5155 C C   . VAL B 1 131 ? -14.298 62.004 353.602 1.00 54.84  ? 132 VAL B C   1 
ATOM   5156 O O   . VAL B 1 131 ? -14.281 61.156 352.700 1.00 54.47  ? 132 VAL B O   1 
ATOM   5157 C CB  . VAL B 1 131 ? -14.151 64.050 352.205 1.00 57.68  ? 132 VAL B CB  1 
ATOM   5158 C CG1 . VAL B 1 131 ? -15.054 65.002 351.455 1.00 68.31  ? 132 VAL B CG1 1 
ATOM   5159 C CG2 . VAL B 1 131 ? -12.937 64.774 352.767 1.00 63.77  ? 132 VAL B CG2 1 
ATOM   5160 N N   . TYR B 1 132 ? -13.761 61.788 354.804 1.00 56.18  ? 133 TYR B N   1 
ATOM   5161 C CA  . TYR B 1 132 ? -13.199 60.504 355.204 1.00 54.42  ? 133 TYR B CA  1 
ATOM   5162 C C   . TYR B 1 132 ? -14.128 59.737 356.134 1.00 49.77  ? 133 TYR B C   1 
ATOM   5163 O O   . TYR B 1 132 ? -13.741 58.683 356.649 1.00 63.10  ? 133 TYR B O   1 
ATOM   5164 C CB  . TYR B 1 132 ? -11.833 60.697 355.876 1.00 63.03  ? 133 TYR B CB  1 
ATOM   5165 C CG  . TYR B 1 132 ? -10.810 61.459 355.049 1.00 54.38  ? 133 TYR B CG  1 
ATOM   5166 C CD1 . TYR B 1 132 ? -9.770  62.148 355.663 1.00 55.93  ? 133 TYR B CD1 1 
ATOM   5167 C CD2 . TYR B 1 132 ? -10.881 61.487 353.661 1.00 49.84  ? 133 TYR B CD2 1 
ATOM   5168 C CE1 . TYR B 1 132 ? -8.832  62.851 354.919 1.00 43.64  ? 133 TYR B CE1 1 
ATOM   5169 C CE2 . TYR B 1 132 ? -9.946  62.187 352.909 1.00 47.84  ? 133 TYR B CE2 1 
ATOM   5170 C CZ  . TYR B 1 132 ? -8.924  62.864 353.546 1.00 55.62  ? 133 TYR B CZ  1 
ATOM   5171 O OH  . TYR B 1 132 ? -7.989  63.565 352.819 1.00 57.59  ? 133 TYR B OH  1 
ATOM   5172 N N   . ASP B 1 133 ? -15.335 60.250 356.367 1.00 53.33  ? 134 ASP B N   1 
ATOM   5173 C CA  . ASP B 1 133 ? -16.325 59.579 357.199 1.00 57.51  ? 134 ASP B CA  1 
ATOM   5174 C C   . ASP B 1 133 ? -16.518 58.138 356.751 1.00 55.21  ? 134 ASP B C   1 
ATOM   5175 O O   . ASP B 1 133 ? -16.964 57.881 355.630 1.00 58.83  ? 134 ASP B O   1 
ATOM   5176 C CB  . ASP B 1 133 ? -17.648 60.346 357.121 1.00 74.29  ? 134 ASP B CB  1 
ATOM   5177 C CG  . ASP B 1 133 ? -18.628 59.945 358.208 1.00 69.15  ? 134 ASP B CG  1 
ATOM   5178 O OD1 . ASP B 1 133 ? -18.421 58.897 358.856 1.00 57.30  ? 134 ASP B OD1 1 
ATOM   5179 O OD2 . ASP B 1 133 ? -19.613 60.688 358.412 1.00 64.77  ? 134 ASP B OD2 1 
ATOM   5180 N N   . GLY B 1 134 ? -16.175 57.197 357.629 1.00 50.67  ? 135 GLY B N   1 
ATOM   5181 C CA  . GLY B 1 134 ? -16.215 55.789 357.291 1.00 50.53  ? 135 GLY B CA  1 
ATOM   5182 C C   . GLY B 1 134 ? -17.563 55.109 357.397 1.00 58.56  ? 135 GLY B C   1 
ATOM   5183 O O   . GLY B 1 134 ? -17.672 53.931 357.043 1.00 57.70  ? 135 GLY B O   1 
ATOM   5184 N N   . ARG B 1 135 ? -18.606 55.815 357.845 1.00 52.22  ? 136 ARG B N   1 
ATOM   5185 C CA  . ARG B 1 135 ? -19.859 55.141 358.178 1.00 65.16  ? 136 ARG B CA  1 
ATOM   5186 C C   . ARG B 1 135 ? -20.562 54.593 356.935 1.00 57.10  ? 136 ARG B C   1 
ATOM   5187 O O   . ARG B 1 135 ? -21.140 53.500 356.979 1.00 59.61  ? 136 ARG B O   1 
ATOM   5188 C CB  . ARG B 1 135 ? -20.773 56.092 358.959 1.00 57.31  ? 136 ARG B CB  1 
ATOM   5189 C CG  . ARG B 1 135 ? -21.475 57.145 358.107 1.00 66.93  ? 136 ARG B CG  1 
ATOM   5190 C CD  . ARG B 1 135 ? -22.271 58.106 358.956 1.00 58.39  ? 136 ARG B CD  1 
ATOM   5191 N NE  . ARG B 1 135 ? -21.390 59.030 359.656 1.00 73.32  ? 136 ARG B NE  1 
ATOM   5192 C CZ  . ARG B 1 135 ? -21.738 59.718 360.739 1.00 74.75  ? 136 ARG B CZ  1 
ATOM   5193 N NH1 . ARG B 1 135 ? -22.953 59.581 361.247 1.00 67.56  ? 136 ARG B NH1 1 
ATOM   5194 N NH2 . ARG B 1 135 ? -20.868 60.537 361.314 1.00 60.57  ? 136 ARG B NH2 1 
ATOM   5195 N N   . PHE B 1 136 ? -20.511 55.318 355.813 1.00 56.30  ? 137 PHE B N   1 
ATOM   5196 C CA  . PHE B 1 136 ? -21.257 54.884 354.631 1.00 60.88  ? 137 PHE B CA  1 
ATOM   5197 C C   . PHE B 1 136 ? -20.639 53.644 354.004 1.00 46.87  ? 137 PHE B C   1 
ATOM   5198 O O   . PHE B 1 136 ? -21.359 52.712 353.627 1.00 53.30  ? 137 PHE B O   1 
ATOM   5199 C CB  . PHE B 1 136 ? -21.351 56.020 353.613 1.00 48.29  ? 137 PHE B CB  1 
ATOM   5200 C CG  . PHE B 1 136 ? -21.881 57.293 354.196 1.00 46.85  ? 137 PHE B CG  1 
ATOM   5201 C CD1 . PHE B 1 136 ? -23.225 57.414 354.517 1.00 54.00  ? 137 PHE B CD1 1 
ATOM   5202 C CD2 . PHE B 1 136 ? -21.033 58.353 354.465 1.00 54.30  ? 137 PHE B CD2 1 
ATOM   5203 C CE1 . PHE B 1 136 ? -23.720 58.583 355.081 1.00 63.99  ? 137 PHE B CE1 1 
ATOM   5204 C CE2 . PHE B 1 136 ? -21.520 59.526 355.032 1.00 67.92  ? 137 PHE B CE2 1 
ATOM   5205 C CZ  . PHE B 1 136 ? -22.865 59.641 355.339 1.00 66.16  ? 137 PHE B CZ  1 
ATOM   5206 N N   . LEU B 1 137 ? -19.310 53.604 353.891 1.00 48.70  ? 138 LEU B N   1 
ATOM   5207 C CA  . LEU B 1 137 ? -18.665 52.431 353.314 1.00 58.25  ? 138 LEU B CA  1 
ATOM   5208 C C   . LEU B 1 137 ? -18.961 51.195 354.148 1.00 57.13  ? 138 LEU B C   1 
ATOM   5209 O O   . LEU B 1 137 ? -19.344 50.146 353.616 1.00 58.39  ? 138 LEU B O   1 
ATOM   5210 C CB  . LEU B 1 137 ? -17.154 52.662 353.189 1.00 61.75  ? 138 LEU B CB  1 
ATOM   5211 C CG  . LEU B 1 137 ? -16.312 51.757 352.272 1.00 69.82  ? 138 LEU B CG  1 
ATOM   5212 C CD1 . LEU B 1 137 ? -16.149 50.312 352.774 1.00 88.37  ? 138 LEU B CD1 1 
ATOM   5213 C CD2 . LEU B 1 137 ? -16.917 51.767 350.878 1.00 58.19  ? 138 LEU B CD2 1 
ATOM   5214 N N   . VAL B 1 138 ? -18.817 51.309 355.468 1.00 63.76  ? 139 VAL B N   1 
ATOM   5215 C CA  . VAL B 1 138 ? -18.928 50.127 356.309 1.00 59.51  ? 139 VAL B CA  1 
ATOM   5216 C C   . VAL B 1 138 ? -20.376 49.641 356.360 1.00 58.96  ? 139 VAL B C   1 
ATOM   5217 O O   . VAL B 1 138 ? -20.636 48.434 356.346 1.00 55.29  ? 139 VAL B O   1 
ATOM   5218 C CB  . VAL B 1 138 ? -18.337 50.412 357.705 1.00 65.72  ? 139 VAL B CB  1 
ATOM   5219 C CG1 . VAL B 1 138 ? -16.875 50.821 357.603 1.00 60.23  ? 139 VAL B CG1 1 
ATOM   5220 C CG2 . VAL B 1 138 ? -19.131 51.473 358.419 1.00 79.57  ? 139 VAL B CG2 1 
ATOM   5221 N N   . GLN B 1 139 ? -21.343 50.564 356.364 1.00 46.45  ? 140 GLN B N   1 
ATOM   5222 C CA  . GLN B 1 139 ? -22.744 50.155 356.289 1.00 47.56  ? 140 GLN B CA  1 
ATOM   5223 C C   . GLN B 1 139 ? -23.082 49.542 354.933 1.00 67.21  ? 140 GLN B C   1 
ATOM   5224 O O   . GLN B 1 139 ? -23.815 48.550 354.864 1.00 68.80  ? 140 GLN B O   1 
ATOM   5225 C CB  . GLN B 1 139 ? -23.663 51.346 356.563 1.00 61.33  ? 140 GLN B CB  1 
ATOM   5226 C CG  . GLN B 1 139 ? -25.031 50.972 357.150 1.00 83.32  ? 140 GLN B CG  1 
ATOM   5227 C CD  . GLN B 1 139 ? -25.971 50.308 356.149 1.00 84.78  ? 140 GLN B CD  1 
ATOM   5228 O OE1 . GLN B 1 139 ? -26.089 50.747 355.007 1.00 78.77  ? 140 GLN B OE1 1 
ATOM   5229 N NE2 . GLN B 1 139 ? -26.663 49.260 356.588 1.00 92.75  ? 140 GLN B NE2 1 
ATOM   5230 N N   . ALA B 1 140 ? -22.572 50.128 353.843 1.00 60.78  ? 141 ALA B N   1 
ATOM   5231 C CA  . ALA B 1 140 ? -22.954 49.667 352.511 1.00 70.71  ? 141 ALA B CA  1 
ATOM   5232 C C   . ALA B 1 140 ? -22.301 48.335 352.164 1.00 62.22  ? 141 ALA B C   1 
ATOM   5233 O O   . ALA B 1 140 ? -22.918 47.493 351.504 1.00 63.66  ? 141 ALA B O   1 
ATOM   5234 C CB  . ALA B 1 140 ? -22.593 50.715 351.457 1.00 57.88  ? 141 ALA B CB  1 
ATOM   5235 N N   . GLU B 1 141 ? -21.066 48.139 352.578 1.00 53.69  ? 142 GLU B N   1 
ATOM   5236 C CA  . GLU B 1 141 ? -20.360 46.946 352.215 1.00 49.30  ? 142 GLU B CA  1 
ATOM   5237 C C   . GLU B 1 141 ? -19.944 46.021 353.314 1.00 73.36  ? 142 GLU B C   1 
ATOM   5238 O O   . GLU B 1 141 ? -19.231 45.083 353.086 1.00 69.09  ? 142 GLU B O   1 
ATOM   5239 C CB  . GLU B 1 141 ? -19.139 47.331 351.417 1.00 64.39  ? 142 GLU B CB  1 
ATOM   5240 C CG  . GLU B 1 141 ? -19.443 48.054 350.126 1.00 59.77  ? 142 GLU B CG  1 
ATOM   5241 C CD  . GLU B 1 141 ? -20.007 47.159 349.063 1.00 70.50  ? 142 GLU B CD  1 
ATOM   5242 O OE1 . GLU B 1 141 ? -20.907 47.582 348.346 1.00 71.20  ? 142 GLU B OE1 1 
ATOM   5243 O OE2 . GLU B 1 141 ? -19.540 46.039 348.942 1.00 72.29  ? 142 GLU B OE2 1 
ATOM   5244 N N   . ARG B 1 142 ? -20.400 46.294 354.511 1.00 77.17  ? 143 ARG B N   1 
ATOM   5245 C CA  . ARG B 1 142 ? -20.097 45.476 355.685 1.00 67.14  ? 143 ARG B CA  1 
ATOM   5246 C C   . ARG B 1 142 ? -18.596 45.243 355.803 1.00 66.20  ? 143 ARG B C   1 
ATOM   5247 O O   . ARG B 1 142 ? -18.115 44.116 355.904 1.00 73.86  ? 143 ARG B O   1 
ATOM   5248 C CB  . ARG B 1 142 ? -20.865 44.155 355.651 1.00 65.82  ? 143 ARG B CB  1 
ATOM   5249 C CG  . ARG B 1 142 ? -22.377 44.320 355.703 1.00 69.68  ? 143 ARG B CG  1 
ATOM   5250 C CD  . ARG B 1 142 ? -23.051 43.125 356.368 1.00 103.35 ? 143 ARG B CD  1 
ATOM   5251 N NE  . ARG B 1 142 ? -23.253 43.319 357.802 1.00 98.65  ? 143 ARG B NE  1 
ATOM   5252 C CZ  . ARG B 1 142 ? -22.583 42.670 358.749 1.00 100.83 ? 143 ARG B CZ  1 
ATOM   5253 N NH1 . ARG B 1 142 ? -21.657 41.777 358.421 1.00 105.56 ? 143 ARG B NH1 1 
ATOM   5254 N NH2 . ARG B 1 142 ? -22.842 42.909 360.028 1.00 96.13  ? 143 ARG B NH2 1 
ATOM   5255 N N   . THR B 1 143 ? -17.852 46.337 355.771 1.00 71.50  ? 144 THR B N   1 
ATOM   5256 C CA  . THR B 1 143 ? -16.409 46.316 355.915 1.00 59.81  ? 144 THR B CA  1 
ATOM   5257 C C   . THR B 1 143 ? -16.020 46.902 357.264 1.00 57.33  ? 144 THR B C   1 
ATOM   5258 O O   . THR B 1 143 ? -16.785 47.641 357.889 1.00 73.11  ? 144 THR B O   1 
ATOM   5259 C CB  . THR B 1 143 ? -15.755 47.097 354.768 1.00 62.47  ? 144 THR B CB  1 
ATOM   5260 O OG1 . THR B 1 143 ? -16.145 46.506 353.526 1.00 91.79  ? 144 THR B OG1 1 
ATOM   5261 C CG2 . THR B 1 143 ? -14.241 47.069 354.854 1.00 71.86  ? 144 THR B CG2 1 
ATOM   5262 N N   . VAL B 1 144 ? -14.828 46.541 357.726 1.00 54.23  ? 145 VAL B N   1 
ATOM   5263 C CA  . VAL B 1 144 ? -14.170 47.253 358.816 1.00 68.54  ? 145 VAL B CA  1 
ATOM   5264 C C   . VAL B 1 144 ? -13.250 48.305 358.213 1.00 59.36  ? 145 VAL B C   1 
ATOM   5265 O O   . VAL B 1 144 ? -12.334 47.969 357.456 1.00 65.50  ? 145 VAL B O   1 
ATOM   5266 C CB  . VAL B 1 144 ? -13.368 46.293 359.702 1.00 66.71  ? 145 VAL B CB  1 
ATOM   5267 C CG1 . VAL B 1 144 ? -13.012 46.965 361.014 1.00 43.62  ? 145 VAL B CG1 1 
ATOM   5268 C CG2 . VAL B 1 144 ? -14.122 45.007 359.903 1.00 68.99  ? 145 VAL B CG2 1 
ATOM   5269 N N   . LEU B 1 145 ? -13.464 49.576 358.564 1.00 56.61  ? 146 LEU B N   1 
ATOM   5270 C CA  . LEU B 1 145 ? -12.574 50.651 358.137 1.00 50.37  ? 146 LEU B CA  1 
ATOM   5271 C C   . LEU B 1 145 ? -11.808 51.196 359.333 1.00 61.56  ? 146 LEU B C   1 
ATOM   5272 O O   . LEU B 1 145 ? -12.405 51.552 360.355 1.00 56.88  ? 146 LEU B O   1 
ATOM   5273 C CB  . LEU B 1 145 ? -13.324 51.793 357.445 1.00 55.88  ? 146 LEU B CB  1 
ATOM   5274 C CG  . LEU B 1 145 ? -12.481 53.009 356.997 1.00 72.07  ? 146 LEU B CG  1 
ATOM   5275 C CD1 . LEU B 1 145 ? -11.146 52.622 356.339 1.00 75.83  ? 146 LEU B CD1 1 
ATOM   5276 C CD2 . LEU B 1 145 ? -13.267 53.824 356.002 1.00 83.09  ? 146 LEU B CD2 1 
ATOM   5277 N N   . VAL B 1 146 ? -10.490 51.281 359.185 1.00 55.07  ? 147 VAL B N   1 
ATOM   5278 C CA  . VAL B 1 146 ? -9.597  51.908 360.146 1.00 50.75  ? 147 VAL B CA  1 
ATOM   5279 C C   . VAL B 1 146 ? -8.933  53.097 359.464 1.00 58.27  ? 147 VAL B C   1 
ATOM   5280 O O   . VAL B 1 146 ? -8.598  53.030 358.278 1.00 58.10  ? 147 VAL B O   1 
ATOM   5281 C CB  . VAL B 1 146 ? -8.537  50.908 360.657 1.00 60.70  ? 147 VAL B CB  1 
ATOM   5282 C CG1 . VAL B 1 146 ? -7.711  51.515 361.801 1.00 46.69  ? 147 VAL B CG1 1 
ATOM   5283 C CG2 . VAL B 1 146 ? -9.199  49.619 361.101 1.00 53.74  ? 147 VAL B CG2 1 
ATOM   5284 N N   . SER B 1 147 ? -8.765  54.192 360.201 1.00 49.92  ? 148 SER B N   1 
ATOM   5285 C CA  . SER B 1 147 ? -7.930  55.297 359.749 1.00 50.11  ? 148 SER B CA  1 
ATOM   5286 C C   . SER B 1 147 ? -7.161  55.840 360.942 1.00 58.97  ? 148 SER B C   1 
ATOM   5287 O O   . SER B 1 147 ? -7.624  55.757 362.083 1.00 60.34  ? 148 SER B O   1 
ATOM   5288 C CB  . SER B 1 147 ? -8.742  56.420 359.092 1.00 57.11  ? 148 SER B CB  1 
ATOM   5289 O OG  . SER B 1 147 ? -9.665  56.982 360.003 1.00 55.14  ? 148 SER B OG  1 
ATOM   5290 N N   . MET B 1 148 ? -5.976  56.382 360.680 1.00 52.95  ? 149 MET B N   1 
ATOM   5291 C CA  . MET B 1 148 ? -5.117  56.873 361.747 1.00 47.51  ? 149 MET B CA  1 
ATOM   5292 C C   . MET B 1 148 ? -4.641  58.278 361.419 1.00 63.32  ? 149 MET B C   1 
ATOM   5293 O O   . MET B 1 148 ? -4.598  58.690 360.255 1.00 57.38  ? 149 MET B O   1 
ATOM   5294 C CB  . MET B 1 148 ? -3.904  55.951 361.977 1.00 43.94  ? 149 MET B CB  1 
ATOM   5295 C CG  . MET B 1 148 ? -2.680  56.294 361.142 1.00 54.37  ? 149 MET B CG  1 
ATOM   5296 S SD  . MET B 1 148 ? -2.935  55.957 359.386 1.00 55.68  ? 149 MET B SD  1 
ATOM   5297 C CE  . MET B 1 148 ? -3.059  54.165 359.394 1.00 49.98  ? 149 MET B CE  1 
ATOM   5298 N N   . ASN B 1 149 ? -4.298  59.017 362.470 1.00 48.31  ? 150 ASN B N   1 
ATOM   5299 C CA  . ASN B 1 149 ? -3.573  60.266 362.322 1.00 48.48  ? 150 ASN B CA  1 
ATOM   5300 C C   . ASN B 1 149 ? -2.081  59.973 362.362 1.00 41.95  ? 150 ASN B C   1 
ATOM   5301 O O   . ASN B 1 149 ? -1.634  59.068 363.069 1.00 51.74  ? 150 ASN B O   1 
ATOM   5302 C CB  . ASN B 1 149 ? -3.950  61.255 363.425 1.00 47.00  ? 150 ASN B CB  1 
ATOM   5303 C CG  . ASN B 1 149 ? -5.162  62.083 363.068 1.00 58.11  ? 150 ASN B CG  1 
ATOM   5304 O OD1 . ASN B 1 149 ? -5.825  61.823 362.067 1.00 51.86  ? 150 ASN B OD1 1 
ATOM   5305 N ND2 . ASN B 1 149 ? -5.461  63.084 363.887 1.00 55.82  ? 150 ASN B ND2 1 
ATOM   5306 N N   . TYR B 1 150 ? -1.315  60.719 361.576 1.00 51.86  ? 151 TYR B N   1 
ATOM   5307 C CA  . TYR B 1 150 ? 0.133   60.606 361.612 1.00 38.65  ? 151 TYR B CA  1 
ATOM   5308 C C   . TYR B 1 150 ? 0.715   62.006 361.562 1.00 46.88  ? 151 TYR B C   1 
ATOM   5309 O O   . TYR B 1 150 ? 0.108   62.927 361.004 1.00 47.88  ? 151 TYR B O   1 
ATOM   5310 C CB  . TYR B 1 150 ? 0.673   59.734 360.463 1.00 59.29  ? 151 TYR B CB  1 
ATOM   5311 C CG  . TYR B 1 150 ? 0.344   60.237 359.076 1.00 42.86  ? 151 TYR B CG  1 
ATOM   5312 C CD1 . TYR B 1 150 ? -0.809  59.827 358.422 1.00 46.33  ? 151 TYR B CD1 1 
ATOM   5313 C CD2 . TYR B 1 150 ? 1.197   61.111 358.414 1.00 43.01  ? 151 TYR B CD2 1 
ATOM   5314 C CE1 . TYR B 1 150 ? -1.109  60.283 357.145 1.00 44.79  ? 151 TYR B CE1 1 
ATOM   5315 C CE2 . TYR B 1 150 ? 0.908   61.568 357.137 1.00 53.00  ? 151 TYR B CE2 1 
ATOM   5316 C CZ  . TYR B 1 150 ? -0.245  61.155 356.510 1.00 52.65  ? 151 TYR B CZ  1 
ATOM   5317 O OH  . TYR B 1 150 ? -0.527  61.616 355.242 1.00 51.65  ? 151 TYR B OH  1 
ATOM   5318 N N   . ARG B 1 151 ? 1.884   62.163 362.175 1.00 48.34  ? 152 ARG B N   1 
ATOM   5319 C CA  . ARG B 1 151 ? 2.506   63.475 362.264 1.00 46.37  ? 152 ARG B CA  1 
ATOM   5320 C C   . ARG B 1 151 ? 2.932   63.946 360.883 1.00 48.75  ? 152 ARG B C   1 
ATOM   5321 O O   . ARG B 1 151 ? 3.499   63.185 360.095 1.00 54.12  ? 152 ARG B O   1 
ATOM   5322 C CB  . ARG B 1 151 ? 3.707   63.431 363.210 1.00 48.74  ? 152 ARG B CB  1 
ATOM   5323 C CG  . ARG B 1 151 ? 3.330   63.291 364.682 1.00 50.89  ? 152 ARG B CG  1 
ATOM   5324 C CD  . ARG B 1 151 ? 4.560   63.070 365.561 1.00 38.33  ? 152 ARG B CD  1 
ATOM   5325 N NE  . ARG B 1 151 ? 4.980   61.669 365.565 1.00 47.68  ? 152 ARG B NE  1 
ATOM   5326 C CZ  . ARG B 1 151 ? 6.099   61.217 366.130 1.00 54.44  ? 152 ARG B CZ  1 
ATOM   5327 N NH1 . ARG B 1 151 ? 6.923   62.054 366.752 1.00 43.15  ? 152 ARG B NH1 1 
ATOM   5328 N NH2 . ARG B 1 151 ? 6.392   59.923 366.079 1.00 41.74  ? 152 ARG B NH2 1 
ATOM   5329 N N   . VAL B 1 152 ? 2.643   65.211 360.588 1.00 46.41  ? 153 VAL B N   1 
ATOM   5330 C CA  . VAL B 1 152 ? 2.976   65.815 359.310 1.00 44.77  ? 153 VAL B CA  1 
ATOM   5331 C C   . VAL B 1 152 ? 3.930   66.975 359.560 1.00 50.85  ? 153 VAL B C   1 
ATOM   5332 O O   . VAL B 1 152 ? 4.158   67.387 360.695 1.00 51.31  ? 153 VAL B O   1 
ATOM   5333 C CB  . VAL B 1 152 ? 1.722   66.285 358.553 1.00 65.65  ? 153 VAL B CB  1 
ATOM   5334 C CG1 . VAL B 1 152 ? 0.905   65.080 358.082 1.00 47.98  ? 153 VAL B CG1 1 
ATOM   5335 C CG2 . VAL B 1 152 ? 0.893   67.189 359.445 1.00 44.50  ? 153 VAL B CG2 1 
ATOM   5336 N N   . GLY B 1 153 ? 4.491   67.502 358.474 1.00 51.98  ? 154 GLY B N   1 
ATOM   5337 C CA  . GLY B 1 153 ? 5.417   68.610 358.598 1.00 52.12  ? 154 GLY B CA  1 
ATOM   5338 C C   . GLY B 1 153 ? 6.726   68.219 359.275 1.00 56.56  ? 154 GLY B C   1 
ATOM   5339 O O   . GLY B 1 153 ? 7.150   67.055 359.280 1.00 53.38  ? 154 GLY B O   1 
ATOM   5340 N N   . ALA B 1 154 ? 7.377   69.231 359.853 1.00 52.83  ? 155 ALA B N   1 
ATOM   5341 C CA  . ALA B 1 154 ? 8.615   68.980 360.583 1.00 58.12  ? 155 ALA B CA  1 
ATOM   5342 C C   . ALA B 1 154 ? 8.399   67.983 361.712 1.00 60.92  ? 155 ALA B C   1 
ATOM   5343 O O   . ALA B 1 154 ? 9.293   67.183 362.014 1.00 61.81  ? 155 ALA B O   1 
ATOM   5344 C CB  . ALA B 1 154 ? 9.183   70.291 361.126 1.00 47.24  ? 155 ALA B CB  1 
ATOM   5345 N N   . PHE B 1 155 ? 7.215   67.995 362.330 1.00 50.33  ? 156 PHE B N   1 
ATOM   5346 C CA  . PHE B 1 155 ? 6.941   67.069 363.422 1.00 53.19  ? 156 PHE B CA  1 
ATOM   5347 C C   . PHE B 1 155 ? 6.972   65.617 362.973 1.00 53.24  ? 156 PHE B C   1 
ATOM   5348 O O   . PHE B 1 155 ? 7.174   64.728 363.807 1.00 53.31  ? 156 PHE B O   1 
ATOM   5349 C CB  . PHE B 1 155 ? 5.584   67.388 364.050 1.00 53.55  ? 156 PHE B CB  1 
ATOM   5350 C CG  . PHE B 1 155 ? 5.431   68.823 364.453 1.00 54.67  ? 156 PHE B CG  1 
ATOM   5351 C CD1 . PHE B 1 155 ? 5.945   69.278 365.657 1.00 58.25  ? 156 PHE B CD1 1 
ATOM   5352 C CD2 . PHE B 1 155 ? 4.781   69.722 363.624 1.00 50.04  ? 156 PHE B CD2 1 
ATOM   5353 C CE1 . PHE B 1 155 ? 5.805   70.605 366.033 1.00 55.69  ? 156 PHE B CE1 1 
ATOM   5354 C CE2 . PHE B 1 155 ? 4.641   71.051 363.993 1.00 56.68  ? 156 PHE B CE2 1 
ATOM   5355 C CZ  . PHE B 1 155 ? 5.154   71.492 365.199 1.00 54.49  ? 156 PHE B CZ  1 
ATOM   5356 N N   . GLY B 1 156 ? 6.784   65.352 361.684 1.00 57.03  ? 157 GLY B N   1 
ATOM   5357 C CA  . GLY B 1 156 ? 6.736   63.982 361.217 1.00 47.00  ? 157 GLY B CA  1 
ATOM   5358 C C   . GLY B 1 156 ? 7.881   63.584 360.308 1.00 56.50  ? 157 GLY B C   1 
ATOM   5359 O O   . GLY B 1 156 ? 8.174   62.391 360.160 1.00 45.95  ? 157 GLY B O   1 
ATOM   5360 N N   . PHE B 1 157 ? 8.543   64.569 359.690 1.00 45.28  ? 158 PHE B N   1 
ATOM   5361 C CA  . PHE B 1 157 ? 9.513   64.248 358.653 1.00 55.20  ? 158 PHE B CA  1 
ATOM   5362 C C   . PHE B 1 157 ? 10.751  65.132 358.679 1.00 58.84  ? 158 PHE B C   1 
ATOM   5363 O O   . PHE B 1 157 ? 11.572  65.049 357.755 1.00 58.06  ? 158 PHE B O   1 
ATOM   5364 C CB  . PHE B 1 157 ? 8.831   64.303 357.278 1.00 46.78  ? 158 PHE B CB  1 
ATOM   5365 C CG  . PHE B 1 157 ? 7.705   63.331 357.158 1.00 40.45  ? 158 PHE B CG  1 
ATOM   5366 C CD1 . PHE B 1 157 ? 7.960   61.987 356.944 1.00 41.10  ? 158 PHE B CD1 1 
ATOM   5367 C CD2 . PHE B 1 157 ? 6.398   63.742 357.336 1.00 38.83  ? 158 PHE B CD2 1 
ATOM   5368 C CE1 . PHE B 1 157 ? 6.928   61.073 356.870 1.00 44.37  ? 158 PHE B CE1 1 
ATOM   5369 C CE2 . PHE B 1 157 ? 5.356   62.832 357.260 1.00 48.00  ? 158 PHE B CE2 1 
ATOM   5370 C CZ  . PHE B 1 157 ? 5.622   61.495 357.027 1.00 47.87  ? 158 PHE B CZ  1 
ATOM   5371 N N   . LEU B 1 158 ? 10.932  65.962 359.700 1.00 54.50  ? 159 LEU B N   1 
ATOM   5372 C CA  . LEU B 1 158 ? 12.225  66.601 359.859 1.00 56.92  ? 159 LEU B CA  1 
ATOM   5373 C C   . LEU B 1 158 ? 13.260  65.528 360.161 1.00 61.31  ? 159 LEU B C   1 
ATOM   5374 O O   . LEU B 1 158 ? 13.039  64.649 360.998 1.00 58.08  ? 159 LEU B O   1 
ATOM   5375 C CB  . LEU B 1 158 ? 12.185  67.648 360.967 1.00 56.60  ? 159 LEU B CB  1 
ATOM   5376 C CG  . LEU B 1 158 ? 13.502  68.391 361.168 1.00 65.89  ? 159 LEU B CG  1 
ATOM   5377 C CD1 . LEU B 1 158 ? 13.251  69.883 361.319 1.00 49.82  ? 159 LEU B CD1 1 
ATOM   5378 C CD2 . LEU B 1 158 ? 14.239  67.830 362.371 1.00 48.40  ? 159 LEU B CD2 1 
ATOM   5379 N N   . ALA B 1 159 ? 14.377  65.576 359.447 1.00 69.17  ? 160 ALA B N   1 
ATOM   5380 C CA  . ALA B 1 159 ? 15.406  64.562 359.601 1.00 69.09  ? 160 ALA B CA  1 
ATOM   5381 C C   . ALA B 1 159 ? 16.764  65.232 359.700 1.00 71.53  ? 160 ALA B C   1 
ATOM   5382 O O   . ALA B 1 159 ? 17.104  66.083 358.873 1.00 66.37  ? 160 ALA B O   1 
ATOM   5383 C CB  . ALA B 1 159 ? 15.391  63.569 358.431 1.00 56.83  ? 160 ALA B CB  1 
ATOM   5384 N N   . LEU B 1 160 ? 17.516  64.870 360.737 1.00 67.96  ? 161 LEU B N   1 
ATOM   5385 C CA  . LEU B 1 160 ? 18.963  65.051 360.773 1.00 57.36  ? 161 LEU B CA  1 
ATOM   5386 C C   . LEU B 1 160 ? 19.553  63.657 360.612 1.00 57.17  ? 161 LEU B C   1 
ATOM   5387 O O   . LEU B 1 160 ? 19.855  62.986 361.611 1.00 64.12  ? 161 LEU B O   1 
ATOM   5388 C CB  . LEU B 1 160 ? 19.418  65.704 362.078 1.00 55.34  ? 161 LEU B CB  1 
ATOM   5389 C CG  . LEU B 1 160 ? 19.030  67.180 362.153 1.00 65.07  ? 161 LEU B CG  1 
ATOM   5390 C CD1 . LEU B 1 160 ? 19.431  67.774 363.485 1.00 69.62  ? 161 LEU B CD1 1 
ATOM   5391 C CD2 . LEU B 1 160 ? 19.675  67.947 361.007 1.00 61.39  ? 161 LEU B CD2 1 
ATOM   5392 N N   . PRO B 1 161 ? 19.719  63.172 359.379 1.00 63.36  ? 162 PRO B N   1 
ATOM   5393 C CA  . PRO B 1 161 ? 19.982  61.741 359.172 1.00 64.43  ? 162 PRO B CA  1 
ATOM   5394 C C   . PRO B 1 161 ? 21.236  61.277 359.898 1.00 69.45  ? 162 PRO B C   1 
ATOM   5395 O O   . PRO B 1 161 ? 22.249  61.980 359.948 1.00 64.45  ? 162 PRO B O   1 
ATOM   5396 C CB  . PRO B 1 161 ? 20.130  61.624 357.650 1.00 59.51  ? 162 PRO B CB  1 
ATOM   5397 C CG  . PRO B 1 161 ? 19.410  62.830 357.101 1.00 60.93  ? 162 PRO B CG  1 
ATOM   5398 C CD  . PRO B 1 161 ? 19.659  63.915 358.106 1.00 64.00  ? 162 PRO B CD  1 
ATOM   5399 N N   . GLY B 1 162 ? 21.149  60.080 360.476 1.00 61.87  ? 163 GLY B N   1 
ATOM   5400 C CA  . GLY B 1 162 ? 22.185  59.536 361.320 1.00 65.18  ? 163 GLY B CA  1 
ATOM   5401 C C   . GLY B 1 162 ? 21.975  59.782 362.802 1.00 74.04  ? 163 GLY B C   1 
ATOM   5402 O O   . GLY B 1 162 ? 22.422  58.975 363.622 1.00 73.92  ? 163 GLY B O   1 
ATOM   5403 N N   . SER B 1 163 ? 21.301  60.871 363.164 1.00 78.56  ? 164 SER B N   1 
ATOM   5404 C CA  . SER B 1 163 ? 21.064  61.199 364.561 1.00 69.82  ? 164 SER B CA  1 
ATOM   5405 C C   . SER B 1 163 ? 19.930  60.353 365.134 1.00 67.43  ? 164 SER B C   1 
ATOM   5406 O O   . SER B 1 163 ? 19.039  59.886 364.419 1.00 69.77  ? 164 SER B O   1 
ATOM   5407 C CB  . SER B 1 163 ? 20.727  62.681 364.719 1.00 70.69  ? 164 SER B CB  1 
ATOM   5408 O OG  . SER B 1 163 ? 19.361  62.911 364.427 1.00 73.71  ? 164 SER B OG  1 
ATOM   5409 N N   . ARG B 1 164 ? 19.967  60.152 366.442 1.00 79.47  ? 165 ARG B N   1 
ATOM   5410 C CA  . ARG B 1 164 ? 18.943  59.406 367.156 1.00 83.39  ? 165 ARG B CA  1 
ATOM   5411 C C   . ARG B 1 164 ? 17.764  60.235 367.562 1.00 65.80  ? 165 ARG B C   1 
ATOM   5412 O O   . ARG B 1 164 ? 16.697  59.742 367.777 1.00 70.32  ? 165 ARG B O   1 
ATOM   5413 C CB  . ARG B 1 164 ? 19.506  58.769 368.409 1.00 84.70  ? 165 ARG B CB  1 
ATOM   5414 C CG  . ARG B 1 164 ? 19.666  57.275 368.295 1.00 108.96 ? 165 ARG B CG  1 
ATOM   5415 C CD  . ARG B 1 164 ? 19.708  56.617 369.661 1.00 125.21 ? 165 ARG B CD  1 
ATOM   5416 N NE  . ARG B 1 164 ? 18.567  55.738 369.882 1.00 131.25 ? 165 ARG B NE  1 
ATOM   5417 C CZ  . ARG B 1 164 ? 18.263  54.722 369.089 1.00 136.40 ? 165 ARG B CZ  1 
ATOM   5418 N NH1 . ARG B 1 164 ? 17.220  53.960 369.355 1.00 133.39 ? 165 ARG B NH1 1 
ATOM   5419 N NH2 . ARG B 1 164 ? 19.000  54.478 368.021 1.00 122.89 ? 165 ARG B NH2 1 
ATOM   5420 N N   . GLU B 1 165 ? 17.973  61.542 367.676 1.00 62.58  ? 166 GLU B N   1 
ATOM   5421 C CA  . GLU B 1 165 ? 16.906  62.452 368.095 1.00 71.76  ? 166 GLU B CA  1 
ATOM   5422 C C   . GLU B 1 165 ? 15.954  62.898 366.982 1.00 80.35  ? 166 GLU B C   1 
ATOM   5423 O O   . GLU B 1 165 ? 14.790  63.203 367.242 1.00 69.52  ? 166 GLU B O   1 
ATOM   5424 C CB  . GLU B 1 165 ? 17.502  63.681 368.789 1.00 77.84  ? 166 GLU B CB  1 
ATOM   5425 C CG  . GLU B 1 165 ? 18.754  63.391 369.600 1.00 94.89  ? 166 GLU B CG  1 
ATOM   5426 C CD  . GLU B 1 165 ? 18.451  63.116 371.060 1.00 114.08 ? 166 GLU B CD  1 
ATOM   5427 O OE1 . GLU B 1 165 ? 19.244  62.401 371.709 1.00 116.61 ? 166 GLU B OE1 1 
ATOM   5428 O OE2 . GLU B 1 165 ? 17.420  63.614 371.559 1.00 105.44 ? 166 GLU B OE2 1 
ATOM   5429 N N   . ALA B 1 166 ? 16.449  62.941 365.751 1.00 65.82  ? 167 ALA B N   1 
ATOM   5430 C CA  . ALA B 1 166 ? 15.642  63.369 364.614 1.00 62.63  ? 167 ALA B CA  1 
ATOM   5431 C C   . ALA B 1 166 ? 15.948  62.424 363.467 1.00 58.30  ? 167 ALA B C   1 
ATOM   5432 O O   . ALA B 1 166 ? 16.487  62.827 362.434 1.00 53.23  ? 167 ALA B O   1 
ATOM   5433 C CB  . ALA B 1 166 ? 15.947  64.822 364.255 1.00 70.85  ? 167 ALA B CB  1 
ATOM   5434 N N   . PRO B 1 167 ? 15.635  61.135 363.632 1.00 53.44  ? 168 PRO B N   1 
ATOM   5435 C CA  . PRO B 1 167 ? 15.996  60.154 362.602 1.00 67.91  ? 168 PRO B CA  1 
ATOM   5436 C C   . PRO B 1 167 ? 15.217  60.314 361.314 1.00 70.06  ? 168 PRO B C   1 
ATOM   5437 O O   . PRO B 1 167 ? 15.615  59.735 360.295 1.00 69.16  ? 168 PRO B O   1 
ATOM   5438 C CB  . PRO B 1 167 ? 15.676  58.815 363.275 1.00 58.36  ? 168 PRO B CB  1 
ATOM   5439 C CG  . PRO B 1 167 ? 14.537  59.142 364.173 1.00 59.08  ? 168 PRO B CG  1 
ATOM   5440 C CD  . PRO B 1 167 ? 14.843  60.519 364.713 1.00 55.36  ? 168 PRO B CD  1 
ATOM   5441 N N   . GLY B 1 168 ? 14.135  61.083 361.326 1.00 60.03  ? 169 GLY B N   1 
ATOM   5442 C CA  . GLY B 1 168 ? 13.289  61.222 360.166 1.00 56.16  ? 169 GLY B CA  1 
ATOM   5443 C C   . GLY B 1 168 ? 12.329  60.060 360.023 1.00 60.71  ? 169 GLY B C   1 
ATOM   5444 O O   . GLY B 1 168 ? 12.439  59.021 360.680 1.00 61.39  ? 169 GLY B O   1 
ATOM   5445 N N   . ASN B 1 169 ? 11.352  60.263 359.142 1.00 58.18  ? 170 ASN B N   1 
ATOM   5446 C CA  . ASN B 1 169 ? 10.360  59.261 358.764 1.00 54.31  ? 170 ASN B CA  1 
ATOM   5447 C C   . ASN B 1 169 ? 9.460   58.852 359.926 1.00 48.03  ? 170 ASN B C   1 
ATOM   5448 O O   . ASN B 1 169 ? 8.763   57.834 359.842 1.00 54.43  ? 170 ASN B O   1 
ATOM   5449 C CB  . ASN B 1 169 ? 11.031  58.029 358.139 1.00 63.83  ? 170 ASN B CB  1 
ATOM   5450 C CG  . ASN B 1 169 ? 11.602  58.320 356.755 1.00 65.47  ? 170 ASN B CG  1 
ATOM   5451 O OD1 . ASN B 1 169 ? 11.196  59.278 356.103 1.00 54.37  ? 170 ASN B OD1 1 
ATOM   5452 N ND2 . ASN B 1 169 ? 12.543  57.497 356.308 1.00 54.37  ? 170 ASN B ND2 1 
ATOM   5453 N N   . VAL B 1 170 ? 9.422   59.638 361.008 1.00 47.68  ? 171 VAL B N   1 
ATOM   5454 C CA  . VAL B 1 170 ? 8.633   59.199 362.160 1.00 60.71  ? 171 VAL B CA  1 
ATOM   5455 C C   . VAL B 1 170 ? 7.146   59.248 361.830 1.00 55.35  ? 171 VAL B C   1 
ATOM   5456 O O   . VAL B 1 170 ? 6.362   58.443 362.351 1.00 47.17  ? 171 VAL B O   1 
ATOM   5457 C CB  . VAL B 1 170 ? 8.973   60.008 363.434 1.00 43.32  ? 171 VAL B CB  1 
ATOM   5458 C CG1 . VAL B 1 170 ? 10.454  59.863 363.784 1.00 47.92  ? 171 VAL B CG1 1 
ATOM   5459 C CG2 . VAL B 1 170 ? 8.595   61.477 363.292 1.00 50.01  ? 171 VAL B CG2 1 
ATOM   5460 N N   . GLY B 1 171 ? 6.741   60.147 360.927 1.00 57.40  ? 172 GLY B N   1 
ATOM   5461 C CA  . GLY B 1 171 ? 5.361   60.143 360.461 1.00 39.04  ? 172 GLY B CA  1 
ATOM   5462 C C   . GLY B 1 171 ? 4.975   58.833 359.801 1.00 53.48  ? 172 GLY B C   1 
ATOM   5463 O O   . GLY B 1 171 ? 3.833   58.376 359.920 1.00 50.79  ? 172 GLY B O   1 
ATOM   5464 N N   . LEU B 1 172 ? 5.922   58.209 359.094 1.00 52.33  ? 173 LEU B N   1 
ATOM   5465 C CA  . LEU B 1 172 ? 5.664   56.893 358.516 1.00 50.61  ? 173 LEU B CA  1 
ATOM   5466 C C   . LEU B 1 172 ? 5.596   55.831 359.604 1.00 47.83  ? 173 LEU B C   1 
ATOM   5467 O O   . LEU B 1 172 ? 4.733   54.945 359.566 1.00 55.06  ? 173 LEU B O   1 
ATOM   5468 C CB  . LEU B 1 172 ? 6.745   56.548 357.483 1.00 52.38  ? 173 LEU B CB  1 
ATOM   5469 C CG  . LEU B 1 172 ? 6.666   57.242 356.117 1.00 59.60  ? 173 LEU B CG  1 
ATOM   5470 C CD1 . LEU B 1 172 ? 7.875   56.904 355.273 1.00 54.24  ? 173 LEU B CD1 1 
ATOM   5471 C CD2 . LEU B 1 172 ? 5.395   56.849 355.388 1.00 45.65  ? 173 LEU B CD2 1 
ATOM   5472 N N   . LEU B 1 173 ? 6.489   55.914 360.594 1.00 49.69  ? 174 LEU B N   1 
ATOM   5473 C CA  . LEU B 1 173 ? 6.442   54.969 361.707 1.00 64.55  ? 174 LEU B CA  1 
ATOM   5474 C C   . LEU B 1 173 ? 5.154   55.105 362.512 1.00 44.66  ? 174 LEU B C   1 
ATOM   5475 O O   . LEU B 1 173 ? 4.666   54.111 363.061 1.00 53.85  ? 174 LEU B O   1 
ATOM   5476 C CB  . LEU B 1 173 ? 7.666   55.151 362.605 1.00 50.15  ? 174 LEU B CB  1 
ATOM   5477 C CG  . LEU B 1 173 ? 8.997   54.890 361.890 1.00 64.49  ? 174 LEU B CG  1 
ATOM   5478 C CD1 . LEU B 1 173 ? 10.165  55.431 362.696 1.00 42.11  ? 174 LEU B CD1 1 
ATOM   5479 C CD2 . LEU B 1 173 ? 9.179   53.404 361.585 1.00 59.57  ? 174 LEU B CD2 1 
ATOM   5480 N N   . ASP B 1 174 ? 4.582   56.312 362.587 1.00 50.67  ? 175 ASP B N   1 
ATOM   5481 C CA  . ASP B 1 174 ? 3.241   56.448 363.152 1.00 48.49  ? 175 ASP B CA  1 
ATOM   5482 C C   . ASP B 1 174 ? 2.250   55.572 362.401 1.00 49.55  ? 175 ASP B C   1 
ATOM   5483 O O   . ASP B 1 174 ? 1.448   54.854 363.010 1.00 58.98  ? 175 ASP B O   1 
ATOM   5484 C CB  . ASP B 1 174 ? 2.774   57.904 363.115 1.00 36.75  ? 175 ASP B CB  1 
ATOM   5485 C CG  . ASP B 1 174 ? 3.617   58.814 363.970 1.00 56.17  ? 175 ASP B CG  1 
ATOM   5486 O OD1 . ASP B 1 174 ? 3.512   60.045 363.780 1.00 62.98  ? 175 ASP B OD1 1 
ATOM   5487 O OD2 . ASP B 1 174 ? 4.389   58.308 364.818 1.00 59.10  ? 175 ASP B OD2 1 
ATOM   5488 N N   . GLN B 1 175 ? 2.288   55.625 361.065 1.00 55.09  ? 176 GLN B N   1 
ATOM   5489 C CA  . GLN B 1 175 ? 1.397   54.790 360.269 1.00 48.70  ? 176 GLN B CA  1 
ATOM   5490 C C   . GLN B 1 175 ? 1.691   53.315 360.494 1.00 44.74  ? 176 GLN B C   1 
ATOM   5491 O O   . GLN B 1 175 ? 0.767   52.499 360.607 1.00 50.05  ? 176 GLN B O   1 
ATOM   5492 C CB  . GLN B 1 175 ? 1.516   55.142 358.781 1.00 54.92  ? 176 GLN B CB  1 
ATOM   5493 C CG  . GLN B 1 175 ? 1.534   56.635 358.455 1.00 50.70  ? 176 GLN B CG  1 
ATOM   5494 C CD  . GLN B 1 175 ? 1.708   56.900 356.960 1.00 55.20  ? 176 GLN B CD  1 
ATOM   5495 O OE1 . GLN B 1 175 ? 1.876   55.967 356.178 1.00 58.74  ? 176 GLN B OE1 1 
ATOM   5496 N NE2 . GLN B 1 175 ? 1.687   58.171 356.566 1.00 56.98  ? 176 GLN B NE2 1 
ATOM   5497 N N   . ARG B 1 176 ? 2.975   52.952 360.569 1.00 50.36  ? 177 ARG B N   1 
ATOM   5498 C CA  . ARG B 1 176 ? 3.330   51.550 360.756 1.00 54.11  ? 177 ARG B CA  1 
ATOM   5499 C C   . ARG B 1 176 ? 2.804   51.028 362.087 1.00 58.95  ? 177 ARG B C   1 
ATOM   5500 O O   . ARG B 1 176 ? 2.183   49.959 362.142 1.00 51.33  ? 177 ARG B O   1 
ATOM   5501 C CB  . ARG B 1 176 ? 4.845   51.366 360.665 1.00 48.57  ? 177 ARG B CB  1 
ATOM   5502 C CG  . ARG B 1 176 ? 5.283   49.945 360.984 1.00 58.63  ? 177 ARG B CG  1 
ATOM   5503 C CD  . ARG B 1 176 ? 6.780   49.791 360.876 1.00 69.10  ? 177 ARG B CD  1 
ATOM   5504 N NE  . ARG B 1 176 ? 7.196   49.704 359.484 1.00 66.92  ? 177 ARG B NE  1 
ATOM   5505 C CZ  . ARG B 1 176 ? 8.448   49.853 359.068 1.00 79.14  ? 177 ARG B CZ  1 
ATOM   5506 N NH1 . ARG B 1 176 ? 8.732   49.765 357.772 1.00 67.08  ? 177 ARG B NH1 1 
ATOM   5507 N NH2 . ARG B 1 176 ? 9.414   50.087 359.946 1.00 68.90  ? 177 ARG B NH2 1 
ATOM   5508 N N   . LEU B 1 177 ? 3.040   51.780 363.172 1.00 55.97  ? 178 LEU B N   1 
ATOM   5509 C CA  . LEU B 1 177 ? 2.524   51.397 364.486 1.00 47.32  ? 178 LEU B CA  1 
ATOM   5510 C C   . LEU B 1 177 ? 1.011   51.219 364.459 1.00 57.97  ? 178 LEU B C   1 
ATOM   5511 O O   . LEU B 1 177 ? 0.476   50.301 365.094 1.00 55.02  ? 178 LEU B O   1 
ATOM   5512 C CB  . LEU B 1 177 ? 2.921   52.440 365.529 1.00 53.79  ? 178 LEU B CB  1 
ATOM   5513 C CG  . LEU B 1 177 ? 2.415   52.206 366.954 1.00 57.58  ? 178 LEU B CG  1 
ATOM   5514 C CD1 . LEU B 1 177 ? 2.776   50.798 367.402 1.00 53.19  ? 178 LEU B CD1 1 
ATOM   5515 C CD2 . LEU B 1 177 ? 2.979   53.251 367.917 1.00 47.56  ? 178 LEU B CD2 1 
ATOM   5516 N N   . ALA B 1 178 ? 0.303   52.087 363.726 1.00 48.51  ? 179 ALA B N   1 
ATOM   5517 C CA  . ALA B 1 178 ? -1.138  51.918 363.571 1.00 49.77  ? 179 ALA B CA  1 
ATOM   5518 C C   . ALA B 1 178 ? -1.459  50.612 362.861 1.00 58.51  ? 179 ALA B C   1 
ATOM   5519 O O   . ALA B 1 178 ? -2.419  49.919 363.218 1.00 64.46  ? 179 ALA B O   1 
ATOM   5520 C CB  . ALA B 1 178 ? -1.734  53.103 362.814 1.00 49.25  ? 179 ALA B CB  1 
ATOM   5521 N N   . LEU B 1 179 ? -0.658  50.255 361.855 1.00 56.18  ? 180 LEU B N   1 
ATOM   5522 C CA  . LEU B 1 179 ? -0.851  48.975 361.186 1.00 70.73  ? 180 LEU B CA  1 
ATOM   5523 C C   . LEU B 1 179 ? -0.555  47.820 362.133 1.00 55.68  ? 180 LEU B C   1 
ATOM   5524 O O   . LEU B 1 179 ? -1.275  46.814 362.141 1.00 52.62  ? 180 LEU B O   1 
ATOM   5525 C CB  . LEU B 1 179 ? 0.027   48.896 359.936 1.00 62.85  ? 180 LEU B CB  1 
ATOM   5526 C CG  . LEU B 1 179 ? -0.336  49.904 358.846 1.00 60.03  ? 180 LEU B CG  1 
ATOM   5527 C CD1 . LEU B 1 179 ? 0.533   49.721 357.615 1.00 57.63  ? 180 LEU B CD1 1 
ATOM   5528 C CD2 . LEU B 1 179 ? -1.805  49.766 358.499 1.00 49.59  ? 180 LEU B CD2 1 
ATOM   5529 N N   . GLN B 1 180 ? 0.500   47.950 362.941 1.00 63.39  ? 181 GLN B N   1 
ATOM   5530 C CA  . GLN B 1 180 ? 0.757   46.957 363.982 1.00 71.53  ? 181 GLN B CA  1 
ATOM   5531 C C   . GLN B 1 180 ? -0.420  46.855 364.942 1.00 57.62  ? 181 GLN B C   1 
ATOM   5532 O O   . GLN B 1 180 ? -0.816  45.751 365.336 1.00 61.63  ? 181 GLN B O   1 
ATOM   5533 C CB  . GLN B 1 180 ? 2.051   47.294 364.725 1.00 54.12  ? 181 GLN B CB  1 
ATOM   5534 C CG  . GLN B 1 180 ? 3.301   46.842 363.962 1.00 75.23  ? 181 GLN B CG  1 
ATOM   5535 C CD  . GLN B 1 180 ? 4.563   47.589 364.366 1.00 77.52  ? 181 GLN B CD  1 
ATOM   5536 O OE1 . GLN B 1 180 ? 4.505   48.613 365.049 1.00 70.37  ? 181 GLN B OE1 1 
ATOM   5537 N NE2 . GLN B 1 180 ? 5.714   47.081 363.933 1.00 68.86  ? 181 GLN B NE2 1 
ATOM   5538 N N   . TRP B 1 181 ? -1.017  47.994 365.297 1.00 53.79  ? 182 TRP B N   1 
ATOM   5539 C CA  . TRP B 1 181 ? -2.196  47.978 366.156 1.00 69.37  ? 182 TRP B CA  1 
ATOM   5540 C C   . TRP B 1 181 ? -3.341  47.210 365.507 1.00 63.85  ? 182 TRP B C   1 
ATOM   5541 O O   . TRP B 1 181 ? -4.097  46.510 366.193 1.00 63.79  ? 182 TRP B O   1 
ATOM   5542 C CB  . TRP B 1 181 ? -2.626  49.410 366.470 1.00 63.65  ? 182 TRP B CB  1 
ATOM   5543 C CG  . TRP B 1 181 ? -3.682  49.527 367.520 1.00 48.48  ? 182 TRP B CG  1 
ATOM   5544 C CD1 . TRP B 1 181 ? -3.489  49.776 368.849 1.00 54.62  ? 182 TRP B CD1 1 
ATOM   5545 C CD2 . TRP B 1 181 ? -5.100  49.419 367.333 1.00 51.31  ? 182 TRP B CD2 1 
ATOM   5546 N NE1 . TRP B 1 181 ? -4.697  49.825 369.499 1.00 47.47  ? 182 TRP B NE1 1 
ATOM   5547 C CE2 . TRP B 1 181 ? -5.702  49.608 368.594 1.00 50.08  ? 182 TRP B CE2 1 
ATOM   5548 C CE3 . TRP B 1 181 ? -5.919  49.181 366.224 1.00 48.31  ? 182 TRP B CE3 1 
ATOM   5549 C CZ2 . TRP B 1 181 ? -7.087  49.566 368.778 1.00 48.35  ? 182 TRP B CZ2 1 
ATOM   5550 C CZ3 . TRP B 1 181 ? -7.296  49.135 366.406 1.00 60.00  ? 182 TRP B CZ3 1 
ATOM   5551 C CH2 . TRP B 1 181 ? -7.864  49.328 367.676 1.00 70.21  ? 182 TRP B CH2 1 
ATOM   5552 N N   . VAL B 1 182 ? -3.489  47.336 364.186 1.00 65.93  ? 183 VAL B N   1 
ATOM   5553 C CA  . VAL B 1 182 ? -4.593  46.676 363.495 1.00 63.45  ? 183 VAL B CA  1 
ATOM   5554 C C   . VAL B 1 182 ? -4.418  45.161 363.530 1.00 66.08  ? 183 VAL B C   1 
ATOM   5555 O O   . VAL B 1 182 ? -5.394  44.413 363.648 1.00 64.58  ? 183 VAL B O   1 
ATOM   5556 C CB  . VAL B 1 182 ? -4.718  47.210 362.053 1.00 64.75  ? 183 VAL B CB  1 
ATOM   5557 C CG1 . VAL B 1 182 ? -5.659  46.344 361.227 1.00 50.28  ? 183 VAL B CG1 1 
ATOM   5558 C CG2 . VAL B 1 182 ? -5.209  48.648 362.058 1.00 58.72  ? 183 VAL B CG2 1 
ATOM   5559 N N   . GLN B 1 183 ? -3.176  44.681 363.448 1.00 59.31  ? 184 GLN B N   1 
ATOM   5560 C CA  . GLN B 1 183 ? -2.966  43.236 363.462 1.00 68.69  ? 184 GLN B CA  1 
ATOM   5561 C C   . GLN B 1 183 ? -3.248  42.653 364.841 1.00 69.35  ? 184 GLN B C   1 
ATOM   5562 O O   . GLN B 1 183 ? -3.864  41.587 364.959 1.00 63.02  ? 184 GLN B O   1 
ATOM   5563 C CB  . GLN B 1 183 ? -1.545  42.899 363.006 1.00 69.25  ? 184 GLN B CB  1 
ATOM   5564 C CG  . GLN B 1 183 ? -1.350  42.906 361.483 1.00 75.45  ? 184 GLN B CG  1 
ATOM   5565 C CD  . GLN B 1 183 ? -2.123  41.811 360.779 1.00 69.36  ? 184 GLN B CD  1 
ATOM   5566 O OE1 . GLN B 1 183 ? -1.824  40.626 360.927 1.00 83.20  ? 184 GLN B OE1 1 
ATOM   5567 N NE2 . GLN B 1 183 ? -3.123  42.205 360.001 1.00 66.23  ? 184 GLN B NE2 1 
ATOM   5568 N N   . GLU B 1 184 ? -2.835  43.352 365.897 1.00 72.52  ? 185 GLU B N   1 
ATOM   5569 C CA  . GLU B 1 184 ? -3.037  42.847 367.247 1.00 75.67  ? 185 GLU B CA  1 
ATOM   5570 C C   . GLU B 1 184 ? -4.479  42.975 367.730 1.00 74.79  ? 185 GLU B C   1 
ATOM   5571 O O   . GLU B 1 184 ? -4.891  42.196 368.595 1.00 80.76  ? 185 GLU B O   1 
ATOM   5572 C CB  . GLU B 1 184 ? -2.099  43.572 368.215 1.00 63.38  ? 185 GLU B CB  1 
ATOM   5573 C CG  . GLU B 1 184 ? -0.631  43.478 367.818 1.00 82.17  ? 185 GLU B CG  1 
ATOM   5574 C CD  . GLU B 1 184 ? 0.292   44.224 368.764 1.00 100.39 ? 185 GLU B CD  1 
ATOM   5575 O OE1 . GLU B 1 184 ? 1.508   43.932 368.762 1.00 93.01  ? 185 GLU B OE1 1 
ATOM   5576 O OE2 . GLU B 1 184 ? -0.198  45.099 369.511 1.00 109.19 ? 185 GLU B OE2 1 
ATOM   5577 N N   . ASN B 1 185 ? -5.267  43.910 367.186 1.00 64.78  ? 186 ASN B N   1 
ATOM   5578 C CA  . ASN B 1 185 ? -6.525  44.280 367.819 1.00 52.52  ? 186 ASN B CA  1 
ATOM   5579 C C   . ASN B 1 185 ? -7.754  44.271 366.921 1.00 55.74  ? 186 ASN B C   1 
ATOM   5580 O O   . ASN B 1 185 ? -8.866  44.343 367.456 1.00 74.51  ? 186 ASN B O   1 
ATOM   5581 C CB  . ASN B 1 185 ? -6.409  45.678 368.452 1.00 61.11  ? 186 ASN B CB  1 
ATOM   5582 C CG  . ASN B 1 185 ? -5.379  45.729 369.564 1.00 72.16  ? 186 ASN B CG  1 
ATOM   5583 O OD1 . ASN B 1 185 ? -5.445  44.956 370.523 1.00 74.89  ? 186 ASN B OD1 1 
ATOM   5584 N ND2 . ASN B 1 185 ? -4.411  46.633 369.435 1.00 53.95  ? 186 ASN B ND2 1 
ATOM   5585 N N   . VAL B 1 186 ? -7.611  44.191 365.595 1.00 66.41  ? 187 VAL B N   1 
ATOM   5586 C CA  . VAL B 1 186 ? -8.789  44.372 364.749 1.00 49.63  ? 187 VAL B CA  1 
ATOM   5587 C C   . VAL B 1 186 ? -9.757  43.208 364.904 1.00 55.44  ? 187 VAL B C   1 
ATOM   5588 O O   . VAL B 1 186 ? -10.969 43.377 364.712 1.00 67.95  ? 187 VAL B O   1 
ATOM   5589 C CB  . VAL B 1 186 ? -8.397  44.589 363.272 1.00 65.70  ? 187 VAL B CB  1 
ATOM   5590 C CG1 . VAL B 1 186 ? -8.123  43.261 362.557 1.00 55.53  ? 187 VAL B CG1 1 
ATOM   5591 C CG2 . VAL B 1 186 ? -9.488  45.375 362.545 1.00 50.17  ? 187 VAL B CG2 1 
ATOM   5592 N N   . ALA B 1 187 ? -9.260  42.020 365.266 1.00 59.66  ? 188 ALA B N   1 
ATOM   5593 C CA  . ALA B 1 187 ? -10.157 40.885 365.466 1.00 70.26  ? 188 ALA B CA  1 
ATOM   5594 C C   . ALA B 1 187 ? -11.178 41.163 366.563 1.00 63.49  ? 188 ALA B C   1 
ATOM   5595 O O   . ALA B 1 187 ? -12.310 40.671 366.492 1.00 67.42  ? 188 ALA B O   1 
ATOM   5596 C CB  . ALA B 1 187 ? -9.356  39.622 365.783 1.00 51.11  ? 188 ALA B CB  1 
ATOM   5597 N N   . ALA B 1 188 ? -10.814 41.972 367.565 1.00 55.56  ? 189 ALA B N   1 
ATOM   5598 C CA  . ALA B 1 188 ? -11.760 42.312 368.625 1.00 74.37  ? 189 ALA B CA  1 
ATOM   5599 C C   . ALA B 1 188 ? -12.985 43.046 368.095 1.00 64.80  ? 189 ALA B C   1 
ATOM   5600 O O   . ALA B 1 188 ? -14.046 42.996 368.726 1.00 67.41  ? 189 ALA B O   1 
ATOM   5601 C CB  . ALA B 1 188 ? -11.077 43.155 369.701 1.00 56.32  ? 189 ALA B CB  1 
ATOM   5602 N N   . PHE B 1 189 ? -12.868 43.723 366.954 1.00 67.72  ? 190 PHE B N   1 
ATOM   5603 C CA  . PHE B 1 189 ? -14.001 44.392 366.334 1.00 54.65  ? 190 PHE B CA  1 
ATOM   5604 C C   . PHE B 1 189 ? -14.674 43.527 365.275 1.00 65.02  ? 190 PHE B C   1 
ATOM   5605 O O   . PHE B 1 189 ? -15.466 44.039 364.475 1.00 69.37  ? 190 PHE B O   1 
ATOM   5606 C CB  . PHE B 1 189 ? -13.560 45.727 365.734 1.00 60.00  ? 190 PHE B CB  1 
ATOM   5607 C CG  . PHE B 1 189 ? -12.848 46.629 366.706 1.00 64.15  ? 190 PHE B CG  1 
ATOM   5608 C CD1 . PHE B 1 189 ? -13.546 47.603 367.407 1.00 63.93  ? 190 PHE B CD1 1 
ATOM   5609 C CD2 . PHE B 1 189 ? -11.479 46.517 366.905 1.00 56.91  ? 190 PHE B CD2 1 
ATOM   5610 C CE1 . PHE B 1 189 ? -12.900 48.440 368.290 1.00 45.67  ? 190 PHE B CE1 1 
ATOM   5611 C CE2 . PHE B 1 189 ? -10.822 47.350 367.790 1.00 54.09  ? 190 PHE B CE2 1 
ATOM   5612 C CZ  . PHE B 1 189 ? -11.533 48.314 368.484 1.00 61.22  ? 190 PHE B CZ  1 
ATOM   5613 N N   . GLY B 1 190 ? -14.391 42.228 365.265 1.00 55.58  ? 191 GLY B N   1 
ATOM   5614 C CA  . GLY B 1 190 ? -14.978 41.353 364.273 1.00 73.09  ? 191 GLY B CA  1 
ATOM   5615 C C   . GLY B 1 190 ? -14.260 41.416 362.951 1.00 92.78  ? 191 GLY B C   1 
ATOM   5616 O O   . GLY B 1 190 ? -14.868 41.174 361.902 1.00 74.48  ? 191 GLY B O   1 
ATOM   5617 N N   . GLY B 1 191 ? -12.971 41.731 362.974 1.00 84.93  ? 192 GLY B N   1 
ATOM   5618 C CA  . GLY B 1 191 ? -12.215 41.997 361.771 1.00 60.14  ? 192 GLY B CA  1 
ATOM   5619 C C   . GLY B 1 191 ? -11.129 40.979 361.486 1.00 70.38  ? 192 GLY B C   1 
ATOM   5620 O O   . GLY B 1 191 ? -10.576 40.363 362.399 1.00 83.50  ? 192 GLY B O   1 
ATOM   5621 N N   . ASP B 1 192 ? -10.808 40.826 360.205 1.00 81.13  ? 193 ASP B N   1 
ATOM   5622 C CA  . ASP B 1 192 ? -9.867  39.811 359.767 1.00 78.83  ? 193 ASP B CA  1 
ATOM   5623 C C   . ASP B 1 192 ? -8.484  40.421 359.598 1.00 65.86  ? 193 ASP B C   1 
ATOM   5624 O O   . ASP B 1 192 ? -8.276  41.204 358.661 1.00 70.57  ? 193 ASP B O   1 
ATOM   5625 C CB  . ASP B 1 192 ? -10.338 39.190 358.456 1.00 66.45  ? 193 ASP B CB  1 
ATOM   5626 C CG  . ASP B 1 192 ? -9.633  37.890 358.143 1.00 77.23  ? 193 ASP B CG  1 
ATOM   5627 O OD1 . ASP B 1 192 ? -8.529  37.662 358.683 1.00 65.44  ? 193 ASP B OD1 1 
ATOM   5628 O OD2 . ASP B 1 192 ? -10.184 37.098 357.349 1.00 92.16  ? 193 ASP B OD2 1 
ATOM   5629 N N   . PRO B 1 193 ? -7.514  40.102 360.457 1.00 66.69  ? 194 PRO B N   1 
ATOM   5630 C CA  . PRO B 1 193 ? -6.149  40.602 360.251 1.00 73.82  ? 194 PRO B CA  1 
ATOM   5631 C C   . PRO B 1 193 ? -5.386  39.900 359.138 1.00 73.69  ? 194 PRO B C   1 
ATOM   5632 O O   . PRO B 1 193 ? -4.246  40.287 358.858 1.00 67.77  ? 194 PRO B O   1 
ATOM   5633 C CB  . PRO B 1 193 ? -5.482  40.359 361.617 1.00 57.46  ? 194 PRO B CB  1 
ATOM   5634 C CG  . PRO B 1 193 ? -6.247  39.244 362.217 1.00 61.21  ? 194 PRO B CG  1 
ATOM   5635 C CD  . PRO B 1 193 ? -7.663  39.399 361.743 1.00 67.20  ? 194 PRO B CD  1 
ATOM   5636 N N   . THR B 1 194 ? -5.966  38.886 358.496 1.00 63.46  ? 195 THR B N   1 
ATOM   5637 C CA  . THR B 1 194 ? -5.327  38.218 357.371 1.00 74.88  ? 195 THR B CA  1 
ATOM   5638 C C   . THR B 1 194 ? -5.796  38.775 356.032 1.00 81.80  ? 195 THR B C   1 
ATOM   5639 O O   . THR B 1 194 ? -5.430  38.240 354.981 1.00 69.79  ? 195 THR B O   1 
ATOM   5640 C CB  . THR B 1 194 ? -5.575  36.706 357.427 1.00 65.93  ? 195 THR B CB  1 
ATOM   5641 O OG1 . THR B 1 194 ? -6.969  36.437 357.232 1.00 62.24  ? 195 THR B OG1 1 
ATOM   5642 C CG2 . THR B 1 194 ? -5.125  36.132 358.774 1.00 65.74  ? 195 THR B CG2 1 
ATOM   5643 N N   . SER B 1 195 ? -6.582  39.855 356.050 1.00 75.77  ? 196 SER B N   1 
ATOM   5644 C CA  . SER B 1 195 ? -7.155  40.443 354.845 1.00 70.01  ? 196 SER B CA  1 
ATOM   5645 C C   . SER B 1 195 ? -7.278  41.948 355.100 1.00 66.59  ? 196 SER B C   1 
ATOM   5646 O O   . SER B 1 195 ? -8.354  42.477 355.402 1.00 60.51  ? 196 SER B O   1 
ATOM   5647 C CB  . SER B 1 195 ? -8.502  39.813 354.496 1.00 66.16  ? 196 SER B CB  1 
ATOM   5648 O OG  . SER B 1 195 ? -9.094  40.460 353.384 1.00 76.23  ? 196 SER B OG  1 
ATOM   5649 N N   . VAL B 1 196 ? -6.149  42.640 354.974 1.00 55.26  ? 197 VAL B N   1 
ATOM   5650 C CA  . VAL B 1 196 ? -6.038  44.056 355.301 1.00 65.13  ? 197 VAL B CA  1 
ATOM   5651 C C   . VAL B 1 196 ? -5.534  44.798 354.070 1.00 71.36  ? 197 VAL B C   1 
ATOM   5652 O O   . VAL B 1 196 ? -4.425  44.533 353.583 1.00 57.74  ? 197 VAL B O   1 
ATOM   5653 C CB  . VAL B 1 196 ? -5.112  44.278 356.509 1.00 61.40  ? 197 VAL B CB  1 
ATOM   5654 C CG1 . VAL B 1 196 ? -4.707  45.737 356.623 1.00 51.28  ? 197 VAL B CG1 1 
ATOM   5655 C CG2 . VAL B 1 196 ? -5.785  43.769 357.797 1.00 55.38  ? 197 VAL B CG2 1 
ATOM   5656 N N   . THR B 1 197 ? -6.349  45.727 353.576 1.00 56.68  ? 198 THR B N   1 
ATOM   5657 C CA  . THR B 1 197 ? -6.071  46.499 352.366 1.00 62.25  ? 198 THR B CA  1 
ATOM   5658 C C   . THR B 1 197 ? -5.816  47.957 352.728 1.00 57.06  ? 198 THR B C   1 
ATOM   5659 O O   . THR B 1 197 ? -6.722  48.656 353.203 1.00 56.50  ? 198 THR B O   1 
ATOM   5660 C CB  . THR B 1 197 ? -7.223  46.389 351.364 1.00 57.95  ? 198 THR B CB  1 
ATOM   5661 O OG1 . THR B 1 197 ? -7.665  45.028 351.243 1.00 62.34  ? 198 THR B OG1 1 
ATOM   5662 C CG2 . THR B 1 197 ? -6.787  46.889 350.022 1.00 63.41  ? 198 THR B CG2 1 
ATOM   5663 N N   . LEU B 1 198 ? -4.596  48.430 352.477 1.00 56.02  ? 199 LEU B N   1 
ATOM   5664 C CA  . LEU B 1 198 ? -4.281  49.848 352.587 1.00 50.39  ? 199 LEU B CA  1 
ATOM   5665 C C   . LEU B 1 198 ? -4.861  50.611 351.399 1.00 59.75  ? 199 LEU B C   1 
ATOM   5666 O O   . LEU B 1 198 ? -4.704  50.187 350.252 1.00 57.60  ? 199 LEU B O   1 
ATOM   5667 C CB  . LEU B 1 198 ? -2.771  50.052 352.630 1.00 47.65  ? 199 LEU B CB  1 
ATOM   5668 C CG  . LEU B 1 198 ? -1.963  49.435 353.760 1.00 59.14  ? 199 LEU B CG  1 
ATOM   5669 C CD1 . LEU B 1 198 ? -0.580  50.063 353.769 1.00 56.78  ? 199 LEU B CD1 1 
ATOM   5670 C CD2 . LEU B 1 198 ? -2.675  49.639 355.085 1.00 56.71  ? 199 LEU B CD2 1 
ATOM   5671 N N   . PHE B 1 199 ? -5.517  51.741 351.662 1.00 52.16  ? 200 PHE B N   1 
ATOM   5672 C CA  . PHE B 1 199 ? -5.861  52.653 350.578 1.00 44.72  ? 200 PHE B CA  1 
ATOM   5673 C C   . PHE B 1 199 ? -5.675  54.090 351.038 1.00 53.96  ? 200 PHE B C   1 
ATOM   5674 O O   . PHE B 1 199 ? -6.018  54.433 352.171 1.00 60.96  ? 200 PHE B O   1 
ATOM   5675 C CB  . PHE B 1 199 ? -7.279  52.389 350.026 1.00 45.34  ? 200 PHE B CB  1 
ATOM   5676 C CG  . PHE B 1 199 ? -8.415  52.953 350.832 1.00 52.49  ? 200 PHE B CG  1 
ATOM   5677 C CD1 . PHE B 1 199 ? -9.355  53.765 350.211 1.00 48.48  ? 200 PHE B CD1 1 
ATOM   5678 C CD2 . PHE B 1 199 ? -8.605  52.612 352.165 1.00 50.00  ? 200 PHE B CD2 1 
ATOM   5679 C CE1 . PHE B 1 199 ? -10.436 54.272 350.907 1.00 58.26  ? 200 PHE B CE1 1 
ATOM   5680 C CE2 . PHE B 1 199 ? -9.692  53.121 352.873 1.00 48.55  ? 200 PHE B CE2 1 
ATOM   5681 C CZ  . PHE B 1 199 ? -10.605 53.951 352.240 1.00 54.57  ? 200 PHE B CZ  1 
ATOM   5682 N N   . GLY B 1 200 ? -5.071  54.905 350.171 1.00 53.15  ? 201 GLY B N   1 
ATOM   5683 C CA  . GLY B 1 200 ? -4.751  56.281 350.487 1.00 45.99  ? 201 GLY B CA  1 
ATOM   5684 C C   . GLY B 1 200 ? -4.703  57.116 349.226 1.00 58.52  ? 201 GLY B C   1 
ATOM   5685 O O   . GLY B 1 200 ? -4.691  56.598 348.106 1.00 54.09  ? 201 GLY B O   1 
ATOM   5686 N N   . GLU B 1 201 ? -4.673  58.429 349.421 1.00 45.90  ? 202 GLU B N   1 
ATOM   5687 C CA  . GLU B 1 201 ? -4.756  59.371 348.321 1.00 49.84  ? 202 GLU B CA  1 
ATOM   5688 C C   . GLU B 1 201 ? -3.638  60.394 348.443 1.00 51.67  ? 202 GLU B C   1 
ATOM   5689 O O   . GLU B 1 201 ? -3.351  60.883 349.538 1.00 48.25  ? 202 GLU B O   1 
ATOM   5690 C CB  . GLU B 1 201 ? -6.127  60.063 348.295 1.00 52.87  ? 202 GLU B CB  1 
ATOM   5691 C CG  . GLU B 1 201 ? -6.413  60.849 347.031 1.00 55.88  ? 202 GLU B CG  1 
ATOM   5692 C CD  . GLU B 1 201 ? -6.075  62.320 347.178 1.00 71.62  ? 202 GLU B CD  1 
ATOM   5693 O OE1 . GLU B 1 201 ? -6.220  63.064 346.186 1.00 63.65  ? 202 GLU B OE1 1 
ATOM   5694 O OE2 . GLU B 1 201 ? -5.664  62.732 348.287 1.00 65.84  ? 202 GLU B OE2 1 
ATOM   5695 N N   . SER B 1 202 ? -3.028  60.743 347.313 1.00 50.31  ? 203 SER B N   1 
ATOM   5696 C CA  . SER B 1 202 ? -1.945  61.722 347.291 1.00 51.44  ? 203 SER B CA  1 
ATOM   5697 C C   . SER B 1 202 ? -0.825  61.258 348.209 1.00 45.32  ? 203 SER B C   1 
ATOM   5698 O O   . SER B 1 202 ? -0.410  60.101 348.146 1.00 44.04  ? 203 SER B O   1 
ATOM   5699 C CB  . SER B 1 202 ? -2.453  63.097 347.729 1.00 41.91  ? 203 SER B CB  1 
ATOM   5700 O OG  . SER B 1 202 ? -1.409  64.056 347.710 1.00 60.36  ? 203 SER B OG  1 
ATOM   5701 N N   . ALA B 1 203 ? -0.332  62.150 349.064 1.00 54.84  ? 204 ALA B N   1 
ATOM   5702 C CA  . ALA B 1 203 ? 0.720   61.742 349.998 1.00 52.23  ? 204 ALA B CA  1 
ATOM   5703 C C   . ALA B 1 203 ? 0.336   60.470 350.745 1.00 45.53  ? 204 ALA B C   1 
ATOM   5704 O O   . ALA B 1 203 ? 1.210   59.675 351.115 1.00 48.12  ? 204 ALA B O   1 
ATOM   5705 C CB  . ALA B 1 203 ? 1.032   62.868 350.986 1.00 51.06  ? 204 ALA B CB  1 
ATOM   5706 N N   . GLY B 1 204 ? -0.965  60.256 350.961 1.00 44.53  ? 205 GLY B N   1 
ATOM   5707 C CA  . GLY B 1 204 ? -1.420  58.979 351.487 1.00 47.05  ? 205 GLY B CA  1 
ATOM   5708 C C   . GLY B 1 204 ? -1.109  57.825 350.553 1.00 55.27  ? 205 GLY B C   1 
ATOM   5709 O O   . GLY B 1 204 ? -0.630  56.774 350.986 1.00 46.91  ? 205 GLY B O   1 
ATOM   5710 N N   . ALA B 1 205 ? -1.365  58.009 349.255 1.00 52.35  ? 206 ALA B N   1 
ATOM   5711 C CA  . ALA B 1 205 ? -1.014  56.975 348.284 1.00 52.10  ? 206 ALA B CA  1 
ATOM   5712 C C   . ALA B 1 205 ? 0.492   56.748 348.245 1.00 49.54  ? 206 ALA B C   1 
ATOM   5713 O O   . ALA B 1 205 ? 0.955   55.600 348.210 1.00 44.23  ? 206 ALA B O   1 
ATOM   5714 C CB  . ALA B 1 205 ? -1.542  57.350 346.900 1.00 50.51  ? 206 ALA B CB  1 
ATOM   5715 N N   . ALA B 1 206 ? 1.274   57.831 348.267 1.00 48.33  ? 207 ALA B N   1 
ATOM   5716 C CA  . ALA B 1 206 ? 2.723   57.692 348.368 1.00 43.75  ? 207 ALA B CA  1 
ATOM   5717 C C   . ALA B 1 206 ? 3.121   56.916 349.617 1.00 59.61  ? 207 ALA B C   1 
ATOM   5718 O O   . ALA B 1 206 ? 4.028   56.076 349.568 1.00 57.66  ? 207 ALA B O   1 
ATOM   5719 C CB  . ALA B 1 206 ? 3.386   59.070 348.363 1.00 42.84  ? 207 ALA B CB  1 
ATOM   5720 N N   . SER B 1 207 ? 2.457   57.181 350.748 1.00 45.80  ? 208 SER B N   1 
ATOM   5721 C CA  . SER B 1 207 ? 2.762   56.437 351.969 1.00 48.06  ? 208 SER B CA  1 
ATOM   5722 C C   . SER B 1 207 ? 2.458   54.955 351.787 1.00 57.61  ? 208 SER B C   1 
ATOM   5723 O O   . SER B 1 207 ? 3.279   54.094 352.124 1.00 46.76  ? 208 SER B O   1 
ATOM   5724 C CB  . SER B 1 207 ? 1.978   57.010 353.154 1.00 44.71  ? 208 SER B CB  1 
ATOM   5725 O OG  . SER B 1 207 ? 2.265   58.388 353.354 1.00 46.03  ? 208 SER B OG  1 
ATOM   5726 N N   . VAL B 1 208 ? 1.277   54.642 351.244 1.00 38.49  ? 209 VAL B N   1 
ATOM   5727 C CA  . VAL B 1 208 ? 0.938   53.253 350.930 1.00 51.00  ? 209 VAL B CA  1 
ATOM   5728 C C   . VAL B 1 208 ? 2.067   52.580 350.162 1.00 70.23  ? 209 VAL B C   1 
ATOM   5729 O O   . VAL B 1 208 ? 2.474   51.455 350.478 1.00 65.32  ? 209 VAL B O   1 
ATOM   5730 C CB  . VAL B 1 208 ? -0.374  53.195 350.135 1.00 55.46  ? 209 VAL B CB  1 
ATOM   5731 C CG1 . VAL B 1 208 ? -0.719  51.752 349.792 1.00 51.07  ? 209 VAL B CG1 1 
ATOM   5732 C CG2 . VAL B 1 208 ? -1.469  53.858 350.926 1.00 44.08  ? 209 VAL B CG2 1 
ATOM   5733 N N   . GLY B 1 209 ? 2.588   53.260 349.137 1.00 56.76  ? 210 GLY B N   1 
ATOM   5734 C CA  . GLY B 1 209 ? 3.646   52.669 348.334 1.00 61.95  ? 210 GLY B CA  1 
ATOM   5735 C C   . GLY B 1 209 ? 4.923   52.437 349.116 1.00 45.89  ? 210 GLY B C   1 
ATOM   5736 O O   . GLY B 1 209 ? 5.610   51.433 348.915 1.00 68.03  ? 210 GLY B O   1 
ATOM   5737 N N   . MET B 1 210 ? 5.264   53.358 350.017 1.00 57.83  ? 211 MET B N   1 
ATOM   5738 C CA  . MET B 1 210 ? 6.462   53.170 350.828 1.00 64.68  ? 211 MET B CA  1 
ATOM   5739 C C   . MET B 1 210 ? 6.301   52.022 351.814 1.00 62.61  ? 211 MET B C   1 
ATOM   5740 O O   . MET B 1 210 ? 7.287   51.353 352.140 1.00 73.48  ? 211 MET B O   1 
ATOM   5741 C CB  . MET B 1 210 ? 6.805   54.467 351.550 1.00 51.41  ? 211 MET B CB  1 
ATOM   5742 C CG  . MET B 1 210 ? 7.087   55.584 350.578 1.00 47.65  ? 211 MET B CG  1 
ATOM   5743 S SD  . MET B 1 210 ? 7.663   57.082 351.362 1.00 66.36  ? 211 MET B SD  1 
ATOM   5744 C CE  . MET B 1 210 ? 7.319   58.275 350.070 1.00 60.50  ? 211 MET B CE  1 
ATOM   5745 N N   . HIS B 1 211 ? 5.080   51.777 352.298 1.00 55.75  ? 212 HIS B N   1 
ATOM   5746 C CA  . HIS B 1 211 ? 4.842   50.570 353.083 1.00 59.36  ? 212 HIS B CA  1 
ATOM   5747 C C   . HIS B 1 211 ? 4.997   49.323 352.224 1.00 65.18  ? 212 HIS B C   1 
ATOM   5748 O O   . HIS B 1 211 ? 5.426   48.277 352.723 1.00 54.23  ? 212 HIS B O   1 
ATOM   5749 C CB  . HIS B 1 211 ? 3.455   50.615 353.730 1.00 48.27  ? 212 HIS B CB  1 
ATOM   5750 C CG  . HIS B 1 211 ? 3.334   51.638 354.817 1.00 64.83  ? 212 HIS B CG  1 
ATOM   5751 N ND1 . HIS B 1 211 ? 4.095   51.596 355.966 1.00 57.59  ? 212 HIS B ND1 1 
ATOM   5752 C CD2 . HIS B 1 211 ? 2.555   52.741 354.922 1.00 53.07  ? 212 HIS B CD2 1 
ATOM   5753 C CE1 . HIS B 1 211 ? 3.785   52.625 356.734 1.00 56.85  ? 212 HIS B CE1 1 
ATOM   5754 N NE2 . HIS B 1 211 ? 2.854   53.336 356.124 1.00 62.14  ? 212 HIS B NE2 1 
ATOM   5755 N N   . LEU B 1 212 ? 4.671   49.420 350.931 1.00 68.81  ? 213 LEU B N   1 
ATOM   5756 C CA  . LEU B 1 212 ? 4.908   48.306 350.019 1.00 60.25  ? 213 LEU B CA  1 
ATOM   5757 C C   . LEU B 1 212 ? 6.394   48.045 349.821 1.00 57.39  ? 213 LEU B C   1 
ATOM   5758 O O   . LEU B 1 212 ? 6.790   46.896 349.599 1.00 61.30  ? 213 LEU B O   1 
ATOM   5759 C CB  . LEU B 1 212 ? 4.243   48.569 348.668 1.00 59.49  ? 213 LEU B CB  1 
ATOM   5760 C CG  . LEU B 1 212 ? 2.760   48.211 348.591 1.00 77.54  ? 213 LEU B CG  1 
ATOM   5761 C CD1 . LEU B 1 212 ? 2.151   48.744 347.301 1.00 67.42  ? 213 LEU B CD1 1 
ATOM   5762 C CD2 . LEU B 1 212 ? 2.571   46.706 348.707 1.00 64.91  ? 213 LEU B CD2 1 
ATOM   5763 N N   . LEU B 1 213 ? 7.230   49.073 349.924 1.00 60.35  ? 214 LEU B N   1 
ATOM   5764 C CA  . LEU B 1 213 ? 8.655   48.933 349.669 1.00 50.23  ? 214 LEU B CA  1 
ATOM   5765 C C   . LEU B 1 213 ? 9.468   48.734 350.940 1.00 58.28  ? 214 LEU B C   1 
ATOM   5766 O O   . LEU B 1 213 ? 10.681  48.516 350.855 1.00 65.14  ? 214 LEU B O   1 
ATOM   5767 C CB  . LEU B 1 213 ? 9.164   50.162 348.901 1.00 54.15  ? 214 LEU B CB  1 
ATOM   5768 C CG  . LEU B 1 213 ? 8.372   50.465 347.614 1.00 63.70  ? 214 LEU B CG  1 
ATOM   5769 C CD1 . LEU B 1 213 ? 8.804   51.769 346.937 1.00 63.63  ? 214 LEU B CD1 1 
ATOM   5770 C CD2 . LEU B 1 213 ? 8.474   49.299 346.642 1.00 46.57  ? 214 LEU B CD2 1 
ATOM   5771 N N   . SER B 1 214 ? 8.835   48.803 352.108 1.00 66.78  ? 215 SER B N   1 
ATOM   5772 C CA  . SER B 1 214 ? 9.519   48.609 353.377 1.00 70.55  ? 215 SER B CA  1 
ATOM   5773 C C   . SER B 1 214 ? 9.141   47.248 353.934 1.00 67.57  ? 215 SER B C   1 
ATOM   5774 O O   . SER B 1 214 ? 7.958   47.010 354.221 1.00 66.97  ? 215 SER B O   1 
ATOM   5775 C CB  . SER B 1 214 ? 9.158   49.709 354.369 1.00 58.13  ? 215 SER B CB  1 
ATOM   5776 O OG  . SER B 1 214 ? 10.189  49.861 355.322 1.00 71.69  ? 215 SER B OG  1 
ATOM   5777 N N   . PRO B 1 215 ? 10.093  46.333 354.081 1.00 75.49  ? 216 PRO B N   1 
ATOM   5778 C CA  . PRO B 1 215 ? 9.760   44.962 354.492 1.00 66.42  ? 216 PRO B CA  1 
ATOM   5779 C C   . PRO B 1 215 ? 9.027   44.906 355.825 1.00 70.88  ? 216 PRO B C   1 
ATOM   5780 O O   . PRO B 1 215 ? 8.039   44.164 355.938 1.00 65.55  ? 216 PRO B O   1 
ATOM   5781 C CB  . PRO B 1 215 ? 11.132  44.274 354.562 1.00 79.70  ? 216 PRO B CB  1 
ATOM   5782 C CG  . PRO B 1 215 ? 11.962  45.026 353.570 1.00 56.16  ? 216 PRO B CG  1 
ATOM   5783 C CD  . PRO B 1 215 ? 11.496  46.457 353.643 1.00 70.60  ? 216 PRO B CD  1 
ATOM   5784 N N   . PRO B 1 216 ? 9.446   45.656 356.858 1.00 58.55  ? 217 PRO B N   1 
ATOM   5785 C CA  . PRO B 1 216 ? 8.704   45.576 358.130 1.00 64.89  ? 217 PRO B CA  1 
ATOM   5786 C C   . PRO B 1 216 ? 7.247   45.988 358.015 1.00 70.00  ? 217 PRO B C   1 
ATOM   5787 O O   . PRO B 1 216 ? 6.456   45.641 358.899 1.00 63.56  ? 217 PRO B O   1 
ATOM   5788 C CB  . PRO B 1 216 ? 9.480   46.520 359.061 1.00 58.45  ? 217 PRO B CB  1 
ATOM   5789 C CG  . PRO B 1 216 ? 10.831  46.591 358.479 1.00 63.60  ? 217 PRO B CG  1 
ATOM   5790 C CD  . PRO B 1 216 ? 10.615  46.547 357.001 1.00 59.43  ? 217 PRO B CD  1 
ATOM   5791 N N   . SER B 1 217 ? 6.859   46.699 356.955 1.00 62.58  ? 218 SER B N   1 
ATOM   5792 C CA  . SER B 1 217 ? 5.460   47.063 356.777 1.00 57.29  ? 218 SER B CA  1 
ATOM   5793 C C   . SER B 1 217 ? 4.699   46.079 355.902 1.00 68.81  ? 218 SER B C   1 
ATOM   5794 O O   . SER B 1 217 ? 3.485   45.926 356.085 1.00 72.58  ? 218 SER B O   1 
ATOM   5795 C CB  . SER B 1 217 ? 5.341   48.468 356.177 1.00 62.20  ? 218 SER B CB  1 
ATOM   5796 O OG  . SER B 1 217 ? 5.909   49.453 357.023 1.00 54.61  ? 218 SER B OG  1 
ATOM   5797 N N   . ARG B 1 218 ? 5.385   45.406 355.020 1.00 78.77  ? 219 ARG B N   1 
ATOM   5798 C CA  . ARG B 1 218 ? 4.731   44.537 354.087 1.00 75.74  ? 219 ARG B CA  1 
ATOM   5799 C C   . ARG B 1 218 ? 3.960   43.429 354.766 1.00 65.17  ? 219 ARG B C   1 
ATOM   5800 O O   . ARG B 1 218 ? 2.914   43.067 354.312 1.00 71.68  ? 219 ARG B O   1 
ATOM   5801 C CB  . ARG B 1 218 ? 5.756   44.047 353.082 1.00 82.04  ? 219 ARG B CB  1 
ATOM   5802 C CG  . ARG B 1 218 ? 5.203   43.301 351.904 1.00 86.51  ? 219 ARG B CG  1 
ATOM   5803 C CD  . ARG B 1 218 ? 4.314   44.141 351.041 1.00 70.47  ? 219 ARG B CD  1 
ATOM   5804 N NE  . ARG B 1 218 ? 3.658   43.310 350.053 1.00 79.68  ? 219 ARG B NE  1 
ATOM   5805 C CZ  . ARG B 1 218 ? 2.787   42.364 350.348 1.00 89.16  ? 219 ARG B CZ  1 
ATOM   5806 N NH1 . ARG B 1 218 ? 2.488   42.138 351.589 1.00 103.42 ? 219 ARG B NH1 1 
ATOM   5807 N NH2 . ARG B 1 218 ? 2.219   41.644 349.418 1.00 78.41  ? 219 ARG B NH2 1 
ATOM   5808 N N   . GLY B 1 219 ? 4.487   42.880 355.839 1.00 68.48  ? 220 GLY B N   1 
ATOM   5809 C CA  . GLY B 1 219 ? 3.813   41.843 356.597 1.00 80.75  ? 220 GLY B CA  1 
ATOM   5810 C C   . GLY B 1 219 ? 2.536   42.286 357.281 1.00 70.82  ? 220 GLY B C   1 
ATOM   5811 O O   . GLY B 1 219 ? 1.794   41.429 357.773 1.00 78.06  ? 220 GLY B O   1 
ATOM   5812 N N   . LEU B 1 220 ? 2.255   43.588 357.310 1.00 56.26  ? 221 LEU B N   1 
ATOM   5813 C CA  . LEU B 1 220 ? 1.104   44.100 358.039 1.00 69.65  ? 221 LEU B CA  1 
ATOM   5814 C C   . LEU B 1 220 ? -0.140  44.250 357.174 1.00 72.50  ? 221 LEU B C   1 
ATOM   5815 O O   . LEU B 1 220 ? -1.223  44.489 357.719 1.00 74.42  ? 221 LEU B O   1 
ATOM   5816 C CB  . LEU B 1 220 ? 1.448   45.448 358.688 1.00 64.81  ? 221 LEU B CB  1 
ATOM   5817 C CG  . LEU B 1 220 ? 2.853   45.549 359.300 1.00 76.51  ? 221 LEU B CG  1 
ATOM   5818 C CD1 . LEU B 1 220 ? 3.029   46.841 360.068 1.00 54.50  ? 221 LEU B CD1 1 
ATOM   5819 C CD2 . LEU B 1 220 ? 3.186   44.357 360.200 1.00 63.73  ? 221 LEU B CD2 1 
ATOM   5820 N N   . PHE B 1 221 ? -0.023  44.113 355.854 1.00 61.97  ? 222 PHE B N   1 
ATOM   5821 C CA  . PHE B 1 221 ? -1.183  44.223 354.981 1.00 63.75  ? 222 PHE B CA  1 
ATOM   5822 C C   . PHE B 1 221 ? -1.000  43.290 353.789 1.00 64.59  ? 222 PHE B C   1 
ATOM   5823 O O   . PHE B 1 221 ? 0.052   42.670 353.609 1.00 62.55  ? 222 PHE B O   1 
ATOM   5824 C CB  . PHE B 1 221 ? -1.419  45.678 354.541 1.00 63.59  ? 222 PHE B CB  1 
ATOM   5825 C CG  . PHE B 1 221 ? -0.289  46.273 353.742 1.00 67.54  ? 222 PHE B CG  1 
ATOM   5826 C CD1 . PHE B 1 221 ? 0.891   46.662 354.361 1.00 54.59  ? 222 PHE B CD1 1 
ATOM   5827 C CD2 . PHE B 1 221 ? -0.412  46.455 352.369 1.00 60.10  ? 222 PHE B CD2 1 
ATOM   5828 C CE1 . PHE B 1 221 ? 1.932   47.211 353.625 1.00 61.68  ? 222 PHE B CE1 1 
ATOM   5829 C CE2 . PHE B 1 221 ? 0.624   47.002 351.630 1.00 52.22  ? 222 PHE B CE2 1 
ATOM   5830 C CZ  . PHE B 1 221 ? 1.798   47.381 352.258 1.00 55.60  ? 222 PHE B CZ  1 
ATOM   5831 N N   . HIS B 1 222 ? -2.046  43.189 352.972 1.00 52.48  ? 223 HIS B N   1 
ATOM   5832 C CA  . HIS B 1 222 ? -2.064  42.219 351.884 1.00 82.77  ? 223 HIS B CA  1 
ATOM   5833 C C   . HIS B 1 222 ? -2.455  42.783 350.523 1.00 72.25  ? 223 HIS B C   1 
ATOM   5834 O O   . HIS B 1 222 ? -2.111  42.168 349.507 1.00 76.05  ? 223 HIS B O   1 
ATOM   5835 C CB  . HIS B 1 222 ? -3.000  41.057 352.241 1.00 72.78  ? 223 HIS B CB  1 
ATOM   5836 C CG  . HIS B 1 222 ? -2.733  40.484 353.597 1.00 91.66  ? 223 HIS B CG  1 
ATOM   5837 N ND1 . HIS B 1 222 ? -3.526  40.756 354.692 1.00 75.38  ? 223 HIS B ND1 1 
ATOM   5838 C CD2 . HIS B 1 222 ? -1.738  39.681 354.041 1.00 89.87  ? 223 HIS B CD2 1 
ATOM   5839 C CE1 . HIS B 1 222 ? -3.035  40.134 355.749 1.00 70.60  ? 223 HIS B CE1 1 
ATOM   5840 N NE2 . HIS B 1 222 ? -1.954  39.471 355.380 1.00 86.02  ? 223 HIS B NE2 1 
ATOM   5841 N N   . ARG B 1 223 ? -3.163  43.908 350.459 1.00 68.57  ? 224 ARG B N   1 
ATOM   5842 C CA  . ARG B 1 223 ? -3.442  44.573 349.196 1.00 59.95  ? 224 ARG B CA  1 
ATOM   5843 C C   . ARG B 1 223 ? -3.294  46.072 349.396 1.00 62.50  ? 224 ARG B C   1 
ATOM   5844 O O   . ARG B 1 223 ? -3.353  46.577 350.518 1.00 59.21  ? 224 ARG B O   1 
ATOM   5845 C CB  . ARG B 1 223 ? -4.847  44.262 348.664 1.00 62.27  ? 224 ARG B CB  1 
ATOM   5846 C CG  . ARG B 1 223 ? -5.337  42.867 348.939 1.00 59.61  ? 224 ARG B CG  1 
ATOM   5847 C CD  . ARG B 1 223 ? -6.716  42.645 348.363 1.00 65.78  ? 224 ARG B CD  1 
ATOM   5848 N NE  . ARG B 1 223 ? -6.958  41.226 348.146 1.00 88.34  ? 224 ARG B NE  1 
ATOM   5849 C CZ  . ARG B 1 223 ? -7.366  40.387 349.089 1.00 76.35  ? 224 ARG B CZ  1 
ATOM   5850 N NH1 . ARG B 1 223 ? -7.578  40.828 350.322 1.00 76.32  ? 224 ARG B NH1 1 
ATOM   5851 N NH2 . ARG B 1 223 ? -7.553  39.107 348.799 1.00 94.67  ? 224 ARG B NH2 1 
ATOM   5852 N N   . ALA B 1 224 ? -3.120  46.784 348.285 1.00 66.51  ? 225 ALA B N   1 
ATOM   5853 C CA  . ALA B 1 224 ? -2.884  48.218 348.309 1.00 62.61  ? 225 ALA B CA  1 
ATOM   5854 C C   . ALA B 1 224 ? -3.763  48.915 347.280 1.00 55.52  ? 225 ALA B C   1 
ATOM   5855 O O   . ALA B 1 224 ? -4.103  48.347 346.239 1.00 60.83  ? 225 ALA B O   1 
ATOM   5856 C CB  . ALA B 1 224 ? -1.406  48.540 348.043 1.00 51.09  ? 225 ALA B CB  1 
ATOM   5857 N N   . VAL B 1 225 ? -4.142  50.151 347.596 1.00 50.76  ? 226 VAL B N   1 
ATOM   5858 C CA  . VAL B 1 225 ? -4.830  51.046 346.675 1.00 47.72  ? 226 VAL B CA  1 
ATOM   5859 C C   . VAL B 1 225 ? -4.103  52.382 346.720 1.00 52.04  ? 226 VAL B C   1 
ATOM   5860 O O   . VAL B 1 225 ? -3.945  52.966 347.798 1.00 57.18  ? 226 VAL B O   1 
ATOM   5861 C CB  . VAL B 1 225 ? -6.317  51.220 347.030 1.00 54.05  ? 226 VAL B CB  1 
ATOM   5862 C CG1 . VAL B 1 225 ? -6.991  52.228 346.107 1.00 43.63  ? 226 VAL B CG1 1 
ATOM   5863 C CG2 . VAL B 1 225 ? -7.041  49.880 346.996 1.00 51.22  ? 226 VAL B CG2 1 
ATOM   5864 N N   . LEU B 1 226 ? -3.639  52.854 345.562 1.00 55.13  ? 227 LEU B N   1 
ATOM   5865 C CA  . LEU B 1 226 ? -2.902  54.112 345.458 1.00 43.93  ? 227 LEU B CA  1 
ATOM   5866 C C   . LEU B 1 226 ? -3.703  55.059 344.580 1.00 51.24  ? 227 LEU B C   1 
ATOM   5867 O O   . LEU B 1 226 ? -3.817  54.846 343.370 1.00 51.89  ? 227 LEU B O   1 
ATOM   5868 C CB  . LEU B 1 226 ? -1.502  53.896 344.891 1.00 40.26  ? 227 LEU B CB  1 
ATOM   5869 C CG  . LEU B 1 226 ? -0.535  53.149 345.807 1.00 48.23  ? 227 LEU B CG  1 
ATOM   5870 C CD1 . LEU B 1 226 ? -0.710  51.645 345.688 1.00 55.38  ? 227 LEU B CD1 1 
ATOM   5871 C CD2 . LEU B 1 226 ? 0.894   53.543 345.500 1.00 53.60  ? 227 LEU B CD2 1 
ATOM   5872 N N   . GLN B 1 227 ? -4.231  56.113 345.180 1.00 48.33  ? 228 GLN B N   1 
ATOM   5873 C CA  . GLN B 1 227 ? -5.129  57.045 344.512 1.00 40.71  ? 228 GLN B CA  1 
ATOM   5874 C C   . GLN B 1 227 ? -4.404  58.368 344.283 1.00 53.79  ? 228 GLN B C   1 
ATOM   5875 O O   . GLN B 1 227 ? -4.120  59.096 345.240 1.00 55.59  ? 228 GLN B O   1 
ATOM   5876 C CB  . GLN B 1 227 ? -6.379  57.250 345.360 1.00 47.33  ? 228 GLN B CB  1 
ATOM   5877 C CG  . GLN B 1 227 ? -7.101  55.969 345.770 1.00 52.56  ? 228 GLN B CG  1 
ATOM   5878 C CD  . GLN B 1 227 ? -8.334  56.249 346.625 1.00 67.50  ? 228 GLN B CD  1 
ATOM   5879 O OE1 . GLN B 1 227 ? -8.936  55.336 347.193 1.00 60.39  ? 228 GLN B OE1 1 
ATOM   5880 N NE2 . GLN B 1 227 ? -8.711  57.518 346.721 1.00 50.14  ? 228 GLN B NE2 1 
ATOM   5881 N N   . SER B 1 228 ? -4.125  58.694 343.018 1.00 55.80  ? 229 SER B N   1 
ATOM   5882 C CA  . SER B 1 228 ? -3.538  59.989 342.660 1.00 48.11  ? 229 SER B CA  1 
ATOM   5883 C C   . SER B 1 228 ? -2.247  60.253 343.430 1.00 52.72  ? 229 SER B C   1 
ATOM   5884 O O   . SER B 1 228 ? -2.032  61.347 343.961 1.00 45.50  ? 229 SER B O   1 
ATOM   5885 C CB  . SER B 1 228 ? -4.531  61.131 342.887 1.00 48.83  ? 229 SER B CB  1 
ATOM   5886 O OG  . SER B 1 228 ? -5.772  60.867 342.262 1.00 55.71  ? 229 SER B OG  1 
ATOM   5887 N N   . GLY B 1 229 ? -1.393  59.243 343.514 1.00 42.88  ? 230 GLY B N   1 
ATOM   5888 C CA  . GLY B 1 229 ? -0.105  59.420 344.152 1.00 41.38  ? 230 GLY B CA  1 
ATOM   5889 C C   . GLY B 1 229 ? 0.680   58.128 344.112 1.00 46.68  ? 230 GLY B C   1 
ATOM   5890 O O   . GLY B 1 229 ? 0.125   57.041 343.916 1.00 47.01  ? 230 GLY B O   1 
ATOM   5891 N N   . ALA B 1 230 ? 1.988   58.267 344.321 1.00 42.44  ? 231 ALA B N   1 
ATOM   5892 C CA  . ALA B 1 230 ? 2.914   57.149 344.214 1.00 42.88  ? 231 ALA B CA  1 
ATOM   5893 C C   . ALA B 1 230 ? 4.174   57.507 344.979 1.00 49.56  ? 231 ALA B C   1 
ATOM   5894 O O   . ALA B 1 230 ? 4.506   58.692 345.093 1.00 47.80  ? 231 ALA B O   1 
ATOM   5895 C CB  . ALA B 1 230 ? 3.244   56.837 342.745 1.00 46.46  ? 231 ALA B CB  1 
ATOM   5896 N N   . PRO B 1 231 ? 4.894   56.516 345.516 1.00 51.78  ? 232 PRO B N   1 
ATOM   5897 C CA  . PRO B 1 231 ? 6.120   56.822 346.269 1.00 46.06  ? 232 PRO B CA  1 
ATOM   5898 C C   . PRO B 1 231 ? 7.264   57.314 345.408 1.00 62.46  ? 232 PRO B C   1 
ATOM   5899 O O   . PRO B 1 231 ? 8.205   57.909 345.951 1.00 51.91  ? 232 PRO B O   1 
ATOM   5900 C CB  . PRO B 1 231 ? 6.471   55.479 346.918 1.00 45.57  ? 232 PRO B CB  1 
ATOM   5901 C CG  . PRO B 1 231 ? 5.910   54.466 345.968 1.00 47.35  ? 232 PRO B CG  1 
ATOM   5902 C CD  . PRO B 1 231 ? 4.616   55.068 345.483 1.00 50.35  ? 232 PRO B CD  1 
ATOM   5903 N N   . ASN B 1 232 ? 7.229   57.072 344.095 1.00 61.38  ? 233 ASN B N   1 
ATOM   5904 C CA  . ASN B 1 232 ? 8.309   57.449 343.195 1.00 48.84  ? 233 ASN B CA  1 
ATOM   5905 C C   . ASN B 1 232 ? 8.120   58.831 342.582 1.00 50.61  ? 233 ASN B C   1 
ATOM   5906 O O   . ASN B 1 232 ? 8.942   59.247 341.762 1.00 58.70  ? 233 ASN B O   1 
ATOM   5907 C CB  . ASN B 1 232 ? 8.462   56.407 342.087 1.00 53.73  ? 233 ASN B CB  1 
ATOM   5908 C CG  . ASN B 1 232 ? 7.134   55.944 341.540 1.00 57.63  ? 233 ASN B CG  1 
ATOM   5909 O OD1 . ASN B 1 232 ? 6.275   55.486 342.289 1.00 63.61  ? 233 ASN B OD1 1 
ATOM   5910 N ND2 . ASN B 1 232 ? 6.953   56.061 340.226 1.00 66.73  ? 233 ASN B ND2 1 
ATOM   5911 N N   . GLY B 1 233 ? 7.072   59.552 342.964 1.00 63.33  ? 234 GLY B N   1 
ATOM   5912 C CA  . GLY B 1 233 ? 6.898   60.917 342.525 1.00 81.46  ? 234 GLY B CA  1 
ATOM   5913 C C   . GLY B 1 233 ? 8.045   61.819 342.942 1.00 77.28  ? 234 GLY B C   1 
ATOM   5914 O O   . GLY B 1 233 ? 8.580   61.703 344.051 1.00 74.37  ? 234 GLY B O   1 
ATOM   5915 N N   . PRO B 1 234 ? 8.411   62.789 342.073 1.00 63.90  ? 235 PRO B N   1 
ATOM   5916 C CA  . PRO B 1 234 ? 9.573   63.649 342.356 1.00 57.72  ? 235 PRO B CA  1 
ATOM   5917 C C   . PRO B 1 234 ? 9.425   64.503 343.600 1.00 57.95  ? 235 PRO B C   1 
ATOM   5918 O O   . PRO B 1 234 ? 10.313  65.310 343.889 1.00 59.33  ? 235 PRO B O   1 
ATOM   5919 C CB  . PRO B 1 234 ? 9.679   64.545 341.113 1.00 45.08  ? 235 PRO B CB  1 
ATOM   5920 C CG  . PRO B 1 234 ? 8.384   64.443 340.419 1.00 57.05  ? 235 PRO B CG  1 
ATOM   5921 C CD  . PRO B 1 234 ? 7.562   63.330 341.000 1.00 46.43  ? 235 PRO B CD  1 
ATOM   5922 N N   . TRP B 1 235 ? 8.328   64.339 344.337 1.00 54.99  ? 236 TRP B N   1 
ATOM   5923 C CA  . TRP B 1 235 ? 8.026   65.125 345.522 1.00 53.57  ? 236 TRP B CA  1 
ATOM   5924 C C   . TRP B 1 235 ? 7.941   64.296 346.800 1.00 50.23  ? 236 TRP B C   1 
ATOM   5925 O O   . TRP B 1 235 ? 7.959   64.881 347.892 1.00 49.98  ? 236 TRP B O   1 
ATOM   5926 C CB  . TRP B 1 235 ? 6.692   65.861 345.326 1.00 43.30  ? 236 TRP B CB  1 
ATOM   5927 C CG  . TRP B 1 235 ? 5.663   64.911 344.857 1.00 42.83  ? 236 TRP B CG  1 
ATOM   5928 C CD1 . TRP B 1 235 ? 5.397   64.566 343.568 1.00 44.64  ? 236 TRP B CD1 1 
ATOM   5929 C CD2 . TRP B 1 235 ? 4.797   64.118 345.671 1.00 45.30  ? 236 TRP B CD2 1 
ATOM   5930 N NE1 . TRP B 1 235 ? 4.400   63.628 343.526 1.00 45.74  ? 236 TRP B NE1 1 
ATOM   5931 C CE2 . TRP B 1 235 ? 4.016   63.333 344.807 1.00 47.03  ? 236 TRP B CE2 1 
ATOM   5932 C CE3 . TRP B 1 235 ? 4.597   64.006 347.048 1.00 38.50  ? 236 TRP B CE3 1 
ATOM   5933 C CZ2 . TRP B 1 235 ? 3.051   62.450 345.272 1.00 38.43  ? 236 TRP B CZ2 1 
ATOM   5934 C CZ3 . TRP B 1 235 ? 3.647   63.128 347.506 1.00 39.17  ? 236 TRP B CZ3 1 
ATOM   5935 C CH2 . TRP B 1 235 ? 2.881   62.364 346.622 1.00 41.97  ? 236 TRP B CH2 1 
ATOM   5936 N N   . ALA B 1 236 ? 7.857   62.958 346.698 1.00 54.84  ? 237 ALA B N   1 
ATOM   5937 C CA  . ALA B 1 236 ? 7.494   62.126 347.828 1.00 54.89  ? 237 ALA B CA  1 
ATOM   5938 C C   . ALA B 1 236 ? 8.672   61.833 348.744 1.00 55.93  ? 237 ALA B C   1 
ATOM   5939 O O   . ALA B 1 236 ? 8.458   61.450 349.899 1.00 59.67  ? 237 ALA B O   1 
ATOM   5940 C CB  . ALA B 1 236 ? 6.868   60.824 347.324 1.00 52.27  ? 237 ALA B CB  1 
ATOM   5941 N N   . THR B 1 237 ? 9.903   62.016 348.270 1.00 49.78  ? 238 THR B N   1 
ATOM   5942 C CA  . THR B 1 237 ? 11.082  61.720 349.068 1.00 46.45  ? 238 THR B CA  1 
ATOM   5943 C C   . THR B 1 237 ? 12.140  62.791 348.847 1.00 57.30  ? 238 THR B C   1 
ATOM   5944 O O   . THR B 1 237 ? 12.086  63.562 347.883 1.00 61.01  ? 238 THR B O   1 
ATOM   5945 C CB  . THR B 1 237 ? 11.676  60.341 348.734 1.00 59.51  ? 238 THR B CB  1 
ATOM   5946 O OG1 . THR B 1 237 ? 12.000  60.284 347.340 1.00 64.30  ? 238 THR B OG1 1 
ATOM   5947 C CG2 . THR B 1 237 ? 10.701  59.222 349.067 1.00 52.01  ? 238 THR B CG2 1 
ATOM   5948 N N   . VAL B 1 238 ? 13.107  62.829 349.772 1.00 55.11  ? 239 VAL B N   1 
ATOM   5949 C CA  . VAL B 1 238 ? 14.320  63.625 349.645 1.00 47.03  ? 239 VAL B CA  1 
ATOM   5950 C C   . VAL B 1 238 ? 15.523  62.764 349.996 1.00 71.50  ? 239 VAL B C   1 
ATOM   5951 O O   . VAL B 1 238 ? 15.429  61.784 350.742 1.00 62.90  ? 239 VAL B O   1 
ATOM   5952 C CB  . VAL B 1 238 ? 14.332  64.873 350.547 1.00 60.93  ? 239 VAL B CB  1 
ATOM   5953 C CG1 . VAL B 1 238 ? 13.554  65.960 349.925 1.00 53.21  ? 239 VAL B CG1 1 
ATOM   5954 C CG2 . VAL B 1 238 ? 13.797  64.538 351.936 1.00 49.21  ? 239 VAL B CG2 1 
ATOM   5955 N N   . GLY B 1 239 ? 16.674  63.173 349.471 1.00 59.67  ? 240 GLY B N   1 
ATOM   5956 C CA  . GLY B 1 239 ? 17.921  62.574 349.882 1.00 65.07  ? 240 GLY B CA  1 
ATOM   5957 C C   . GLY B 1 239 ? 18.324  63.004 351.280 1.00 72.97  ? 240 GLY B C   1 
ATOM   5958 O O   . GLY B 1 239 ? 17.830  63.987 351.836 1.00 58.54  ? 240 GLY B O   1 
ATOM   5959 N N   . MET B 1 240 ? 19.247  62.246 351.862 1.00 58.80  ? 241 MET B N   1 
ATOM   5960 C CA  . MET B 1 240 ? 19.737  62.531 353.206 1.00 71.46  ? 241 MET B CA  1 
ATOM   5961 C C   . MET B 1 240 ? 20.329  63.934 353.290 1.00 62.97  ? 241 MET B C   1 
ATOM   5962 O O   . MET B 1 240 ? 20.054  64.678 354.231 1.00 58.61  ? 241 MET B O   1 
ATOM   5963 C CB  . MET B 1 240 ? 20.780  61.494 353.627 1.00 50.52  ? 241 MET B CB  1 
ATOM   5964 C CG  . MET B 1 240 ? 20.193  60.150 354.026 1.00 69.93  ? 241 MET B CG  1 
ATOM   5965 S SD  . MET B 1 240 ? 21.454  58.958 354.517 1.00 76.79  ? 241 MET B SD  1 
ATOM   5966 C CE  . MET B 1 240 ? 22.570  59.050 353.119 1.00 63.65  ? 241 MET B CE  1 
ATOM   5967 N N   . GLY B 1 241 ? 21.143  64.288 352.301 1.00 52.97  ? 242 GLY B N   1 
ATOM   5968 C CA  . GLY B 1 241 ? 21.772  65.595 352.262 1.00 49.87  ? 242 GLY B CA  1 
ATOM   5969 C C   . GLY B 1 241 ? 20.762  66.723 352.186 1.00 70.56  ? 242 GLY B C   1 
ATOM   5970 O O   . GLY B 1 241 ? 20.875  67.720 352.899 1.00 66.16  ? 242 GLY B O   1 
ATOM   5971 N N   . GLU B 1 242 ? 19.769  66.564 351.316 1.00 75.29  ? 243 GLU B N   1 
ATOM   5972 C CA  . GLU B 1 242 ? 18.732  67.574 351.145 1.00 61.20  ? 243 GLU B CA  1 
ATOM   5973 C C   . GLU B 1 242 ? 17.909  67.741 352.418 1.00 63.54  ? 243 GLU B C   1 
ATOM   5974 O O   . GLU B 1 242 ? 17.618  68.861 352.838 1.00 54.57  ? 243 GLU B O   1 
ATOM   5975 C CB  . GLU B 1 242 ? 17.818  67.209 349.973 1.00 61.76  ? 243 GLU B CB  1 
ATOM   5976 C CG  . GLU B 1 242 ? 16.823  68.296 349.600 1.00 53.53  ? 243 GLU B CG  1 
ATOM   5977 C CD  . GLU B 1 242 ? 17.442  69.680 349.608 1.00 59.34  ? 243 GLU B CD  1 
ATOM   5978 O OE1 . GLU B 1 242 ? 18.684  69.778 349.518 1.00 76.12  ? 243 GLU B OE1 1 
ATOM   5979 O OE2 . GLU B 1 242 ? 16.687  70.670 349.705 1.00 68.05  ? 243 GLU B OE2 1 
ATOM   5980 N N   . ALA B 1 243 ? 17.536  66.620 353.027 1.00 49.67  ? 244 ALA B N   1 
ATOM   5981 C CA  . ALA B 1 243 ? 16.747  66.640 354.253 1.00 62.81  ? 244 ALA B CA  1 
ATOM   5982 C C   . ALA B 1 243 ? 17.501  67.334 355.383 1.00 63.72  ? 244 ALA B C   1 
ATOM   5983 O O   . ALA B 1 243 ? 16.917  68.094 356.156 1.00 64.93  ? 244 ALA B O   1 
ATOM   5984 C CB  . ALA B 1 243 ? 16.362  65.226 354.659 1.00 55.42  ? 244 ALA B CB  1 
ATOM   5985 N N   . ARG B 1 244 ? 18.799  67.067 355.473 1.00 64.26  ? 245 ARG B N   1 
ATOM   5986 C CA  . ARG B 1 244 ? 19.635  67.665 356.507 1.00 60.41  ? 245 ARG B CA  1 
ATOM   5987 C C   . ARG B 1 244 ? 19.748  69.174 356.320 1.00 58.62  ? 245 ARG B C   1 
ATOM   5988 O O   . ARG B 1 244 ? 19.725  69.933 357.289 1.00 68.34  ? 245 ARG B O   1 
ATOM   5989 C CB  . ARG B 1 244 ? 21.026  67.029 356.507 1.00 66.12  ? 245 ARG B CB  1 
ATOM   5990 C CG  . ARG B 1 244 ? 22.054  67.783 357.335 1.00 58.85  ? 245 ARG B CG  1 
ATOM   5991 C CD  . ARG B 1 244 ? 23.247  66.902 357.669 1.00 62.51  ? 245 ARG B CD  1 
ATOM   5992 N NE  . ARG B 1 244 ? 22.874  65.778 358.524 1.00 58.62  ? 245 ARG B NE  1 
ATOM   5993 C CZ  . ARG B 1 244 ? 22.809  65.837 359.850 1.00 48.62  ? 245 ARG B CZ  1 
ATOM   5994 N NH1 . ARG B 1 244 ? 23.092  66.970 360.480 1.00 43.09  ? 245 ARG B NH1 1 
ATOM   5995 N NH2 . ARG B 1 244 ? 22.461  64.765 360.547 1.00 42.62  ? 245 ARG B NH2 1 
ATOM   5996 N N   . ARG B 1 245 ? 19.872  69.602 355.068 1.00 63.21  ? 246 ARG B N   1 
ATOM   5997 C CA  . ARG B 1 245 ? 19.989  71.021 354.752 1.00 64.88  ? 246 ARG B CA  1 
ATOM   5998 C C   . ARG B 1 245 ? 18.689  71.761 355.048 1.00 72.12  ? 246 ARG B C   1 
ATOM   5999 O O   . ARG B 1 245 ? 18.691  72.970 355.279 1.00 61.91  ? 246 ARG B O   1 
ATOM   6000 C CB  . ARG B 1 245 ? 20.380  71.212 353.285 1.00 55.16  ? 246 ARG B CB  1 
ATOM   6001 C CG  . ARG B 1 245 ? 20.445  72.665 352.844 1.00 49.52  ? 246 ARG B CG  1 
ATOM   6002 C CD  . ARG B 1 245 ? 20.298  72.792 351.337 1.00 66.51  ? 246 ARG B CD  1 
ATOM   6003 N NE  . ARG B 1 245 ? 18.907  72.664 350.911 1.00 71.13  ? 246 ARG B NE  1 
ATOM   6004 C CZ  . ARG B 1 245 ? 17.978  73.595 351.105 1.00 75.45  ? 246 ARG B CZ  1 
ATOM   6005 N NH1 . ARG B 1 245 ? 18.289  74.727 351.721 1.00 70.11  ? 246 ARG B NH1 1 
ATOM   6006 N NH2 . ARG B 1 245 ? 16.737  73.394 350.684 1.00 66.34  ? 246 ARG B NH2 1 
ATOM   6007 N N   . ARG B 1 246 ? 17.581  71.027 355.040 1.00 73.18  ? 247 ARG B N   1 
ATOM   6008 C CA  . ARG B 1 246 ? 16.273  71.612 355.308 1.00 69.16  ? 247 ARG B CA  1 
ATOM   6009 C C   . ARG B 1 246 ? 15.947  71.576 356.797 1.00 66.16  ? 247 ARG B C   1 
ATOM   6010 O O   . ARG B 1 246 ? 15.116  72.346 357.280 1.00 57.22  ? 247 ARG B O   1 
ATOM   6011 C CB  . ARG B 1 246 ? 15.187  70.883 354.514 1.00 57.23  ? 247 ARG B CB  1 
ATOM   6012 C CG  . ARG B 1 246 ? 15.206  71.174 353.023 1.00 74.41  ? 247 ARG B CG  1 
ATOM   6013 C CD  . ARG B 1 246 ? 13.970  70.618 352.335 1.00 56.44  ? 247 ARG B CD  1 
ATOM   6014 N NE  . ARG B 1 246 ? 14.161  70.479 350.895 1.00 61.54  ? 247 ARG B NE  1 
ATOM   6015 C CZ  . ARG B 1 246 ? 13.337  69.813 350.092 1.00 62.55  ? 247 ARG B CZ  1 
ATOM   6016 N NH1 . ARG B 1 246 ? 12.259  69.222 350.589 1.00 49.52  ? 247 ARG B NH1 1 
ATOM   6017 N NH2 . ARG B 1 246 ? 13.589  69.739 348.793 1.00 59.24  ? 247 ARG B NH2 1 
ATOM   6018 N N   . ALA B 1 247 ? 16.607  70.677 357.520 1.00 56.71  ? 248 ALA B N   1 
ATOM   6019 C CA  . ALA B 1 247 ? 16.390  70.539 358.955 1.00 62.41  ? 248 ALA B CA  1 
ATOM   6020 C C   . ALA B 1 247 ? 17.114  71.633 359.732 1.00 66.20  ? 248 ALA B C   1 
ATOM   6021 O O   . ALA B 1 247 ? 16.585  72.173 360.703 1.00 63.55  ? 248 ALA B O   1 
ATOM   6022 C CB  . ALA B 1 247 ? 16.837  69.164 359.429 1.00 46.45  ? 248 ALA B CB  1 
ATOM   6023 N N   . THR B 1 248 ? 18.328  71.956 359.297 1.00 67.23  ? 249 THR B N   1 
ATOM   6024 C CA  . THR B 1 248 ? 19.128  72.987 359.951 1.00 67.79  ? 249 THR B CA  1 
ATOM   6025 C C   . THR B 1 248 ? 18.735  74.382 359.485 1.00 60.49  ? 249 THR B C   1 
ATOM   6026 O O   . THR B 1 248 ? 18.779  75.331 360.276 1.00 82.90  ? 249 THR B O   1 
ATOM   6027 C CB  . THR B 1 248 ? 20.620  72.741 359.719 1.00 54.63  ? 249 THR B CB  1 
ATOM   6028 O OG1 . THR B 1 248 ? 20.967  73.090 358.379 1.00 75.33  ? 249 THR B OG1 1 
ATOM   6029 C CG2 . THR B 1 248 ? 20.947  71.286 359.953 1.00 57.99  ? 249 THR B CG2 1 
ATOM   6030 N N   . GLN B 1 249 ? 18.342  74.530 358.221 1.00 65.13  ? 250 GLN B N   1 
ATOM   6031 C CA  . GLN B 1 249 ? 17.814  75.814 357.773 1.00 71.11  ? 250 GLN B CA  1 
ATOM   6032 C C   . GLN B 1 249 ? 16.563  76.193 358.561 1.00 77.65  ? 250 GLN B C   1 
ATOM   6033 O O   . GLN B 1 249 ? 16.384  77.358 358.937 1.00 59.48  ? 250 GLN B O   1 
ATOM   6034 C CB  . GLN B 1 249 ? 17.524  75.763 356.275 1.00 59.11  ? 250 GLN B CB  1 
ATOM   6035 C CG  . GLN B 1 249 ? 16.542  76.809 355.785 1.00 77.68  ? 250 GLN B CG  1 
ATOM   6036 C CD  . GLN B 1 249 ? 17.188  78.154 355.527 1.00 86.62  ? 250 GLN B CD  1 
ATOM   6037 O OE1 . GLN B 1 249 ? 18.129  78.551 356.215 1.00 89.01  ? 250 GLN B OE1 1 
ATOM   6038 N NE2 . GLN B 1 249 ? 16.679  78.867 354.528 1.00 93.63  ? 250 GLN B NE2 1 
ATOM   6039 N N   . LEU B 1 250 ? 15.689  75.217 358.829 1.00 60.89  ? 251 LEU B N   1 
ATOM   6040 C CA  . LEU B 1 250 ? 14.538  75.481 359.683 1.00 57.58  ? 251 LEU B CA  1 
ATOM   6041 C C   . LEU B 1 250 ? 14.985  75.901 361.073 1.00 74.51  ? 251 LEU B C   1 
ATOM   6042 O O   . LEU B 1 250 ? 14.433  76.843 361.655 1.00 65.03  ? 251 LEU B O   1 
ATOM   6043 C CB  . LEU B 1 250 ? 13.642  74.246 359.768 1.00 59.40  ? 251 LEU B CB  1 
ATOM   6044 C CG  . LEU B 1 250 ? 12.459  74.392 360.726 1.00 58.01  ? 251 LEU B CG  1 
ATOM   6045 C CD1 . LEU B 1 250 ? 11.553  75.528 360.276 1.00 57.58  ? 251 LEU B CD1 1 
ATOM   6046 C CD2 . LEU B 1 250 ? 11.685  73.092 360.844 1.00 55.88  ? 251 LEU B CD2 1 
ATOM   6047 N N   . ALA B 1 251 ? 15.994  75.217 361.615 1.00 66.49  ? 252 ALA B N   1 
ATOM   6048 C CA  . ALA B 1 251 ? 16.506  75.565 362.935 1.00 77.74  ? 252 ALA B CA  1 
ATOM   6049 C C   . ALA B 1 251 ? 17.062  76.983 362.957 1.00 68.19  ? 252 ALA B C   1 
ATOM   6050 O O   . ALA B 1 251 ? 16.883  77.711 363.939 1.00 80.76  ? 252 ALA B O   1 
ATOM   6051 C CB  . ALA B 1 251 ? 17.572  74.555 363.358 1.00 75.69  ? 252 ALA B CB  1 
ATOM   6052 N N   . HIS B 1 252 ? 17.715  77.405 361.873 1.00 70.76  ? 253 HIS B N   1 
ATOM   6053 C CA  . HIS B 1 252 ? 18.346  78.722 361.858 1.00 75.26  ? 253 HIS B CA  1 
ATOM   6054 C C   . HIS B 1 252 ? 17.312  79.843 361.829 1.00 80.02  ? 253 HIS B C   1 
ATOM   6055 O O   . HIS B 1 252 ? 17.425  80.817 362.584 1.00 90.34  ? 253 HIS B O   1 
ATOM   6056 C CB  . HIS B 1 252 ? 19.305  78.832 360.672 1.00 76.72  ? 253 HIS B CB  1 
ATOM   6057 C CG  . HIS B 1 252 ? 19.854  80.211 360.469 1.00 93.52  ? 253 HIS B CG  1 
ATOM   6058 N ND1 . HIS B 1 252 ? 19.198  81.173 359.730 1.00 98.48  ? 253 HIS B ND1 1 
ATOM   6059 C CD2 . HIS B 1 252 ? 20.992  80.793 360.917 1.00 87.64  ? 253 HIS B CD2 1 
ATOM   6060 C CE1 . HIS B 1 252 ? 19.908  82.287 359.728 1.00 95.90  ? 253 HIS B CE1 1 
ATOM   6061 N NE2 . HIS B 1 252 ? 21.002  82.083 360.441 1.00 108.55 ? 253 HIS B NE2 1 
ATOM   6062 N N   . LEU B 1 253 ? 16.302  79.740 360.954 1.00 83.31  ? 254 LEU B N   1 
ATOM   6063 C CA  . LEU B 1 253 ? 15.230  80.733 360.945 1.00 88.89  ? 254 LEU B CA  1 
ATOM   6064 C C   . LEU B 1 253 ? 14.442  80.722 362.240 1.00 82.03  ? 254 LEU B C   1 
ATOM   6065 O O   . LEU B 1 253 ? 13.773  81.712 362.557 1.00 85.15  ? 254 LEU B O   1 
ATOM   6066 C CB  . LEU B 1 253 ? 14.264  80.511 359.786 1.00 77.01  ? 254 LEU B CB  1 
ATOM   6067 C CG  . LEU B 1 253 ? 14.864  80.606 358.386 1.00 72.33  ? 254 LEU B CG  1 
ATOM   6068 C CD1 . LEU B 1 253 ? 14.367  79.485 357.500 1.00 79.75  ? 254 LEU B CD1 1 
ATOM   6069 C CD2 . LEU B 1 253 ? 14.583  81.966 357.761 1.00 69.85  ? 254 LEU B CD2 1 
ATOM   6070 N N   . VAL B 1 254 ? 14.539  79.633 362.996 1.00 80.26  ? 255 VAL B N   1 
ATOM   6071 C CA  . VAL B 1 254 ? 13.853  79.519 364.271 1.00 78.14  ? 255 VAL B CA  1 
ATOM   6072 C C   . VAL B 1 254 ? 14.724  80.046 365.415 1.00 92.33  ? 255 VAL B C   1 
ATOM   6073 O O   . VAL B 1 254 ? 14.194  80.589 366.391 1.00 85.70  ? 255 VAL B O   1 
ATOM   6074 C CB  . VAL B 1 254 ? 13.420  78.052 364.478 1.00 67.58  ? 255 VAL B CB  1 
ATOM   6075 C CG1 . VAL B 1 254 ? 13.286  77.715 365.916 1.00 82.09  ? 255 VAL B CG1 1 
ATOM   6076 C CG2 . VAL B 1 254 ? 12.095  77.785 363.785 1.00 90.08  ? 255 VAL B CG2 1 
ATOM   6077 N N   . GLY B 1 255 ? 16.048  79.954 365.290 1.00 90.39  ? 256 GLY B N   1 
ATOM   6078 C CA  . GLY B 1 255 ? 16.968  80.516 366.262 1.00 66.82  ? 256 GLY B CA  1 
ATOM   6079 C C   . GLY B 1 255 ? 17.915  79.489 366.852 1.00 79.13  ? 256 GLY B C   1 
ATOM   6080 O O   . GLY B 1 255 ? 18.565  79.734 367.875 1.00 101.69 ? 256 GLY B O   1 
ATOM   6081 N N   . CYS B 1 256 ? 17.978  78.316 366.221 1.00 75.97  ? 257 CYS B N   1 
ATOM   6082 C CA  . CYS B 1 256 ? 18.772  77.189 366.691 1.00 77.95  ? 257 CYS B CA  1 
ATOM   6083 C C   . CYS B 1 256 ? 19.940  76.932 365.751 1.00 98.37  ? 257 CYS B C   1 
ATOM   6084 O O   . CYS B 1 256 ? 19.726  76.743 364.546 1.00 115.84 ? 257 CYS B O   1 
ATOM   6085 C CB  . CYS B 1 256 ? 17.916  75.923 366.789 1.00 72.62  ? 257 CYS B CB  1 
ATOM   6086 S SG  . CYS B 1 256 ? 16.513  76.013 367.917 1.00 86.79  ? 257 CYS B SG  1 
ATOM   6087 N N   . PRO B 1 257 ? 21.182  76.902 366.253 1.00 118.35 ? 258 PRO B N   1 
ATOM   6088 C CA  . PRO B 1 257 ? 21.517  77.169 367.653 1.00 116.56 ? 258 PRO B CA  1 
ATOM   6089 C C   . PRO B 1 257 ? 21.718  78.664 367.890 1.00 125.05 ? 258 PRO B C   1 
ATOM   6090 O O   . PRO B 1 257 ? 21.951  79.394 366.925 1.00 115.43 ? 258 PRO B O   1 
ATOM   6091 C CB  . PRO B 1 257 ? 22.827  76.390 367.861 1.00 110.74 ? 258 PRO B CB  1 
ATOM   6092 C CG  . PRO B 1 257 ? 23.250  75.889 366.479 1.00 112.08 ? 258 PRO B CG  1 
ATOM   6093 C CD  . PRO B 1 257 ? 22.378  76.561 365.468 1.00 113.08 ? 258 PRO B CD  1 
ATOM   6094 N N   . PRO B 1 258 ? 21.616  79.117 369.151 1.00 130.95 ? 259 PRO B N   1 
ATOM   6095 C CA  . PRO B 1 258 ? 21.839  80.534 369.464 1.00 129.94 ? 259 PRO B CA  1 
ATOM   6096 C C   . PRO B 1 258 ? 23.293  80.955 369.263 1.00 138.61 ? 259 PRO B C   1 
ATOM   6097 O O   . PRO B 1 258 ? 23.679  81.275 368.137 1.00 124.86 ? 259 PRO B O   1 
ATOM   6098 C CB  . PRO B 1 258 ? 21.440  80.637 370.942 1.00 128.02 ? 259 PRO B CB  1 
ATOM   6099 C CG  . PRO B 1 258 ? 21.558  79.249 371.472 1.00 118.46 ? 259 PRO B CG  1 
ATOM   6100 C CD  . PRO B 1 258 ? 21.193  78.348 370.334 1.00 119.85 ? 259 PRO B CD  1 
ATOM   6101 N N   . GLY B 1 263 ? 26.339  72.098 364.618 1.00 82.06  ? 264 GLY B N   1 
ATOM   6102 C CA  . GLY B 1 263 ? 27.149  71.662 365.730 1.00 98.69  ? 264 GLY B CA  1 
ATOM   6103 C C   . GLY B 1 263 ? 26.730  70.278 366.141 1.00 114.54 ? 264 GLY B C   1 
ATOM   6104 O O   . GLY B 1 263 ? 26.782  69.376 365.340 1.00 109.93 ? 264 GLY B O   1 
ATOM   6105 N N   . ASN B 1 264 ? 26.325  70.103 367.389 1.00 108.98 ? 265 ASN B N   1 
ATOM   6106 C CA  . ASN B 1 264 ? 25.888  68.800 367.855 1.00 115.43 ? 265 ASN B CA  1 
ATOM   6107 C C   . ASN B 1 264 ? 24.480  68.644 367.406 1.00 95.43  ? 265 ASN B C   1 
ATOM   6108 O O   . ASN B 1 264 ? 23.700  69.545 367.535 1.00 86.18  ? 265 ASN B O   1 
ATOM   6109 C CB  . ASN B 1 264 ? 25.941  68.702 369.383 1.00 115.93 ? 265 ASN B CB  1 
ATOM   6110 C CG  . ASN B 1 264 ? 25.921  67.273 369.880 1.00 125.07 ? 265 ASN B CG  1 
ATOM   6111 O OD1 . ASN B 1 264 ? 25.432  66.383 369.199 1.00 124.93 ? 265 ASN B OD1 1 
ATOM   6112 N ND2 . ASN B 1 264 ? 26.472  67.042 371.069 1.00 142.82 ? 265 ASN B ND2 1 
ATOM   6113 N N   . ASP B 1 265 ? 24.160  67.505 366.854 1.00 70.26  ? 266 ASP B N   1 
ATOM   6114 C CA  . ASP B 1 265 ? 22.804  67.258 366.418 1.00 74.37  ? 266 ASP B CA  1 
ATOM   6115 C C   . ASP B 1 265 ? 21.874  67.260 367.610 1.00 80.85  ? 266 ASP B C   1 
ATOM   6116 O O   . ASP B 1 265 ? 20.762  67.772 367.509 1.00 71.85  ? 266 ASP B O   1 
ATOM   6117 C CB  . ASP B 1 265 ? 22.657  65.948 365.622 1.00 67.76  ? 266 ASP B CB  1 
ATOM   6118 C CG  . ASP B 1 265 ? 22.697  66.171 364.106 1.00 85.50  ? 266 ASP B CG  1 
ATOM   6119 O OD1 . ASP B 1 265 ? 22.752  67.344 363.681 1.00 68.64  ? 266 ASP B OD1 1 
ATOM   6120 O OD2 . ASP B 1 265 ? 22.708  65.171 363.344 1.00 65.19  ? 266 ASP B OD2 1 
ATOM   6121 N N   . THR B 1 266 ? 22.313  66.748 368.762 1.00 85.80  ? 267 THR B N   1 
ATOM   6122 C CA  . THR B 1 266 ? 21.426  66.724 369.924 1.00 85.10  ? 267 THR B CA  1 
ATOM   6123 C C   . THR B 1 266 ? 21.153  68.130 370.456 1.00 60.70  ? 267 THR B C   1 
ATOM   6124 O O   . THR B 1 266 ? 20.039  68.434 370.897 1.00 79.12  ? 267 THR B O   1 
ATOM   6125 C CB  . THR B 1 266 ? 22.026  65.872 371.024 1.00 82.78  ? 267 THR B CB  1 
ATOM   6126 O OG1 . THR B 1 266 ? 23.370  66.304 371.242 1.00 104.28 ? 267 THR B OG1 1 
ATOM   6127 C CG2 . THR B 1 266 ? 22.020  64.426 370.613 1.00 83.42  ? 267 THR B CG2 1 
ATOM   6128 N N   . GLU B 1 267 ? 22.171  68.989 370.478 1.00 66.24  ? 268 GLU B N   1 
ATOM   6129 C CA  . GLU B 1 267 ? 21.913  70.357 370.910 1.00 75.10  ? 268 GLU B CA  1 
ATOM   6130 C C   . GLU B 1 267 ? 21.027  71.088 369.913 1.00 75.38  ? 268 GLU B C   1 
ATOM   6131 O O   . GLU B 1 267 ? 20.218  71.930 370.313 1.00 75.99  ? 268 GLU B O   1 
ATOM   6132 C CB  . GLU B 1 267 ? 23.219  71.129 371.126 1.00 85.35  ? 268 GLU B CB  1 
ATOM   6133 C CG  . GLU B 1 267 ? 23.042  72.365 372.030 1.00 116.84 ? 268 GLU B CG  1 
ATOM   6134 C CD  . GLU B 1 267 ? 24.262  73.272 372.058 1.00 134.19 ? 268 GLU B CD  1 
ATOM   6135 O OE1 . GLU B 1 267 ? 25.027  73.265 371.071 1.00 133.23 ? 268 GLU B OE1 1 
ATOM   6136 O OE2 . GLU B 1 267 ? 24.455  73.990 373.065 1.00 132.09 ? 268 GLU B OE2 1 
ATOM   6137 N N   . LEU B 1 268 ? 21.156  70.768 368.620 1.00 82.08  ? 269 LEU B N   1 
ATOM   6138 C CA  . LEU B 1 268 ? 20.345  71.423 367.597 1.00 65.44  ? 269 LEU B CA  1 
ATOM   6139 C C   . LEU B 1 268 ? 18.864  71.128 367.800 1.00 76.02  ? 269 LEU B C   1 
ATOM   6140 O O   . LEU B 1 268 ? 18.033  72.044 367.839 1.00 76.89  ? 269 LEU B O   1 
ATOM   6141 C CB  . LEU B 1 268 ? 20.802  70.975 366.206 1.00 76.06  ? 269 LEU B CB  1 
ATOM   6142 C CG  . LEU B 1 268 ? 20.320  71.710 364.945 1.00 77.31  ? 269 LEU B CG  1 
ATOM   6143 C CD1 . LEU B 1 268 ? 18.923  71.277 364.521 1.00 73.16  ? 269 LEU B CD1 1 
ATOM   6144 C CD2 . LEU B 1 268 ? 20.377  73.215 365.146 1.00 70.02  ? 269 LEU B CD2 1 
ATOM   6145 N N   . VAL B 1 269 ? 18.511  69.848 367.931 1.00 48.53  ? 270 VAL B N   1 
ATOM   6146 C CA  . VAL B 1 269 ? 17.098  69.505 368.015 1.00 67.44  ? 270 VAL B CA  1 
ATOM   6147 C C   . VAL B 1 269 ? 16.548  69.830 369.392 1.00 70.04  ? 270 VAL B C   1 
ATOM   6148 O O   . VAL B 1 269 ? 15.377  70.207 369.525 1.00 78.39  ? 270 VAL B O   1 
ATOM   6149 C CB  . VAL B 1 269 ? 16.883  68.027 367.652 1.00 67.54  ? 270 VAL B CB  1 
ATOM   6150 C CG1 . VAL B 1 269 ? 17.096  67.807 366.167 1.00 76.99  ? 270 VAL B CG1 1 
ATOM   6151 C CG2 . VAL B 1 269 ? 17.817  67.164 368.444 1.00 76.53  ? 270 VAL B CG2 1 
ATOM   6152 N N   . ALA B 1 270 ? 17.369  69.694 370.436 1.00 76.85  ? 271 ALA B N   1 
ATOM   6153 C CA  . ALA B 1 270 ? 16.928  70.077 371.772 1.00 67.25  ? 271 ALA B CA  1 
ATOM   6154 C C   . ALA B 1 270 ? 16.494  71.535 371.803 1.00 60.67  ? 271 ALA B C   1 
ATOM   6155 O O   . ALA B 1 270 ? 15.519  71.888 372.476 1.00 74.28  ? 271 ALA B O   1 
ATOM   6156 C CB  . ALA B 1 270 ? 18.039  69.822 372.790 1.00 57.82  ? 271 ALA B CB  1 
ATOM   6157 N N   . CYS B 1 271 ? 17.196  72.397 371.068 1.00 63.00  ? 272 CYS B N   1 
ATOM   6158 C CA  . CYS B 1 271 ? 16.744  73.775 370.942 1.00 57.00  ? 272 CYS B CA  1 
ATOM   6159 C C   . CYS B 1 271 ? 15.435  73.847 370.163 1.00 86.35  ? 272 CYS B C   1 
ATOM   6160 O O   . CYS B 1 271 ? 14.545  74.638 370.504 1.00 71.90  ? 272 CYS B O   1 
ATOM   6161 C CB  . CYS B 1 271 ? 17.832  74.618 370.277 1.00 54.45  ? 272 CYS B CB  1 
ATOM   6162 S SG  . CYS B 1 271 ? 17.316  76.273 369.779 1.00 97.09  ? 272 CYS B SG  1 
ATOM   6163 N N   . LEU B 1 272 ? 15.296  73.017 369.119 1.00 66.30  ? 273 LEU B N   1 
ATOM   6164 C CA  . LEU B 1 272 ? 14.056  72.984 368.346 1.00 77.84  ? 273 LEU B CA  1 
ATOM   6165 C C   . LEU B 1 272 ? 12.868  72.559 369.201 1.00 70.15  ? 273 LEU B C   1 
ATOM   6166 O O   . LEU B 1 272 ? 11.746  73.025 368.978 1.00 74.89  ? 273 LEU B O   1 
ATOM   6167 C CB  . LEU B 1 272 ? 14.195  72.039 367.147 1.00 68.46  ? 273 LEU B CB  1 
ATOM   6168 C CG  . LEU B 1 272 ? 14.903  72.532 365.881 1.00 64.80  ? 273 LEU B CG  1 
ATOM   6169 C CD1 . LEU B 1 272 ? 15.103  71.375 364.921 1.00 72.32  ? 273 LEU B CD1 1 
ATOM   6170 C CD2 . LEU B 1 272 ? 14.145  73.668 365.198 1.00 68.59  ? 273 LEU B CD2 1 
ATOM   6171 N N   . ARG B 1 273 ? 13.094  71.678 370.178 1.00 66.32  ? 274 ARG B N   1 
ATOM   6172 C CA  . ARG B 1 273 ? 12.003  71.209 371.028 1.00 79.89  ? 274 ARG B CA  1 
ATOM   6173 C C   . ARG B 1 273 ? 11.468  72.306 371.940 1.00 63.65  ? 274 ARG B C   1 
ATOM   6174 O O   . ARG B 1 273 ? 10.293  72.270 372.321 1.00 73.31  ? 274 ARG B O   1 
ATOM   6175 C CB  . ARG B 1 273 ? 12.464  70.024 371.866 1.00 54.71  ? 274 ARG B CB  1 
ATOM   6176 C CG  . ARG B 1 273 ? 12.487  68.726 371.107 1.00 67.18  ? 274 ARG B CG  1 
ATOM   6177 C CD  . ARG B 1 273 ? 13.166  67.662 371.925 1.00 61.62  ? 274 ARG B CD  1 
ATOM   6178 N NE  . ARG B 1 273 ? 13.097  66.364 371.274 1.00 82.21  ? 274 ARG B NE  1 
ATOM   6179 C CZ  . ARG B 1 273 ? 14.127  65.536 371.160 1.00 86.05  ? 274 ARG B CZ  1 
ATOM   6180 N NH1 . ARG B 1 273 ? 15.314  65.875 371.654 1.00 74.45  ? 274 ARG B NH1 1 
ATOM   6181 N NH2 . ARG B 1 273 ? 13.975  64.371 370.543 1.00 64.16  ? 274 ARG B NH2 1 
ATOM   6182 N N   . THR B 1 274 ? 12.305  73.275 372.310 1.00 64.24  ? 275 THR B N   1 
ATOM   6183 C CA  . THR B 1 274 ? 11.851  74.392 373.132 1.00 75.19  ? 275 THR B CA  1 
ATOM   6184 C C   . THR B 1 274 ? 11.005  75.385 372.352 1.00 74.39  ? 275 THR B C   1 
ATOM   6185 O O   . THR B 1 274 ? 10.509  76.354 372.937 1.00 76.28  ? 275 THR B O   1 
ATOM   6186 C CB  . THR B 1 274 ? 13.049  75.119 373.751 1.00 76.35  ? 275 THR B CB  1 
ATOM   6187 O OG1 . THR B 1 274 ? 13.747  75.850 372.730 1.00 73.47  ? 275 THR B OG1 1 
ATOM   6188 C CG2 . THR B 1 274 ? 14.000  74.123 374.429 1.00 47.88  ? 275 THR B CG2 1 
ATOM   6189 N N   . ARG B 1 275 ? 10.829  75.174 371.057 1.00 74.82  ? 276 ARG B N   1 
ATOM   6190 C CA  . ARG B 1 275 ? 10.064  76.150 370.297 1.00 79.46  ? 276 ARG B CA  1 
ATOM   6191 C C   . ARG B 1 275 ? 8.602   75.731 370.211 1.00 63.37  ? 276 ARG B C   1 
ATOM   6192 O O   . ARG B 1 275 ? 8.307   74.548 370.021 1.00 70.50  ? 276 ARG B O   1 
ATOM   6193 C CB  . ARG B 1 275 ? 10.639  76.300 368.898 1.00 70.31  ? 276 ARG B CB  1 
ATOM   6194 C CG  . ARG B 1 275 ? 12.059  76.807 368.909 1.00 76.67  ? 276 ARG B CG  1 
ATOM   6195 C CD  . ARG B 1 275 ? 12.109  78.259 369.347 1.00 87.74  ? 276 ARG B CD  1 
ATOM   6196 N NE  . ARG B 1 275 ? 13.446  78.832 369.229 1.00 84.78  ? 276 ARG B NE  1 
ATOM   6197 C CZ  . ARG B 1 275 ? 14.383  78.753 370.170 1.00 87.58  ? 276 ARG B CZ  1 
ATOM   6198 N NH1 . ARG B 1 275 ? 14.145  78.104 371.305 1.00 92.32  ? 276 ARG B NH1 1 
ATOM   6199 N NH2 . ARG B 1 275 ? 15.569  79.311 369.965 1.00 77.63  ? 276 ARG B NH2 1 
ATOM   6200 N N   . PRO B 1 276 ? 7.678   76.676 370.366 1.00 72.67  ? 277 PRO B N   1 
ATOM   6201 C CA  . PRO B 1 276 ? 6.258   76.332 370.245 1.00 73.18  ? 277 PRO B CA  1 
ATOM   6202 C C   . PRO B 1 276 ? 5.936   75.809 368.853 1.00 79.95  ? 277 PRO B C   1 
ATOM   6203 O O   . PRO B 1 276 ? 6.570   76.175 367.859 1.00 60.87  ? 277 PRO B O   1 
ATOM   6204 C CB  . PRO B 1 276 ? 5.538   77.655 370.540 1.00 77.10  ? 277 PRO B CB  1 
ATOM   6205 C CG  . PRO B 1 276 ? 6.582   78.717 370.435 1.00 72.51  ? 277 PRO B CG  1 
ATOM   6206 C CD  . PRO B 1 276 ? 7.886   78.077 370.768 1.00 75.48  ? 277 PRO B CD  1 
ATOM   6207 N N   . ALA B 1 277 ? 4.934   74.931 368.800 1.00 75.75  ? 278 ALA B N   1 
ATOM   6208 C CA  . ALA B 1 277 ? 4.622   74.222 367.565 1.00 65.97  ? 278 ALA B CA  1 
ATOM   6209 C C   . ALA B 1 277 ? 4.278   75.182 366.430 1.00 67.43  ? 278 ALA B C   1 
ATOM   6210 O O   . ALA B 1 277 ? 4.756   75.007 365.303 1.00 71.14  ? 278 ALA B O   1 
ATOM   6211 C CB  . ALA B 1 277 ? 3.483   73.235 367.812 1.00 63.30  ? 278 ALA B CB  1 
ATOM   6212 N N   . GLN B 1 278 ? 3.453   76.202 366.706 1.00 61.25  ? 279 GLN B N   1 
ATOM   6213 C CA  . GLN B 1 278 ? 3.083   77.171 365.673 1.00 69.78  ? 279 GLN B CA  1 
ATOM   6214 C C   . GLN B 1 278 ? 4.315   77.773 365.010 1.00 76.42  ? 279 GLN B C   1 
ATOM   6215 O O   . GLN B 1 278 ? 4.324   78.034 363.800 1.00 72.24  ? 279 GLN B O   1 
ATOM   6216 C CB  . GLN B 1 278 ? 2.234   78.293 366.278 1.00 61.49  ? 279 GLN B CB  1 
ATOM   6217 C CG  . GLN B 1 278 ? 0.731   78.295 365.975 1.00 88.12  ? 279 GLN B CG  1 
ATOM   6218 C CD  . GLN B 1 278 ? 0.376   78.027 364.522 1.00 79.37  ? 279 GLN B CD  1 
ATOM   6219 O OE1 . GLN B 1 278 ? 0.826   78.726 363.615 1.00 90.21  ? 279 GLN B OE1 1 
ATOM   6220 N NE2 . GLN B 1 278 ? -0.488  77.040 364.303 1.00 84.40  ? 279 GLN B NE2 1 
ATOM   6221 N N   . VAL B 1 279 ? 5.366   77.996 365.797 1.00 66.09  ? 280 VAL B N   1 
ATOM   6222 C CA  . VAL B 1 279 ? 6.543   78.698 365.303 1.00 75.14  ? 280 VAL B CA  1 
ATOM   6223 C C   . VAL B 1 279 ? 7.266   77.865 364.250 1.00 72.55  ? 280 VAL B C   1 
ATOM   6224 O O   . VAL B 1 279 ? 7.743   78.396 363.239 1.00 70.61  ? 280 VAL B O   1 
ATOM   6225 C CB  . VAL B 1 279 ? 7.447   79.067 366.490 1.00 76.72  ? 280 VAL B CB  1 
ATOM   6226 C CG1 . VAL B 1 279 ? 8.791   79.509 366.015 1.00 57.47  ? 280 VAL B CG1 1 
ATOM   6227 C CG2 . VAL B 1 279 ? 6.791   80.180 367.296 1.00 68.24  ? 280 VAL B CG2 1 
ATOM   6228 N N   . LEU B 1 280 ? 7.342   76.550 364.458 1.00 63.20  ? 281 LEU B N   1 
ATOM   6229 C CA  . LEU B 1 280 ? 7.899   75.680 363.433 1.00 57.17  ? 281 LEU B CA  1 
ATOM   6230 C C   . LEU B 1 280 ? 7.037   75.696 362.176 1.00 70.53  ? 281 LEU B C   1 
ATOM   6231 O O   . LEU B 1 280 ? 7.559   75.769 361.056 1.00 65.96  ? 281 LEU B O   1 
ATOM   6232 C CB  . LEU B 1 280 ? 8.040   74.260 363.976 1.00 62.31  ? 281 LEU B CB  1 
ATOM   6233 C CG  . LEU B 1 280 ? 8.996   74.091 365.154 1.00 46.14  ? 281 LEU B CG  1 
ATOM   6234 C CD1 . LEU B 1 280 ? 9.216   72.619 365.448 1.00 61.94  ? 281 LEU B CD1 1 
ATOM   6235 C CD2 . LEU B 1 280 ? 10.318  74.774 364.871 1.00 57.06  ? 281 LEU B CD2 1 
ATOM   6236 N N   . VAL B 1 281 ? 5.713   75.651 362.345 1.00 53.51  ? 282 VAL B N   1 
ATOM   6237 C CA  . VAL B 1 281 ? 4.808   75.657 361.198 1.00 60.22  ? 282 VAL B CA  1 
ATOM   6238 C C   . VAL B 1 281 ? 4.977   76.934 360.382 1.00 60.06  ? 282 VAL B C   1 
ATOM   6239 O O   . VAL B 1 281 ? 4.971   76.902 359.145 1.00 82.35  ? 282 VAL B O   1 
ATOM   6240 C CB  . VAL B 1 281 ? 3.354   75.476 361.668 1.00 57.58  ? 282 VAL B CB  1 
ATOM   6241 C CG1 . VAL B 1 281 ? 2.387   75.765 360.535 1.00 64.01  ? 282 VAL B CG1 1 
ATOM   6242 C CG2 . VAL B 1 281 ? 3.147   74.080 362.204 1.00 55.93  ? 282 VAL B CG2 1 
ATOM   6243 N N   . ASN B 1 282 ? 5.142   78.075 361.056 1.00 70.74  ? 283 ASN B N   1 
ATOM   6244 C CA  . ASN B 1 282 ? 5.176   79.351 360.350 1.00 62.02  ? 283 ASN B CA  1 
ATOM   6245 C C   . ASN B 1 282 ? 6.442   79.530 359.522 1.00 72.24  ? 283 ASN B C   1 
ATOM   6246 O O   . ASN B 1 282 ? 6.438   80.320 358.572 1.00 86.78  ? 283 ASN B O   1 
ATOM   6247 C CB  . ASN B 1 282 ? 5.036   80.510 361.339 1.00 68.04  ? 283 ASN B CB  1 
ATOM   6248 C CG  . ASN B 1 282 ? 3.675   80.541 362.023 1.00 81.62  ? 283 ASN B CG  1 
ATOM   6249 O OD1 . ASN B 1 282 ? 2.689   80.010 361.509 1.00 83.85  ? 283 ASN B OD1 1 
ATOM   6250 N ND2 . ASN B 1 282 ? 3.621   81.161 363.196 1.00 87.15  ? 283 ASN B ND2 1 
ATOM   6251 N N   . HIS B 1 283 ? 7.521   78.825 359.855 1.00 61.85  ? 284 HIS B N   1 
ATOM   6252 C CA  . HIS B 1 283 ? 8.751   78.907 359.085 1.00 74.58  ? 284 HIS B CA  1 
ATOM   6253 C C   . HIS B 1 283 ? 9.001   77.674 358.235 1.00 76.63  ? 284 HIS B C   1 
ATOM   6254 O O   . HIS B 1 283 ? 9.947   77.669 357.438 1.00 71.91  ? 284 HIS B O   1 
ATOM   6255 C CB  . HIS B 1 283 ? 9.945   79.136 360.020 1.00 60.75  ? 284 HIS B CB  1 
ATOM   6256 C CG  . HIS B 1 283 ? 9.878   80.426 360.776 1.00 83.45  ? 284 HIS B CG  1 
ATOM   6257 N ND1 . HIS B 1 283 ? 9.531   80.491 362.109 1.00 70.46  ? 284 HIS B ND1 1 
ATOM   6258 C CD2 . HIS B 1 283 ? 10.113  81.701 360.386 1.00 81.10  ? 284 HIS B CD2 1 
ATOM   6259 C CE1 . HIS B 1 283 ? 9.555   81.751 362.506 1.00 83.10  ? 284 HIS B CE1 1 
ATOM   6260 N NE2 . HIS B 1 283 ? 9.907   82.505 361.480 1.00 81.13  ? 284 HIS B NE2 1 
ATOM   6261 N N   . GLU B 1 284 ? 8.197   76.637 358.446 1.00 70.71  ? 285 GLU B N   1 
ATOM   6262 C CA  . GLU B 1 284 ? 8.339   75.361 357.753 1.00 69.24  ? 285 GLU B CA  1 
ATOM   6263 C C   . GLU B 1 284 ? 8.898   75.401 356.324 1.00 87.53  ? 285 GLU B C   1 
ATOM   6264 O O   . GLU B 1 284 ? 9.877   74.711 356.029 1.00 65.89  ? 285 GLU B O   1 
ATOM   6265 C CB  . GLU B 1 284 ? 7.034   74.558 357.809 1.00 69.04  ? 285 GLU B CB  1 
ATOM   6266 C CG  . GLU B 1 284 ? 7.208   73.070 357.515 1.00 78.88  ? 285 GLU B CG  1 
ATOM   6267 C CD  . GLU B 1 284 ? 6.008   72.234 357.917 1.00 92.52  ? 285 GLU B CD  1 
ATOM   6268 O OE1 . GLU B 1 284 ? 6.028   71.653 359.021 1.00 85.89  ? 285 GLU B OE1 1 
ATOM   6269 O OE2 . GLU B 1 284 ? 5.051   72.141 357.120 1.00 80.37  ? 285 GLU B OE2 1 
ATOM   6270 N N   . TRP B 1 285 ? 8.289   76.223 355.480 1.00 82.03  ? 286 TRP B N   1 
ATOM   6271 C CA  A TRP B 1 285 ? 8.208   76.667 354.079 0.48 81.34  ? 286 TRP B CA  1 
ATOM   6272 C CA  B TRP B 1 285 ? 8.263   76.640 354.073 0.52 81.32  ? 286 TRP B CA  1 
ATOM   6273 C C   . TRP B 1 285 ? 9.401   77.455 353.327 1.00 76.88  ? 286 TRP B C   1 
ATOM   6274 O O   . TRP B 1 285 ? 9.957   77.433 352.182 1.00 81.17  ? 286 TRP B O   1 
ATOM   6275 C CB  A TRP B 1 285 ? 6.848   77.337 353.828 0.48 84.22  ? 286 TRP B CB  1 
ATOM   6276 C CB  B TRP B 1 285 ? 6.904   77.277 353.745 0.52 84.20  ? 286 TRP B CB  1 
ATOM   6277 C CG  A TRP B 1 285 ? 6.287   77.041 352.468 0.48 79.15  ? 286 TRP B CG  1 
ATOM   6278 C CG  B TRP B 1 285 ? 6.184   76.580 352.629 0.52 78.72  ? 286 TRP B CG  1 
ATOM   6279 C CD1 A TRP B 1 285 ? 6.840   76.242 351.510 0.48 83.69  ? 286 TRP B CD1 1 
ATOM   6280 C CD1 B TRP B 1 285 ? 5.768   77.129 351.451 0.52 88.00  ? 286 TRP B CD1 1 
ATOM   6281 C CD2 A TRP B 1 285 ? 5.063   77.543 351.914 0.48 90.69  ? 286 TRP B CD2 1 
ATOM   6282 C CD2 B TRP B 1 285 ? 5.804   75.197 352.582 0.52 78.35  ? 286 TRP B CD2 1 
ATOM   6283 N NE1 A TRP B 1 285 ? 6.037   76.214 350.395 0.48 85.35  ? 286 TRP B NE1 1 
ATOM   6284 N NE1 B TRP B 1 285 ? 5.150   76.178 350.675 0.52 83.94  ? 286 TRP B NE1 1 
ATOM   6285 C CE2 A TRP B 1 285 ? 4.940   77.005 350.617 0.48 86.64  ? 286 TRP B CE2 1 
ATOM   6286 C CE2 B TRP B 1 285 ? 5.159   74.983 351.347 0.52 80.02  ? 286 TRP B CE2 1 
ATOM   6287 C CE3 A TRP B 1 285 ? 4.061   78.394 352.389 0.48 91.96  ? 286 TRP B CE3 1 
ATOM   6288 C CE3 B TRP B 1 285 ? 5.946   74.123 353.464 0.52 78.81  ? 286 TRP B CE3 1 
ATOM   6289 C CZ2 A TRP B 1 285 ? 3.857   77.290 349.791 0.48 87.06  ? 286 TRP B CZ2 1 
ATOM   6290 C CZ2 B TRP B 1 285 ? 4.656   73.738 350.974 0.52 77.83  ? 286 TRP B CZ2 1 
ATOM   6291 C CZ3 A TRP B 1 285 ? 2.985   78.675 351.565 0.48 81.70  ? 286 TRP B CZ3 1 
ATOM   6292 C CZ3 B TRP B 1 285 ? 5.446   72.887 353.091 0.52 79.28  ? 286 TRP B CZ3 1 
ATOM   6293 C CH2 A TRP B 1 285 ? 2.892   78.125 350.281 0.48 80.88  ? 286 TRP B CH2 1 
ATOM   6294 C CH2 B TRP B 1 285 ? 4.809   72.706 351.858 0.52 78.89  ? 286 TRP B CH2 1 
ATOM   6295 N N   . HIS B 1 286 ? 9.644   78.487 354.166 1.00 84.62  ? 287 HIS B N   1 
ATOM   6296 C CA  . HIS B 1 286 ? 10.806  79.306 353.841 1.00 81.52  ? 287 HIS B CA  1 
ATOM   6297 C C   . HIS B 1 286 ? 12.074  78.461 353.772 1.00 80.19  ? 287 HIS B C   1 
ATOM   6298 O O   . HIS B 1 286 ? 13.184  78.992 353.756 1.00 92.05  ? 287 HIS B O   1 
ATOM   6299 C CB  . HIS B 1 286 ? 10.976  80.426 354.869 1.00 82.34  ? 287 HIS B CB  1 
ATOM   6300 C CG  . HIS B 1 286 ? 9.717   81.187 355.147 1.00 92.38  ? 287 HIS B CG  1 
ATOM   6301 N ND1 . HIS B 1 286 ? 8.947   81.743 354.149 1.00 110.56 ? 287 HIS B ND1 1 
ATOM   6302 C CD2 . HIS B 1 286 ? 9.093   81.483 356.312 1.00 100.51 ? 287 HIS B CD2 1 
ATOM   6303 C CE1 . HIS B 1 286 ? 7.904   82.349 354.686 1.00 105.96 ? 287 HIS B CE1 1 
ATOM   6304 N NE2 . HIS B 1 286 ? 7.968   82.206 355.997 1.00 114.25 ? 287 HIS B NE2 1 
ATOM   6305 N N   . VAL B 1 287 ? 11.900  77.144 353.732 1.00 60.91  ? 288 VAL B N   1 
ATOM   6306 C CA  . VAL B 1 287 ? 13.029  76.224 353.665 1.00 69.32  ? 288 VAL B CA  1 
ATOM   6307 C C   . VAL B 1 287 ? 13.261  75.750 352.230 1.00 83.12  ? 288 VAL B C   1 
ATOM   6308 O O   . VAL B 1 287 ? 14.402  75.499 351.826 1.00 74.73  ? 288 VAL B O   1 
ATOM   6309 C CB  . VAL B 1 287 ? 12.788  75.038 354.622 1.00 75.02  ? 288 VAL B CB  1 
ATOM   6310 C CG1 . VAL B 1 287 ? 13.555  73.826 354.186 1.00 65.77  ? 288 VAL B CG1 1 
ATOM   6311 C CG2 . VAL B 1 287 ? 13.156  75.415 356.060 1.00 64.14  ? 288 VAL B CG2 1 
ATOM   6312 N N   . LEU B 1 288 ? 12.188  75.640 351.451 1.00 79.40  ? 289 LEU B N   1 
ATOM   6313 C CA  . LEU B 1 288 ? 12.289  75.066 350.116 1.00 77.63  ? 289 LEU B CA  1 
ATOM   6314 C C   . LEU B 1 288 ? 13.272  75.862 349.261 1.00 89.81  ? 289 LEU B C   1 
ATOM   6315 O O   . LEU B 1 288 ? 13.270  77.100 349.301 1.00 84.06  ? 289 LEU B O   1 
ATOM   6316 C CB  . LEU B 1 288 ? 10.916  75.040 349.446 1.00 69.02  ? 289 LEU B CB  1 
ATOM   6317 C CG  . LEU B 1 288 ? 10.012  73.896 349.903 1.00 76.35  ? 289 LEU B CG  1 
ATOM   6318 C CD1 . LEU B 1 288 ? 8.623   74.028 349.295 1.00 65.36  ? 289 LEU B CD1 1 
ATOM   6319 C CD2 . LEU B 1 288 ? 10.647  72.561 349.554 1.00 59.80  ? 289 LEU B CD2 1 
ATOM   6320 N N   . PRO B 1 289 ? 14.122  75.188 348.474 1.00 109.63 ? 290 PRO B N   1 
ATOM   6321 C CA  . PRO B 1 289 ? 15.105  75.909 347.650 1.00 113.67 ? 290 PRO B CA  1 
ATOM   6322 C C   . PRO B 1 289 ? 14.483  76.769 346.565 1.00 106.73 ? 290 PRO B C   1 
ATOM   6323 O O   . PRO B 1 289 ? 15.223  77.518 345.911 1.00 113.37 ? 290 PRO B O   1 
ATOM   6324 C CB  . PRO B 1 289 ? 15.952  74.780 347.042 1.00 99.53  ? 290 PRO B CB  1 
ATOM   6325 C CG  . PRO B 1 289 ? 15.039  73.596 347.024 1.00 82.76  ? 290 PRO B CG  1 
ATOM   6326 C CD  . PRO B 1 289 ? 14.185  73.731 348.261 1.00 92.95  ? 290 PRO B CD  1 
ATOM   6327 N N   . GLN B 1 290 ? 13.176  76.680 346.356 1.00 111.73 ? 291 GLN B N   1 
ATOM   6328 C CA  . GLN B 1 290 ? 12.550  77.487 345.317 1.00 118.11 ? 291 GLN B CA  1 
ATOM   6329 C C   . GLN B 1 290 ? 11.035  77.544 345.444 1.00 116.02 ? 291 GLN B C   1 
ATOM   6330 O O   . GLN B 1 290 ? 10.377  76.523 345.640 1.00 114.41 ? 291 GLN B O   1 
ATOM   6331 C CB  . GLN B 1 290 ? 12.937  76.965 343.931 1.00 110.21 ? 291 GLN B CB  1 
ATOM   6332 C CG  . GLN B 1 290 ? 14.360  77.303 343.516 1.00 135.29 ? 291 GLN B CG  1 
ATOM   6333 C CD  . GLN B 1 290 ? 14.413  78.330 342.402 1.00 147.56 ? 291 GLN B CD  1 
ATOM   6334 O OE1 . GLN B 1 290 ? 14.183  79.519 342.627 1.00 147.61 ? 291 GLN B OE1 1 
ATOM   6335 N NE2 . GLN B 1 290 ? 14.718  77.876 341.192 1.00 134.84 ? 291 GLN B NE2 1 
ATOM   6336 N N   . GLU B 1 291 ? 10.490  78.749 345.326 1.00 123.70 ? 292 GLU B N   1 
ATOM   6337 C CA  . GLU B 1 291 ? 9.111   78.933 345.410 1.00 131.96 ? 292 GLU B CA  1 
ATOM   6338 C C   . GLU B 1 291 ? 8.674   78.062 344.283 1.00 127.42 ? 292 GLU B C   1 
ATOM   6339 O O   . GLU B 1 291 ? 9.058   78.256 343.149 1.00 119.54 ? 292 GLU B O   1 
ATOM   6340 C CB  . GLU B 1 291 ? 8.796   80.367 345.045 1.00 130.74 ? 292 GLU B CB  1 
ATOM   6341 C CG  . GLU B 1 291 ? 7.460   80.861 345.546 1.00 133.50 ? 292 GLU B CG  1 
ATOM   6342 C CD  . GLU B 1 291 ? 7.503   81.219 347.007 1.00 140.99 ? 292 GLU B CD  1 
ATOM   6343 O OE1 . GLU B 1 291 ? 7.662   80.297 347.838 1.00 140.60 ? 292 GLU B OE1 1 
ATOM   6344 O OE2 . GLU B 1 291 ? 7.378   82.421 347.316 1.00 137.08 ? 292 GLU B OE2 1 
ATOM   6345 N N   . SER B 1 292 ? 7.838   77.103 344.604 1.00 124.75 ? 293 SER B N   1 
ATOM   6346 C CA  . SER B 1 292 ? 7.273   76.258 343.556 1.00 76.81  ? 293 SER B CA  1 
ATOM   6347 C C   . SER B 1 292 ? 5.840   75.827 343.869 1.00 77.85  ? 293 SER B C   1 
ATOM   6348 O O   . SER B 1 292 ? 5.237   76.212 344.876 1.00 97.47  ? 293 SER B O   1 
ATOM   6349 C CB  . SER B 1 292 ? 8.143   75.017 343.344 1.00 80.08  ? 293 SER B CB  1 
ATOM   6350 O OG  . SER B 1 292 ? 8.242   74.249 344.531 1.00 85.64  ? 293 SER B OG  1 
ATOM   6351 N N   . VAL B 1 293 ? 5.303   75.014 342.964 1.00 64.49  ? 294 VAL B N   1 
ATOM   6352 C CA  . VAL B 1 293 ? 4.125   74.202 343.227 1.00 56.48  ? 294 VAL B CA  1 
ATOM   6353 C C   . VAL B 1 293 ? 4.574   72.752 343.294 1.00 67.44  ? 294 VAL B C   1 
ATOM   6354 O O   . VAL B 1 293 ? 5.567   72.352 342.672 1.00 75.45  ? 294 VAL B O   1 
ATOM   6355 C CB  . VAL B 1 293 ? 3.015   74.371 342.166 1.00 81.90  ? 294 VAL B CB  1 
ATOM   6356 C CG1 . VAL B 1 293 ? 2.457   75.771 342.210 1.00 73.74  ? 294 VAL B CG1 1 
ATOM   6357 C CG2 . VAL B 1 293 ? 3.539   74.031 340.774 1.00 61.10  ? 294 VAL B CG2 1 
ATOM   6358 N N   . PHE B 1 294 ? 3.858   71.971 344.048 1.00 64.21  ? 295 PHE B N   1 
ATOM   6359 C CA  . PHE B 1 294 ? 4.164   70.585 344.186 1.00 73.77  ? 295 PHE B CA  1 
ATOM   6360 C C   . PHE B 1 294 ? 5.493   70.231 344.817 1.00 66.97  ? 295 PHE B C   1 
ATOM   6361 O O   . PHE B 1 294 ? 6.090   69.252 344.484 1.00 65.32  ? 295 PHE B O   1 
ATOM   6362 C CB  . PHE B 1 294 ? 3.977   69.888 342.870 1.00 64.94  ? 295 PHE B CB  1 
ATOM   6363 C CG  . PHE B 1 294 ? 2.987   68.794 342.923 1.00 63.83  ? 295 PHE B CG  1 
ATOM   6364 C CD1 . PHE B 1 294 ? 1.829   68.869 342.211 1.00 56.42  ? 295 PHE B CD1 1 
ATOM   6365 C CD2 . PHE B 1 294 ? 3.213   67.700 343.695 1.00 64.98  ? 295 PHE B CD2 1 
ATOM   6366 C CE1 . PHE B 1 294 ? 0.918   67.861 342.251 1.00 58.46  ? 295 PHE B CE1 1 
ATOM   6367 C CE2 . PHE B 1 294 ? 2.308   66.688 343.743 1.00 66.45  ? 295 PHE B CE2 1 
ATOM   6368 C CZ  . PHE B 1 294 ? 1.160   66.774 343.023 1.00 60.76  ? 295 PHE B CZ  1 
ATOM   6369 N N   . ARG B 1 295 ? 5.971   71.072 345.695 1.00 56.59  ? 296 ARG B N   1 
ATOM   6370 C CA  . ARG B 1 295 ? 7.143   70.740 346.497 1.00 64.08  ? 296 ARG B CA  1 
ATOM   6371 C C   . ARG B 1 295 ? 6.868   71.114 347.948 1.00 58.30  ? 296 ARG B C   1 
ATOM   6372 O O   . ARG B 1 295 ? 6.260   72.150 348.231 1.00 67.71  ? 296 ARG B O   1 
ATOM   6373 C CB  . ARG B 1 295 ? 8.420   71.428 345.985 1.00 68.55  ? 296 ARG B CB  1 
ATOM   6374 C CG  . ARG B 1 295 ? 8.858   70.987 344.576 1.00 74.71  ? 296 ARG B CG  1 
ATOM   6375 C CD  . ARG B 1 295 ? 9.184   69.492 344.503 1.00 55.92  ? 296 ARG B CD  1 
ATOM   6376 N NE  . ARG B 1 295 ? 9.695   69.060 343.197 1.00 79.35  ? 296 ARG B NE  1 
ATOM   6377 C CZ  . ARG B 1 295 ? 8.945   68.554 342.219 1.00 73.31  ? 296 ARG B CZ  1 
ATOM   6378 N NH1 . ARG B 1 295 ? 7.636   68.406 342.381 1.00 58.99  ? 296 ARG B NH1 1 
ATOM   6379 N NH2 . ARG B 1 295 ? 9.505   68.192 341.071 1.00 66.83  ? 296 ARG B NH2 1 
ATOM   6380 N N   . PHE B 1 296 ? 7.324   70.252 348.853 1.00 60.01  ? 297 PHE B N   1 
ATOM   6381 C CA  . PHE B 1 296 ? 6.967   70.225 350.268 1.00 66.48  ? 297 PHE B CA  1 
ATOM   6382 C C   . PHE B 1 296 ? 8.228   70.029 351.098 1.00 58.23  ? 297 PHE B C   1 
ATOM   6383 O O   . PHE B 1 296 ? 9.027   69.130 350.818 1.00 57.02  ? 297 PHE B O   1 
ATOM   6384 C CB  . PHE B 1 296 ? 5.964   69.100 350.560 1.00 52.37  ? 297 PHE B CB  1 
ATOM   6385 C CG  . PHE B 1 296 ? 4.901   68.951 349.503 1.00 65.35  ? 297 PHE B CG  1 
ATOM   6386 C CD1 . PHE B 1 296 ? 3.970   69.947 349.302 1.00 56.73  ? 297 PHE B CD1 1 
ATOM   6387 C CD2 . PHE B 1 296 ? 4.842   67.819 348.701 1.00 54.62  ? 297 PHE B CD2 1 
ATOM   6388 C CE1 . PHE B 1 296 ? 3.002   69.816 348.330 1.00 65.23  ? 297 PHE B CE1 1 
ATOM   6389 C CE2 . PHE B 1 296 ? 3.881   67.689 347.714 1.00 60.55  ? 297 PHE B CE2 1 
ATOM   6390 C CZ  . PHE B 1 296 ? 2.955   68.687 347.534 1.00 52.92  ? 297 PHE B CZ  1 
ATOM   6391 N N   . SER B 1 297 ? 8.378   70.845 352.142 1.00 55.34  ? 298 SER B N   1 
ATOM   6392 C CA  . SER B 1 297 ? 9.661   70.957 352.835 1.00 62.64  ? 298 SER B CA  1 
ATOM   6393 C C   . SER B 1 297 ? 10.072  69.659 353.522 1.00 60.82  ? 298 SER B C   1 
ATOM   6394 O O   . SER B 1 297 ? 11.244  69.269 353.465 1.00 59.94  ? 298 SER B O   1 
ATOM   6395 C CB  . SER B 1 297 ? 9.602   72.096 353.846 1.00 62.30  ? 298 SER B CB  1 
ATOM   6396 O OG  . SER B 1 297 ? 9.327   73.316 353.184 1.00 71.15  ? 298 SER B OG  1 
ATOM   6397 N N   . PHE B 1 298 ? 9.147   68.987 354.194 1.00 48.98  ? 299 PHE B N   1 
ATOM   6398 C CA  . PHE B 1 298 ? 9.500   67.827 355.004 1.00 53.08  ? 299 PHE B CA  1 
ATOM   6399 C C   . PHE B 1 298 ? 8.668   66.638 354.552 1.00 54.65  ? 299 PHE B C   1 
ATOM   6400 O O   . PHE B 1 298 ? 7.451   66.600 354.760 1.00 59.05  ? 299 PHE B O   1 
ATOM   6401 C CB  . PHE B 1 298 ? 9.328   68.139 356.488 1.00 49.02  ? 299 PHE B CB  1 
ATOM   6402 C CG  . PHE B 1 298 ? 10.256  69.218 356.960 1.00 54.51  ? 299 PHE B CG  1 
ATOM   6403 C CD1 . PHE B 1 298 ? 9.812   70.521 357.104 1.00 53.71  ? 299 PHE B CD1 1 
ATOM   6404 C CD2 . PHE B 1 298 ? 11.596  68.937 357.198 1.00 57.52  ? 299 PHE B CD2 1 
ATOM   6405 C CE1 . PHE B 1 298 ? 10.676  71.522 357.513 1.00 54.11  ? 299 PHE B CE1 1 
ATOM   6406 C CE2 . PHE B 1 298 ? 12.464  69.928 357.604 1.00 50.68  ? 299 PHE B CE2 1 
ATOM   6407 C CZ  . PHE B 1 298 ? 12.004  71.225 357.763 1.00 55.93  ? 299 PHE B CZ  1 
ATOM   6408 N N   . VAL B 1 299 ? 9.338   65.686 353.916 1.00 53.38  ? 300 VAL B N   1 
ATOM   6409 C CA  . VAL B 1 299 ? 8.710   64.537 353.275 1.00 50.40  ? 300 VAL B CA  1 
ATOM   6410 C C   . VAL B 1 299 ? 9.553   63.338 353.692 1.00 57.41  ? 300 VAL B C   1 
ATOM   6411 O O   . VAL B 1 299 ? 10.599  63.533 354.333 1.00 43.83  ? 300 VAL B O   1 
ATOM   6412 C CB  . VAL B 1 299 ? 8.646   64.720 351.748 1.00 55.85  ? 300 VAL B CB  1 
ATOM   6413 C CG1 . VAL B 1 299 ? 7.686   65.854 351.375 1.00 40.27  ? 300 VAL B CG1 1 
ATOM   6414 C CG2 . VAL B 1 299 ? 10.031  65.002 351.193 1.00 48.20  ? 300 VAL B CG2 1 
ATOM   6415 N N   . PRO B 1 300 ? 9.141   62.102 353.408 1.00 44.06  ? 301 PRO B N   1 
ATOM   6416 C CA  . PRO B 1 300 ? 9.991   60.956 353.748 1.00 47.62  ? 301 PRO B CA  1 
ATOM   6417 C C   . PRO B 1 300 ? 11.390  61.094 353.164 1.00 58.75  ? 301 PRO B C   1 
ATOM   6418 O O   . PRO B 1 300 ? 11.585  61.640 352.076 1.00 60.47  ? 301 PRO B O   1 
ATOM   6419 C CB  . PRO B 1 300 ? 9.236   59.771 353.144 1.00 43.46  ? 301 PRO B CB  1 
ATOM   6420 C CG  . PRO B 1 300 ? 7.813   60.174 353.280 1.00 48.05  ? 301 PRO B CG  1 
ATOM   6421 C CD  . PRO B 1 300 ? 7.774   61.674 353.064 1.00 42.60  ? 301 PRO B CD  1 
ATOM   6422 N N   . VAL B 1 301 ? 12.372  60.601 353.908 1.00 50.58  ? 302 VAL B N   1 
ATOM   6423 C CA  . VAL B 1 301 ? 13.778  60.708 353.541 1.00 48.77  ? 302 VAL B CA  1 
ATOM   6424 C C   . VAL B 1 301 ? 14.289  59.327 353.155 1.00 51.66  ? 302 VAL B C   1 
ATOM   6425 O O   . VAL B 1 301 ? 13.985  58.331 353.825 1.00 56.04  ? 302 VAL B O   1 
ATOM   6426 C CB  . VAL B 1 301 ? 14.603  61.310 354.695 1.00 55.39  ? 302 VAL B CB  1 
ATOM   6427 C CG1 . VAL B 1 301 ? 14.381  60.513 355.982 1.00 54.71  ? 302 VAL B CG1 1 
ATOM   6428 C CG2 . VAL B 1 301 ? 16.075  61.360 354.330 1.00 57.20  ? 302 VAL B CG2 1 
ATOM   6429 N N   . VAL B 1 302 ? 15.044  59.261 352.060 1.00 59.56  ? 303 VAL B N   1 
ATOM   6430 C CA  . VAL B 1 302 ? 15.686  58.011 351.656 1.00 66.22  ? 303 VAL B CA  1 
ATOM   6431 C C   . VAL B 1 302 ? 16.916  57.846 352.543 1.00 73.44  ? 303 VAL B C   1 
ATOM   6432 O O   . VAL B 1 302 ? 17.985  58.388 352.256 1.00 70.14  ? 303 VAL B O   1 
ATOM   6433 C CB  . VAL B 1 302 ? 16.047  57.992 350.170 1.00 65.81  ? 303 VAL B CB  1 
ATOM   6434 C CG1 . VAL B 1 302 ? 16.721  56.673 349.822 1.00 60.07  ? 303 VAL B CG1 1 
ATOM   6435 C CG2 . VAL B 1 302 ? 14.798  58.199 349.318 1.00 54.78  ? 303 VAL B CG2 1 
ATOM   6436 N N   . ASP B 1 303 ? 16.760  57.083 353.626 1.00 71.93  ? 304 ASP B N   1 
ATOM   6437 C CA  . ASP B 1 303 ? 17.717  57.041 354.722 1.00 84.08  ? 304 ASP B CA  1 
ATOM   6438 C C   . ASP B 1 303 ? 18.532  55.760 354.786 1.00 73.21  ? 304 ASP B C   1 
ATOM   6439 O O   . ASP B 1 303 ? 19.569  55.745 355.454 1.00 79.56  ? 304 ASP B O   1 
ATOM   6440 C CB  . ASP B 1 303 ? 16.982  57.204 356.060 1.00 53.47  ? 304 ASP B CB  1 
ATOM   6441 C CG  . ASP B 1 303 ? 15.858  56.196 356.218 1.00 80.19  ? 304 ASP B CG  1 
ATOM   6442 O OD1 . ASP B 1 303 ? 15.485  55.904 357.367 1.00 88.08  ? 304 ASP B OD1 1 
ATOM   6443 O OD2 . ASP B 1 303 ? 15.351  55.686 355.191 1.00 92.82  ? 304 ASP B OD2 1 
ATOM   6444 N N   . GLY B 1 304 ? 18.046  54.738 354.128 1.00 70.76  ? 305 GLY B N   1 
ATOM   6445 C CA  . GLY B 1 304 ? 18.659  53.454 354.169 1.00 73.78  ? 305 GLY B CA  1 
ATOM   6446 C C   . GLY B 1 304 ? 17.994  52.627 355.233 1.00 77.23  ? 305 GLY B C   1 
ATOM   6447 O O   . GLY B 1 304 ? 18.308  51.473 355.378 1.00 92.89  ? 305 GLY B O   1 
ATOM   6448 N N   . ASP B 1 305 ? 17.060  53.201 355.967 1.00 67.72  ? 306 ASP B N   1 
ATOM   6449 C CA  . ASP B 1 305 ? 16.379  52.448 356.985 1.00 71.50  ? 306 ASP B CA  1 
ATOM   6450 C C   . ASP B 1 305 ? 14.974  52.097 356.614 1.00 65.79  ? 306 ASP B C   1 
ATOM   6451 O O   . ASP B 1 305 ? 14.706  50.974 356.276 1.00 76.17  ? 306 ASP B O   1 
ATOM   6452 C CB  . ASP B 1 305 ? 16.383  53.187 358.298 1.00 68.78  ? 306 ASP B CB  1 
ATOM   6453 C CG  . ASP B 1 305 ? 15.892  52.342 359.424 1.00 79.85  ? 306 ASP B CG  1 
ATOM   6454 O OD1 . ASP B 1 305 ? 15.813  51.126 359.262 1.00 85.29  ? 306 ASP B OD1 1 
ATOM   6455 O OD2 . ASP B 1 305 ? 15.588  52.876 360.488 1.00 76.47  ? 306 ASP B OD2 1 
ATOM   6456 N N   . PHE B 1 306 ? 14.069  53.054 356.675 1.00 68.49  ? 307 PHE B N   1 
ATOM   6457 C CA  . PHE B 1 306 ? 12.698  52.771 356.320 1.00 68.65  ? 307 PHE B CA  1 
ATOM   6458 C C   . PHE B 1 306 ? 12.709  52.392 354.869 1.00 65.99  ? 307 PHE B C   1 
ATOM   6459 O O   . PHE B 1 306 ? 12.069  51.462 354.462 1.00 58.63  ? 307 PHE B O   1 
ATOM   6460 C CB  . PHE B 1 306 ? 11.813  53.975 356.537 1.00 49.15  ? 307 PHE B CB  1 
ATOM   6461 C CG  . PHE B 1 306 ? 10.374  53.649 356.524 1.00 50.07  ? 307 PHE B CG  1 
ATOM   6462 C CD1 . PHE B 1 306 ? 9.719   53.484 355.362 1.00 55.73  ? 307 PHE B CD1 1 
ATOM   6463 C CD2 . PHE B 1 306 ? 9.703   53.463 357.674 1.00 51.79  ? 307 PHE B CD2 1 
ATOM   6464 C CE1 . PHE B 1 306 ? 8.406   53.159 355.338 1.00 49.08  ? 307 PHE B CE1 1 
ATOM   6465 C CE2 . PHE B 1 306 ? 8.387   53.147 357.668 1.00 54.88  ? 307 PHE B CE2 1 
ATOM   6466 C CZ  . PHE B 1 306 ? 7.734   52.991 356.493 1.00 64.67  ? 307 PHE B CZ  1 
ATOM   6467 N N   . LEU B 1 307 ? 13.466  53.134 354.093 1.00 57.70  ? 308 LEU B N   1 
ATOM   6468 C CA  . LEU B 1 307 ? 13.609  52.846 352.699 1.00 71.57  ? 308 LEU B CA  1 
ATOM   6469 C C   . LEU B 1 307 ? 15.068  52.535 352.530 1.00 69.40  ? 308 LEU B C   1 
ATOM   6470 O O   . LEU B 1 307 ? 15.892  53.368 352.732 1.00 62.44  ? 308 LEU B O   1 
ATOM   6471 C CB  . LEU B 1 307 ? 13.251  54.063 351.888 1.00 58.95  ? 308 LEU B CB  1 
ATOM   6472 C CG  . LEU B 1 307 ? 11.803  54.476 351.928 1.00 67.56  ? 308 LEU B CG  1 
ATOM   6473 C CD1 . LEU B 1 307 ? 11.645  55.817 351.260 1.00 53.12  ? 308 LEU B CD1 1 
ATOM   6474 C CD2 . LEU B 1 307 ? 10.961  53.432 351.247 1.00 49.14  ? 308 LEU B CD2 1 
ATOM   6475 N N   . SER B 1 308 ? 15.381  51.327 352.133 1.00 68.42  ? 309 SER B N   1 
ATOM   6476 C CA  . SER B 1 308 ? 16.773  50.911 351.982 1.00 79.91  ? 309 SER B CA  1 
ATOM   6477 C C   . SER B 1 308 ? 17.433  51.596 350.794 1.00 83.25  ? 309 SER B C   1 
ATOM   6478 O O   . SER B 1 308 ? 18.640  51.866 350.820 1.00 86.25  ? 309 SER B O   1 
ATOM   6479 C CB  . SER B 1 308 ? 16.857  49.390 351.836 1.00 62.25  ? 309 SER B CB  1 
ATOM   6480 O OG  . SER B 1 308 ? 16.060  48.934 350.757 1.00 85.45  ? 309 SER B OG  1 
ATOM   6481 N N   . ASP B 1 309 ? 16.658  51.894 349.755 1.00 66.57  ? 310 ASP B N   1 
ATOM   6482 C CA  . ASP B 1 309 ? 17.130  52.644 348.603 1.00 81.56  ? 310 ASP B CA  1 
ATOM   6483 C C   . ASP B 1 309 ? 16.020  53.604 348.184 1.00 83.05  ? 310 ASP B C   1 
ATOM   6484 O O   . ASP B 1 309 ? 14.992  53.725 348.857 1.00 72.67  ? 310 ASP B O   1 
ATOM   6485 C CB  . ASP B 1 309 ? 17.541  51.693 347.471 1.00 81.47  ? 310 ASP B CB  1 
ATOM   6486 C CG  . ASP B 1 309 ? 18.664  52.252 346.622 1.00 95.95  ? 310 ASP B CG  1 
ATOM   6487 O OD1 . ASP B 1 309 ? 18.458  53.307 345.984 1.00 88.22  ? 310 ASP B OD1 1 
ATOM   6488 O OD2 . ASP B 1 309 ? 19.752  51.636 346.596 1.00 108.31 ? 310 ASP B OD2 1 
ATOM   6489 N N   . THR B 1 310 ? 16.224  54.295 347.064 1.00 75.64  ? 311 THR B N   1 
ATOM   6490 C CA  . THR B 1 310 ? 15.172  55.142 346.532 1.00 63.16  ? 311 THR B CA  1 
ATOM   6491 C C   . THR B 1 310 ? 13.978  54.279 346.126 1.00 70.34  ? 311 THR B C   1 
ATOM   6492 O O   . THR B 1 310 ? 14.137  53.100 345.793 1.00 69.73  ? 311 THR B O   1 
ATOM   6493 C CB  . THR B 1 310 ? 15.668  55.940 345.330 1.00 65.53  ? 311 THR B CB  1 
ATOM   6494 O OG1 . THR B 1 310 ? 15.917  55.044 344.240 1.00 66.01  ? 311 THR B OG1 1 
ATOM   6495 C CG2 . THR B 1 310 ? 16.941  56.692 345.677 1.00 58.56  ? 311 THR B CG2 1 
ATOM   6496 N N   . PRO B 1 311 ? 12.766  54.836 346.172 1.00 63.53  ? 312 PRO B N   1 
ATOM   6497 C CA  . PRO B 1 311 ? 11.582  54.047 345.787 1.00 64.73  ? 312 PRO B CA  1 
ATOM   6498 C C   . PRO B 1 311 ? 11.650  53.474 344.377 1.00 72.46  ? 312 PRO B C   1 
ATOM   6499 O O   . PRO B 1 311 ? 11.178  52.353 344.155 1.00 71.53  ? 312 PRO B O   1 
ATOM   6500 C CB  . PRO B 1 311 ? 10.432  55.050 345.950 1.00 59.39  ? 312 PRO B CB  1 
ATOM   6501 C CG  . PRO B 1 311 ? 10.932  56.020 346.995 1.00 57.11  ? 312 PRO B CG  1 
ATOM   6502 C CD  . PRO B 1 311 ? 12.415  56.117 346.811 1.00 55.43  ? 312 PRO B CD  1 
ATOM   6503 N N   . GLU B 1 312 ? 12.267  54.170 343.432 1.00 67.20  ? 313 GLU B N   1 
ATOM   6504 C CA  . GLU B 1 312 ? 12.422  53.610 342.090 1.00 86.91  ? 313 GLU B CA  1 
ATOM   6505 C C   . GLU B 1 312 ? 13.329  52.408 342.057 1.00 83.16  ? 313 GLU B C   1 
ATOM   6506 O O   . GLU B 1 312 ? 12.984  51.386 341.531 1.00 68.99  ? 313 GLU B O   1 
ATOM   6507 C CB  . GLU B 1 312 ? 12.951  54.638 341.127 1.00 76.96  ? 313 GLU B CB  1 
ATOM   6508 C CG  . GLU B 1 312 ? 11.986  55.779 340.937 1.00 99.76  ? 313 GLU B CG  1 
ATOM   6509 C CD  . GLU B 1 312 ? 11.735  56.076 339.484 1.00 126.73 ? 313 GLU B CD  1 
ATOM   6510 O OE1 . GLU B 1 312 ? 12.557  55.611 338.674 1.00 121.66 ? 313 GLU B OE1 1 
ATOM   6511 O OE2 . GLU B 1 312 ? 10.725  56.749 339.159 1.00 132.34 ? 313 GLU B OE2 1 
ATOM   6512 N N   . ALA B 1 313 ? 14.481  52.523 342.666 1.00 71.89  ? 314 ALA B N   1 
ATOM   6513 C CA  . ALA B 1 313 ? 15.358  51.362 342.809 1.00 68.42  ? 314 ALA B CA  1 
ATOM   6514 C C   . ALA B 1 313 ? 14.634  50.183 343.451 1.00 78.43  ? 314 ALA B C   1 
ATOM   6515 O O   . ALA B 1 313 ? 14.800  49.033 343.025 1.00 85.42  ? 314 ALA B O   1 
ATOM   6516 C CB  . ALA B 1 313 ? 16.592  51.732 343.633 1.00 68.93  ? 314 ALA B CB  1 
ATOM   6517 N N   . LEU B 1 314 ? 13.826  50.449 344.481 1.00 81.33  ? 315 LEU B N   1 
ATOM   6518 C CA  . LEU B 1 314 ? 13.080  49.379 345.137 1.00 76.94  ? 315 LEU B CA  1 
ATOM   6519 C C   . LEU B 1 314 ? 11.950  48.863 344.250 1.00 71.39  ? 315 LEU B C   1 
ATOM   6520 O O   . LEU B 1 314 ? 11.714  47.651 344.179 1.00 61.92  ? 315 LEU B O   1 
ATOM   6521 C CB  . LEU B 1 314 ? 12.533  49.873 346.478 1.00 68.24  ? 315 LEU B CB  1 
ATOM   6522 C CG  . LEU B 1 314 ? 13.590  50.325 347.484 1.00 73.70  ? 315 LEU B CG  1 
ATOM   6523 C CD1 . LEU B 1 314 ? 12.934  50.811 348.765 1.00 66.06  ? 315 LEU B CD1 1 
ATOM   6524 C CD2 . LEU B 1 314 ? 14.571  49.198 347.771 1.00 72.93  ? 315 LEU B CD2 1 
ATOM   6525 N N   . ILE B 1 315 ? 11.231  49.765 343.579 1.00 66.39  ? 316 ILE B N   1 
ATOM   6526 C CA  . ILE B 1 315 ? 10.185  49.334 342.654 1.00 69.65  ? 316 ILE B CA  1 
ATOM   6527 C C   . ILE B 1 315 ? 10.777  48.429 341.580 1.00 79.21  ? 316 ILE B C   1 
ATOM   6528 O O   . ILE B 1 315 ? 10.226  47.368 341.260 1.00 71.64  ? 316 ILE B O   1 
ATOM   6529 C CB  . ILE B 1 315 ? 9.474   50.553 342.037 1.00 72.23  ? 316 ILE B CB  1 
ATOM   6530 C CG1 . ILE B 1 315 ? 8.536   51.207 343.052 1.00 63.68  ? 316 ILE B CG1 1 
ATOM   6531 C CG2 . ILE B 1 315 ? 8.691   50.148 340.810 1.00 60.02  ? 316 ILE B CG2 1 
ATOM   6532 C CD1 . ILE B 1 315 ? 8.231   52.661 342.746 1.00 55.50  ? 316 ILE B CD1 1 
ATOM   6533 N N   . ASN B 1 316 ? 11.931  48.823 341.031 1.00 75.56  ? 317 ASN B N   1 
ATOM   6534 C CA  . ASN B 1 316 ? 12.529  48.079 339.927 1.00 83.69  ? 317 ASN B CA  1 
ATOM   6535 C C   . ASN B 1 316 ? 13.090  46.738 340.378 1.00 83.98  ? 317 ASN B C   1 
ATOM   6536 O O   . ASN B 1 316 ? 13.071  45.769 339.610 1.00 84.43  ? 317 ASN B O   1 
ATOM   6537 C CB  . ASN B 1 316 ? 13.630  48.908 339.271 1.00 57.89  ? 317 ASN B CB  1 
ATOM   6538 C CG  . ASN B 1 316 ? 13.083  50.072 338.475 1.00 63.89  ? 317 ASN B CG  1 
ATOM   6539 O OD1 . ASN B 1 316 ? 11.911  50.083 338.098 1.00 69.87  ? 317 ASN B OD1 1 
ATOM   6540 N ND2 . ASN B 1 316 ? 13.932  51.060 338.209 1.00 55.05  ? 317 ASN B ND2 1 
ATOM   6541 N N   . ALA B 1 317 ? 13.592  46.659 341.607 1.00 85.16  ? 318 ALA B N   1 
ATOM   6542 C CA  . ALA B 1 317 ? 14.208  45.438 342.100 1.00 83.15  ? 318 ALA B CA  1 
ATOM   6543 C C   . ALA B 1 317 ? 13.229  44.510 342.800 1.00 77.32  ? 318 ALA B C   1 
ATOM   6544 O O   . ALA B 1 317 ? 13.615  43.397 343.172 1.00 88.04  ? 318 ALA B O   1 
ATOM   6545 C CB  . ALA B 1 317 ? 15.353  45.774 343.061 1.00 75.20  ? 318 ALA B CB  1 
ATOM   6546 N N   . GLY B 1 318 ? 11.980  44.926 342.982 1.00 75.09  ? 319 GLY B N   1 
ATOM   6547 C CA  . GLY B 1 318 ? 11.080  44.182 343.835 1.00 85.40  ? 319 GLY B CA  1 
ATOM   6548 C C   . GLY B 1 318 ? 10.418  43.019 343.123 1.00 72.53  ? 319 GLY B C   1 
ATOM   6549 O O   . GLY B 1 318 ? 10.179  43.047 341.918 1.00 66.15  ? 319 GLY B O   1 
ATOM   6550 N N   . ASP B 1 319 ? 10.130  41.975 343.896 1.00 84.67  ? 320 ASP B N   1 
ATOM   6551 C CA  . ASP B 1 319 ? 9.299   40.860 343.458 1.00 70.50  ? 320 ASP B CA  1 
ATOM   6552 C C   . ASP B 1 319 ? 7.934   41.015 344.113 1.00 79.11  ? 320 ASP B C   1 
ATOM   6553 O O   . ASP B 1 319 ? 7.832   41.046 345.345 1.00 88.56  ? 320 ASP B O   1 
ATOM   6554 C CB  . ASP B 1 319 ? 9.936   39.519 343.823 1.00 76.18  ? 320 ASP B CB  1 
ATOM   6555 C CG  . ASP B 1 319 ? 8.994   38.344 343.616 1.00 82.57  ? 320 ASP B CG  1 
ATOM   6556 O OD1 . ASP B 1 319 ? 8.085   38.436 342.762 1.00 79.50  ? 320 ASP B OD1 1 
ATOM   6557 O OD2 . ASP B 1 319 ? 9.164   37.322 344.314 1.00 98.43  ? 320 ASP B OD2 1 
ATOM   6558 N N   . PHE B 1 320 ? 6.890   41.113 343.293 1.00 60.33  ? 321 PHE B N   1 
ATOM   6559 C CA  . PHE B 1 320 ? 5.559   41.470 343.769 1.00 72.60  ? 321 PHE B CA  1 
ATOM   6560 C C   . PHE B 1 320 ? 4.536   40.374 343.486 1.00 75.05  ? 321 PHE B C   1 
ATOM   6561 O O   . PHE B 1 320 ? 3.350   40.656 343.301 1.00 70.27  ? 321 PHE B O   1 
ATOM   6562 C CB  . PHE B 1 320 ? 5.115   42.798 343.155 1.00 66.44  ? 321 PHE B CB  1 
ATOM   6563 C CG  . PHE B 1 320 ? 6.056   43.938 343.440 1.00 68.50  ? 321 PHE B CG  1 
ATOM   6564 C CD1 . PHE B 1 320 ? 6.109   44.516 344.700 1.00 50.90  ? 321 PHE B CD1 1 
ATOM   6565 C CD2 . PHE B 1 320 ? 6.898   44.420 342.453 1.00 67.12  ? 321 PHE B CD2 1 
ATOM   6566 C CE1 . PHE B 1 320 ? 6.980   45.559 344.962 1.00 72.15  ? 321 PHE B CE1 1 
ATOM   6567 C CE2 . PHE B 1 320 ? 7.772   45.464 342.711 1.00 68.18  ? 321 PHE B CE2 1 
ATOM   6568 C CZ  . PHE B 1 320 ? 7.812   46.035 343.964 1.00 66.80  ? 321 PHE B CZ  1 
ATOM   6569 N N   . HIS B 1 321 ? 4.979   39.120 343.457 1.00 75.90  ? 322 HIS B N   1 
ATOM   6570 C CA  . HIS B 1 321 ? 4.048   38.014 343.302 1.00 79.28  ? 322 HIS B CA  1 
ATOM   6571 C C   . HIS B 1 321 ? 3.218   37.845 344.568 1.00 83.17  ? 322 HIS B C   1 
ATOM   6572 O O   . HIS B 1 321 ? 3.725   37.969 345.686 1.00 69.42  ? 322 HIS B O   1 
ATOM   6573 C CB  . HIS B 1 321 ? 4.800   36.725 342.976 1.00 96.24  ? 322 HIS B CB  1 
ATOM   6574 C CG  . HIS B 1 321 ? 5.188   36.605 341.534 1.00 110.68 ? 322 HIS B CG  1 
ATOM   6575 N ND1 . HIS B 1 321 ? 6.465   36.859 341.082 1.00 97.84  ? 322 HIS B ND1 1 
ATOM   6576 C CD2 . HIS B 1 321 ? 4.463   36.267 340.441 1.00 99.08  ? 322 HIS B CD2 1 
ATOM   6577 C CE1 . HIS B 1 321 ? 6.511   36.680 339.774 1.00 90.07  ? 322 HIS B CE1 1 
ATOM   6578 N NE2 . HIS B 1 321 ? 5.309   36.321 339.360 1.00 92.18  ? 322 HIS B NE2 1 
ATOM   6579 N N   . GLY B 1 322 ? 1.929   37.573 344.383 1.00 90.62  ? 323 GLY B N   1 
ATOM   6580 C CA  . GLY B 1 322 ? 1.002   37.462 345.490 1.00 80.91  ? 323 GLY B CA  1 
ATOM   6581 C C   . GLY B 1 322 ? 0.402   38.768 345.962 1.00 79.82  ? 323 GLY B C   1 
ATOM   6582 O O   . GLY B 1 322 ? -0.299  38.775 346.981 1.00 88.83  ? 323 GLY B O   1 
ATOM   6583 N N   . LEU B 1 323 ? 0.652   39.869 345.256 1.00 82.13  ? 324 LEU B N   1 
ATOM   6584 C CA  . LEU B 1 323 ? 0.183   41.190 345.646 1.00 79.72  ? 324 LEU B CA  1 
ATOM   6585 C C   . LEU B 1 323 ? -0.796  41.722 344.614 1.00 67.86  ? 324 LEU B C   1 
ATOM   6586 O O   . LEU B 1 323 ? -0.625  41.506 343.412 1.00 73.35  ? 324 LEU B O   1 
ATOM   6587 C CB  . LEU B 1 323 ? 1.345   42.171 345.794 1.00 71.13  ? 324 LEU B CB  1 
ATOM   6588 C CG  . LEU B 1 323 ? 0.966   43.650 345.807 1.00 69.49  ? 324 LEU B CG  1 
ATOM   6589 C CD1 . LEU B 1 323 ? 0.257   44.012 347.109 1.00 63.73  ? 324 LEU B CD1 1 
ATOM   6590 C CD2 . LEU B 1 323 ? 2.198   44.501 345.603 1.00 62.68  ? 324 LEU B CD2 1 
ATOM   6591 N N   . GLN B 1 324 ? -1.820  42.421 345.093 1.00 71.75  ? 325 GLN B N   1 
ATOM   6592 C CA  . GLN B 1 324 ? -2.838  43.024 344.249 1.00 68.43  ? 325 GLN B CA  1 
ATOM   6593 C C   . GLN B 1 324 ? -2.927  44.507 344.561 1.00 71.78  ? 325 GLN B C   1 
ATOM   6594 O O   . GLN B 1 324 ? -2.916  44.916 345.727 1.00 67.03  ? 325 GLN B O   1 
ATOM   6595 C CB  . GLN B 1 324 ? -4.188  42.343 344.450 1.00 64.31  ? 325 GLN B CB  1 
ATOM   6596 C CG  . GLN B 1 324 ? -4.091  40.856 344.247 1.00 73.93  ? 325 GLN B CG  1 
ATOM   6597 C CD  . GLN B 1 324 ? -3.808  40.125 345.540 1.00 92.49  ? 325 GLN B CD  1 
ATOM   6598 O OE1 . GLN B 1 324 ? -4.230  40.559 346.612 1.00 91.21  ? 325 GLN B OE1 1 
ATOM   6599 N NE2 . GLN B 1 324 ? -3.032  39.046 345.457 1.00 88.29  ? 325 GLN B NE2 1 
ATOM   6600 N N   . VAL B 1 325 ? -2.984  45.308 343.508 1.00 65.70  ? 326 VAL B N   1 
ATOM   6601 C CA  . VAL B 1 325 ? -2.888  46.750 343.624 1.00 56.63  ? 326 VAL B CA  1 
ATOM   6602 C C   . VAL B 1 325 ? -3.980  47.364 342.766 1.00 55.36  ? 326 VAL B C   1 
ATOM   6603 O O   . VAL B 1 325 ? -4.302  46.852 341.688 1.00 65.65  ? 326 VAL B O   1 
ATOM   6604 C CB  . VAL B 1 325 ? -1.490  47.253 343.207 1.00 53.22  ? 326 VAL B CB  1 
ATOM   6605 C CG1 . VAL B 1 325 ? -1.375  48.729 343.424 1.00 66.38  ? 326 VAL B CG1 1 
ATOM   6606 C CG2 . VAL B 1 325 ? -0.409  46.538 344.003 1.00 62.78  ? 326 VAL B CG2 1 
ATOM   6607 N N   . LEU B 1 326 ? -4.577  48.435 343.270 1.00 57.87  ? 327 LEU B N   1 
ATOM   6608 C CA  . LEU B 1 326 ? -5.547  49.238 342.539 1.00 45.80  ? 327 LEU B CA  1 
ATOM   6609 C C   . LEU B 1 326 ? -5.005  50.660 342.516 1.00 63.31  ? 327 LEU B C   1 
ATOM   6610 O O   . LEU B 1 326 ? -4.731  51.236 343.574 1.00 58.09  ? 327 LEU B O   1 
ATOM   6611 C CB  . LEU B 1 326 ? -6.920  49.156 343.211 1.00 50.68  ? 327 LEU B CB  1 
ATOM   6612 C CG  . LEU B 1 326 ? -8.039  50.139 342.884 1.00 63.02  ? 327 LEU B CG  1 
ATOM   6613 C CD1 . LEU B 1 326 ? -8.420  50.010 341.450 1.00 48.89  ? 327 LEU B CD1 1 
ATOM   6614 C CD2 . LEU B 1 326 ? -9.243  49.863 343.768 1.00 64.28  ? 327 LEU B CD2 1 
ATOM   6615 N N   . VAL B 1 327 ? -4.785  51.201 341.316 1.00 66.28  ? 328 VAL B N   1 
ATOM   6616 C CA  . VAL B 1 327 ? -4.190  52.521 341.151 1.00 63.50  ? 328 VAL B CA  1 
ATOM   6617 C C   . VAL B 1 327 ? -5.072  53.341 340.225 1.00 55.95  ? 328 VAL B C   1 
ATOM   6618 O O   . VAL B 1 327 ? -5.874  52.807 339.456 1.00 59.00  ? 328 VAL B O   1 
ATOM   6619 C CB  . VAL B 1 327 ? -2.753  52.457 340.590 1.00 55.65  ? 328 VAL B CB  1 
ATOM   6620 C CG1 . VAL B 1 327 ? -1.887  51.611 341.478 1.00 52.12  ? 328 VAL B CG1 1 
ATOM   6621 C CG2 . VAL B 1 327 ? -2.768  51.894 339.181 1.00 57.59  ? 328 VAL B CG2 1 
ATOM   6622 N N   . GLY B 1 328 ? -4.909  54.654 340.296 1.00 47.71  ? 329 GLY B N   1 
ATOM   6623 C CA  . GLY B 1 328 ? -5.685  55.518 339.428 1.00 46.87  ? 329 GLY B CA  1 
ATOM   6624 C C   . GLY B 1 328 ? -5.408  56.968 339.731 1.00 43.20  ? 329 GLY B C   1 
ATOM   6625 O O   . GLY B 1 328 ? -4.694  57.308 340.681 1.00 58.12  ? 329 GLY B O   1 
ATOM   6626 N N   . VAL B 1 329 ? -5.987  57.822 338.890 1.00 42.78  ? 330 VAL B N   1 
ATOM   6627 C CA  . VAL B 1 329 ? -5.845  59.268 338.967 1.00 43.35  ? 330 VAL B CA  1 
ATOM   6628 C C   . VAL B 1 329 ? -7.191  59.887 338.609 1.00 52.79  ? 330 VAL B C   1 
ATOM   6629 O O   . VAL B 1 329 ? -8.101  59.211 338.125 1.00 51.39  ? 330 VAL B O   1 
ATOM   6630 C CB  . VAL B 1 329 ? -4.746  59.796 338.016 1.00 55.78  ? 330 VAL B CB  1 
ATOM   6631 C CG1 . VAL B 1 329 ? -3.424  59.039 338.188 1.00 42.98  ? 330 VAL B CG1 1 
ATOM   6632 C CG2 . VAL B 1 329 ? -5.221  59.666 336.591 1.00 46.45  ? 330 VAL B CG2 1 
ATOM   6633 N N   . VAL B 1 330 ? -7.315  61.191 338.849 1.00 56.21  ? 331 VAL B N   1 
ATOM   6634 C CA  . VAL B 1 330 ? -8.470  61.932 338.351 1.00 50.73  ? 331 VAL B CA  1 
ATOM   6635 C C   . VAL B 1 330 ? -8.161  62.393 336.933 1.00 59.36  ? 331 VAL B C   1 
ATOM   6636 O O   . VAL B 1 330 ? -7.024  62.269 336.466 1.00 48.77  ? 331 VAL B O   1 
ATOM   6637 C CB  . VAL B 1 330 ? -8.819  63.129 339.251 1.00 55.87  ? 331 VAL B CB  1 
ATOM   6638 C CG1 . VAL B 1 330 ? -9.247  62.652 340.633 1.00 55.26  ? 331 VAL B CG1 1 
ATOM   6639 C CG2 . VAL B 1 330 ? -7.641  64.088 339.323 1.00 50.64  ? 331 VAL B CG2 1 
ATOM   6640 N N   . LYS B 1 331 ? -9.163  62.947 336.246 1.00 52.23  ? 332 LYS B N   1 
ATOM   6641 C CA  . LYS B 1 331 ? -8.977  63.322 334.850 1.00 54.77  ? 332 LYS B CA  1 
ATOM   6642 C C   . LYS B 1 331 ? -8.035  64.512 334.715 1.00 66.99  ? 332 LYS B C   1 
ATOM   6643 O O   . LYS B 1 331 ? -7.216  64.561 333.790 1.00 55.13  ? 332 LYS B O   1 
ATOM   6644 C CB  . LYS B 1 331 ? -10.327 63.631 334.201 1.00 65.45  ? 332 LYS B CB  1 
ATOM   6645 C CG  . LYS B 1 331 ? -10.226 63.978 332.723 1.00 50.82  ? 332 LYS B CG  1 
ATOM   6646 C CD  . LYS B 1 331 ? -11.576 63.911 332.022 1.00 77.39  ? 332 LYS B CD  1 
ATOM   6647 C CE  . LYS B 1 331 ? -11.795 65.131 331.130 1.00 84.50  ? 332 LYS B CE  1 
ATOM   6648 N NZ  . LYS B 1 331 ? -11.980 66.377 331.944 1.00 78.02  ? 332 LYS B NZ  1 
ATOM   6649 N N   . ASP B 1 332 ? -8.123  65.468 335.631 1.00 64.09  ? 333 ASP B N   1 
ATOM   6650 C CA  . ASP B 1 332 ? -7.346  66.703 335.566 1.00 52.03  ? 333 ASP B CA  1 
ATOM   6651 C C   . ASP B 1 332 ? -6.519  66.833 336.839 1.00 67.63  ? 333 ASP B C   1 
ATOM   6652 O O   . ASP B 1 332 ? -6.780  67.697 337.684 1.00 51.76  ? 333 ASP B O   1 
ATOM   6653 C CB  . ASP B 1 332 ? -8.265  67.893 335.360 1.00 63.21  ? 333 ASP B CB  1 
ATOM   6654 C CG  . ASP B 1 332 ? -9.086  67.770 334.090 1.00 72.24  ? 333 ASP B CG  1 
ATOM   6655 O OD1 . ASP B 1 332 ? -8.499  67.868 332.989 1.00 64.57  ? 333 ASP B OD1 1 
ATOM   6656 O OD2 . ASP B 1 332 ? -10.312 67.552 334.195 1.00 66.73  ? 333 ASP B OD2 1 
ATOM   6657 N N   . GLU B 1 333 ? -5.504  65.974 336.962 1.00 54.82  ? 334 GLU B N   1 
ATOM   6658 C CA  . GLU B 1 333 ? -4.633  65.993 338.130 1.00 54.93  ? 334 GLU B CA  1 
ATOM   6659 C C   . GLU B 1 333 ? -3.991  67.352 338.358 1.00 49.68  ? 334 GLU B C   1 
ATOM   6660 O O   . GLU B 1 333 ? -3.651  67.685 339.499 1.00 59.71  ? 334 GLU B O   1 
ATOM   6661 C CB  . GLU B 1 333 ? -3.541  64.930 337.981 1.00 41.21  ? 334 GLU B CB  1 
ATOM   6662 C CG  . GLU B 1 333 ? -4.034  63.516 338.225 1.00 56.82  ? 334 GLU B CG  1 
ATOM   6663 C CD  . GLU B 1 333 ? -4.349  63.241 339.697 1.00 74.38  ? 334 GLU B CD  1 
ATOM   6664 O OE1 . GLU B 1 333 ? -4.972  62.194 339.977 1.00 65.15  ? 334 GLU B OE1 1 
ATOM   6665 O OE2 . GLU B 1 333 ? -3.982  64.061 340.573 1.00 64.16  ? 334 GLU B OE2 1 
ATOM   6666 N N   . GLY B 1 334 ? -3.840  68.148 337.311 1.00 53.24  ? 335 GLY B N   1 
ATOM   6667 C CA  . GLY B 1 334 ? -2.995  69.317 337.366 1.00 44.82  ? 335 GLY B CA  1 
ATOM   6668 C C   . GLY B 1 334 ? -3.612  70.631 337.800 1.00 50.95  ? 335 GLY B C   1 
ATOM   6669 O O   . GLY B 1 334 ? -2.931  71.441 338.431 1.00 52.71  ? 335 GLY B O   1 
ATOM   6670 N N   . SER B 1 335 ? -4.888  70.862 337.475 1.00 63.02  ? 336 SER B N   1 
ATOM   6671 C CA  . SER B 1 335 ? -5.459  72.203 337.593 1.00 68.21  ? 336 SER B CA  1 
ATOM   6672 C C   . SER B 1 335 ? -5.488  72.708 339.033 1.00 61.44  ? 336 SER B C   1 
ATOM   6673 O O   . SER B 1 335 ? -5.346  73.914 339.267 1.00 62.97  ? 336 SER B O   1 
ATOM   6674 C CB  . SER B 1 335 ? -6.871  72.220 337.014 1.00 65.96  ? 336 SER B CB  1 
ATOM   6675 O OG  . SER B 1 335 ? -7.710  71.335 337.741 1.00 71.12  ? 336 SER B OG  1 
ATOM   6676 N N   . TYR B 1 336 ? -5.679  71.814 340.004 1.00 63.50  ? 337 TYR B N   1 
ATOM   6677 C CA  . TYR B 1 336 ? -5.816  72.239 341.397 1.00 62.28  ? 337 TYR B CA  1 
ATOM   6678 C C   . TYR B 1 336 ? -4.589  73.005 341.875 1.00 64.92  ? 337 TYR B C   1 
ATOM   6679 O O   . TYR B 1 336 ? -4.710  73.982 342.622 1.00 70.00  ? 337 TYR B O   1 
ATOM   6680 C CB  . TYR B 1 336 ? -6.067  71.017 342.280 1.00 67.74  ? 337 TYR B CB  1 
ATOM   6681 C CG  . TYR B 1 336 ? -6.176  71.283 343.761 1.00 66.55  ? 337 TYR B CG  1 
ATOM   6682 C CD1 . TYR B 1 336 ? -7.237  72.009 344.282 1.00 72.80  ? 337 TYR B CD1 1 
ATOM   6683 C CD2 . TYR B 1 336 ? -5.229  70.781 344.644 1.00 71.10  ? 337 TYR B CD2 1 
ATOM   6684 C CE1 . TYR B 1 336 ? -7.345  72.239 345.641 1.00 78.19  ? 337 TYR B CE1 1 
ATOM   6685 C CE2 . TYR B 1 336 ? -5.328  71.006 346.001 1.00 82.93  ? 337 TYR B CE2 1 
ATOM   6686 C CZ  . TYR B 1 336 ? -6.388  71.736 346.493 1.00 83.12  ? 337 TYR B CZ  1 
ATOM   6687 O OH  . TYR B 1 336 ? -6.490  71.960 347.844 1.00 88.94  ? 337 TYR B OH  1 
ATOM   6688 N N   . PHE B 1 337 ? -3.402  72.591 341.439 1.00 68.58  ? 338 PHE B N   1 
ATOM   6689 C CA  . PHE B 1 337 ? -2.169  73.159 341.967 1.00 67.80  ? 338 PHE B CA  1 
ATOM   6690 C C   . PHE B 1 337 ? -1.767  74.463 341.291 1.00 66.37  ? 338 PHE B C   1 
ATOM   6691 O O   . PHE B 1 337 ? -0.947  75.201 341.847 1.00 65.66  ? 338 PHE B O   1 
ATOM   6692 C CB  . PHE B 1 337 ? -1.045  72.128 341.852 1.00 50.30  ? 338 PHE B CB  1 
ATOM   6693 C CG  . PHE B 1 337 ? -1.373  70.818 342.507 1.00 63.52  ? 338 PHE B CG  1 
ATOM   6694 C CD1 . PHE B 1 337 ? -1.214  70.648 343.870 1.00 66.96  ? 338 PHE B CD1 1 
ATOM   6695 C CD2 . PHE B 1 337 ? -1.879  69.770 341.770 1.00 48.90  ? 338 PHE B CD2 1 
ATOM   6696 C CE1 . PHE B 1 337 ? -1.533  69.438 344.470 1.00 56.01  ? 338 PHE B CE1 1 
ATOM   6697 C CE2 . PHE B 1 337 ? -2.186  68.565 342.349 1.00 67.29  ? 338 PHE B CE2 1 
ATOM   6698 C CZ  . PHE B 1 337 ? -2.021  68.395 343.701 1.00 71.56  ? 338 PHE B CZ  1 
ATOM   6699 N N   . LEU B 1 338 ? -2.330  74.778 340.124 1.00 56.16  ? 339 LEU B N   1 
ATOM   6700 C CA  . LEU B 1 338 ? -1.923  75.999 339.438 1.00 64.23  ? 339 LEU B CA  1 
ATOM   6701 C C   . LEU B 1 338 ? -2.519  77.244 340.083 1.00 69.06  ? 339 LEU B C   1 
ATOM   6702 O O   . LEU B 1 338 ? -1.895  78.311 340.050 1.00 73.50  ? 339 LEU B O   1 
ATOM   6703 C CB  . LEU B 1 338 ? -2.305  75.918 337.963 1.00 61.67  ? 339 LEU B CB  1 
ATOM   6704 C CG  . LEU B 1 338 ? -1.716  74.674 337.305 1.00 71.68  ? 339 LEU B CG  1 
ATOM   6705 C CD1 . LEU B 1 338 ? -2.221  74.503 335.883 1.00 64.30  ? 339 LEU B CD1 1 
ATOM   6706 C CD2 . LEU B 1 338 ? -0.193  74.732 337.352 1.00 61.99  ? 339 LEU B CD2 1 
ATOM   6707 N N   . VAL B 1 339 ? -3.653  77.152 340.728 1.00 66.82  ? 340 VAL B N   1 
ATOM   6708 C CA  . VAL B 1 339 ? -4.210  78.315 341.348 1.00 65.04  ? 340 VAL B CA  1 
ATOM   6709 C C   . VAL B 1 339 ? -3.427  78.699 342.570 1.00 72.41  ? 340 VAL B C   1 
ATOM   6710 O O   . VAL B 1 339 ? -3.655  79.715 343.138 1.00 89.17  ? 340 VAL B O   1 
ATOM   6711 C CB  . VAL B 1 339 ? -5.680  78.152 341.694 1.00 73.81  ? 340 VAL B CB  1 
ATOM   6712 C CG1 . VAL B 1 339 ? -6.431  77.602 340.522 1.00 75.12  ? 340 VAL B CG1 1 
ATOM   6713 C CG2 . VAL B 1 339 ? -5.863  77.258 342.884 1.00 74.19  ? 340 VAL B CG2 1 
ATOM   6714 N N   . TYR B 1 340 ? -2.515  77.861 342.984 1.00 65.13  ? 341 TYR B N   1 
ATOM   6715 C CA  . TYR B 1 340 ? -1.730  78.127 344.164 1.00 76.27  ? 341 TYR B CA  1 
ATOM   6716 C C   . TYR B 1 340 ? -0.354  78.700 343.881 1.00 86.26  ? 341 TYR B C   1 
ATOM   6717 O O   . TYR B 1 340 ? 0.597   78.361 344.552 1.00 85.64  ? 341 TYR B O   1 
ATOM   6718 C CB  . TYR B 1 340 ? -1.593  76.876 345.018 1.00 74.57  ? 341 TYR B CB  1 
ATOM   6719 C CG  . TYR B 1 340 ? -2.741  76.558 345.904 1.00 74.11  ? 341 TYR B CG  1 
ATOM   6720 C CD1 . TYR B 1 340 ? -2.852  77.111 347.144 1.00 84.60  ? 341 TYR B CD1 1 
ATOM   6721 C CD2 . TYR B 1 340 ? -3.681  75.656 345.520 1.00 78.59  ? 341 TYR B CD2 1 
ATOM   6722 C CE1 . TYR B 1 340 ? -3.895  76.795 347.962 1.00 72.27  ? 341 TYR B CE1 1 
ATOM   6723 C CE2 . TYR B 1 340 ? -4.719  75.337 346.331 1.00 83.17  ? 341 TYR B CE2 1 
ATOM   6724 C CZ  . TYR B 1 340 ? -4.816  75.920 347.542 1.00 76.07  ? 341 TYR B CZ  1 
ATOM   6725 O OH  . TYR B 1 340 ? -5.849  75.589 348.330 1.00 79.67  ? 341 TYR B OH  1 
ATOM   6726 N N   . GLY B 1 341 ? -0.233  79.569 342.892 1.00 108.37 ? 342 GLY B N   1 
ATOM   6727 C CA  . GLY B 1 341 ? 1.055   80.165 342.607 1.00 101.15 ? 342 GLY B CA  1 
ATOM   6728 C C   . GLY B 1 341 ? 1.627   80.254 341.225 1.00 100.25 ? 342 GLY B C   1 
ATOM   6729 O O   . GLY B 1 341 ? 2.638   80.897 341.051 1.00 115.86 ? 342 GLY B O   1 
ATOM   6730 N N   . ALA B 1 342 ? 1.013   79.623 340.251 1.00 93.88  ? 343 ALA B N   1 
ATOM   6731 C CA  . ALA B 1 342 ? 1.501   79.733 338.903 1.00 119.68 ? 343 ALA B CA  1 
ATOM   6732 C C   . ALA B 1 342 ? 1.035   81.072 338.389 1.00 110.92 ? 343 ALA B C   1 
ATOM   6733 O O   . ALA B 1 342 ? -0.054  81.488 338.706 1.00 121.32 ? 343 ALA B O   1 
ATOM   6734 C CB  . ALA B 1 342 ? 0.966   78.617 338.056 1.00 80.69  ? 343 ALA B CB  1 
ATOM   6735 N N   . PRO B 1 343 ? 1.922   81.765 337.581 1.00 78.85  ? 344 PRO B N   1 
ATOM   6736 C CA  . PRO B 1 343 ? 1.422   83.054 337.092 1.00 100.51 ? 344 PRO B CA  1 
ATOM   6737 C C   . PRO B 1 343 ? 0.235   82.989 336.170 1.00 98.01  ? 344 PRO B C   1 
ATOM   6738 O O   . PRO B 1 343 ? 0.195   82.190 335.294 1.00 63.85  ? 344 PRO B O   1 
ATOM   6739 C CB  . PRO B 1 343 ? 2.596   83.628 336.325 1.00 93.51  ? 344 PRO B CB  1 
ATOM   6740 C CG  . PRO B 1 343 ? 3.428   82.499 335.974 1.00 91.34  ? 344 PRO B CG  1 
ATOM   6741 C CD  . PRO B 1 343 ? 3.390   81.680 337.182 1.00 77.95  ? 344 PRO B CD  1 
ATOM   6742 N N   . GLY B 1 344 ? -0.710  83.882 336.380 1.00 123.32 ? 345 GLY B N   1 
ATOM   6743 C CA  . GLY B 1 344 ? -1.921  83.976 335.610 1.00 115.24 ? 345 GLY B CA  1 
ATOM   6744 C C   . GLY B 1 344 ? -3.071  83.082 335.954 1.00 83.16  ? 345 GLY B C   1 
ATOM   6745 O O   . GLY B 1 344 ? -3.998  82.997 335.211 1.00 82.27  ? 345 GLY B O   1 
ATOM   6746 N N   . PHE B 1 345 ? -3.046  82.444 337.092 1.00 85.97  ? 346 PHE B N   1 
ATOM   6747 C CA  . PHE B 1 345 ? -4.109  81.531 337.395 1.00 89.91  ? 346 PHE B CA  1 
ATOM   6748 C C   . PHE B 1 345 ? -4.969  81.873 338.554 1.00 71.29  ? 346 PHE B C   1 
ATOM   6749 O O   . PHE B 1 345 ? -4.473  82.251 339.562 1.00 90.70  ? 346 PHE B O   1 
ATOM   6750 C CB  . PHE B 1 345 ? -3.479  80.220 337.756 1.00 72.41  ? 346 PHE B CB  1 
ATOM   6751 C CG  . PHE B 1 345 ? -3.076  79.420 336.601 1.00 75.27  ? 346 PHE B CG  1 
ATOM   6752 C CD1 . PHE B 1 345 ? -1.808  79.461 336.147 1.00 65.30  ? 346 PHE B CD1 1 
ATOM   6753 C CD2 . PHE B 1 345 ? -3.968  78.615 335.990 1.00 65.85  ? 346 PHE B CD2 1 
ATOM   6754 C CE1 . PHE B 1 345 ? -1.432  78.714 335.082 1.00 76.71  ? 346 PHE B CE1 1 
ATOM   6755 C CE2 . PHE B 1 345 ? -3.608  77.864 334.924 1.00 71.04  ? 346 PHE B CE2 1 
ATOM   6756 C CZ  . PHE B 1 345 ? -2.336  77.915 334.466 1.00 66.90  ? 346 PHE B CZ  1 
ATOM   6757 N N   . SER B 1 346 ? -6.271  81.787 338.424 1.00 80.16  ? 347 SER B N   1 
ATOM   6758 C CA  . SER B 1 346 ? -7.036  81.935 339.650 1.00 84.22  ? 347 SER B CA  1 
ATOM   6759 C C   . SER B 1 346 ? -8.251  81.034 339.530 1.00 82.47  ? 347 SER B C   1 
ATOM   6760 O O   . SER B 1 346 ? -8.629  80.617 338.431 1.00 73.09  ? 347 SER B O   1 
ATOM   6761 C CB  . SER B 1 346 ? -7.466  83.386 339.900 1.00 82.83  ? 347 SER B CB  1 
ATOM   6762 O OG  . SER B 1 346 ? -8.587  83.725 339.103 1.00 106.26 ? 347 SER B OG  1 
ATOM   6763 N N   . LYS B 1 347 ? -8.859  80.719 340.672 1.00 65.78  ? 348 LYS B N   1 
ATOM   6764 C CA  . LYS B 1 347 ? -10.130 80.014 340.604 1.00 75.81  ? 348 LYS B CA  1 
ATOM   6765 C C   . LYS B 1 347 ? -11.263 80.925 340.152 1.00 71.65  ? 348 LYS B C   1 
ATOM   6766 O O   . LYS B 1 347 ? -12.337 80.427 339.800 1.00 70.00  ? 348 LYS B O   1 
ATOM   6767 C CB  . LYS B 1 347 ? -10.464 79.385 341.960 1.00 72.53  ? 348 LYS B CB  1 
ATOM   6768 C CG  . LYS B 1 347 ? -11.076 80.345 342.968 1.00 65.81  ? 348 LYS B CG  1 
ATOM   6769 C CD  . LYS B 1 347 ? -11.454 79.623 344.254 1.00 83.00  ? 348 LYS B CD  1 
ATOM   6770 C CE  . LYS B 1 347 ? -12.419 80.448 345.092 1.00 67.72  ? 348 LYS B CE  1 
ATOM   6771 N NZ  . LYS B 1 347 ? -13.732 80.608 344.406 1.00 69.04  ? 348 LYS B NZ  1 
ATOM   6772 N N   . ASP B 1 348 ? -11.039 82.238 340.120 1.00 67.45  ? 349 ASP B N   1 
ATOM   6773 C CA  . ASP B 1 348 ? -12.107 83.202 339.905 1.00 78.25  ? 349 ASP B CA  1 
ATOM   6774 C C   . ASP B 1 348 ? -12.061 83.861 338.530 1.00 84.29  ? 349 ASP B C   1 
ATOM   6775 O O   . ASP B 1 348 ? -12.811 84.813 338.290 1.00 94.85  ? 349 ASP B O   1 
ATOM   6776 C CB  . ASP B 1 348 ? -12.077 84.260 341.010 1.00 72.24  ? 349 ASP B CB  1 
ATOM   6777 C CG  . ASP B 1 348 ? -12.455 83.690 342.375 1.00 82.61  ? 349 ASP B CG  1 
ATOM   6778 O OD1 . ASP B 1 348 ? -13.444 82.929 342.454 1.00 78.15  ? 349 ASP B OD1 1 
ATOM   6779 O OD2 . ASP B 1 348 ? -11.761 83.998 343.369 1.00 71.84  ? 349 ASP B OD2 1 
ATOM   6780 N N   . ASN B 1 349 ? -11.202 83.389 337.623 1.00 91.66  ? 350 ASN B N   1 
ATOM   6781 C CA  . ASN B 1 349 ? -11.280 83.762 336.214 1.00 84.83  ? 350 ASN B CA  1 
ATOM   6782 C C   . ASN B 1 349 ? -10.897 82.548 335.375 1.00 83.29  ? 350 ASN B C   1 
ATOM   6783 O O   . ASN B 1 349 ? -10.620 81.465 335.900 1.00 79.56  ? 350 ASN B O   1 
ATOM   6784 C CB  . ASN B 1 349 ? -10.439 85.018 335.896 1.00 74.43  ? 350 ASN B CB  1 
ATOM   6785 C CG  . ASN B 1 349 ? -8.920  84.809 336.011 1.00 87.59  ? 350 ASN B CG  1 
ATOM   6786 O OD1 . ASN B 1 349 ? -8.387  83.739 335.721 1.00 89.05  ? 350 ASN B OD1 1 
ATOM   6787 N ND2 . ASN B 1 349 ? -8.219  85.872 336.423 1.00 90.08  ? 350 ASN B ND2 1 
ATOM   6788 N N   . GLU B 1 350 ? -10.898 82.724 334.054 1.00 80.30  ? 351 GLU B N   1 
ATOM   6789 C CA  . GLU B 1 350 ? -10.671 81.593 333.163 1.00 77.81  ? 351 GLU B CA  1 
ATOM   6790 C C   . GLU B 1 350 ? -9.219  81.132 333.138 1.00 78.54  ? 351 GLU B C   1 
ATOM   6791 O O   . GLU B 1 350 ? -8.946  80.057 332.593 1.00 64.89  ? 351 GLU B O   1 
ATOM   6792 C CB  . GLU B 1 350 ? -11.134 81.943 331.750 1.00 73.34  ? 351 GLU B CB  1 
ATOM   6793 C CG  . GLU B 1 350 ? -12.636 81.829 331.563 1.00 91.20  ? 351 GLU B CG  1 
ATOM   6794 C CD  . GLU B 1 350 ? -13.151 80.429 331.855 1.00 101.82 ? 351 GLU B CD  1 
ATOM   6795 O OE1 . GLU B 1 350 ? -13.014 79.548 330.978 1.00 107.79 ? 351 GLU B OE1 1 
ATOM   6796 O OE2 . GLU B 1 350 ? -13.689 80.209 332.962 1.00 101.40 ? 351 GLU B OE2 1 
ATOM   6797 N N   . SER B 1 351 ? -8.295  81.907 333.710 1.00 67.55  ? 352 SER B N   1 
ATOM   6798 C CA  . SER B 1 351 ? -6.878  81.542 333.764 1.00 76.46  ? 352 SER B CA  1 
ATOM   6799 C C   . SER B 1 351 ? -6.302  81.310 332.369 1.00 65.43  ? 352 SER B C   1 
ATOM   6800 O O   . SER B 1 351 ? -5.505  80.393 332.150 1.00 73.16  ? 352 SER B O   1 
ATOM   6801 C CB  . SER B 1 351 ? -6.662  80.318 334.652 1.00 64.67  ? 352 SER B CB  1 
ATOM   6802 O OG  . SER B 1 351 ? -7.168  80.563 335.946 1.00 71.56  ? 352 SER B OG  1 
ATOM   6803 N N   . LEU B 1 352 ? -6.706  82.146 331.418 1.00 78.99  ? 353 LEU B N   1 
ATOM   6804 C CA  . LEU B 1 352 ? -6.186  82.078 330.054 1.00 64.28  ? 353 LEU B CA  1 
ATOM   6805 C C   . LEU B 1 352 ? -4.835  82.779 330.026 1.00 71.21  ? 353 LEU B C   1 
ATOM   6806 O O   . LEU B 1 352 ? -4.758  84.001 329.880 1.00 82.46  ? 353 LEU B O   1 
ATOM   6807 C CB  . LEU B 1 352 ? -7.171  82.707 329.077 1.00 57.51  ? 353 LEU B CB  1 
ATOM   6808 C CG  . LEU B 1 352 ? -8.542  82.032 329.078 1.00 72.91  ? 353 LEU B CG  1 
ATOM   6809 C CD1 . LEU B 1 352 ? -9.568  82.903 328.373 1.00 68.92  ? 353 LEU B CD1 1 
ATOM   6810 C CD2 . LEU B 1 352 ? -8.463  80.653 328.433 1.00 67.56  ? 353 LEU B CD2 1 
ATOM   6811 N N   . ILE B 1 353 ? -3.762  82.002 330.157 1.00 69.45  ? 354 ILE B N   1 
ATOM   6812 C CA  . ILE B 1 353 ? -2.428  82.551 330.352 1.00 59.77  ? 354 ILE B CA  1 
ATOM   6813 C C   . ILE B 1 353 ? -1.786  82.867 329.007 1.00 65.95  ? 354 ILE B C   1 
ATOM   6814 O O   . ILE B 1 353 ? -2.175  82.349 327.956 1.00 62.49  ? 354 ILE B O   1 
ATOM   6815 C CB  . ILE B 1 353 ? -1.541  81.591 331.175 1.00 76.52  ? 354 ILE B CB  1 
ATOM   6816 C CG1 . ILE B 1 353 ? -1.497  80.208 330.514 1.00 62.90  ? 354 ILE B CG1 1 
ATOM   6817 C CG2 . ILE B 1 353 ? -2.051  81.495 332.606 1.00 59.26  ? 354 ILE B CG2 1 
ATOM   6818 C CD1 . ILE B 1 353 ? -0.470  79.260 331.104 1.00 54.65  ? 354 ILE B CD1 1 
ATOM   6819 N N   . SER B 1 354 ? -0.786  83.745 329.048 1.00 67.03  ? 355 SER B N   1 
ATOM   6820 C CA  . SER B 1 354 ? 0.032   84.051 327.888 1.00 61.73  ? 355 SER B CA  1 
ATOM   6821 C C   . SER B 1 354 ? 1.127   83.000 327.730 1.00 71.47  ? 355 SER B C   1 
ATOM   6822 O O   . SER B 1 354 ? 1.327   82.134 328.587 1.00 69.50  ? 355 SER B O   1 
ATOM   6823 C CB  . SER B 1 354 ? 0.656   85.438 328.020 1.00 63.30  ? 355 SER B CB  1 
ATOM   6824 O OG  . SER B 1 354 ? 1.607   85.462 329.073 1.00 68.97  ? 355 SER B OG  1 
ATOM   6825 N N   . ARG B 1 355 ? 1.864   83.083 326.643 1.00 66.74  ? 356 ARG B N   1 
ATOM   6826 C CA  . ARG B 1 355 ? 2.962   82.184 326.455 1.00 62.11  ? 356 ARG B CA  1 
ATOM   6827 C C   . ARG B 1 355 ? 4.045   82.452 327.438 1.00 58.88  ? 356 ARG B C   1 
ATOM   6828 O O   . ARG B 1 355 ? 4.658   81.564 327.927 1.00 67.56  ? 356 ARG B O   1 
ATOM   6829 C CB  . ARG B 1 355 ? 3.505   82.234 325.061 1.00 57.33  ? 356 ARG B CB  1 
ATOM   6830 C CG  . ARG B 1 355 ? 4.647   81.272 324.905 1.00 64.51  ? 356 ARG B CG  1 
ATOM   6831 C CD  . ARG B 1 355 ? 4.628   80.571 323.581 1.00 69.23  ? 356 ARG B CD  1 
ATOM   6832 N NE  . ARG B 1 355 ? 5.694   79.603 323.474 1.00 77.50  ? 356 ARG B NE  1 
ATOM   6833 C CZ  . ARG B 1 355 ? 5.486   78.306 323.482 1.00 69.03  ? 356 ARG B CZ  1 
ATOM   6834 N NH1 . ARG B 1 355 ? 4.272   77.868 323.592 1.00 64.12  ? 356 ARG B NH1 1 
ATOM   6835 N NH2 . ARG B 1 355 ? 6.472   77.466 323.382 1.00 52.25  ? 356 ARG B NH2 1 
ATOM   6836 N N   . ALA B 1 356 ? 4.320   83.702 327.695 1.00 62.33  ? 357 ALA B N   1 
ATOM   6837 C CA  . ALA B 1 356 ? 5.337   84.037 328.682 1.00 64.86  ? 357 ALA B CA  1 
ATOM   6838 C C   . ALA B 1 356 ? 4.969   83.482 330.053 1.00 69.45  ? 357 ALA B C   1 
ATOM   6839 O O   . ALA B 1 356 ? 5.838   83.023 330.805 1.00 71.23  ? 357 ALA B O   1 
ATOM   6840 C CB  . ALA B 1 356 ? 5.525   85.553 328.739 1.00 52.14  ? 357 ALA B CB  1 
ATOM   6841 N N   . GLU B 1 357 ? 3.679   83.507 330.389 1.00 60.28  ? 358 GLU B N   1 
ATOM   6842 C CA  . GLU B 1 357 ? 3.237   82.947 331.658 1.00 65.58  ? 358 GLU B CA  1 
ATOM   6843 C C   . GLU B 1 357 ? 3.326   81.427 331.654 1.00 69.62  ? 358 GLU B C   1 
ATOM   6844 O O   . GLU B 1 357 ? 3.626   80.820 332.689 1.00 70.45  ? 358 GLU B O   1 
ATOM   6845 C CB  . GLU B 1 357 ? 1.812   83.408 331.957 1.00 60.90  ? 358 GLU B CB  1 
ATOM   6846 C CG  . GLU B 1 357 ? 1.707   84.887 332.280 1.00 63.89  ? 358 GLU B CG  1 
ATOM   6847 C CD  . GLU B 1 357 ? 0.269   85.356 332.400 1.00 75.41  ? 358 GLU B CD  1 
ATOM   6848 O OE1 . GLU B 1 357 ? -0.596  84.824 331.673 1.00 73.08  ? 358 GLU B OE1 1 
ATOM   6849 O OE2 . GLU B 1 357 ? 0.004   86.260 333.219 1.00 68.60  ? 358 GLU B OE2 1 
ATOM   6850 N N   . PHE B 1 358 ? 3.079   80.800 330.505 1.00 64.98  ? 359 PHE B N   1 
ATOM   6851 C CA  . PHE B 1 358 ? 3.248   79.356 330.392 1.00 64.23  ? 359 PHE B CA  1 
ATOM   6852 C C   . PHE B 1 358 ? 4.699   78.959 330.625 1.00 63.47  ? 359 PHE B C   1 
ATOM   6853 O O   . PHE B 1 358 ? 4.989   78.045 331.405 1.00 61.78  ? 359 PHE B O   1 
ATOM   6854 C CB  . PHE B 1 358 ? 2.772   78.895 329.016 1.00 61.75  ? 359 PHE B CB  1 
ATOM   6855 C CG  . PHE B 1 358 ? 3.155   77.485 328.669 1.00 60.05  ? 359 PHE B CG  1 
ATOM   6856 C CD1 . PHE B 1 358 ? 2.440   76.414 329.175 1.00 55.32  ? 359 PHE B CD1 1 
ATOM   6857 C CD2 . PHE B 1 358 ? 4.208   77.234 327.802 1.00 63.26  ? 359 PHE B CD2 1 
ATOM   6858 C CE1 . PHE B 1 358 ? 2.778   75.117 328.837 1.00 67.90  ? 359 PHE B CE1 1 
ATOM   6859 C CE2 . PHE B 1 358 ? 4.554   75.939 327.459 1.00 52.50  ? 359 PHE B CE2 1 
ATOM   6860 C CZ  . PHE B 1 358 ? 3.837   74.879 327.976 1.00 69.74  ? 359 PHE B CZ  1 
ATOM   6861 N N   . LEU B 1 359 ? 5.629   79.643 329.954 1.00 67.72  ? 360 LEU B N   1 
ATOM   6862 C CA  . LEU B 1 359 ? 7.043   79.318 330.113 1.00 61.60  ? 360 LEU B CA  1 
ATOM   6863 C C   . LEU B 1 359 ? 7.498   79.555 331.546 1.00 68.24  ? 360 LEU B C   1 
ATOM   6864 O O   . LEU B 1 359 ? 8.325   78.804 332.076 1.00 81.40  ? 360 LEU B O   1 
ATOM   6865 C CB  . LEU B 1 359 ? 7.884   80.137 329.133 1.00 65.86  ? 360 LEU B CB  1 
ATOM   6866 C CG  . LEU B 1 359 ? 7.549   79.999 327.639 1.00 67.73  ? 360 LEU B CG  1 
ATOM   6867 C CD1 . LEU B 1 359 ? 8.248   81.076 326.820 1.00 60.62  ? 360 LEU B CD1 1 
ATOM   6868 C CD2 . LEU B 1 359 ? 7.900   78.613 327.110 1.00 68.52  ? 360 LEU B CD2 1 
ATOM   6869 N N   . ALA B 1 360 ? 6.957   80.588 332.194 1.00 65.49  ? 361 ALA B N   1 
ATOM   6870 C CA  . ALA B 1 360 ? 7.275   80.821 333.598 1.00 58.08  ? 361 ALA B CA  1 
ATOM   6871 C C   . ALA B 1 360 ? 6.640   79.759 334.486 1.00 68.03  ? 361 ALA B C   1 
ATOM   6872 O O   . ALA B 1 360 ? 7.270   79.280 335.436 1.00 75.20  ? 361 ALA B O   1 
ATOM   6873 C CB  . ALA B 1 360 ? 6.817   82.218 334.013 1.00 59.22  ? 361 ALA B CB  1 
ATOM   6874 N N   . GLY B 1 361 ? 5.395   79.375 334.190 1.00 66.99  ? 362 GLY B N   1 
ATOM   6875 C CA  . GLY B 1 361 ? 4.742   78.331 334.961 1.00 52.72  ? 362 GLY B CA  1 
ATOM   6876 C C   . GLY B 1 361 ? 5.424   76.979 334.857 1.00 66.22  ? 362 GLY B C   1 
ATOM   6877 O O   . GLY B 1 361 ? 5.333   76.163 335.778 1.00 65.36  ? 362 GLY B O   1 
ATOM   6878 N N   . VAL B 1 362 ? 6.117   76.719 333.747 1.00 68.43  ? 363 VAL B N   1 
ATOM   6879 C CA  . VAL B 1 362 ? 6.791   75.434 333.588 1.00 67.78  ? 363 VAL B CA  1 
ATOM   6880 C C   . VAL B 1 362 ? 7.907   75.279 334.618 1.00 55.55  ? 363 VAL B C   1 
ATOM   6881 O O   . VAL B 1 362 ? 8.124   74.188 335.159 1.00 66.24  ? 363 VAL B O   1 
ATOM   6882 C CB  . VAL B 1 362 ? 7.317   75.279 332.148 1.00 62.22  ? 363 VAL B CB  1 
ATOM   6883 C CG1 . VAL B 1 362 ? 8.291   74.118 332.056 1.00 53.95  ? 363 VAL B CG1 1 
ATOM   6884 C CG2 . VAL B 1 362 ? 6.162   75.071 331.178 1.00 64.39  ? 363 VAL B CG2 1 
ATOM   6885 N N   . ARG B 1 363 ? 8.630   76.360 334.910 1.00 63.23  ? 364 ARG B N   1 
ATOM   6886 C CA  . ARG B 1 363 ? 9.719   76.285 335.877 1.00 68.82  ? 364 ARG B CA  1 
ATOM   6887 C C   . ARG B 1 363 ? 9.223   76.268 337.315 1.00 62.56  ? 364 ARG B C   1 
ATOM   6888 O O   . ARG B 1 363 ? 9.940   75.793 338.203 1.00 65.93  ? 364 ARG B O   1 
ATOM   6889 C CB  . ARG B 1 363 ? 10.687  77.451 335.668 1.00 74.76  ? 364 ARG B CB  1 
ATOM   6890 C CG  . ARG B 1 363 ? 11.153  77.588 334.227 1.00 62.73  ? 364 ARG B CG  1 
ATOM   6891 C CD  . ARG B 1 363 ? 12.670  77.668 334.127 1.00 91.27  ? 364 ARG B CD  1 
ATOM   6892 N NE  . ARG B 1 363 ? 13.327  76.441 334.572 1.00 86.16  ? 364 ARG B NE  1 
ATOM   6893 C CZ  . ARG B 1 363 ? 14.597  76.139 334.312 1.00 86.29  ? 364 ARG B CZ  1 
ATOM   6894 N NH1 . ARG B 1 363 ? 15.348  76.972 333.603 1.00 79.36  ? 364 ARG B NH1 1 
ATOM   6895 N NH2 . ARG B 1 363 ? 15.115  75.003 334.757 1.00 80.34  ? 364 ARG B NH2 1 
ATOM   6896 N N   . VAL B 1 364 ? 8.017   76.775 337.562 1.00 67.34  ? 365 VAL B N   1 
ATOM   6897 C CA  . VAL B 1 364 ? 7.396   76.608 338.870 1.00 68.62  ? 365 VAL B CA  1 
ATOM   6898 C C   . VAL B 1 364 ? 6.902   75.177 339.040 1.00 76.26  ? 365 VAL B C   1 
ATOM   6899 O O   . VAL B 1 364 ? 7.021   74.584 340.121 1.00 74.33  ? 365 VAL B O   1 
ATOM   6900 C CB  . VAL B 1 364 ? 6.260   77.633 339.042 1.00 65.52  ? 365 VAL B CB  1 
ATOM   6901 C CG1 . VAL B 1 364 ? 5.312   77.204 340.141 1.00 82.17  ? 365 VAL B CG1 1 
ATOM   6902 C CG2 . VAL B 1 364 ? 6.837   79.006 339.339 1.00 70.27  ? 365 VAL B CG2 1 
ATOM   6903 N N   . GLY B 1 365 ? 6.359   74.591 337.968 1.00 66.62  ? 366 GLY B N   1 
ATOM   6904 C CA  . GLY B 1 365 ? 5.799   73.256 338.059 1.00 67.75  ? 366 GLY B CA  1 
ATOM   6905 C C   . GLY B 1 365 ? 6.818   72.147 337.931 1.00 59.79  ? 366 GLY B C   1 
ATOM   6906 O O   . GLY B 1 365 ? 6.598   71.042 338.436 1.00 64.75  ? 366 GLY B O   1 
ATOM   6907 N N   . VAL B 1 366 ? 7.929   72.408 337.254 1.00 56.86  ? 367 VAL B N   1 
ATOM   6908 C CA  . VAL B 1 366 ? 9.033   71.453 337.184 1.00 62.72  ? 367 VAL B CA  1 
ATOM   6909 C C   . VAL B 1 366 ? 10.254  72.127 337.796 1.00 61.62  ? 367 VAL B C   1 
ATOM   6910 O O   . VAL B 1 366 ? 11.162  72.550 337.066 1.00 52.53  ? 367 VAL B O   1 
ATOM   6911 C CB  . VAL B 1 366 ? 9.295   70.997 335.740 1.00 56.76  ? 367 VAL B CB  1 
ATOM   6912 C CG1 . VAL B 1 366 ? 10.144  69.734 335.727 1.00 51.63  ? 367 VAL B CG1 1 
ATOM   6913 C CG2 . VAL B 1 366 ? 7.976   70.760 335.023 1.00 56.35  ? 367 VAL B CG2 1 
ATOM   6914 N N   . PRO B 1 367 ? 10.316  72.256 339.115 1.00 69.17  ? 368 PRO B N   1 
ATOM   6915 C CA  . PRO B 1 367 ? 11.413  72.999 339.737 1.00 52.43  ? 368 PRO B CA  1 
ATOM   6916 C C   . PRO B 1 367 ? 12.686  72.170 339.817 1.00 67.17  ? 368 PRO B C   1 
ATOM   6917 O O   . PRO B 1 367 ? 12.664  70.936 339.794 1.00 65.21  ? 368 PRO B O   1 
ATOM   6918 C CB  . PRO B 1 367 ? 10.865  73.305 341.134 1.00 68.00  ? 368 PRO B CB  1 
ATOM   6919 C CG  . PRO B 1 367 ? 9.994   72.138 341.428 1.00 57.53  ? 368 PRO B CG  1 
ATOM   6920 C CD  . PRO B 1 367 ? 9.385   71.707 340.118 1.00 52.07  ? 368 PRO B CD  1 
ATOM   6921 N N   . GLN B 1 368 ? 13.810  72.865 339.961 1.00 69.70  ? 369 GLN B N   1 
ATOM   6922 C CA  . GLN B 1 368 ? 15.117  72.228 340.120 1.00 90.99  ? 369 GLN B CA  1 
ATOM   6923 C C   . GLN B 1 368 ? 15.650  71.412 338.943 1.00 91.95  ? 369 GLN B C   1 
ATOM   6924 O O   . GLN B 1 368 ? 16.344  70.415 339.145 1.00 83.05  ? 369 GLN B O   1 
ATOM   6925 C CB  . GLN B 1 368 ? 15.127  71.363 341.385 1.00 89.94  ? 369 GLN B CB  1 
ATOM   6926 C CG  . GLN B 1 368 ? 16.275  71.663 342.334 1.00 103.66 ? 369 GLN B CG  1 
ATOM   6927 C CD  . GLN B 1 368 ? 15.887  72.638 343.428 1.00 109.19 ? 369 GLN B CD  1 
ATOM   6928 O OE1 . GLN B 1 368 ? 15.326  73.700 343.159 1.00 107.92 ? 369 GLN B OE1 1 
ATOM   6929 N NE2 . GLN B 1 368 ? 16.186  72.281 344.672 1.00 103.46 ? 369 GLN B NE2 1 
ATOM   6930 N N   . VAL B 1 369 ? 15.344  71.829 337.721 1.00 85.40  ? 370 VAL B N   1 
ATOM   6931 C CA  . VAL B 1 369 ? 15.847  71.120 336.552 1.00 81.95  ? 370 VAL B CA  1 
ATOM   6932 C C   . VAL B 1 369 ? 16.670  72.088 335.715 1.00 76.07  ? 370 VAL B C   1 
ATOM   6933 O O   . VAL B 1 369 ? 16.513  73.308 335.795 1.00 71.62  ? 370 VAL B O   1 
ATOM   6934 C CB  . VAL B 1 369 ? 14.731  70.484 335.692 1.00 71.21  ? 370 VAL B CB  1 
ATOM   6935 C CG1 . VAL B 1 369 ? 14.270  69.182 336.309 1.00 77.67  ? 370 VAL B CG1 1 
ATOM   6936 C CG2 . VAL B 1 369 ? 13.574  71.436 335.511 1.00 83.02  ? 370 VAL B CG2 1 
ATOM   6937 N N   . SER B 1 370 ? 17.564  71.523 334.908 1.00 84.20  ? 371 SER B N   1 
ATOM   6938 C CA  . SER B 1 370 ? 18.422  72.335 334.061 1.00 73.11  ? 371 SER B CA  1 
ATOM   6939 C C   . SER B 1 370 ? 17.595  73.087 333.023 1.00 82.63  ? 371 SER B C   1 
ATOM   6940 O O   . SER B 1 370 ? 16.446  72.741 332.728 1.00 73.66  ? 371 SER B O   1 
ATOM   6941 C CB  . SER B 1 370 ? 19.462  71.462 333.362 1.00 89.78  ? 371 SER B CB  1 
ATOM   6942 O OG  . SER B 1 370 ? 18.847  70.336 332.759 1.00 75.46  ? 371 SER B OG  1 
ATOM   6943 N N   . ASP B 1 371 ? 18.201  74.137 332.463 1.00 97.14  ? 372 ASP B N   1 
ATOM   6944 C CA  . ASP B 1 371 ? 17.532  74.908 331.418 1.00 85.81  ? 372 ASP B CA  1 
ATOM   6945 C C   . ASP B 1 371 ? 17.219  74.039 330.206 1.00 76.77  ? 372 ASP B C   1 
ATOM   6946 O O   . ASP B 1 371 ? 16.179  74.216 329.559 1.00 68.95  ? 372 ASP B O   1 
ATOM   6947 C CB  . ASP B 1 371 ? 18.398  76.099 331.016 1.00 85.61  ? 372 ASP B CB  1 
ATOM   6948 C CG  . ASP B 1 371 ? 18.688  77.016 332.178 1.00 100.79 ? 372 ASP B CG  1 
ATOM   6949 O OD1 . ASP B 1 371 ? 17.760  77.728 332.611 1.00 103.60 ? 372 ASP B OD1 1 
ATOM   6950 O OD2 . ASP B 1 371 ? 19.839  77.018 332.666 1.00 114.93 ? 372 ASP B OD2 1 
ATOM   6951 N N   . LEU B 1 372 ? 18.110  73.092 329.892 1.00 73.62  ? 373 LEU B N   1 
ATOM   6952 C CA  . LEU B 1 372 ? 17.869  72.163 328.794 1.00 72.66  ? 373 LEU B CA  1 
ATOM   6953 C C   . LEU B 1 372 ? 16.646  71.299 329.078 1.00 77.94  ? 373 LEU B C   1 
ATOM   6954 O O   . LEU B 1 372 ? 15.851  71.012 328.178 1.00 68.35  ? 373 LEU B O   1 
ATOM   6955 C CB  . LEU B 1 372 ? 19.096  71.280 328.570 1.00 65.56  ? 373 LEU B CB  1 
ATOM   6956 C CG  . LEU B 1 372 ? 19.016  70.357 327.357 1.00 86.06  ? 373 LEU B CG  1 
ATOM   6957 C CD1 . LEU B 1 372 ? 19.095  71.242 326.126 1.00 81.95  ? 373 LEU B CD1 1 
ATOM   6958 C CD2 . LEU B 1 372 ? 20.173  69.385 327.335 1.00 89.03  ? 373 LEU B CD2 1 
ATOM   6959 N N   . ALA B 1 373 ? 16.495  70.871 330.332 1.00 79.49  ? 374 ALA B N   1 
ATOM   6960 C CA  . ALA B 1 373 ? 15.343  70.064 330.716 1.00 62.51  ? 374 ALA B CA  1 
ATOM   6961 C C   . ALA B 1 373 ? 14.048  70.849 330.567 1.00 65.67  ? 374 ALA B C   1 
ATOM   6962 O O   . ALA B 1 373 ? 13.052  70.320 330.062 1.00 61.30  ? 374 ALA B O   1 
ATOM   6963 C CB  . ALA B 1 373 ? 15.522  69.571 332.151 1.00 65.69  ? 374 ALA B CB  1 
ATOM   6964 N N   . ALA B 1 374 ? 14.052  72.119 330.984 1.00 51.44  ? 375 ALA B N   1 
ATOM   6965 C CA  . ALA B 1 374 ? 12.850  72.937 330.863 1.00 50.65  ? 375 ALA B CA  1 
ATOM   6966 C C   . ALA B 1 374 ? 12.396  73.047 329.412 1.00 71.40  ? 375 ALA B C   1 
ATOM   6967 O O   . ALA B 1 374 ? 11.198  72.947 329.123 1.00 76.53  ? 375 ALA B O   1 
ATOM   6968 C CB  . ALA B 1 374 ? 13.092  74.325 331.455 1.00 56.31  ? 375 ALA B CB  1 
ATOM   6969 N N   . GLU B 1 375 ? 13.336  73.242 328.480 1.00 64.56  ? 376 GLU B N   1 
ATOM   6970 C CA  . GLU B 1 375 ? 12.947  73.414 327.083 1.00 70.04  ? 376 GLU B CA  1 
ATOM   6971 C C   . GLU B 1 375 ? 12.440  72.116 326.472 1.00 55.47  ? 376 GLU B C   1 
ATOM   6972 O O   . GLU B 1 375 ? 11.547  72.145 325.616 1.00 62.01  ? 376 GLU B O   1 
ATOM   6973 C CB  . GLU B 1 375 ? 14.115  73.970 326.272 1.00 78.79  ? 376 GLU B CB  1 
ATOM   6974 C CG  . GLU B 1 375 ? 14.337  75.457 326.486 1.00 99.46  ? 376 GLU B CG  1 
ATOM   6975 C CD  . GLU B 1 375 ? 15.676  75.916 325.964 1.00 121.58 ? 376 GLU B CD  1 
ATOM   6976 O OE1 . GLU B 1 375 ? 15.900  77.142 325.879 1.00 125.61 ? 376 GLU B OE1 1 
ATOM   6977 O OE2 . GLU B 1 375 ? 16.506  75.041 325.640 1.00 121.95 ? 376 GLU B OE2 1 
ATOM   6978 N N   . ALA B 1 376 ? 12.983  70.973 326.893 1.00 46.37  ? 377 ALA B N   1 
ATOM   6979 C CA  . ALA B 1 376 ? 12.380  69.704 326.501 1.00 57.80  ? 377 ALA B CA  1 
ATOM   6980 C C   . ALA B 1 376 ? 10.919  69.634 326.936 1.00 66.54  ? 377 ALA B C   1 
ATOM   6981 O O   . ALA B 1 376 ? 10.070  69.110 326.204 1.00 72.95  ? 377 ALA B O   1 
ATOM   6982 C CB  . ALA B 1 376 ? 13.175  68.537 327.084 1.00 44.39  ? 377 ALA B CB  1 
ATOM   6983 N N   . VAL B 1 377 ? 10.603  70.167 328.122 1.00 62.68  ? 378 VAL B N   1 
ATOM   6984 C CA  . VAL B 1 377 ? 9.213   70.208 328.566 1.00 61.21  ? 378 VAL B CA  1 
ATOM   6985 C C   . VAL B 1 377 ? 8.397   71.114 327.657 1.00 55.28  ? 378 VAL B C   1 
ATOM   6986 O O   . VAL B 1 377 ? 7.270   70.779 327.267 1.00 57.85  ? 378 VAL B O   1 
ATOM   6987 C CB  . VAL B 1 377 ? 9.125   70.662 330.038 1.00 66.55  ? 378 VAL B CB  1 
ATOM   6988 C CG1 . VAL B 1 377 ? 7.669   70.803 330.460 1.00 40.42  ? 378 VAL B CG1 1 
ATOM   6989 C CG2 . VAL B 1 377 ? 9.863   69.689 330.956 1.00 42.77  ? 378 VAL B CG2 1 
ATOM   6990 N N   . VAL B 1 378 ? 8.954   72.274 327.303 1.00 52.04  ? 379 VAL B N   1 
ATOM   6991 C CA  . VAL B 1 378 ? 8.253   73.205 326.425 1.00 64.98  ? 379 VAL B CA  1 
ATOM   6992 C C   . VAL B 1 378 ? 8.056   72.600 325.039 1.00 65.23  ? 379 VAL B C   1 
ATOM   6993 O O   . VAL B 1 378 ? 7.015   72.803 324.404 1.00 69.59  ? 379 VAL B O   1 
ATOM   6994 C CB  . VAL B 1 378 ? 9.013   74.541 326.357 1.00 64.90  ? 379 VAL B CB  1 
ATOM   6995 C CG1 . VAL B 1 378 ? 8.397   75.447 325.306 1.00 67.96  ? 379 VAL B CG1 1 
ATOM   6996 C CG2 . VAL B 1 378 ? 8.995   75.215 327.713 1.00 67.48  ? 379 VAL B CG2 1 
ATOM   6997 N N   . LEU B 1 379 ? 9.040   71.840 324.550 1.00 57.94  ? 380 LEU B N   1 
ATOM   6998 C CA  . LEU B 1 379 ? 8.933   71.253 323.217 1.00 68.88  ? 380 LEU B CA  1 
ATOM   6999 C C   . LEU B 1 379 ? 7.774   70.266 323.132 1.00 75.01  ? 380 LEU B C   1 
ATOM   7000 O O   . LEU B 1 379 ? 6.973   70.307 322.189 1.00 73.07  ? 380 LEU B O   1 
ATOM   7001 C CB  . LEU B 1 379 ? 10.241  70.554 322.834 1.00 69.11  ? 380 LEU B CB  1 
ATOM   7002 C CG  . LEU B 1 379 ? 10.106  69.516 321.709 1.00 69.65  ? 380 LEU B CG  1 
ATOM   7003 C CD1 . LEU B 1 379 ? 10.032  70.190 320.340 1.00 53.47  ? 380 LEU B CD1 1 
ATOM   7004 C CD2 . LEU B 1 379 ? 11.223  68.483 321.748 1.00 65.41  ? 380 LEU B CD2 1 
ATOM   7005 N N   A HIS B 1 380 ? 7.669   69.374 324.122 0.60 60.99  ? 381 HIS B N   1 
ATOM   7006 N N   B HIS B 1 380 ? 7.670   69.357 324.103 0.40 60.87  ? 381 HIS B N   1 
ATOM   7007 C CA  A HIS B 1 380 ? 6.705   68.284 324.082 0.60 61.82  ? 381 HIS B CA  1 
ATOM   7008 C CA  B HIS B 1 380 ? 6.658   68.311 324.005 0.40 61.99  ? 381 HIS B CA  1 
ATOM   7009 C C   A HIS B 1 380 ? 5.287   68.737 324.402 0.60 58.33  ? 381 HIS B C   1 
ATOM   7010 C C   B HIS B 1 380 ? 5.259   68.864 324.237 0.40 58.57  ? 381 HIS B C   1 
ATOM   7011 O O   A HIS B 1 380 ? 4.330   68.074 323.986 0.60 61.77  ? 381 HIS B O   1 
ATOM   7012 O O   B HIS B 1 380 ? 4.295   68.410 323.609 0.40 64.72  ? 381 HIS B O   1 
ATOM   7013 C CB  A HIS B 1 380 ? 7.130   67.177 325.054 0.60 57.64  ? 381 HIS B CB  1 
ATOM   7014 C CB  B HIS B 1 380 ? 6.960   67.188 324.996 0.40 58.00  ? 381 HIS B CB  1 
ATOM   7015 C CG  A HIS B 1 380 ? 6.176   66.026 325.110 0.60 63.71  ? 381 HIS B CG  1 
ATOM   7016 C CG  B HIS B 1 380 ? 7.954   66.194 324.490 0.40 64.78  ? 381 HIS B CG  1 
ATOM   7017 N ND1 A HIS B 1 380 ? 5.040   66.039 325.891 0.60 68.15  ? 381 HIS B ND1 1 
ATOM   7018 N ND1 B HIS B 1 380 ? 9.275   66.199 324.882 0.40 69.71  ? 381 HIS B ND1 1 
ATOM   7019 C CD2 A HIS B 1 380 ? 6.182   64.830 324.476 0.60 58.62  ? 381 HIS B CD2 1 
ATOM   7020 C CD2 B HIS B 1 380 ? 7.826   65.172 323.611 0.40 64.94  ? 381 HIS B CD2 1 
ATOM   7021 C CE1 A HIS B 1 380 ? 4.391   64.900 325.739 0.60 63.73  ? 381 HIS B CE1 1 
ATOM   7022 C CE1 B HIS B 1 380 ? 9.916   65.218 324.273 0.40 65.22  ? 381 HIS B CE1 1 
ATOM   7023 N NE2 A HIS B 1 380 ? 5.059   64.149 324.882 0.60 55.35  ? 381 HIS B NE2 1 
ATOM   7024 N NE2 B HIS B 1 380 ? 9.060   64.581 323.495 0.40 66.38  ? 381 HIS B NE2 1 
ATOM   7025 N N   . TYR B 1 381 ? 5.127   69.847 325.120 1.00 51.69  ? 382 TYR B N   1 
ATOM   7026 C CA  . TYR B 1 381 ? 3.813   70.326 325.513 1.00 59.37  ? 382 TYR B CA  1 
ATOM   7027 C C   . TYR B 1 381 ? 3.340   71.536 324.722 1.00 50.34  ? 382 TYR B C   1 
ATOM   7028 O O   . TYR B 1 381 ? 2.189   71.949 324.889 1.00 69.61  ? 382 TYR B O   1 
ATOM   7029 C CB  . TYR B 1 381 ? 3.804   70.632 327.016 1.00 53.04  ? 382 TYR B CB  1 
ATOM   7030 C CG  . TYR B 1 381 ? 3.717   69.366 327.832 1.00 61.44  ? 382 TYR B CG  1 
ATOM   7031 C CD1 . TYR B 1 381 ? 4.865   68.688 328.230 1.00 44.60  ? 382 TYR B CD1 1 
ATOM   7032 C CD2 . TYR B 1 381 ? 2.484   68.826 328.175 1.00 57.08  ? 382 TYR B CD2 1 
ATOM   7033 C CE1 . TYR B 1 381 ? 4.782   67.516 328.967 1.00 50.57  ? 382 TYR B CE1 1 
ATOM   7034 C CE2 . TYR B 1 381 ? 2.392   67.659 328.909 1.00 48.22  ? 382 TYR B CE2 1 
ATOM   7035 C CZ  . TYR B 1 381 ? 3.540   67.006 329.300 1.00 49.03  ? 382 TYR B CZ  1 
ATOM   7036 O OH  . TYR B 1 381 ? 3.438   65.842 330.030 1.00 56.18  ? 382 TYR B OH  1 
ATOM   7037 N N   . THR B 1 382 ? 4.177   72.109 323.865 1.00 57.69  ? 383 THR B N   1 
ATOM   7038 C CA  . THR B 1 382 ? 3.709   73.141 322.952 1.00 59.47  ? 383 THR B CA  1 
ATOM   7039 C C   . THR B 1 382 ? 3.105   72.493 321.712 1.00 49.55  ? 383 THR B C   1 
ATOM   7040 O O   . THR B 1 382 ? 3.672   71.546 321.159 1.00 61.18  ? 383 THR B O   1 
ATOM   7041 C CB  . THR B 1 382 ? 4.852   74.076 322.557 1.00 64.34  ? 383 THR B CB  1 
ATOM   7042 O OG1 . THR B 1 382 ? 5.347   74.761 323.719 1.00 60.13  ? 383 THR B OG1 1 
ATOM   7043 C CG2 . THR B 1 382 ? 4.388   75.088 321.522 1.00 58.38  ? 383 THR B CG2 1 
ATOM   7044 N N   . ASP B 1 383 ? 1.937   72.973 321.303 1.00 62.72  ? 384 ASP B N   1 
ATOM   7045 C CA  . ASP B 1 383 ? 1.398   72.677 319.979 1.00 75.59  ? 384 ASP B CA  1 
ATOM   7046 C C   . ASP B 1 383 ? 1.945   73.738 319.029 1.00 62.89  ? 384 ASP B C   1 
ATOM   7047 O O   . ASP B 1 383 ? 1.545   74.903 319.094 1.00 64.14  ? 384 ASP B O   1 
ATOM   7048 C CB  . ASP B 1 383 ? -0.129  72.666 319.998 1.00 80.34  ? 384 ASP B CB  1 
ATOM   7049 C CG  . ASP B 1 383 ? -0.734  72.340 318.638 1.00 75.99  ? 384 ASP B CG  1 
ATOM   7050 O OD1 . ASP B 1 383 ? 0.029   72.137 317.672 1.00 79.40  ? 384 ASP B OD1 1 
ATOM   7051 O OD2 . ASP B 1 383 ? -1.979  72.285 318.534 1.00 73.20  ? 384 ASP B OD2 1 
ATOM   7052 N N   . TRP B 1 384 ? 2.861   73.341 318.151 1.00 61.62  ? 385 TRP B N   1 
ATOM   7053 C CA  . TRP B 1 384 ? 3.584   74.311 317.340 1.00 66.51  ? 385 TRP B CA  1 
ATOM   7054 C C   . TRP B 1 384 ? 2.771   74.842 316.165 1.00 56.75  ? 385 TRP B C   1 
ATOM   7055 O O   . TRP B 1 384 ? 3.260   75.714 315.440 1.00 65.45  ? 385 TRP B O   1 
ATOM   7056 C CB  . TRP B 1 384 ? 4.898   73.692 316.876 1.00 57.17  ? 385 TRP B CB  1 
ATOM   7057 C CG  . TRP B 1 384 ? 5.777   73.393 318.043 1.00 60.66  ? 385 TRP B CG  1 
ATOM   7058 C CD1 . TRP B 1 384 ? 5.959   72.183 318.650 1.00 64.10  ? 385 TRP B CD1 1 
ATOM   7059 C CD2 . TRP B 1 384 ? 6.566   74.333 318.778 1.00 56.52  ? 385 TRP B CD2 1 
ATOM   7060 N NE1 . TRP B 1 384 ? 6.831   72.308 319.707 1.00 60.03  ? 385 TRP B NE1 1 
ATOM   7061 C CE2 . TRP B 1 384 ? 7.216   73.620 319.807 1.00 65.78  ? 385 TRP B CE2 1 
ATOM   7062 C CE3 . TRP B 1 384 ? 6.790   75.707 318.663 1.00 54.07  ? 385 TRP B CE3 1 
ATOM   7063 C CZ2 . TRP B 1 384 ? 8.075   74.237 320.715 1.00 72.41  ? 385 TRP B CZ2 1 
ATOM   7064 C CZ3 . TRP B 1 384 ? 7.644   76.318 319.564 1.00 62.96  ? 385 TRP B CZ3 1 
ATOM   7065 C CH2 . TRP B 1 384 ? 8.278   75.583 320.576 1.00 66.48  ? 385 TRP B CH2 1 
ATOM   7066 N N   . LEU B 1 385 ? 1.544   74.357 315.977 1.00 69.57  ? 386 LEU B N   1 
ATOM   7067 C CA  . LEU B 1 385 ? 0.583   74.986 315.080 1.00 61.82  ? 386 LEU B CA  1 
ATOM   7068 C C   . LEU B 1 385 ? -0.242  76.068 315.765 1.00 73.83  ? 386 LEU B C   1 
ATOM   7069 O O   . LEU B 1 385 ? -0.777  76.949 315.081 1.00 70.67  ? 386 LEU B O   1 
ATOM   7070 C CB  . LEU B 1 385 ? -0.357  73.929 314.492 1.00 60.21  ? 386 LEU B CB  1 
ATOM   7071 C CG  . LEU B 1 385 ? 0.258   73.072 313.383 1.00 85.80  ? 386 LEU B CG  1 
ATOM   7072 C CD1 . LEU B 1 385 ? -0.776  72.130 312.782 1.00 81.34  ? 386 LEU B CD1 1 
ATOM   7073 C CD2 . LEU B 1 385 ? 0.884   73.953 312.305 1.00 60.51  ? 386 LEU B CD2 1 
ATOM   7074 N N   . HIS B 1 386 ? -0.368  76.013 317.091 1.00 80.14  ? 387 HIS B N   1 
ATOM   7075 C CA  . HIS B 1 386 ? -1.045  77.047 317.877 1.00 65.57  ? 387 HIS B CA  1 
ATOM   7076 C C   . HIS B 1 386 ? -0.198  77.341 319.105 1.00 67.80  ? 387 HIS B C   1 
ATOM   7077 O O   . HIS B 1 386 ? -0.606  77.075 320.240 1.00 68.55  ? 387 HIS B O   1 
ATOM   7078 C CB  . HIS B 1 386 ? -2.454  76.603 318.277 1.00 64.60  ? 387 HIS B CB  1 
ATOM   7079 C CG  . HIS B 1 386 ? -3.238  75.989 317.160 1.00 77.36  ? 387 HIS B CG  1 
ATOM   7080 N ND1 . HIS B 1 386 ? -4.005  76.736 316.292 1.00 68.18  ? 387 HIS B ND1 1 
ATOM   7081 C CD2 . HIS B 1 386 ? -3.377  74.699 316.771 1.00 78.63  ? 387 HIS B CD2 1 
ATOM   7082 C CE1 . HIS B 1 386 ? -4.582  75.932 315.415 1.00 82.00  ? 387 HIS B CE1 1 
ATOM   7083 N NE2 . HIS B 1 386 ? -4.215  74.692 315.682 1.00 69.03  ? 387 HIS B NE2 1 
ATOM   7084 N N   . PRO B 1 387 ? 1.004   77.893 318.913 1.00 74.63  ? 388 PRO B N   1 
ATOM   7085 C CA  . PRO B 1 387 ? 1.948   77.999 320.036 1.00 74.33  ? 388 PRO B CA  1 
ATOM   7086 C C   . PRO B 1 387 ? 1.546   79.009 321.095 1.00 64.37  ? 388 PRO B C   1 
ATOM   7087 O O   . PRO B 1 387 ? 2.133   78.993 322.184 1.00 73.24  ? 388 PRO B O   1 
ATOM   7088 C CB  . PRO B 1 387 ? 3.258   78.410 319.353 1.00 69.70  ? 388 PRO B CB  1 
ATOM   7089 C CG  . PRO B 1 387 ? 2.817   79.159 318.149 1.00 71.90  ? 388 PRO B CG  1 
ATOM   7090 C CD  . PRO B 1 387 ? 1.555   78.478 317.677 1.00 63.92  ? 388 PRO B CD  1 
ATOM   7091 N N   . GLU B 1 388 ? 0.564   79.872 320.828 1.00 70.29  ? 389 GLU B N   1 
ATOM   7092 C CA  . GLU B 1 388 ? 0.228   80.948 321.751 1.00 68.39  ? 389 GLU B CA  1 
ATOM   7093 C C   . GLU B 1 388 ? -1.255  81.005 322.102 1.00 60.08  ? 389 GLU B C   1 
ATOM   7094 O O   . GLU B 1 388 ? -1.696  81.999 322.688 1.00 72.76  ? 389 GLU B O   1 
ATOM   7095 C CB  . GLU B 1 388 ? 0.682   82.296 321.177 1.00 73.55  ? 389 GLU B CB  1 
ATOM   7096 C CG  . GLU B 1 388 ? 2.173   82.360 320.880 1.00 73.75  ? 389 GLU B CG  1 
ATOM   7097 C CD  . GLU B 1 388 ? 2.721   83.770 320.940 1.00 98.49  ? 389 GLU B CD  1 
ATOM   7098 O OE1 . GLU B 1 388 ? 1.944   84.721 320.709 1.00 116.10 ? 389 GLU B OE1 1 
ATOM   7099 O OE2 . GLU B 1 388 ? 3.926   83.927 321.230 1.00 104.39 ? 389 GLU B OE2 1 
ATOM   7100 N N   . ASP B 1 389 ? -2.029  79.978 321.770 1.00 56.26  ? 390 ASP B N   1 
ATOM   7101 C CA  . ASP B 1 389 ? -3.438  79.934 322.161 1.00 59.10  ? 390 ASP B CA  1 
ATOM   7102 C C   . ASP B 1 389 ? -3.554  79.853 323.681 1.00 78.02  ? 390 ASP B C   1 
ATOM   7103 O O   . ASP B 1 389 ? -3.111  78.859 324.275 1.00 60.95  ? 390 ASP B O   1 
ATOM   7104 C CB  . ASP B 1 389 ? -4.127  78.740 321.500 1.00 59.01  ? 390 ASP B CB  1 
ATOM   7105 C CG  . ASP B 1 389 ? -5.608  78.651 321.840 1.00 72.72  ? 390 ASP B CG  1 
ATOM   7106 O OD1 . ASP B 1 389 ? -6.162  79.628 322.384 1.00 80.71  ? 390 ASP B OD1 1 
ATOM   7107 O OD2 . ASP B 1 389 ? -6.226  77.600 321.558 1.00 84.39  ? 390 ASP B OD2 1 
ATOM   7108 N N   . PRO B 1 390 ? -4.140  80.855 324.346 1.00 67.04  ? 391 PRO B N   1 
ATOM   7109 C CA  . PRO B 1 390 ? -4.184  80.824 325.818 1.00 74.41  ? 391 PRO B CA  1 
ATOM   7110 C C   . PRO B 1 390 ? -4.877  79.598 326.382 1.00 74.27  ? 391 PRO B C   1 
ATOM   7111 O O   . PRO B 1 390 ? -4.389  79.016 327.358 1.00 65.02  ? 391 PRO B O   1 
ATOM   7112 C CB  . PRO B 1 390 ? -4.935  82.116 326.170 1.00 75.06  ? 391 PRO B CB  1 
ATOM   7113 C CG  . PRO B 1 390 ? -4.751  82.998 324.983 1.00 72.66  ? 391 PRO B CG  1 
ATOM   7114 C CD  . PRO B 1 390 ? -4.745  82.082 323.803 1.00 69.12  ? 391 PRO B CD  1 
ATOM   7115 N N   . ALA B 1 391 ? -6.000  79.182 325.794 1.00 71.62  ? 392 ALA B N   1 
ATOM   7116 C CA  . ALA B 1 391 ? -6.715  78.029 326.330 1.00 64.85  ? 392 ALA B CA  1 
ATOM   7117 C C   . ALA B 1 391 ? -5.866  76.769 326.245 1.00 65.86  ? 392 ALA B C   1 
ATOM   7118 O O   . ALA B 1 391 ? -5.843  75.965 327.183 1.00 67.47  ? 392 ALA B O   1 
ATOM   7119 C CB  . ALA B 1 391 ? -8.037  77.834 325.591 1.00 73.10  ? 392 ALA B CB  1 
ATOM   7120 N N   . ARG B 1 392 ? -5.156  76.584 325.129 1.00 66.78  ? 393 ARG B N   1 
ATOM   7121 C CA  . ARG B 1 392 ? -4.286  75.420 324.991 1.00 65.30  ? 393 ARG B CA  1 
ATOM   7122 C C   . ARG B 1 392 ? -3.114  75.492 325.956 1.00 67.28  ? 393 ARG B C   1 
ATOM   7123 O O   . ARG B 1 392 ? -2.676  74.464 326.483 1.00 56.30  ? 393 ARG B O   1 
ATOM   7124 C CB  . ARG B 1 392 ? -3.774  75.301 323.557 1.00 54.92  ? 393 ARG B CB  1 
ATOM   7125 C CG  . ARG B 1 392 ? -4.762  74.704 322.571 1.00 51.93  ? 393 ARG B CG  1 
ATOM   7126 C CD  . ARG B 1 392 ? -4.241  74.897 321.154 1.00 62.83  ? 393 ARG B CD  1 
ATOM   7127 N NE  . ARG B 1 392 ? -4.897  74.029 320.183 1.00 70.44  ? 393 ARG B NE  1 
ATOM   7128 C CZ  . ARG B 1 392 ? -5.769  74.455 319.276 1.00 73.64  ? 393 ARG B CZ  1 
ATOM   7129 N NH1 . ARG B 1 392 ? -6.089  75.742 319.218 1.00 67.54  ? 393 ARG B NH1 1 
ATOM   7130 N NH2 . ARG B 1 392 ? -6.316  73.597 318.424 1.00 80.96  ? 393 ARG B NH2 1 
ATOM   7131 N N   . LEU B 1 393 ? -2.584  76.697 326.186 1.00 52.44  ? 394 LEU B N   1 
ATOM   7132 C CA  . LEU B 1 393 ? -1.471  76.852 327.115 1.00 58.52  ? 394 LEU B CA  1 
ATOM   7133 C C   . LEU B 1 393 ? -1.892  76.496 328.538 1.00 64.17  ? 394 LEU B C   1 
ATOM   7134 O O   . LEU B 1 393 ? -1.140  75.846 329.273 1.00 62.17  ? 394 LEU B O   1 
ATOM   7135 C CB  . LEU B 1 393 ? -0.933  78.281 327.046 1.00 63.36  ? 394 LEU B CB  1 
ATOM   7136 C CG  . LEU B 1 393 ? -0.187  78.646 325.756 1.00 65.76  ? 394 LEU B CG  1 
ATOM   7137 C CD1 . LEU B 1 393 ? -0.088  80.154 325.567 1.00 59.26  ? 394 LEU B CD1 1 
ATOM   7138 C CD2 . LEU B 1 393 ? 1.197   78.027 325.751 1.00 55.84  ? 394 LEU B CD2 1 
ATOM   7139 N N   . ARG B 1 394 ? -3.096  76.906 328.938 1.00 57.84  ? 395 ARG B N   1 
ATOM   7140 C CA  . ARG B 1 394 ? -3.589  76.574 330.271 1.00 63.73  ? 395 ARG B CA  1 
ATOM   7141 C C   . ARG B 1 394 ? -3.703  75.065 330.448 1.00 62.37  ? 395 ARG B C   1 
ATOM   7142 O O   . ARG B 1 394 ? -3.165  74.502 331.408 1.00 54.01  ? 395 ARG B O   1 
ATOM   7143 C CB  . ARG B 1 394 ? -4.935  77.258 330.512 1.00 59.51  ? 395 ARG B CB  1 
ATOM   7144 C CG  . ARG B 1 394 ? -5.587  76.919 331.840 1.00 65.96  ? 395 ARG B CG  1 
ATOM   7145 C CD  . ARG B 1 394 ? -7.029  77.390 331.864 1.00 61.29  ? 395 ARG B CD  1 
ATOM   7146 N NE  . ARG B 1 394 ? -7.886  76.546 331.037 1.00 65.45  ? 395 ARG B NE  1 
ATOM   7147 C CZ  . ARG B 1 394 ? -9.010  76.960 330.460 1.00 65.54  ? 395 ARG B CZ  1 
ATOM   7148 N NH1 . ARG B 1 394 ? -9.414  78.213 330.611 1.00 67.49  ? 395 ARG B NH1 1 
ATOM   7149 N NH2 . ARG B 1 394 ? -9.726  76.124 329.723 1.00 83.32  ? 395 ARG B NH2 1 
ATOM   7150 N N   . GLU B 1 395 ? -4.385  74.390 329.517 1.00 63.01  ? 396 GLU B N   1 
ATOM   7151 C CA  . GLU B 1 395 ? -4.514  72.938 329.596 1.00 72.30  ? 396 GLU B CA  1 
ATOM   7152 C C   . GLU B 1 395 ? -3.151  72.265 329.546 1.00 59.73  ? 396 GLU B C   1 
ATOM   7153 O O   . GLU B 1 395 ? -2.930  71.240 330.202 1.00 64.67  ? 396 GLU B O   1 
ATOM   7154 C CB  . GLU B 1 395 ? -5.407  72.416 328.465 1.00 51.36  ? 396 GLU B CB  1 
ATOM   7155 C CG  . GLU B 1 395 ? -6.746  73.142 328.322 1.00 76.92  ? 396 GLU B CG  1 
ATOM   7156 C CD  . GLU B 1 395 ? -7.659  72.958 329.529 1.00 105.70 ? 396 GLU B CD  1 
ATOM   7157 O OE1 . GLU B 1 395 ? -8.316  71.898 329.625 1.00 112.77 ? 396 GLU B OE1 1 
ATOM   7158 O OE2 . GLU B 1 395 ? -7.723  73.874 330.382 1.00 105.90 ? 396 GLU B OE2 1 
ATOM   7159 N N   . ALA B 1 396 ? -2.218  72.836 328.785 1.00 59.07  ? 397 ALA B N   1 
ATOM   7160 C CA  . ALA B 1 396 ? -0.904  72.221 328.648 1.00 63.86  ? 397 ALA B CA  1 
ATOM   7161 C C   . ALA B 1 396 ? -0.123  72.313 329.952 1.00 60.61  ? 397 ALA B C   1 
ATOM   7162 O O   . ALA B 1 396 ? 0.485   71.330 330.391 1.00 50.81  ? 397 ALA B O   1 
ATOM   7163 C CB  . ALA B 1 396 ? -0.130  72.872 327.500 1.00 48.87  ? 397 ALA B CB  1 
ATOM   7164 N N   . LEU B 1 397 ? -0.130  73.487 330.589 1.00 50.42  ? 398 LEU B N   1 
ATOM   7165 C CA  . LEU B 1 397 ? 0.543   73.609 331.877 1.00 66.18  ? 398 LEU B CA  1 
ATOM   7166 C C   . LEU B 1 397 ? -0.074  72.669 332.903 1.00 56.00  ? 398 LEU B C   1 
ATOM   7167 O O   . LEU B 1 397 ? 0.647   72.013 333.663 1.00 52.54  ? 398 LEU B O   1 
ATOM   7168 C CB  . LEU B 1 397 ? 0.503   75.052 332.378 1.00 55.39  ? 398 LEU B CB  1 
ATOM   7169 C CG  . LEU B 1 397 ? 1.388   75.259 333.610 1.00 61.40  ? 398 LEU B CG  1 
ATOM   7170 C CD1 . LEU B 1 397 ? 2.802   74.779 333.326 1.00 56.34  ? 398 LEU B CD1 1 
ATOM   7171 C CD2 . LEU B 1 397 ? 1.397   76.709 334.045 1.00 53.52  ? 398 LEU B CD2 1 
ATOM   7172 N N   . SER B 1 398 ? -1.407  72.578 332.926 1.00 55.75  ? 399 SER B N   1 
ATOM   7173 C CA  . SER B 1 398 ? -2.073  71.626 333.809 1.00 61.85  ? 399 SER B CA  1 
ATOM   7174 C C   . SER B 1 398 ? -1.595  70.206 333.543 1.00 55.09  ? 399 SER B C   1 
ATOM   7175 O O   . SER B 1 398 ? -1.364  69.434 334.481 1.00 57.29  ? 399 SER B O   1 
ATOM   7176 C CB  . SER B 1 398 ? -3.592  71.731 333.640 1.00 53.16  ? 399 SER B CB  1 
ATOM   7177 O OG  . SER B 1 398 ? -4.271  70.784 334.448 1.00 64.55  ? 399 SER B OG  1 
ATOM   7178 N N   . ASP B 1 399 ? -1.426  69.848 332.269 1.00 50.84  ? 400 ASP B N   1 
ATOM   7179 C CA  . ASP B 1 399 ? -0.896  68.531 331.933 1.00 52.56  ? 400 ASP B CA  1 
ATOM   7180 C C   . ASP B 1 399 ? 0.544   68.380 332.402 1.00 55.17  ? 400 ASP B C   1 
ATOM   7181 O O   . ASP B 1 399 ? 0.915   67.336 332.949 1.00 50.65  ? 400 ASP B O   1 
ATOM   7182 C CB  . ASP B 1 399 ? -0.997  68.292 330.424 1.00 57.03  ? 400 ASP B CB  1 
ATOM   7183 C CG  . ASP B 1 399 ? -2.371  67.812 330.001 1.00 70.60  ? 400 ASP B CG  1 
ATOM   7184 O OD1 . ASP B 1 399 ? -3.098  67.264 330.859 1.00 75.22  ? 400 ASP B OD1 1 
ATOM   7185 O OD2 . ASP B 1 399 ? -2.719  67.973 328.810 1.00 81.72  ? 400 ASP B OD2 1 
ATOM   7186 N N   . VAL B 1 400 ? 1.368   69.413 332.201 1.00 55.67  ? 401 VAL B N   1 
ATOM   7187 C CA  . VAL B 1 400 ? 2.772   69.359 332.614 1.00 47.51  ? 401 VAL B CA  1 
ATOM   7188 C C   . VAL B 1 400 ? 2.885   68.948 334.081 1.00 59.39  ? 401 VAL B C   1 
ATOM   7189 O O   . VAL B 1 400 ? 3.458   67.903 334.416 1.00 50.80  ? 401 VAL B O   1 
ATOM   7190 C CB  . VAL B 1 400 ? 3.465   70.710 332.360 1.00 57.63  ? 401 VAL B CB  1 
ATOM   7191 C CG1 . VAL B 1 400 ? 4.775   70.774 333.123 1.00 43.21  ? 401 VAL B CG1 1 
ATOM   7192 C CG2 . VAL B 1 400 ? 3.704   70.930 330.869 1.00 40.99  ? 401 VAL B CG2 1 
ATOM   7193 N N   . VAL B 1 401 ? 2.336   69.759 334.984 1.00 50.17  ? 402 VAL B N   1 
ATOM   7194 C CA  . VAL B 1 401 ? 2.582   69.481 336.391 1.00 66.45  ? 402 VAL B CA  1 
ATOM   7195 C C   . VAL B 1 401 ? 1.749   68.280 336.848 1.00 52.01  ? 402 VAL B C   1 
ATOM   7196 O O   . VAL B 1 401 ? 2.167   67.525 337.725 1.00 54.95  ? 402 VAL B O   1 
ATOM   7197 C CB  . VAL B 1 401 ? 2.328   70.744 337.235 1.00 83.39  ? 402 VAL B CB  1 
ATOM   7198 C CG1 . VAL B 1 401 ? 2.966   71.927 336.581 1.00 63.78  ? 402 VAL B CG1 1 
ATOM   7199 C CG2 . VAL B 1 401 ? 0.866   71.036 337.301 1.00 68.32  ? 402 VAL B CG2 1 
ATOM   7200 N N   . GLY B 1 402 ? 0.606   68.052 336.204 1.00 52.32  ? 403 GLY B N   1 
ATOM   7201 C CA  . GLY B 1 402 ? -0.158  66.840 336.477 1.00 43.86  ? 403 GLY B CA  1 
ATOM   7202 C C   . GLY B 1 402 ? 0.554   65.565 336.046 1.00 51.36  ? 403 GLY B C   1 
ATOM   7203 O O   . GLY B 1 402 ? 0.574   64.583 336.791 1.00 56.20  ? 403 GLY B O   1 
ATOM   7204 N N   . ASP B 1 403 ? 1.142   65.559 334.841 1.00 46.27  ? 404 ASP B N   1 
ATOM   7205 C CA  . ASP B 1 403 ? 1.856   64.369 334.367 1.00 51.37  ? 404 ASP B CA  1 
ATOM   7206 C C   . ASP B 1 403 ? 3.127   64.132 335.173 1.00 53.50  ? 404 ASP B C   1 
ATOM   7207 O O   . ASP B 1 403 ? 3.420   63.000 335.576 1.00 47.99  ? 404 ASP B O   1 
ATOM   7208 C CB  . ASP B 1 403 ? 2.214   64.502 332.880 1.00 61.36  ? 404 ASP B CB  1 
ATOM   7209 C CG  . ASP B 1 403 ? 0.996   64.548 331.969 1.00 53.18  ? 404 ASP B CG  1 
ATOM   7210 O OD1 . ASP B 1 403 ? -0.122  64.262 332.435 1.00 65.82  ? 404 ASP B OD1 1 
ATOM   7211 O OD2 . ASP B 1 403 ? 1.160   64.886 330.780 1.00 62.41  ? 404 ASP B OD2 1 
ATOM   7212 N N   . HIS B 1 404 ? 3.898   65.152 335.396 1.00 48.25  ? 405 HIS B N   1 
ATOM   7213 C CA  . HIS B 1 404 ? 5.131   65.007 336.111 1.00 52.61  ? 405 HIS B CA  1 
ATOM   7214 C C   . HIS B 1 404 ? 4.984   64.571 337.541 1.00 58.00  ? 405 HIS B C   1 
ATOM   7215 O O   . HIS B 1 404 ? 5.702   63.747 338.014 1.00 45.29  ? 405 HIS B O   1 
ATOM   7216 C CB  . HIS B 1 404 ? 5.828   66.344 336.023 1.00 49.14  ? 405 HIS B CB  1 
ATOM   7217 C CG  . HIS B 1 404 ? 7.046   66.475 336.861 1.00 51.78  ? 405 HIS B CG  1 
ATOM   7218 N ND1 . HIS B 1 404 ? 8.129   65.645 336.756 1.00 54.61  ? 405 HIS B ND1 1 
ATOM   7219 C CD2 . HIS B 1 404 ? 7.372   67.394 337.782 1.00 48.05  ? 405 HIS B CD2 1 
ATOM   7220 C CE1 . HIS B 1 404 ? 9.056   66.027 337.599 1.00 50.31  ? 405 HIS B CE1 1 
ATOM   7221 N NE2 . HIS B 1 404 ? 8.617   67.085 338.236 1.00 61.25  ? 405 HIS B NE2 1 
ATOM   7222 N N   . ASN B 1 405 ? 4.068   65.183 338.234 1.00 46.02  ? 406 ASN B N   1 
ATOM   7223 C CA  . ASN B 1 405 ? 3.833   64.879 339.608 1.00 53.84  ? 406 ASN B CA  1 
ATOM   7224 C C   . ASN B 1 405 ? 3.007   63.675 339.982 1.00 49.90  ? 406 ASN B C   1 
ATOM   7225 O O   . ASN B 1 405 ? 3.304   63.014 340.927 1.00 52.04  ? 406 ASN B O   1 
ATOM   7226 C CB  . ASN B 1 405 ? 3.369   66.126 340.304 1.00 43.10  ? 406 ASN B CB  1 
ATOM   7227 C CG  . ASN B 1 405 ? 4.445   67.156 340.371 1.00 55.36  ? 406 ASN B CG  1 
ATOM   7228 O OD1 . ASN B 1 405 ? 5.489   66.908 340.882 1.00 54.28  ? 406 ASN B OD1 1 
ATOM   7229 N ND2 . ASN B 1 405 ? 4.199   68.298 339.833 1.00 49.53  ? 406 ASN B ND2 1 
ATOM   7230 N N   . VAL B 1 406 ? 1.961   63.407 339.232 1.00 58.36  ? 407 VAL B N   1 
ATOM   7231 C CA  . VAL B 1 406 ? 1.095   62.314 339.548 1.00 47.61  ? 407 VAL B CA  1 
ATOM   7232 C C   . VAL B 1 406 ? 0.927   61.216 338.547 1.00 52.26  ? 407 VAL B C   1 
ATOM   7233 O O   . VAL B 1 406 ? 1.216   60.097 338.831 1.00 49.98  ? 407 VAL B O   1 
ATOM   7234 C CB  . VAL B 1 406 ? -0.289  62.875 339.813 1.00 52.22  ? 407 VAL B CB  1 
ATOM   7235 C CG1 . VAL B 1 406 ? -1.237  61.827 340.306 1.00 47.90  ? 407 VAL B CG1 1 
ATOM   7236 C CG2 . VAL B 1 406 ? -0.195  63.982 340.801 1.00 44.27  ? 407 VAL B CG2 1 
ATOM   7237 N N   . VAL B 1 407 ? 0.448   61.546 337.370 1.00 54.98  ? 408 VAL B N   1 
ATOM   7238 C CA  . VAL B 1 407 ? 0.167   60.539 336.391 1.00 54.28  ? 408 VAL B CA  1 
ATOM   7239 C C   . VAL B 1 407 ? 1.321   59.722 335.929 1.00 54.25  ? 408 VAL B C   1 
ATOM   7240 O O   . VAL B 1 407 ? 1.210   58.540 335.879 1.00 51.21  ? 408 VAL B O   1 
ATOM   7241 C CB  . VAL B 1 407 ? -0.503  61.142 335.176 1.00 51.02  ? 408 VAL B CB  1 
ATOM   7242 C CG1 . VAL B 1 407 ? -0.982  60.054 334.271 1.00 41.35  ? 408 VAL B CG1 1 
ATOM   7243 C CG2 . VAL B 1 407 ? -1.671  61.969 335.602 1.00 50.64  ? 408 VAL B CG2 1 
ATOM   7244 N N   . CYS B 1 408 ? 2.422   60.349 335.602 1.00 47.51  ? 409 CYS B N   1 
ATOM   7245 C CA  . CYS B 1 408 ? 3.561   59.599 335.158 1.00 46.10  ? 409 CYS B CA  1 
ATOM   7246 C C   . CYS B 1 408 ? 4.217   58.738 336.241 1.00 58.40  ? 409 CYS B C   1 
ATOM   7247 O O   . CYS B 1 408 ? 4.485   57.603 336.000 1.00 44.60  ? 409 CYS B O   1 
ATOM   7248 C CB  . CYS B 1 408 ? 4.313   60.280 333.997 1.00 57.30  ? 409 CYS B CB  1 
ATOM   7249 S SG  . CYS B 1 408 ? 3.299   60.189 332.468 1.00 59.07  ? 409 CYS B SG  1 
ATOM   7250 N N   . PRO B 1 409 ? 4.371   59.230 337.462 1.00 52.08  ? 410 PRO B N   1 
ATOM   7251 C CA  . PRO B 1 409 ? 4.835   58.366 338.568 1.00 52.00  ? 410 PRO B CA  1 
ATOM   7252 C C   . PRO B 1 409 ? 3.918   57.176 338.832 1.00 51.72  ? 410 PRO B C   1 
ATOM   7253 O O   . PRO B 1 409 ? 4.405   56.046 338.991 1.00 40.24  ? 410 PRO B O   1 
ATOM   7254 C CB  . PRO B 1 409 ? 4.901   59.334 339.755 1.00 43.46  ? 410 PRO B CB  1 
ATOM   7255 C CG  . PRO B 1 409 ? 5.166   60.655 339.137 1.00 57.53  ? 410 PRO B CG  1 
ATOM   7256 C CD  . PRO B 1 409 ? 4.422   60.659 337.835 1.00 52.38  ? 410 PRO B CD  1 
ATOM   7257 N N   . VAL B 1 410 ? 2.598   57.394 338.866 1.00 42.03  ? 411 VAL B N   1 
ATOM   7258 C CA  . VAL B 1 410 ? 1.657   56.287 339.041 1.00 39.88  ? 411 VAL B CA  1 
ATOM   7259 C C   . VAL B 1 410 ? 1.783   55.286 337.898 1.00 62.62  ? 411 VAL B C   1 
ATOM   7260 O O   . VAL B 1 410 ? 1.773   54.067 338.116 1.00 60.75  ? 411 VAL B O   1 
ATOM   7261 C CB  . VAL B 1 410 ? 0.217   56.827 339.163 1.00 61.00  ? 411 VAL B CB  1 
ATOM   7262 C CG1 . VAL B 1 410 ? -0.805  55.707 338.976 1.00 43.44  ? 411 VAL B CG1 1 
ATOM   7263 C CG2 . VAL B 1 410 ? 0.017   57.524 340.505 1.00 48.58  ? 411 VAL B CG2 1 
ATOM   7264 N N   . ALA B 1 411 ? 1.899   55.780 336.658 1.00 63.53  ? 412 ALA B N   1 
ATOM   7265 C CA  . ALA B 1 411 ? 1.995   54.876 335.514 1.00 47.37  ? 412 ALA B CA  1 
ATOM   7266 C C   . ALA B 1 411 ? 3.271   54.048 335.568 1.00 53.46  ? 412 ALA B C   1 
ATOM   7267 O O   . ALA B 1 411 ? 3.238   52.834 335.329 1.00 47.38  ? 412 ALA B O   1 
ATOM   7268 C CB  . ALA B 1 411 ? 1.921   55.660 334.204 1.00 56.22  ? 412 ALA B CB  1 
ATOM   7269 N N   . GLN B 1 412 ? 4.351   54.658 335.956 1.00 40.35  ? 413 GLN B N   1 
ATOM   7270 C CA  . GLN B 1 412 ? 5.572   53.942 336.062 1.00 50.05  ? 413 GLN B CA  1 
ATOM   7271 C C   . GLN B 1 412 ? 5.479   52.859 337.098 1.00 60.19  ? 413 GLN B C   1 
ATOM   7272 O O   . GLN B 1 412 ? 5.955   51.791 336.892 1.00 60.59  ? 413 GLN B O   1 
ATOM   7273 C CB  . GLN B 1 412 ? 6.622   54.904 336.464 1.00 46.57  ? 413 GLN B CB  1 
ATOM   7274 C CG  . GLN B 1 412 ? 7.848   54.260 336.963 1.00 59.83  ? 413 GLN B CG  1 
ATOM   7275 C CD  . GLN B 1 412 ? 8.948   54.418 336.001 1.00 89.07  ? 413 GLN B CD  1 
ATOM   7276 O OE1 . GLN B 1 412 ? 8.961   53.795 334.958 1.00 94.79  ? 413 GLN B OE1 1 
ATOM   7277 N NE2 . GLN B 1 412 ? 9.875   55.274 336.329 1.00 94.97  ? 413 GLN B NE2 1 
ATOM   7278 N N   . LEU B 1 413 ? 4.878   53.158 338.231 1.00 55.85  ? 414 LEU B N   1 
ATOM   7279 C CA  . LEU B 1 413 ? 4.685   52.170 339.288 1.00 58.29  ? 414 LEU B CA  1 
ATOM   7280 C C   . LEU B 1 413 ? 3.811   51.019 338.813 1.00 53.65  ? 414 LEU B C   1 
ATOM   7281 O O   . LEU B 1 413 ? 4.167   49.846 338.974 1.00 57.03  ? 414 LEU B O   1 
ATOM   7282 C CB  . LEU B 1 413 ? 4.060   52.824 340.519 1.00 54.95  ? 414 LEU B CB  1 
ATOM   7283 C CG  . LEU B 1 413 ? 3.646   51.829 341.604 1.00 51.90  ? 414 LEU B CG  1 
ATOM   7284 C CD1 . LEU B 1 413 ? 4.873   51.156 342.183 1.00 53.68  ? 414 LEU B CD1 1 
ATOM   7285 C CD2 . LEU B 1 413 ? 2.877   52.538 342.690 1.00 70.87  ? 414 LEU B CD2 1 
ATOM   7286 N N   . ALA B 1 414 ? 2.653   51.340 338.232 1.00 47.55  ? 415 ALA B N   1 
ATOM   7287 C CA  . ALA B 1 414 ? 1.729   50.302 337.786 1.00 60.99  ? 415 ALA B CA  1 
ATOM   7288 C C   . ALA B 1 414 ? 2.394   49.342 336.804 1.00 73.20  ? 415 ALA B C   1 
ATOM   7289 O O   . ALA B 1 414 ? 2.153   48.129 336.855 1.00 64.56  ? 415 ALA B O   1 
ATOM   7290 C CB  . ALA B 1 414 ? 0.492   50.942 337.159 1.00 58.29  ? 415 ALA B CB  1 
ATOM   7291 N N   . GLY B 1 415 ? 3.246   49.860 335.916 1.00 62.95  ? 416 GLY B N   1 
ATOM   7292 C CA  . GLY B 1 415 ? 3.859   49.004 334.912 1.00 56.14  ? 416 GLY B CA  1 
ATOM   7293 C C   . GLY B 1 415 ? 4.903   48.067 335.483 1.00 61.09  ? 416 GLY B C   1 
ATOM   7294 O O   . GLY B 1 415 ? 4.941   46.884 335.136 1.00 65.10  ? 416 GLY B O   1 
ATOM   7295 N N   . ARG B 1 416 ? 5.769   48.579 336.360 1.00 56.51  ? 417 ARG B N   1 
ATOM   7296 C CA  . ARG B 1 416 ? 6.767   47.717 336.984 1.00 64.98  ? 417 ARG B CA  1 
ATOM   7297 C C   . ARG B 1 416 ? 6.111   46.656 337.859 1.00 70.71  ? 417 ARG B C   1 
ATOM   7298 O O   . ARG B 1 416 ? 6.551   45.500 337.876 1.00 83.30  ? 417 ARG B O   1 
ATOM   7299 C CB  . ARG B 1 416 ? 7.749   48.556 337.796 1.00 67.48  ? 417 ARG B CB  1 
ATOM   7300 C CG  . ARG B 1 416 ? 8.445   49.622 336.978 1.00 67.89  ? 417 ARG B CG  1 
ATOM   7301 C CD  . ARG B 1 416 ? 9.122   48.996 335.778 1.00 82.57  ? 417 ARG B CD  1 
ATOM   7302 N NE  . ARG B 1 416 ? 10.117  48.008 336.183 1.00 91.11  ? 417 ARG B NE  1 
ATOM   7303 C CZ  . ARG B 1 416 ? 11.396  48.049 335.822 1.00 93.89  ? 417 ARG B CZ  1 
ATOM   7304 N NH1 . ARG B 1 416 ? 11.833  49.027 335.038 1.00 84.66  ? 417 ARG B NH1 1 
ATOM   7305 N NH2 . ARG B 1 416 ? 12.236  47.111 336.239 1.00 84.66  ? 417 ARG B NH2 1 
ATOM   7306 N N   . LEU B 1 417 ? 5.053   47.027 338.588 1.00 71.32  ? 418 LEU B N   1 
ATOM   7307 C CA  . LEU B 1 417 ? 4.373   46.053 339.438 1.00 80.22  ? 418 LEU B CA  1 
ATOM   7308 C C   . LEU B 1 417 ? 3.732   44.953 338.604 1.00 67.26  ? 418 LEU B C   1 
ATOM   7309 O O   . LEU B 1 417 ? 3.817   43.770 338.952 1.00 73.75  ? 418 LEU B O   1 
ATOM   7310 C CB  . LEU B 1 417 ? 3.315   46.736 340.314 1.00 67.73  ? 418 LEU B CB  1 
ATOM   7311 C CG  . LEU B 1 417 ? 3.717   47.755 341.389 1.00 64.65  ? 418 LEU B CG  1 
ATOM   7312 C CD1 . LEU B 1 417 ? 2.634   47.865 342.450 1.00 51.22  ? 418 LEU B CD1 1 
ATOM   7313 C CD2 . LEU B 1 417 ? 5.035   47.404 342.026 1.00 54.89  ? 418 LEU B CD2 1 
ATOM   7314 N N   . ALA B 1 418 ? 3.086   45.324 337.496 1.00 66.99  ? 419 ALA B N   1 
ATOM   7315 C CA  . ALA B 1 418 ? 2.423   44.328 336.661 1.00 75.17  ? 419 ALA B CA  1 
ATOM   7316 C C   . ALA B 1 418 ? 3.430   43.369 336.043 1.00 67.26  ? 419 ALA B C   1 
ATOM   7317 O O   . ALA B 1 418 ? 3.192   42.158 335.981 1.00 79.45  ? 419 ALA B O   1 
ATOM   7318 C CB  . ALA B 1 418 ? 1.599   45.015 335.571 1.00 65.75  ? 419 ALA B CB  1 
ATOM   7319 N N   . ALA B 1 419 ? 4.572   43.892 335.597 1.00 66.74  ? 420 ALA B N   1 
ATOM   7320 C CA  . ALA B 1 419 ? 5.569   43.054 334.948 1.00 74.25  ? 420 ALA B CA  1 
ATOM   7321 C C   . ALA B 1 419 ? 6.317   42.168 335.933 1.00 72.70  ? 420 ALA B C   1 
ATOM   7322 O O   . ALA B 1 419 ? 6.938   41.185 335.516 1.00 81.93  ? 420 ALA B O   1 
ATOM   7323 C CB  . ALA B 1 419 ? 6.559   43.926 334.177 1.00 61.36  ? 420 ALA B CB  1 
ATOM   7324 N N   . GLN B 1 420 ? 6.268   42.478 337.227 1.00 72.45  ? 421 GLN B N   1 
ATOM   7325 C CA  . GLN B 1 420 ? 7.079   41.774 338.208 1.00 64.61  ? 421 GLN B CA  1 
ATOM   7326 C C   . GLN B 1 420 ? 6.242   40.971 339.197 1.00 66.90  ? 421 GLN B C   1 
ATOM   7327 O O   . GLN B 1 420 ? 6.686   40.698 340.312 1.00 65.04  ? 421 GLN B O   1 
ATOM   7328 C CB  . GLN B 1 420 ? 7.997   42.751 338.938 1.00 67.07  ? 421 GLN B CB  1 
ATOM   7329 C CG  . GLN B 1 420 ? 9.026   43.389 338.016 1.00 70.78  ? 421 GLN B CG  1 
ATOM   7330 C CD  . GLN B 1 420 ? 9.622   44.656 338.590 1.00 86.32  ? 421 GLN B CD  1 
ATOM   7331 O OE1 . GLN B 1 420 ? 10.077  45.533 337.853 1.00 69.38  ? 421 GLN B OE1 1 
ATOM   7332 N NE2 . GLN B 1 420 ? 9.628   44.757 339.916 1.00 78.36  ? 421 GLN B NE2 1 
ATOM   7333 N N   . GLY B 1 421 ? 5.038   40.568 338.798 1.00 75.60  ? 422 GLY B N   1 
ATOM   7334 C CA  . GLY B 1 421 ? 4.312   39.545 339.522 1.00 76.02  ? 422 GLY B CA  1 
ATOM   7335 C C   . GLY B 1 421 ? 3.070   39.997 340.248 1.00 78.74  ? 422 GLY B C   1 
ATOM   7336 O O   . GLY B 1 421 ? 2.360   39.146 340.798 1.00 93.13  ? 422 GLY B O   1 
ATOM   7337 N N   . ALA B 1 422 ? 2.779   41.290 340.287 1.00 63.09  ? 423 ALA B N   1 
ATOM   7338 C CA  . ALA B 1 422 ? 1.549   41.765 340.899 1.00 74.24  ? 423 ALA B CA  1 
ATOM   7339 C C   . ALA B 1 422 ? 0.479   41.918 339.829 1.00 67.53  ? 423 ALA B C   1 
ATOM   7340 O O   . ALA B 1 422 ? 0.783   42.209 338.668 1.00 71.52  ? 423 ALA B O   1 
ATOM   7341 C CB  . ALA B 1 422 ? 1.768   43.095 341.625 1.00 59.29  ? 423 ALA B CB  1 
ATOM   7342 N N   . ARG B 1 423 ? -0.778  41.679 340.215 1.00 64.43  ? 424 ARG B N   1 
ATOM   7343 C CA  . ARG B 1 423 ? -1.917  41.997 339.361 1.00 81.73  ? 424 ARG B CA  1 
ATOM   7344 C C   . ARG B 1 423 ? -2.385  43.404 339.661 1.00 75.38  ? 424 ARG B C   1 
ATOM   7345 O O   . ARG B 1 423 ? -2.864  43.689 340.765 1.00 66.46  ? 424 ARG B O   1 
ATOM   7346 C CB  . ARG B 1 423 ? -3.087  41.033 339.515 1.00 68.37  ? 424 ARG B CB  1 
ATOM   7347 C CG  . ARG B 1 423 ? -4.388  41.567 338.885 1.00 86.71  ? 424 ARG B CG  1 
ATOM   7348 C CD  . ARG B 1 423 ? -5.367  40.450 338.748 1.00 98.37  ? 424 ARG B CD  1 
ATOM   7349 N NE  . ARG B 1 423 ? -4.679  39.160 338.781 1.00 117.16 ? 424 ARG B NE  1 
ATOM   7350 C CZ  . ARG B 1 423 ? -4.081  38.548 337.757 1.00 116.10 ? 424 ARG B CZ  1 
ATOM   7351 N NH1 . ARG B 1 423 ? -4.065  39.090 336.542 1.00 111.26 ? 424 ARG B NH1 1 
ATOM   7352 N NH2 . ARG B 1 423 ? -3.505  37.362 337.966 1.00 105.82 ? 424 ARG B NH2 1 
ATOM   7353 N N   . VAL B 1 424 ? -2.306  44.253 338.659 1.00 67.84  ? 425 VAL B N   1 
ATOM   7354 C CA  . VAL B 1 424 ? -2.611  45.661 338.796 1.00 49.10  ? 425 VAL B CA  1 
ATOM   7355 C C   . VAL B 1 424 ? -3.947  45.941 338.132 1.00 58.18  ? 425 VAL B C   1 
ATOM   7356 O O   . VAL B 1 424 ? -4.378  45.243 337.208 1.00 66.43  ? 425 VAL B O   1 
ATOM   7357 C CB  . VAL B 1 424 ? -1.474  46.499 338.188 1.00 52.56  ? 425 VAL B CB  1 
ATOM   7358 C CG1 . VAL B 1 424 ? -1.722  47.991 338.382 1.00 62.29  ? 425 VAL B CG1 1 
ATOM   7359 C CG2 . VAL B 1 424 ? -0.144  46.071 338.798 1.00 46.64  ? 425 VAL B CG2 1 
ATOM   7360 N N   . TYR B 1 425 ? -4.611  46.971 338.629 1.00 65.74  ? 426 TYR B N   1 
ATOM   7361 C CA  . TYR B 1 425 ? -5.905  47.403 338.135 1.00 50.69  ? 426 TYR B CA  1 
ATOM   7362 C C   . TYR B 1 425 ? -5.915  48.920 338.150 1.00 68.71  ? 426 TYR B C   1 
ATOM   7363 O O   . TYR B 1 425 ? -5.640  49.528 339.191 1.00 56.52  ? 426 TYR B O   1 
ATOM   7364 C CB  . TYR B 1 425 ? -7.029  46.873 339.016 1.00 56.23  ? 426 TYR B CB  1 
ATOM   7365 C CG  . TYR B 1 425 ? -7.405  45.431 338.841 1.00 59.93  ? 426 TYR B CG  1 
ATOM   7366 C CD1 . TYR B 1 425 ? -8.271  45.044 337.827 1.00 75.86  ? 426 TYR B CD1 1 
ATOM   7367 C CD2 . TYR B 1 425 ? -6.955  44.461 339.727 1.00 67.49  ? 426 TYR B CD2 1 
ATOM   7368 C CE1 . TYR B 1 425 ? -8.647  43.711 337.671 1.00 77.60  ? 426 TYR B CE1 1 
ATOM   7369 C CE2 . TYR B 1 425 ? -7.324  43.139 339.586 1.00 61.12  ? 426 TYR B CE2 1 
ATOM   7370 C CZ  . TYR B 1 425 ? -8.163  42.761 338.564 1.00 76.75  ? 426 TYR B CZ  1 
ATOM   7371 O OH  . TYR B 1 425 ? -8.494  41.425 338.468 1.00 72.63  ? 426 TYR B OH  1 
ATOM   7372 N N   . ALA B 1 426 ? -6.228  49.538 337.017 1.00 56.02  ? 427 ALA B N   1 
ATOM   7373 C CA  . ALA B 1 426 ? -6.053  50.976 336.900 1.00 51.08  ? 427 ALA B CA  1 
ATOM   7374 C C   . ALA B 1 426 ? -7.348  51.646 336.473 1.00 53.57  ? 427 ALA B C   1 
ATOM   7375 O O   . ALA B 1 426 ? -8.170  51.059 335.763 1.00 66.99  ? 427 ALA B O   1 
ATOM   7376 C CB  . ALA B 1 426 ? -4.930  51.322 335.922 1.00 51.07  ? 427 ALA B CB  1 
ATOM   7377 N N   . TYR B 1 427 ? -7.513  52.891 336.913 1.00 48.37  ? 428 TYR B N   1 
ATOM   7378 C CA  . TYR B 1 427 ? -8.705  53.668 336.616 1.00 55.74  ? 428 TYR B CA  1 
ATOM   7379 C C   . TYR B 1 427 ? -8.311  55.106 336.320 1.00 54.86  ? 428 TYR B C   1 
ATOM   7380 O O   . TYR B 1 427 ? -7.230  55.570 336.690 1.00 50.81  ? 428 TYR B O   1 
ATOM   7381 C CB  . TYR B 1 427 ? -9.726  53.636 337.775 1.00 48.56  ? 428 TYR B CB  1 
ATOM   7382 C CG  . TYR B 1 427 ? -9.289  54.392 339.018 1.00 52.31  ? 428 TYR B CG  1 
ATOM   7383 C CD1 . TYR B 1 427 ? -9.479  55.767 339.129 1.00 47.38  ? 428 TYR B CD1 1 
ATOM   7384 C CD2 . TYR B 1 427 ? -8.695  53.727 340.079 1.00 57.57  ? 428 TYR B CD2 1 
ATOM   7385 C CE1 . TYR B 1 427 ? -9.077  56.455 340.252 1.00 58.24  ? 428 TYR B CE1 1 
ATOM   7386 C CE2 . TYR B 1 427 ? -8.293  54.407 341.217 1.00 63.20  ? 428 TYR B CE2 1 
ATOM   7387 C CZ  . TYR B 1 427 ? -8.487  55.770 341.293 1.00 57.37  ? 428 TYR B CZ  1 
ATOM   7388 O OH  . TYR B 1 427 ? -8.080  56.452 342.406 1.00 54.84  ? 428 TYR B OH  1 
ATOM   7389 N N   . VAL B 1 428 ? -9.218  55.813 335.653 1.00 52.97  ? 429 VAL B N   1 
ATOM   7390 C CA  . VAL B 1 428 ? -9.191  57.266 335.591 1.00 47.65  ? 429 VAL B CA  1 
ATOM   7391 C C   . VAL B 1 428 ? -10.566 57.750 336.022 1.00 51.62  ? 429 VAL B C   1 
ATOM   7392 O O   . VAL B 1 428 ? -11.580 57.375 335.420 1.00 54.41  ? 429 VAL B O   1 
ATOM   7393 C CB  . VAL B 1 428 ? -8.829  57.793 334.193 1.00 64.78  ? 429 VAL B CB  1 
ATOM   7394 C CG1 . VAL B 1 428 ? -9.019  59.306 334.136 1.00 52.05  ? 429 VAL B CG1 1 
ATOM   7395 C CG2 . VAL B 1 428 ? -7.387  57.420 333.854 1.00 52.65  ? 429 VAL B CG2 1 
ATOM   7396 N N   . PHE B 1 429 ? -10.604 58.546 337.082 1.00 49.75  ? 430 PHE B N   1 
ATOM   7397 C CA  . PHE B 1 429 ? -11.854 59.066 337.610 1.00 57.26  ? 430 PHE B CA  1 
ATOM   7398 C C   . PHE B 1 429 ? -12.165 60.369 336.893 1.00 43.02  ? 430 PHE B C   1 
ATOM   7399 O O   . PHE B 1 429 ? -11.389 61.325 336.976 1.00 62.06  ? 430 PHE B O   1 
ATOM   7400 C CB  . PHE B 1 429 ? -11.754 59.286 339.119 1.00 42.56  ? 430 PHE B CB  1 
ATOM   7401 C CG  . PHE B 1 429 ? -13.015 59.804 339.736 1.00 45.72  ? 430 PHE B CG  1 
ATOM   7402 C CD1 . PHE B 1 429 ? -13.281 61.167 339.774 1.00 51.80  ? 430 PHE B CD1 1 
ATOM   7403 C CD2 . PHE B 1 429 ? -13.942 58.927 340.280 1.00 58.17  ? 430 PHE B CD2 1 
ATOM   7404 C CE1 . PHE B 1 429 ? -14.449 61.643 340.355 1.00 68.18  ? 430 PHE B CE1 1 
ATOM   7405 C CE2 . PHE B 1 429 ? -15.108 59.395 340.859 1.00 51.35  ? 430 PHE B CE2 1 
ATOM   7406 C CZ  . PHE B 1 429 ? -15.363 60.752 340.897 1.00 58.84  ? 430 PHE B CZ  1 
ATOM   7407 N N   . GLU B 1 430 ? -13.246 60.342 336.126 1.00 57.74  ? 431 GLU B N   1 
ATOM   7408 C CA  . GLU B 1 430 ? -13.689 61.446 335.302 1.00 67.54  ? 431 GLU B CA  1 
ATOM   7409 C C   . GLU B 1 430 ? -15.053 62.056 335.492 1.00 69.18  ? 431 GLU B C   1 
ATOM   7410 O O   . GLU B 1 430 ? -15.566 62.646 334.579 1.00 66.82  ? 431 GLU B O   1 
ATOM   7411 C CB  . GLU B 1 430 ? -13.433 61.210 333.812 1.00 60.41  ? 431 GLU B CB  1 
ATOM   7412 C CG  . GLU B 1 430 ? -13.067 59.837 333.359 1.00 59.84  ? 431 GLU B CG  1 
ATOM   7413 C CD  . GLU B 1 430 ? -12.600 59.815 331.926 1.00 85.49  ? 431 GLU B CD  1 
ATOM   7414 O OE1 . GLU B 1 430 ? -11.429 60.046 331.681 1.00 76.05  ? 431 GLU B OE1 1 
ATOM   7415 O OE2 . GLU B 1 430 ? -13.398 59.547 331.033 1.00 75.59  ? 431 GLU B OE2 1 
ATOM   7416 N N   . HIS B 1 431 ? -15.641 61.924 336.659 1.00 59.88  ? 432 HIS B N   1 
ATOM   7417 C CA  . HIS B 1 431 ? -16.929 62.523 336.889 1.00 64.41  ? 432 HIS B CA  1 
ATOM   7418 C C   . HIS B 1 431 ? -16.714 63.789 337.650 1.00 64.73  ? 432 HIS B C   1 
ATOM   7419 O O   . HIS B 1 431 ? -15.997 63.799 338.596 1.00 66.67  ? 432 HIS B O   1 
ATOM   7420 C CB  . HIS B 1 431 ? -17.870 61.608 337.651 1.00 56.54  ? 432 HIS B CB  1 
ATOM   7421 C CG  . HIS B 1 431 ? -19.079 62.307 338.173 1.00 68.63  ? 432 HIS B CG  1 
ATOM   7422 N ND1 . HIS B 1 431 ? -20.079 62.765 337.359 1.00 69.19  ? 432 HIS B ND1 1 
ATOM   7423 C CD2 . HIS B 1 431 ? -19.415 62.678 339.420 1.00 60.65  ? 432 HIS B CD2 1 
ATOM   7424 C CE1 . HIS B 1 431 ? -20.989 63.370 338.083 1.00 59.66  ? 432 HIS B CE1 1 
ATOM   7425 N NE2 . HIS B 1 431 ? -20.617 63.317 339.338 1.00 62.97  ? 432 HIS B NE2 1 
ATOM   7426 N N   . ARG B 1 432 ? -17.347 64.857 337.230 1.00 58.68  ? 433 ARG B N   1 
ATOM   7427 C CA  . ARG B 1 432 ? -17.210 66.102 337.916 1.00 58.34  ? 433 ARG B CA  1 
ATOM   7428 C C   . ARG B 1 432 ? -18.431 66.236 338.758 1.00 72.74  ? 433 ARG B C   1 
ATOM   7429 O O   . ARG B 1 432 ? -19.516 66.272 338.264 1.00 73.35  ? 433 ARG B O   1 
ATOM   7430 C CB  . ARG B 1 432 ? -17.128 67.236 336.937 1.00 66.73  ? 433 ARG B CB  1 
ATOM   7431 C CG  . ARG B 1 432 ? -17.206 68.570 337.618 1.00 69.53  ? 433 ARG B CG  1 
ATOM   7432 C CD  . ARG B 1 432 ? -16.844 69.704 336.708 1.00 58.65  ? 433 ARG B CD  1 
ATOM   7433 N NE  . ARG B 1 432 ? -17.178 70.954 337.334 1.00 68.30  ? 433 ARG B NE  1 
ATOM   7434 C CZ  . ARG B 1 432 ? -16.300 71.857 337.699 1.00 74.50  ? 433 ARG B CZ  1 
ATOM   7435 N NH1 . ARG B 1 432 ? -15.021 71.669 337.494 1.00 65.01  ? 433 ARG B NH1 1 
ATOM   7436 N NH2 . ARG B 1 432 ? -16.713 72.952 338.269 1.00 75.09  ? 433 ARG B NH2 1 
ATOM   7437 N N   . ALA B 1 433 ? -18.241 66.337 340.049 1.00 62.83  ? 434 ALA B N   1 
ATOM   7438 C CA  . ALA B 1 433 ? -19.338 66.399 340.955 1.00 61.90  ? 434 ALA B CA  1 
ATOM   7439 C C   . ALA B 1 433 ? -20.236 67.560 340.729 1.00 66.36  ? 434 ALA B C   1 
ATOM   7440 O O   . ALA B 1 433 ? -19.813 68.629 340.420 1.00 71.31  ? 434 ALA B O   1 
ATOM   7441 C CB  . ALA B 1 433 ? -18.825 66.416 342.364 1.00 66.36  ? 434 ALA B CB  1 
ATOM   7442 N N   . SER B 1 434 ? -21.516 67.333 340.888 1.00 68.69  ? 435 SER B N   1 
ATOM   7443 C CA  . SER B 1 434 ? -22.458 68.432 340.711 1.00 67.58  ? 435 SER B CA  1 
ATOM   7444 C C   . SER B 1 434 ? -22.242 69.529 341.744 1.00 67.47  ? 435 SER B C   1 
ATOM   7445 O O   . SER B 1 434 ? -22.531 70.699 341.472 1.00 71.16  ? 435 SER B O   1 
ATOM   7446 C CB  . SER B 1 434 ? -23.895 67.910 340.782 1.00 67.81  ? 435 SER B CB  1 
ATOM   7447 O OG  . SER B 1 434 ? -24.227 67.468 342.088 1.00 63.36  ? 435 SER B OG  1 
ATOM   7448 N N   . THR B 1 435 ? -21.724 69.177 342.920 1.00 69.82  ? 436 THR B N   1 
ATOM   7449 C CA  . THR B 1 435 ? -21.536 70.119 344.017 1.00 72.66  ? 436 THR B CA  1 
ATOM   7450 C C   . THR B 1 435 ? -20.152 70.756 344.030 1.00 55.04  ? 436 THR B C   1 
ATOM   7451 O O   . THR B 1 435 ? -19.808 71.434 345.005 1.00 78.59  ? 436 THR B O   1 
ATOM   7452 C CB  . THR B 1 435 ? -21.784 69.421 345.357 1.00 71.40  ? 436 THR B CB  1 
ATOM   7453 O OG1 . THR B 1 435 ? -20.871 68.324 345.497 1.00 74.65  ? 436 THR B OG1 1 
ATOM   7454 C CG2 . THR B 1 435 ? -23.214 68.900 345.435 1.00 65.73  ? 436 THR B CG2 1 
ATOM   7455 N N   . LEU B 1 436 ? -19.353 70.553 342.984 1.00 66.67  ? 437 LEU B N   1 
ATOM   7456 C CA  . LEU B 1 436 ? -17.995 71.081 342.964 1.00 76.05  ? 437 LEU B CA  1 
ATOM   7457 C C   . LEU B 1 436 ? -18.014 72.604 342.985 1.00 64.65  ? 437 LEU B C   1 
ATOM   7458 O O   . LEU B 1 436 ? -18.720 73.237 342.196 1.00 64.18  ? 437 LEU B O   1 
ATOM   7459 C CB  . LEU B 1 436 ? -17.245 70.583 341.730 1.00 74.79  ? 437 LEU B CB  1 
ATOM   7460 C CG  . LEU B 1 436 ? -15.996 69.739 341.998 1.00 74.54  ? 437 LEU B CG  1 
ATOM   7461 C CD1 . LEU B 1 436 ? -15.297 69.446 340.697 1.00 77.23  ? 437 LEU B CD1 1 
ATOM   7462 C CD2 . LEU B 1 436 ? -15.046 70.432 342.962 1.00 66.56  ? 437 LEU B CD2 1 
ATOM   7463 N N   . SER B 1 437 ? -17.236 73.191 343.890 1.00 68.74  ? 438 SER B N   1 
ATOM   7464 C CA  . SER B 1 437 ? -17.179 74.639 344.023 1.00 72.14  ? 438 SER B CA  1 
ATOM   7465 C C   . SER B 1 437 ? -16.076 75.270 343.184 1.00 74.15  ? 438 SER B C   1 
ATOM   7466 O O   . SER B 1 437 ? -16.093 76.490 342.982 1.00 78.89  ? 438 SER B O   1 
ATOM   7467 C CB  . SER B 1 437 ? -16.996 75.026 345.497 1.00 71.55  ? 438 SER B CB  1 
ATOM   7468 O OG  . SER B 1 437 ? -16.186 74.087 346.184 1.00 83.16  ? 438 SER B OG  1 
ATOM   7469 N N   . TRP B 1 438 ? -15.130 74.475 342.691 1.00 80.68  ? 439 TRP B N   1 
ATOM   7470 C CA  . TRP B 1 438 ? -14.068 74.984 341.843 1.00 65.48  ? 439 TRP B CA  1 
ATOM   7471 C C   . TRP B 1 438 ? -14.618 75.347 340.463 1.00 68.86  ? 439 TRP B C   1 
ATOM   7472 O O   . TRP B 1 438 ? -15.660 74.834 340.044 1.00 60.04  ? 439 TRP B O   1 
ATOM   7473 C CB  . TRP B 1 438 ? -12.953 73.946 341.725 1.00 63.48  ? 439 TRP B CB  1 
ATOM   7474 C CG  . TRP B 1 438 ? -12.208 73.732 343.012 1.00 71.71  ? 439 TRP B CG  1 
ATOM   7475 C CD1 . TRP B 1 438 ? -12.348 72.683 343.876 1.00 69.46  ? 439 TRP B CD1 1 
ATOM   7476 C CD2 . TRP B 1 438 ? -11.219 74.596 343.588 1.00 76.63  ? 439 TRP B CD2 1 
ATOM   7477 N NE1 . TRP B 1 438 ? -11.501 72.838 344.950 1.00 60.01  ? 439 TRP B NE1 1 
ATOM   7478 C CE2 . TRP B 1 438 ? -10.799 74.005 344.797 1.00 70.94  ? 439 TRP B CE2 1 
ATOM   7479 C CE3 . TRP B 1 438 ? -10.646 75.810 343.197 1.00 70.47  ? 439 TRP B CE3 1 
ATOM   7480 C CZ2 . TRP B 1 438 ? -9.834  74.586 345.617 1.00 71.84  ? 439 TRP B CZ2 1 
ATOM   7481 C CZ3 . TRP B 1 438 ? -9.688  76.386 344.012 1.00 68.06  ? 439 TRP B CZ3 1 
ATOM   7482 C CH2 . TRP B 1 438 ? -9.291  75.774 345.207 1.00 81.05  ? 439 TRP B CH2 1 
ATOM   7483 N N   . PRO B 1 439 ? -13.941 76.242 339.744 1.00 67.58  ? 440 PRO B N   1 
ATOM   7484 C CA  . PRO B 1 439 ? -14.429 76.649 338.421 1.00 60.95  ? 440 PRO B CA  1 
ATOM   7485 C C   . PRO B 1 439 ? -14.430 75.491 337.433 1.00 60.84  ? 440 PRO B C   1 
ATOM   7486 O O   . PRO B 1 439 ? -13.764 74.470 337.620 1.00 68.30  ? 440 PRO B O   1 
ATOM   7487 C CB  . PRO B 1 439 ? -13.439 77.741 337.997 1.00 67.75  ? 440 PRO B CB  1 
ATOM   7488 C CG  . PRO B 1 439 ? -12.216 77.483 338.820 1.00 70.55  ? 440 PRO B CG  1 
ATOM   7489 C CD  . PRO B 1 439 ? -12.727 76.981 340.131 1.00 69.57  ? 440 PRO B CD  1 
ATOM   7490 N N   . LEU B 1 440 ? -15.196 75.669 336.355 1.00 75.96  ? 441 LEU B N   1 
ATOM   7491 C CA  . LEU B 1 440 ? -15.380 74.586 335.394 1.00 71.48  ? 441 LEU B CA  1 
ATOM   7492 C C   . LEU B 1 440 ? -14.078 74.240 334.681 1.00 78.17  ? 441 LEU B C   1 
ATOM   7493 O O   . LEU B 1 440 ? -13.827 73.066 334.383 1.00 72.98  ? 441 LEU B O   1 
ATOM   7494 C CB  . LEU B 1 440 ? -16.462 74.955 334.379 1.00 74.46  ? 441 LEU B CB  1 
ATOM   7495 C CG  . LEU B 1 440 ? -17.257 73.798 333.758 1.00 87.56  ? 441 LEU B CG  1 
ATOM   7496 C CD1 . LEU B 1 440 ? -18.529 74.325 333.124 1.00 84.79  ? 441 LEU B CD1 1 
ATOM   7497 C CD2 . LEU B 1 440 ? -16.453 73.006 332.729 1.00 98.95  ? 441 LEU B CD2 1 
ATOM   7498 N N   . TRP B 1 441 ? -13.236 75.240 334.399 1.00 71.21  ? 442 TRP B N   1 
ATOM   7499 C CA  . TRP B 1 441 ? -12.029 74.965 333.623 1.00 68.79  ? 442 TRP B CA  1 
ATOM   7500 C C   . TRP B 1 441 ? -11.094 73.989 334.326 1.00 61.59  ? 442 TRP B C   1 
ATOM   7501 O O   . TRP B 1 441 ? -10.298 73.325 333.655 1.00 68.47  ? 442 TRP B O   1 
ATOM   7502 C CB  . TRP B 1 441 ? -11.287 76.265 333.287 1.00 67.80  ? 442 TRP B CB  1 
ATOM   7503 C CG  . TRP B 1 441 ? -10.704 77.012 334.458 1.00 76.19  ? 442 TRP B CG  1 
ATOM   7504 C CD1 . TRP B 1 441 ? -11.264 78.071 335.110 1.00 69.10  ? 442 TRP B CD1 1 
ATOM   7505 C CD2 . TRP B 1 441 ? -9.436  76.777 335.091 1.00 65.06  ? 442 TRP B CD2 1 
ATOM   7506 N NE1 . TRP B 1 441 ? -10.433 78.502 336.114 1.00 68.12  ? 442 TRP B NE1 1 
ATOM   7507 C CE2 . TRP B 1 441 ? -9.305  77.724 336.126 1.00 64.42  ? 442 TRP B CE2 1 
ATOM   7508 C CE3 . TRP B 1 441 ? -8.404  75.853 334.888 1.00 60.06  ? 442 TRP B CE3 1 
ATOM   7509 C CZ2 . TRP B 1 441 ? -8.187  77.774 336.960 1.00 60.77  ? 442 TRP B CZ2 1 
ATOM   7510 C CZ3 . TRP B 1 441 ? -7.292  75.904 335.716 1.00 59.99  ? 442 TRP B CZ3 1 
ATOM   7511 C CH2 . TRP B 1 441 ? -7.193  76.861 336.738 1.00 67.53  ? 442 TRP B CH2 1 
ATOM   7512 N N   . MET B 1 442 ? -11.183 73.867 335.654 1.00 68.94  ? 443 MET B N   1 
ATOM   7513 C CA  . MET B 1 442 ? -10.348 72.917 336.381 1.00 59.69  ? 443 MET B CA  1 
ATOM   7514 C C   . MET B 1 442 ? -10.760 71.467 336.145 1.00 62.63  ? 443 MET B C   1 
ATOM   7515 O O   . MET B 1 442 ? -9.984  70.558 336.465 1.00 62.14  ? 443 MET B O   1 
ATOM   7516 C CB  . MET B 1 442 ? -10.365 73.250 337.879 1.00 57.01  ? 443 MET B CB  1 
ATOM   7517 C CG  . MET B 1 442 ? -9.676  74.576 338.195 1.00 63.89  ? 443 MET B CG  1 
ATOM   7518 S SD  . MET B 1 442 ? -9.592  75.039 339.940 1.00 74.27  ? 443 MET B SD  1 
ATOM   7519 C CE  . MET B 1 442 ? -9.012  73.514 340.659 1.00 65.66  ? 443 MET B CE  1 
ATOM   7520 N N   . GLY B 1 443 ? -11.944 71.229 335.587 1.00 58.17  ? 444 GLY B N   1 
ATOM   7521 C CA  . GLY B 1 443 ? -12.318 69.872 335.209 1.00 50.47  ? 444 GLY B CA  1 
ATOM   7522 C C   . GLY B 1 443 ? -12.611 69.016 336.425 1.00 67.94  ? 444 GLY B C   1 
ATOM   7523 O O   . GLY B 1 443 ? -13.408 69.385 337.296 1.00 58.96  ? 444 GLY B O   1 
ATOM   7524 N N   . VAL B 1 444 ? -11.976 67.849 336.481 1.00 54.54  ? 445 VAL B N   1 
ATOM   7525 C CA  . VAL B 1 444 ? -12.100 66.939 337.618 1.00 56.92  ? 445 VAL B CA  1 
ATOM   7526 C C   . VAL B 1 444 ? -10.824 67.052 338.443 1.00 51.81  ? 445 VAL B C   1 
ATOM   7527 O O   . VAL B 1 444 ? -9.839  66.356 338.154 1.00 55.62  ? 445 VAL B O   1 
ATOM   7528 C CB  . VAL B 1 444 ? -12.350 65.493 337.154 1.00 65.50  ? 445 VAL B CB  1 
ATOM   7529 C CG1 . VAL B 1 444 ? -12.692 64.602 338.336 1.00 52.10  ? 445 VAL B CG1 1 
ATOM   7530 C CG2 . VAL B 1 444 ? -13.463 65.448 336.112 1.00 48.10  ? 445 VAL B CG2 1 
ATOM   7531 N N   . PRO B 1 445 ? -10.791 67.899 339.471 1.00 52.05  ? 446 PRO B N   1 
ATOM   7532 C CA  . PRO B 1 445 ? -9.518  68.239 340.115 1.00 56.03  ? 446 PRO B CA  1 
ATOM   7533 C C   . PRO B 1 445 ? -9.011  67.127 341.018 1.00 55.18  ? 446 PRO B C   1 
ATOM   7534 O O   . PRO B 1 445 ? -9.696  66.152 341.333 1.00 49.09  ? 446 PRO B O   1 
ATOM   7535 C CB  . PRO B 1 445 ? -9.843  69.501 340.923 1.00 55.92  ? 446 PRO B CB  1 
ATOM   7536 C CG  . PRO B 1 445 ? -11.209 69.946 340.449 1.00 57.58  ? 446 PRO B CG  1 
ATOM   7537 C CD  . PRO B 1 445 ? -11.899 68.694 340.020 1.00 58.53  ? 446 PRO B CD  1 
ATOM   7538 N N   . HIS B 1 446 ? -7.761  67.304 341.433 1.00 61.47  ? 447 HIS B N   1 
ATOM   7539 C CA  . HIS B 1 446 ? -7.114  66.378 342.348 1.00 64.44  ? 447 HIS B CA  1 
ATOM   7540 C C   . HIS B 1 446 ? -7.914  66.243 343.637 1.00 60.70  ? 447 HIS B C   1 
ATOM   7541 O O   . HIS B 1 446 ? -8.302  67.241 344.247 1.00 58.64  ? 447 HIS B O   1 
ATOM   7542 C CB  . HIS B 1 446 ? -5.707  66.882 342.653 1.00 66.71  ? 447 HIS B CB  1 
ATOM   7543 C CG  . HIS B 1 446 ? -4.946  66.019 343.605 1.00 64.68  ? 447 HIS B CG  1 
ATOM   7544 N ND1 . HIS B 1 446 ? -4.250  64.901 343.199 1.00 66.80  ? 447 HIS B ND1 1 
ATOM   7545 C CD2 . HIS B 1 446 ? -4.771  66.109 344.944 1.00 54.77  ? 447 HIS B CD2 1 
ATOM   7546 C CE1 . HIS B 1 446 ? -3.676  64.339 344.247 1.00 63.42  ? 447 HIS B CE1 1 
ATOM   7547 N NE2 . HIS B 1 446 ? -3.977  65.052 345.318 1.00 69.09  ? 447 HIS B NE2 1 
ATOM   7548 N N   . GLY B 1 447 ? -8.180  65.003 344.039 1.00 58.09  ? 448 GLY B N   1 
ATOM   7549 C CA  . GLY B 1 447 ? -8.802  64.742 345.318 1.00 56.80  ? 448 GLY B CA  1 
ATOM   7550 C C   . GLY B 1 447 ? -10.309 64.603 345.321 1.00 60.66  ? 448 GLY B C   1 
ATOM   7551 O O   . GLY B 1 447 ? -10.872 64.242 346.362 1.00 52.03  ? 448 GLY B O   1 
ATOM   7552 N N   . TYR B 1 448 ? -10.989 64.846 344.198 1.00 57.37  ? 449 TYR B N   1 
ATOM   7553 C CA  . TYR B 1 448 ? -12.444 64.938 344.205 1.00 58.06  ? 449 TYR B CA  1 
ATOM   7554 C C   . TYR B 1 448 ? -13.127 63.645 343.779 1.00 45.67  ? 449 TYR B C   1 
ATOM   7555 O O   . TYR B 1 448 ? -14.329 63.642 343.498 1.00 53.90  ? 449 TYR B O   1 
ATOM   7556 C CB  . TYR B 1 448 ? -12.894 66.135 343.367 1.00 48.19  ? 449 TYR B CB  1 
ATOM   7557 C CG  . TYR B 1 448 ? -12.660 67.369 344.189 1.00 62.13  ? 449 TYR B CG  1 
ATOM   7558 C CD1 . TYR B 1 448 ? -13.576 67.758 345.156 1.00 55.20  ? 449 TYR B CD1 1 
ATOM   7559 C CD2 . TYR B 1 448 ? -11.469 68.073 344.093 1.00 62.89  ? 449 TYR B CD2 1 
ATOM   7560 C CE1 . TYR B 1 448 ? -13.341 68.861 345.962 1.00 57.56  ? 449 TYR B CE1 1 
ATOM   7561 C CE2 . TYR B 1 448 ? -11.222 69.177 344.897 1.00 77.77  ? 449 TYR B CE2 1 
ATOM   7562 C CZ  . TYR B 1 448 ? -12.162 69.565 345.831 1.00 61.64  ? 449 TYR B CZ  1 
ATOM   7563 O OH  . TYR B 1 448 ? -11.919 70.663 346.626 1.00 61.95  ? 449 TYR B OH  1 
ATOM   7564 N N   . GLU B 1 449 ? -12.394 62.544 343.766 1.00 45.66  ? 450 GLU B N   1 
ATOM   7565 C CA  . GLU B 1 449 ? -13.000 61.226 343.743 1.00 52.80  ? 450 GLU B CA  1 
ATOM   7566 C C   . GLU B 1 449 ? -13.163 60.637 345.139 1.00 62.12  ? 450 GLU B C   1 
ATOM   7567 O O   . GLU B 1 449 ? -13.898 59.656 345.299 1.00 59.45  ? 450 GLU B O   1 
ATOM   7568 C CB  . GLU B 1 449 ? -12.150 60.289 342.892 1.00 47.45  ? 450 GLU B CB  1 
ATOM   7569 C CG  . GLU B 1 449 ? -10.950 59.679 343.602 1.00 48.56  ? 450 GLU B CG  1 
ATOM   7570 C CD  . GLU B 1 449 ? -9.889  60.675 344.102 1.00 64.15  ? 450 GLU B CD  1 
ATOM   7571 O OE1 . GLU B 1 449 ? -10.083 61.909 344.030 1.00 62.73  ? 450 GLU B OE1 1 
ATOM   7572 O OE2 . GLU B 1 449 ? -8.825  60.200 344.559 1.00 55.82  ? 450 GLU B OE2 1 
ATOM   7573 N N   . ILE B 1 450 ? -12.497 61.215 346.145 1.00 52.97  ? 451 ILE B N   1 
ATOM   7574 C CA  . ILE B 1 450 ? -12.505 60.645 347.490 1.00 54.40  ? 451 ILE B CA  1 
ATOM   7575 C C   . ILE B 1 450 ? -13.924 60.575 348.033 1.00 58.56  ? 451 ILE B C   1 
ATOM   7576 O O   . ILE B 1 450 ? -14.363 59.537 348.547 1.00 50.35  ? 451 ILE B O   1 
ATOM   7577 C CB  . ILE B 1 450 ? -11.589 61.461 348.419 1.00 60.68  ? 451 ILE B CB  1 
ATOM   7578 C CG1 . ILE B 1 450 ? -10.131 61.377 347.958 1.00 57.30  ? 451 ILE B CG1 1 
ATOM   7579 C CG2 . ILE B 1 450 ? -11.751 61.006 349.862 1.00 46.26  ? 451 ILE B CG2 1 
ATOM   7580 C CD1 . ILE B 1 450 ? -9.184  62.129 348.872 1.00 59.45  ? 451 ILE B CD1 1 
ATOM   7581 N N   . GLU B 1 451 ? -14.666 61.681 347.919 1.00 47.48  ? 452 GLU B N   1 
ATOM   7582 C CA  . GLU B 1 451 ? -16.015 61.747 348.466 1.00 48.97  ? 452 GLU B CA  1 
ATOM   7583 C C   . GLU B 1 451 ? -16.940 60.692 347.871 1.00 60.38  ? 452 GLU B C   1 
ATOM   7584 O O   . GLU B 1 451 ? -17.929 60.323 348.518 1.00 51.50  ? 452 GLU B O   1 
ATOM   7585 C CB  . GLU B 1 451 ? -16.595 63.145 348.247 1.00 58.51  ? 452 GLU B CB  1 
ATOM   7586 C CG  . GLU B 1 451 ? -16.456 63.651 346.814 1.00 65.69  ? 452 GLU B CG  1 
ATOM   7587 C CD  . GLU B 1 451 ? -16.682 65.147 346.697 1.00 75.36  ? 452 GLU B CD  1 
ATOM   7588 O OE1 . GLU B 1 451 ? -17.731 65.546 346.146 1.00 73.31  ? 452 GLU B OE1 1 
ATOM   7589 O OE2 . GLU B 1 451 ? -15.814 65.922 347.155 1.00 79.84  ? 452 GLU B OE2 1 
ATOM   7590 N N   . PHE B 1 452 ? -16.643 60.192 346.663 1.00 50.88  ? 453 PHE B N   1 
ATOM   7591 C CA  . PHE B 1 452 ? -17.451 59.126 346.076 1.00 46.06  ? 453 PHE B CA  1 
ATOM   7592 C C   . PHE B 1 452 ? -17.030 57.747 346.559 1.00 52.54  ? 453 PHE B C   1 
ATOM   7593 O O   . PHE B 1 452 ? -17.877 56.858 346.700 1.00 57.61  ? 453 PHE B O   1 
ATOM   7594 C CB  . PHE B 1 452 ? -17.390 59.180 344.544 1.00 59.05  ? 453 PHE B CB  1 
ATOM   7595 C CG  . PHE B 1 452 ? -18.203 60.291 343.960 1.00 57.74  ? 453 PHE B CG  1 
ATOM   7596 C CD1 . PHE B 1 452 ? -19.518 60.082 343.577 1.00 57.82  ? 453 PHE B CD1 1 
ATOM   7597 C CD2 . PHE B 1 452 ? -17.663 61.556 343.826 1.00 57.87  ? 453 PHE B CD2 1 
ATOM   7598 C CE1 . PHE B 1 452 ? -20.274 61.116 343.062 1.00 61.19  ? 453 PHE B CE1 1 
ATOM   7599 C CE2 . PHE B 1 452 ? -18.412 62.593 343.312 1.00 55.72  ? 453 PHE B CE2 1 
ATOM   7600 C CZ  . PHE B 1 452 ? -19.718 62.375 342.927 1.00 60.79  ? 453 PHE B CZ  1 
ATOM   7601 N N   . ILE B 1 453 ? -15.741 57.544 346.811 1.00 51.65  ? 454 ILE B N   1 
ATOM   7602 C CA  . ILE B 1 453 ? -15.292 56.271 347.355 1.00 65.03  ? 454 ILE B CA  1 
ATOM   7603 C C   . ILE B 1 453 ? -15.797 56.065 348.775 1.00 65.76  ? 454 ILE B C   1 
ATOM   7604 O O   . ILE B 1 453 ? -16.105 54.934 349.175 1.00 63.94  ? 454 ILE B O   1 
ATOM   7605 C CB  . ILE B 1 453 ? -13.769 56.238 347.279 1.00 61.67  ? 454 ILE B CB  1 
ATOM   7606 C CG1 . ILE B 1 453 ? -13.400 55.940 345.854 1.00 64.75  ? 454 ILE B CG1 1 
ATOM   7607 C CG2 . ILE B 1 453 ? -13.170 55.163 348.177 1.00 47.79  ? 454 ILE B CG2 1 
ATOM   7608 C CD1 . ILE B 1 453 ? -11.983 55.870 345.737 1.00 84.77  ? 454 ILE B CD1 1 
ATOM   7609 N N   . PHE B 1 454 ? -15.886 57.132 349.560 1.00 49.65  ? 455 PHE B N   1 
ATOM   7610 C CA  . PHE B 1 454 ? -16.395 57.032 350.919 1.00 57.28  ? 455 PHE B CA  1 
ATOM   7611 C C   . PHE B 1 454 ? -17.914 57.125 350.992 1.00 60.95  ? 455 PHE B C   1 
ATOM   7612 O O   . PHE B 1 454 ? -18.469 57.057 352.091 1.00 63.34  ? 455 PHE B O   1 
ATOM   7613 C CB  . PHE B 1 454 ? -15.756 58.109 351.804 1.00 45.19  ? 455 PHE B CB  1 
ATOM   7614 C CG  . PHE B 1 454 ? -14.397 57.727 352.325 1.00 57.32  ? 455 PHE B CG  1 
ATOM   7615 C CD1 . PHE B 1 454 ? -13.252 58.054 351.619 1.00 51.03  ? 455 PHE B CD1 1 
ATOM   7616 C CD2 . PHE B 1 454 ? -14.265 57.020 353.511 1.00 56.12  ? 455 PHE B CD2 1 
ATOM   7617 C CE1 . PHE B 1 454 ? -11.998 57.694 352.092 1.00 56.93  ? 455 PHE B CE1 1 
ATOM   7618 C CE2 . PHE B 1 454 ? -13.017 56.657 353.985 1.00 53.27  ? 455 PHE B CE2 1 
ATOM   7619 C CZ  . PHE B 1 454 ? -11.882 56.996 353.276 1.00 55.76  ? 455 PHE B CZ  1 
ATOM   7620 N N   . GLY B 1 455 ? -18.598 57.263 349.857 1.00 57.88  ? 456 GLY B N   1 
ATOM   7621 C CA  . GLY B 1 455 ? -20.048 57.263 349.864 1.00 62.94  ? 456 GLY B CA  1 
ATOM   7622 C C   . GLY B 1 455 ? -20.695 58.507 350.429 1.00 67.16  ? 456 GLY B C   1 
ATOM   7623 O O   . GLY B 1 455 ? -21.879 58.472 350.779 1.00 66.20  ? 456 GLY B O   1 
ATOM   7624 N N   . ILE B 1 456 ? -19.959 59.610 350.512 1.00 55.00  ? 457 ILE B N   1 
ATOM   7625 C CA  . ILE B 1 456 ? -20.466 60.885 351.025 1.00 56.05  ? 457 ILE B CA  1 
ATOM   7626 C C   . ILE B 1 456 ? -21.774 61.321 350.360 1.00 52.76  ? 457 ILE B C   1 
ATOM   7627 O O   . ILE B 1 456 ? -22.618 61.916 351.045 1.00 66.74  ? 457 ILE B O   1 
ATOM   7628 C CB  . ILE B 1 456 ? -19.389 61.976 350.897 1.00 54.15  ? 457 ILE B CB  1 
ATOM   7629 C CG1 . ILE B 1 456 ? -18.135 61.548 351.657 1.00 52.35  ? 457 ILE B CG1 1 
ATOM   7630 C CG2 . ILE B 1 456 ? -19.878 63.304 351.437 1.00 50.06  ? 457 ILE B CG2 1 
ATOM   7631 C CD1 . ILE B 1 456 ? -18.409 61.148 353.092 1.00 54.60  ? 457 ILE B CD1 1 
ATOM   7632 N N   . PRO B 1 457 ? -22.009 61.077 349.061 1.00 66.61  ? 458 PRO B N   1 
ATOM   7633 C CA  . PRO B 1 457 ? -23.311 61.467 348.485 1.00 65.43  ? 458 PRO B CA  1 
ATOM   7634 C C   . PRO B 1 457 ? -24.525 60.832 349.153 1.00 68.52  ? 458 PRO B C   1 
ATOM   7635 O O   . PRO B 1 457 ? -25.637 61.348 348.977 1.00 60.12  ? 458 PRO B O   1 
ATOM   7636 C CB  . PRO B 1 457 ? -23.189 61.029 347.019 1.00 62.58  ? 458 PRO B CB  1 
ATOM   7637 C CG  . PRO B 1 457 ? -21.764 61.174 346.729 1.00 65.39  ? 458 PRO B CG  1 
ATOM   7638 C CD  . PRO B 1 457 ? -21.046 60.752 347.990 1.00 48.75  ? 458 PRO B CD  1 
ATOM   7639 N N   . LEU B 1 458 ? -24.366 59.736 349.901 1.00 59.82  ? 459 LEU B N   1 
ATOM   7640 C CA  . LEU B 1 458 ? -25.507 59.157 350.601 1.00 59.79  ? 459 LEU B CA  1 
ATOM   7641 C C   . LEU B 1 458 ? -25.919 59.956 351.830 1.00 60.76  ? 459 LEU B C   1 
ATOM   7642 O O   . LEU B 1 458 ? -26.995 59.702 352.381 1.00 69.08  ? 459 LEU B O   1 
ATOM   7643 C CB  . LEU B 1 458 ? -25.212 57.717 351.019 1.00 48.63  ? 459 LEU B CB  1 
ATOM   7644 C CG  . LEU B 1 458 ? -24.818 56.735 349.922 1.00 62.19  ? 459 LEU B CG  1 
ATOM   7645 C CD1 . LEU B 1 458 ? -24.748 55.339 350.502 1.00 71.60  ? 459 LEU B CD1 1 
ATOM   7646 C CD2 . LEU B 1 458 ? -25.804 56.789 348.767 1.00 68.84  ? 459 LEU B CD2 1 
ATOM   7647 N N   . ASP B 1 459 ? -25.094 60.891 352.279 1.00 73.46  ? 460 ASP B N   1 
ATOM   7648 C CA  . ASP B 1 459 ? -25.431 61.726 353.423 1.00 74.97  ? 460 ASP B CA  1 
ATOM   7649 C C   . ASP B 1 459 ? -26.663 62.563 353.091 1.00 81.87  ? 460 ASP B C   1 
ATOM   7650 O O   . ASP B 1 459 ? -26.613 63.379 352.156 1.00 73.86  ? 460 ASP B O   1 
ATOM   7651 C CB  . ASP B 1 459 ? -24.238 62.617 353.776 1.00 71.75  ? 460 ASP B CB  1 
ATOM   7652 C CG  . ASP B 1 459 ? -24.453 63.448 355.038 1.00 79.31  ? 460 ASP B CG  1 
ATOM   7653 O OD1 . ASP B 1 459 ? -25.579 63.487 355.579 1.00 85.28  ? 460 ASP B OD1 1 
ATOM   7654 O OD2 . ASP B 1 459 ? -23.474 64.080 355.485 1.00 76.84  ? 460 ASP B OD2 1 
ATOM   7655 N N   . PRO B 1 460 ? -27.776 62.398 353.813 1.00 76.60  ? 461 PRO B N   1 
ATOM   7656 C CA  . PRO B 1 460 ? -28.983 63.174 353.484 1.00 83.46  ? 461 PRO B CA  1 
ATOM   7657 C C   . PRO B 1 460 ? -28.792 64.671 353.626 1.00 87.70  ? 461 PRO B C   1 
ATOM   7658 O O   . PRO B 1 460 ? -29.601 65.442 353.094 1.00 89.49  ? 461 PRO B O   1 
ATOM   7659 C CB  . PRO B 1 460 ? -30.027 62.647 354.483 1.00 93.61  ? 461 PRO B CB  1 
ATOM   7660 C CG  . PRO B 1 460 ? -29.474 61.345 354.980 1.00 99.59  ? 461 PRO B CG  1 
ATOM   7661 C CD  . PRO B 1 460 ? -27.988 61.514 354.970 1.00 90.70  ? 461 PRO B CD  1 
ATOM   7662 N N   . SER B 1 461 ? -27.744 65.106 354.323 1.00 77.73  ? 462 SER B N   1 
ATOM   7663 C CA  . SER B 1 461 ? -27.507 66.528 354.518 1.00 71.92  ? 462 SER B CA  1 
ATOM   7664 C C   . SER B 1 461 ? -27.045 67.228 353.247 1.00 88.46  ? 462 SER B C   1 
ATOM   7665 O O   . SER B 1 461 ? -27.127 68.458 353.170 1.00 83.31  ? 462 SER B O   1 
ATOM   7666 C CB  . SER B 1 461 ? -26.474 66.721 355.626 1.00 77.57  ? 462 SER B CB  1 
ATOM   7667 O OG  . SER B 1 461 ? -25.822 67.970 355.500 1.00 96.62  ? 462 SER B OG  1 
ATOM   7668 N N   . ARG B 1 462 ? -26.508 66.430 352.348 1.00 85.61  ? 463 ARG B N   1 
ATOM   7669 C CA  . ARG B 1 462 ? -25.946 66.887 351.113 1.00 98.76  ? 463 ARG B CA  1 
ATOM   7670 C C   . ARG B 1 462 ? -26.876 66.890 349.938 1.00 102.00 ? 463 ARG B C   1 
ATOM   7671 O O   . ARG B 1 462 ? -27.939 66.318 349.985 1.00 97.84  ? 463 ARG B O   1 
ATOM   7672 C CB  . ARG B 1 462 ? -24.649 66.166 350.847 1.00 89.58  ? 463 ARG B CB  1 
ATOM   7673 C CG  . ARG B 1 462 ? -23.558 66.711 351.734 1.00 79.95  ? 463 ARG B CG  1 
ATOM   7674 C CD  . ARG B 1 462 ? -22.428 65.750 351.873 1.00 79.90  ? 463 ARG B CD  1 
ATOM   7675 N NE  . ARG B 1 462 ? -21.635 66.095 353.025 1.00 91.24  ? 463 ARG B NE  1 
ATOM   7676 C CZ  . ARG B 1 462 ? -20.516 66.784 352.972 1.00 96.00  ? 463 ARG B CZ  1 
ATOM   7677 N NH1 . ARG B 1 462 ? -20.053 67.203 351.816 1.00 96.31  ? 463 ARG B NH1 1 
ATOM   7678 N NH2 . ARG B 1 462 ? -19.868 67.039 354.080 1.00 84.23  ? 463 ARG B NH2 1 
ATOM   7679 N N   . ASN B 1 463 ? -26.456 67.571 348.894 1.00 81.24  ? 464 ASN B N   1 
ATOM   7680 C CA  . ASN B 1 463 ? -27.257 67.757 347.723 1.00 83.13  ? 464 ASN B CA  1 
ATOM   7681 C C   . ASN B 1 463 ? -26.868 67.097 346.417 1.00 73.75  ? 464 ASN B C   1 
ATOM   7682 O O   . ASN B 1 463 ? -27.095 67.647 345.387 1.00 75.78  ? 464 ASN B O   1 
ATOM   7683 C CB  . ASN B 1 463 ? -27.513 69.245 347.551 1.00 96.34  ? 464 ASN B CB  1 
ATOM   7684 C CG  . ASN B 1 463 ? -28.109 69.872 348.795 1.00 112.04 ? 464 ASN B CG  1 
ATOM   7685 O OD1 . ASN B 1 463 ? -29.010 69.319 349.387 1.00 101.40 ? 464 ASN B OD1 1 
ATOM   7686 N ND2 . ASN B 1 463 ? -27.610 71.036 349.187 1.00 138.44 ? 464 ASN B ND2 1 
ATOM   7687 N N   . TYR B 1 464 ? -26.278 65.928 346.457 1.00 65.86  ? 465 TYR B N   1 
ATOM   7688 C CA  . TYR B 1 464 ? -25.923 65.217 345.250 1.00 59.26  ? 465 TYR B CA  1 
ATOM   7689 C C   . TYR B 1 464 ? -27.159 64.685 344.535 1.00 74.43  ? 465 TYR B C   1 
ATOM   7690 O O   . TYR B 1 464 ? -28.170 64.492 345.147 1.00 77.38  ? 465 TYR B O   1 
ATOM   7691 C CB  . TYR B 1 464 ? -25.014 64.042 345.584 1.00 61.65  ? 465 TYR B CB  1 
ATOM   7692 C CG  . TYR B 1 464 ? -23.664 64.420 346.097 1.00 70.25  ? 465 TYR B CG  1 
ATOM   7693 C CD1 . TYR B 1 464 ? -23.469 64.707 347.412 1.00 61.48  ? 465 TYR B CD1 1 
ATOM   7694 C CD2 . TYR B 1 464 ? -22.588 64.484 345.265 1.00 59.50  ? 465 TYR B CD2 1 
ATOM   7695 C CE1 . TYR B 1 464 ? -22.242 65.059 347.886 1.00 70.53  ? 465 TYR B CE1 1 
ATOM   7696 C CE2 . TYR B 1 464 ? -21.356 64.841 345.730 1.00 71.19  ? 465 TYR B CE2 1 
ATOM   7697 C CZ  . TYR B 1 464 ? -21.190 65.123 347.047 1.00 81.63  ? 465 TYR B CZ  1 
ATOM   7698 O OH  . TYR B 1 464 ? -19.974 65.487 347.523 1.00 61.82  ? 465 TYR B OH  1 
ATOM   7699 N N   . THR B 1 465 ? -27.069 64.442 343.238 1.00 66.69  ? 466 THR B N   1 
ATOM   7700 C CA  . THR B 1 465 ? -28.167 63.893 342.460 1.00 66.15  ? 466 THR B CA  1 
ATOM   7701 C C   . THR B 1 465 ? -28.347 62.411 342.763 1.00 63.15  ? 466 THR B C   1 
ATOM   7702 O O   . THR B 1 465 ? -27.446 61.737 343.272 1.00 59.96  ? 466 THR B O   1 
ATOM   7703 C CB  . THR B 1 465 ? -27.919 64.078 340.966 1.00 64.45  ? 466 THR B CB  1 
ATOM   7704 O OG1 . THR B 1 465 ? -26.865 63.197 340.550 1.00 59.98  ? 466 THR B OG1 1 
ATOM   7705 C CG2 . THR B 1 465 ? -27.535 65.518 340.662 1.00 47.73  ? 466 THR B CG2 1 
ATOM   7706 N N   . ALA B 1 466 ? -29.538 61.903 342.436 1.00 61.35  ? 467 ALA B N   1 
ATOM   7707 C CA  . ALA B 1 466 ? -29.809 60.485 342.636 1.00 68.82  ? 467 ALA B CA  1 
ATOM   7708 C C   . ALA B 1 466 ? -28.830 59.630 341.855 1.00 69.54  ? 467 ALA B C   1 
ATOM   7709 O O   . ALA B 1 466 ? -28.474 58.528 342.288 1.00 73.44  ? 467 ALA B O   1 
ATOM   7710 C CB  . ALA B 1 466 ? -31.244 60.159 342.226 1.00 52.60  ? 467 ALA B CB  1 
ATOM   7711 N N   . GLU B 1 467 ? -28.399 60.126 340.705 1.00 70.41  ? 468 GLU B N   1 
ATOM   7712 C CA  . GLU B 1 467 ? -27.433 59.430 339.865 1.00 75.23  ? 468 GLU B CA  1 
ATOM   7713 C C   . GLU B 1 467 ? -26.070 59.339 340.501 1.00 70.64  ? 468 GLU B C   1 
ATOM   7714 O O   . GLU B 1 467 ? -25.444 58.319 340.502 1.00 65.28  ? 468 GLU B O   1 
ATOM   7715 C CB  . GLU B 1 467 ? -27.298 60.143 338.549 1.00 68.29  ? 468 GLU B CB  1 
ATOM   7716 C CG  . GLU B 1 467 ? -27.986 59.481 337.396 1.00 89.59  ? 468 GLU B CG  1 
ATOM   7717 C CD  . GLU B 1 467 ? -27.531 60.067 336.082 1.00 119.57 ? 468 GLU B CD  1 
ATOM   7718 O OE1 . GLU B 1 467 ? -27.498 61.303 335.967 1.00 115.22 ? 468 GLU B OE1 1 
ATOM   7719 O OE2 . GLU B 1 467 ? -27.182 59.299 335.170 1.00 104.99 ? 468 GLU B OE2 1 
ATOM   7720 N N   . GLU B 1 468 ? -25.618 60.433 341.057 1.00 59.84  ? 469 GLU B N   1 
ATOM   7721 C CA  . GLU B 1 468 ? -24.347 60.439 341.779 1.00 65.79  ? 469 GLU B CA  1 
ATOM   7722 C C   . GLU B 1 468 ? -24.367 59.484 342.970 1.00 70.00  ? 469 GLU B C   1 
ATOM   7723 O O   . GLU B 1 468 ? -23.320 58.947 343.355 1.00 58.27  ? 469 GLU B O   1 
ATOM   7724 C CB  . GLU B 1 468 ? -24.024 61.863 342.230 1.00 62.24  ? 469 GLU B CB  1 
ATOM   7725 C CG  . GLU B 1 468 ? -23.629 62.789 341.080 1.00 53.19  ? 469 GLU B CG  1 
ATOM   7726 C CD  . GLU B 1 468 ? -23.473 64.238 341.508 1.00 67.54  ? 469 GLU B CD  1 
ATOM   7727 O OE1 . GLU B 1 468 ? -24.350 64.739 342.244 1.00 56.82  ? 469 GLU B OE1 1 
ATOM   7728 O OE2 . GLU B 1 468 ? -22.477 64.878 341.099 1.00 69.28  ? 469 GLU B OE2 1 
ATOM   7729 N N   . LYS B 1 469 ? -25.545 59.246 343.553 1.00 56.70  ? 470 LYS B N   1 
ATOM   7730 C CA  . LYS B 1 469 ? -25.642 58.329 344.684 1.00 59.48  ? 470 LYS B CA  1 
ATOM   7731 C C   . LYS B 1 469 ? -25.434 56.883 344.246 1.00 57.88  ? 470 LYS B C   1 
ATOM   7732 O O   . LYS B 1 469 ? -24.739 56.116 344.923 1.00 57.21  ? 470 LYS B O   1 
ATOM   7733 C CB  . LYS B 1 469 ? -26.995 58.502 345.373 1.00 63.50  ? 470 LYS B CB  1 
ATOM   7734 C CG  . LYS B 1 469 ? -27.092 59.771 346.200 1.00 57.35  ? 470 LYS B CG  1 
ATOM   7735 C CD  . LYS B 1 469 ? -28.413 59.855 346.933 1.00 59.04  ? 470 LYS B CD  1 
ATOM   7736 C CE  . LYS B 1 469 ? -29.218 61.043 346.455 1.00 59.00  ? 470 LYS B CE  1 
ATOM   7737 N NZ  . LYS B 1 469 ? -29.600 61.930 347.586 1.00 52.98  ? 470 LYS B NZ  1 
ATOM   7738 N N   . ILE B 1 470 ? -25.943 56.551 343.087 1.00 69.29  ? 471 ILE B N   1 
ATOM   7739 C CA  . ILE B 1 470 ? -25.780 55.235 342.549 1.00 68.04  ? 471 ILE B CA  1 
ATOM   7740 C C   . ILE B 1 470 ? -24.358 55.048 342.141 1.00 55.27  ? 471 ILE B C   1 
ATOM   7741 O O   . ILE B 1 470 ? -23.837 53.984 342.240 1.00 63.42  ? 471 ILE B O   1 
ATOM   7742 C CB  . ILE B 1 470 ? -26.728 55.017 341.367 1.00 73.98  ? 471 ILE B CB  1 
ATOM   7743 C CG1 . ILE B 1 470 ? -28.110 54.741 341.884 1.00 84.19  ? 471 ILE B CG1 1 
ATOM   7744 C CG2 . ILE B 1 470 ? -26.351 53.804 340.548 1.00 77.56  ? 471 ILE B CG2 1 
ATOM   7745 C CD1 . ILE B 1 470 ? -29.167 55.492 341.144 1.00 95.70  ? 471 ILE B CD1 1 
ATOM   7746 N N   . PHE B 1 471 ? -23.746 56.098 341.657 1.00 61.10  ? 472 PHE B N   1 
ATOM   7747 C CA  . PHE B 1 471 ? -22.351 56.051 341.239 1.00 61.85  ? 472 PHE B CA  1 
ATOM   7748 C C   . PHE B 1 471 ? -21.429 55.801 342.429 1.00 61.03  ? 472 PHE B C   1 
ATOM   7749 O O   . PHE B 1 471 ? -20.491 54.997 342.342 1.00 59.56  ? 472 PHE B O   1 
ATOM   7750 C CB  . PHE B 1 471 ? -21.989 57.352 340.524 1.00 62.49  ? 472 PHE B CB  1 
ATOM   7751 C CG  . PHE B 1 471 ? -20.560 57.427 340.082 1.00 59.58  ? 472 PHE B CG  1 
ATOM   7752 C CD1 . PHE B 1 471 ? -19.958 56.357 339.440 1.00 55.96  ? 472 PHE B CD1 1 
ATOM   7753 C CD2 . PHE B 1 471 ? -19.818 58.578 340.303 1.00 61.38  ? 472 PHE B CD2 1 
ATOM   7754 C CE1 . PHE B 1 471 ? -18.634 56.433 339.030 1.00 62.36  ? 472 PHE B CE1 1 
ATOM   7755 C CE2 . PHE B 1 471 ? -18.496 58.661 339.898 1.00 62.58  ? 472 PHE B CE2 1 
ATOM   7756 C CZ  . PHE B 1 471 ? -17.904 57.590 339.256 1.00 53.00  ? 472 PHE B CZ  1 
ATOM   7757 N N   . ALA B 1 472 ? -21.690 56.470 343.554 1.00 53.12  ? 473 ALA B N   1 
ATOM   7758 C CA  . ALA B 1 472 ? -20.932 56.187 344.770 1.00 61.31  ? 473 ALA B CA  1 
ATOM   7759 C C   . ALA B 1 472 ? -21.139 54.749 345.227 1.00 59.55  ? 473 ALA B C   1 
ATOM   7760 O O   . ALA B 1 472 ? -20.191 54.084 345.663 1.00 61.60  ? 473 ALA B O   1 
ATOM   7761 C CB  . ALA B 1 472 ? -21.327 57.162 345.879 1.00 56.00  ? 473 ALA B CB  1 
ATOM   7762 N N   . GLN B 1 473 ? -22.372 54.248 345.137 1.00 51.54  ? 474 GLN B N   1 
ATOM   7763 C CA  . GLN B 1 473 ? -22.614 52.869 345.549 1.00 64.30  ? 474 GLN B CA  1 
ATOM   7764 C C   . GLN B 1 473 ? -21.851 51.896 344.661 1.00 65.49  ? 474 GLN B C   1 
ATOM   7765 O O   . GLN B 1 473 ? -21.348 50.873 345.139 1.00 59.77  ? 474 GLN B O   1 
ATOM   7766 C CB  . GLN B 1 473 ? -24.116 52.572 345.546 1.00 48.27  ? 474 GLN B CB  1 
ATOM   7767 C CG  . GLN B 1 473 ? -24.848 53.210 346.723 1.00 73.44  ? 474 GLN B CG  1 
ATOM   7768 C CD  . GLN B 1 473 ? -26.349 52.976 346.701 1.00 78.89  ? 474 GLN B CD  1 
ATOM   7769 O OE1 . GLN B 1 473 ? -26.982 53.023 345.646 1.00 74.50  ? 474 GLN B OE1 1 
ATOM   7770 N NE2 . GLN B 1 473 ? -26.926 52.732 347.874 1.00 71.00  ? 474 GLN B NE2 1 
ATOM   7771 N N   . ARG B 1 474 ? -21.725 52.215 343.368 1.00 60.28  ? 475 ARG B N   1 
ATOM   7772 C CA  . ARG B 1 474 ? -20.938 51.364 342.482 1.00 64.08  ? 475 ARG B CA  1 
ATOM   7773 C C   . ARG B 1 474 ? -19.457 51.433 342.830 1.00 64.34  ? 475 ARG B C   1 
ATOM   7774 O O   . ARG B 1 474 ? -18.773 50.403 342.874 1.00 56.91  ? 475 ARG B O   1 
ATOM   7775 C CB  . ARG B 1 474 ? -21.165 51.757 341.021 1.00 59.76  ? 475 ARG B CB  1 
ATOM   7776 C CG  . ARG B 1 474 ? -20.393 50.879 340.047 1.00 80.37  ? 475 ARG B CG  1 
ATOM   7777 C CD  . ARG B 1 474 ? -21.049 50.799 338.678 1.00 68.53  ? 475 ARG B CD  1 
ATOM   7778 N NE  . ARG B 1 474 ? -21.278 52.122 338.108 1.00 58.22  ? 475 ARG B NE  1 
ATOM   7779 C CZ  . ARG B 1 474 ? -20.420 52.759 337.317 1.00 69.78  ? 475 ARG B CZ  1 
ATOM   7780 N NH1 . ARG B 1 474 ? -19.257 52.197 336.988 1.00 46.19  ? 475 ARG B NH1 1 
ATOM   7781 N NH2 . ARG B 1 474 ? -20.727 53.962 336.851 1.00 54.30  ? 475 ARG B NH2 1 
ATOM   7782 N N   . LEU B 1 475 ? -18.949 52.636 343.100 1.00 57.25  ? 476 LEU B N   1 
ATOM   7783 C CA  . LEU B 1 475 ? -17.533 52.768 343.412 1.00 55.02  ? 476 LEU B CA  1 
ATOM   7784 C C   . LEU B 1 475 ? -17.202 52.156 344.765 1.00 68.23  ? 476 LEU B C   1 
ATOM   7785 O O   . LEU B 1 475 ? -16.129 51.563 344.936 1.00 69.09  ? 476 LEU B O   1 
ATOM   7786 C CB  . LEU B 1 475 ? -17.115 54.234 343.367 1.00 56.37  ? 476 LEU B CB  1 
ATOM   7787 C CG  . LEU B 1 475 ? -16.693 54.671 341.967 1.00 67.15  ? 476 LEU B CG  1 
ATOM   7788 C CD1 . LEU B 1 475 ? -16.487 56.160 341.960 1.00 66.18  ? 476 LEU B CD1 1 
ATOM   7789 C CD2 . LEU B 1 475 ? -15.445 53.931 341.534 1.00 73.28  ? 476 LEU B CD2 1 
ATOM   7790 N N   . MET B 1 476 ? -18.107 52.285 345.740 1.00 52.31  ? 477 MET B N   1 
ATOM   7791 C CA  . MET B 1 476 ? -17.899 51.617 347.021 1.00 52.97  ? 477 MET B CA  1 
ATOM   7792 C C   . MET B 1 476 ? -17.821 50.109 346.836 1.00 57.95  ? 477 MET B C   1 
ATOM   7793 O O   . MET B 1 476 ? -17.017 49.432 347.489 1.00 53.21  ? 477 MET B O   1 
ATOM   7794 C CB  . MET B 1 476 ? -19.024 51.980 347.991 1.00 61.08  ? 477 MET B CB  1 
ATOM   7795 C CG  . MET B 1 476 ? -18.900 53.366 348.599 1.00 63.25  ? 477 MET B CG  1 
ATOM   7796 S SD  . MET B 1 476 ? -20.045 53.623 349.966 1.00 70.62  ? 477 MET B SD  1 
ATOM   7797 C CE  . MET B 1 476 ? -21.608 53.741 349.090 1.00 60.09  ? 477 MET B CE  1 
ATOM   7798 N N   . ARG B 1 477 ? -18.641 49.566 345.931 1.00 63.04  ? 478 ARG B N   1 
ATOM   7799 C CA  . ARG B 1 477 ? -18.615 48.131 345.674 1.00 64.15  ? 478 ARG B CA  1 
ATOM   7800 C C   . ARG B 1 477 ? -17.300 47.706 345.032 1.00 66.54  ? 478 ARG B C   1 
ATOM   7801 O O   . ARG B 1 477 ? -16.736 46.670 345.401 1.00 63.45  ? 478 ARG B O   1 
ATOM   7802 C CB  . ARG B 1 477 ? -19.799 47.732 344.794 1.00 68.39  ? 478 ARG B CB  1 
ATOM   7803 C CG  . ARG B 1 477 ? -19.860 46.240 344.497 1.00 77.43  ? 478 ARG B CG  1 
ATOM   7804 C CD  . ARG B 1 477 ? -20.599 45.480 345.591 1.00 75.24  ? 478 ARG B CD  1 
ATOM   7805 N NE  . ARG B 1 477 ? -22.038 45.700 345.513 1.00 90.23  ? 478 ARG B NE  1 
ATOM   7806 C CZ  . ARG B 1 477 ? -22.897 45.399 346.482 1.00 91.94  ? 478 ARG B CZ  1 
ATOM   7807 N NH1 . ARG B 1 477 ? -22.465 44.863 347.615 1.00 114.34 ? 478 ARG B NH1 1 
ATOM   7808 N NH2 . ARG B 1 477 ? -24.191 45.638 346.318 1.00 104.80 ? 478 ARG B NH2 1 
ATOM   7809 N N   . TYR B 1 478 ? -16.802 48.488 344.065 1.00 60.79  ? 479 TYR B N   1 
ATOM   7810 C CA  . TYR B 1 478 ? -15.510 48.199 343.445 1.00 50.93  ? 479 TYR B CA  1 
ATOM   7811 C C   . TYR B 1 478 ? -14.412 48.094 344.494 1.00 60.82  ? 479 TYR B C   1 
ATOM   7812 O O   . TYR B 1 478 ? -13.656 47.114 344.533 1.00 52.25  ? 479 TYR B O   1 
ATOM   7813 C CB  . TYR B 1 478 ? -15.147 49.295 342.438 1.00 68.31  ? 479 TYR B CB  1 
ATOM   7814 C CG  . TYR B 1 478 ? -15.955 49.325 341.161 1.00 55.80  ? 479 TYR B CG  1 
ATOM   7815 C CD1 . TYR B 1 478 ? -16.334 48.158 340.516 1.00 58.37  ? 479 TYR B CD1 1 
ATOM   7816 C CD2 . TYR B 1 478 ? -16.324 50.535 340.592 1.00 63.04  ? 479 TYR B CD2 1 
ATOM   7817 C CE1 . TYR B 1 478 ? -17.066 48.199 339.339 1.00 64.19  ? 479 TYR B CE1 1 
ATOM   7818 C CE2 . TYR B 1 478 ? -17.050 50.586 339.428 1.00 65.41  ? 479 TYR B CE2 1 
ATOM   7819 C CZ  . TYR B 1 478 ? -17.421 49.420 338.803 1.00 65.28  ? 479 TYR B CZ  1 
ATOM   7820 O OH  . TYR B 1 478 ? -18.149 49.492 337.639 1.00 70.27  ? 479 TYR B OH  1 
ATOM   7821 N N   . TRP B 1 479 ? -14.308 49.117 345.348 1.00 53.77  ? 480 TRP B N   1 
ATOM   7822 C CA  . TRP B 1 479 ? -13.259 49.151 346.362 1.00 59.16  ? 480 TRP B CA  1 
ATOM   7823 C C   . TRP B 1 479 ? -13.388 47.987 347.337 1.00 62.50  ? 480 TRP B C   1 
ATOM   7824 O O   . TRP B 1 479 ? -12.390 47.334 347.675 1.00 51.18  ? 480 TRP B O   1 
ATOM   7825 C CB  . TRP B 1 479 ? -13.294 50.495 347.097 1.00 60.26  ? 480 TRP B CB  1 
ATOM   7826 C CG  . TRP B 1 479 ? -12.240 51.452 346.594 1.00 56.85  ? 480 TRP B CG  1 
ATOM   7827 C CD1 . TRP B 1 479 ? -11.221 52.000 347.319 1.00 54.95  ? 480 TRP B CD1 1 
ATOM   7828 C CD2 . TRP B 1 479 ? -12.095 51.961 345.255 1.00 61.28  ? 480 TRP B CD2 1 
ATOM   7829 N NE1 . TRP B 1 479 ? -10.451 52.808 346.520 1.00 55.53  ? 480 TRP B NE1 1 
ATOM   7830 C CE2 . TRP B 1 479 ? -10.969 52.811 345.252 1.00 63.82  ? 480 TRP B CE2 1 
ATOM   7831 C CE3 . TRP B 1 479 ? -12.811 51.786 344.064 1.00 61.71  ? 480 TRP B CE3 1 
ATOM   7832 C CZ2 . TRP B 1 479 ? -10.535 53.480 344.105 1.00 61.59  ? 480 TRP B CZ2 1 
ATOM   7833 C CZ3 . TRP B 1 479 ? -12.378 52.451 342.925 1.00 64.99  ? 480 TRP B CZ3 1 
ATOM   7834 C CH2 . TRP B 1 479 ? -11.249 53.282 342.953 1.00 63.39  ? 480 TRP B CH2 1 
ATOM   7835 N N   . ALA B 1 480 ? -14.612 47.695 347.785 1.00 56.93  ? 481 ALA B N   1 
ATOM   7836 C CA  . ALA B 1 480 ? -14.807 46.596 348.726 1.00 65.10  ? 481 ALA B CA  1 
ATOM   7837 C C   . ALA B 1 480 ? -14.564 45.249 348.059 1.00 68.94  ? 481 ALA B C   1 
ATOM   7838 O O   . ALA B 1 480 ? -13.984 44.343 348.671 1.00 58.40  ? 481 ALA B O   1 
ATOM   7839 C CB  . ALA B 1 480 ? -16.213 46.653 349.317 1.00 62.08  ? 481 ALA B CB  1 
ATOM   7840 N N   . ASN B 1 481 ? -15.010 45.098 346.807 1.00 66.53  ? 482 ASN B N   1 
ATOM   7841 C CA  . ASN B 1 481 ? -14.693 43.894 346.047 1.00 55.87  ? 482 ASN B CA  1 
ATOM   7842 C C   . ASN B 1 481 ? -13.188 43.675 346.005 1.00 63.47  ? 482 ASN B C   1 
ATOM   7843 O O   . ASN B 1 481 ? -12.697 42.571 346.266 1.00 62.91  ? 482 ASN B O   1 
ATOM   7844 C CB  . ASN B 1 481 ? -15.270 43.993 344.634 1.00 67.93  ? 482 ASN B CB  1 
ATOM   7845 C CG  . ASN B 1 481 ? -16.748 43.650 344.582 1.00 74.95  ? 482 ASN B CG  1 
ATOM   7846 O OD1 . ASN B 1 481 ? -17.257 42.923 345.435 1.00 75.75  ? 482 ASN B OD1 1 
ATOM   7847 N ND2 . ASN B 1 481 ? -17.441 44.165 343.572 1.00 68.03  ? 482 ASN B ND2 1 
ATOM   7848 N N   . PHE B 1 482 ? -12.433 44.736 345.714 1.00 66.27  ? 483 PHE B N   1 
ATOM   7849 C CA  . PHE B 1 482 ? -10.983 44.602 345.703 1.00 60.04  ? 483 PHE B CA  1 
ATOM   7850 C C   . PHE B 1 482 ? -10.456 44.226 347.081 1.00 57.12  ? 483 PHE B C   1 
ATOM   7851 O O   . PHE B 1 482 ? -9.513  43.435 347.195 1.00 61.47  ? 483 PHE B O   1 
ATOM   7852 C CB  . PHE B 1 482 ? -10.321 45.889 345.208 1.00 56.90  ? 483 PHE B CB  1 
ATOM   7853 C CG  . PHE B 1 482 ? -8.820  45.830 345.243 1.00 59.80  ? 483 PHE B CG  1 
ATOM   7854 C CD1 . PHE B 1 482 ? -8.128  45.041 344.340 1.00 51.49  ? 483 PHE B CD1 1 
ATOM   7855 C CD2 . PHE B 1 482 ? -8.102  46.530 346.199 1.00 53.38  ? 483 PHE B CD2 1 
ATOM   7856 C CE1 . PHE B 1 482 ? -6.749  44.965 344.377 1.00 58.53  ? 483 PHE B CE1 1 
ATOM   7857 C CE2 . PHE B 1 482 ? -6.721  46.457 346.240 1.00 58.08  ? 483 PHE B CE2 1 
ATOM   7858 C CZ  . PHE B 1 482 ? -6.046  45.673 345.327 1.00 52.68  ? 483 PHE B CZ  1 
ATOM   7859 N N   . ALA B 1 483 ? -11.046 44.774 348.146 1.00 59.39  ? 484 ALA B N   1 
ATOM   7860 C CA  . ALA B 1 483 ? -10.538 44.452 349.479 1.00 66.53  ? 484 ALA B CA  1 
ATOM   7861 C C   . ALA B 1 483 ? -10.766 42.984 349.818 1.00 55.02  ? 484 ALA B C   1 
ATOM   7862 O O   . ALA B 1 483 ? -9.850  42.303 350.293 1.00 56.14  ? 484 ALA B O   1 
ATOM   7863 C CB  . ALA B 1 483 ? -11.174 45.357 350.534 1.00 48.27  ? 484 ALA B CB  1 
ATOM   7864 N N   . ARG B 1 484 ? -11.931 42.484 349.508 1.00 55.99  ? 485 ARG B N   1 
ATOM   7865 C CA  . ARG B 1 484 ? -12.213 41.115 349.765 1.00 69.37  ? 485 ARG B CA  1 
ATOM   7866 C C   . ARG B 1 484 ? -11.553 40.153 348.826 1.00 72.52  ? 485 ARG B C   1 
ATOM   7867 O O   . ARG B 1 484 ? -10.981 39.192 349.255 1.00 74.41  ? 485 ARG B O   1 
ATOM   7868 C CB  . ARG B 1 484 ? -13.696 40.852 349.641 1.00 66.87  ? 485 ARG B CB  1 
ATOM   7869 C CG  . ARG B 1 484 ? -14.596 41.659 350.521 1.00 61.41  ? 485 ARG B CG  1 
ATOM   7870 C CD  . ARG B 1 484 ? -15.997 41.439 350.059 1.00 55.59  ? 485 ARG B CD  1 
ATOM   7871 N NE  . ARG B 1 484 ? -16.888 42.531 350.337 1.00 60.83  ? 485 ARG B NE  1 
ATOM   7872 C CZ  . ARG B 1 484 ? -17.576 43.158 349.414 1.00 61.54  ? 485 ARG B CZ  1 
ATOM   7873 N NH1 . ARG B 1 484 ? -17.436 42.830 348.170 1.00 68.57  ? 485 ARG B NH1 1 
ATOM   7874 N NH2 . ARG B 1 484 ? -18.380 44.129 349.726 1.00 79.80  ? 485 ARG B NH2 1 
ATOM   7875 N N   . THR B 1 485 ? -11.647 40.407 347.538 1.00 64.28  ? 486 THR B N   1 
ATOM   7876 C CA  . THR B 1 485 ? -11.184 39.461 346.529 1.00 71.55  ? 486 THR B CA  1 
ATOM   7877 C C   . THR B 1 485 ? -9.836  39.815 345.925 1.00 75.43  ? 486 THR B C   1 
ATOM   7878 O O   . THR B 1 485 ? -9.125  38.912 345.463 1.00 76.65  ? 486 THR B O   1 
ATOM   7879 C CB  . THR B 1 485 ? -12.209 39.339 345.406 1.00 71.84  ? 486 THR B CB  1 
ATOM   7880 O OG1 . THR B 1 485 ? -11.965 40.366 344.434 1.00 83.94  ? 486 THR B OG1 1 
ATOM   7881 C CG2 . THR B 1 485 ? -13.595 39.473 345.956 1.00 86.87  ? 486 THR B CG2 1 
ATOM   7882 N N   . GLY B 1 486 ? -9.445  41.091 345.952 1.00 80.26  ? 487 GLY B N   1 
ATOM   7883 C CA  . GLY B 1 486 ? -8.303  41.543 345.179 1.00 61.56  ? 487 GLY B CA  1 
ATOM   7884 C C   . GLY B 1 486 ? -8.618  41.742 343.723 1.00 70.58  ? 487 GLY B C   1 
ATOM   7885 O O   . GLY B 1 486 ? -7.700  41.821 342.902 1.00 58.65  ? 487 GLY B O   1 
ATOM   7886 N N   . ASP B 1 487 ? -9.894  41.783 343.386 1.00 59.20  ? 488 ASP B N   1 
ATOM   7887 C CA  . ASP B 1 487 ? -10.460 41.986 342.072 1.00 61.70  ? 488 ASP B CA  1 
ATOM   7888 C C   . ASP B 1 487 ? -11.694 42.846 342.287 1.00 62.62  ? 488 ASP B C   1 
ATOM   7889 O O   . ASP B 1 487 ? -12.607 42.449 343.022 1.00 57.67  ? 488 ASP B O   1 
ATOM   7890 C CB  . ASP B 1 487 ? -10.820 40.649 341.430 1.00 83.56  ? 488 ASP B CB  1 
ATOM   7891 C CG  . ASP B 1 487 ? -11.266 40.789 340.009 1.00 72.16  ? 488 ASP B CG  1 
ATOM   7892 O OD1 . ASP B 1 487 ? -10.927 39.884 339.226 1.00 93.25  ? 488 ASP B OD1 1 
ATOM   7893 O OD2 . ASP B 1 487 ? -11.935 41.787 339.672 1.00 68.99  ? 488 ASP B OD2 1 
ATOM   7894 N N   . PRO B 1 488 ? -11.758 44.038 341.695 1.00 69.14  ? 489 PRO B N   1 
ATOM   7895 C CA  . PRO B 1 488 ? -12.954 44.868 341.872 1.00 64.36  ? 489 PRO B CA  1 
ATOM   7896 C C   . PRO B 1 488 ? -14.176 44.344 341.139 1.00 63.51  ? 489 PRO B C   1 
ATOM   7897 O O   . PRO B 1 488 ? -15.219 45.003 341.182 1.00 67.83  ? 489 PRO B O   1 
ATOM   7898 C CB  . PRO B 1 488 ? -12.517 46.228 341.314 1.00 62.13  ? 489 PRO B CB  1 
ATOM   7899 C CG  . PRO B 1 488 ? -11.512 45.870 340.268 1.00 61.72  ? 489 PRO B CG  1 
ATOM   7900 C CD  . PRO B 1 488 ? -10.774 44.662 340.792 1.00 61.08  ? 489 PRO B CD  1 
ATOM   7901 N N   . ASN B 1 489 ? -14.098 43.190 340.477 1.00 70.54  ? 490 ASN B N   1 
ATOM   7902 C CA  . ASN B 1 489 ? -15.196 42.717 339.644 1.00 83.19  ? 490 ASN B CA  1 
ATOM   7903 C C   . ASN B 1 489 ? -16.168 41.861 340.441 1.00 82.42  ? 490 ASN B C   1 
ATOM   7904 O O   . ASN B 1 489 ? -15.789 41.176 341.395 1.00 83.17  ? 490 ASN B O   1 
ATOM   7905 C CB  . ASN B 1 489 ? -14.676 41.915 338.451 1.00 79.55  ? 490 ASN B CB  1 
ATOM   7906 C CG  . ASN B 1 489 ? -14.117 42.799 337.364 1.00 69.99  ? 490 ASN B CG  1 
ATOM   7907 O OD1 . ASN B 1 489 ? -14.862 43.483 336.667 1.00 68.12  ? 490 ASN B OD1 1 
ATOM   7908 N ND2 . ASN B 1 489 ? -12.794 42.799 337.219 1.00 56.93  ? 490 ASN B ND2 1 
ATOM   7909 N N   . GLU B 1 490 ? -17.427 41.894 340.018 1.00 97.53  ? 491 GLU B N   1 
ATOM   7910 C CA  . GLU B 1 490 ? -18.493 41.171 340.701 1.00 123.66 ? 491 GLU B CA  1 
ATOM   7911 C C   . GLU B 1 490 ? -18.459 39.696 340.321 1.00 132.32 ? 491 GLU B C   1 
ATOM   7912 O O   . GLU B 1 490 ? -18.606 39.369 339.138 1.00 136.22 ? 491 GLU B O   1 
ATOM   7913 C CB  . GLU B 1 490 ? -19.847 41.767 340.338 1.00 117.08 ? 491 GLU B CB  1 
ATOM   7914 C CG  . GLU B 1 490 ? -19.944 43.268 340.556 1.00 125.06 ? 491 GLU B CG  1 
ATOM   7915 C CD  . GLU B 1 490 ? -20.521 43.627 341.913 1.00 130.09 ? 491 GLU B CD  1 
ATOM   7916 O OE1 . GLU B 1 490 ? -20.363 42.831 342.866 1.00 119.63 ? 491 GLU B OE1 1 
ATOM   7917 O OE2 . GLU B 1 490 ? -21.141 44.706 342.023 1.00 125.63 ? 491 GLU B OE2 1 
ATOM   7918 N N   . PRO B 1 491 ? -18.286 38.774 341.283 1.00 128.19 ? 492 PRO B N   1 
ATOM   7919 C CA  . PRO B 1 491 ? -18.258 37.344 340.962 1.00 132.75 ? 492 PRO B CA  1 
ATOM   7920 C C   . PRO B 1 491 ? -19.659 36.749 340.822 1.00 138.65 ? 492 PRO B C   1 
ATOM   7921 O O   . PRO B 1 491 ? -20.075 36.422 339.707 1.00 121.10 ? 492 PRO B O   1 
ATOM   7922 C CB  . PRO B 1 491 ? -17.515 36.723 342.157 1.00 116.14 ? 492 PRO B CB  1 
ATOM   7923 C CG  . PRO B 1 491 ? -17.323 37.844 343.173 1.00 104.38 ? 492 PRO B CG  1 
ATOM   7924 C CD  . PRO B 1 491 ? -18.137 39.016 342.726 1.00 110.13 ? 492 PRO B CD  1 
ATOM   7925 N N   . ALA B 1 496 ? -22.744 42.785 333.371 1.00 131.99 ? 497 ALA B N   1 
ATOM   7926 C CA  . ALA B 1 496 ? -21.868 43.795 333.957 1.00 121.08 ? 497 ALA B CA  1 
ATOM   7927 C C   . ALA B 1 496 ? -20.517 43.847 333.243 1.00 128.67 ? 497 ALA B C   1 
ATOM   7928 O O   . ALA B 1 496 ? -19.821 42.833 333.156 1.00 124.80 ? 497 ALA B O   1 
ATOM   7929 C CB  . ALA B 1 496 ? -21.672 43.525 335.437 1.00 110.25 ? 497 ALA B CB  1 
ATOM   7930 N N   . PRO B 1 497 ? -20.149 45.028 332.743 1.00 120.39 ? 498 PRO B N   1 
ATOM   7931 C CA  . PRO B 1 497 ? -18.883 45.157 332.006 1.00 112.83 ? 498 PRO B CA  1 
ATOM   7932 C C   . PRO B 1 497 ? -17.685 44.853 332.897 1.00 102.97 ? 498 PRO B C   1 
ATOM   7933 O O   . PRO B 1 497 ? -17.665 45.193 334.081 1.00 104.08 ? 498 PRO B O   1 
ATOM   7934 C CB  . PRO B 1 497 ? -18.885 46.619 331.544 1.00 106.76 ? 498 PRO B CB  1 
ATOM   7935 C CG  . PRO B 1 497 ? -19.873 47.313 332.438 1.00 104.81 ? 498 PRO B CG  1 
ATOM   7936 C CD  . PRO B 1 497 ? -20.903 46.291 332.792 1.00 105.93 ? 498 PRO B CD  1 
ATOM   7937 N N   . GLN B 1 498 ? -16.675 44.214 332.309 1.00 96.04  ? 499 GLN B N   1 
ATOM   7938 C CA  . GLN B 1 498 ? -15.539 43.704 333.064 1.00 83.56  ? 499 GLN B CA  1 
ATOM   7939 C C   . GLN B 1 498 ? -14.408 44.723 333.132 1.00 82.63  ? 499 GLN B C   1 
ATOM   7940 O O   . GLN B 1 498 ? -14.120 45.424 332.159 1.00 79.24  ? 499 GLN B O   1 
ATOM   7941 C CB  . GLN B 1 498 ? -15.025 42.401 332.448 1.00 94.82  ? 499 GLN B CB  1 
ATOM   7942 C CG  . GLN B 1 498 ? -15.885 41.184 332.763 1.00 97.67  ? 499 GLN B CG  1 
ATOM   7943 C CD  . GLN B 1 498 ? -16.362 41.157 334.208 1.00 103.65 ? 499 GLN B CD  1 
ATOM   7944 O OE1 . GLN B 1 498 ? -17.525 41.453 334.498 1.00 89.76  ? 499 GLN B OE1 1 
ATOM   7945 N NE2 . GLN B 1 498 ? -15.465 40.797 335.121 1.00 81.10  ? 499 GLN B NE2 1 
ATOM   7946 N N   . TRP B 1 499 ? -13.766 44.788 334.298 1.00 85.18  ? 500 TRP B N   1 
ATOM   7947 C CA  . TRP B 1 499 ? -12.599 45.632 334.508 1.00 64.40  ? 500 TRP B CA  1 
ATOM   7948 C C   . TRP B 1 499 ? -11.351 44.792 334.259 1.00 70.49  ? 500 TRP B C   1 
ATOM   7949 O O   . TRP B 1 499 ? -11.030 43.922 335.083 1.00 68.03  ? 500 TRP B O   1 
ATOM   7950 C CB  . TRP B 1 499 ? -12.602 46.186 335.928 1.00 75.16  ? 500 TRP B CB  1 
ATOM   7951 C CG  . TRP B 1 499 ? -11.652 47.325 336.208 1.00 73.81  ? 500 TRP B CG  1 
ATOM   7952 C CD1 . TRP B 1 499 ? -10.486 47.608 335.562 1.00 75.01  ? 500 TRP B CD1 1 
ATOM   7953 C CD2 . TRP B 1 499 ? -11.791 48.319 337.235 1.00 76.92  ? 500 TRP B CD2 1 
ATOM   7954 N NE1 . TRP B 1 499 ? -9.897  48.722 336.110 1.00 67.24  ? 500 TRP B NE1 1 
ATOM   7955 C CE2 . TRP B 1 499 ? -10.681 49.180 337.136 1.00 81.03  ? 500 TRP B CE2 1 
ATOM   7956 C CE3 . TRP B 1 499 ? -12.752 48.567 338.222 1.00 66.19  ? 500 TRP B CE3 1 
ATOM   7957 C CZ2 . TRP B 1 499 ? -10.502 50.274 337.992 1.00 79.59  ? 500 TRP B CZ2 1 
ATOM   7958 C CZ3 . TRP B 1 499 ? -12.574 49.649 339.071 1.00 55.70  ? 500 TRP B CZ3 1 
ATOM   7959 C CH2 . TRP B 1 499 ? -11.455 50.487 338.952 1.00 68.78  ? 500 TRP B CH2 1 
ATOM   7960 N N   . PRO B 1 500 ? -10.630 44.997 333.161 1.00 69.84  ? 501 PRO B N   1 
ATOM   7961 C CA  . PRO B 1 500 ? -9.457  44.165 332.877 1.00 62.14  ? 501 PRO B CA  1 
ATOM   7962 C C   . PRO B 1 500 ? -8.262  44.604 333.703 1.00 60.44  ? 501 PRO B C   1 
ATOM   7963 O O   . PRO B 1 500 ? -8.094  45.801 333.979 1.00 61.41  ? 501 PRO B O   1 
ATOM   7964 C CB  . PRO B 1 500 ? -9.204  44.396 331.377 1.00 54.86  ? 501 PRO B CB  1 
ATOM   7965 C CG  . PRO B 1 500 ? -10.275 45.350 330.910 1.00 69.46  ? 501 PRO B CG  1 
ATOM   7966 C CD  . PRO B 1 500 ? -10.849 46.009 332.118 1.00 58.17  ? 501 PRO B CD  1 
ATOM   7967 N N   . PRO B 1 501 ? -7.415  43.666 334.123 1.00 54.20  ? 502 PRO B N   1 
ATOM   7968 C CA  . PRO B 1 501 ? -6.162  44.050 334.782 1.00 57.49  ? 502 PRO B CA  1 
ATOM   7969 C C   . PRO B 1 501 ? -5.244  44.851 333.874 1.00 61.19  ? 502 PRO B C   1 
ATOM   7970 O O   . PRO B 1 501 ? -5.265  44.723 332.648 1.00 79.47  ? 502 PRO B O   1 
ATOM   7971 C CB  . PRO B 1 501 ? -5.528  42.705 335.168 1.00 53.09  ? 502 PRO B CB  1 
ATOM   7972 C CG  . PRO B 1 501 ? -6.368  41.655 334.541 1.00 64.04  ? 502 PRO B CG  1 
ATOM   7973 C CD  . PRO B 1 501 ? -7.726  42.248 334.347 1.00 60.68  ? 502 PRO B CD  1 
ATOM   7974 N N   . TYR B 1 502 ? -4.426  45.685 334.508 1.00 70.59  ? 503 TYR B N   1 
ATOM   7975 C CA  . TYR B 1 502 ? -3.473  46.540 333.817 1.00 65.95  ? 503 TYR B CA  1 
ATOM   7976 C C   . TYR B 1 502 ? -2.142  45.812 333.666 1.00 62.97  ? 503 TYR B C   1 
ATOM   7977 O O   . TYR B 1 502 ? -1.573  45.331 334.651 1.00 71.69  ? 503 TYR B O   1 
ATOM   7978 C CB  . TYR B 1 502 ? -3.293  47.848 334.592 1.00 54.17  ? 503 TYR B CB  1 
ATOM   7979 C CG  . TYR B 1 502 ? -2.310  48.821 333.983 1.00 56.52  ? 503 TYR B CG  1 
ATOM   7980 C CD1 . TYR B 1 502 ? -2.751  49.895 333.217 1.00 48.51  ? 503 TYR B CD1 1 
ATOM   7981 C CD2 . TYR B 1 502 ? -0.942  48.678 334.188 1.00 48.81  ? 503 TYR B CD2 1 
ATOM   7982 C CE1 . TYR B 1 502 ? -1.861  50.792 332.663 1.00 50.50  ? 503 TYR B CE1 1 
ATOM   7983 C CE2 . TYR B 1 502 ? -0.043  49.565 333.632 1.00 46.57  ? 503 TYR B CE2 1 
ATOM   7984 C CZ  . TYR B 1 502 ? -0.508  50.625 332.868 1.00 59.16  ? 503 TYR B CZ  1 
ATOM   7985 O OH  . TYR B 1 502 ? 0.372   51.528 332.306 1.00 58.21  ? 503 TYR B OH  1 
ATOM   7986 N N   . THR B 1 503 ? -1.644  45.745 332.434 1.00 71.70  ? 504 THR B N   1 
ATOM   7987 C CA  . THR B 1 503 ? -0.370  45.110 332.131 1.00 73.21  ? 504 THR B CA  1 
ATOM   7988 C C   . THR B 1 503 ? 0.524   46.093 331.388 1.00 73.71  ? 504 THR B C   1 
ATOM   7989 O O   . THR B 1 503 ? 0.050   47.040 330.753 1.00 74.48  ? 504 THR B O   1 
ATOM   7990 C CB  . THR B 1 503 ? -0.563  43.844 331.294 1.00 64.29  ? 504 THR B CB  1 
ATOM   7991 O OG1 . THR B 1 503 ? -1.375  44.158 330.155 1.00 77.09  ? 504 THR B OG1 1 
ATOM   7992 C CG2 . THR B 1 503 ? -1.253  42.770 332.114 1.00 63.10  ? 504 THR B CG2 1 
ATOM   7993 N N   . ALA B 1 504 ? 1.836   45.850 331.468 1.00 65.02  ? 505 ALA B N   1 
ATOM   7994 C CA  . ALA B 1 504 ? 2.795   46.776 330.872 1.00 62.20  ? 505 ALA B CA  1 
ATOM   7995 C C   . ALA B 1 504 ? 2.593   46.910 329.367 1.00 77.96  ? 505 ALA B C   1 
ATOM   7996 O O   . ALA B 1 504 ? 2.853   47.978 328.800 1.00 85.05  ? 505 ALA B O   1 
ATOM   7997 C CB  . ALA B 1 504 ? 4.222   46.325 331.186 1.00 69.70  ? 505 ALA B CB  1 
ATOM   7998 N N   . GLY B 1 505 ? 2.115   45.855 328.709 1.00 80.32  ? 506 GLY B N   1 
ATOM   7999 C CA  . GLY B 1 505 ? 1.887   45.894 327.277 1.00 67.68  ? 506 GLY B CA  1 
ATOM   8000 C C   . GLY B 1 505 ? 0.568   46.531 326.889 1.00 58.17  ? 506 GLY B C   1 
ATOM   8001 O O   . GLY B 1 505 ? 0.548   47.584 326.247 1.00 71.06  ? 506 GLY B O   1 
ATOM   8002 N N   . ALA B 1 506 ? -0.547  45.908 327.280 1.00 67.20  ? 507 ALA B N   1 
ATOM   8003 C CA  . ALA B 1 506 ? -1.856  46.430 326.893 1.00 63.74  ? 507 ALA B CA  1 
ATOM   8004 C C   . ALA B 1 506 ? -2.165  47.770 327.560 1.00 73.59  ? 507 ALA B C   1 
ATOM   8005 O O   . ALA B 1 506 ? -2.833  48.616 326.952 1.00 57.94  ? 507 ALA B O   1 
ATOM   8006 C CB  . ALA B 1 506 ? -2.950  45.409 327.219 1.00 51.75  ? 507 ALA B CB  1 
ATOM   8007 N N   . GLN B 1 507 ? -1.704  47.977 328.800 1.00 57.56  ? 508 GLN B N   1 
ATOM   8008 C CA  . GLN B 1 507 ? -1.905  49.238 329.523 1.00 50.07  ? 508 GLN B CA  1 
ATOM   8009 C C   . GLN B 1 507 ? -3.387  49.598 329.632 1.00 58.62  ? 508 GLN B C   1 
ATOM   8010 O O   . GLN B 1 507 ? -3.770  50.766 329.528 1.00 58.97  ? 508 GLN B O   1 
ATOM   8011 C CB  . GLN B 1 507 ? -1.121  50.384 328.877 1.00 56.82  ? 508 GLN B CB  1 
ATOM   8012 C CG  . GLN B 1 507 ? 0.387   50.179 328.838 1.00 69.23  ? 508 GLN B CG  1 
ATOM   8013 C CD  . GLN B 1 507 ? 1.082   51.173 327.924 1.00 78.88  ? 508 GLN B CD  1 
ATOM   8014 O OE1 . GLN B 1 507 ? 0.747   52.357 327.905 1.00 82.06  ? 508 GLN B OE1 1 
ATOM   8015 N NE2 . GLN B 1 507 ? 2.050   50.693 327.155 1.00 96.58  ? 508 GLN B NE2 1 
ATOM   8016 N N   . GLN B 1 508 ? -4.231  48.590 329.851 1.00 56.09  ? 509 GLN B N   1 
ATOM   8017 C CA  . GLN B 1 508 ? -5.668  48.817 329.935 1.00 55.19  ? 509 GLN B CA  1 
ATOM   8018 C C   . GLN B 1 508 ? -6.065  49.388 331.293 1.00 67.89  ? 509 GLN B C   1 
ATOM   8019 O O   . GLN B 1 508 ? -5.570  48.958 332.339 1.00 52.08  ? 509 GLN B O   1 
ATOM   8020 C CB  . GLN B 1 508 ? -6.434  47.519 329.678 1.00 63.86  ? 509 GLN B CB  1 
ATOM   8021 C CG  . GLN B 1 508 ? -6.127  46.871 328.341 1.00 76.37  ? 509 GLN B CG  1 
ATOM   8022 C CD  . GLN B 1 508 ? -6.917  45.597 328.119 1.00 69.25  ? 509 GLN B CD  1 
ATOM   8023 O OE1 . GLN B 1 508 ? -8.099  45.637 327.780 1.00 69.62  ? 509 GLN B OE1 1 
ATOM   8024 N NE2 . GLN B 1 508 ? -6.268  44.454 328.326 1.00 63.43  ? 509 GLN B NE2 1 
ATOM   8025 N N   . TYR B 1 509 ? -6.967  50.367 331.261 1.00 59.74  ? 510 TYR B N   1 
ATOM   8026 C CA  . TYR B 1 509 ? -7.573  50.951 332.446 1.00 56.83  ? 510 TYR B CA  1 
ATOM   8027 C C   . TYR B 1 509 ? -9.028  51.244 332.120 1.00 64.97  ? 510 TYR B C   1 
ATOM   8028 O O   . TYR B 1 509 ? -9.432  51.226 330.955 1.00 59.95  ? 510 TYR B O   1 
ATOM   8029 C CB  . TYR B 1 509 ? -6.857  52.232 332.880 1.00 55.65  ? 510 TYR B CB  1 
ATOM   8030 C CG  . TYR B 1 509 ? -7.039  53.388 331.923 1.00 53.86  ? 510 TYR B CG  1 
ATOM   8031 C CD1 . TYR B 1 509 ? -8.062  54.312 332.108 1.00 60.67  ? 510 TYR B CD1 1 
ATOM   8032 C CD2 . TYR B 1 509 ? -6.186  53.562 330.837 1.00 49.60  ? 510 TYR B CD2 1 
ATOM   8033 C CE1 . TYR B 1 509 ? -8.237  55.371 331.239 1.00 58.74  ? 510 TYR B CE1 1 
ATOM   8034 C CE2 . TYR B 1 509 ? -6.348  54.626 329.963 1.00 46.65  ? 510 TYR B CE2 1 
ATOM   8035 C CZ  . TYR B 1 509 ? -7.375  55.526 330.172 1.00 56.44  ? 510 TYR B CZ  1 
ATOM   8036 O OH  . TYR B 1 509 ? -7.551  56.588 329.318 1.00 57.28  ? 510 TYR B OH  1 
ATOM   8037 N N   . VAL B 1 510 ? -9.828  51.522 333.148 1.00 54.83  ? 511 VAL B N   1 
ATOM   8038 C CA  . VAL B 1 510 ? -11.223 51.869 332.913 1.00 60.70  ? 511 VAL B CA  1 
ATOM   8039 C C   . VAL B 1 510 ? -11.478 53.287 333.393 1.00 59.76  ? 511 VAL B C   1 
ATOM   8040 O O   . VAL B 1 510 ? -10.762 53.835 334.235 1.00 55.78  ? 511 VAL B O   1 
ATOM   8041 C CB  . VAL B 1 510 ? -12.219 50.901 333.584 1.00 65.35  ? 511 VAL B CB  1 
ATOM   8042 C CG1 . VAL B 1 510 ? -11.865 49.460 333.266 1.00 63.56  ? 511 VAL B CG1 1 
ATOM   8043 C CG2 . VAL B 1 510 ? -12.283 51.158 335.079 1.00 63.76  ? 511 VAL B CG2 1 
ATOM   8044 N N   . SER B 1 511 ? -12.524 53.880 332.840 1.00 56.47  ? 512 SER B N   1 
ATOM   8045 C CA  . SER B 1 511 ? -12.948 55.213 333.222 1.00 71.47  ? 512 SER B CA  1 
ATOM   8046 C C   . SER B 1 511 ? -14.117 55.108 334.194 1.00 68.33  ? 512 SER B C   1 
ATOM   8047 O O   . SER B 1 511 ? -14.986 54.241 334.051 1.00 56.73  ? 512 SER B O   1 
ATOM   8048 C CB  . SER B 1 511 ? -13.323 56.030 331.982 1.00 57.21  ? 512 SER B CB  1 
ATOM   8049 O OG  . SER B 1 511 ? -14.724 56.072 331.787 1.00 76.27  ? 512 SER B OG  1 
ATOM   8050 N N   . LEU B 1 512 ? -14.119 55.971 335.203 1.00 61.27  ? 513 LEU B N   1 
ATOM   8051 C CA  . LEU B 1 512 ? -15.134 55.942 336.248 1.00 49.89  ? 513 LEU B CA  1 
ATOM   8052 C C   . LEU B 1 512 ? -15.962 57.214 336.155 1.00 61.22  ? 513 LEU B C   1 
ATOM   8053 O O   . LEU B 1 512 ? -15.468 58.305 336.465 1.00 53.01  ? 513 LEU B O   1 
ATOM   8054 C CB  . LEU B 1 512 ? -14.495 55.806 337.625 1.00 48.39  ? 513 LEU B CB  1 
ATOM   8055 C CG  . LEU B 1 512 ? -13.646 54.555 337.797 1.00 59.76  ? 513 LEU B CG  1 
ATOM   8056 C CD1 . LEU B 1 512 ? -12.957 54.561 339.159 1.00 49.58  ? 513 LEU B CD1 1 
ATOM   8057 C CD2 . LEU B 1 512 ? -14.533 53.333 337.625 1.00 48.75  ? 513 LEU B CD2 1 
ATOM   8058 N N   . ASP B 1 513 ? -17.212 57.073 335.725 1.00 45.79  ? 514 ASP B N   1 
ATOM   8059 C CA  . ASP B 1 513 ? -18.159 58.182 335.732 1.00 53.21  ? 514 ASP B CA  1 
ATOM   8060 C C   . ASP B 1 513 ? -19.565 57.594 335.699 1.00 55.41  ? 514 ASP B C   1 
ATOM   8061 O O   . ASP B 1 513 ? -19.756 56.395 335.924 1.00 59.97  ? 514 ASP B O   1 
ATOM   8062 C CB  . ASP B 1 513 ? -17.886 59.159 334.578 1.00 68.89  ? 514 ASP B CB  1 
ATOM   8063 C CG  . ASP B 1 513 ? -17.936 58.496 333.207 1.00 75.70  ? 514 ASP B CG  1 
ATOM   8064 O OD1 . ASP B 1 513 ? -18.267 57.296 333.117 1.00 66.17  ? 514 ASP B OD1 1 
ATOM   8065 O OD2 . ASP B 1 513 ? -17.646 59.189 332.209 1.00 93.01  ? 514 ASP B OD2 1 
ATOM   8066 N N   . LEU B 1 514 ? -20.555 58.446 335.413 1.00 56.05  ? 515 LEU B N   1 
ATOM   8067 C CA  . LEU B 1 514 ? -21.948 58.013 335.446 1.00 57.84  ? 515 LEU B CA  1 
ATOM   8068 C C   . LEU B 1 514 ? -22.240 56.939 334.404 1.00 64.52  ? 515 LEU B C   1 
ATOM   8069 O O   . LEU B 1 514 ? -23.164 56.137 334.587 1.00 74.60  ? 515 LEU B O   1 
ATOM   8070 C CB  . LEU B 1 514 ? -22.866 59.220 335.248 1.00 53.72  ? 515 LEU B CB  1 
ATOM   8071 C CG  . LEU B 1 514 ? -22.601 60.365 336.229 1.00 68.16  ? 515 LEU B CG  1 
ATOM   8072 C CD1 . LEU B 1 514 ? -23.616 61.497 336.084 1.00 47.94  ? 515 LEU B CD1 1 
ATOM   8073 C CD2 . LEU B 1 514 ? -22.593 59.824 337.650 1.00 56.48  ? 515 LEU B CD2 1 
ATOM   8074 N N   . ARG B 1 515 ? -21.477 56.907 333.313 1.00 65.77  ? 516 ARG B N   1 
ATOM   8075 C CA  . ARG B 1 515 ? -21.655 55.885 332.296 1.00 64.94  ? 516 ARG B CA  1 
ATOM   8076 C C   . ARG B 1 515 ? -21.082 54.555 332.782 1.00 62.15  ? 516 ARG B C   1 
ATOM   8077 O O   . ARG B 1 515 ? -20.290 54.520 333.725 1.00 65.17  ? 516 ARG B O   1 
ATOM   8078 C CB  . ARG B 1 515 ? -20.973 56.309 330.995 1.00 66.72  ? 516 ARG B CB  1 
ATOM   8079 C CG  . ARG B 1 515 ? -21.363 57.697 330.497 1.00 77.55  ? 516 ARG B CG  1 
ATOM   8080 C CD  . ARG B 1 515 ? -20.269 58.309 329.623 1.00 75.82  ? 516 ARG B CD  1 
ATOM   8081 N NE  . ARG B 1 515 ? -19.445 57.293 328.971 1.00 85.69  ? 516 ARG B NE  1 
ATOM   8082 C CZ  . ARG B 1 515 ? -18.123 57.201 329.102 1.00 93.11  ? 516 ARG B CZ  1 
ATOM   8083 N NH1 . ARG B 1 515 ? -17.465 58.069 329.859 1.00 90.32  ? 516 ARG B NH1 1 
ATOM   8084 N NH2 . ARG B 1 515 ? -17.457 56.241 328.471 1.00 87.14  ? 516 ARG B NH2 1 
ATOM   8085 N N   . PRO B 1 516 ? -21.479 53.442 332.164 1.00 70.31  ? 517 PRO B N   1 
ATOM   8086 C CA  . PRO B 1 516 ? -20.854 52.152 332.494 1.00 64.95  ? 517 PRO B CA  1 
ATOM   8087 C C   . PRO B 1 516 ? -19.359 52.168 332.208 1.00 63.75  ? 517 PRO B C   1 
ATOM   8088 O O   . PRO B 1 516 ? -18.828 53.061 331.543 1.00 66.82  ? 517 PRO B O   1 
ATOM   8089 C CB  . PRO B 1 516 ? -21.588 51.157 331.584 1.00 54.86  ? 517 PRO B CB  1 
ATOM   8090 C CG  . PRO B 1 516 ? -22.912 51.802 331.331 1.00 66.02  ? 517 PRO B CG  1 
ATOM   8091 C CD  . PRO B 1 516 ? -22.624 53.277 331.247 1.00 62.31  ? 517 PRO B CD  1 
ATOM   8092 N N   . LEU B 1 517 ? -18.674 51.146 332.720 1.00 68.03  ? 518 LEU B N   1 
ATOM   8093 C CA  . LEU B 1 517 ? -17.237 51.018 332.506 1.00 58.80  ? 518 LEU B CA  1 
ATOM   8094 C C   . LEU B 1 517 ? -16.902 50.937 331.021 1.00 80.41  ? 518 LEU B C   1 
ATOM   8095 O O   . LEU B 1 517 ? -17.471 50.127 330.284 1.00 73.06  ? 518 LEU B O   1 
ATOM   8096 C CB  . LEU B 1 517 ? -16.699 49.779 333.216 1.00 55.52  ? 518 LEU B CB  1 
ATOM   8097 C CG  . LEU B 1 517 ? -16.572 49.870 334.734 1.00 73.37  ? 518 LEU B CG  1 
ATOM   8098 C CD1 . LEU B 1 517 ? -15.747 48.707 335.261 1.00 63.44  ? 518 LEU B CD1 1 
ATOM   8099 C CD2 . LEU B 1 517 ? -15.961 51.199 335.127 1.00 76.73  ? 518 LEU B CD2 1 
ATOM   8100 N N   . GLU B 1 518 ? -15.970 51.784 330.591 1.00 77.56  ? 519 GLU B N   1 
ATOM   8101 C CA  . GLU B 1 518 ? -15.369 51.714 329.268 1.00 75.39  ? 519 GLU B CA  1 
ATOM   8102 C C   . GLU B 1 518 ? -13.874 51.486 329.434 1.00 67.85  ? 519 GLU B C   1 
ATOM   8103 O O   . GLU B 1 518 ? -13.236 52.113 330.285 1.00 73.27  ? 519 GLU B O   1 
ATOM   8104 C CB  . GLU B 1 518 ? -15.635 52.997 328.463 1.00 65.70  ? 519 GLU B CB  1 
ATOM   8105 C CG  . GLU B 1 518 ? -14.854 53.099 327.163 1.00 91.78  ? 519 GLU B CG  1 
ATOM   8106 C CD  . GLU B 1 518 ? -14.706 54.529 326.683 1.00 91.86  ? 519 GLU B CD  1 
ATOM   8107 O OE1 . GLU B 1 518 ? -15.276 55.435 327.327 1.00 89.77  ? 519 GLU B OE1 1 
ATOM   8108 O OE2 . GLU B 1 518 ? -14.014 54.745 325.664 1.00 104.69 ? 519 GLU B OE2 1 
ATOM   8109 N N   . VAL B 1 519 ? -13.320 50.574 328.641 1.00 71.74  ? 520 VAL B N   1 
ATOM   8110 C CA  . VAL B 1 519 ? -11.898 50.252 328.695 1.00 57.41  ? 520 VAL B CA  1 
ATOM   8111 C C   . VAL B 1 519 ? -11.136 51.166 327.746 1.00 70.28  ? 520 VAL B C   1 
ATOM   8112 O O   . VAL B 1 519 ? -11.610 51.485 326.649 1.00 73.33  ? 520 VAL B O   1 
ATOM   8113 C CB  . VAL B 1 519 ? -11.666 48.772 328.350 1.00 57.23  ? 520 VAL B CB  1 
ATOM   8114 C CG1 . VAL B 1 519 ? -10.184 48.412 328.460 1.00 54.55  ? 520 VAL B CG1 1 
ATOM   8115 C CG2 . VAL B 1 519 ? -12.513 47.896 329.257 1.00 62.37  ? 520 VAL B CG2 1 
ATOM   8116 N N   . ARG B 1 520 ? -9.951  51.601 328.173 1.00 59.37  ? 521 ARG B N   1 
ATOM   8117 C CA  . ARG B 1 520 ? -9.075  52.417 327.348 1.00 49.56  ? 521 ARG B CA  1 
ATOM   8118 C C   . ARG B 1 520 ? -7.648  51.920 327.515 1.00 58.09  ? 521 ARG B C   1 
ATOM   8119 O O   . ARG B 1 520 ? -7.361  51.067 328.357 1.00 60.29  ? 521 ARG B O   1 
ATOM   8120 C CB  . ARG B 1 520 ? -9.172  53.900 327.708 1.00 45.65  ? 521 ARG B CB  1 
ATOM   8121 C CG  . ARG B 1 520 ? -10.547 54.494 327.507 1.00 49.15  ? 521 ARG B CG  1 
ATOM   8122 C CD  . ARG B 1 520 ? -10.612 55.900 328.069 1.00 60.41  ? 521 ARG B CD  1 
ATOM   8123 N NE  . ARG B 1 520 ? -11.973 56.426 328.044 1.00 70.96  ? 521 ARG B NE  1 
ATOM   8124 C CZ  . ARG B 1 520 ? -12.340 57.567 328.617 1.00 76.00  ? 521 ARG B CZ  1 
ATOM   8125 N NH1 . ARG B 1 520 ? -11.443 58.305 329.262 1.00 71.03  ? 521 ARG B NH1 1 
ATOM   8126 N NH2 . ARG B 1 520 ? -13.601 57.973 328.544 1.00 73.73  ? 521 ARG B NH2 1 
ATOM   8127 N N   . ARG B 1 521 ? -6.761  52.431 326.694 1.00 56.44  ? 522 ARG B N   1 
ATOM   8128 C CA  . ARG B 1 521 ? -5.386  52.026 326.742 1.00 54.73  ? 522 ARG B CA  1 
ATOM   8129 C C   . ARG B 1 521 ? -4.509  53.210 326.951 1.00 61.68  ? 522 ARG B C   1 
ATOM   8130 O O   . ARG B 1 521 ? -4.713  54.216 326.346 1.00 59.05  ? 522 ARG B O   1 
ATOM   8131 C CB  . ARG B 1 521 ? -4.962  51.420 325.418 1.00 67.78  ? 522 ARG B CB  1 
ATOM   8132 C CG  . ARG B 1 521 ? -5.558  50.094 325.053 1.00 63.51  ? 522 ARG B CG  1 
ATOM   8133 C CD  . ARG B 1 521 ? -4.796  49.468 323.921 1.00 53.86  ? 522 ARG B CD  1 
ATOM   8134 N NE  . ARG B 1 521 ? -3.472  49.086 324.341 1.00 67.55  ? 522 ARG B NE  1 
ATOM   8135 C CZ  . ARG B 1 521 ? -2.370  49.343 323.674 1.00 73.16  ? 522 ARG B CZ  1 
ATOM   8136 N NH1 . ARG B 1 521 ? -2.427  49.956 322.530 1.00 72.22  ? 522 ARG B NH1 1 
ATOM   8137 N NH2 . ARG B 1 521 ? -1.218  48.966 324.150 1.00 61.10  ? 522 ARG B NH2 1 
ATOM   8138 N N   . GLY B 1 522 ? -3.533  53.083 327.822 1.00 61.82  ? 523 GLY B N   1 
ATOM   8139 C CA  . GLY B 1 522 ? -2.577  54.127 328.037 1.00 65.75  ? 523 GLY B CA  1 
ATOM   8140 C C   . GLY B 1 522 ? -2.834  55.241 328.994 1.00 66.74  ? 523 GLY B C   1 
ATOM   8141 O O   . GLY B 1 522 ? -3.689  56.047 328.784 1.00 71.38  ? 523 GLY B O   1 
ATOM   8142 N N   . LEU B 1 523 ? -2.051  55.295 330.044 1.00 63.74  ? 524 LEU B N   1 
ATOM   8143 C CA  . LEU B 1 523 ? -2.161  56.369 330.982 1.00 65.68  ? 524 LEU B CA  1 
ATOM   8144 C C   . LEU B 1 523 ? -1.203  57.434 330.520 1.00 58.28  ? 524 LEU B C   1 
ATOM   8145 O O   . LEU B 1 523 ? -0.054  57.360 330.846 1.00 62.54  ? 524 LEU B O   1 
ATOM   8146 C CB  . LEU B 1 523 ? -1.775  55.899 332.366 1.00 63.31  ? 524 LEU B CB  1 
ATOM   8147 C CG  . LEU B 1 523 ? -2.703  54.877 332.980 1.00 67.55  ? 524 LEU B CG  1 
ATOM   8148 C CD1 . LEU B 1 523 ? -2.137  54.281 334.233 1.00 56.53  ? 524 LEU B CD1 1 
ATOM   8149 C CD2 . LEU B 1 523 ? -4.047  55.485 333.255 1.00 65.54  ? 524 LEU B CD2 1 
ATOM   8150 N N   A ARG B 1 524 ? -1.701  58.279 329.624 0.53 60.16  ? 525 ARG B N   1 
ATOM   8151 N N   B ARG B 1 524 ? -1.698  58.268 329.615 0.47 60.17  ? 525 ARG B N   1 
ATOM   8152 C CA  A ARG B 1 524 ? -0.903  59.342 329.007 0.53 60.31  ? 525 ARG B CA  1 
ATOM   8153 C CA  B ARG B 1 524 ? -0.915  59.334 328.989 0.47 60.46  ? 525 ARG B CA  1 
ATOM   8154 C C   A ARG B 1 524 ? 0.434   58.784 328.522 0.53 56.64  ? 525 ARG B C   1 
ATOM   8155 C C   B ARG B 1 524 ? 0.434   58.785 328.520 0.47 56.60  ? 525 ARG B C   1 
ATOM   8156 O O   A ARG B 1 524 ? 1.510   59.257 328.896 0.53 55.11  ? 525 ARG B O   1 
ATOM   8157 O O   B ARG B 1 524 ? 1.505   59.260 328.902 0.47 55.12  ? 525 ARG B O   1 
ATOM   8158 C CB  A ARG B 1 524 ? -0.692  60.513 329.974 0.53 59.97  ? 525 ARG B CB  1 
ATOM   8159 C CB  B ARG B 1 524 ? -0.736  60.520 329.942 0.47 59.94  ? 525 ARG B CB  1 
ATOM   8160 C CG  A ARG B 1 524 ? -1.955  61.018 330.658 0.53 57.20  ? 525 ARG B CG  1 
ATOM   8161 C CG  B ARG B 1 524 ? -2.035  61.039 330.545 0.47 57.23  ? 525 ARG B CG  1 
ATOM   8162 C CD  A ARG B 1 524 ? -2.540  62.217 329.930 0.53 63.06  ? 525 ARG B CD  1 
ATOM   8163 C CD  B ARG B 1 524 ? -2.262  62.499 330.195 0.47 63.19  ? 525 ARG B CD  1 
ATOM   8164 N NE  A ARG B 1 524 ? -1.560  63.286 329.744 0.53 71.43  ? 525 ARG B NE  1 
ATOM   8165 N NE  B ARG B 1 524 ? -2.123  63.363 331.362 0.47 59.85  ? 525 ARG B NE  1 
ATOM   8166 C CZ  A ARG B 1 524 ? -1.475  64.037 328.650 0.53 55.47  ? 525 ARG B CZ  1 
ATOM   8167 C CZ  B ARG B 1 524 ? -3.097  64.123 331.853 0.47 62.32  ? 525 ARG B CZ  1 
ATOM   8168 N NH1 A ARG B 1 524 ? -2.313  63.833 327.643 0.53 57.72  ? 525 ARG B NH1 1 
ATOM   8169 N NH1 B ARG B 1 524 ? -4.287  64.136 331.272 0.47 41.41  ? 525 ARG B NH1 1 
ATOM   8170 N NH2 A ARG B 1 524 ? -0.554  64.988 328.560 0.53 38.92  ? 525 ARG B NH2 1 
ATOM   8171 N NH2 B ARG B 1 524 ? -2.876  64.875 332.925 0.47 70.70  ? 525 ARG B NH2 1 
ATOM   8172 N N   . ALA B 1 525 ? 0.349   57.748 327.682 1.00 60.53  ? 526 ALA B N   1 
ATOM   8173 C CA  . ALA B 1 525 ? 1.533   56.968 327.322 1.00 58.01  ? 526 ALA B CA  1 
ATOM   8174 C C   . ALA B 1 525 ? 2.584   57.815 326.615 1.00 71.21  ? 526 ALA B C   1 
ATOM   8175 O O   . ALA B 1 525 ? 3.779   57.713 326.921 1.00 60.63  ? 526 ALA B O   1 
ATOM   8176 C CB  . ALA B 1 525 ? 1.128   55.780 326.449 1.00 55.07  ? 526 ALA B CB  1 
ATOM   8177 N N   . GLN B 1 526 ? 2.163   58.651 325.660 1.00 50.60  ? 527 GLN B N   1 
ATOM   8178 C CA  . GLN B 1 526 ? 3.126   59.492 324.953 1.00 67.13  ? 527 GLN B CA  1 
ATOM   8179 C C   . GLN B 1 526 ? 3.796   60.465 325.913 1.00 63.49  ? 527 GLN B C   1 
ATOM   8180 O O   . GLN B 1 526 ? 5.028   60.578 325.945 1.00 60.29  ? 527 GLN B O   1 
ATOM   8181 C CB  . GLN B 1 526 ? 2.443   60.246 323.809 1.00 61.97  ? 527 GLN B CB  1 
ATOM   8182 C CG  . GLN B 1 526 ? 2.076   59.383 322.616 1.00 52.75  ? 527 GLN B CG  1 
ATOM   8183 C CD  . GLN B 1 526 ? 3.276   58.689 322.007 1.00 70.76  ? 527 GLN B CD  1 
ATOM   8184 O OE1 . GLN B 1 526 ? 3.341   57.460 321.970 1.00 76.25  ? 527 GLN B OE1 1 
ATOM   8185 N NE2 . GLN B 1 526 ? 4.233   59.473 321.522 1.00 71.27  ? 527 GLN B NE2 1 
ATOM   8186 N N   . ALA B 1 527 ? 2.997   61.168 326.718 1.00 60.84  ? 528 ALA B N   1 
ATOM   8187 C CA  . ALA B 1 527 ? 3.558   62.133 327.659 1.00 58.11  ? 528 ALA B CA  1 
ATOM   8188 C C   . ALA B 1 527 ? 4.456   61.446 328.678 1.00 61.23  ? 528 ALA B C   1 
ATOM   8189 O O   . ALA B 1 527 ? 5.556   61.923 328.981 1.00 65.15  ? 528 ALA B O   1 
ATOM   8190 C CB  . ALA B 1 527 ? 2.436   62.899 328.361 1.00 57.77  ? 528 ALA B CB  1 
ATOM   8191 N N   . CYS B 1 528 ? 4.011   60.309 329.209 1.00 41.45  ? 529 CYS B N   1 
ATOM   8192 C CA  . CYS B 1 528 ? 4.772   59.673 330.274 1.00 63.79  ? 529 CYS B CA  1 
ATOM   8193 C C   . CYS B 1 528 ? 6.027   58.986 329.763 1.00 62.19  ? 529 CYS B C   1 
ATOM   8194 O O   . CYS B 1 528 ? 6.943   58.735 330.555 1.00 62.08  ? 529 CYS B O   1 
ATOM   8195 C CB  . CYS B 1 528 ? 3.885   58.690 331.035 1.00 58.09  ? 529 CYS B CB  1 
ATOM   8196 S SG  . CYS B 1 528 ? 2.697   59.555 332.084 1.00 52.98  ? 529 CYS B SG  1 
ATOM   8197 N N   . ALA B 1 529 ? 6.101   58.685 328.465 1.00 58.33  ? 530 ALA B N   1 
ATOM   8198 C CA  . ALA B 1 529 ? 7.365   58.229 327.901 1.00 51.83  ? 530 ALA B CA  1 
ATOM   8199 C C   . ALA B 1 529 ? 8.430   59.305 328.039 1.00 54.78  ? 530 ALA B C   1 
ATOM   8200 O O   . ALA B 1 529 ? 9.603   59.007 328.293 1.00 52.26  ? 530 ALA B O   1 
ATOM   8201 C CB  . ALA B 1 529 ? 7.186   57.827 326.436 1.00 48.38  ? 530 ALA B CB  1 
ATOM   8202 N N   . PHE B 1 530 ? 8.033   60.569 327.900 1.00 59.23  ? 531 PHE B N   1 
ATOM   8203 C CA  . PHE B 1 530 ? 8.977   61.662 328.094 1.00 53.42  ? 531 PHE B CA  1 
ATOM   8204 C C   . PHE B 1 530 ? 9.468   61.709 329.534 1.00 62.67  ? 531 PHE B C   1 
ATOM   8205 O O   . PHE B 1 530 ? 10.671  61.842 329.790 1.00 69.66  ? 531 PHE B O   1 
ATOM   8206 C CB  . PHE B 1 530 ? 8.327   62.987 327.699 1.00 63.02  ? 531 PHE B CB  1 
ATOM   8207 C CG  . PHE B 1 530 ? 9.066   64.193 328.197 1.00 63.69  ? 531 PHE B CG  1 
ATOM   8208 C CD1 . PHE B 1 530 ? 8.613   64.893 329.302 1.00 60.12  ? 531 PHE B CD1 1 
ATOM   8209 C CD2 . PHE B 1 530 ? 10.220  64.621 327.565 1.00 60.82  ? 531 PHE B CD2 1 
ATOM   8210 C CE1 . PHE B 1 530 ? 9.301   66.000 329.764 1.00 74.66  ? 531 PHE B CE1 1 
ATOM   8211 C CE2 . PHE B 1 530 ? 10.908  65.727 328.020 1.00 59.79  ? 531 PHE B CE2 1 
ATOM   8212 C CZ  . PHE B 1 530 ? 10.450  66.417 329.118 1.00 71.64  ? 531 PHE B CZ  1 
ATOM   8213 N N   . TRP B 1 531 ? 8.547   61.587 330.495 1.00 50.25  ? 532 TRP B N   1 
ATOM   8214 C CA  . TRP B 1 531 ? 8.908   61.781 331.895 1.00 64.90  ? 532 TRP B CA  1 
ATOM   8215 C C   . TRP B 1 531 ? 9.614   60.571 332.491 1.00 61.04  ? 532 TRP B C   1 
ATOM   8216 O O   . TRP B 1 531 ? 10.463  60.734 333.374 1.00 62.35  ? 532 TRP B O   1 
ATOM   8217 C CB  . TRP B 1 531 ? 7.664   62.106 332.727 1.00 55.30  ? 532 TRP B CB  1 
ATOM   8218 C CG  . TRP B 1 531 ? 7.016   63.417 332.385 1.00 53.85  ? 532 TRP B CG  1 
ATOM   8219 C CD1 . TRP B 1 531 ? 5.873   63.600 331.667 1.00 49.76  ? 532 TRP B CD1 1 
ATOM   8220 C CD2 . TRP B 1 531 ? 7.465   64.726 332.762 1.00 49.60  ? 532 TRP B CD2 1 
ATOM   8221 N NE1 . TRP B 1 531 ? 5.582   64.938 331.566 1.00 51.49  ? 532 TRP B NE1 1 
ATOM   8222 C CE2 . TRP B 1 531 ? 6.544   65.652 332.230 1.00 44.61  ? 532 TRP B CE2 1 
ATOM   8223 C CE3 . TRP B 1 531 ? 8.553   65.204 333.500 1.00 38.59  ? 532 TRP B CE3 1 
ATOM   8224 C CZ2 . TRP B 1 531 ? 6.680   67.029 332.406 1.00 43.71  ? 532 TRP B CZ2 1 
ATOM   8225 C CZ3 . TRP B 1 531 ? 8.688   66.576 333.674 1.00 51.31  ? 532 TRP B CZ3 1 
ATOM   8226 C CH2 . TRP B 1 531 ? 7.755   67.471 333.128 1.00 59.23  ? 532 TRP B CH2 1 
ATOM   8227 N N   . ASN B 1 532 ? 9.287   59.360 332.036 1.00 58.74  ? 533 ASN B N   1 
ATOM   8228 C CA  . ASN B 1 532 ? 9.804   58.154 332.669 1.00 68.49  ? 533 ASN B CA  1 
ATOM   8229 C C   . ASN B 1 532 ? 10.932  57.487 331.898 1.00 66.76  ? 533 ASN B C   1 
ATOM   8230 O O   . ASN B 1 532 ? 11.641  56.653 332.469 1.00 71.72  ? 533 ASN B O   1 
ATOM   8231 C CB  . ASN B 1 532 ? 8.674   57.138 332.877 1.00 64.28  ? 533 ASN B CB  1 
ATOM   8232 C CG  . ASN B 1 532 ? 7.580   57.668 333.781 1.00 49.83  ? 533 ASN B CG  1 
ATOM   8233 O OD1 . ASN B 1 532 ? 7.834   58.505 334.643 1.00 71.11  ? 533 ASN B OD1 1 
ATOM   8234 N ND2 . ASN B 1 532 ? 6.358   57.184 333.591 1.00 53.52  ? 533 ASN B ND2 1 
ATOM   8235 N N   . ARG B 1 533 ? 11.120  57.852 330.656 1.00 73.43  ? 534 ARG B N   1 
ATOM   8236 C CA  . ARG B 1 533 ? 12.144  57.261 329.854 1.00 70.73  ? 534 ARG B CA  1 
ATOM   8237 C C   . ARG B 1 533 ? 13.225  58.211 329.395 1.00 75.12  ? 534 ARG B C   1 
ATOM   8238 O O   . ARG B 1 533 ? 14.384  57.943 329.554 1.00 71.60  ? 534 ARG B O   1 
ATOM   8239 C CB  . ARG B 1 533 ? 11.504  56.654 328.623 1.00 67.38  ? 534 ARG B CB  1 
ATOM   8240 C CG  . ARG B 1 533 ? 10.813  55.336 328.834 1.00 62.79  ? 534 ARG B CG  1 
ATOM   8241 C CD  . ARG B 1 533 ? 9.798   55.107 327.747 1.00 73.95  ? 534 ARG B CD  1 
ATOM   8242 N NE  . ARG B 1 533 ? 8.913   53.989 328.018 1.00 72.03  ? 534 ARG B NE  1 
ATOM   8243 C CZ  . ARG B 1 533 ? 9.285   52.721 327.946 1.00 68.38  ? 534 ARG B CZ  1 
ATOM   8244 N NH1 . ARG B 1 533 ? 10.525  52.411 327.622 1.00 67.57  ? 534 ARG B NH1 1 
ATOM   8245 N NH2 . ARG B 1 533 ? 8.417   51.769 328.209 1.00 62.73  ? 534 ARG B NH2 1 
ATOM   8246 N N   . PHE B 1 534 ? 12.850  59.323 328.806 1.00 69.34  ? 535 PHE B N   1 
ATOM   8247 C CA  . PHE B 1 534 ? 13.858  60.240 328.276 1.00 74.07  ? 535 PHE B CA  1 
ATOM   8248 C C   . PHE B 1 534 ? 14.427  61.189 329.332 1.00 62.80  ? 535 PHE B C   1 
ATOM   8249 O O   . PHE B 1 534 ? 15.640  61.209 329.562 1.00 63.80  ? 535 PHE B O   1 
ATOM   8250 C CB  . PHE B 1 534 ? 13.298  61.062 327.108 1.00 55.54  ? 535 PHE B CB  1 
ATOM   8251 C CG  . PHE B 1 534 ? 14.273  62.084 326.591 1.00 70.19  ? 535 PHE B CG  1 
ATOM   8252 C CD1 . PHE B 1 534 ? 15.440  61.682 325.950 1.00 67.90  ? 535 PHE B CD1 1 
ATOM   8253 C CD2 . PHE B 1 534 ? 14.052  63.439 326.781 1.00 71.20  ? 535 PHE B CD2 1 
ATOM   8254 C CE1 . PHE B 1 534 ? 16.354  62.613 325.490 1.00 67.47  ? 535 PHE B CE1 1 
ATOM   8255 C CE2 . PHE B 1 534 ? 14.964  64.378 326.322 1.00 65.63  ? 535 PHE B CE2 1 
ATOM   8256 C CZ  . PHE B 1 534 ? 16.116  63.964 325.677 1.00 68.19  ? 535 PHE B CZ  1 
ATOM   8257 N N   . LEU B 1 535 ? 13.569  61.999 329.950 1.00 58.20  ? 536 LEU B N   1 
ATOM   8258 C CA  . LEU B 1 535 ? 14.038  63.055 330.846 1.00 75.87  ? 536 LEU B CA  1 
ATOM   8259 C C   . LEU B 1 535 ? 15.007  62.582 331.930 1.00 84.06  ? 536 LEU B C   1 
ATOM   8260 O O   . LEU B 1 535 ? 15.955  63.329 332.234 1.00 69.72  ? 536 LEU B O   1 
ATOM   8261 C CB  . LEU B 1 535 ? 12.830  63.763 331.478 1.00 72.88  ? 536 LEU B CB  1 
ATOM   8262 C CG  . LEU B 1 535 ? 13.188  64.810 332.533 1.00 78.68  ? 536 LEU B CG  1 
ATOM   8263 C CD1 . LEU B 1 535 ? 13.901  65.990 331.890 1.00 84.04  ? 536 LEU B CD1 1 
ATOM   8264 C CD2 . LEU B 1 535 ? 11.960  65.267 333.289 1.00 75.56  ? 536 LEU B CD2 1 
ATOM   8265 N N   . PRO B 1 536 ? 14.845  61.403 332.549 1.00 76.22  ? 537 PRO B N   1 
ATOM   8266 C CA  . PRO B 1 536 ? 15.905  60.926 333.456 1.00 82.79  ? 537 PRO B CA  1 
ATOM   8267 C C   . PRO B 1 536 ? 17.270  60.831 332.793 1.00 82.61  ? 537 PRO B C   1 
ATOM   8268 O O   . PRO B 1 536 ? 18.276  61.216 333.402 1.00 81.47  ? 537 PRO B O   1 
ATOM   8269 C CB  . PRO B 1 536 ? 15.388  59.550 333.913 1.00 68.51  ? 537 PRO B CB  1 
ATOM   8270 C CG  . PRO B 1 536 ? 14.226  59.227 333.009 1.00 81.78  ? 537 PRO B CG  1 
ATOM   8271 C CD  . PRO B 1 536 ? 13.649  60.548 332.631 1.00 64.32  ? 537 PRO B CD  1 
ATOM   8272 N N   . LYS B 1 537 ? 17.336  60.345 331.549 1.00 91.87  ? 538 LYS B N   1 
ATOM   8273 C CA  . LYS B 1 537 ? 18.620  60.246 330.862 1.00 80.21  ? 538 LYS B CA  1 
ATOM   8274 C C   . LYS B 1 537 ? 19.160  61.602 330.440 1.00 69.96  ? 538 LYS B C   1 
ATOM   8275 O O   . LYS B 1 537 ? 20.373  61.741 330.248 1.00 81.33  ? 538 LYS B O   1 
ATOM   8276 C CB  . LYS B 1 537 ? 18.494  59.323 329.656 1.00 68.80  ? 538 LYS B CB  1 
ATOM   8277 C CG  . LYS B 1 537 ? 18.291  57.887 330.083 1.00 82.01  ? 538 LYS B CG  1 
ATOM   8278 C CD  . LYS B 1 537 ? 17.454  57.104 329.113 1.00 84.28  ? 538 LYS B CD  1 
ATOM   8279 C CE  . LYS B 1 537 ? 17.520  57.675 327.724 1.00 90.57  ? 538 LYS B CE  1 
ATOM   8280 N NZ  . LYS B 1 537 ? 17.210  56.587 326.778 1.00 106.87 ? 538 LYS B NZ  1 
ATOM   8281 N N   . LEU B 1 538 ? 18.294  62.603 330.295 1.00 83.91  ? 539 LEU B N   1 
ATOM   8282 C CA  . LEU B 1 538 ? 18.778  63.957 330.064 1.00 80.57  ? 539 LEU B CA  1 
ATOM   8283 C C   . LEU B 1 538 ? 19.475  64.503 331.302 1.00 80.82  ? 539 LEU B C   1 
ATOM   8284 O O   . LEU B 1 538 ? 20.536  65.128 331.196 1.00 92.94  ? 539 LEU B O   1 
ATOM   8285 C CB  . LEU B 1 538 ? 17.620  64.862 329.645 1.00 70.96  ? 539 LEU B CB  1 
ATOM   8286 C CG  . LEU B 1 538 ? 17.976  66.283 329.213 1.00 77.23  ? 539 LEU B CG  1 
ATOM   8287 C CD1 . LEU B 1 538 ? 17.125  66.689 328.031 1.00 89.39  ? 539 LEU B CD1 1 
ATOM   8288 C CD2 . LEU B 1 538 ? 17.780  67.256 330.358 1.00 81.44  ? 539 LEU B CD2 1 
ATOM   8289 N N   . LEU B 1 539 ? 18.898  64.269 332.487 1.00 100.77 ? 540 LEU B N   1 
ATOM   8290 C CA  . LEU B 1 539 ? 19.487  64.765 333.728 1.00 105.37 ? 540 LEU B CA  1 
ATOM   8291 C C   . LEU B 1 539 ? 20.793  64.060 334.081 1.00 94.16  ? 540 LEU B C   1 
ATOM   8292 O O   . LEU B 1 539 ? 21.634  64.653 334.765 1.00 99.74  ? 540 LEU B O   1 
ATOM   8293 C CB  . LEU B 1 539 ? 18.485  64.621 334.881 1.00 102.32 ? 540 LEU B CB  1 
ATOM   8294 C CG  . LEU B 1 539 ? 17.237  65.520 334.839 1.00 102.81 ? 540 LEU B CG  1 
ATOM   8295 C CD1 . LEU B 1 539 ? 16.309  65.228 336.006 1.00 84.48  ? 540 LEU B CD1 1 
ATOM   8296 C CD2 . LEU B 1 539 ? 17.592  67.003 334.812 1.00 92.73  ? 540 LEU B CD2 1 
ATOM   8297 N N   . SER B 1 540 ? 21.025  62.838 333.624 1.00 98.86  ? 541 SER B N   1 
ATOM   8298 C CA  . SER B 1 540 ? 22.296  62.237 333.978 1.00 100.50 ? 541 SER B CA  1 
ATOM   8299 C C   . SER B 1 540 ? 23.373  62.856 333.122 1.00 111.24 ? 541 SER B C   1 
ATOM   8300 O O   . SER B 1 540 ? 24.182  63.625 333.598 1.00 119.53 ? 541 SER B O   1 
ATOM   8301 C CB  . SER B 1 540 ? 22.265  60.761 333.672 1.00 91.49  ? 541 SER B CB  1 
ATOM   8302 O OG  . SER B 1 540 ? 21.108  60.162 334.189 1.00 103.58 ? 541 SER B OG  1 
ATOM   8303 N N   . ALA B 1 541 ? 23.339  62.589 331.835 1.00 111.67 ? 542 ALA B N   1 
ATOM   8304 C CA  . ALA B 1 541 ? 24.275  63.223 330.932 1.00 109.91 ? 542 ALA B CA  1 
ATOM   8305 C C   . ALA B 1 541 ? 24.439  64.720 331.128 1.00 112.30 ? 542 ALA B C   1 
ATOM   8306 O O   . ALA B 1 541 ? 23.568  65.391 331.651 1.00 115.25 ? 542 ALA B O   1 
ATOM   8307 C CB  . ALA B 1 541 ? 23.880  62.921 329.503 1.00 97.26  ? 542 ALA B CB  1 
HETATM 8308 C C1  . NAG C 2 .   ? 29.499  32.826 345.721 1.00 100.09 ? 1   NAG C C1  1 
HETATM 8309 C C2  . NAG C 2 .   ? 28.714  32.150 344.603 1.00 120.58 ? 1   NAG C C2  1 
HETATM 8310 C C3  . NAG C 2 .   ? 28.242  33.169 343.573 1.00 118.13 ? 1   NAG C C3  1 
HETATM 8311 C C4  . NAG C 2 .   ? 27.560  34.353 344.249 1.00 119.46 ? 1   NAG C C4  1 
HETATM 8312 C C5  . NAG C 2 .   ? 28.415  34.898 345.388 1.00 97.59  ? 1   NAG C C5  1 
HETATM 8313 C C6  . NAG C 2 .   ? 27.700  36.032 346.112 1.00 89.76  ? 1   NAG C C6  1 
HETATM 8314 C C7  . NAG C 2 .   ? 29.291  29.843 344.122 1.00 123.14 ? 1   NAG C C7  1 
HETATM 8315 C C8  . NAG C 2 .   ? 30.490  28.944 344.055 1.00 108.11 ? 1   NAG C C8  1 
HETATM 8316 N N2  . NAG C 2 .   ? 29.534  31.141 343.962 1.00 119.85 ? 1   NAG C N2  1 
HETATM 8317 O O3  . NAG C 2 .   ? 27.325  32.544 342.668 1.00 105.92 ? 1   NAG C O3  1 
HETATM 8318 O O4  . NAG C 2 .   ? 27.334  35.388 343.285 1.00 119.28 ? 1   NAG C O4  1 
HETATM 8319 O O5  . NAG C 2 .   ? 28.700  33.849 346.311 1.00 83.27  ? 1   NAG C O5  1 
HETATM 8320 O O6  . NAG C 2 .   ? 26.374  35.617 346.459 1.00 118.64 ? 1   NAG C O6  1 
HETATM 8321 O O7  . NAG C 2 .   ? 28.165  29.412 344.311 1.00 118.06 ? 1   NAG C O7  1 
HETATM 8322 C C1  . NAG C 2 .   ? 26.005  35.908 343.470 1.00 125.50 ? 2   NAG C C1  1 
HETATM 8323 C C2  . NAG C 2 .   ? 25.977  37.381 343.078 1.00 129.30 ? 2   NAG C C2  1 
HETATM 8324 C C3  . NAG C 2 .   ? 24.580  37.965 343.245 1.00 134.63 ? 2   NAG C C3  1 
HETATM 8325 C C4  . NAG C 2 .   ? 23.533  37.075 342.585 1.00 137.34 ? 2   NAG C C4  1 
HETATM 8326 C C5  . NAG C 2 .   ? 23.707  35.621 343.007 1.00 138.20 ? 2   NAG C C5  1 
HETATM 8327 C C6  . NAG C 2 .   ? 22.710  34.720 342.289 1.00 126.85 ? 2   NAG C C6  1 
HETATM 8328 C C7  . NAG C 2 .   ? 27.476  39.254 343.442 1.00 113.79 ? 2   NAG C C7  1 
HETATM 8329 C C8  . NAG C 2 .   ? 28.605  39.793 344.269 1.00 106.53 ? 2   NAG C C8  1 
HETATM 8330 N N2  . NAG C 2 .   ? 26.926  38.126 343.882 1.00 122.59 ? 2   NAG C N2  1 
HETATM 8331 O O3  . NAG C 2 .   ? 24.534  39.270 342.660 1.00 133.22 ? 2   NAG C O3  1 
HETATM 8332 O O4  . NAG C 2 .   ? 22.224  37.525 342.951 1.00 127.76 ? 2   NAG C O4  1 
HETATM 8333 O O5  . NAG C 2 .   ? 25.035  35.195 342.707 1.00 141.38 ? 2   NAG C O5  1 
HETATM 8334 O O6  . NAG C 2 .   ? 21.440  35.379 342.214 1.00 140.08 ? 2   NAG C O6  1 
HETATM 8335 O O7  . NAG C 2 .   ? 27.086  39.815 342.431 1.00 105.82 ? 2   NAG C O7  1 
HETATM 8336 C C1  . FUC C 2 .   ? 26.138  35.936 347.842 1.00 123.16 ? 3   FUC C C1  1 
HETATM 8337 C C2  . FUC C 2 .   ? 24.653  36.251 348.047 1.00 125.51 ? 3   FUC C C2  1 
HETATM 8338 C C3  . FUC C 2 .   ? 23.783  34.989 348.099 1.00 132.68 ? 3   FUC C C3  1 
HETATM 8339 C C4  . FUC C 2 .   ? 24.511  33.711 348.535 1.00 116.90 ? 3   FUC C C4  1 
HETATM 8340 C C5  . FUC C 2 .   ? 25.758  33.999 349.375 1.00 105.98 ? 3   FUC C C5  1 
HETATM 8341 C C6  . FUC C 2 .   ? 25.370  34.547 350.744 1.00 117.45 ? 3   FUC C C6  1 
HETATM 8342 O O2  . FUC C 2 .   ? 24.198  37.097 346.984 1.00 118.49 ? 3   FUC C O2  1 
HETATM 8343 O O3  . FUC C 2 .   ? 22.683  35.222 348.988 1.00 135.90 ? 3   FUC C O3  1 
HETATM 8344 O O4  . FUC C 2 .   ? 23.613  32.887 349.287 1.00 113.43 ? 3   FUC C O4  1 
HETATM 8345 O O5  . FUC C 2 .   ? 26.654  34.926 348.732 1.00 106.55 ? 3   FUC C O5  1 
HETATM 8346 C C1  . NAG D 2 .   ? -6.782  85.927 336.585 1.00 100.00 ? 1   NAG D C1  1 
HETATM 8347 C C2  . NAG D 2 .   ? -6.222  87.056 335.707 1.00 110.38 ? 1   NAG D C2  1 
HETATM 8348 C C3  . NAG D 2 .   ? -4.722  87.245 335.949 1.00 105.13 ? 1   NAG D C3  1 
HETATM 8349 C C4  . NAG D 2 .   ? -4.420  87.397 337.434 1.00 126.61 ? 1   NAG D C4  1 
HETATM 8350 C C5  . NAG D 2 .   ? -5.025  86.217 338.194 1.00 116.25 ? 1   NAG D C5  1 
HETATM 8351 C C6  . NAG D 2 .   ? -4.850  86.278 339.697 1.00 119.44 ? 1   NAG D C6  1 
HETATM 8352 C C7  . NAG D 2 .   ? -7.383  87.441 333.571 1.00 114.57 ? 1   NAG D C7  1 
HETATM 8353 C C8  . NAG D 2 .   ? -8.139  88.527 334.278 1.00 99.61  ? 1   NAG D C8  1 
HETATM 8354 N N2  . NAG D 2 .   ? -6.478  86.781 334.302 1.00 108.62 ? 1   NAG D N2  1 
HETATM 8355 O O3  . NAG D 2 .   ? -4.273  88.396 335.243 1.00 101.70 ? 1   NAG D O3  1 
HETATM 8356 O O4  . NAG D 2 .   ? -3.010  87.460 337.634 1.00 133.31 ? 1   NAG D O4  1 
HETATM 8357 O O5  . NAG D 2 .   ? -6.437  86.159 337.946 1.00 107.73 ? 1   NAG D O5  1 
HETATM 8358 O O6  . NAG D 2 .   ? -4.867  87.601 340.217 1.00 125.83 ? 1   NAG D O6  1 
HETATM 8359 O O7  . NAG D 2 .   ? -7.579  87.176 332.390 1.00 131.71 ? 1   NAG D O7  1 
HETATM 8360 C C1  . NAG D 2 .   ? -2.627  88.691 338.318 1.00 137.02 ? 2   NAG D C1  1 
HETATM 8361 C C2  . NAG D 2 .   ? -1.348  88.451 339.112 1.00 140.52 ? 2   NAG D C2  1 
HETATM 8362 C C3  . NAG D 2 .   ? -1.000  89.698 339.907 1.00 138.46 ? 2   NAG D C3  1 
HETATM 8363 C C4  . NAG D 2 .   ? -0.836  90.877 338.955 1.00 147.30 ? 2   NAG D C4  1 
HETATM 8364 C C5  . NAG D 2 .   ? -2.056  91.040 338.034 1.00 148.59 ? 2   NAG D C5  1 
HETATM 8365 C C6  . NAG D 2 .   ? -1.810  92.020 336.909 1.00 142.27 ? 2   NAG D C6  1 
HETATM 8366 C C7  . NAG D 2 .   ? -0.847  86.131 339.685 1.00 120.35 ? 2   NAG D C7  1 
HETATM 8367 C C8  . NAG D 2 .   ? -1.042  85.020 340.672 1.00 102.71 ? 2   NAG D C8  1 
HETATM 8368 N N2  . NAG D 2 .   ? -1.448  87.288 339.977 1.00 137.88 ? 2   NAG D N2  1 
HETATM 8369 O O3  . NAG D 2 .   ? 0.198   89.486 340.647 1.00 118.08 ? 2   NAG D O3  1 
HETATM 8370 O O4  . NAG D 2 .   ? -0.655  92.074 339.702 1.00 134.40 ? 2   NAG D O4  1 
HETATM 8371 O O5  . NAG D 2 .   ? -2.425  89.797 337.407 1.00 146.60 ? 2   NAG D O5  1 
HETATM 8372 O O6  . NAG D 2 .   ? -1.233  91.379 335.778 1.00 135.74 ? 2   NAG D O6  1 
HETATM 8373 O O7  . NAG D 2 .   ? -0.173  85.989 338.668 1.00 102.94 ? 2   NAG D O7  1 
HETATM 8374 C C1  . FUC D 2 .   ? -6.205  88.149 340.305 1.00 122.75 ? 3   FUC D C1  1 
HETATM 8375 C C2  . FUC D 2 .   ? -7.080  87.222 341.191 1.00 131.63 ? 3   FUC D C2  1 
HETATM 8376 C C3  . FUC D 2 .   ? -8.489  87.820 341.349 1.00 135.79 ? 3   FUC D C3  1 
HETATM 8377 C C4  . FUC D 2 .   ? -8.456  89.350 341.662 1.00 140.04 ? 3   FUC D C4  1 
HETATM 8378 C C5  . FUC D 2 .   ? -7.020  89.887 341.865 1.00 134.08 ? 3   FUC D C5  1 
HETATM 8379 C C6  . FUC D 2 .   ? -6.951  91.408 341.892 1.00 121.65 ? 3   FUC D C6  1 
HETATM 8380 O O2  . FUC D 2 .   ? -6.483  86.896 342.452 1.00 136.08 ? 3   FUC D O2  1 
HETATM 8381 O O3  . FUC D 2 .   ? -9.219  87.638 340.131 1.00 110.21 ? 3   FUC D O3  1 
HETATM 8382 O O4  . FUC D 2 .   ? -9.100  90.080 340.630 1.00 141.49 ? 3   FUC D O4  1 
HETATM 8383 O O5  . FUC D 2 .   ? -6.110  89.477 340.823 1.00 129.62 ? 3   FUC D O5  1 
HETATM 8384 C C1  . NAG E 3 .   ? 26.598  65.105 372.203 1.00 132.29 ? 1   NAG E C1  1 
HETATM 8385 C C2  . NAG E 3 .   ? 27.608  63.980 372.447 1.00 126.28 ? 1   NAG E C2  1 
HETATM 8386 C C3  . NAG E 3 .   ? 28.193  63.981 373.860 1.00 130.02 ? 1   NAG E C3  1 
HETATM 8387 C C4  . NAG E 3 .   ? 27.116  64.195 374.924 1.00 143.52 ? 1   NAG E C4  1 
HETATM 8388 C C5  . NAG E 3 .   ? 26.003  65.154 374.493 1.00 146.07 ? 1   NAG E C5  1 
HETATM 8389 C C6  . NAG E 3 .   ? 25.628  66.094 375.633 1.00 138.22 ? 1   NAG E C6  1 
HETATM 8390 C C7  . NAG E 3 .   ? 26.579  62.366 370.956 1.00 124.46 ? 1   NAG E C7  1 
HETATM 8391 C C8  . NAG E 3 .   ? 27.173  61.109 370.394 1.00 106.25 ? 1   NAG E C8  1 
HETATM 8392 N N2  . NAG E 3 .   ? 26.984  62.699 372.178 1.00 119.43 ? 1   NAG E N2  1 
HETATM 8393 O O3  . NAG E 3 .   ? 29.178  65.015 373.966 1.00 139.28 ? 1   NAG E O3  1 
HETATM 8394 O O4  . NAG E 3 .   ? 26.537  62.930 375.267 1.00 131.34 ? 1   NAG E O4  1 
HETATM 8395 O O5  . NAG E 3 .   ? 26.395  65.925 373.356 1.00 135.20 ? 1   NAG E O5  1 
HETATM 8396 O O6  . NAG E 3 .   ? 25.046  65.340 376.702 1.00 136.34 ? 1   NAG E O6  1 
HETATM 8397 O O7  . NAG E 3 .   ? 25.776  63.040 370.332 1.00 122.60 ? 1   NAG E O7  1 
HETATM 8398 C C1  . NAG E 3 .   ? 26.937  62.588 376.606 1.00 149.94 ? 2   NAG E C1  1 
HETATM 8399 C C2  . NAG E 3 .   ? 25.868  61.710 377.247 1.00 152.13 ? 2   NAG E C2  1 
HETATM 8400 C C3  . NAG E 3 .   ? 26.264  61.314 378.664 1.00 140.14 ? 2   NAG E C3  1 
HETATM 8401 C C4  . NAG E 3 .   ? 27.688  60.773 378.703 1.00 140.39 ? 2   NAG E C4  1 
HETATM 8402 C C5  . NAG E 3 .   ? 28.647  61.708 377.976 1.00 139.33 ? 2   NAG E C5  1 
HETATM 8403 C C6  . NAG E 3 .   ? 30.057  61.131 377.950 1.00 127.29 ? 2   NAG E C6  1 
HETATM 8404 C C7  . NAG E 3 .   ? 23.494  61.852 376.770 1.00 142.21 ? 2   NAG E C7  1 
HETATM 8405 C C8  . NAG E 3 .   ? 23.579  61.391 375.345 1.00 130.70 ? 2   NAG E C8  1 
HETATM 8406 N N2  . NAG E 3 .   ? 24.597  62.408 377.263 1.00 149.08 ? 2   NAG E N2  1 
HETATM 8407 O O3  . NAG E 3 .   ? 25.360  60.315 379.150 1.00 129.93 ? 2   NAG E O3  1 
HETATM 8408 O O4  . NAG E 3 .   ? 28.105  60.625 380.065 1.00 127.72 ? 2   NAG E O4  1 
HETATM 8409 O O5  . NAG E 3 .   ? 28.192  61.912 376.641 1.00 144.68 ? 2   NAG E O5  1 
HETATM 8410 O O6  . NAG E 3 .   ? 30.149  60.144 376.916 1.00 124.83 ? 2   NAG E O6  1 
HETATM 8411 O O7  . NAG E 3 .   ? 22.478  61.726 377.434 1.00 127.19 ? 2   NAG E O7  1 
HETATM 8412 C C1  . NAG F 4 .   ? 40.864  29.592 371.408 1.00 131.13 ? 604 NAG A C1  1 
HETATM 8413 C C2  . NAG F 4 .   ? 39.642  30.506 371.434 1.00 133.47 ? 604 NAG A C2  1 
HETATM 8414 C C3  . NAG F 4 .   ? 38.576  29.982 372.385 1.00 135.61 ? 604 NAG A C3  1 
HETATM 8415 C C4  . NAG F 4 .   ? 38.270  28.527 372.064 1.00 134.14 ? 604 NAG A C4  1 
HETATM 8416 C C5  . NAG F 4 .   ? 39.555  27.709 372.081 1.00 129.11 ? 604 NAG A C5  1 
HETATM 8417 C C6  . NAG F 4 .   ? 39.273  26.249 371.746 1.00 119.53 ? 604 NAG A C6  1 
HETATM 8418 C C7  . NAG F 4 .   ? 40.543  32.704 370.939 1.00 110.99 ? 604 NAG A C7  1 
HETATM 8419 C C8  . NAG F 4 .   ? 41.190  33.926 371.520 1.00 95.03  ? 604 NAG A C8  1 
HETATM 8420 N N2  . NAG F 4 .   ? 40.033  31.848 371.820 1.00 118.97 ? 604 NAG A N2  1 
HETATM 8421 O O3  . NAG F 4 .   ? 37.385  30.764 372.250 1.00 126.04 ? 604 NAG A O3  1 
HETATM 8422 O O4  . NAG F 4 .   ? 37.356  28.004 373.034 1.00 143.38 ? 604 NAG A O4  1 
HETATM 8423 O O5  . NAG F 4 .   ? 40.489  28.239 371.139 1.00 128.82 ? 604 NAG A O5  1 
HETATM 8424 O O6  . NAG F 4 .   ? 38.247  25.750 372.612 1.00 130.82 ? 604 NAG A O6  1 
HETATM 8425 O O7  . NAG F 4 .   ? 40.487  32.509 369.736 1.00 116.09 ? 604 NAG A O7  1 
HETATM 8426 P P01 . ELT G 5 .   ? 46.430  49.557 353.073 1.00 50.65  ? 605 ELT A P01 1 
HETATM 8427 O O02 . ELT G 5 .   ? 45.739  50.549 353.728 1.00 55.71  ? 605 ELT A O02 1 
HETATM 8428 N N03 . ELT G 5 .   ? 45.785  49.787 351.597 1.00 67.86  ? 605 ELT A N03 1 
HETATM 8429 C C04 . ELT G 5 .   ? 44.789  48.909 351.115 1.00 62.54  ? 605 ELT A C04 1 
HETATM 8430 C C05 . ELT G 5 .   ? 45.672  51.119 351.129 1.00 67.81  ? 605 ELT A C05 1 
HETATM 8431 O O06 . ELT G 5 .   ? 45.758  48.209 353.455 1.00 57.05  ? 605 ELT A O06 1 
HETATM 8432 C C07 . ELT G 5 .   ? 44.729  48.198 354.345 1.00 64.39  ? 605 ELT A C07 1 
HETATM 8433 C C08 . ELT G 5 .   ? 43.460  48.499 353.607 1.00 69.47  ? 605 ELT A C08 1 
HETATM 8434 O O3  . HI6 H 6 .   ? 37.261  55.230 350.111 1.00 83.70  ? 606 HI6 A O3  1 
HETATM 8435 C C14 . HI6 H 6 .   ? 36.608  54.986 351.065 1.00 72.05  ? 606 HI6 A C14 1 
HETATM 8436 N N4  . HI6 H 6 .   ? 36.110  56.062 351.902 1.00 67.76  ? 606 HI6 A N4  1 
HETATM 8437 C C11 . HI6 H 6 .   ? 36.307  53.743 351.377 1.00 84.05  ? 606 HI6 A C11 1 
HETATM 8438 C C10 . HI6 H 6 .   ? 36.669  52.681 350.565 1.00 77.50  ? 606 HI6 A C10 1 
HETATM 8439 C C9  . HI6 H 6 .   ? 36.315  51.394 350.958 1.00 85.05  ? 606 HI6 A C9  1 
HETATM 8440 N N3  . HI6 H 6 .   ? 35.638  51.203 352.092 1.00 82.10  ? 606 HI6 A N3  1 
HETATM 8441 C C13 . HI6 H 6 .   ? 35.288  52.216 352.870 1.00 62.27  ? 606 HI6 A C13 1 
HETATM 8442 C C12 . HI6 H 6 .   ? 35.608  53.517 352.543 1.00 73.97  ? 606 HI6 A C12 1 
HETATM 8443 C C8  . HI6 H 6 .   ? 35.243  49.880 352.530 1.00 78.96  ? 606 HI6 A C8  1 
HETATM 8444 O O2  . HI6 H 6 .   ? 35.940  48.908 351.820 1.00 91.79  ? 606 HI6 A O2  1 
HETATM 8445 C C7  . HI6 H 6 .   ? 35.765  47.673 352.440 1.00 81.58  ? 606 HI6 A C7  1 
HETATM 8446 N N2  . HI6 H 6 .   ? 37.094  47.254 352.818 1.00 91.69  ? 606 HI6 A N2  1 
HETATM 8447 C C2  . HI6 H 6 .   ? 37.482  47.421 354.078 1.00 103.14 ? 606 HI6 A C2  1 
HETATM 8448 C C1  . HI6 H 6 .   ? 36.650  47.956 354.953 1.00 102.15 ? 606 HI6 A C1  1 
HETATM 8449 N N1  . HI6 H 6 .   ? 37.086  48.992 355.876 1.00 77.34  ? 606 HI6 A N1  1 
HETATM 8450 O O1  . HI6 H 6 .   ? 37.551  48.658 357.156 1.00 90.61  ? 606 HI6 A O1  1 
HETATM 8451 C C3  . HI6 H 6 .   ? 38.759  47.032 354.467 1.00 96.38  ? 606 HI6 A C3  1 
HETATM 8452 C C4  . HI6 H 6 .   ? 39.601  46.479 353.515 1.00 88.23  ? 606 HI6 A C4  1 
HETATM 8453 C C5  . HI6 H 6 .   ? 39.146  46.328 352.217 1.00 94.93  ? 606 HI6 A C5  1 
HETATM 8454 C C6  . HI6 H 6 .   ? 37.872  46.736 351.891 1.00 81.17  ? 606 HI6 A C6  1 
HETATM 8455 P P01 . ELT I 5 .   ? -1.383  65.161 347.741 1.00 49.92  ? 601 ELT B P01 1 
HETATM 8456 O O02 . ELT I 5 .   ? -1.022  65.179 349.072 1.00 51.52  ? 601 ELT B O02 1 
HETATM 8457 N N03 . ELT I 5 .   ? -0.065  65.882 347.171 1.00 59.76  ? 601 ELT B N03 1 
HETATM 8458 C C04 . ELT I 5 .   ? 0.999   65.079 346.705 1.00 64.85  ? 601 ELT B C04 1 
HETATM 8459 C C05 . ELT I 5 .   ? -0.140  67.203 346.664 1.00 70.54  ? 601 ELT B C05 1 
HETATM 8460 O O06 . ELT I 5 .   ? -2.437  66.285 347.544 1.00 56.51  ? 601 ELT B O06 1 
HETATM 8461 C C07 . ELT I 5 .   ? -2.741  67.099 348.587 1.00 67.92  ? 601 ELT B C07 1 
HETATM 8462 C C08 . ELT I 5 .   ? -2.711  68.512 348.077 1.00 70.58  ? 601 ELT B C08 1 
HETATM 8463 O O3  A HI6 J 6 .   ? 5.633   72.257 352.530 0.40 74.56  ? 602 HI6 B O3  1 
HETATM 8464 O O3  B HI6 J 6 .   ? 3.965   77.207 355.745 0.60 78.74  ? 602 HI6 B O3  1 
HETATM 8465 C C14 A HI6 J 6 .   ? 5.351   73.301 352.919 0.40 75.68  ? 602 HI6 B C14 1 
HETATM 8466 C C14 B HI6 J 6 .   ? 3.817   76.095 355.366 0.60 83.43  ? 602 HI6 B C14 1 
HETATM 8467 N N4  A HI6 J 6 .   ? 6.148   73.940 353.888 0.40 76.41  ? 602 HI6 B N4  1 
HETATM 8468 N N4  B HI6 J 6 .   ? 4.261   75.037 356.256 0.60 70.70  ? 602 HI6 B N4  1 
HETATM 8469 C C11 A HI6 J 6 .   ? 4.295   73.895 352.501 0.40 79.26  ? 602 HI6 B C11 1 
HETATM 8470 C C11 B HI6 J 6 .   ? 3.271   75.801 354.178 0.60 78.43  ? 602 HI6 B C11 1 
HETATM 8471 C C10 A HI6 J 6 .   ? 3.411   74.370 353.479 0.40 74.38  ? 602 HI6 B C10 1 
HETATM 8472 C C10 B HI6 J 6 .   ? 2.708   76.824 353.392 0.60 79.15  ? 602 HI6 B C10 1 
HETATM 8473 C C9  A HI6 J 6 .   ? 2.292   74.998 352.994 0.40 76.13  ? 602 HI6 B C9  1 
HETATM 8474 C C9  B HI6 J 6 .   ? 2.151   76.464 352.159 0.60 80.22  ? 602 HI6 B C9  1 
HETATM 8475 N N3  A HI6 J 6 .   ? 2.151   75.102 351.666 0.40 83.45  ? 602 HI6 B N3  1 
HETATM 8476 N N3  B HI6 J 6 .   ? 2.184   75.165 351.804 0.60 83.93  ? 602 HI6 B N3  1 
HETATM 8477 C C13 A HI6 J 6 .   ? 2.995   74.663 350.714 0.40 82.54  ? 602 HI6 B C13 1 
HETATM 8478 C C13 B HI6 J 6 .   ? 2.717   74.157 352.522 0.60 74.40  ? 602 HI6 B C13 1 
HETATM 8479 C C12 A HI6 J 6 .   ? 4.156   74.019 351.124 0.40 78.99  ? 602 HI6 B C12 1 
HETATM 8480 C C12 B HI6 J 6 .   ? 3.289   74.462 353.760 0.60 71.37  ? 602 HI6 B C12 1 
HETATM 8481 C C8  A HI6 J 6 .   ? 0.982   75.777 351.222 0.40 82.38  ? 602 HI6 B C8  1 
HETATM 8482 C C8  B HI6 J 6 .   ? 1.588   74.879 350.535 0.60 81.94  ? 602 HI6 B C8  1 
HETATM 8483 O O2  A HI6 J 6 .   ? 0.357   74.988 350.298 0.40 85.60  ? 602 HI6 B O2  1 
HETATM 8484 O O2  B HI6 J 6 .   ? 0.245   75.129 350.748 0.60 81.73  ? 602 HI6 B O2  1 
HETATM 8485 C C7  A HI6 J 6 .   ? -0.760  75.584 349.776 0.40 88.84  ? 602 HI6 B C7  1 
HETATM 8486 C C7  B HI6 J 6 .   ? -0.489  75.600 349.678 0.60 89.54  ? 602 HI6 B C7  1 
HETATM 8487 N N2  A HI6 J 6 .   ? -1.397  74.511 349.078 0.40 82.13  ? 602 HI6 B N2  1 
HETATM 8488 N N2  B HI6 J 6 .   ? -1.219  74.534 349.043 0.60 81.96  ? 602 HI6 B N2  1 
HETATM 8489 C C2  A HI6 J 6 .   ? -2.413  73.807 349.646 0.40 84.78  ? 602 HI6 B C2  1 
HETATM 8490 C C2  B HI6 J 6 .   ? -2.242  73.893 349.671 0.60 85.33  ? 602 HI6 B C2  1 
HETATM 8491 C C1  A HI6 J 6 .   ? -2.901  74.051 350.830 0.40 85.36  ? 602 HI6 B C1  1 
HETATM 8492 C C1  B HI6 J 6 .   ? -2.639  74.166 350.877 0.60 86.19  ? 602 HI6 B C1  1 
HETATM 8493 N N1  A HI6 J 6 .   ? -2.878  73.022 351.817 0.40 78.56  ? 602 HI6 B N1  1 
HETATM 8494 N N1  B HI6 J 6 .   ? -3.013  73.072 351.720 0.60 77.93  ? 602 HI6 B N1  1 
HETATM 8495 O O1  A HI6 J 6 .   ? -3.423  73.267 353.066 0.40 89.77  ? 602 HI6 B O1  1 
HETATM 8496 O O1  B HI6 J 6 .   ? -3.370  73.285 353.041 0.60 90.72  ? 602 HI6 B O1  1 
HETATM 8497 C C3  A HI6 J 6 .   ? -2.990  72.752 348.925 0.40 81.37  ? 602 HI6 B C3  1 
HETATM 8498 C C3  B HI6 J 6 .   ? -2.913  72.857 349.004 0.60 81.16  ? 602 HI6 B C3  1 
HETATM 8499 C C4  A HI6 J 6 .   ? -2.464  72.483 347.644 0.40 84.58  ? 602 HI6 B C4  1 
HETATM 8500 C C4  B HI6 J 6 .   ? -2.478  72.547 347.701 0.60 84.38  ? 602 HI6 B C4  1 
HETATM 8501 C C5  A HI6 J 6 .   ? -1.404  73.223 347.098 0.40 86.67  ? 602 HI6 B C5  1 
HETATM 8502 C C5  B HI6 J 6 .   ? -1.420  73.225 347.079 0.60 86.79  ? 602 HI6 B C5  1 
HETATM 8503 C C6  A HI6 J 6 .   ? -0.882  74.262 347.871 0.40 83.63  ? 602 HI6 B C6  1 
HETATM 8504 C C6  B HI6 J 6 .   ? -0.802  74.248 347.804 0.60 83.57  ? 602 HI6 B C6  1 
HETATM 8505 O O   . HOH K 7 .   ? 51.542  67.442 347.838 1.00 68.06  ? 701 HOH A O   1 
HETATM 8506 O O   . HOH K 7 .   ? 54.239  52.640 340.107 1.00 60.01  ? 702 HOH A O   1 
HETATM 8507 O O   . HOH K 7 .   ? 31.808  40.066 332.330 1.00 71.25  ? 703 HOH A O   1 
HETATM 8508 O O   . HOH K 7 .   ? 54.440  42.965 353.941 1.00 49.78  ? 704 HOH A O   1 
HETATM 8509 O O   . HOH K 7 .   ? 51.890  37.467 334.527 1.00 73.54  ? 705 HOH A O   1 
HETATM 8510 O O   . HOH K 7 .   ? 36.351  57.141 357.170 1.00 45.49  ? 706 HOH A O   1 
HETATM 8511 O O   . HOH K 7 .   ? 61.590  49.012 329.949 1.00 65.07  ? 707 HOH A O   1 
HETATM 8512 O O   . HOH K 7 .   ? 52.556  69.316 383.742 1.00 69.43  ? 708 HOH A O   1 
HETATM 8513 O O   . HOH K 7 .   ? 46.542  62.787 385.880 1.00 70.99  ? 709 HOH A O   1 
HETATM 8514 O O   . HOH K 7 .   ? 65.000  45.717 381.747 1.00 62.87  ? 710 HOH A O   1 
HETATM 8515 O O   . HOH K 7 .   ? 54.918  44.192 370.077 1.00 53.69  ? 711 HOH A O   1 
HETATM 8516 O O   . HOH K 7 .   ? 39.851  46.138 366.489 1.00 50.78  ? 712 HOH A O   1 
HETATM 8517 O O   . HOH K 7 .   ? 49.940  34.628 357.856 1.00 68.01  ? 713 HOH A O   1 
HETATM 8518 O O   . HOH K 7 .   ? 62.322  38.412 375.160 1.00 68.13  ? 714 HOH A O   1 
HETATM 8519 O O   . HOH K 7 .   ? 45.181  39.743 350.214 1.00 62.87  ? 715 HOH A O   1 
HETATM 8520 O O   . HOH K 7 .   ? 53.255  49.838 339.650 1.00 58.59  ? 716 HOH A O   1 
HETATM 8521 O O   . HOH K 7 .   ? 42.900  48.040 374.398 1.00 67.16  ? 717 HOH A O   1 
HETATM 8522 O O   . HOH K 7 .   ? 45.556  66.011 371.137 1.00 56.43  ? 718 HOH A O   1 
HETATM 8523 O O   . HOH K 7 .   ? 44.854  46.994 372.405 1.00 72.42  ? 719 HOH A O   1 
HETATM 8524 O O   . HOH K 7 .   ? 34.572  69.430 364.616 1.00 59.53  ? 720 HOH A O   1 
HETATM 8525 O O   . HOH K 7 .   ? 63.158  38.600 368.911 1.00 55.96  ? 721 HOH A O   1 
HETATM 8526 O O   . HOH K 7 .   ? 50.211  43.119 354.281 1.00 65.48  ? 722 HOH A O   1 
HETATM 8527 O O   . HOH K 7 .   ? 73.660  43.165 353.606 1.00 61.59  ? 723 HOH A O   1 
HETATM 8528 O O   . HOH K 7 .   ? 46.671  56.727 372.143 1.00 52.65  ? 724 HOH A O   1 
HETATM 8529 O O   . HOH K 7 .   ? 61.734  42.381 340.531 1.00 69.71  ? 725 HOH A O   1 
HETATM 8530 O O   . HOH K 7 .   ? 35.571  60.863 355.999 1.00 68.65  ? 726 HOH A O   1 
HETATM 8531 O O   . HOH K 7 .   ? 40.904  49.505 358.269 1.00 56.51  ? 727 HOH A O   1 
HETATM 8532 O O   . HOH K 7 .   ? 40.257  67.812 360.261 1.00 55.41  ? 728 HOH A O   1 
HETATM 8533 O O   . HOH K 7 .   ? 35.044  78.020 358.799 1.00 74.47  ? 729 HOH A O   1 
HETATM 8534 O O   . HOH K 7 .   ? 34.597  64.053 367.928 1.00 53.77  ? 730 HOH A O   1 
HETATM 8535 O O   . HOH K 7 .   ? 45.100  50.294 360.915 1.00 46.39  ? 731 HOH A O   1 
HETATM 8536 O O   . HOH K 7 .   ? 45.484  71.003 365.793 1.00 58.02  ? 732 HOH A O   1 
HETATM 8537 O O   . HOH K 7 .   ? 53.922  72.560 381.422 1.00 53.70  ? 733 HOH A O   1 
HETATM 8538 O O   . HOH K 7 .   ? 57.417  35.854 382.724 1.00 69.39  ? 734 HOH A O   1 
HETATM 8539 O O   . HOH K 7 .   ? 58.528  66.747 347.947 1.00 63.18  ? 735 HOH A O   1 
HETATM 8540 O O   . HOH K 7 .   ? 50.450  50.987 368.072 1.00 54.75  ? 736 HOH A O   1 
HETATM 8541 O O   . HOH K 7 .   ? 49.680  40.059 343.914 1.00 65.28  ? 737 HOH A O   1 
HETATM 8542 O O   . HOH K 7 .   ? 63.516  67.613 358.100 1.00 68.19  ? 738 HOH A O   1 
HETATM 8543 O O   . HOH K 7 .   ? 52.973  66.856 374.077 1.00 55.10  ? 739 HOH A O   1 
HETATM 8544 O O   . HOH K 7 .   ? 39.323  62.116 373.043 1.00 54.45  ? 740 HOH A O   1 
HETATM 8545 O O   . HOH K 7 .   ? 42.298  64.101 348.711 1.00 49.53  ? 741 HOH A O   1 
HETATM 8546 O O   . HOH K 7 .   ? 62.092  30.458 353.224 1.00 68.69  ? 742 HOH A O   1 
HETATM 8547 O O   . HOH K 7 .   ? 40.013  63.475 347.335 1.00 59.46  ? 743 HOH A O   1 
HETATM 8548 O O   . HOH K 7 .   ? 50.317  54.625 363.877 1.00 41.60  ? 744 HOH A O   1 
HETATM 8549 O O   . HOH K 7 .   ? 61.585  45.408 379.454 1.00 45.84  ? 745 HOH A O   1 
HETATM 8550 O O   . HOH K 7 .   ? 39.750  61.051 360.717 1.00 50.79  ? 746 HOH A O   1 
HETATM 8551 O O   . HOH K 7 .   ? 40.771  57.447 352.164 1.00 47.73  ? 747 HOH A O   1 
HETATM 8552 O O   . HOH K 7 .   ? 43.382  65.521 369.415 1.00 58.98  ? 748 HOH A O   1 
HETATM 8553 O O   . HOH K 7 .   ? 50.192  32.571 370.903 1.00 62.00  ? 749 HOH A O   1 
HETATM 8554 O O   . HOH K 7 .   ? 48.611  48.912 359.133 1.00 53.45  ? 750 HOH A O   1 
HETATM 8555 O O   . HOH K 7 .   ? 66.519  41.388 349.318 1.00 47.01  ? 751 HOH A O   1 
HETATM 8556 O O   . HOH K 7 .   ? 40.442  51.346 363.204 1.00 53.45  ? 752 HOH A O   1 
HETATM 8557 O O   . HOH K 7 .   ? 37.643  51.007 360.774 1.00 58.84  ? 753 HOH A O   1 
HETATM 8558 O O   . HOH K 7 .   ? 48.343  48.804 369.971 1.00 55.51  ? 754 HOH A O   1 
HETATM 8559 O O   . HOH K 7 .   ? 58.186  63.532 385.563 1.00 51.95  ? 755 HOH A O   1 
HETATM 8560 O O   . HOH K 7 .   ? 48.351  40.581 361.370 1.00 60.84  ? 756 HOH A O   1 
HETATM 8561 O O   . HOH K 7 .   ? 42.917  55.106 369.276 1.00 55.19  ? 757 HOH A O   1 
HETATM 8562 O O   . HOH K 7 .   ? 50.549  69.538 350.624 1.00 61.75  ? 758 HOH A O   1 
HETATM 8563 O O   . HOH K 7 .   ? 66.029  53.168 364.749 1.00 51.06  ? 759 HOH A O   1 
HETATM 8564 O O   . HOH K 7 .   ? 47.397  38.232 344.990 1.00 66.59  ? 760 HOH A O   1 
HETATM 8565 O O   . HOH K 7 .   ? 61.565  61.629 364.761 1.00 51.54  ? 761 HOH A O   1 
HETATM 8566 O O   . HOH K 7 .   ? 42.317  29.961 323.777 1.00 69.56  ? 762 HOH A O   1 
HETATM 8567 O O   . HOH K 7 .   ? 58.488  28.350 370.636 1.00 71.87  ? 763 HOH A O   1 
HETATM 8568 O O   . HOH K 7 .   ? 30.775  53.280 359.497 1.00 63.90  ? 764 HOH A O   1 
HETATM 8569 O O   . HOH K 7 .   ? 64.717  51.585 388.582 1.00 68.27  ? 765 HOH A O   1 
HETATM 8570 O O   . HOH K 7 .   ? 44.627  50.859 376.899 1.00 68.63  ? 766 HOH A O   1 
HETATM 8571 O O   . HOH K 7 .   ? 39.457  66.204 348.576 1.00 58.23  ? 767 HOH A O   1 
HETATM 8572 O O   . HOH K 7 .   ? 43.032  31.504 332.447 1.00 64.38  ? 768 HOH A O   1 
HETATM 8573 O O   . HOH K 7 .   ? 39.262  26.511 330.199 1.00 62.04  ? 769 HOH A O   1 
HETATM 8574 O O   . HOH K 7 .   ? 43.934  62.004 340.324 1.00 59.49  ? 770 HOH A O   1 
HETATM 8575 O O   . HOH K 7 .   ? 49.304  30.685 349.264 1.00 73.19  ? 771 HOH A O   1 
HETATM 8576 O O   . HOH K 7 .   ? 45.044  54.587 356.882 1.00 48.86  ? 772 HOH A O   1 
HETATM 8577 O O   . HOH K 7 .   ? 70.403  47.537 347.539 1.00 63.12  ? 773 HOH A O   1 
HETATM 8578 O O   . HOH K 7 .   ? 42.503  56.180 345.841 1.00 61.15  ? 774 HOH A O   1 
HETATM 8579 O O   . HOH K 7 .   ? 71.080  54.828 338.056 1.00 72.09  ? 775 HOH A O   1 
HETATM 8580 O O   . HOH K 7 .   ? 72.062  44.917 365.933 1.00 70.97  ? 776 HOH A O   1 
HETATM 8581 O O   . HOH K 7 .   ? 68.065  61.776 358.052 1.00 71.74  ? 777 HOH A O   1 
HETATM 8582 O O   . HOH K 7 .   ? 62.307  32.566 356.380 1.00 57.99  ? 778 HOH A O   1 
HETATM 8583 O O   . HOH K 7 .   ? 44.890  65.451 350.752 1.00 62.19  ? 779 HOH A O   1 
HETATM 8584 O O   . HOH K 7 .   ? 49.135  35.679 344.864 1.00 66.64  ? 780 HOH A O   1 
HETATM 8585 O O   . HOH K 7 .   ? 45.860  31.386 337.652 1.00 65.02  ? 781 HOH A O   1 
HETATM 8586 O O   . HOH K 7 .   ? 42.710  56.862 364.286 1.00 48.15  ? 782 HOH A O   1 
HETATM 8587 O O   . HOH K 7 .   ? 50.528  49.662 338.978 1.00 54.23  ? 783 HOH A O   1 
HETATM 8588 O O   . HOH K 7 .   ? 69.811  41.498 344.410 1.00 61.62  ? 784 HOH A O   1 
HETATM 8589 O O   . HOH K 7 .   ? 41.671  67.134 374.865 1.00 57.70  ? 785 HOH A O   1 
HETATM 8590 O O   . HOH K 7 .   ? 36.788  59.691 358.100 1.00 61.53  ? 786 HOH A O   1 
HETATM 8591 O O   . HOH K 7 .   ? 31.555  55.144 361.593 1.00 64.05  ? 787 HOH A O   1 
HETATM 8592 O O   . HOH K 7 .   ? 68.998  63.388 363.015 1.00 69.24  ? 788 HOH A O   1 
HETATM 8593 O O   . HOH K 7 .   ? 64.356  63.812 372.327 1.00 50.75  ? 789 HOH A O   1 
HETATM 8594 O O   . HOH K 7 .   ? 42.358  49.519 360.530 1.00 50.19  ? 790 HOH A O   1 
HETATM 8595 O O   . HOH K 7 .   ? 45.512  34.399 346.017 1.00 66.91  ? 791 HOH A O   1 
HETATM 8596 O O   . HOH K 7 .   ? 61.521  62.837 382.742 1.00 71.38  ? 792 HOH A O   1 
HETATM 8597 O O   . HOH K 7 .   ? 44.200  66.930 373.713 1.00 66.94  ? 793 HOH A O   1 
HETATM 8598 O O   . HOH K 7 .   ? 30.351  65.332 365.431 1.00 60.68  ? 794 HOH A O   1 
HETATM 8599 O O   . HOH K 7 .   ? 71.005  54.056 369.891 1.00 64.19  ? 795 HOH A O   1 
HETATM 8600 O O   . HOH K 7 .   ? 43.541  65.646 339.150 1.00 70.23  ? 796 HOH A O   1 
HETATM 8601 O O   . HOH K 7 .   ? 72.929  41.659 346.642 1.00 69.24  ? 797 HOH A O   1 
HETATM 8602 O O   . HOH K 7 .   ? 41.825  57.485 343.920 1.00 66.29  ? 798 HOH A O   1 
HETATM 8603 O O   . HOH K 7 .   ? 53.670  69.031 370.064 1.00 61.72  ? 799 HOH A O   1 
HETATM 8604 O O   . HOH K 7 .   ? 50.954  39.029 346.019 1.00 58.56  ? 800 HOH A O   1 
HETATM 8605 O O   . HOH K 7 .   ? 45.551  28.463 358.626 1.00 66.32  ? 801 HOH A O   1 
HETATM 8606 O O   . HOH K 7 .   ? 52.086  49.054 391.382 1.00 72.12  ? 802 HOH A O   1 
HETATM 8607 O O   . HOH K 7 .   ? 59.485  43.299 339.389 1.00 61.03  ? 803 HOH A O   1 
HETATM 8608 O O   . HOH K 7 .   ? 55.623  40.622 383.009 1.00 65.14  ? 804 HOH A O   1 
HETATM 8609 O O   . HOH K 7 .   ? 44.165  71.496 363.327 1.00 65.42  ? 805 HOH A O   1 
HETATM 8610 O O   . HOH K 7 .   ? 55.543  70.222 353.322 1.00 63.44  ? 806 HOH A O   1 
HETATM 8611 O O   . HOH K 7 .   ? 40.171  49.120 351.551 1.00 68.55  ? 807 HOH A O   1 
HETATM 8612 O O   . HOH K 7 .   ? 49.808  44.661 381.903 1.00 70.62  ? 808 HOH A O   1 
HETATM 8613 O O   . HOH K 7 .   ? 29.236  62.683 364.778 1.00 64.78  ? 809 HOH A O   1 
HETATM 8614 O O   . HOH K 7 .   ? 59.575  36.849 338.795 1.00 68.00  ? 810 HOH A O   1 
HETATM 8615 O O   . HOH K 7 .   ? 44.790  35.696 362.995 1.00 62.56  ? 811 HOH A O   1 
HETATM 8616 O O   . HOH K 7 .   ? 68.914  30.545 349.130 1.00 74.02  ? 812 HOH A O   1 
HETATM 8617 O O   . HOH K 7 .   ? 37.843  45.680 358.650 1.00 61.25  ? 813 HOH A O   1 
HETATM 8618 O O   . HOH K 7 .   ? 41.841  45.291 368.070 1.00 56.81  ? 814 HOH A O   1 
HETATM 8619 O O   . HOH K 7 .   ? 44.170  32.523 334.269 1.00 54.22  ? 815 HOH A O   1 
HETATM 8620 O O   . HOH K 7 .   ? 53.819  69.712 372.206 1.00 70.81  ? 816 HOH A O   1 
HETATM 8621 O O   . HOH K 7 .   ? 51.945  37.418 339.330 1.00 68.71  ? 817 HOH A O   1 
HETATM 8622 O O   . HOH K 7 .   ? 64.014  64.694 375.246 1.00 63.68  ? 818 HOH A O   1 
HETATM 8623 O O   . HOH K 7 .   ? 45.751  47.155 357.153 1.00 71.40  ? 819 HOH A O   1 
HETATM 8624 O O   . HOH K 7 .   ? 38.667  65.722 337.719 1.00 69.15  ? 820 HOH A O   1 
HETATM 8625 O O   . HOH K 7 .   ? 53.296  69.330 360.875 1.00 66.68  ? 821 HOH A O   1 
HETATM 8626 O O   . HOH K 7 .   ? 61.419  67.536 346.741 1.00 67.84  ? 822 HOH A O   1 
HETATM 8627 O O   . HOH K 7 .   ? 52.284  28.334 355.804 1.00 66.67  ? 823 HOH A O   1 
HETATM 8628 O O   . HOH K 7 .   ? 53.543  38.502 346.126 1.00 55.31  ? 824 HOH A O   1 
HETATM 8629 O O   . HOH K 7 .   ? 55.378  63.219 385.752 1.00 61.53  ? 825 HOH A O   1 
HETATM 8630 O O   . HOH K 7 .   ? 61.980  66.115 376.190 1.00 56.05  ? 826 HOH A O   1 
HETATM 8631 O O   . HOH K 7 .   ? 46.691  34.131 343.478 1.00 74.16  ? 827 HOH A O   1 
HETATM 8632 O O   . HOH K 7 .   ? 62.552  64.363 347.543 1.00 71.68  ? 828 HOH A O   1 
HETATM 8633 O O   . HOH K 7 .   ? 53.204  71.265 353.978 1.00 71.68  ? 829 HOH A O   1 
HETATM 8634 O O   . HOH K 7 .   ? 54.611  24.197 362.840 1.00 74.85  ? 830 HOH A O   1 
HETATM 8635 O O   . HOH K 7 .   ? 64.223  32.602 366.620 1.00 59.42  ? 831 HOH A O   1 
HETATM 8636 O O   . HOH K 7 .   ? 60.065  44.445 335.519 1.00 64.11  ? 832 HOH A O   1 
HETATM 8637 O O   . HOH K 7 .   ? 46.914  30.076 334.862 1.00 68.63  ? 833 HOH A O   1 
HETATM 8638 O O   . HOH K 7 .   ? 42.088  27.407 357.550 1.00 74.05  ? 834 HOH A O   1 
HETATM 8639 O O   . HOH K 7 .   ? 55.390  37.230 337.192 1.00 60.22  ? 835 HOH A O   1 
HETATM 8640 O O   . HOH K 7 .   ? 39.392  28.501 357.278 1.00 73.11  ? 836 HOH A O   1 
HETATM 8641 O O   . HOH K 7 .   ? 39.732  65.742 363.261 1.00 71.54  ? 837 HOH A O   1 
HETATM 8642 O O   . HOH K 7 .   ? 52.879  58.074 341.158 1.00 58.66  ? 838 HOH A O   1 
HETATM 8643 O O   . HOH K 7 .   ? 64.370  57.016 386.899 1.00 71.01  ? 839 HOH A O   1 
HETATM 8644 O O   . HOH K 7 .   ? 39.245  63.016 363.550 1.00 67.68  ? 840 HOH A O   1 
HETATM 8645 O O   . HOH K 7 .   ? 55.747  37.243 344.676 1.00 71.31  ? 841 HOH A O   1 
HETATM 8646 O O   . HOH K 7 .   ? 56.490  68.920 368.568 1.00 71.21  ? 842 HOH A O   1 
HETATM 8647 O O   . HOH K 7 .   ? 62.598  49.654 338.829 1.00 62.93  ? 843 HOH A O   1 
HETATM 8648 O O   . HOH K 7 .   ? 37.234  24.553 333.401 1.00 74.71  ? 844 HOH A O   1 
HETATM 8649 O O   . HOH K 7 .   ? 66.714  65.452 372.799 1.00 71.92  ? 845 HOH A O   1 
HETATM 8650 O O   . HOH L 7 .   ? -5.109  72.160 353.967 1.00 65.88  ? 701 HOH B O   1 
HETATM 8651 O O   . HOH L 7 .   ? -18.943 46.151 367.722 1.00 74.87  ? 702 HOH B O   1 
HETATM 8652 O O   . HOH L 7 .   ? -4.324  64.446 334.733 1.00 59.63  ? 703 HOH B O   1 
HETATM 8653 O O   . HOH L 7 .   ? 11.871  68.735 339.486 1.00 60.56  ? 704 HOH B O   1 
HETATM 8654 O O   . HOH L 7 .   ? -1.086  61.495 370.822 1.00 49.92  ? 705 HOH B O   1 
HETATM 8655 O O   . HOH L 7 .   ? -13.905 61.454 358.847 1.00 55.90  ? 706 HOH B O   1 
HETATM 8656 O O   . HOH L 7 .   ? -17.429 57.911 380.263 1.00 69.73  ? 707 HOH B O   1 
HETATM 8657 O O   . HOH L 7 .   ? -17.971 55.951 354.245 1.00 63.85  ? 708 HOH B O   1 
HETATM 8658 O O   . HOH L 7 .   ? 7.461   59.378 336.927 1.00 61.65  ? 709 HOH B O   1 
HETATM 8659 O O   . HOH L 7 .   ? -30.357 66.033 350.495 1.00 64.32  ? 710 HOH B O   1 
HETATM 8660 O O   . HOH L 7 .   ? -7.732  58.904 342.066 1.00 56.74  ? 711 HOH B O   1 
HETATM 8661 O O   . HOH L 7 .   ? -17.768 43.043 353.008 1.00 70.77  ? 712 HOH B O   1 
HETATM 8662 O O   . HOH L 7 .   ? -10.853 58.735 358.604 1.00 58.54  ? 713 HOH B O   1 
HETATM 8663 O O   . HOH L 7 .   ? -26.435 63.762 348.838 1.00 59.83  ? 714 HOH B O   1 
HETATM 8664 O O   . HOH L 7 .   ? 8.031   80.539 323.088 1.00 73.16  ? 715 HOH B O   1 
HETATM 8665 O O   . HOH L 7 .   ? 8.825   58.342 338.554 1.00 61.70  ? 716 HOH B O   1 
HETATM 8666 O O   . HOH L 7 .   ? 12.742  49.439 352.055 1.00 62.73  ? 717 HOH B O   1 
HETATM 8667 O O   . HOH L 7 .   ? -16.092 64.576 360.397 1.00 57.70  ? 718 HOH B O   1 
HETATM 8668 O O   . HOH L 7 .   ? 3.869   71.186 360.330 1.00 58.58  ? 719 HOH B O   1 
HETATM 8669 O O   . HOH L 7 .   ? -2.494  79.374 358.316 1.00 69.04  ? 720 HOH B O   1 
HETATM 8670 O O   . HOH L 7 .   ? -3.660  65.170 361.440 1.00 59.58  ? 721 HOH B O   1 
HETATM 8671 O O   . HOH L 7 .   ? -4.363  72.155 356.906 1.00 66.68  ? 722 HOH B O   1 
HETATM 8672 O O   . HOH L 7 .   ? 6.209   69.271 372.598 1.00 71.37  ? 723 HOH B O   1 
HETATM 8673 O O   . HOH L 7 .   ? -7.280  62.449 343.669 1.00 54.71  ? 724 HOH B O   1 
HETATM 8674 O O   . HOH L 7 .   ? 10.077  59.838 345.633 1.00 60.31  ? 725 HOH B O   1 
HETATM 8675 O O   . HOH L 7 .   ? -1.988  59.160 371.707 1.00 49.43  ? 726 HOH B O   1 
HETATM 8676 O O   . HOH L 7 .   ? -14.764 78.705 342.539 1.00 64.95  ? 727 HOH B O   1 
HETATM 8677 O O   . HOH L 7 .   ? 12.798  62.395 363.164 1.00 65.25  ? 728 HOH B O   1 
HETATM 8678 O O   . HOH L 7 .   ? 7.223   64.659 366.524 1.00 56.58  ? 729 HOH B O   1 
HETATM 8679 O O   . HOH L 7 .   ? -10.334 38.561 352.039 1.00 70.98  ? 730 HOH B O   1 
HETATM 8680 O O   . HOH L 7 .   ? 14.641  67.560 357.379 1.00 54.75  ? 731 HOH B O   1 
HETATM 8681 O O   . HOH L 7 .   ? 20.406  65.021 349.271 1.00 69.32  ? 732 HOH B O   1 
HETATM 8682 O O   . HOH L 7 .   ? -1.816  43.085 336.050 1.00 67.43  ? 733 HOH B O   1 
HETATM 8683 O O   . HOH L 7 .   ? -15.878 65.067 340.941 1.00 63.75  ? 734 HOH B O   1 
HETATM 8684 O O   . HOH L 7 .   ? -22.187 49.885 347.905 1.00 64.71  ? 735 HOH B O   1 
HETATM 8685 O O   . HOH L 7 .   ? 5.570   58.366 371.135 1.00 62.62  ? 736 HOH B O   1 
HETATM 8686 O O   . HOH L 7 .   ? 1.657   80.023 334.709 1.00 63.06  ? 737 HOH B O   1 
HETATM 8687 O O   . HOH L 7 .   ? -6.228  62.486 351.099 1.00 54.50  ? 738 HOH B O   1 
HETATM 8688 O O   . HOH L 7 .   ? 2.526   72.067 358.039 1.00 54.07  ? 739 HOH B O   1 
HETATM 8689 O O   . HOH L 7 .   ? -5.693  66.382 331.728 1.00 74.91  ? 740 HOH B O   1 
HETATM 8690 O O   . HOH L 7 .   ? -5.146  61.433 375.744 1.00 70.19  ? 741 HOH B O   1 
HETATM 8691 O O   . HOH L 7 .   ? -2.507  45.541 359.844 1.00 62.30  ? 742 HOH B O   1 
HETATM 8692 O O   . HOH L 7 .   ? -9.078  74.561 359.746 1.00 73.04  ? 743 HOH B O   1 
HETATM 8693 O O   . HOH L 7 .   ? -5.527  58.255 357.610 1.00 46.13  ? 744 HOH B O   1 
HETATM 8694 O O   . HOH L 7 .   ? -5.988  68.943 340.028 1.00 59.78  ? 745 HOH B O   1 
HETATM 8695 O O   . HOH L 7 .   ? -8.975  60.768 374.223 1.00 58.00  ? 746 HOH B O   1 
HETATM 8696 O O   . HOH L 7 .   ? -6.786  40.898 365.507 1.00 57.14  ? 747 HOH B O   1 
HETATM 8697 O O   . HOH L 7 .   ? 12.897  52.496 360.215 1.00 70.19  ? 748 HOH B O   1 
HETATM 8698 O O   . HOH L 7 .   ? 5.645   68.541 354.030 1.00 58.28  ? 749 HOH B O   1 
HETATM 8699 O O   . HOH L 7 .   ? 0.201   53.564 330.453 1.00 61.97  ? 750 HOH B O   1 
HETATM 8700 O O   . HOH L 7 .   ? 13.451  68.005 354.544 1.00 56.01  ? 751 HOH B O   1 
HETATM 8701 O O   . HOH L 7 .   ? -10.776 59.376 372.679 1.00 55.67  ? 752 HOH B O   1 
HETATM 8702 O O   . HOH L 7 .   ? 0.214   47.819 369.244 1.00 72.88  ? 753 HOH B O   1 
HETATM 8703 O O   . HOH L 7 .   ? -10.133 40.470 336.456 1.00 66.68  ? 754 HOH B O   1 
HETATM 8704 O O   . HOH L 7 .   ? 2.180   67.068 362.703 1.00 49.61  ? 755 HOH B O   1 
HETATM 8705 O O   . HOH L 7 .   ? 24.169  69.728 363.650 1.00 73.41  ? 756 HOH B O   1 
HETATM 8706 O O   . HOH L 7 .   ? -3.444  71.942 325.609 1.00 64.21  ? 757 HOH B O   1 
HETATM 8707 O O   . HOH L 7 .   ? -16.748 71.446 346.837 1.00 73.55  ? 758 HOH B O   1 
HETATM 8708 O O   . HOH L 7 .   ? -29.695 64.917 347.433 1.00 71.84  ? 759 HOH B O   1 
HETATM 8709 O O   . HOH L 7 .   ? -13.460 64.158 347.541 1.00 60.07  ? 760 HOH B O   1 
HETATM 8710 O O   . HOH L 7 .   ? -6.255  67.638 354.247 1.00 47.34  ? 761 HOH B O   1 
HETATM 8711 O O   . HOH L 7 .   ? -6.204  65.078 354.333 1.00 49.08  ? 762 HOH B O   1 
HETATM 8712 O O   . HOH L 7 .   ? 11.567  62.001 356.971 1.00 55.47  ? 763 HOH B O   1 
HETATM 8713 O O   . HOH L 7 .   ? -17.833 54.397 335.045 1.00 61.36  ? 764 HOH B O   1 
HETATM 8714 O O   . HOH L 7 .   ? -9.505  60.474 366.162 1.00 50.18  ? 765 HOH B O   1 
HETATM 8715 O O   . HOH L 7 .   ? -14.084 42.953 373.501 1.00 71.14  ? 766 HOH B O   1 
HETATM 8716 O O   . HOH L 7 .   ? 5.237   66.507 367.745 1.00 68.78  ? 767 HOH B O   1 
HETATM 8717 O O   . HOH L 7 .   ? 2.601   43.361 332.515 1.00 71.46  ? 768 HOH B O   1 
HETATM 8718 O O   . HOH L 7 .   ? 12.574  65.390 355.078 1.00 49.85  ? 769 HOH B O   1 
HETATM 8719 O O   . HOH L 7 .   ? -1.225  76.371 361.567 1.00 63.21  ? 770 HOH B O   1 
HETATM 8720 O O   . HOH L 7 .   ? -5.295  65.910 371.996 1.00 63.42  ? 771 HOH B O   1 
HETATM 8721 O O   . HOH L 7 .   ? -4.176  48.096 372.539 1.00 69.16  ? 772 HOH B O   1 
HETATM 8722 O O   . HOH L 7 .   ? -8.204  64.528 363.696 1.00 50.94  ? 773 HOH B O   1 
HETATM 8723 O O   . HOH L 7 .   ? -3.785  45.835 330.348 1.00 65.58  ? 774 HOH B O   1 
HETATM 8724 O O   . HOH L 7 .   ? -11.797 61.478 371.585 1.00 46.78  ? 775 HOH B O   1 
HETATM 8725 O O   . HOH L 7 .   ? -16.579 68.611 347.685 1.00 62.13  ? 776 HOH B O   1 
HETATM 8726 O O   . HOH L 7 .   ? -23.919 68.924 348.864 1.00 72.55  ? 777 HOH B O   1 
HETATM 8727 O O   . HOH L 7 .   ? -3.849  50.739 372.103 1.00 57.26  ? 778 HOH B O   1 
HETATM 8728 O O   . HOH L 7 .   ? -0.726  77.643 359.383 1.00 65.44  ? 779 HOH B O   1 
HETATM 8729 O O   . HOH L 7 .   ? 0.169   70.379 371.490 1.00 68.78  ? 780 HOH B O   1 
HETATM 8730 O O   . HOH L 7 .   ? 8.030   62.548 336.722 1.00 56.82  ? 781 HOH B O   1 
HETATM 8731 O O   . HOH L 7 .   ? -3.831  67.625 334.437 1.00 59.16  ? 782 HOH B O   1 
HETATM 8732 O O   . HOH L 7 .   ? -0.059  64.352 354.239 1.00 54.83  ? 783 HOH B O   1 
HETATM 8733 O O   . HOH L 7 .   ? -6.860  73.565 351.751 1.00 62.97  ? 784 HOH B O   1 
HETATM 8734 O O   . HOH L 7 .   ? -14.181 68.249 357.250 1.00 61.07  ? 785 HOH B O   1 
HETATM 8735 O O   . HOH L 7 .   ? 0.633   75.310 322.506 1.00 59.66  ? 786 HOH B O   1 
HETATM 8736 O O   . HOH L 7 .   ? -11.040 65.931 370.334 1.00 59.42  ? 787 HOH B O   1 
HETATM 8737 O O   . HOH L 7 .   ? -12.741 70.495 357.102 1.00 74.66  ? 788 HOH B O   1 
HETATM 8738 O O   . HOH L 7 .   ? -18.575 65.001 334.525 1.00 63.36  ? 789 HOH B O   1 
HETATM 8739 O O   . HOH L 7 .   ? -15.270 45.437 329.407 1.00 74.86  ? 790 HOH B O   1 
HETATM 8740 O O   . HOH L 7 .   ? -5.911  38.087 352.032 1.00 71.41  ? 791 HOH B O   1 
HETATM 8741 O O   . HOH L 7 .   ? -0.232  73.275 323.662 1.00 70.25  ? 792 HOH B O   1 
HETATM 8742 O O   . HOH L 7 .   ? 16.698  65.245 347.263 1.00 60.62  ? 793 HOH B O   1 
HETATM 8743 O O   . HOH L 7 .   ? -15.368 49.122 326.946 1.00 63.29  ? 794 HOH B O   1 
HETATM 8744 O O   . HOH L 7 .   ? 3.354   51.866 331.837 1.00 72.08  ? 795 HOH B O   1 
HETATM 8745 O O   . HOH L 7 .   ? -8.837  35.540 360.838 1.00 74.75  ? 796 HOH B O   1 
HETATM 8746 O O   . HOH L 7 .   ? -14.399 67.168 354.372 1.00 65.64  ? 797 HOH B O   1 
HETATM 8747 O O   . HOH L 7 .   ? 11.689  57.739 336.363 1.00 73.70  ? 798 HOH B O   1 
HETATM 8748 O O   . HOH L 7 .   ? -2.667  59.072 374.534 1.00 61.29  ? 799 HOH B O   1 
HETATM 8749 O O   . HOH L 7 .   ? -12.059 61.316 328.852 1.00 70.91  ? 800 HOH B O   1 
HETATM 8750 O O   . HOH L 7 .   ? 9.403   78.484 323.470 1.00 67.65  ? 801 HOH B O   1 
HETATM 8751 O O   . HOH L 7 .   ? 6.502   51.852 364.159 1.00 65.99  ? 802 HOH B O   1 
HETATM 8752 O O   . HOH L 7 .   ? -1.534  80.495 318.608 1.00 60.50  ? 803 HOH B O   1 
HETATM 8753 O O   . HOH L 7 .   ? 9.449   68.098 347.855 1.00 30.00  ? 804 HOH B O   1 
HETATM 8754 O O   . HOH L 7 .   ? -6.671  64.158 375.413 1.00 70.17  ? 805 HOH B O   1 
HETATM 8755 O O   . HOH L 7 .   ? 3.653   73.581 371.380 1.00 60.50  ? 806 HOH B O   1 
HETATM 8756 O O   . HOH L 7 .   ? -0.156  61.224 326.158 1.00 55.40  ? 807 HOH B O   1 
HETATM 8757 O O   . HOH L 7 .   ? 5.037   55.032 328.193 1.00 72.15  ? 808 HOH B O   1 
HETATM 8758 O O   . HOH L 7 .   ? -23.708 46.540 357.498 1.00 73.78  ? 809 HOH B O   1 
HETATM 8759 O O   . HOH L 7 .   ? -20.128 61.460 334.003 1.00 69.21  ? 810 HOH B O   1 
HETATM 8760 O O   . HOH L 7 .   ? -2.840  45.886 323.347 1.00 70.95  ? 811 HOH B O   1 
HETATM 8761 O O   . HOH L 7 .   ? -25.156 60.334 332.615 1.00 70.44  ? 812 HOH B O   1 
HETATM 8762 O O   . HOH L 7 .   ? 10.912  69.301 375.442 1.00 65.83  ? 813 HOH B O   1 
HETATM 8763 O O   . HOH L 7 .   ? -5.823  69.391 330.723 1.00 74.91  ? 814 HOH B O   1 
HETATM 8764 O O   . HOH L 7 .   ? -14.760 81.640 337.642 1.00 74.55  ? 815 HOH B O   1 
HETATM 8765 O O   . HOH L 7 .   ? -3.691  77.448 363.028 1.00 69.47  ? 816 HOH B O   1 
HETATM 8766 O O   . HOH L 7 .   ? -1.571  49.803 372.547 1.00 69.57  ? 817 HOH B O   1 
HETATM 8767 O O   . HOH L 7 .   ? -3.071  58.317 379.999 1.00 73.10  ? 818 HOH B O   1 
HETATM 8768 O O   . HOH L 7 .   ? -2.817  50.108 383.768 1.00 72.53  ? 819 HOH B O   1 
HETATM 8769 O O   . HOH L 7 .   ? -0.757  69.068 326.035 1.00 73.55  ? 820 HOH B O   1 
HETATM 8770 O O   . HOH L 7 .   ? -18.814 76.528 340.152 1.00 72.62  ? 821 HOH B O   1 
HETATM 8771 O O   . HOH L 7 .   ? 11.545  74.304 322.741 1.00 62.35  ? 822 HOH B O   1 
HETATM 8772 O O   . HOH L 7 .   ? 2.898   47.348 368.856 1.00 74.08  ? 823 HOH B O   1 
HETATM 8773 O O   . HOH L 7 .   ? 6.820   82.824 364.134 1.00 74.28  ? 824 HOH B O   1 
HETATM 8774 O O   . HOH L 7 .   ? 8.064   53.019 365.650 1.00 65.99  ? 825 HOH B O   1 
HETATM 8775 O O   . HOH L 7 .   ? -11.543 64.009 372.509 1.00 54.66  ? 826 HOH B O   1 
HETATM 8776 O O   . HOH L 7 .   ? 5.488   53.660 332.113 1.00 64.42  ? 827 HOH B O   1 
HETATM 8777 O O   . HOH L 7 .   ? 11.309  77.723 325.138 1.00 68.88  ? 828 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 259 PRO PRO A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 ?   ?   ?   A . n 
A 1 493 ASP 493 494 ?   ?   ?   A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 497 ALA ALA A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 ?   ?   ?   B . n 
B 1 262 GLY 262 263 ?   ?   ?   B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 ?   ?   ?   B . n 
B 1 495 LYS 495 496 ?   ?   ?   B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 4 NAG 1   604 605 NAG NAG A . 
G 5 ELT 1   605 1   ELT GA1 A . 
H 6 HI6 1   606 5   HI6 HI6 A . 
I 5 ELT 1   601 2   ELT GA1 B . 
J 6 HI6 1   602 4   HI6 HI6 B . 
K 7 HOH 1   701 202 HOH HOH A . 
K 7 HOH 2   702 186 HOH HOH A . 
K 7 HOH 3   703 124 HOH HOH A . 
K 7 HOH 4   704 220 HOH HOH A . 
K 7 HOH 5   705 15  HOH HOH A . 
K 7 HOH 6   706 99  HOH HOH A . 
K 7 HOH 7   707 47  HOH HOH A . 
K 7 HOH 8   708 158 HOH HOH A . 
K 7 HOH 9   709 268 HOH HOH A . 
K 7 HOH 10  710 243 HOH HOH A . 
K 7 HOH 11  711 153 HOH HOH A . 
K 7 HOH 12  712 200 HOH HOH A . 
K 7 HOH 13  713 318 HOH HOH A . 
K 7 HOH 14  714 295 HOH HOH A . 
K 7 HOH 15  715 191 HOH HOH A . 
K 7 HOH 16  716 87  HOH HOH A . 
K 7 HOH 17  717 98  HOH HOH A . 
K 7 HOH 18  718 335 HOH HOH A . 
K 7 HOH 19  719 183 HOH HOH A . 
K 7 HOH 20  720 306 HOH HOH A . 
K 7 HOH 21  721 224 HOH HOH A . 
K 7 HOH 22  722 261 HOH HOH A . 
K 7 HOH 23  723 161 HOH HOH A . 
K 7 HOH 24  724 80  HOH HOH A . 
K 7 HOH 25  725 138 HOH HOH A . 
K 7 HOH 26  726 121 HOH HOH A . 
K 7 HOH 27  727 313 HOH HOH A . 
K 7 HOH 28  728 204 HOH HOH A . 
K 7 HOH 29  729 300 HOH HOH A . 
K 7 HOH 30  730 254 HOH HOH A . 
K 7 HOH 31  731 92  HOH HOH A . 
K 7 HOH 32  732 238 HOH HOH A . 
K 7 HOH 33  733 175 HOH HOH A . 
K 7 HOH 34  734 45  HOH HOH A . 
K 7 HOH 35  735 354 HOH HOH A . 
K 7 HOH 36  736 61  HOH HOH A . 
K 7 HOH 37  737 225 HOH HOH A . 
K 7 HOH 38  738 134 HOH HOH A . 
K 7 HOH 39  739 222 HOH HOH A . 
K 7 HOH 40  740 22  HOH HOH A . 
K 7 HOH 41  741 75  HOH HOH A . 
K 7 HOH 42  742 194 HOH HOH A . 
K 7 HOH 43  743 221 HOH HOH A . 
K 7 HOH 44  744 76  HOH HOH A . 
K 7 HOH 45  745 77  HOH HOH A . 
K 7 HOH 46  746 195 HOH HOH A . 
K 7 HOH 47  747 67  HOH HOH A . 
K 7 HOH 48  748 199 HOH HOH A . 
K 7 HOH 49  749 212 HOH HOH A . 
K 7 HOH 50  750 102 HOH HOH A . 
K 7 HOH 51  751 177 HOH HOH A . 
K 7 HOH 52  752 164 HOH HOH A . 
K 7 HOH 53  753 139 HOH HOH A . 
K 7 HOH 54  754 236 HOH HOH A . 
K 7 HOH 55  755 70  HOH HOH A . 
K 7 HOH 56  756 165 HOH HOH A . 
K 7 HOH 57  757 100 HOH HOH A . 
K 7 HOH 58  758 84  HOH HOH A . 
K 7 HOH 59  759 209 HOH HOH A . 
K 7 HOH 60  760 251 HOH HOH A . 
K 7 HOH 61  761 160 HOH HOH A . 
K 7 HOH 62  762 395 HOH HOH A . 
K 7 HOH 63  763 378 HOH HOH A . 
K 7 HOH 64  764 307 HOH HOH A . 
K 7 HOH 65  765 396 HOH HOH A . 
K 7 HOH 66  766 189 HOH HOH A . 
K 7 HOH 67  767 60  HOH HOH A . 
K 7 HOH 68  768 355 HOH HOH A . 
K 7 HOH 69  769 93  HOH HOH A . 
K 7 HOH 70  770 303 HOH HOH A . 
K 7 HOH 71  771 123 HOH HOH A . 
K 7 HOH 72  772 46  HOH HOH A . 
K 7 HOH 73  773 256 HOH HOH A . 
K 7 HOH 74  774 69  HOH HOH A . 
K 7 HOH 75  775 95  HOH HOH A . 
K 7 HOH 76  776 293 HOH HOH A . 
K 7 HOH 77  777 117 HOH HOH A . 
K 7 HOH 78  778 208 HOH HOH A . 
K 7 HOH 79  779 205 HOH HOH A . 
K 7 HOH 80  780 314 HOH HOH A . 
K 7 HOH 81  781 270 HOH HOH A . 
K 7 HOH 82  782 56  HOH HOH A . 
K 7 HOH 83  783 126 HOH HOH A . 
K 7 HOH 84  784 97  HOH HOH A . 
K 7 HOH 85  785 73  HOH HOH A . 
K 7 HOH 86  786 280 HOH HOH A . 
K 7 HOH 87  787 184 HOH HOH A . 
K 7 HOH 88  788 334 HOH HOH A . 
K 7 HOH 89  789 42  HOH HOH A . 
K 7 HOH 90  790 41  HOH HOH A . 
K 7 HOH 91  791 82  HOH HOH A . 
K 7 HOH 92  792 332 HOH HOH A . 
K 7 HOH 93  793 163 HOH HOH A . 
K 7 HOH 94  794 159 HOH HOH A . 
K 7 HOH 95  795 284 HOH HOH A . 
K 7 HOH 96  796 358 HOH HOH A . 
K 7 HOH 97  797 319 HOH HOH A . 
K 7 HOH 98  798 388 HOH HOH A . 
K 7 HOH 99  799 127 HOH HOH A . 
K 7 HOH 100 800 39  HOH HOH A . 
K 7 HOH 101 801 157 HOH HOH A . 
K 7 HOH 102 802 179 HOH HOH A . 
K 7 HOH 103 803 101 HOH HOH A . 
K 7 HOH 104 804 283 HOH HOH A . 
K 7 HOH 105 805 288 HOH HOH A . 
K 7 HOH 106 806 156 HOH HOH A . 
K 7 HOH 107 807 28  HOH HOH A . 
K 7 HOH 108 808 63  HOH HOH A . 
K 7 HOH 109 809 315 HOH HOH A . 
K 7 HOH 110 810 35  HOH HOH A . 
K 7 HOH 111 811 11  HOH HOH A . 
K 7 HOH 112 812 144 HOH HOH A . 
K 7 HOH 113 813 88  HOH HOH A . 
K 7 HOH 114 814 330 HOH HOH A . 
K 7 HOH 115 815 325 HOH HOH A . 
K 7 HOH 116 816 316 HOH HOH A . 
K 7 HOH 117 817 18  HOH HOH A . 
K 7 HOH 118 818 282 HOH HOH A . 
K 7 HOH 119 819 36  HOH HOH A . 
K 7 HOH 120 820 374 HOH HOH A . 
K 7 HOH 121 821 108 HOH HOH A . 
K 7 HOH 122 822 146 HOH HOH A . 
K 7 HOH 123 823 34  HOH HOH A . 
K 7 HOH 124 824 340 HOH HOH A . 
K 7 HOH 125 825 266 HOH HOH A . 
K 7 HOH 126 826 33  HOH HOH A . 
K 7 HOH 127 827 348 HOH HOH A . 
K 7 HOH 128 828 297 HOH HOH A . 
K 7 HOH 129 829 336 HOH HOH A . 
K 7 HOH 130 830 331 HOH HOH A . 
K 7 HOH 131 831 341 HOH HOH A . 
K 7 HOH 132 832 64  HOH HOH A . 
K 7 HOH 133 833 342 HOH HOH A . 
K 7 HOH 134 834 327 HOH HOH A . 
K 7 HOH 135 835 32  HOH HOH A . 
K 7 HOH 136 836 16  HOH HOH A . 
K 7 HOH 137 837 207 HOH HOH A . 
K 7 HOH 138 838 31  HOH HOH A . 
K 7 HOH 139 839 59  HOH HOH A . 
K 7 HOH 140 840 37  HOH HOH A . 
K 7 HOH 141 841 13  HOH HOH A . 
K 7 HOH 142 842 52  HOH HOH A . 
K 7 HOH 143 843 356 HOH HOH A . 
K 7 HOH 144 844 113 HOH HOH A . 
K 7 HOH 145 845 48  HOH HOH A . 
L 7 HOH 1   701 104 HOH HOH B . 
L 7 HOH 2   702 265 HOH HOH B . 
L 7 HOH 3   703 131 HOH HOH B . 
L 7 HOH 4   704 83  HOH HOH B . 
L 7 HOH 5   705 229 HOH HOH B . 
L 7 HOH 6   706 206 HOH HOH B . 
L 7 HOH 7   707 217 HOH HOH B . 
L 7 HOH 8   708 203 HOH HOH B . 
L 7 HOH 9   709 242 HOH HOH B . 
L 7 HOH 10  710 6   HOH HOH B . 
L 7 HOH 11  711 58  HOH HOH B . 
L 7 HOH 12  712 302 HOH HOH B . 
L 7 HOH 13  713 96  HOH HOH B . 
L 7 HOH 14  714 234 HOH HOH B . 
L 7 HOH 15  715 248 HOH HOH B . 
L 7 HOH 16  716 17  HOH HOH B . 
L 7 HOH 17  717 351 HOH HOH B . 
L 7 HOH 18  718 281 HOH HOH B . 
L 7 HOH 19  719 235 HOH HOH B . 
L 7 HOH 20  720 310 HOH HOH B . 
L 7 HOH 21  721 226 HOH HOH B . 
L 7 HOH 22  722 219 HOH HOH B . 
L 7 HOH 23  723 292 HOH HOH B . 
L 7 HOH 24  724 193 HOH HOH B . 
L 7 HOH 25  725 89  HOH HOH B . 
L 7 HOH 26  726 40  HOH HOH B . 
L 7 HOH 27  727 255 HOH HOH B . 
L 7 HOH 28  728 213 HOH HOH B . 
L 7 HOH 29  729 216 HOH HOH B . 
L 7 HOH 30  730 276 HOH HOH B . 
L 7 HOH 31  731 72  HOH HOH B . 
L 7 HOH 32  732 386 HOH HOH B . 
L 7 HOH 33  733 239 HOH HOH B . 
L 7 HOH 34  734 267 HOH HOH B . 
L 7 HOH 35  735 274 HOH HOH B . 
L 7 HOH 36  736 272 HOH HOH B . 
L 7 HOH 37  737 211 HOH HOH B . 
L 7 HOH 38  738 130 HOH HOH B . 
L 7 HOH 39  739 54  HOH HOH B . 
L 7 HOH 40  740 112 HOH HOH B . 
L 7 HOH 41  741 350 HOH HOH B . 
L 7 HOH 42  742 260 HOH HOH B . 
L 7 HOH 43  743 246 HOH HOH B . 
L 7 HOH 44  744 152 HOH HOH B . 
L 7 HOH 45  745 192 HOH HOH B . 
L 7 HOH 46  746 286 HOH HOH B . 
L 7 HOH 47  747 81  HOH HOH B . 
L 7 HOH 48  748 110 HOH HOH B . 
L 7 HOH 49  749 176 HOH HOH B . 
L 7 HOH 50  750 232 HOH HOH B . 
L 7 HOH 51  751 253 HOH HOH B . 
L 7 HOH 52  752 74  HOH HOH B . 
L 7 HOH 53  753 116 HOH HOH B . 
L 7 HOH 54  754 118 HOH HOH B . 
L 7 HOH 55  755 128 HOH HOH B . 
L 7 HOH 56  756 339 HOH HOH B . 
L 7 HOH 57  757 299 HOH HOH B . 
L 7 HOH 58  758 215 HOH HOH B . 
L 7 HOH 59  759 369 HOH HOH B . 
L 7 HOH 60  760 241 HOH HOH B . 
L 7 HOH 61  761 23  HOH HOH B . 
L 7 HOH 62  762 201 HOH HOH B . 
L 7 HOH 63  763 214 HOH HOH B . 
L 7 HOH 64  764 181 HOH HOH B . 
L 7 HOH 65  765 125 HOH HOH B . 
L 7 HOH 66  766 107 HOH HOH B . 
L 7 HOH 67  767 301 HOH HOH B . 
L 7 HOH 68  768 91  HOH HOH B . 
L 7 HOH 69  769 155 HOH HOH B . 
L 7 HOH 70  770 51  HOH HOH B . 
L 7 HOH 71  771 264 HOH HOH B . 
L 7 HOH 72  772 259 HOH HOH B . 
L 7 HOH 73  773 105 HOH HOH B . 
L 7 HOH 74  774 227 HOH HOH B . 
L 7 HOH 75  775 262 HOH HOH B . 
L 7 HOH 76  776 2   HOH HOH B . 
L 7 HOH 77  777 394 HOH HOH B . 
L 7 HOH 78  778 3   HOH HOH B . 
L 7 HOH 79  779 296 HOH HOH B . 
L 7 HOH 80  780 290 HOH HOH B . 
L 7 HOH 81  781 263 HOH HOH B . 
L 7 HOH 82  782 170 HOH HOH B . 
L 7 HOH 83  783 79  HOH HOH B . 
L 7 HOH 84  784 174 HOH HOH B . 
L 7 HOH 85  785 285 HOH HOH B . 
L 7 HOH 86  786 5   HOH HOH B . 
L 7 HOH 87  787 43  HOH HOH B . 
L 7 HOH 88  788 304 HOH HOH B . 
L 7 HOH 89  789 111 HOH HOH B . 
L 7 HOH 90  790 86  HOH HOH B . 
L 7 HOH 91  791 257 HOH HOH B . 
L 7 HOH 92  792 298 HOH HOH B . 
L 7 HOH 93  793 53  HOH HOH B . 
L 7 HOH 94  794 337 HOH HOH B . 
L 7 HOH 95  795 141 HOH HOH B . 
L 7 HOH 96  796 187 HOH HOH B . 
L 7 HOH 97  797 258 HOH HOH B . 
L 7 HOH 98  798 145 HOH HOH B . 
L 7 HOH 99  799 115 HOH HOH B . 
L 7 HOH 100 800 132 HOH HOH B . 
L 7 HOH 101 801 25  HOH HOH B . 
L 7 HOH 102 802 362 HOH HOH B . 
L 7 HOH 103 803 147 HOH HOH B . 
L 7 HOH 104 804 403 HOH HOH B . 
L 7 HOH 105 805 106 HOH HOH B . 
L 7 HOH 106 806 57  HOH HOH B . 
L 7 HOH 107 807 50  HOH HOH B . 
L 7 HOH 108 808 171 HOH HOH B . 
L 7 HOH 109 809 279 HOH HOH B . 
L 7 HOH 110 810 129 HOH HOH B . 
L 7 HOH 111 811 289 HOH HOH B . 
L 7 HOH 112 812 190 HOH HOH B . 
L 7 HOH 113 813 275 HOH HOH B . 
L 7 HOH 114 814 136 HOH HOH B . 
L 7 HOH 115 815 151 HOH HOH B . 
L 7 HOH 116 816 370 HOH HOH B . 
L 7 HOH 117 817 321 HOH HOH B . 
L 7 HOH 118 818 401 HOH HOH B . 
L 7 HOH 119 819 71  HOH HOH B . 
L 7 HOH 120 820 329 HOH HOH B . 
L 7 HOH 121 821 1   HOH HOH B . 
L 7 HOH 122 822 19  HOH HOH B . 
L 7 HOH 123 823 328 HOH HOH B . 
L 7 HOH 124 824 148 HOH HOH B . 
L 7 HOH 125 825 44  HOH HOH B . 
L 7 HOH 126 826 27  HOH HOH B . 
L 7 HOH 127 827 68  HOH HOH B . 
L 7 HOH 128 828 166 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F,G,H,K 
1 2 B,D,E,I,J,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5160  ? 
1 MORE         22    ? 
1 'SSA (A^2)'  38510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_557 y,x,-z+2 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 649.7320000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-02-17 
2 'Structure model' 1 1 2021-03-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation_author.identifier_ORCID' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.17.1-3660 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.17.1-3660 5 
# 
_pdbx_entry_details.entry_id                 6WUY 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG  B CYS 409 ? ? SG  B CYS 529 ? ? 0.95 
2 1 OG  B SER 203 ? ? P01 B ELT 601 ? ? 1.11 
3 1 OG  A SER 203 ? ? P01 A ELT 605 ? ? 1.31 
4 1 OG  B SER 203 ? ? O02 B ELT 601 ? ? 1.81 
5 1 OG  A SER 203 ? ? O06 A ELT 605 ? ? 1.92 
6 1 ND2 A ASN 350 ? ? C1  C NAG 1   ? ? 2.09 
7 1 OD1 A ASP 304 ? ? O   A HOH 701 ? ? 2.14 
8 1 CB  A SER 203 ? ? P01 A ELT 605 ? ? 2.14 
9 1 SG  B CYS 409 ? ? CB  B CYS 529 ? ? 2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  B GLU 285 ? ? N  B TRP 286 ? ? CA B TRP 286 ? A 144.88 121.70 23.18  2.50 Y 
2 1 C  B GLU 285 ? ? N  B TRP 286 ? ? CA B TRP 286 ? B 142.59 121.70 20.89  2.50 Y 
3 1 CA B TRP 286 ? A C  B TRP 286 ? ? O  B TRP 286 ? ? 137.12 120.10 17.02  2.10 N 
4 1 CA B TRP 286 ? B C  B TRP 286 ? ? O  B TRP 286 ? ? 136.68 120.10 16.58  2.10 N 
5 1 CA B TRP 286 ? A C  B TRP 286 ? ? N  B HIS 287 ? ? 102.49 117.20 -14.71 2.20 Y 
6 1 CA B TRP 286 ? B C  B TRP 286 ? ? N  B HIS 287 ? ? 103.26 117.20 -13.94 2.20 Y 
7 1 CB B CYS 409 ? ? CA B CYS 409 ? ? C  B CYS 409 ? ? 124.89 111.50 13.39  1.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 62  ? ? -115.95 53.19   
2  1 ALA A 167 ? ? -155.41 70.55   
3  1 SER A 203 ? ? 58.43   -121.82 
4  1 ASP A 306 ? ? -102.38 -78.25  
5  1 VAL A 367 ? ? -116.04 76.70   
6  1 PRO A 368 ? ? -36.14  -12.01  
7  1 ASP A 372 ? ? -121.16 -61.49  
8  1 VAL A 407 ? ? -126.62 -57.04  
9  1 SER B 203 ? ? 57.43   -132.14 
10 1 PRO B 235 ? ? -62.90  3.83    
11 1 HIS B 287 ? ? -56.95  13.46   
12 1 ASP B 306 ? ? -106.68 -75.51  
13 1 TYR B 341 ? ? -98.71  37.93   
14 1 VAL B 367 ? ? -119.26 74.88   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 C NAG 1   ? O1 ? C NAG 1 O1 
2 1 N 1 E NAG 1   ? O1 ? E NAG 1 O1 
3 1 N 1 A NAG 604 ? O1 ? F NAG 1 O1 
4 1 N 1 A ELT 605 ? O1 ? G ELT 1 O1 
5 1 N 1 B ELT 601 ? O1 ? I ELT 1 O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A GLY 260 ? A GLY 259 
4  1 Y 1 A GLY 261 ? A GLY 260 
5  1 Y 1 A THR 262 ? A THR 261 
6  1 Y 1 A GLY 263 ? A GLY 262 
7  1 Y 1 A GLY 264 ? A GLY 263 
8  1 Y 1 A ARG 493 ? A ARG 492 
9  1 Y 1 A ASP 494 ? A ASP 493 
10 1 Y 1 A PRO 495 ? A PRO 494 
11 1 Y 1 A LYS 496 ? A LYS 495 
12 1 Y 1 A THR 543 ? A THR 542 
13 1 Y 1 B GLY 2   ? B GLY 1   
14 1 Y 1 B ARG 3   ? B ARG 2   
15 1 Y 1 B GLY 260 ? B GLY 259 
16 1 Y 1 B GLY 261 ? B GLY 260 
17 1 Y 1 B THR 262 ? B THR 261 
18 1 Y 1 B GLY 263 ? B GLY 262 
19 1 Y 1 B ARG 493 ? B ARG 492 
20 1 Y 1 B ASP 494 ? B ASP 493 
21 1 Y 1 B PRO 495 ? B PRO 494 
22 1 Y 1 B LYS 496 ? B LYS 495 
23 1 Y 1 B THR 543 ? B THR 542 
# 
_pdbx_audit_support.funding_organization   'Defense Threat Reduction Agency (DTRA)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           CB#3889 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 602 n 
C 2 NAG 2 C NAG 2 C NAG 603 n 
C 2 FUC 3 C FUC 3 C FUC 601 n 
D 2 NAG 1 D NAG 1 F NAG 602 n 
D 2 NAG 2 D NAG 2 F NAG 603 n 
D 2 FUC 3 D FUC 3 F FUC 601 n 
E 3 NAG 1 E NAG 1 G NAG 602 n 
E 3 NAG 2 E NAG 2 G NAG 603 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-ROH'                                      'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}'           LINUCS                      PDB-CARE   ?     
4 3 DGlcpNAcb1-4DGlcpNAcb1-ROH                                                   'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                        WURCS                       PDB2Glycan 1.1.0 
6 3 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}'                              LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
3 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
3 NAG 1 n 
3 NAG 2 n 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 ELT ? ? ELT ? ? 'SUBJECT OF INVESTIGATION' ? 
2 HI6 ? ? HI6 ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       NAG 
5 'ethoxy-~{N},~{N}-dimethyl-phosphonamidic acid'                                                ELT 
6 '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' HI6 
7 water                                                                                          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#