data_6WYG
# 
_entry.id   6WYG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WYG         
WWPDB D_1000248973 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WYG 
_pdbx_database_status.recvd_initial_deposition_date   2020-05-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bailey, J.B.' 1 0000-0002-4659-8189 
'Zhang, L.'    2 0000-0001-7758-281X 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary J.Am.Chem.Soc.                           JACSAT ? 1520-5126 ? ? 142 ? 19402 19410 
'Anisotropic Dynamics and Mechanics of Macromolecular Crystals Containing Lattice-Patterned Polymer Networks.' 2020 ? 
10.1021/jacs.0c10065      33124805 ? 
? ? ? ? ? ? ? US ? ? 1       'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 68  ? 352   367   
'Towards automated crystallographic structure refinement with phenix.refine.'                                  2012 ? 
10.1107/S0907444912001308 22505256 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Han, K.'                1  ? 
primary 'Bailey, J.B.'           2  ? 
primary 'Zhang, L.'              3  ? 
primary 'Tezcan, F.A.'           4  ? 
1       'Afonine, P.V.'          5  ? 
1       'Grosse-Kunstleve, R.W.' 6  ? 
1       'Echols, N.'             7  ? 
1       'Headd, J.J.'            8  ? 
1       'Moriarty, N.W.'         9  ? 
1       'Mustyakimov, M.'        10 ? 
1       'Terwilliger, T.C.'      11 ? 
1       'Urzhumtsev, A.'         12 ? 
1       'Zwart, P.H.'            13 ? 
1       'Adams, P.D.'            14 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WYG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     126.810 
_cell.length_a_esd                 ? 
_cell.length_b                     126.810 
_cell.length_b_esd                 ? 
_cell.length_c                     281.285 
_cell.length_c_esd                 ? 
_cell.volume                       3917276.346 
_cell.volume_esd                   ? 
_cell.Z_PDB                        72 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WYG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            
;R 3 2"
;
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ferritin heavy chain'                                                                           21059.211 4   
1.16.3.1 'K86Q, C90E, C102A, C130A, K157C' ? ? 
2 non-polymer nat 'FE (III) ION'                                                                                   55.845    9   ? 
?                                 ? ? 
3 non-polymer syn 'CALCIUM ION'                                                                                    40.078    8   ? 
?                                 ? ? 
4 non-polymer syn 'butyl 1-{[2-(2,5-dioxopyrrolidin-1-yl)ethyl]amino}-2-methyl-1-oxopropan-2-yl carbonotrithioate' 376.558   4   ? 
?                                 ? ? 
5 water       nat water                                                                                            18.015    269 ? 
?                                 ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI
FLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRCMGA
PESGLAEYLFDKHTLGDSDNES
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI
FLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRCMGA
PESGLAEYLFDKHTLGDSDNES
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   THR n 
1 3   ALA n 
1 4   SER n 
1 5   THR n 
1 6   SER n 
1 7   GLN n 
1 8   VAL n 
1 9   ARG n 
1 10  GLN n 
1 11  ASN n 
1 12  TYR n 
1 13  HIS n 
1 14  GLN n 
1 15  ASP n 
1 16  SER n 
1 17  GLU n 
1 18  ALA n 
1 19  ALA n 
1 20  ILE n 
1 21  ASN n 
1 22  ARG n 
1 23  GLN n 
1 24  ILE n 
1 25  ASN n 
1 26  LEU n 
1 27  GLU n 
1 28  LEU n 
1 29  TYR n 
1 30  ALA n 
1 31  SER n 
1 32  TYR n 
1 33  VAL n 
1 34  TYR n 
1 35  LEU n 
1 36  SER n 
1 37  MET n 
1 38  SER n 
1 39  TYR n 
1 40  TYR n 
1 41  PHE n 
1 42  ASP n 
1 43  ARG n 
1 44  ASP n 
1 45  ASP n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  LYS n 
1 50  ASN n 
1 51  PHE n 
1 52  ALA n 
1 53  LYS n 
1 54  TYR n 
1 55  PHE n 
1 56  LEU n 
1 57  HIS n 
1 58  GLN n 
1 59  SER n 
1 60  HIS n 
1 61  GLU n 
1 62  GLU n 
1 63  ARG n 
1 64  GLU n 
1 65  HIS n 
1 66  ALA n 
1 67  GLU n 
1 68  LYS n 
1 69  LEU n 
1 70  MET n 
1 71  LYS n 
1 72  LEU n 
1 73  GLN n 
1 74  ASN n 
1 75  GLN n 
1 76  ARG n 
1 77  GLY n 
1 78  GLY n 
1 79  ARG n 
1 80  ILE n 
1 81  PHE n 
1 82  LEU n 
1 83  GLN n 
1 84  ASP n 
1 85  ILE n 
1 86  GLN n 
1 87  LYS n 
1 88  PRO n 
1 89  ASP n 
1 90  GLU n 
1 91  ASP n 
1 92  ASP n 
1 93  TRP n 
1 94  GLU n 
1 95  SER n 
1 96  GLY n 
1 97  LEU n 
1 98  ASN n 
1 99  ALA n 
1 100 MET n 
1 101 GLU n 
1 102 ALA n 
1 103 ALA n 
1 104 LEU n 
1 105 HIS n 
1 106 LEU n 
1 107 GLU n 
1 108 LYS n 
1 109 ASN n 
1 110 VAL n 
1 111 ASN n 
1 112 GLN n 
1 113 SER n 
1 114 LEU n 
1 115 LEU n 
1 116 GLU n 
1 117 LEU n 
1 118 HIS n 
1 119 LYS n 
1 120 LEU n 
1 121 ALA n 
1 122 THR n 
1 123 ASP n 
1 124 LYS n 
1 125 ASN n 
1 126 ASP n 
1 127 PRO n 
1 128 HIS n 
1 129 LEU n 
1 130 ALA n 
1 131 ASP n 
1 132 PHE n 
1 133 ILE n 
1 134 GLU n 
1 135 THR n 
1 136 HIS n 
1 137 TYR n 
1 138 LEU n 
1 139 ASN n 
1 140 GLU n 
1 141 GLN n 
1 142 VAL n 
1 143 LYS n 
1 144 ALA n 
1 145 ILE n 
1 146 LYS n 
1 147 GLU n 
1 148 LEU n 
1 149 GLY n 
1 150 ASP n 
1 151 HIS n 
1 152 VAL n 
1 153 THR n 
1 154 ASN n 
1 155 LEU n 
1 156 ARG n 
1 157 CYS n 
1 158 MET n 
1 159 GLY n 
1 160 ALA n 
1 161 PRO n 
1 162 GLU n 
1 163 SER n 
1 164 GLY n 
1 165 LEU n 
1 166 ALA n 
1 167 GLU n 
1 168 TYR n 
1 169 LEU n 
1 170 PHE n 
1 171 ASP n 
1 172 LYS n 
1 173 HIS n 
1 174 THR n 
1 175 LEU n 
1 176 GLY n 
1 177 ASP n 
1 178 SER n 
1 179 ASP n 
1 180 ASN n 
1 181 GLU n 
1 182 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   182 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FRIH_HUMAN 
_struct_ref.pdbx_db_accession          P02794 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI
FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA
PESGLAEYLFDKHTLGDSDNES
;
_struct_ref.pdbx_align_begin           2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WYG A 1 ? 182 ? P02794 2 ? 183 ? 1 182 
2 1 6WYG B 1 ? 182 ? P02794 2 ? 183 ? 1 182 
3 1 6WYG C 1 ? 182 ? P02794 2 ? 183 ? 1 182 
4 1 6WYG D 1 ? 182 ? P02794 2 ? 183 ? 1 182 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WYG GLN A 86  ? UNP P02794 LYS 87  'engineered mutation' 86  1  
1 6WYG GLU A 90  ? UNP P02794 CYS 91  'engineered mutation' 90  2  
1 6WYG ALA A 102 ? UNP P02794 CYS 103 'engineered mutation' 102 3  
1 6WYG ALA A 130 ? UNP P02794 CYS 131 'engineered mutation' 130 4  
1 6WYG CYS A 157 ? UNP P02794 LYS 158 'engineered mutation' 157 5  
2 6WYG GLN B 86  ? UNP P02794 LYS 87  'engineered mutation' 86  6  
2 6WYG GLU B 90  ? UNP P02794 CYS 91  'engineered mutation' 90  7  
2 6WYG ALA B 102 ? UNP P02794 CYS 103 'engineered mutation' 102 8  
2 6WYG ALA B 130 ? UNP P02794 CYS 131 'engineered mutation' 130 9  
2 6WYG CYS B 157 ? UNP P02794 LYS 158 'engineered mutation' 157 10 
3 6WYG GLN C 86  ? UNP P02794 LYS 87  'engineered mutation' 86  11 
3 6WYG GLU C 90  ? UNP P02794 CYS 91  'engineered mutation' 90  12 
3 6WYG ALA C 102 ? UNP P02794 CYS 103 'engineered mutation' 102 13 
3 6WYG ALA C 130 ? UNP P02794 CYS 131 'engineered mutation' 130 14 
3 6WYG CYS C 157 ? UNP P02794 LYS 158 'engineered mutation' 157 15 
4 6WYG GLN D 86  ? UNP P02794 LYS 87  'engineered mutation' 86  16 
4 6WYG GLU D 90  ? UNP P02794 CYS 91  'engineered mutation' 90  17 
4 6WYG ALA D 102 ? UNP P02794 CYS 103 'engineered mutation' 102 18 
4 6WYG ALA D 130 ? UNP P02794 CYS 131 'engineered mutation' 130 19 
4 6WYG CYS D 157 ? UNP P02794 LYS 158 'engineered mutation' 157 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                          ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                         ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                       ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                  ? 
'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                                    ? 
'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                                         ? 
'C3 H7 N O2 S'     121.158 
FE  non-polymer         . 'FE (III) ION'                                                                                   ? 
'Fe 3'             55.845  
GLN 'L-peptide linking' y GLUTAMINE                                                                                        ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                  ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                          ? 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                        ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                            ? 
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                       ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                          ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                           ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                       ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                    ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                          ? 
'C5 H9 N O2'       115.130 
RFT non-polymer         . 'butyl 1-{[2-(2,5-dioxopyrrolidin-1-yl)ethyl]amino}-2-methyl-1-oxopropan-2-yl carbonotrithioate' ? 
'C15 H24 N2 O3 S3' 376.558 
SER 'L-peptide linking' y SERINE                                                                                           ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                                        ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                       ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                         ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                           ? 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WYG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.71 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;5 uL reservoir + 5 uL 25 uM 157C delta C-star Human H-chain Ferritin in 15 mM HEPES, pH 7.0 against reservoir of 500 uL 50 mM MES, pH 6.5, 6 mM calcium chloride
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-13 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97946 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97946 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            34.69 
_reflns.entry_id                         6WYG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.27 
_reflns.d_resolution_low                 93.76 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       38783 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.27 
_reflns_shell.d_res_low                   2.34 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3707 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.843 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               55.55 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WYG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.27 
_refine.ls_d_res_low                             50.07 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     38062 
_refine.ls_number_reflns_R_free                  3839 
_refine.ls_number_reflns_R_work                  34223 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.92 
_refine.ls_percent_reflns_R_free                 10.09 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2039 
_refine.ls_R_factor_R_free                       0.2600 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1976 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 6B8F' 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.2660 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3348 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.27 
_refine_hist.d_res_low                        50.07 
_refine_hist.number_atoms_solvent             269 
_refine_hist.number_atoms_total               5796 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        5478 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0078  ? 5632 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9023  ? 7631 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0472  ? 816  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0052  ? 1019 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 10.8700 ? 759  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.27 2.30  . . 102 881  65.71  . . . 0.6432 . 0.6332 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.30 2.33  . . 121 1212 90.01  . . . 0.4652 . 0.3947 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.33 2.36  . . 136 1342 99.53  . . . 0.3442 . 0.2367 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.36 2.40  . . 163 1314 98.86  . . . 0.3198 . 0.2421 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.40 2.43  . . 155 1292 97.77  . . . 0.2984 . 0.2298 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.43 2.47  . . 141 1320 98.98  . . . 0.3075 . 0.2278 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.47 2.51  . . 129 1339 99.73  . . . 0.3071 . 0.2137 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.51 2.55  . . 153 1338 99.87  . . . 0.2881 . 0.2060 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.55 2.60  . . 163 1318 99.73  . . . 0.3213 . 0.2318 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.60 2.65  . . 156 1326 99.26  . . . 0.2704 . 0.2229 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.65 2.70  . . 99  820  61.14  . . . 0.3181 . 0.2283 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.70 2.76  . . 166 1307 99.80  . . . 0.2891 . 0.2279 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.76 2.83  . . 149 1329 99.39  . . . 0.3475 . 0.2597 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.83 2.90  . . 157 1332 99.47  . . . 0.3348 . 0.2387 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.90 2.98  . . 133 1300 96.96  . . . 0.2695 . 0.2259 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.98 3.06  . . 151 1327 99.19  . . . 0.2975 . 0.2199 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.06 3.16  . . 143 1361 100.00 . . . 0.2698 . 0.2006 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.16 3.28  . . 164 1327 99.87  . . . 0.3013 . 0.1978 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.28 3.41  . . 153 1346 99.73  . . . 0.2637 . 0.1865 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.41 3.56  . . 107 1007 74.92  . . . 0.2385 . 0.1723 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.56 3.75  . . 124 1079 79.77  . . . 0.1846 . 0.1596 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.75 3.98  . . 127 1112 81.46  . . . 0.2454 . 0.1611 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.98 4.29  . . 137 1367 99.80  . . . 0.2077 . 0.1458 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.29 4.72  . . 152 1364 100.00 . . . 0.1983 . 0.1340 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.72 5.41  . . 149 1370 99.15  . . . 0.1922 . 0.1538 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.41 6.80  . . 150 1351 98.04  . . . 0.2460 . 0.2044 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.81 50.07 . . 159 1442 98.16  . . . 0.2243 . 0.1894 . . . . . . . . . . . 
# 
_struct.entry_id                     6WYG 
_struct.title                        
'Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a RAFT agent' 
_struct.pdbx_descriptor              'Ferritin heavy chain (E.C.1.16.3.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WYG 
_struct_keywords.text            
'Ferritin, Polymer, Hydrogel, Polymer Integrated Crystals, Crystal Hydrogel Hybrids, RAFT Polymerization, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 13  ? ASP A 42  ? HIS A 13  ASP A 42  1 ? 30 
HELX_P HELX_P2  AA2 LEU A 48  ? ARG A 76  ? LEU A 48  ARG A 76  1 ? 29 
HELX_P HELX_P3  AA3 SER A 95  ? LYS A 124 ? SER A 95  LYS A 124 1 ? 30 
HELX_P HELX_P4  AA4 ASP A 126 ? MET A 158 ? ASP A 126 MET A 158 1 ? 33 
HELX_P HELX_P5  AA5 SER A 163 ? THR A 174 ? SER A 163 THR A 174 1 ? 12 
HELX_P HELX_P6  AA6 HIS B 13  ? ASP B 42  ? HIS B 13  ASP B 42  1 ? 30 
HELX_P HELX_P7  AA7 LEU B 48  ? ARG B 76  ? LEU B 48  ARG B 76  1 ? 29 
HELX_P HELX_P8  AA8 SER B 95  ? LYS B 124 ? SER B 95  LYS B 124 1 ? 30 
HELX_P HELX_P9  AA9 ASP B 126 ? MET B 158 ? ASP B 126 MET B 158 1 ? 33 
HELX_P HELX_P10 AB1 SER B 163 ? THR B 174 ? SER B 163 THR B 174 1 ? 12 
HELX_P HELX_P11 AB2 HIS C 13  ? ASP C 42  ? HIS C 13  ASP C 42  1 ? 30 
HELX_P HELX_P12 AB3 LEU C 48  ? ARG C 76  ? LEU C 48  ARG C 76  1 ? 29 
HELX_P HELX_P13 AB4 SER C 95  ? LYS C 124 ? SER C 95  LYS C 124 1 ? 30 
HELX_P HELX_P14 AB5 ASP C 126 ? MET C 158 ? ASP C 126 MET C 158 1 ? 33 
HELX_P HELX_P15 AB6 SER C 163 ? THR C 174 ? SER C 163 THR C 174 1 ? 12 
HELX_P HELX_P16 AB7 HIS D 13  ? PHE D 41  ? HIS D 13  PHE D 41  1 ? 29 
HELX_P HELX_P17 AB8 LEU D 48  ? ARG D 76  ? LEU D 48  ARG D 76  1 ? 29 
HELX_P HELX_P18 AB9 SER D 95  ? LYS D 124 ? SER D 95  LYS D 124 1 ? 30 
HELX_P HELX_P19 AC1 ASP D 126 ? MET D 158 ? ASP D 126 MET D 158 1 ? 33 
HELX_P HELX_P20 AC2 SER D 163 ? THR D 174 ? SER D 163 THR D 174 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale none ? A CYS 157 SG  ? ? ? 1_555 I  RFT . C20 ? ? A CYS 157 A RFT 205 1_555  ? ? ? ? ? ? ? 1.827 ? ? 
covale2  covale none ? B CYS 157 SG  ? ? ? 1_555 N  RFT . C20 ? ? B CYS 157 B RFT 205 1_555  ? ? ? ? ? ? ? 1.823 ? ? 
covale3  covale none ? C CYS 157 SG  ? ? ? 1_555 S  RFT . C20 ? ? C CYS 157 C RFT 205 1_555  ? ? ? ? ? ? ? 1.836 ? ? 
covale4  covale none ? D CYS 157 SG  ? ? ? 1_555 Y  RFT . C20 ? ? D CYS 157 D RFT 206 1_555  ? ? ? ? ? ? ? 1.814 ? ? 
metalc1  metalc ?    ? A GLU 27  OE1 ? ? ? 1_555 E  FE  . FE  ? ? A GLU 27  A FE  201 1_555  ? ? ? ? ? ? ? 2.526 ? ? 
metalc2  metalc ?    ? A GLU 62  OE1 ? ? ? 1_555 E  FE  . FE  ? ? A GLU 62  A FE  201 1_555  ? ? ? ? ? ? ? 2.515 ? ? 
metalc3  metalc ?    ? A GLU 62  OE1 ? ? ? 1_555 F  FE  . FE  ? ? A GLU 62  A FE  202 1_555  ? ? ? ? ? ? ? 2.790 ? ? 
metalc4  metalc ?    ? A GLU 62  OE2 ? ? ? 1_555 F  FE  . FE  ? ? A GLU 62  A FE  202 1_555  ? ? ? ? ? ? ? 2.475 ? ? 
metalc5  metalc ?    ? A ASP 84  OD1 ? ? ? 1_555 L  CA  . CA  ? ? A ASP 84  B CA  203 2_655  ? ? ? ? ? ? ? 2.892 ? ? 
metalc6  metalc ?    ? A ASP 84  OD2 ? ? ? 1_555 L  CA  . CA  ? ? A ASP 84  B CA  203 2_655  ? ? ? ? ? ? ? 2.702 ? ? 
metalc7  metalc ?    ? A GLN 86  OE1 ? ? ? 1_555 L  CA  . CA  ? ? A GLN 86  B CA  203 6_655  ? ? ? ? ? ? ? 2.873 ? ? 
metalc8  metalc ?    ? A GLU 107 OE1 ? ? ? 1_555 F  FE  . FE  ? ? A GLU 107 A FE  202 1_555  ? ? ? ? ? ? ? 2.462 ? ? 
metalc9  metalc ?    ? A ASN 109 OD1 ? ? ? 1_555 H  CA  . CA  ? ? A ASN 109 A CA  204 1_555  ? ? ? ? ? ? ? 2.494 ? ? 
metalc10 metalc ?    ? A GLN 112 OE1 ? ? ? 1_555 H  CA  . CA  ? ? A GLN 112 A CA  204 1_555  ? ? ? ? ? ? ? 2.277 ? ? 
metalc11 metalc ?    ? A ASP 131 OD1 ? ? ? 1_555 Q  CA  . CA  ? ? A ASP 131 C CA  203 5_555  ? ? ? ? ? ? ? 2.766 ? ? 
metalc12 metalc ?    ? A GLU 134 OE2 ? ? ? 1_555 Q  CA  . CA  ? ? A GLU 134 C CA  203 5_555  ? ? ? ? ? ? ? 2.050 ? ? 
metalc13 metalc ?    ? H CA  .   CA  ? ? ? 1_555 Z  HOH . O   ? ? A CA  204 A HOH 354 1_555  ? ? ? ? ? ? ? 2.471 ? ? 
metalc14 metalc ?    ? Z HOH .   O   ? ? ? 5_555 R  CA  . CA  ? ? A HOH 352 C CA  204 1_555  ? ? ? ? ? ? ? 2.760 ? ? 
metalc15 metalc ?    ? B GLU 27  OE1 ? ? ? 1_555 J  FE  . FE  ? ? B GLU 27  B FE  201 1_555  ? ? ? ? ? ? ? 2.725 ? ? 
metalc16 metalc ?    ? B GLU 62  OE1 ? ? ? 1_555 J  FE  . FE  ? ? B GLU 62  B FE  201 1_555  ? ? ? ? ? ? ? 2.309 ? ? 
metalc17 metalc ?    ? B GLU 62  OE2 ? ? ? 1_555 J  FE  . FE  ? ? B GLU 62  B FE  201 1_555  ? ? ? ? ? ? ? 2.404 ? ? 
metalc18 metalc ?    ? B GLU 62  OE1 ? ? ? 1_555 K  FE  . FE  ? ? B GLU 62  B FE  202 1_555  ? ? ? ? ? ? ? 2.328 ? ? 
metalc19 metalc ?    ? B HIS 65  ND1 ? ? ? 1_555 J  FE  . FE  ? ? B HIS 65  B FE  201 1_555  ? ? ? ? ? ? ? 2.777 ? ? 
metalc20 metalc ?    ? B ASP 84  OD1 ? ? ? 1_555 L  CA  . CA  ? ? B ASP 84  B CA  203 1_555  ? ? ? ? ? ? ? 2.933 ? ? 
metalc21 metalc ?    ? B ASP 84  OD2 ? ? ? 1_555 L  CA  . CA  ? ? B ASP 84  B CA  203 1_555  ? ? ? ? ? ? ? 2.437 ? ? 
metalc22 metalc ?    ? B GLU 107 OE1 ? ? ? 1_555 K  FE  . FE  ? ? B GLU 107 B FE  202 1_555  ? ? ? ? ? ? ? 2.609 ? ? 
metalc23 metalc ?    ? B GLU 107 OE2 ? ? ? 1_555 K  FE  . FE  ? ? B GLU 107 B FE  202 1_555  ? ? ? ? ? ? ? 2.603 ? ? 
metalc24 metalc ?    ? B ASP 131 OD1 ? ? ? 1_555 Q  CA  . CA  ? ? B ASP 131 C CA  203 2_555  ? ? ? ? ? ? ? 2.984 ? ? 
metalc25 metalc ?    ? B GLU 134 OE1 ? ? ? 1_555 Q  CA  . CA  ? ? B GLU 134 C CA  203 2_555  ? ? ? ? ? ? ? 2.854 ? ? 
metalc26 metalc ?    ? B GLU 134 OE2 ? ? ? 1_555 R  CA  . CA  ? ? B GLU 134 C CA  204 2_555  ? ? ? ? ? ? ? 2.992 ? ? 
metalc27 metalc ?    ? B GLU 147 OE1 ? ? ? 1_555 M  CA  . CA  ? ? B GLU 147 B CA  204 1_555  ? ? ? ? ? ? ? 2.907 ? ? 
metalc28 metalc ?    ? K FE  .   FE  ? ? ? 1_555 AA HOH . O   ? ? B FE  202 B HOH 306 1_555  ? ? ? ? ? ? ? 2.512 ? ? 
metalc29 metalc ?    ? M CA  .   CA  ? ? ? 1_555 AA HOH . O   ? ? B CA  204 B HOH 312 1_555  ? ? ? ? ? ? ? 2.985 ? ? 
metalc30 metalc ?    ? M CA  .   CA  ? ? ? 1_555 AA HOH . O   ? ? B CA  204 B HOH 368 1_555  ? ? ? ? ? ? ? 2.751 ? ? 
metalc31 metalc ?    ? M CA  .   CA  ? ? ? 1_555 AA HOH . O   ? ? B CA  204 B HOH 376 1_555  ? ? ? ? ? ? ? 2.898 ? ? 
metalc32 metalc ?    ? C GLU 27  OE1 ? ? ? 1_555 O  FE  . FE  ? ? C GLU 27  C FE  201 1_555  ? ? ? ? ? ? ? 2.404 ? ? 
metalc33 metalc ?    ? C GLU 62  OE2 ? ? ? 1_555 O  FE  . FE  ? ? C GLU 62  C FE  201 1_555  ? ? ? ? ? ? ? 2.745 ? ? 
metalc34 metalc ?    ? C GLU 62  OE1 ? ? ? 1_555 P  FE  . FE  ? ? C GLU 62  C FE  202 1_555  ? ? ? ? ? ? ? 2.081 ? ? 
metalc35 metalc ?    ? C GLU 107 OE1 ? ? ? 1_555 P  FE  . FE  ? ? C GLU 107 C FE  202 1_555  ? ? ? ? ? ? ? 2.703 ? ? 
metalc36 metalc ?    ? C GLU 107 OE2 ? ? ? 1_555 P  FE  . FE  ? ? C GLU 107 C FE  202 1_555  ? ? ? ? ? ? ? 2.431 ? ? 
metalc37 metalc ?    ? C ASP 131 OD1 ? ? ? 1_555 Q  CA  . CA  ? ? C ASP 131 C CA  203 1_555  ? ? ? ? ? ? ? 2.821 ? ? 
metalc38 metalc ?    ? C GLU 134 OE2 ? ? ? 1_555 Q  CA  . CA  ? ? C GLU 134 C CA  203 1_555  ? ? ? ? ? ? ? 2.135 ? ? 
metalc39 metalc ?    ? C GLN 141 OE1 ? ? ? 1_555 P  FE  . FE  ? ? C GLN 141 C FE  202 1_555  ? ? ? ? ? ? ? 2.296 ? ? 
metalc40 metalc ?    ? P FE  .   FE  ? ? ? 1_555 BA HOH . O   ? ? C FE  202 C HOH 310 1_555  ? ? ? ? ? ? ? 2.400 ? ? 
metalc41 metalc ?    ? R CA  .   CA  ? ? ? 1_555 BA HOH . O   ? ? C CA  204 C HOH 315 1_555  ? ? ? ? ? ? ? 3.099 ? ? 
metalc42 metalc ?    ? D GLU 62  OE1 ? ? ? 1_555 T  FE  . FE  ? ? D GLU 62  D FE  201 1_555  ? ? ? ? ? ? ? 2.678 ? ? 
metalc43 metalc ?    ? D GLU 62  OE2 ? ? ? 1_555 T  FE  . FE  ? ? D GLU 62  D FE  201 1_555  ? ? ? ? ? ? ? 2.426 ? ? 
metalc44 metalc ?    ? D GLU 62  OE1 ? ? ? 1_555 U  FE  . FE  ? ? D GLU 62  D FE  202 1_555  ? ? ? ? ? ? ? 2.432 ? ? 
metalc45 metalc ?    ? D GLU 90  OE1 ? ? ? 1_555 X  CA  . CA  ? ? D GLU 90  D CA  205 1_555  ? ? ? ? ? ? ? 3.092 ? ? 
metalc46 metalc ?    ? D GLU 90  OE2 ? ? ? 1_555 X  CA  . CA  ? ? D GLU 90  D CA  205 1_555  ? ? ? ? ? ? ? 2.699 ? ? 
metalc47 metalc ?    ? D ASP 92  OD2 ? ? ? 1_555 X  CA  . CA  ? ? D ASP 92  D CA  205 12_555 ? ? ? ? ? ? ? 3.054 ? ? 
metalc48 metalc ?    ? D GLU 107 OE1 ? ? ? 1_555 U  FE  . FE  ? ? D GLU 107 D FE  202 1_555  ? ? ? ? ? ? ? 2.682 ? ? 
metalc49 metalc ?    ? D GLU 107 OE2 ? ? ? 1_555 U  FE  . FE  ? ? D GLU 107 D FE  202 1_555  ? ? ? ? ? ? ? 2.352 ? ? 
metalc50 metalc ?    ? D ASP 131 OD1 ? ? ? 1_555 V  CA  . CA  ? ? D ASP 131 D CA  203 1_555  ? ? ? ? ? ? ? 2.560 ? ? 
metalc51 metalc ?    ? D ASP 131 OD1 ? ? ? 1_555 V  CA  . CA  ? ? D ASP 131 D CA  203 2_555  ? ? ? ? ? ? ? 2.560 ? ? 
metalc52 metalc ?    ? D GLU 134 OE1 ? ? ? 1_555 V  CA  . CA  ? ? D GLU 134 D CA  203 1_555  ? ? ? ? ? ? ? 2.480 ? ? 
metalc53 metalc ?    ? D GLU 134 OE1 ? ? ? 1_555 V  CA  . CA  ? ? D GLU 134 D CA  203 2_555  ? ? ? ? ? ? ? 2.480 ? ? 
metalc54 metalc ?    ? D GLU 134 OE2 ? ? ? 1_555 W  CA  . CA  ? ? D GLU 134 D CA  204 1_555  ? ? ? ? ? ? ? 2.887 ? ? 
metalc55 metalc ?    ? D GLU 134 OE2 ? ? ? 1_555 W  CA  . CA  ? ? D GLU 134 D CA  204 2_555  ? ? ? ? ? ? ? 2.887 ? ? 
metalc56 metalc ?    ? D GLN 141 OE1 ? ? ? 1_555 T  FE  . FE  ? ? D GLN 141 D FE  201 1_555  ? ? ? ? ? ? ? 2.320 ? ? 
metalc57 metalc ?    ? D GLN 141 OE1 ? ? ? 1_555 U  FE  . FE  ? ? D GLN 141 D FE  202 1_555  ? ? ? ? ? ? ? 2.471 ? ? 
metalc58 metalc ?    ? U FE  .   FE  ? ? ? 1_555 CA HOH . O   ? ? D FE  202 D HOH 312 1_555  ? ? ? ? ? ? ? 2.248 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 160 A . ? ALA 160 A PRO 161 A ? PRO 161 A 1 2.19  
2 ALA 160 B . ? ALA 160 B PRO 161 B ? PRO 161 B 1 -6.62 
3 ALA 160 C . ? ALA 160 C PRO 161 C ? PRO 161 C 1 -3.16 
4 ALA 160 D . ? ALA 160 D PRO 161 D ? PRO 161 D 1 -1.82 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  201 ? 5 'binding site for residue FE A 201'                   
AC2 Software A FE  202 ? 4 'binding site for residue FE A 202'                   
AC3 Software A FE  203 ? 4 'binding site for residue FE A 203'                   
AC4 Software A CA  204 ? 3 'binding site for residue CA A 204'                   
AC5 Software A RFT 205 ? 3 'binding site for residue RFT A 205'                  
AC6 Software B FE  201 ? 5 'binding site for residue FE B 201'                   
AC7 Software B FE  202 ? 5 'binding site for residue FE B 202'                   
AC8 Software B CA  203 ? 4 'binding site for residue CA B 203'                   
AC9 Software B CA  204 ? 4 'binding site for residue CA B 204'                   
AD1 Software C FE  201 ? 4 'binding site for residue FE C 201'                   
AD2 Software C FE  202 ? 5 'binding site for residue FE C 202'                   
AD3 Software C CA  203 ? 6 'binding site for residue CA C 203'                   
AD4 Software C CA  204 ? 4 'binding site for residue CA C 204'                   
AD5 Software D FE  201 ? 5 'binding site for residue FE D 201'                   
AD6 Software D FE  202 ? 5 'binding site for residue FE D 202'                   
AD7 Software D CA  203 ? 6 'binding site for residue CA D 203'                   
AD8 Software D CA  204 ? 3 'binding site for residue CA D 204'                   
AD9 Software D CA  205 ? 3 'binding site for residue CA D 205'                   
AE1 Software B RFT 205 ? 7 'binding site for residue RFT B 205'                  
AE2 Software C RFT 205 ? 8 'binding site for residue RFT C 205'                  
AE3 Software D RFT 206 ? 8 'binding site for Di-peptide RFT D 206 and CYS D 157' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5 GLU A  27  ? GLU A 27  . ? 1_555  ? 
2   AC1 5 GLU A  62  ? GLU A 62  . ? 1_555  ? 
3   AC1 5 HIS A  65  ? HIS A 65  . ? 1_555  ? 
4   AC1 5 GLN A  141 ? GLN A 141 . ? 1_555  ? 
5   AC1 5 FE  F  .   ? FE  A 202 . ? 1_555  ? 
6   AC2 4 GLU A  62  ? GLU A 62  . ? 1_555  ? 
7   AC2 4 GLU A  107 ? GLU A 107 . ? 1_555  ? 
8   AC2 4 GLN A  141 ? GLN A 141 . ? 1_555  ? 
9   AC2 4 FE  E  .   ? FE  A 201 . ? 1_555  ? 
10  AC3 4 HIS A  173 ? HIS A 173 . ? 1_555  ? 
11  AC3 4 HIS B  173 ? HIS B 173 . ? 1_555  ? 
12  AC3 4 HIS C  173 ? HIS C 173 . ? 1_555  ? 
13  AC3 4 HIS D  173 ? HIS D 173 . ? 1_555  ? 
14  AC4 3 ASN A  109 ? ASN A 109 . ? 1_555  ? 
15  AC4 3 GLN A  112 ? GLN A 112 . ? 1_555  ? 
16  AC4 3 HOH Z  .   ? HOH A 354 . ? 1_555  ? 
17  AC5 3 CYS A  157 ? CYS A 157 . ? 1_555  ? 
18  AC5 3 HOH AA .   ? HOH B 320 . ? 1_555  ? 
19  AC5 3 HOH AA .   ? HOH B 323 . ? 1_555  ? 
20  AC6 5 GLU B  27  ? GLU B 27  . ? 1_555  ? 
21  AC6 5 GLU B  62  ? GLU B 62  . ? 1_555  ? 
22  AC6 5 HIS B  65  ? HIS B 65  . ? 1_555  ? 
23  AC6 5 GLN B  141 ? GLN B 141 . ? 1_555  ? 
24  AC6 5 FE  K  .   ? FE  B 202 . ? 1_555  ? 
25  AC7 5 GLU B  62  ? GLU B 62  . ? 1_555  ? 
26  AC7 5 GLU B  107 ? GLU B 107 . ? 1_555  ? 
27  AC7 5 GLN B  141 ? GLN B 141 . ? 1_555  ? 
28  AC7 5 FE  J  .   ? FE  B 201 . ? 1_555  ? 
29  AC7 5 HOH AA .   ? HOH B 306 . ? 1_555  ? 
30  AC8 4 ASP A  84  ? ASP A 84  . ? 3_665  ? 
31  AC8 4 GLN A  86  ? GLN A 86  . ? 6_665  ? 
32  AC8 4 ASP B  84  ? ASP B 84  . ? 1_555  ? 
33  AC8 4 GLN B  86  ? GLN B 86  . ? 4_555  ? 
34  AC9 4 GLU B  147 ? GLU B 147 . ? 1_555  ? 
35  AC9 4 HOH AA .   ? HOH B 312 . ? 1_555  ? 
36  AC9 4 HOH AA .   ? HOH B 368 . ? 1_555  ? 
37  AC9 4 HOH AA .   ? HOH B 376 . ? 1_555  ? 
38  AD1 4 GLU C  27  ? GLU C 27  . ? 1_555  ? 
39  AD1 4 GLU C  62  ? GLU C 62  . ? 1_555  ? 
40  AD1 4 GLN C  141 ? GLN C 141 . ? 1_555  ? 
41  AD1 4 FE  P  .   ? FE  C 202 . ? 1_555  ? 
42  AD2 5 GLU C  62  ? GLU C 62  . ? 1_555  ? 
43  AD2 5 GLU C  107 ? GLU C 107 . ? 1_555  ? 
44  AD2 5 GLN C  141 ? GLN C 141 . ? 1_555  ? 
45  AD2 5 FE  O  .   ? FE  C 201 . ? 1_555  ? 
46  AD2 5 HOH BA .   ? HOH C 310 . ? 1_555  ? 
47  AD3 6 ASP A  131 ? ASP A 131 . ? 5_555  ? 
48  AD3 6 GLU A  134 ? GLU A 134 . ? 5_555  ? 
49  AD3 6 ASP B  131 ? ASP B 131 . ? 3_555  ? 
50  AD3 6 GLU B  134 ? GLU B 134 . ? 3_555  ? 
51  AD3 6 ASP C  131 ? ASP C 131 . ? 1_555  ? 
52  AD3 6 GLU C  134 ? GLU C 134 . ? 1_555  ? 
53  AD4 4 GLU A  134 ? GLU A 134 . ? 5_555  ? 
54  AD4 4 HOH Z  .   ? HOH A 352 . ? 5_555  ? 
55  AD4 4 GLU B  134 ? GLU B 134 . ? 3_555  ? 
56  AD4 4 HOH BA .   ? HOH C 315 . ? 1_555  ? 
57  AD5 5 GLU D  27  ? GLU D 27  . ? 1_555  ? 
58  AD5 5 GLU D  62  ? GLU D 62  . ? 1_555  ? 
59  AD5 5 HIS D  65  ? HIS D 65  . ? 1_555  ? 
60  AD5 5 GLN D  141 ? GLN D 141 . ? 1_555  ? 
61  AD5 5 FE  U  .   ? FE  D 202 . ? 1_555  ? 
62  AD6 5 GLU D  62  ? GLU D 62  . ? 1_555  ? 
63  AD6 5 GLU D  107 ? GLU D 107 . ? 1_555  ? 
64  AD6 5 GLN D  141 ? GLN D 141 . ? 1_555  ? 
65  AD6 5 FE  T  .   ? FE  D 201 . ? 1_555  ? 
66  AD6 5 HOH CA .   ? HOH D 312 . ? 1_555  ? 
67  AD7 6 ASP D  131 ? ASP D 131 . ? 2_555  ? 
68  AD7 6 ASP D  131 ? ASP D 131 . ? 1_555  ? 
69  AD7 6 ASP D  131 ? ASP D 131 . ? 3_555  ? 
70  AD7 6 GLU D  134 ? GLU D 134 . ? 1_555  ? 
71  AD7 6 GLU D  134 ? GLU D 134 . ? 3_555  ? 
72  AD7 6 GLU D  134 ? GLU D 134 . ? 2_555  ? 
73  AD8 3 GLU D  134 ? GLU D 134 . ? 2_555  ? 
74  AD8 3 GLU D  134 ? GLU D 134 . ? 1_555  ? 
75  AD8 3 GLU D  134 ? GLU D 134 . ? 3_555  ? 
76  AD9 3 GLU D  90  ? GLU D 90  . ? 1_555  ? 
77  AD9 3 ASP D  92  ? ASP D 92  . ? 12_555 ? 
78  AD9 3 GLU D  94  ? GLU D 94  . ? 12_555 ? 
79  AE1 7 THR B  153 ? THR B 153 . ? 1_555  ? 
80  AE1 7 ASN B  154 ? ASN B 154 . ? 1_555  ? 
81  AE1 7 LEU B  155 ? LEU B 155 . ? 1_555  ? 
82  AE1 7 ARG B  156 ? ARG B 156 . ? 1_555  ? 
83  AE1 7 MET B  158 ? MET B 158 . ? 1_555  ? 
84  AE1 7 GLY B  159 ? GLY B 159 . ? 1_555  ? 
85  AE1 7 GLY D  164 ? GLY D 164 . ? 1_555  ? 
86  AE2 8 GLY A  164 ? GLY A 164 . ? 1_555  ? 
87  AE2 8 THR C  153 ? THR C 153 . ? 1_555  ? 
88  AE2 8 ASN C  154 ? ASN C 154 . ? 1_555  ? 
89  AE2 8 LEU C  155 ? LEU C 155 . ? 1_555  ? 
90  AE2 8 ARG C  156 ? ARG C 156 . ? 1_555  ? 
91  AE2 8 MET C  158 ? MET C 158 . ? 1_555  ? 
92  AE2 8 GLY C  159 ? GLY C 159 . ? 1_555  ? 
93  AE2 8 HOH BA .   ? HOH C 328 . ? 1_555  ? 
94  AE3 8 GLY C  164 ? GLY C 164 . ? 1_555  ? 
95  AE3 8 LEU C  165 ? LEU C 165 . ? 1_555  ? 
96  AE3 8 THR D  153 ? THR D 153 . ? 1_555  ? 
97  AE3 8 ASN D  154 ? ASN D 154 . ? 1_555  ? 
98  AE3 8 LEU D  155 ? LEU D 155 . ? 1_555  ? 
99  AE3 8 ARG D  156 ? ARG D 156 . ? 1_555  ? 
100 AE3 8 MET D  158 ? MET D 158 . ? 1_555  ? 
101 AE3 8 GLY D  159 ? GLY D 159 . ? 1_555  ? 
# 
_atom_sites.entry_id                    6WYG 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.007886 
_atom_sites.fract_transf_matrix[1][2]   0.004553 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009106 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003555 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C   ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
CA  ? ? 16.26893 3.65395 ? ? 3.58509  77.28589 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
FE  ? ? 20.90327 4.99816 ? ? 2.55100  38.46870 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N   ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O   ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O1- ? ? 5.12366  3.84317 ? ? 3.49406  27.47979 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S   ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A  1 5   ? 55.55233  3.93109   -27.87149 1.000 88.91612  ?  5   THR A N   1 
ATOM   2    C  CA  . THR A  1 5   ? 55.29102  2.91362   -28.88381 1.000 85.01589  ?  5   THR A CA  1 
ATOM   3    C  C   . THR A  1 5   ? 53.87072  2.35215   -28.72229 1.000 81.80957  ?  5   THR A C   1 
ATOM   4    O  O   . THR A  1 5   ? 53.49124  1.38700   -29.38556 1.000 90.30847  ?  5   THR A O   1 
ATOM   5    C  CB  . THR A  1 5   ? 56.33001  1.78092   -28.81941 1.000 80.37236  ?  5   THR A CB  1 
ATOM   6    O  OG1 . THR A  1 5   ? 55.89198  0.68781   -29.63086 1.000 85.05032  ?  5   THR A OG1 1 
ATOM   7    C  CG2 . THR A  1 5   ? 56.52813  1.30769   -27.38888 1.000 73.08786  ?  5   THR A CG2 1 
ATOM   8    N  N   . SER A  1 6   ? 53.08706  2.97030   -27.84154 1.000 70.77163  ?  6   SER A N   1 
ATOM   9    C  CA  . SER A  1 6   ? 51.70353  2.56706   -27.64264 1.000 63.71633  ?  6   SER A CA  1 
ATOM   10   C  C   . SER A  1 6   ? 50.81155  3.11127   -28.75281 1.000 62.29771  ?  6   SER A C   1 
ATOM   11   O  O   . SER A  1 6   ? 51.01011  4.22312   -29.25708 1.000 58.97431  ?  6   SER A O   1 
ATOM   12   C  CB  . SER A  1 6   ? 51.18445  3.04809   -26.28935 1.000 66.98614  ?  6   SER A CB  1 
ATOM   13   O  OG  . SER A  1 6   ? 50.21108  2.14773   -25.78363 1.000 73.63454  ?  6   SER A OG  1 
ATOM   14   N  N   . GLN A  1 7   ? 49.81898  2.30142   -29.13523 1.000 53.39730  ?  7   GLN A N   1 
ATOM   15   C  CA  . GLN A  1 7   ? 48.89788  2.68768   -30.20108 1.000 56.15356  ?  7   GLN A CA  1 
ATOM   16   C  C   . GLN A  1 7   ? 48.01055  3.86638   -29.79701 1.000 56.74979  ?  7   GLN A C   1 
ATOM   17   O  O   . GLN A  1 7   ? 47.54732  4.60977   -30.66421 1.000 60.68408  ?  7   GLN A O   1 
ATOM   18   C  CB  . GLN A  1 7   ? 48.02365  1.49186   -30.58879 1.000 56.94350  ?  7   GLN A CB  1 
ATOM   19   C  CG  . GLN A  1 7   ? 46.92185  1.22402   -29.57034 1.000 52.70900  ?  7   GLN A CG  1 
ATOM   20   C  CD  . GLN A  1 7   ? 46.23274  -0.09990  -29.78456 1.000 56.34292  ?  7   GLN A CD  1 
ATOM   21   O  OE1 . GLN A  1 7   ? 45.93489  -0.48740  -30.91530 1.000 60.03277  ?  7   GLN A OE1 1 
ATOM   22   N  NE2 . GLN A  1 7   ? 46.00513  -0.82129  -28.69713 1.000 49.82277  ?  7   GLN A NE2 1 
ATOM   23   N  N   . VAL A  1 8   ? 47.73330  4.03393   -28.50043 1.000 50.20302  ?  8   VAL A N   1 
ATOM   24   C  CA  . VAL A  1 8   ? 46.91633  5.14250   -28.03777 1.000 48.80162  ?  8   VAL A CA  1 
ATOM   25   C  C   . VAL A  1 8   ? 47.73970  6.36695   -27.68016 1.000 54.90327  ?  8   VAL A C   1 
ATOM   26   O  O   . VAL A  1 8   ? 47.15360  7.42219   -27.38773 1.000 50.59790  ?  8   VAL A O   1 
ATOM   27   C  CB  . VAL A  1 8   ? 46.04119  4.76206   -26.81959 1.000 47.09825  ?  8   VAL A CB  1 
ATOM   28   C  CG1 . VAL A  1 8   ? 45.17178  3.51666   -27.09964 1.000 47.98840  ?  8   VAL A CG1 1 
ATOM   29   C  CG2 . VAL A  1 8   ? 46.88077  4.59688   -25.57891 1.000 46.42581  ?  8   VAL A CG2 1 
ATOM   30   N  N   . ARG A  1 9   ? 49.06725  6.27540   -27.69506 1.000 50.57582  ?  9   ARG A N   1 
ATOM   31   C  CA  . ARG A  1 9   ? 49.86954  7.37384   -27.17718 1.000 55.82719  ?  9   ARG A CA  1 
ATOM   32   C  C   . ARG A  1 9   ? 49.86947  8.54449   -28.15889 1.000 57.18711  ?  9   ARG A C   1 
ATOM   33   O  O   . ARG A  1 9   ? 50.25996  8.39821   -29.32217 1.000 57.54894  ?  9   ARG A O   1 
ATOM   34   C  CB  . ARG A  1 9   ? 51.29300  6.92746   -26.88542 1.000 52.14534  ?  9   ARG A CB  1 
ATOM   35   C  CG  . ARG A  1 9   ? 52.09710  8.01715   -26.18664 1.000 52.37170  ?  9   ARG A CG  1 
ATOM   36   C  CD  . ARG A  1 9   ? 53.49764  7.53960   -25.83682 1.000 55.32759  ?  9   ARG A CD  1 
ATOM   37   N  NE  . ARG A  1 9   ? 54.21404  8.44243   -24.93633 1.000 58.46117  ?  9   ARG A NE  1 
ATOM   38   C  CZ  . ARG A  1 9   ? 54.95242  8.01547   -23.91360 1.000 65.00067  ?  9   ARG A CZ  1 
ATOM   39   N  NH1 . ARG A  1 9   ? 55.03642  6.70948   -23.66315 1.000 65.86816  ?  9   ARG A NH1 1 
ATOM   40   N  NH2 . ARG A  1 9   ? 55.57968  8.87788   -23.12418 1.000 53.57356  ?  9   ARG A NH2 1 
ATOM   41   N  N   . GLN A  1 10  ? 49.42190  9.70274   -27.68586 1.000 52.17216  ?  10  GLN A N   1 
ATOM   42   C  CA  . GLN A  1 10  ? 49.41440  10.91398  -28.49067 1.000 54.85399  ?  10  GLN A CA  1 
ATOM   43   C  C   . GLN A  1 10  ? 49.74253  12.11355  -27.60091 1.000 52.50765  ?  10  GLN A C   1 
ATOM   44   O  O   . GLN A  1 10  ? 49.15581  12.27750  -26.52469 1.000 50.43407  ?  10  GLN A O   1 
ATOM   45   C  CB  . GLN A  1 10  ? 48.05739  11.07643  -29.19938 1.000 51.44901  ?  10  GLN A CB  1 
ATOM   46   C  CG  . GLN A  1 10  ? 47.99784  12.22981  -30.20977 1.000 61.20032  ?  10  GLN A CG  1 
ATOM   47   C  CD  . GLN A  1 10  ? 46.78609  12.17697  -31.13158 1.000 59.81981  ?  10  GLN A CD  1 
ATOM   48   O  OE1 . GLN A  1 10  ? 46.89804  12.44232  -32.33071 1.000 70.57632  ?  10  GLN A OE1 1 
ATOM   49   N  NE2 . GLN A  1 10  ? 45.63250  11.81874  -30.58605 1.000 50.66809  ?  10  GLN A NE2 1 
ATOM   50   N  N   . ASN A  1 11  ? 50.69843  12.93317  -28.04239 1.000 56.88190  ?  11  ASN A N   1 
ATOM   51   C  CA  . ASN A  1 11  ? 51.06124  14.17356  -27.35357 1.000 53.52120  ?  11  ASN A CA  1 
ATOM   52   C  C   . ASN A  1 11  ? 51.44278  13.91257  -25.89786 1.000 54.84356  ?  11  ASN A C   1 
ATOM   53   O  O   . ASN A  1 11  ? 51.14555  14.71304  -25.00605 1.000 55.44980  ?  11  ASN A O   1 
ATOM   54   C  CB  . ASN A  1 11  ? 49.92748  15.20997  -27.44612 1.000 52.77205  ?  11  ASN A CB  1 
ATOM   55   C  CG  . ASN A  1 11  ? 50.36076  16.60753  -26.99092 1.000 56.13734  ?  11  ASN A CG  1 
ATOM   56   O  OD1 . ASN A  1 11  ? 51.50125  17.02813  -27.21729 1.000 56.33220  ?  11  ASN A OD1 1 
ATOM   57   N  ND2 . ASN A  1 11  ? 49.45764  17.31402  -26.31550 1.000 52.13675  ?  11  ASN A ND2 1 
ATOM   58   N  N   . TYR A  1 12  ? 52.09025  12.78387  -25.63185 1.000 56.07978  ?  12  TYR A N   1 
ATOM   59   C  CA  . TYR A  1 12  ? 52.37606  12.35449  -24.26394 1.000 57.94520  ?  12  TYR A CA  1 
ATOM   60   C  C   . TYR A  1 12  ? 53.88055  12.19919  -24.11658 1.000 64.65979  ?  12  TYR A C   1 
ATOM   61   O  O   . TYR A  1 12  ? 54.46020  11.20360  -24.57148 1.000 61.19457  ?  12  TYR A O   1 
ATOM   62   C  CB  . TYR A  1 12  ? 51.65821  11.05799  -23.92031 1.000 50.14740  ?  12  TYR A CB  1 
ATOM   63   C  CG  . TYR A  1 12  ? 51.61816  10.74120  -22.43436 1.000 48.76248  ?  12  TYR A CG  1 
ATOM   64   C  CD1 . TYR A  1 12  ? 51.03743  11.61976  -21.52028 1.000 47.61224  ?  12  TYR A CD1 1 
ATOM   65   C  CD2 . TYR A  1 12  ? 52.13652  9.54288   -21.94772 1.000 48.70119  ?  12  TYR A CD2 1 
ATOM   66   C  CE1 . TYR A  1 12  ? 50.99214  11.31487  -20.16300 1.000 49.85705  ?  12  TYR A CE1 1 
ATOM   67   C  CE2 . TYR A  1 12  ? 52.09244  9.22954   -20.60127 1.000 47.51857  ?  12  TYR A CE2 1 
ATOM   68   C  CZ  . TYR A  1 12  ? 51.52415  10.11050  -19.71133 1.000 51.56280  ?  12  TYR A CZ  1 
ATOM   69   O  OH  . TYR A  1 12  ? 51.48490  9.77744   -18.36806 1.000 45.32087  ?  12  TYR A OH  1 
ATOM   70   N  N   . HIS A  1 13  ? 54.48360  13.17154  -23.44444 1.000 53.39116  ?  13  HIS A N   1 
ATOM   71   C  CA  . HIS A  1 13  ? 55.92681  13.26480  -23.32451 1.000 55.98198  ?  13  HIS A CA  1 
ATOM   72   C  C   . HIS A  1 13  ? 56.44096  12.26132  -22.30739 1.000 57.66511  ?  13  HIS A C   1 
ATOM   73   O  O   . HIS A  1 13  ? 55.73492  11.91449  -21.35194 1.000 52.70925  ?  13  HIS A O   1 
ATOM   74   C  CB  . HIS A  1 13  ? 56.32260  14.68312  -22.91351 1.000 55.57953  ?  13  HIS A CB  1 
ATOM   75   C  CG  . HIS A  1 13  ? 57.75780  15.01019  -23.18520 1.000 64.71890  ?  13  HIS A CG  1 
ATOM   76   N  ND1 . HIS A  1 13  ? 58.78827  14.53313  -22.40644 1.000 58.19463  ?  13  HIS A ND1 1 
ATOM   77   C  CD2 . HIS A  1 13  ? 58.33350  15.76689  -24.15036 1.000 59.61823  ?  13  HIS A CD2 1 
ATOM   78   C  CE1 . HIS A  1 13  ? 59.93570  14.98565  -22.87839 1.000 62.85433  ?  13  HIS A CE1 1 
ATOM   79   N  NE2 . HIS A  1 13  ? 59.68594  15.73505  -23.93560 1.000 61.17449  ?  13  HIS A NE2 1 
ATOM   80   N  N   . GLN A  1 14  ? 57.67740  11.77597  -22.54264 1.000 56.08697  ?  14  GLN A N   1 
ATOM   81   C  CA  . GLN A  1 14  ? 58.31637  10.81577  -21.63626 1.000 55.89354  ?  14  GLN A CA  1 
ATOM   82   C  C   . GLN A  1 14  ? 58.51052  11.40309  -20.24239 1.000 55.05334  ?  14  GLN A C   1 
ATOM   83   O  O   . GLN A  1 14  ? 58.42565  10.67719  -19.24081 1.000 56.12295  ?  14  GLN A O   1 
ATOM   84   C  CB  . GLN A  1 14  ? 59.68246  10.36287  -22.18668 1.000 72.77295  ?  14  GLN A CB  1 
ATOM   85   C  CG  . GLN A  1 14  ? 59.67256  9.83368   -23.60612 1.000 72.80396  ?  14  GLN A CG  1 
ATOM   86   C  CD  . GLN A  1 14  ? 59.60068  8.32812   -23.65953 1.000 70.83327  ?  14  GLN A CD  1 
ATOM   87   O  OE1 . GLN A  1 14  ? 60.53849  7.64291   -23.25586 1.000 84.79117  ?  14  GLN A OE1 1 
ATOM   88   N  NE2 . GLN A  1 14  ? 58.49015  7.80119   -24.15799 1.000 63.05876  ?  14  GLN A NE2 1 
ATOM   89   N  N   . ASP A  1 15  ? 58.82625  12.70641  -20.16382 1.000 55.70535  ?  15  ASP A N   1 
ATOM   90   C  CA  . ASP A  1 15  ? 58.94993  13.37295  -18.87085 1.000 55.01280  ?  15  ASP A CA  1 
ATOM   91   C  C   . ASP A  1 15  ? 57.63972  13.30306  -18.10879 1.000 52.80066  ?  15  ASP A C   1 
ATOM   92   O  O   . ASP A  1 15  ? 57.63136  13.10173  -16.89037 1.000 51.84868  ?  15  ASP A O   1 
ATOM   93   C  CB  . ASP A  1 15  ? 59.35680  14.84264  -19.04901 1.000 56.16840  ?  15  ASP A CB  1 
ATOM   94   C  CG  . ASP A  1 15  ? 60.72338  15.01579  -19.70389 1.000 60.78446  ?  15  ASP A CG  1 
ATOM   95   O  OD1 . ASP A  1 15  ? 61.35777  13.99038  -20.02069 1.000 65.27121  -1 15  ASP A OD1 1 
ATOM   96   O  OD2 . ASP A  1 15  ? 61.15488  16.18245  -19.90774 1.000 60.65576  ?  15  ASP A OD2 1 
ATOM   97   N  N   . SER A  1 16  ? 56.51816  13.48003  -18.81559 1.000 52.40419  ?  16  SER A N   1 
ATOM   98   C  CA  . SER A  1 16  ? 55.19824  13.40067  -18.17687 1.000 50.05260  ?  16  SER A CA  1 
ATOM   99   C  C   . SER A  1 16  ? 54.92225  11.99805  -17.65026 1.000 48.94960  ?  16  SER A C   1 
ATOM   100  O  O   . SER A  1 16  ? 54.47536  11.84100  -16.51165 1.000 47.64499  ?  16  SER A O   1 
ATOM   101  C  CB  . SER A  1 16  ? 54.10236  13.82053  -19.15684 1.000 49.69536  ?  16  SER A CB  1 
ATOM   102  O  OG  . SER A  1 16  ? 54.28968  15.14661  -19.62196 1.000 57.27656  ?  16  SER A OG  1 
ATOM   103  N  N   . GLU A  1 17  ? 55.18971  10.97165  -18.46825 1.000 53.32565  ?  17  GLU A N   1 
ATOM   104  C  CA  . GLU A  1 17  ? 55.05946  9.57787   -18.03307 1.000 48.85247  ?  17  GLU A CA  1 
ATOM   105  C  C   . GLU A  1 17  ? 55.86006  9.32088   -16.76015 1.000 57.04677  ?  17  GLU A C   1 
ATOM   106  O  O   . GLU A  1 17  ? 55.35067  8.72989   -15.79152 1.000 47.48836  ?  17  GLU A O   1 
ATOM   107  C  CB  . GLU A  1 17  ? 55.51979  8.65787   -19.16506 1.000 50.11094  ?  17  GLU A CB  1 
ATOM   108  C  CG  . GLU A  1 17  ? 55.45009  7.15522   -18.87435 1.000 53.91618  ?  17  GLU A CG  1 
ATOM   109  C  CD  . GLU A  1 17  ? 56.03744  6.32131   -20.01527 1.000 59.16249  ?  17  GLU A CD  1 
ATOM   110  O  OE1 . GLU A  1 17  ? 56.36916  6.92300   -21.05594 1.000 59.79884  ?  17  GLU A OE1 1 
ATOM   111  O  OE2 . GLU A  1 17  ? 56.15337  5.07677   -19.89223 1.000 60.30476  -1 17  GLU A OE2 1 
ATOM   112  N  N   . ALA A  1 18  ? 57.11662  9.79145   -16.73478 1.000 50.32323  ?  18  ALA A N   1 
ATOM   113  C  CA  . ALA A  1 18  ? 57.96603  9.55818   -15.57225 1.000 50.48483  ?  18  ALA A CA  1 
ATOM   114  C  C   . ALA A  1 18  ? 57.44093  10.29169  -14.34369 1.000 49.19739  ?  18  ALA A C   1 
ATOM   115  O  O   . ALA A  1 18  ? 57.42108  9.73080   -13.23988 1.000 51.26114  ?  18  ALA A O   1 
ATOM   116  C  CB  . ALA A  1 18  ? 59.41244  9.97457   -15.88304 1.000 52.54079  ?  18  ALA A CB  1 
ATOM   117  N  N   . ALA A  1 19  ? 57.04802  11.55795  -14.50782 1.000 49.14607  ?  19  ALA A N   1 
ATOM   118  C  CA  . ALA A  1 19  ? 56.44458  12.30196  -13.40615 1.000 54.29731  ?  19  ALA A CA  1 
ATOM   119  C  C   . ALA A  1 19  ? 55.18024  11.61571  -12.90421 1.000 46.17070  ?  19  ALA A C   1 
ATOM   120  O  O   . ALA A  1 19  ? 54.93492  11.56960  -11.69674 1.000 45.27198  ?  19  ALA A O   1 
ATOM   121  C  CB  . ALA A  1 19  ? 56.13586  13.73877  -13.83555 1.000 48.41701  ?  19  ALA A CB  1 
ATOM   122  N  N   . ILE A  1 20  ? 54.37730  11.05809  -13.80890 1.000 45.67643  ?  20  ILE A N   1 
ATOM   123  C  CA  . ILE A  1 20  ? 53.16127  10.34960  -13.38339 1.000 44.02243  ?  20  ILE A CA  1 
ATOM   124  C  C   . ILE A  1 20  ? 53.50962  9.13550   -12.52409 1.000 43.66006  ?  20  ILE A C   1 
ATOM   125  O  O   . ILE A  1 20  ? 52.86722  8.88256   -11.50169 1.000 48.59570  ?  20  ILE A O   1 
ATOM   126  C  CB  . ILE A  1 20  ? 52.30429  9.96798   -14.60155 1.000 43.76871  ?  20  ILE A CB  1 
ATOM   127  C  CG1 . ILE A  1 20  ? 51.74275  11.23048  -15.25597 1.000 43.90188  ?  20  ILE A CG1 1 
ATOM   128  C  CG2 . ILE A  1 20  ? 51.16442  9.02356   -14.19429 1.000 50.65503  ?  20  ILE A CG2 1 
ATOM   129  C  CD1 . ILE A  1 20  ? 50.81582  12.00498  -14.35876 1.000 42.74402  ?  20  ILE A CD1 1 
ATOM   130  N  N   . ASN A  1 21  ? 54.56226  8.39609   -12.88972 1.000 45.42475  ?  21  ASN A N   1 
ATOM   131  C  CA  . ASN A  1 21  ? 55.01320  7.30187   -12.02423 1.000 44.69139  ?  21  ASN A CA  1 
ATOM   132  C  C   . ASN A  1 21  ? 55.49293  7.80460   -10.66070 1.000 44.55316  ?  21  ASN A C   1 
ATOM   133  O  O   . ASN A  1 21  ? 55.18861  7.20703   -9.61978  1.000 43.66854  ?  21  ASN A O   1 
ATOM   134  C  CB  . ASN A  1 21  ? 56.12614  6.51354   -12.71861 1.000 50.55921  ?  21  ASN A CB  1 
ATOM   135  C  CG  . ASN A  1 21  ? 55.60806  5.67510   -13.86064 1.000 50.07109  ?  21  ASN A CG  1 
ATOM   136  O  OD1 . ASN A  1 21  ? 54.51021  5.10506   -13.78730 1.000 45.06916  ?  21  ASN A OD1 1 
ATOM   137  N  ND2 . ASN A  1 21  ? 56.37294  5.61606   -14.93476 1.000 47.86707  ?  21  ASN A ND2 1 
ATOM   138  N  N   . ARG A  1 22  ? 56.28612  8.87616   -10.64467 1.000 45.55522  ?  22  ARG A N   1 
ATOM   139  C  CA  . ARG A  1 22  ? 56.70867  9.43587   -9.35987  1.000 45.70943  ?  22  ARG A CA  1 
ATOM   140  C  C   . ARG A  1 22  ? 55.50347  9.82059   -8.50181  1.000 46.30234  ?  22  ARG A C   1 
ATOM   141  O  O   . ARG A  1 22  ? 55.49199  9.58302   -7.28762  1.000 50.79895  ?  22  ARG A O   1 
ATOM   142  C  CB  . ARG A  1 22  ? 57.62279  10.64203  -9.58006  1.000 46.88598  ?  22  ARG A CB  1 
ATOM   143  C  CG  . ARG A  1 22  ? 58.97805  10.28231  -10.18340 1.000 56.43000  ?  22  ARG A CG  1 
ATOM   144  C  CD  . ARG A  1 22  ? 59.92715  11.50389  -10.26551 1.000 61.10922  ?  22  ARG A CD  1 
ATOM   145  N  NE  . ARG A  1 22  ? 60.28473  11.78680  -11.65930 1.000 59.10275  ?  22  ARG A NE  1 
ATOM   146  C  CZ  . ARG A  1 22  ? 59.84498  12.83608  -12.34356 1.000 56.66783  ?  22  ARG A CZ  1 
ATOM   147  N  NH1 . ARG A  1 22  ? 59.05545  13.73773  -11.75799 1.000 61.32888  ?  22  ARG A NH1 1 
ATOM   148  N  NH2 . ARG A  1 22  ? 60.20467  12.99592  -13.60786 1.000 62.55169  ?  22  ARG A NH2 1 
ATOM   149  N  N   . GLN A  1 23  ? 54.46490  10.39108  -9.12062  1.000 44.93368  ?  23  GLN A N   1 
ATOM   150  C  CA  . GLN A  1 23  ? 53.30261  10.82803  -8.35250  1.000 42.34183  ?  23  GLN A CA  1 
ATOM   151  C  C   . GLN A  1 23  ? 52.49846  9.63831   -7.84789  1.000 40.75275  ?  23  GLN A C   1 
ATOM   152  O  O   . GLN A  1 23  ? 51.96918  9.67399   -6.73352  1.000 39.92357  ?  23  GLN A O   1 
ATOM   153  C  CB  . GLN A  1 23  ? 52.42310  11.75206  -9.18876  1.000 41.77131  ?  23  GLN A CB  1 
ATOM   154  C  CG  . GLN A  1 23  ? 51.31451  12.45651  -8.37697  1.000 40.73641  ?  23  GLN A CG  1 
ATOM   155  C  CD  . GLN A  1 23  ? 51.87428  13.56991  -7.50124  1.000 57.82454  ?  23  GLN A CD  1 
ATOM   156  O  OE1 . GLN A  1 23  ? 52.85012  14.24593  -7.86938  1.000 50.85925  ?  23  GLN A OE1 1 
ATOM   157  N  NE2 . GLN A  1 23  ? 51.26883  13.76192  -6.32982  1.000 52.00745  ?  23  GLN A NE2 1 
ATOM   158  N  N   . ILE A  1 24  ? 52.38278  8.58442   -8.66318  1.000 40.71833  ?  24  ILE A N   1 
ATOM   159  C  CA  . ILE A  1 24  ? 51.80065  7.32087   -8.20593  1.000 39.81037  ?  24  ILE A CA  1 
ATOM   160  C  C   . ILE A  1 24  ? 52.47992  6.85294   -6.92156  1.000 47.16335  ?  24  ILE A C   1 
ATOM   161  O  O   . ILE A  1 24  ? 51.81921  6.57368   -5.90456  1.000 38.97255  ?  24  ILE A O   1 
ATOM   162  C  CB  . ILE A  1 24  ? 51.90738  6.26189   -9.31591  1.000 42.11473  ?  24  ILE A CB  1 
ATOM   163  C  CG1 . ILE A  1 24  ? 50.86261  6.52822   -10.40290 1.000 39.75885  ?  24  ILE A CG1 1 
ATOM   164  C  CG2 . ILE A  1 24  ? 51.70450  4.85053   -8.74380  1.000 40.89522  ?  24  ILE A CG2 1 
ATOM   165  C  CD1 . ILE A  1 24  ? 51.15978  5.81400   -11.70619 1.000 40.58594  ?  24  ILE A CD1 1 
ATOM   166  N  N   . ASN A  1 25  ? 53.81964  6.79378   -6.94095  1.000 41.17143  ?  25  ASN A N   1 
ATOM   167  C  CA  . ASN A  1 25  ? 54.54275  6.37445   -5.74311  1.000 48.68773  ?  25  ASN A CA  1 
ATOM   168  C  C   . ASN A  1 25  ? 54.29293  7.32232   -4.57951  1.000 40.95709  ?  25  ASN A C   1 
ATOM   169  O  O   . ASN A  1 25  ? 54.15686  6.88954   -3.42792  1.000 40.55596  ?  25  ASN A O   1 
ATOM   170  C  CB  . ASN A  1 25  ? 56.04837  6.26420   -6.00965  1.000 45.05167  ?  25  ASN A CB  1 
ATOM   171  C  CG  . ASN A  1 25  ? 56.76893  5.64893   -4.84197  1.000 43.75038  ?  25  ASN A CG  1 
ATOM   172  O  OD1 . ASN A  1 25  ? 57.41992  6.34283   -4.06847  1.000 44.35498  ?  25  ASN A OD1 1 
ATOM   173  N  ND2 . ASN A  1 25  ? 56.57371  4.35016   -4.64945  1.000 44.04840  ?  25  ASN A ND2 1 
ATOM   174  N  N   . LEU A  1 26  ? 54.20414  8.62259   -4.86354  1.000 43.68246  ?  26  LEU A N   1 
ATOM   175  C  CA  . LEU A  1 26  ? 53.95150  9.60131   -3.81115  1.000 40.91457  ?  26  LEU A CA  1 
ATOM   176  C  C   . LEU A  1 26  ? 52.57834  9.40326   -3.15773  1.000 44.29254  ?  26  LEU A C   1 
ATOM   177  O  O   . LEU A  1 26  ? 52.44473  9.47240   -1.92708  1.000 39.20808  ?  26  LEU A O   1 
ATOM   178  C  CB  . LEU A  1 26  ? 54.08085  11.00474  -4.39603  1.000 49.42134  ?  26  LEU A CB  1 
ATOM   179  C  CG  . LEU A  1 26  ? 54.12325  12.11315  -3.35039  1.000 49.45672  ?  26  LEU A CG  1 
ATOM   180  C  CD1 . LEU A  1 26  ? 55.14774  11.75452  -2.28936  1.000 45.37000  ?  26  LEU A CD1 1 
ATOM   181  C  CD2 . LEU A  1 26  ? 54.42717  13.46722  -4.01026  1.000 42.72728  ?  26  LEU A CD2 1 
ATOM   182  N  N   . GLU A  1 27  ? 51.54600  9.15345   -3.96235  1.000 38.72612  ?  27  GLU A N   1 
ATOM   183  C  CA  . GLU A  1 27  ? 50.21813  8.93893   -3.39527  1.000 43.55642  ?  27  GLU A CA  1 
ATOM   184  C  C   . GLU A  1 27  ? 50.17512  7.64175   -2.59290  1.000 47.65370  ?  27  GLU A C   1 
ATOM   185  O  O   . GLU A  1 27  ? 49.51153  7.56462   -1.54747  1.000 42.67750  ?  27  GLU A O   1 
ATOM   186  C  CB  . GLU A  1 27  ? 49.15729  8.91856   -4.49602  1.000 37.89789  ?  27  GLU A CB  1 
ATOM   187  C  CG  . GLU A  1 27  ? 49.04130  10.16936  -5.31956  1.000 46.22196  ?  27  GLU A CG  1 
ATOM   188  C  CD  . GLU A  1 27  ? 48.54642  11.36396  -4.52698  1.000 59.38563  ?  27  GLU A CD  1 
ATOM   189  O  OE1 . GLU A  1 27  ? 47.99954  11.15833  -3.42248  1.000 67.34492  ?  27  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A  1 27  ? 48.71770  12.50877  -5.01318  1.000 60.32494  -1 27  GLU A OE2 1 
ATOM   191  N  N   . LEU A  1 28  ? 50.87363  6.60749   -3.06269  1.000 40.70710  ?  28  LEU A N   1 
ATOM   192  C  CA  . LEU A  1 28  ? 50.90368  5.36699   -2.29295  1.000 37.24862  ?  28  LEU A CA  1 
ATOM   193  C  C   . LEU A  1 28  ? 51.63446  5.57795   -0.97523  1.000 40.83150  ?  28  LEU A C   1 
ATOM   194  O  O   . LEU A  1 28  ? 51.22832  5.05272   0.06580   1.000 37.18162  ?  28  LEU A O   1 
ATOM   195  C  CB  . LEU A  1 28  ? 51.55843  4.26864   -3.11662  1.000 37.87568  ?  28  LEU A CB  1 
ATOM   196  C  CG  . LEU A  1 28  ? 50.73394  3.80036   -4.31617  1.000 37.44419  ?  28  LEU A CG  1 
ATOM   197  C  CD1 . LEU A  1 28  ? 51.58312  2.95476   -5.25801  1.000 38.43581  ?  28  LEU A CD1 1 
ATOM   198  C  CD2 . LEU A  1 28  ? 49.50495  3.01946   -3.85856  1.000 36.34711  ?  28  LEU A CD2 1 
ATOM   199  N  N   . TYR A  1 29  ? 52.68472  6.40345   -0.98833  1.000 38.65116  ?  29  TYR A N   1 
ATOM   200  C  CA  . TYR A  1 29  ? 53.38465  6.70262   0.25303   1.000 46.13839  ?  29  TYR A CA  1 
ATOM   201  C  C   . TYR A  1 29  ? 52.46288  7.43105   1.22624   1.000 42.58447  ?  29  TYR A C   1 
ATOM   202  O  O   . TYR A  1 29  ? 52.39353  7.07548   2.40719   1.000 45.30313  ?  29  TYR A O   1 
ATOM   203  C  CB  . TYR A  1 29  ? 54.65557  7.51039   -0.05209  1.000 40.44321  ?  29  TYR A CB  1 
ATOM   204  C  CG  . TYR A  1 29  ? 55.35752  8.10067   1.16109   1.000 41.08001  ?  29  TYR A CG  1 
ATOM   205  C  CD1 . TYR A  1 29  ? 56.07740  7.29544   2.02994   1.000 51.78230  ?  29  TYR A CD1 1 
ATOM   206  C  CD2 . TYR A  1 29  ? 55.30283  9.46638   1.43023   1.000 41.35316  ?  29  TYR A CD2 1 
ATOM   207  C  CE1 . TYR A  1 29  ? 56.73497  7.82383   3.14237   1.000 45.88789  ?  29  TYR A CE1 1 
ATOM   208  C  CE2 . TYR A  1 29  ? 55.95504  10.00944  2.55193   1.000 42.05480  ?  29  TYR A CE2 1 
ATOM   209  C  CZ  . TYR A  1 29  ? 56.67248  9.17710   3.39856   1.000 46.20634  ?  29  TYR A CZ  1 
ATOM   210  O  OH  . TYR A  1 29  ? 57.30771  9.66587   4.51240   1.000 43.19070  ?  29  TYR A OH  1 
ATOM   211  N  N   . ALA A  1 30  ? 51.74166  8.44579   0.74297   1.000 39.20360  ?  30  ALA A N   1 
ATOM   212  C  CA  . ALA A  1 30  ? 50.76642  9.14862   1.58274   1.000 37.52996  ?  30  ALA A CA  1 
ATOM   213  C  C   . ALA A  1 30  ? 49.72331  8.18848   2.15605   1.000 39.99238  ?  30  ALA A C   1 
ATOM   214  O  O   . ALA A  1 30  ? 49.37306  8.25848   3.34887   1.000 38.74858  ?  30  ALA A O   1 
ATOM   215  C  CB  . ALA A  1 30  ? 50.08257  10.25221  0.77260   1.000 37.57991  ?  30  ALA A CB  1 
ATOM   216  N  N   . SER A  1 31  ? 49.20878  7.28809   1.32123   1.000 35.94883  ?  31  SER A N   1 
ATOM   217  C  CA  . SER A  1 31  ? 48.31944  6.24732   1.82172   1.000 41.39450  ?  31  SER A CA  1 
ATOM   218  C  C   . SER A  1 31  ? 48.96182  5.50375   2.99662   1.000 35.50014  ?  31  SER A C   1 
ATOM   219  O  O   . SER A  1 31  ? 48.33272  5.30415   4.05174   1.000 41.67542  ?  31  SER A O   1 
ATOM   220  C  CB  . SER A  1 31  ? 47.96571  5.30213   0.66992   1.000 34.78394  ?  31  SER A CB  1 
ATOM   221  O  OG  . SER A  1 31  ? 47.16243  4.22079   1.10373   1.000 39.68517  ?  31  SER A OG  1 
ATOM   222  N  N   . TYR A  1 32  ? 50.24121  5.14146   2.85156   1.000 36.34622  ?  32  TYR A N   1 
ATOM   223  C  CA  . TYR A  1 32  ? 50.94070  4.37262   3.88776   1.000 36.81322  ?  32  TYR A CA  1 
ATOM   224  C  C   . TYR A  1 32  ? 51.10129  5.16820   5.17477   1.000 37.10274  ?  32  TYR A C   1 
ATOM   225  O  O   . TYR A  1 32  ? 50.91639  4.63861   6.28204   1.000 37.49871  ?  32  TYR A O   1 
ATOM   226  C  CB  . TYR A  1 32  ? 52.31928  3.95332   3.36884   1.000 43.13174  ?  32  TYR A CB  1 
ATOM   227  C  CG  . TYR A  1 32  ? 52.89733  2.72267   4.00102   1.000 41.21884  ?  32  TYR A CG  1 
ATOM   228  C  CD1 . TYR A  1 32  ? 52.10524  1.86367   4.73863   1.000 37.65894  ?  32  TYR A CD1 1 
ATOM   229  C  CD2 . TYR A  1 32  ? 54.25026  2.40117   3.83890   1.000 42.39465  ?  32  TYR A CD2 1 
ATOM   230  C  CE1 . TYR A  1 32  ? 52.63107  0.69375   5.30586   1.000 38.15913  ?  32  TYR A CE1 1 
ATOM   231  C  CE2 . TYR A  1 32  ? 54.78168  1.26057   4.40542   1.000 53.71505  ?  32  TYR A CE2 1 
ATOM   232  C  CZ  . TYR A  1 32  ? 53.96420  0.40420   5.13774   1.000 48.09954  ?  32  TYR A CZ  1 
ATOM   233  O  OH  . TYR A  1 32  ? 54.49312  -0.73078  5.70980   1.000 39.87820  ?  32  TYR A OH  1 
ATOM   234  N  N   . VAL A  1 33  ? 51.50807  6.42422   5.04214   1.000 37.58569  ?  33  VAL A N   1 
ATOM   235  C  CA  . VAL A  1 33  ? 51.63834  7.30456   6.19239   1.000 38.31845  ?  33  VAL A CA  1 
ATOM   236  C  C   . VAL A  1 33  ? 50.33458  7.35972   6.96010   1.000 37.21377  ?  33  VAL A C   1 
ATOM   237  O  O   . VAL A  1 33  ? 50.30764  7.17479   8.18381   1.000 48.70935  ?  33  VAL A O   1 
ATOM   238  C  CB  . VAL A  1 33  ? 52.07813  8.71605   5.74512   1.000 46.19465  ?  33  VAL A CB  1 
ATOM   239  C  CG1 . VAL A  1 33  ? 51.79655  9.73329   6.84569   1.000 38.90126  ?  33  VAL A CG1 1 
ATOM   240  C  CG2 . VAL A  1 33  ? 53.54397  8.72130   5.37168   1.000 39.71050  ?  33  VAL A CG2 1 
ATOM   241  N  N   . TYR A  1 34  ? 49.23401  7.64157   6.25216   1.000 39.01353  ?  34  TYR A N   1 
ATOM   242  C  CA  . TYR A  1 34  ? 47.92564  7.70086   6.91284   1.000 40.34742  ?  34  TYR A CA  1 
ATOM   243  C  C   . TYR A  1 34  ? 47.56975  6.37658   7.58911   1.000 35.40010  ?  34  TYR A C   1 
ATOM   244  O  O   . TYR A  1 34  ? 46.97692  6.37393   8.67051   1.000 38.05529  ?  34  TYR A O   1 
ATOM   245  C  CB  . TYR A  1 34  ? 46.83923  8.09341   5.91384   1.000 35.07089  ?  34  TYR A CB  1 
ATOM   246  C  CG  . TYR A  1 34  ? 46.84620  9.54250   5.54783   1.000 37.41957  ?  34  TYR A CG  1 
ATOM   247  C  CD1 . TYR A  1 34  ? 46.85024  10.51598  6.52540   1.000 55.42422  ?  34  TYR A CD1 1 
ATOM   248  C  CD2 . TYR A  1 34  ? 46.85091  9.94409   4.21544   1.000 36.29749  ?  34  TYR A CD2 1 
ATOM   249  C  CE1 . TYR A  1 34  ? 46.83947  11.87007  6.19151   1.000 62.74529  ?  34  TYR A CE1 1 
ATOM   250  C  CE2 . TYR A  1 34  ? 46.84408  11.27731  3.86297   1.000 39.00357  ?  34  TYR A CE2 1 
ATOM   251  C  CZ  . TYR A  1 34  ? 46.83918  12.24273  4.85658   1.000 59.18735  ?  34  TYR A CZ  1 
ATOM   252  O  OH  . TYR A  1 34  ? 46.83672  13.58255  4.53202   1.000 58.76616  ?  34  TYR A OH  1 
ATOM   253  N  N   . LEU A  1 35  ? 47.91908  5.24074   6.97445   1.000 35.26459  ?  35  LEU A N   1 
ATOM   254  C  CA  . LEU A  1 35  ? 47.62328  3.95653   7.62294   1.000 35.05194  ?  35  LEU A CA  1 
ATOM   255  C  C   . LEU A  1 35  ? 48.44131  3.77362   8.89844   1.000 53.13006  ?  35  LEU A C   1 
ATOM   256  O  O   . LEU A  1 35  ? 47.92544  3.27796   9.91932   1.000 38.51750  ?  35  LEU A O   1 
ATOM   257  C  CB  . LEU A  1 35  ? 47.87899  2.80353   6.65232   1.000 34.93520  ?  35  LEU A CB  1 
ATOM   258  C  CG  . LEU A  1 35  ? 47.79435  1.38266   7.19679   1.000 44.01661  ?  35  LEU A CG  1 
ATOM   259  C  CD1 . LEU A  1 35  ? 46.35998  1.00772   7.53727   1.000 37.98156  ?  35  LEU A CD1 1 
ATOM   260  C  CD2 . LEU A  1 35  ? 48.34316  0.41768   6.17920   1.000 45.13110  ?  35  LEU A CD2 1 
ATOM   261  N  N   . SER A  1 36  ? 49.71593  4.18159   8.86339   1.000 36.62471  ?  36  SER A N   1 
ATOM   262  C  CA  . SER A  1 36  ? 50.50968  4.18482   10.08151  1.000 37.43546  ?  36  SER A CA  1 
ATOM   263  C  C   . SER A  1 36  ? 49.86787  5.03242   11.16966  1.000 37.46366  ?  36  SER A C   1 
ATOM   264  O  O   . SER A  1 36  ? 49.73437  4.58652   12.31302  1.000 37.68968  ?  36  SER A O   1 
ATOM   265  C  CB  . SER A  1 36  ? 51.91732  4.70377   9.81091   1.000 51.42593  ?  36  SER A CB  1 
ATOM   266  O  OG  . SER A  1 36  ? 52.57844  4.78999   11.04843  1.000 39.18253  ?  36  SER A OG  1 
ATOM   267  N  N   . MET A  1 37  ? 49.47401  6.26599   10.83837  1.000 37.36242  ?  37  MET A N   1 
ATOM   268  C  CA  . MET A  1 37  ? 48.88290  7.12828   11.86408  1.000 40.81145  ?  37  MET A CA  1 
ATOM   269  C  C   . MET A  1 37  ? 47.57647  6.54828   12.39041  1.000 36.92344  ?  37  MET A C   1 
ATOM   270  O  O   . MET A  1 37  ? 47.28273  6.61748   13.59726  1.000 42.63582  ?  37  MET A O   1 
ATOM   271  C  CB  . MET A  1 37  ? 48.64213  8.53381   11.31524  1.000 46.32709  ?  37  MET A CB  1 
ATOM   272  C  CG  . MET A  1 37  ? 49.82098  9.12823   10.56543  1.000 49.94668  ?  37  MET A CG  1 
ATOM   273  S  SD  . MET A  1 37  ? 49.34050  10.63449  9.67026   1.000 55.26719  ?  37  MET A SD  1 
ATOM   274  C  CE  . MET A  1 37  ? 49.05539  11.67242  11.02457  1.000 47.45748  ?  37  MET A CE  1 
ATOM   275  N  N   . SER A  1 38  ? 46.78193  5.95063   11.50728  1.000 38.09622  ?  38  SER A N   1 
ATOM   276  C  CA  . SER A  1 38  ? 45.50939  5.41459   11.95457  1.000 36.45207  ?  38  SER A CA  1 
ATOM   277  C  C   . SER A  1 38  ? 45.74997  4.36206   13.01551  1.000 41.75937  ?  38  SER A C   1 
ATOM   278  O  O   . SER A  1 38  ? 45.21575  4.43722   14.12837  1.000 36.11546  ?  38  SER A O   1 
ATOM   279  C  CB  . SER A  1 38  ? 44.73764  4.83320   10.77513  1.000 39.01409  ?  38  SER A CB  1 
ATOM   280  O  OG  . SER A  1 38  ? 43.66758  4.04870   11.23687  1.000 34.19152  ?  38  SER A OG  1 
ATOM   281  N  N   . TYR A  1 39  ? 46.61421  3.40700   12.71765  1.000 44.79845  ?  39  TYR A N   1 
ATOM   282  C  CA  . TYR A  1 39  ? 46.78311  2.36810   13.71595  1.000 48.95270  ?  39  TYR A CA  1 
ATOM   283  C  C   . TYR A  1 39  ? 47.59145  2.84375   14.92169  1.000 45.12589  ?  39  TYR A C   1 
ATOM   284  O  O   . TYR A  1 39  ? 47.44492  2.27405   16.00957  1.000 37.73281  ?  39  TYR A O   1 
ATOM   285  C  CB  . TYR A  1 39  ? 47.34259  1.12180   13.04014  1.000 42.41709  ?  39  TYR A CB  1 
ATOM   286  C  CG  . TYR A  1 39  ? 46.17456  0.37928   12.42872  1.000 40.03507  ?  39  TYR A CG  1 
ATOM   287  C  CD1 . TYR A  1 39  ? 45.38405  -0.46608  13.19845  1.000 40.38476  ?  39  TYR A CD1 1 
ATOM   288  C  CD2 . TYR A  1 39  ? 45.80199  0.59891   11.11349  1.000 42.89259  ?  39  TYR A CD2 1 
ATOM   289  C  CE1 . TYR A  1 39  ? 44.26679  -1.10441  12.65309  1.000 34.79937  ?  39  TYR A CE1 1 
ATOM   290  C  CE2 . TYR A  1 39  ? 44.70410  -0.04288  10.56223  1.000 34.18630  ?  39  TYR A CE2 1 
ATOM   291  C  CZ  . TYR A  1 39  ? 43.94201  -0.89093  11.33743  1.000 34.15749  ?  39  TYR A CZ  1 
ATOM   292  O  OH  . TYR A  1 39  ? 42.84633  -1.52069  10.78243  1.000 36.10225  ?  39  TYR A OH  1 
ATOM   293  N  N   . TYR A  1 40  ? 48.36302  3.92644   14.79563  1.000 37.81516  ?  40  TYR A N   1 
ATOM   294  C  CA  . TYR A  1 40  ? 48.90164  4.53058   16.00700  1.000 44.73948  ?  40  TYR A CA  1 
ATOM   295  C  C   . TYR A  1 40  ? 47.78216  4.96340   16.94889  1.000 45.96115  ?  40  TYR A C   1 
ATOM   296  O  O   . TYR A  1 40  ? 47.87830  4.76972   18.16846  1.000 39.45715  ?  40  TYR A O   1 
ATOM   297  C  CB  . TYR A  1 40  ? 49.79728  5.71780   15.67805  1.000 42.10412  ?  40  TYR A CB  1 
ATOM   298  C  CG  . TYR A  1 40  ? 50.13610  6.52162   16.89369  1.000 40.91575  ?  40  TYR A CG  1 
ATOM   299  C  CD1 . TYR A  1 40  ? 51.14396  6.11527   17.76576  1.000 47.09917  ?  40  TYR A CD1 1 
ATOM   300  C  CD2 . TYR A  1 40  ? 49.44750  7.69059   17.17817  1.000 40.45468  ?  40  TYR A CD2 1 
ATOM   301  C  CE1 . TYR A  1 40  ? 51.46277  6.86389   18.90172  1.000 44.14428  ?  40  TYR A CE1 1 
ATOM   302  C  CE2 . TYR A  1 40  ? 49.75627  8.44611   18.28701  1.000 43.89308  ?  40  TYR A CE2 1 
ATOM   303  C  CZ  . TYR A  1 40  ? 50.75517  8.03288   19.15361  1.000 45.42190  ?  40  TYR A CZ  1 
ATOM   304  O  OH  . TYR A  1 40  ? 51.02323  8.81347   20.26371  1.000 47.52651  ?  40  TYR A OH  1 
ATOM   305  N  N   . PHE A  1 41  ? 46.70572  5.55033   16.40868  1.000 49.71585  ?  41  PHE A N   1 
ATOM   306  C  CA  . PHE A  1 41  ? 45.62701  5.98358   17.29779  1.000 38.28738  ?  41  PHE A CA  1 
ATOM   307  C  C   . PHE A  1 41  ? 44.74092  4.83935   17.80638  1.000 43.29725  ?  41  PHE A C   1 
ATOM   308  O  O   . PHE A  1 41  ? 43.88815  5.07715   18.67605  1.000 43.05903  ?  41  PHE A O   1 
ATOM   309  C  CB  . PHE A  1 41  ? 44.80901  7.07510   16.60329  1.000 38.38632  ?  41  PHE A CB  1 
ATOM   310  C  CG  . PHE A  1 41  ? 45.56783  8.36806   16.48847  1.000 38.65542  ?  41  PHE A CG  1 
ATOM   311  C  CD1 . PHE A  1 41  ? 45.81853  9.13228   17.61783  1.000 44.33722  ?  41  PHE A CD1 1 
ATOM   312  C  CD2 . PHE A  1 41  ? 46.10419  8.77309   15.28677  1.000 38.78435  ?  41  PHE A CD2 1 
ATOM   313  C  CE1 . PHE A  1 41  ? 46.57637  10.31509  17.54563  1.000 47.01156  ?  41  PHE A CE1 1 
ATOM   314  C  CE2 . PHE A  1 41  ? 46.86093  9.95309   15.20107  1.000 44.41782  ?  41  PHE A CE2 1 
ATOM   315  C  CZ  . PHE A  1 41  ? 47.09541  10.72273  16.33559  1.000 40.08434  ?  41  PHE A CZ  1 
ATOM   316  N  N   . ASP A  1 42  ? 44.95157  3.60836   17.32745  1.000 44.21141  ?  42  ASP A N   1 
ATOM   317  C  CA  . ASP A  1 42  ? 44.27060  2.40526   17.80085  1.000 39.85966  ?  42  ASP A CA  1 
ATOM   318  C  C   . ASP A  1 42  ? 45.02124  1.71554   18.93792  1.000 47.35714  ?  42  ASP A C   1 
ATOM   319  O  O   . ASP A  1 42  ? 44.48805  0.77615   19.53720  1.000 50.48631  ?  42  ASP A O   1 
ATOM   320  C  CB  . ASP A  1 42  ? 44.07112  1.43604   16.61982  1.000 38.64966  ?  42  ASP A CB  1 
ATOM   321  C  CG  . ASP A  1 42  ? 43.37100  0.10244   17.01438  1.000 44.98936  ?  42  ASP A CG  1 
ATOM   322  O  OD1 . ASP A  1 42  ? 42.23725  0.14162   17.55914  1.000 42.10057  ?  42  ASP A OD1 1 
ATOM   323  O  OD2 . ASP A  1 42  ? 43.95743  -0.99076  16.74251  1.000 41.64462  -1 42  ASP A OD2 1 
ATOM   324  N  N   . ARG A  1 43  ? 46.23233  2.16505   19.26025  1.000 49.45789  ?  43  ARG A N   1 
ATOM   325  C  CA  . ARG A  1 43  ? 46.97257  1.59737   20.38280  1.000 44.90156  ?  43  ARG A CA  1 
ATOM   326  C  C   . ARG A  1 43  ? 46.19694  1.75734   21.68939  1.000 49.18859  ?  43  ARG A C   1 
ATOM   327  O  O   . ARG A  1 43  ? 45.48305  2.74365   21.91026  1.000 44.98992  ?  43  ARG A O   1 
ATOM   328  C  CB  . ARG A  1 43  ? 48.35302  2.26170   20.51169  1.000 40.69523  ?  43  ARG A CB  1 
ATOM   329  C  CG  . ARG A  1 43  ? 49.26714  2.03761   19.30887  1.000 40.38195  ?  43  ARG A CG  1 
ATOM   330  C  CD  . ARG A  1 43  ? 50.42862  2.99074   19.28037  1.000 43.14574  ?  43  ARG A CD  1 
ATOM   331  N  NE  . ARG A  1 43  ? 51.08724  3.05257   20.58101  1.000 50.44263  ?  43  ARG A NE  1 
ATOM   332  C  CZ  . ARG A  1 43  ? 52.38427  3.30242   20.75749  1.000 52.52985  ?  43  ARG A CZ  1 
ATOM   333  N  NH1 . ARG A  1 43  ? 53.18544  3.51532   19.71371  1.000 43.01368  ?  43  ARG A NH1 1 
ATOM   334  N  NH2 . ARG A  1 43  ? 52.87505  3.35536   21.98435  1.000 44.16051  ?  43  ARG A NH2 1 
ATOM   335  N  N   . ASP A  1 44  ? 46.35954  0.77415   22.57160  1.000 41.13558  ?  44  ASP A N   1 
ATOM   336  C  CA  . ASP A  1 44  ? 45.63392  0.78985   23.83266  1.000 41.82497  ?  44  ASP A CA  1 
ATOM   337  C  C   . ASP A  1 44  ? 46.05926  1.94858   24.71405  1.000 46.83107  ?  44  ASP A C   1 
ATOM   338  O  O   . ASP A  1 44  ? 45.26072  2.41682   25.53454  1.000 48.69983  ?  44  ASP A O   1 
ATOM   339  C  CB  . ASP A  1 44  ? 45.84334  -0.52583  24.57055  1.000 50.30583  ?  44  ASP A CB  1 
ATOM   340  C  CG  . ASP A  1 44  ? 47.30606  -0.79040  24.86467  1.000 55.62991  ?  44  ASP A CG  1 
ATOM   341  O  OD1 . ASP A  1 44  ? 47.99472  -1.34715  23.97108  1.000 57.88360  -1 44  ASP A OD1 1 
ATOM   342  O  OD2 . ASP A  1 44  ? 47.75668  -0.42528  25.97389  1.000 47.39897  -1 44  ASP A OD2 1 
ATOM   343  N  N   . ASP A  1 45  ? 47.29807  2.42883   24.55862  1.000 46.80230  ?  45  ASP A N   1 
ATOM   344  C  CA  . ASP A  1 45  ? 47.79752  3.57062   25.31295  1.000 46.07310  ?  45  ASP A CA  1 
ATOM   345  C  C   . ASP A  1 45  ? 47.59284  4.90527   24.58235  1.000 46.16433  ?  45  ASP A C   1 
ATOM   346  O  O   . ASP A  1 45  ? 48.20177  5.91975   24.96810  1.000 49.45555  ?  45  ASP A O   1 
ATOM   347  C  CB  . ASP A  1 45  ? 49.28791  3.37321   25.65997  1.000 44.99867  ?  45  ASP A CB  1 
ATOM   348  C  CG  . ASP A  1 45  ? 50.17139  3.37473   24.43339  1.000 51.96326  ?  45  ASP A CG  1 
ATOM   349  O  OD1 . ASP A  1 45  ? 49.63670  3.22695   23.31545  1.000 46.84249  ?  45  ASP A OD1 1 
ATOM   350  O  OD2 . ASP A  1 45  ? 51.41084  3.54098   24.57805  1.000 66.24090  -1 45  ASP A OD2 1 
ATOM   351  N  N   . VAL A  1 46  ? 46.76879  4.92475   23.53350  1.000 45.70938  ?  46  VAL A N   1 
ATOM   352  C  CA  . VAL A  1 46  ? 46.34868  6.16747   22.88079  1.000 46.46084  ?  46  VAL A CA  1 
ATOM   353  C  C   . VAL A  1 46  ? 44.82320  6.20180   22.80045  1.000 45.68559  ?  46  VAL A C   1 
ATOM   354  O  O   . VAL A  1 46  ? 44.17539  7.04015   23.44049  1.000 47.83125  ?  46  VAL A O   1 
ATOM   355  C  CB  . VAL A  1 46  ? 46.98406  6.30774   21.48538  1.000 53.87838  ?  46  VAL A CB  1 
ATOM   356  C  CG1 . VAL A  1 46  ? 46.48849  7.57520   20.78917  1.000 45.82714  ?  46  VAL A CG1 1 
ATOM   357  C  CG2 . VAL A  1 46  ? 48.52276  6.28004   21.58558  1.000 42.30612  ?  46  VAL A CG2 1 
ATOM   358  N  N   . ALA A  1 47  ? 44.24439  5.30609   21.99399  1.000 40.77974  ?  47  ALA A N   1 
ATOM   359  C  CA  . ALA A  1 47  ? 42.82225  4.95789   22.07192  1.000 43.69272  ?  47  ALA A CA  1 
ATOM   360  C  C   . ALA A  1 47  ? 41.91636  6.13844   21.71990  1.000 48.60296  ?  47  ALA A C   1 
ATOM   361  O  O   . ALA A  1 47  ? 41.01431  6.50494   22.47471  1.000 40.80274  ?  47  ALA A O   1 
ATOM   362  C  CB  . ALA A  1 47  ? 42.47007  4.40409   23.45434  1.000 41.25608  ?  47  ALA A CB  1 
ATOM   363  N  N   . LEU A  1 48  ? 42.16061  6.72828   20.55480  1.000 39.60328  ?  48  LEU A N   1 
ATOM   364  C  CA  . LEU A  1 48  ? 41.30916  7.76546   19.99499  1.000 39.38209  ?  48  LEU A CA  1 
ATOM   365  C  C   . LEU A  1 48  ? 40.67806  7.19944   18.72110  1.000 38.13575  ?  48  LEU A C   1 
ATOM   366  O  O   . LEU A  1 48  ? 41.19803  7.40159   17.61994  1.000 37.57037  ?  48  LEU A O   1 
ATOM   367  C  CB  . LEU A  1 48  ? 42.12793  9.06503   19.74654  1.000 42.67635  ?  48  LEU A CB  1 
ATOM   368  C  CG  . LEU A  1 48  ? 42.68422  9.67488   21.03770  1.000 44.68735  ?  48  LEU A CG  1 
ATOM   369  C  CD1 . LEU A  1 48  ? 44.02934  10.36677  20.86340  1.000 50.06863  ?  48  LEU A CD1 1 
ATOM   370  C  CD2 . LEU A  1 48  ? 41.65093  10.64268  21.61213  1.000 46.99691  ?  48  LEU A CD2 1 
ATOM   371  N  N   . LYS A  1 49  ? 39.52940  6.51405   18.88270  1.000 36.87325  ?  49  LYS A N   1 
ATOM   372  C  CA  . LYS A  1 49  ? 38.93688  5.74607   17.78843  1.000 36.80543  ?  49  LYS A CA  1 
ATOM   373  C  C   . LYS A  1 49  ? 38.65874  6.60393   16.55955  1.000 37.25694  ?  49  LYS A C   1 
ATOM   374  O  O   . LYS A  1 49  ? 38.78421  6.12156   15.42720  1.000 41.36302  ?  49  LYS A O   1 
ATOM   375  C  CB  . LYS A  1 49  ? 37.64289  5.06966   18.25137  1.000 40.54168  ?  49  LYS A CB  1 
ATOM   376  N  N   . ASN A  1 50  ? 38.29706  7.87109   16.75112  1.000 38.45688  ?  50  ASN A N   1 
ATOM   377  C  CA  . ASN A  1 50  ? 37.89789  8.68980   15.61055  1.000 38.36300  ?  50  ASN A CA  1 
ATOM   378  C  C   . ASN A  1 50  ? 39.09078  9.31335   14.90708  1.000 38.49888  ?  50  ASN A C   1 
ATOM   379  O  O   . ASN A  1 50  ? 39.07049  9.45991   13.68773  1.000 40.94755  ?  50  ASN A O   1 
ATOM   380  C  CB  . ASN A  1 50  ? 36.89667  9.74218   16.07005  1.000 41.23749  ?  50  ASN A CB  1 
ATOM   381  C  CG  . ASN A  1 50  ? 35.57019  9.12760   16.44086  1.000 38.95578  ?  50  ASN A CG  1 
ATOM   382  O  OD1 . ASN A  1 50  ? 35.09260  8.24986   15.75309  1.000 38.87590  ?  50  ASN A OD1 1 
ATOM   383  N  ND2 . ASN A  1 50  ? 34.99282  9.55953   17.54135  1.000 50.74334  ?  50  ASN A ND2 1 
ATOM   384  N  N   . PHE A  1 51  ? 40.15097  9.64404   15.63359  1.000 38.38861  ?  51  PHE A N   1 
ATOM   385  C  CA  . PHE A  1 51  ? 41.42171  9.90343   14.97033  1.000 38.47667  ?  51  PHE A CA  1 
ATOM   386  C  C   . PHE A  1 51  ? 41.81016  8.73170   14.06512  1.000 39.60055  ?  51  PHE A C   1 
ATOM   387  O  O   . PHE A  1 51  ? 42.15770  8.91943   12.88801  1.000 42.18215  ?  51  PHE A O   1 
ATOM   388  C  CB  . PHE A  1 51  ? 42.49820  10.16694  16.02335  1.000 44.46871  ?  51  PHE A CB  1 
ATOM   389  C  CG  . PHE A  1 51  ? 42.60450  11.62652  16.44759  1.000 43.23573  ?  51  PHE A CG  1 
ATOM   390  C  CD1 . PHE A  1 51  ? 43.35670  12.52432  15.70826  1.000 39.70371  ?  51  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A  1 51  ? 41.97548  12.08226  17.59751  1.000 39.21988  ?  51  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A  1 51  ? 43.45180  13.86273  16.09268  1.000 40.44435  ?  51  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A  1 51  ? 42.07085  13.40302  17.98069  1.000 39.89304  ?  51  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A  1 51  ? 42.82546  14.29178  17.23322  1.000 40.52994  ?  51  PHE A CZ  1 
ATOM   395  N  N   . ALA A  1 52  ? 41.72374  7.50423   14.59787  1.000 37.42711  ?  52  ALA A N   1 
ATOM   396  C  CA  . ALA A  1 52  ? 42.06700  6.31190   13.81958  1.000 42.87092  ?  52  ALA A CA  1 
ATOM   397  C  C   . ALA A  1 52  ? 41.19429  6.19018   12.57773  1.000 37.17408  ?  52  ALA A C   1 
ATOM   398  O  O   . ALA A  1 52  ? 41.69077  5.91950   11.48083  1.000 42.18059  ?  52  ALA A O   1 
ATOM   399  C  CB  . ALA A  1 52  ? 41.93149  5.04925   14.68298  1.000 39.60308  ?  52  ALA A CB  1 
ATOM   400  N  N   . LYS A  1 53  ? 39.88409  6.37643   12.73609  1.000 37.43337  ?  53  LYS A N   1 
ATOM   401  C  CA  . LYS A  1 53  ? 38.96581  6.27888   11.60012  1.000 37.74879  ?  53  LYS A CA  1 
ATOM   402  C  C   . LYS A  1 53  ? 39.23085  7.36790   10.56393  1.000 46.65966  ?  53  LYS A C   1 
ATOM   403  O  O   . LYS A  1 53  ? 39.21951  7.10590   9.34979   1.000 38.41019  ?  53  LYS A O   1 
ATOM   404  C  CB  . LYS A  1 53  ? 37.52855  6.35954   12.10559  1.000 42.44902  ?  53  LYS A CB  1 
ATOM   405  C  CG  . LYS A  1 53  ? 36.49781  6.40512   11.02318  1.000 61.46829  ?  53  LYS A CG  1 
ATOM   406  N  N   . TYR A  1 54  ? 39.47208  8.59899   11.02370  1.000 38.74477  ?  54  TYR A N   1 
ATOM   407  C  CA  . TYR A  1 54  ? 39.74404  9.69349   10.10677  1.000 39.41025  ?  54  TYR A CA  1 
ATOM   408  C  C   . TYR A  1 54  ? 40.96792  9.39209   9.24673   1.000 39.16676  ?  54  TYR A C   1 
ATOM   409  O  O   . TYR A  1 54  ? 40.92503  9.52213   8.01454   1.000 45.58013  ?  54  TYR A O   1 
ATOM   410  C  CB  . TYR A  1 54  ? 39.93088  10.98927  10.89917  1.000 39.92306  ?  54  TYR A CB  1 
ATOM   411  C  CG  . TYR A  1 54  ? 40.37058  12.15408  10.03989  1.000 40.70572  ?  54  TYR A CG  1 
ATOM   412  C  CD1 . TYR A  1 54  ? 39.44014  12.92761  9.35821   1.000 50.60047  ?  54  TYR A CD1 1 
ATOM   413  C  CD2 . TYR A  1 54  ? 41.71416  12.47804  9.91332   1.000 40.71773  ?  54  TYR A CD2 1 
ATOM   414  C  CE1 . TYR A  1 54  ? 39.83940  13.99328  8.57798   1.000 57.78284  ?  54  TYR A CE1 1 
ATOM   415  C  CE2 . TYR A  1 54  ? 42.12808  13.54549  9.12682   1.000 41.52589  ?  54  TYR A CE2 1 
ATOM   416  C  CZ  . TYR A  1 54  ? 41.19144  14.29220  8.46194   1.000 55.24046  ?  54  TYR A CZ  1 
ATOM   417  O  OH  . TYR A  1 54  ? 41.59853  15.34765  7.68070   1.000 60.67821  ?  54  TYR A OH  1 
ATOM   418  N  N   . PHE A  1 55  ? 42.06533  8.95388   9.87921   1.000 38.65843  ?  55  PHE A N   1 
ATOM   419  C  CA  . PHE A  1 55  ? 43.28273  8.67006   9.11820   1.000 38.48500  ?  55  PHE A CA  1 
ATOM   420  C  C   . PHE A  1 55  ? 43.13983  7.41088   8.25501   1.000 46.40388  ?  55  PHE A C   1 
ATOM   421  O  O   . PHE A  1 55  ? 43.63901  7.38439   7.12255   1.000 38.06880  ?  55  PHE A O   1 
ATOM   422  C  CB  . PHE A  1 55  ? 44.48737  8.60225   10.07322  1.000 38.25256  ?  55  PHE A CB  1 
ATOM   423  C  CG  . PHE A  1 55  ? 44.95099  9.97820   10.55827  1.000 38.91441  ?  55  PHE A CG  1 
ATOM   424  C  CD1 . PHE A  1 55  ? 45.20237  11.00780  9.64245   1.000 47.42797  ?  55  PHE A CD1 1 
ATOM   425  C  CD2 . PHE A  1 55  ? 45.08793  10.24655  11.90490  1.000 38.91244  ?  55  PHE A CD2 1 
ATOM   426  C  CE1 . PHE A  1 55  ? 45.59705  12.27038  10.05457  1.000 40.33911  ?  55  PHE A CE1 1 
ATOM   427  C  CE2 . PHE A  1 55  ? 45.48449  11.49058  12.33355  1.000 50.01618  ?  55  PHE A CE2 1 
ATOM   428  C  CZ  . PHE A  1 55  ? 45.73860  12.52520  11.40183  1.000 40.32538  ?  55  PHE A CZ  1 
ATOM   429  N  N   . LEU A  1 56  ? 42.40896  6.38974   8.72393   1.000 44.49473  ?  56  LEU A N   1 
ATOM   430  C  CA  . LEU A  1 56  ? 42.16760  5.20860   7.88338   1.000 40.69229  ?  56  LEU A CA  1 
ATOM   431  C  C   . LEU A  1 56  ? 41.43677  5.58882   6.60454   1.000 38.75014  ?  56  LEU A C   1 
ATOM   432  O  O   . LEU A  1 56  ? 41.78973  5.12182   5.51011   1.000 37.55367  ?  56  LEU A O   1 
ATOM   433  C  CB  . LEU A  1 56  ? 41.37297  4.15291   8.65840   1.000 36.82833  ?  56  LEU A CB  1 
ATOM   434  C  CG  . LEU A  1 56  ? 41.31978  2.75798   8.02868   1.000 42.42359  ?  56  LEU A CG  1 
ATOM   435  C  CD1 . LEU A  1 56  ? 42.70103  2.19787   7.90841   1.000 36.01275  ?  56  LEU A CD1 1 
ATOM   436  C  CD2 . LEU A  1 56  ? 40.40733  1.77258   8.78225   1.000 36.25406  ?  56  LEU A CD2 1 
ATOM   437  N  N   . HIS A  1 57  ? 40.42868  6.46342   6.72423   1.000 38.27766  ?  57  HIS A N   1 
ATOM   438  C  CA  . HIS A  1 57  ? 39.70482  6.93214   5.55204   1.000 38.92238  ?  57  HIS A CA  1 
ATOM   439  C  C   . HIS A  1 57  ? 40.58487  7.79773   4.64503   1.000 41.98132  ?  57  HIS A C   1 
ATOM   440  O  O   . HIS A  1 57  ? 40.51015  7.68304   3.41615   1.000 44.85803  ?  57  HIS A O   1 
ATOM   441  C  CB  . HIS A  1 57  ? 38.45302  7.69102   5.99908   1.000 39.68321  ?  57  HIS A CB  1 
ATOM   442  C  CG  . HIS A  1 57  ? 37.64968  8.24735   4.86556   1.000 55.97621  ?  57  HIS A CG  1 
ATOM   443  N  ND1 . HIS A  1 57  ? 36.80163  7.47532   4.09619   1.000 55.53324  ?  57  HIS A ND1 1 
ATOM   444  C  CD2 . HIS A  1 57  ? 37.58336  9.50256   4.35532   1.000 56.46764  ?  57  HIS A CD2 1 
ATOM   445  C  CE1 . HIS A  1 57  ? 36.23484  8.23511   3.17415   1.000 48.84590  ?  57  HIS A CE1 1 
ATOM   446  N  NE2 . HIS A  1 57  ? 36.68821  9.46863   3.31215   1.000 58.16891  ?  57  HIS A NE2 1 
ATOM   447  N  N   . GLN A  1 58  ? 41.41833  8.67587   5.21507   1.000 42.58323  ?  58  GLN A N   1 
ATOM   448  C  CA  . GLN A  1 58  ? 42.39470  9.38249   4.37438   1.000 47.97705  ?  58  GLN A CA  1 
ATOM   449  C  C   . GLN A  1 58  ? 43.31829  8.40021   3.64162   1.000 39.21592  ?  58  GLN A C   1 
ATOM   450  O  O   . GLN A  1 58  ? 43.67215  8.62070   2.47628   1.000 39.90155  ?  58  GLN A O   1 
ATOM   451  C  CB  . GLN A  1 58  ? 43.21160  10.38146  5.20176   1.000 40.12148  ?  58  GLN A CB  1 
ATOM   452  C  CG  . GLN A  1 58  ? 42.39330  11.53239  5.75050   1.000 47.55872  ?  58  GLN A CG  1 
ATOM   453  C  CD  . GLN A  1 58  ? 41.82440  12.41870  4.65062   1.000 60.90636  ?  58  GLN A CD  1 
ATOM   454  O  OE1 . GLN A  1 58  ? 40.59604  12.55662  4.50902   1.000 55.31875  ?  58  GLN A OE1 1 
ATOM   455  N  NE2 . GLN A  1 58  ? 42.72028  13.04696  3.87462   1.000 69.35052  ?  58  GLN A NE2 1 
ATOM   456  N  N   . SER A  1 59  ? 43.67845  7.28914   4.28530   1.000 38.43291  ?  59  SER A N   1 
ATOM   457  C  CA  . SER A  1 59  ? 44.54527  6.30804   3.62242   1.000 37.89720  ?  59  SER A CA  1 
ATOM   458  C  C   . SER A  1 59  ? 43.83662  5.67706   2.43032   1.000 37.86935  ?  59  SER A C   1 
ATOM   459  O  O   . SER A  1 59  ? 44.40832  5.56001   1.33459   1.000 37.87557  ?  59  SER A O   1 
ATOM   460  C  CB  . SER A  1 59  ? 45.00428  5.22987   4.62357   1.000 37.19534  ?  59  SER A CB  1 
ATOM   461  O  OG  . SER A  1 59  ? 45.56150  4.10809   3.95556   1.000 36.70893  ?  59  SER A OG  1 
ATOM   462  N  N   . HIS A  1 60  ? 42.57479  5.27009   2.62668   1.000 38.08154  ?  60  HIS A N   1 
ATOM   463  C  CA  . HIS A  1 60  ? 41.79372  4.72216   1.52269   1.000 38.03485  ?  60  HIS A CA  1 
ATOM   464  C  C   . HIS A  1 60  ? 41.64874  5.73034   0.38208   1.000 40.62146  ?  60  HIS A C   1 
ATOM   465  O  O   . HIS A  1 60  ? 41.72519  5.36206   -0.80096  1.000 43.59533  ?  60  HIS A O   1 
ATOM   466  C  CB  . HIS A  1 60  ? 40.41987  4.26956   2.03233   1.000 41.99811  ?  60  HIS A CB  1 
ATOM   467  C  CG  . HIS A  1 60  ? 40.48402  3.11136   2.98053   1.000 51.47059  ?  60  HIS A CG  1 
ATOM   468  N  ND1 . HIS A  1 60  ? 41.53655  2.21621   2.99439   1.000 55.47452  ?  60  HIS A ND1 1 
ATOM   469  C  CD2 . HIS A  1 60  ? 39.62029  2.68888   3.93711   1.000 55.13005  ?  60  HIS A CD2 1 
ATOM   470  C  CE1 . HIS A  1 60  ? 41.32384  1.29897   3.92337   1.000 46.90558  ?  60  HIS A CE1 1 
ATOM   471  N  NE2 . HIS A  1 60  ? 40.16493  1.55835   4.50491   1.000 56.73125  ?  60  HIS A NE2 1 
ATOM   472  N  N   . GLU A  1 61  ? 41.45162  7.01146   0.71395   1.000 43.42078  ?  61  GLU A N   1 
ATOM   473  C  CA  . GLU A  1 61  ? 41.29706  8.02281   -0.33158  1.000 45.21242  ?  61  GLU A CA  1 
ATOM   474  C  C   . GLU A  1 61  ? 42.59195  8.22108   -1.12160  1.000 43.53354  ?  61  GLU A C   1 
ATOM   475  O  O   . GLU A  1 61  ? 42.55528  8.32331   -2.35479  1.000 46.41936  ?  61  GLU A O   1 
ATOM   476  C  CB  . GLU A  1 61  ? 40.82658  9.35722   0.26176   1.000 49.84065  ?  61  GLU A CB  1 
ATOM   477  C  CG  . GLU A  1 61  ? 39.43143  9.35245   0.93260   1.000 56.93189  ?  61  GLU A CG  1 
ATOM   478  C  CD  . GLU A  1 61  ? 38.29946  8.87265   0.01877   1.000 70.91889  ?  61  GLU A CD  1 
ATOM   479  O  OE1 . GLU A  1 61  ? 37.84607  9.67540   -0.83256  1.000 73.53637  ?  61  GLU A OE1 1 
ATOM   480  O  OE2 . GLU A  1 61  ? 37.84889  7.70091   0.17008   1.000 73.93296  -1 61  GLU A OE2 1 
ATOM   481  N  N   . GLU A  1 62  ? 43.74750  8.28563   -0.44484  1.000 39.86940  ?  62  GLU A N   1 
ATOM   482  C  CA  . GLU A  1 62  ? 44.99614  8.38716   -1.20045  1.000 41.21833  ?  62  GLU A CA  1 
ATOM   483  C  C   . GLU A  1 62  ? 45.25615  7.12907   -2.03062  1.000 44.04794  ?  62  GLU A C   1 
ATOM   484  O  O   . GLU A  1 62  ? 45.83911  7.21900   -3.11986  1.000 46.64267  ?  62  GLU A O   1 
ATOM   485  C  CB  . GLU A  1 62  ? 46.19159  8.66878   -0.27975  1.000 39.92091  ?  62  GLU A CB  1 
ATOM   486  C  CG  . GLU A  1 62  ? 46.14466  10.03772  0.42442   1.000 49.92286  ?  62  GLU A CG  1 
ATOM   487  C  CD  . GLU A  1 62  ? 46.05087  11.23420  -0.52869  1.000 61.79803  ?  62  GLU A CD  1 
ATOM   488  O  OE1 . GLU A  1 62  ? 47.08696  11.85329  -0.84769  1.000 77.68299  ?  62  GLU A OE1 1 
ATOM   489  O  OE2 . GLU A  1 62  ? 44.92553  11.58144  -0.94655  1.000 77.54977  -1 62  GLU A OE2 1 
ATOM   490  N  N   . ARG A  1 63  ? 44.84376  5.95328   -1.54226  1.000 38.47762  ?  63  ARG A N   1 
ATOM   491  C  CA  . ARG A  1 63  ? 44.95375  4.75139   -2.36118  1.000 37.94546  ?  63  ARG A CA  1 
ATOM   492  C  C   . ARG A  1 63  ? 44.14218  4.89594   -3.64829  1.000 45.77445  ?  63  ARG A C   1 
ATOM   493  O  O   . ARG A  1 63  ? 44.64787  4.61980   -4.74996  1.000 38.37912  ?  63  ARG A O   1 
ATOM   494  C  CB  . ARG A  1 63  ? 44.51664  3.53889   -1.54425  1.000 45.45590  ?  63  ARG A CB  1 
ATOM   495  C  CG  . ARG A  1 63  ? 44.74941  2.16236   -2.20021  1.000 51.32085  ?  63  ARG A CG  1 
ATOM   496  N  N   . GLU A  1 64  ? 42.87874  5.33537   -3.52243  1.000 39.03205  ?  64  GLU A N   1 
ATOM   497  C  CA  . GLU A  1 64  ? 42.05303  5.64280   -4.69207  1.000 39.75379  ?  64  GLU A CA  1 
ATOM   498  C  C   . GLU A  1 64  ? 42.76384  6.61457   -5.63708  1.000 42.42298  ?  64  GLU A C   1 
ATOM   499  O  O   . GLU A  1 64  ? 42.67407  6.49030   -6.86572  1.000 42.43758  ?  64  GLU A O   1 
ATOM   500  C  CB  . GLU A  1 64  ? 40.72404  6.25265   -4.23868  1.000 47.80448  ?  64  GLU A CB  1 
ATOM   501  C  CG  . GLU A  1 64  ? 39.56828  5.29701   -4.02392  1.000 58.75095  ?  64  GLU A CG  1 
ATOM   502  C  CD  . GLU A  1 64  ? 38.34613  6.00167   -3.38879  1.000 68.53436  ?  64  GLU A CD  1 
ATOM   503  O  OE1 . GLU A  1 64  ? 38.06111  5.74776   -2.19321  1.000 68.57448  ?  64  GLU A OE1 1 
ATOM   504  O  OE2 . GLU A  1 64  ? 37.67687  6.81597   -4.07589  1.000 66.05557  ?  64  GLU A OE2 1 
ATOM   505  N  N   . HIS A  1 65  ? 43.43528  7.61756   -5.07619  1.000 47.64424  ?  65  HIS A N   1 
ATOM   506  C  CA  . HIS A  1 65  ? 44.10402  8.62983   -5.89571  1.000 52.11341  ?  65  HIS A CA  1 
ATOM   507  C  C   . HIS A  1 65  ? 45.29056  8.03961   -6.66467  1.000 44.42540  ?  65  HIS A C   1 
ATOM   508  O  O   . HIS A  1 65  ? 45.50049  8.34492   -7.85459  1.000 43.90212  ?  65  HIS A O   1 
ATOM   509  C  CB  . HIS A  1 65  ? 44.53783  9.78327   -4.99728  1.000 54.23011  ?  65  HIS A CB  1 
ATOM   510  C  CG  . HIS A  1 65  ? 43.57046  10.92012  -4.98202  1.000 61.56350  ?  65  HIS A CG  1 
ATOM   511  N  ND1 . HIS A  1 65  ? 43.74742  12.03865  -4.19716  1.000 71.69171  ?  65  HIS A ND1 1 
ATOM   512  C  CD2 . HIS A  1 65  ? 42.42927  11.12451  -5.67953  1.000 64.20410  ?  65  HIS A CD2 1 
ATOM   513  C  CE1 . HIS A  1 65  ? 42.76259  12.89034  -4.42042  1.000 71.44891  ?  65  HIS A CE1 1 
ATOM   514  N  NE2 . HIS A  1 65  ? 41.94611  12.35614  -5.31116  1.000 75.51117  ?  65  HIS A NE2 1 
ATOM   515  N  N   . ALA A  1 66  ? 46.06352  7.18194   -6.00133  1.000 39.83372  ?  66  ALA A N   1 
ATOM   516  C  CA  . ALA A  1 66  ? 47.08330  6.38790   -6.68848  1.000 40.43973  ?  66  ALA A CA  1 
ATOM   517  C  C   . ALA A  1 66  ? 46.49259  5.58561   -7.84580  1.000 42.77425  ?  66  ALA A C   1 
ATOM   518  O  O   . ALA A  1 66  ? 47.04149  5.57379   -8.95876  1.000 39.19205  ?  66  ALA A O   1 
ATOM   519  C  CB  . ALA A  1 66  ? 47.75676  5.44732   -5.69389  1.000 38.37504  ?  66  ALA A CB  1 
ATOM   520  N  N   . GLU A  1 67  ? 45.37213  4.90360   -7.59751  1.000 42.31913  ?  67  GLU A N   1 
ATOM   521  C  CA  . GLU A  1 67  ? 44.79546  4.04266   -8.62787  1.000 44.08855  ?  67  GLU A CA  1 
ATOM   522  C  C   . GLU A  1 67  ? 44.27916  4.86073   -9.80527  1.000 43.28968  ?  67  GLU A C   1 
ATOM   523  O  O   . GLU A  1 67  ? 44.38369  4.44002   -10.96201 1.000 45.18663  ?  67  GLU A O   1 
ATOM   524  C  CB  . GLU A  1 67  ? 43.68154  3.18286   -8.02494  1.000 38.57193  ?  67  GLU A CB  1 
ATOM   525  C  CG  . GLU A  1 67  ? 44.20775  2.17558   -7.01189  1.000 40.39480  ?  67  GLU A CG  1 
ATOM   526  C  CD  . GLU A  1 67  ? 43.11280  1.33751   -6.40493  1.000 41.59986  ?  67  GLU A CD  1 
ATOM   527  O  OE1 . GLU A  1 67  ? 41.95285  1.46784   -6.84020  1.000 55.80127  ?  67  GLU A OE1 1 
ATOM   528  O  OE2 . GLU A  1 67  ? 43.40775  0.54480   -5.49400  1.000 47.89301  -1 67  GLU A OE2 1 
ATOM   529  N  N   . LYS A  1 68  ? 43.72383  6.03938   -9.53138  1.000 43.41846  ?  68  LYS A N   1 
ATOM   530  C  CA  . LYS A  1 68  ? 43.30499  6.92141   -10.61597 1.000 41.67611  ?  68  LYS A CA  1 
ATOM   531  C  C   . LYS A  1 68  ? 44.50444  7.39355   -11.44306 1.000 42.25339  ?  68  LYS A C   1 
ATOM   532  O  O   . LYS A  1 68  ? 44.41145  7.51373   -12.67276 1.000 42.60213  ?  68  LYS A O   1 
ATOM   533  C  CB  . LYS A  1 68  ? 42.50933  8.09774   -10.04152 1.000 42.66062  ?  68  LYS A CB  1 
ATOM   534  C  CG  . LYS A  1 68  ? 41.93145  9.05266   -11.07347 1.000 49.55734  ?  68  LYS A CG  1 
ATOM   535  C  CD  . LYS A  1 68  ? 40.92651  10.03468  -10.44008 1.000 54.57708  ?  68  LYS A CD  1 
ATOM   536  N  N   . LEU A  1 69  ? 45.64522  7.64750   -10.79716 1.000 41.41639  ?  69  LEU A N   1 
ATOM   537  C  CA  . LEU A  1 69  ? 46.83326  8.04139   -11.56445 1.000 47.61850  ?  69  LEU A CA  1 
ATOM   538  C  C   . LEU A  1 69  ? 47.37072  6.88170   -12.41218 1.000 53.32500  ?  69  LEU A C   1 
ATOM   539  O  O   . LEU A  1 69  ? 47.87418  7.08948   -13.53113 1.000 41.07965  ?  69  LEU A O   1 
ATOM   540  C  CB  . LEU A  1 69  ? 47.90615  8.56869   -10.61800 1.000 41.46940  ?  69  LEU A CB  1 
ATOM   541  C  CG  . LEU A  1 69  ? 47.65571  9.96682   -10.05231 1.000 45.39576  ?  69  LEU A CG  1 
ATOM   542  C  CD1 . LEU A  1 69  ? 48.61445  10.22323  -8.92494  1.000 52.30796  ?  69  LEU A CD1 1 
ATOM   543  C  CD2 . LEU A  1 69  ? 47.78371  11.03227  -11.12196 1.000 43.61381  ?  69  LEU A CD2 1 
ATOM   544  N  N   . MET A  1 70  ? 47.27310  5.64993   -11.89623 1.000 43.91606  ?  70  MET A N   1 
ATOM   545  C  CA  . MET A  1 70  ? 47.65964  4.48578   -12.69668 1.000 40.73882  ?  70  MET A CA  1 
ATOM   546  C  C   . MET A  1 70  ? 46.72653  4.30821   -13.89333 1.000 47.29758  ?  70  MET A C   1 
ATOM   547  O  O   . MET A  1 70  ? 47.17103  3.98519   -15.00864 1.000 49.46376  ?  70  MET A O   1 
ATOM   548  C  CB  . MET A  1 70  ? 47.66063  3.23582   -11.81999 1.000 43.50144  ?  70  MET A CB  1 
ATOM   549  C  CG  . MET A  1 70  ? 48.56959  3.35354   -10.60017 1.000 37.80979  ?  70  MET A CG  1 
ATOM   550  S  SD  . MET A  1 70  ? 48.50348  1.93197   -9.50357  1.000 74.13469  ?  70  MET A SD  1 
ATOM   551  C  CE  . MET A  1 70  ? 49.39046  0.70254   -10.47453 1.000 41.20362  ?  70  MET A CE  1 
ATOM   552  N  N   . LYS A  1 71  ? 45.42872  4.53426   -13.67354 1.000 40.09521  ?  71  LYS A N   1 
ATOM   553  C  CA  . LYS A  1 71  ? 44.45334  4.51413   -14.75538 1.000 40.76068  ?  71  LYS A CA  1 
ATOM   554  C  C   . LYS A  1 71  ? 44.80970  5.53467   -15.81777 1.000 41.89687  ?  71  LYS A C   1 
ATOM   555  O  O   . LYS A  1 71  ? 44.74564  5.25558   -17.01921 1.000 41.81443  ?  71  LYS A O   1 
ATOM   556  C  CB  . LYS A  1 71  ? 43.05735  4.79817   -14.18825 1.000 41.40570  ?  71  LYS A CB  1 
ATOM   557  C  CG  . LYS A  1 71  ? 41.96593  4.85939   -15.22093 1.000 49.30240  ?  71  LYS A CG  1 
ATOM   558  C  CD  . LYS A  1 71  ? 40.59683  5.08551   -14.58719 1.000 45.41844  ?  71  LYS A CD  1 
ATOM   559  C  CE  . LYS A  1 71  ? 39.49918  5.02765   -15.63491 1.000 51.06781  ?  71  LYS A CE  1 
ATOM   560  N  NZ  . LYS A  1 71  ? 38.31186  4.21146   -15.15904 1.000 68.07844  ?  71  LYS A NZ  1 
ATOM   561  N  N   . LEU A  1 72  ? 45.20532  6.72420   -15.38514 1.000 46.68356  ?  72  LEU A N   1 
ATOM   562  C  CA  . LEU A  1 72  ? 45.55121  7.77519   -16.32469 1.000 43.16683  ?  72  LEU A CA  1 
ATOM   563  C  C   . LEU A  1 72  ? 46.78231  7.39530   -17.13813 1.000 49.61258  ?  72  LEU A C   1 
ATOM   564  O  O   . LEU A  1 72  ? 46.78542  7.50509   -18.37466 1.000 43.12351  ?  72  LEU A O   1 
ATOM   565  C  CB  . LEU A  1 72  ? 45.76936  9.07620   -15.56176 1.000 43.89743  ?  72  LEU A CB  1 
ATOM   566  C  CG  . LEU A  1 72  ? 46.42480  10.14683  -16.39470 1.000 44.85130  ?  72  LEU A CG  1 
ATOM   567  C  CD1 . LEU A  1 72  ? 45.41086  10.67856  -17.35361 1.000 46.04740  ?  72  LEU A CD1 1 
ATOM   568  C  CD2 . LEU A  1 72  ? 46.91805  11.21163  -15.46794 1.000 52.10553  ?  72  LEU A CD2 1 
ATOM   569  N  N   . GLN A  1 73  ? 47.84634  6.95530   -16.45668 1.000 42.05310  ?  73  GLN A N   1 
ATOM   570  C  CA  . GLN A  1 73  ? 49.03132  6.47215   -17.16672 1.000 45.94710  ?  73  GLN A CA  1 
ATOM   571  C  C   . GLN A  1 73  ? 48.62480  5.50707   -18.27940 1.000 45.62569  ?  73  GLN A C   1 
ATOM   572  O  O   . GLN A  1 73  ? 48.96894  5.70555   -19.45126 1.000 46.79851  ?  73  GLN A O   1 
ATOM   573  C  CB  . GLN A  1 73  ? 49.99161  5.80336   -16.17655 1.000 47.57519  ?  73  GLN A CB  1 
ATOM   574  C  CG  . GLN A  1 73  ? 51.29841  5.29233   -16.78166 1.000 53.35668  ?  73  GLN A CG  1 
ATOM   575  C  CD  . GLN A  1 73  ? 52.33839  6.39965   -16.92050 1.000 52.91193  ?  73  GLN A CD  1 
ATOM   576  O  OE1 . GLN A  1 73  ? 52.30070  7.17707   -17.87170 1.000 41.26071  ?  73  GLN A OE1 1 
ATOM   577  N  NE2 . GLN A  1 73  ? 53.27135  6.46669   -15.97598 1.000 47.16681  ?  73  GLN A NE2 1 
ATOM   578  N  N   . ASN A  1 74  ? 47.81618  4.50220   -17.93660 1.000 40.33605  ?  74  ASN A N   1 
ATOM   579  C  CA  . ASN A  1 74  ? 47.39369  3.52352   -18.93435 1.000 44.75977  ?  74  ASN A CA  1 
ATOM   580  C  C   . ASN A  1 74  ? 46.55056  4.15270   -20.05214 1.000 49.85051  ?  74  ASN A C   1 
ATOM   581  O  O   . ASN A  1 74  ? 46.70826  3.80170   -21.22925 1.000 51.50068  ?  74  ASN A O   1 
ATOM   582  C  CB  . ASN A  1 74  ? 46.62370  2.39486   -18.24842 1.000 39.42941  ?  74  ASN A CB  1 
ATOM   583  C  CG  . ASN A  1 74  ? 47.52888  1.30468   -17.74316 1.000 42.43321  ?  74  ASN A CG  1 
ATOM   584  O  OD1 . ASN A  1 74  ? 48.67778  1.18355   -18.18312 1.000 44.76903  ?  74  ASN A OD1 1 
ATOM   585  N  ND2 . ASN A  1 74  ? 47.02988  0.50516   -16.80118 1.000 37.95058  ?  74  ASN A ND2 1 
ATOM   586  N  N   . GLN A  1 75  ? 45.62386  5.05719   -19.71844 1.000 47.58422  ?  75  GLN A N   1 
ATOM   587  C  CA  . GLN A  1 75  ? 44.81402  5.60745   -20.80067 1.000 43.27627  ?  75  GLN A CA  1 
ATOM   588  C  C   . GLN A  1 75  ? 45.57029  6.59651   -21.66612 1.000 43.99772  ?  75  GLN A C   1 
ATOM   589  O  O   . GLN A  1 75  ? 45.15134  6.83216   -22.80610 1.000 45.57722  ?  75  GLN A O   1 
ATOM   590  C  CB  . GLN A  1 75  ? 43.51011  6.23403   -20.28135 1.000 53.92207  ?  75  GLN A CB  1 
ATOM   591  C  CG  . GLN A  1 75  ? 43.64040  7.23830   -19.19347 1.000 61.38176  ?  75  GLN A CG  1 
ATOM   592  C  CD  . GLN A  1 75  ? 42.32723  7.44678   -18.46246 1.000 60.68696  ?  75  GLN A CD  1 
ATOM   593  O  OE1 . GLN A  1 75  ? 42.29567  7.99256   -17.35328 1.000 53.34472  ?  75  GLN A OE1 1 
ATOM   594  N  NE2 . GLN A  1 75  ? 41.22633  7.01884   -19.08577 1.000 67.77987  ?  75  GLN A NE2 1 
ATOM   595  N  N   . ARG A  1 76  ? 46.69689  7.13391   -21.20705 1.000 44.97233  ?  76  ARG A N   1 
ATOM   596  C  CA  . ARG A  1 76  ? 47.52706  7.93324   -22.09447 1.000 50.59210  ?  76  ARG A CA  1 
ATOM   597  C  C   . ARG A  1 76  ? 48.57802  7.09910   -22.82284 1.000 53.89248  ?  76  ARG A C   1 
ATOM   598  O  O   . ARG A  1 76  ? 49.44380  7.66724   -23.49961 1.000 48.20741  ?  76  ARG A O   1 
ATOM   599  C  CB  . ARG A  1 76  ? 48.20066  9.07958   -21.32614 1.000 51.95402  ?  76  ARG A CB  1 
ATOM   600  C  CG  . ARG A  1 76  ? 47.25274  10.20317  -20.88871 1.000 49.86939  ?  76  ARG A CG  1 
ATOM   601  C  CD  . ARG A  1 76  ? 46.51505  10.89052  -22.04407 1.000 46.52831  ?  76  ARG A CD  1 
ATOM   602  N  NE  . ARG A  1 76  ? 47.41845  11.47211  -23.04018 1.000 49.35775  ?  76  ARG A NE  1 
ATOM   603  C  CZ  . ARG A  1 76  ? 48.03724  12.64895  -22.90959 1.000 52.27704  ?  76  ARG A CZ  1 
ATOM   604  N  NH1 . ARG A  1 76  ? 47.86908  13.37430  -21.80971 1.000 48.15625  ?  76  ARG A NH1 1 
ATOM   605  N  NH2 . ARG A  1 76  ? 48.84043  13.09386  -23.87615 1.000 50.02356  ?  76  ARG A NH2 1 
ATOM   606  N  N   . GLY A  1 77  ? 48.51307  5.77462   -22.71275 1.000 46.70114  ?  77  GLY A N   1 
ATOM   607  C  CA  . GLY A  1 77  ? 49.47392  4.92416   -23.37468 1.000 47.58781  ?  77  GLY A CA  1 
ATOM   608  C  C   . GLY A  1 77  ? 50.85480  4.95351   -22.77317 1.000 54.40544  ?  77  GLY A C   1 
ATOM   609  O  O   . GLY A  1 77  ? 51.80601  4.48730   -23.41247 1.000 55.56554  ?  77  GLY A O   1 
ATOM   610  N  N   . GLY A  1 78  ? 51.00189  5.52854   -21.58509 1.000 49.59786  ?  78  GLY A N   1 
ATOM   611  C  CA  . GLY A  1 78  ? 52.20005  5.32810   -20.80832 1.000 52.48833  ?  78  GLY A CA  1 
ATOM   612  C  C   . GLY A  1 78  ? 52.26511  3.91968   -20.23413 1.000 56.93712  ?  78  GLY A C   1 
ATOM   613  O  O   . GLY A  1 78  ? 51.31072  3.13386   -20.27898 1.000 52.38808  ?  78  GLY A O   1 
ATOM   614  N  N   . ARG A  1 79  ? 53.43290  3.60345   -19.68316 1.000 48.39345  ?  79  ARG A N   1 
ATOM   615  C  CA  . ARG A  1 79  ? 53.68038  2.33073   -19.01970 1.000 50.83554  ?  79  ARG A CA  1 
ATOM   616  C  C   . ARG A  1 79  ? 53.95288  2.58581   -17.54314 1.000 47.83608  ?  79  ARG A C   1 
ATOM   617  O  O   . ARG A  1 79  ? 54.81089  3.40555   -17.19409 1.000 48.49707  ?  79  ARG A O   1 
ATOM   618  C  CB  . ARG A  1 79  ? 54.85407  1.58733   -19.67824 1.000 49.52924  ?  79  ARG A CB  1 
ATOM   619  C  CG  . ARG A  1 79  ? 54.49657  1.02907   -21.05785 1.000 49.86331  ?  79  ARG A CG  1 
ATOM   620  C  CD  . ARG A  1 79  ? 53.32040  0.04024   -20.93540 1.000 59.15440  ?  79  ARG A CD  1 
ATOM   621  N  NE  . ARG A  1 79  ? 52.51711  -0.05666  -22.15673 1.000 58.97409  ?  79  ARG A NE  1 
ATOM   622  C  CZ  . ARG A  1 79  ? 51.22118  0.24461   -22.24594 1.000 62.09499  ?  79  ARG A CZ  1 
ATOM   623  N  NH1 . ARG A  1 79  ? 50.54182  0.66714   -21.18032 1.000 50.32222  ?  79  ARG A NH1 1 
ATOM   624  N  NH2 . ARG A  1 79  ? 50.59663  0.11223   -23.41089 1.000 65.94339  ?  79  ARG A NH2 1 
ATOM   625  N  N   . ILE A  1 80  ? 53.19481  1.90893   -16.67984 1.000 53.45548  ?  80  ILE A N   1 
ATOM   626  C  CA  . ILE A  1 80  ? 53.34861  2.08922   -15.24026 1.000 52.63724  ?  80  ILE A CA  1 
ATOM   627  C  C   . ILE A  1 80  ? 54.63110  1.41944   -14.76950 1.000 61.36492  ?  80  ILE A C   1 
ATOM   628  O  O   . ILE A  1 80  ? 54.90123  0.25382   -15.10841 1.000 50.90016  ?  80  ILE A O   1 
ATOM   629  C  CB  . ILE A  1 80  ? 52.15345  1.49235   -14.49140 1.000 49.37840  ?  80  ILE A CB  1 
ATOM   630  C  CG1 . ILE A  1 80  ? 50.82599  2.12325   -14.91478 1.000 45.62507  ?  80  ILE A CG1 1 
ATOM   631  C  CG2 . ILE A  1 80  ? 52.37076  1.60958   -12.99391 1.000 55.85600  ?  80  ILE A CG2 1 
ATOM   632  C  CD1 . ILE A  1 80  ? 49.61813  1.28768   -14.46199 1.000 43.24089  ?  80  ILE A CD1 1 
ATOM   633  N  N   . PHE A  1 81  ? 55.40629  2.12254   -13.94021 1.000 55.41495  ?  81  PHE A N   1 
ATOM   634  C  CA  . PHE A  1 81  ? 56.54282  1.49221   -13.26963 1.000 59.91928  ?  81  PHE A CA  1 
ATOM   635  C  C   . PHE A  1 81  ? 56.49868  1.81421   -11.78330 1.000 48.41294  ?  81  PHE A C   1 
ATOM   636  O  O   . PHE A  1 81  ? 56.58050  2.98056   -11.38855 1.000 49.15438  ?  81  PHE A O   1 
ATOM   637  C  CB  . PHE A  1 81  ? 57.86956  1.91296   -13.91024 1.000 50.35275  ?  81  PHE A CB  1 
ATOM   638  C  CG  . PHE A  1 81  ? 58.15339  1.18714   -15.19640 1.000 51.03989  ?  81  PHE A CG  1 
ATOM   639  C  CD1 . PHE A  1 81  ? 58.43675  -0.17923  -15.18944 1.000 56.73713  ?  81  PHE A CD1 1 
ATOM   640  C  CD2 . PHE A  1 81  ? 58.07999  1.84355   -16.41739 1.000 51.34768  ?  81  PHE A CD2 1 
ATOM   641  C  CE1 . PHE A  1 81  ? 58.69250  -0.86916  -16.38165 1.000 54.88479  ?  81  PHE A CE1 1 
ATOM   642  C  CE2 . PHE A  1 81  ? 58.33280  1.15978   -17.61592 1.000 58.41176  ?  81  PHE A CE2 1 
ATOM   643  C  CZ  . PHE A  1 81  ? 58.63983  -0.20169  -17.59559 1.000 52.41246  ?  81  PHE A CZ  1 
ATOM   644  N  N   . LEU A  1 82  ? 56.32914  0.78506   -10.96967 1.000 48.13079  ?  82  LEU A N   1 
ATOM   645  C  CA  . LEU A  1 82  ? 56.14347  0.95342   -9.54056  1.000 47.67533  ?  82  LEU A CA  1 
ATOM   646  C  C   . LEU A  1 82  ? 57.47159  0.89386   -8.79525  1.000 50.01469  ?  82  LEU A C   1 
ATOM   647  O  O   . LEU A  1 82  ? 58.44795  0.27992   -9.24201  1.000 50.12560  ?  82  LEU A O   1 
ATOM   648  C  CB  . LEU A  1 82  ? 55.17215  -0.10196  -8.99438  1.000 46.74481  ?  82  LEU A CB  1 
ATOM   649  C  CG  . LEU A  1 82  ? 53.80690  -0.09552  -9.68946  1.000 50.62360  ?  82  LEU A CG  1 
ATOM   650  C  CD1 . LEU A  1 82  ? 53.03866  -1.39763  -9.55904  1.000 45.05467  ?  82  LEU A CD1 1 
ATOM   651  C  CD2 . LEU A  1 82  ? 52.98304  1.07558   -9.15779  1.000 50.27223  ?  82  LEU A CD2 1 
ATOM   652  N  N   . GLN A  1 83  ? 57.49266  1.54482   -7.63651  1.000 48.78473  ?  83  GLN A N   1 
ATOM   653  C  CA  . GLN A  1 83  ? 58.66355  1.56625   -6.77995  1.000 54.46079  ?  83  GLN A CA  1 
ATOM   654  C  C   . GLN A  1 83  ? 58.24282  1.19995   -5.36806  1.000 51.86407  ?  83  GLN A C   1 
ATOM   655  O  O   . GLN A  1 83  ? 57.04832  1.10715   -5.05466  1.000 48.17592  ?  83  GLN A O   1 
ATOM   656  C  CB  . GLN A  1 83  ? 59.36426  2.93548   -6.80447  1.000 50.73114  ?  83  GLN A CB  1 
ATOM   657  C  CG  . GLN A  1 83  ? 59.68510  3.43109   -8.20615  1.000 53.98198  ?  83  GLN A CG  1 
ATOM   658  C  CD  . GLN A  1 83  ? 60.73653  2.58364   -8.94407  1.000 63.93711  ?  83  GLN A CD  1 
ATOM   659  O  OE1 . GLN A  1 83  ? 61.41771  1.71916   -8.35968  1.000 67.62190  ?  83  GLN A OE1 1 
ATOM   660  N  NE2 . GLN A  1 83  ? 60.87718  2.84289   -10.24133 1.000 68.21225  ?  83  GLN A NE2 1 
ATOM   661  N  N   . ASP A  1 84  ? 59.24966  0.95603   -4.53004  1.000 50.64734  ?  84  ASP A N   1 
ATOM   662  C  CA  . ASP A  1 84  ? 59.00596  0.70427   -3.12123  1.000 50.42241  ?  84  ASP A CA  1 
ATOM   663  C  C   . ASP A  1 84  ? 58.15976  1.81900   -2.52502  1.000 59.91788  ?  84  ASP A C   1 
ATOM   664  O  O   . ASP A  1 84  ? 58.34054  3.00251   -2.82998  1.000 49.45168  ?  84  ASP A O   1 
ATOM   665  C  CB  . ASP A  1 84  ? 60.32199  0.60046   -2.34948  1.000 60.11753  ?  84  ASP A CB  1 
ATOM   666  C  CG  . ASP A  1 84  ? 61.13474  -0.61435  -2.73410  1.000 58.35892  ?  84  ASP A CG  1 
ATOM   667  O  OD1 . ASP A  1 84  ? 60.78566  -1.28667  -3.72878  1.000 52.85666  ?  84  ASP A OD1 1 
ATOM   668  O  OD2 . ASP A  1 84  ? 62.11411  -0.91220  -2.01781  1.000 67.47384  -1 84  ASP A OD2 1 
ATOM   669  N  N   . ILE A  1 85  ? 57.21155  1.42872   -1.68354  1.000 48.36808  ?  85  ILE A N   1 
ATOM   670  C  CA  . ILE A  1 85  ? 56.50089  2.37505   -0.84933  1.000 47.54606  ?  85  ILE A CA  1 
ATOM   671  C  C   . ILE A  1 85  ? 57.32777  2.50208   0.41943   1.000 48.56460  ?  85  ILE A C   1 
ATOM   672  O  O   . ILE A  1 85  ? 57.36794  1.58760   1.23812   1.000 48.81897  ?  85  ILE A O   1 
ATOM   673  C  CB  . ILE A  1 85  ? 55.06823  1.92115   -0.57194  1.000 47.89083  ?  85  ILE A CB  1 
ATOM   674  C  CG1 . ILE A  1 85  ? 54.43210  1.43701   -1.87880  1.000 45.95016  ?  85  ILE A CG1 1 
ATOM   675  C  CG2 . ILE A  1 85  ? 54.25745  3.04569   0.08669   1.000 45.21899  ?  85  ILE A CG2 1 
ATOM   676  C  CD1 . ILE A  1 85  ? 53.01884  0.83451   -1.70295  1.000 52.29823  ?  85  ILE A CD1 1 
ATOM   677  N  N   . GLN A  1 86  ? 58.01772  3.62939   0.56115   1.000 49.28463  ?  86  GLN A N   1 
ATOM   678  C  CA  . GLN A  1 86  ? 58.83376  3.84703   1.74471   1.000 50.38756  ?  86  GLN A CA  1 
ATOM   679  C  C   . GLN A  1 86  ? 57.95352  3.80263   2.98027   1.000 49.55242  ?  86  GLN A C   1 
ATOM   680  O  O   . GLN A  1 86  ? 56.81161  4.26471   2.96652   1.000 48.90215  ?  86  GLN A O   1 
ATOM   681  C  CB  . GLN A  1 86  ? 59.57581  5.20166   1.67128   1.000 51.24371  ?  86  GLN A CB  1 
ATOM   682  C  CG  . GLN A  1 86  ? 60.51235  5.38586   0.47128   1.000 52.25261  ?  86  GLN A CG  1 
ATOM   683  C  CD  . GLN A  1 86  ? 61.53169  4.26067   0.34489   1.000 59.21832  ?  86  GLN A CD  1 
ATOM   684  O  OE1 . GLN A  1 86  ? 62.13962  3.83183   1.33584   1.000 57.76865  ?  86  GLN A OE1 1 
ATOM   685  N  NE2 . GLN A  1 86  ? 61.71909  3.76594   -0.88034  1.000 60.09816  ?  86  GLN A NE2 1 
ATOM   686  N  N   . LYS A  1 87  ? 58.48000  3.23082   4.04454   1.000 50.42740  ?  87  LYS A N   1 
ATOM   687  C  CA  . LYS A  1 87  ? 57.77617  3.26512   5.30694   1.000 49.88003  ?  87  LYS A CA  1 
ATOM   688  C  C   . LYS A  1 87  ? 57.75157  4.69406   5.83295   1.000 49.87553  ?  87  LYS A C   1 
ATOM   689  O  O   . LYS A  1 87  ? 58.65665  5.48192   5.55025   1.000 50.86645  ?  87  LYS A O   1 
ATOM   690  C  CB  . LYS A  1 87  ? 58.45237  2.34960   6.32527   1.000 51.06505  ?  87  LYS A CB  1 
ATOM   691  C  CG  . LYS A  1 87  ? 59.81917  2.84697   6.80120   1.000 52.82959  ?  87  LYS A CG  1 
ATOM   692  C  CD  . LYS A  1 87  ? 60.41820  1.91712   7.84818   1.000 58.08336  ?  87  LYS A CD  1 
ATOM   693  C  CE  . LYS A  1 87  ? 61.52389  2.62242   8.59680   1.000 55.68250  ?  87  LYS A CE  1 
ATOM   694  N  NZ  . LYS A  1 87  ? 62.11719  1.75657   9.65075   1.000 57.03220  ?  87  LYS A NZ  1 
ATOM   695  N  N   . PRO A  1 88  ? 56.74820  5.05062   6.62218   1.000 57.32800  ?  88  PRO A N   1 
ATOM   696  C  CA  . PRO A  1 88  ? 56.70675  6.42171   7.15551   1.000 48.96047  ?  88  PRO A CA  1 
ATOM   697  C  C   . PRO A  1 88  ? 57.92230  6.70769   8.03209   1.000 50.74327  ?  88  PRO A C   1 
ATOM   698  O  O   . PRO A  1 88  ? 58.59723  5.80274   8.53025   1.000 51.62701  ?  88  PRO A O   1 
ATOM   699  C  CB  . PRO A  1 88  ? 55.40638  6.45562   7.96466   1.000 47.71162  ?  88  PRO A CB  1 
ATOM   700  C  CG  . PRO A  1 88  ? 54.59511  5.18674   7.47229   1.000 46.72306  ?  88  PRO A CG  1 
ATOM   701  C  CD  . PRO A  1 88  ? 55.64122  4.20026   7.11783   1.000 47.82859  ?  88  PRO A CD  1 
ATOM   702  N  N   . ASP A  1 89  ? 58.19725  8.00579   8.19790   1.000 53.07256  ?  89  ASP A N   1 
ATOM   703  C  CA  . ASP A  1 89  ? 59.32030  8.49944   8.99026   1.000 57.98832  ?  89  ASP A CA  1 
ATOM   704  C  C   . ASP A  1 89  ? 59.12751  8.31119   10.48272  1.000 53.00321  ?  89  ASP A C   1 
ATOM   705  O  O   . ASP A  1 89  ? 60.08037  8.45896   11.23749  1.000 54.52810  ?  89  ASP A O   1 
ATOM   706  C  CB  . ASP A  1 89  ? 59.52867  10.00213  8.73831   1.000 65.70588  ?  89  ASP A CB  1 
ATOM   707  C  CG  . ASP A  1 89  ? 59.76586  10.31659  7.29006   1.000 73.54392  ?  89  ASP A CG  1 
ATOM   708  O  OD1 . ASP A  1 89  ? 60.05492  9.35907   6.53174   1.000 90.03201  -1 89  ASP A OD1 1 
ATOM   709  O  OD2 . ASP A  1 89  ? 59.65526  11.50182  6.91327   1.000 69.23624  ?  89  ASP A OD2 1 
ATOM   710  N  N   . GLU A  1 90  ? 57.92048  8.08463   10.94264  1.000 51.64888  ?  90  GLU A N   1 
ATOM   711  C  CA  . GLU A  1 90  ? 57.69853  7.89000   12.36373  1.000 59.83822  ?  90  GLU A CA  1 
ATOM   712  C  C   . GLU A  1 90  ? 56.92080  6.60392   12.54041  1.000 51.04600  ?  90  GLU A C   1 
ATOM   713  O  O   . GLU A  1 90  ? 56.12239  6.23778   11.67363  1.000 53.68196  ?  90  GLU A O   1 
ATOM   714  C  CB  . GLU A  1 90  ? 56.91997  9.06671   13.00509  1.000 51.28797  ?  90  GLU A CB  1 
ATOM   715  C  CG  . GLU A  1 90  ? 57.62053  10.40661  12.91626  1.000 52.23077  ?  90  GLU A CG  1 
ATOM   716  C  CD  . GLU A  1 90  ? 58.98815  10.44401  13.65209  1.000 59.89122  ?  90  GLU A CD  1 
ATOM   717  O  OE1 . GLU A  1 90  ? 59.25150  9.62905   14.56059  1.000 57.31575  ?  90  GLU A OE1 1 
ATOM   718  O  OE2 . GLU A  1 90  ? 59.81520  11.31032  13.30904  1.000 63.44625  -1 90  GLU A OE2 1 
ATOM   719  N  N   . ASP A  1 91  ? 57.17013  5.91929   13.65456  1.000 51.85850  ?  91  ASP A N   1 
ATOM   720  C  CA  . ASP A  1 91  ? 56.30691  4.84122   14.11972  1.000 57.02762  ?  91  ASP A CA  1 
ATOM   721  C  C   . ASP A  1 91  ? 55.42731  5.27713   15.27920  1.000 50.60963  ?  91  ASP A C   1 
ATOM   722  O  O   . ASP A  1 91  ? 54.33784  4.73388   15.45768  1.000 51.18864  ?  91  ASP A O   1 
ATOM   723  C  CB  . ASP A  1 91  ? 57.12535  3.62095   14.57484  1.000 60.82859  ?  91  ASP A CB  1 
ATOM   724  C  CG  . ASP A  1 91  ? 58.34203  3.35556   13.71133  1.000 60.16639  ?  91  ASP A CG  1 
ATOM   725  O  OD1 . ASP A  1 91  ? 58.21815  3.08449   12.49886  1.000 65.70922  ?  91  ASP A OD1 1 
ATOM   726  O  OD2 . ASP A  1 91  ? 59.44643  3.41546   14.27053  1.000 70.49187  -1 91  ASP A OD2 1 
ATOM   727  N  N   . ASP A  1 92  ? 55.90873  6.20652   16.09039  1.000 52.30879  ?  92  ASP A N   1 
ATOM   728  C  CA  . ASP A  1 92  ? 55.15941  6.80738   17.18375  1.000 60.25827  ?  92  ASP A CA  1 
ATOM   729  C  C   . ASP A  1 92  ? 54.82008  8.23673   16.77435  1.000 50.51672  ?  92  ASP A C   1 
ATOM   730  O  O   . ASP A  1 92  ? 55.71442  9.04255   16.52311  1.000 51.44895  ?  92  ASP A O   1 
ATOM   731  C  CB  . ASP A  1 92  ? 55.99198  6.77238   18.47157  1.000 57.68800  ?  92  ASP A CB  1 
ATOM   732  C  CG  . ASP A  1 92  ? 55.22371  7.26049   19.69954  1.000 62.68925  ?  92  ASP A CG  1 
ATOM   733  O  OD1 . ASP A  1 92  ? 54.33479  8.14659   19.57821  1.000 59.37942  ?  92  ASP A OD1 1 
ATOM   734  O  OD2 . ASP A  1 92  ? 55.53833  6.76129   20.80293  1.000 65.22221  -1 92  ASP A OD2 1 
ATOM   735  N  N   . TRP A  1 93  ? 53.54253  8.54223   16.66967  1.000 49.03284  ?  93  TRP A N   1 
ATOM   736  C  CA  . TRP A  1 93  ? 53.14510  9.84811   16.18700  1.000 48.42026  ?  93  TRP A CA  1 
ATOM   737  C  C   . TRP A  1 93  ? 52.85050  10.82820  17.31617  1.000 48.72161  ?  93  TRP A C   1 
ATOM   738  O  O   . TRP A  1 93  ? 52.47707  11.97546  17.03733  1.000 48.32215  ?  93  TRP A O   1 
ATOM   739  C  CB  . TRP A  1 93  ? 51.94093  9.70362   15.25114  1.000 46.71855  ?  93  TRP A CB  1 
ATOM   740  C  CG  . TRP A  1 93  ? 52.27922  8.96882   14.00065  1.000 46.49920  ?  93  TRP A CG  1 
ATOM   741  C  CD1 . TRP A  1 93  ? 51.99836  7.66946   13.71922  1.000 46.06779  ?  93  TRP A CD1 1 
ATOM   742  C  CD2 . TRP A  1 93  ? 52.98815  9.48231   12.85972  1.000 50.98926  ?  93  TRP A CD2 1 
ATOM   743  N  NE1 . TRP A  1 93  ? 52.46892  7.33993   12.46917  1.000 46.05822  ?  93  TRP A NE1 1 
ATOM   744  C  CE2 . TRP A  1 93  ? 53.07572  8.43829   11.91823  1.000 51.94566  ?  93  TRP A CE2 1 
ATOM   745  C  CE3 . TRP A  1 93  ? 53.54635  10.72392  12.53944  1.000 55.57030  ?  93  TRP A CE3 1 
ATOM   746  C  CZ2 . TRP A  1 93  ? 53.70763  8.59270   10.67907  1.000 46.75386  ?  93  TRP A CZ2 1 
ATOM   747  C  CZ3 . TRP A  1 93  ? 54.17259  10.87495  11.30257  1.000 54.03762  ?  93  TRP A CZ3 1 
ATOM   748  C  CH2 . TRP A  1 93  ? 54.24615  9.80244   10.38968  1.000 47.33994  ?  93  TRP A CH2 1 
ATOM   749  N  N   . GLU A  1 94  ? 52.95684  10.37838  18.57138  1.000 49.43909  ?  94  GLU A N   1 
ATOM   750  C  CA  . GLU A  1 94  ? 53.04304  11.20458  19.77311  1.000 50.25224  ?  94  GLU A CA  1 
ATOM   751  C  C   . GLU A  1 94  ? 51.72565  11.82298  20.23287  1.000 58.26089  ?  94  GLU A C   1 
ATOM   752  O  O   . GLU A  1 94  ? 51.42464  11.81250  21.43523  1.000 56.64179  ?  94  GLU A O   1 
ATOM   753  C  CB  . GLU A  1 94  ? 54.08730  12.31246  19.57507  1.000 59.18106  ?  94  GLU A CB  1 
ATOM   754  N  N   . SER A  1 95  ? 50.93665  12.36990  19.30814  1.000 54.01809  ?  95  SER A N   1 
ATOM   755  C  CA  . SER A  1 95  ? 49.76688  13.11877  19.72637  1.000 47.05481  ?  95  SER A CA  1 
ATOM   756  C  C   . SER A  1 95  ? 48.80839  13.30397  18.55775  1.000 45.58444  ?  95  SER A C   1 
ATOM   757  O  O   . SER A  1 95  ? 49.19069  13.19803  17.38783  1.000 45.38068  ?  95  SER A O   1 
ATOM   758  C  CB  . SER A  1 95  ? 50.19142  14.47388  20.32543  1.000 48.03885  ?  95  SER A CB  1 
ATOM   759  O  OG  . SER A  1 95  ? 50.41274  15.43956  19.31503  1.000 54.97391  ?  95  SER A OG  1 
ATOM   760  N  N   . GLY A  1 96  ? 47.54890  13.59295  18.89760  1.000 44.64973  ?  96  GLY A N   1 
ATOM   761  C  CA  . GLY A  1 96  ? 46.59753  13.99171  17.86929  1.000 43.42810  ?  96  GLY A CA  1 
ATOM   762  C  C   . GLY A  1 96  ? 47.08218  15.19001  17.07428  1.000 46.96502  ?  96  GLY A C   1 
ATOM   763  O  O   . GLY A  1 96  ? 47.11057  15.15923  15.83849  1.000 44.25216  ?  96  GLY A O   1 
ATOM   764  N  N   . LEU A  1 97  ? 47.53027  16.23827  17.78058  1.000 50.42737  ?  97  LEU A N   1 
ATOM   765  C  CA  . LEU A  1 97  ? 48.00250  17.46348  17.13836  1.000 52.23994  ?  97  LEU A CA  1 
ATOM   766  C  C   . LEU A  1 97  ? 49.22491  17.22109  16.26235  1.000 45.98146  ?  97  LEU A C   1 
ATOM   767  O  O   . LEU A  1 97  ? 49.28702  17.72294  15.13349  1.000 46.86154  ?  97  LEU A O   1 
ATOM   768  C  CB  . LEU A  1 97  ? 48.32169  18.52004  18.19459  1.000 46.39453  ?  97  LEU A CB  1 
ATOM   769  C  CG  . LEU A  1 97  ? 48.98309  19.82556  17.74170  1.000 51.94748  ?  97  LEU A CG  1 
ATOM   770  C  CD1 . LEU A  1 97  ? 48.04174  20.66528  16.88558  1.000 46.51100  ?  97  LEU A CD1 1 
ATOM   771  C  CD2 . LEU A  1 97  ? 49.48635  20.63667  18.95738  1.000 48.70799  ?  97  LEU A CD2 1 
ATOM   772  N  N   . ASN A  1 98  ? 50.23682  16.51175  16.78306  1.000 46.93642  ?  98  ASN A N   1 
ATOM   773  C  CA  . ASN A  1 98  ? 51.43940  16.27322  15.98327  1.000 47.74241  ?  98  ASN A CA  1 
ATOM   774  C  C   . ASN A  1 98  ? 51.11884  15.47124  14.73877  1.000 46.69298  ?  98  ASN A C   1 
ATOM   775  O  O   . ASN A  1 98  ? 51.65338  15.74721  13.65942  1.000 46.92644  ?  98  ASN A O   1 
ATOM   776  C  CB  . ASN A  1 98  ? 52.51397  15.55148  16.78010  1.000 48.99323  ?  98  ASN A CB  1 
ATOM   777  C  CG  . ASN A  1 98  ? 53.84163  15.45134  16.00416  1.000 55.14500  ?  98  ASN A CG  1 
ATOM   778  O  OD1 . ASN A  1 98  ? 54.42876  16.46520  15.61210  1.000 57.07361  ?  98  ASN A OD1 1 
ATOM   779  N  ND2 . ASN A  1 98  ? 54.30252  14.23957  15.77778  1.000 50.18721  ?  98  ASN A ND2 1 
ATOM   780  N  N   . ALA A  1 99  ? 50.24827  14.46722  14.86871  1.000 45.61564  ?  99  ALA A N   1 
ATOM   781  C  CA  . ALA A  1 99  ? 49.81484  13.72465  13.69485  1.000 44.59908  ?  99  ALA A CA  1 
ATOM   782  C  C   . ALA A  1 99  ? 49.10109  14.64317  12.68322  1.000 45.38952  ?  99  ALA A C   1 
ATOM   783  O  O   . ALA A  1 99  ? 49.39961  14.60264  11.48314  1.000 47.01972  ?  99  ALA A O   1 
ATOM   784  C  CB  . ALA A  1 99  ? 48.94962  12.54814  14.14486  1.000 43.72222  ?  99  ALA A CB  1 
ATOM   785  N  N   . MET A  1 100 ? 48.17241  15.49929  13.14353  1.000 43.38409  ?  100 MET A N   1 
ATOM   786  C  CA  . MET A  1 100 ? 47.54135  16.46137  12.22216  1.000 42.87372  ?  100 MET A CA  1 
ATOM   787  C  C   . MET A  1 100 ? 48.57803  17.37283  11.54393  1.000 49.65624  ?  100 MET A C   1 
ATOM   788  O  O   . MET A  1 100 ? 48.47767  17.66586  10.34598  1.000 43.66013  ?  100 MET A O   1 
ATOM   789  C  CB  . MET A  1 100 ? 46.51430  17.32054  12.95818  1.000 47.28600  ?  100 MET A CB  1 
ATOM   790  C  CG  . MET A  1 100 ? 45.19112  16.61972  13.34094  1.000 55.90702  ?  100 MET A CG  1 
ATOM   791  S  SD  . MET A  1 100 ? 44.18874  15.72205  12.07288  1.000 48.47404  ?  100 MET A SD  1 
ATOM   792  C  CE  . MET A  1 100 ? 44.27904  16.83014  10.76977  1.000 40.10360  ?  100 MET A CE  1 
ATOM   793  N  N   . GLU A  1 101 ? 49.57494  17.85614  12.28616  1.000 45.20990  ?  101 GLU A N   1 
ATOM   794  C  CA  . GLU A  1 101 ? 50.60624  18.68909  11.65484  1.000 49.11712  ?  101 GLU A CA  1 
ATOM   795  C  C   . GLU A  1 101 ? 51.41471  17.91527  10.62314  1.000 47.77837  ?  101 GLU A C   1 
ATOM   796  O  O   . GLU A  1 101 ? 51.69530  18.42693  9.54018   1.000 46.81432  ?  101 GLU A O   1 
ATOM   797  C  CB  . GLU A  1 101 ? 51.55794  19.31400  12.67794  1.000 47.86446  ?  101 GLU A CB  1 
ATOM   798  C  CG  . GLU A  1 101 ? 50.85347  20.10558  13.74947  1.000 58.83582  ?  101 GLU A CG  1 
ATOM   799  C  CD  . GLU A  1 101 ? 51.76113  20.58053  14.86457  1.000 60.29863  ?  101 GLU A CD  1 
ATOM   800  O  OE1 . GLU A  1 101 ? 52.63833  19.82151  15.34138  1.000 71.54044  ?  101 GLU A OE1 1 
ATOM   801  O  OE2 . GLU A  1 101 ? 51.56828  21.73896  15.26492  1.000 58.91615  -1 101 GLU A OE2 1 
ATOM   802  N  N   . ALA A  1 102 ? 51.85049  16.70030  10.97032  1.000 46.62182  ?  102 ALA A N   1 
ATOM   803  C  CA  . ALA A  1 102 ? 52.59886  15.88484  10.01918  1.000 46.85264  ?  102 ALA A CA  1 
ATOM   804  C  C   . ALA A  1 102 ? 51.78217  15.65485  8.76475   1.000 45.65968  ?  102 ALA A C   1 
ATOM   805  O  O   . ALA A  1 102 ? 52.31070  15.71353  7.65593   1.000 50.33378  ?  102 ALA A O   1 
ATOM   806  C  CB  . ALA A  1 102 ? 53.01205  14.53646  10.65217  1.000 47.02964  ?  102 ALA A CB  1 
ATOM   807  N  N   . ALA A  1 103 ? 50.47341  15.45206  8.91845   1.000 53.47882  ?  103 ALA A N   1 
ATOM   808  C  CA  . ALA A  1 103 ? 49.61007  15.22046  7.76608   1.000 43.27447  ?  103 ALA A CA  1 
ATOM   809  C  C   . ALA A  1 103 ? 49.47275  16.47996  6.91604   1.000 53.01612  ?  103 ALA A C   1 
ATOM   810  O  O   . ALA A  1 103 ? 49.40971  16.40312  5.68060   1.000 53.26174  ?  103 ALA A O   1 
ATOM   811  C  CB  . ALA A  1 103 ? 48.24835  14.72964  8.24037   1.000 42.01808  ?  103 ALA A CB  1 
ATOM   812  N  N   . LEU A  1 104 ? 49.41597  17.64735  7.55869   1.000 43.96844  ?  104 LEU A N   1 
ATOM   813  C  CA  . LEU A  1 104 ? 49.36956  18.89453  6.80274   1.000 44.38037  ?  104 LEU A CA  1 
ATOM   814  C  C   . LEU A  1 104 ? 50.65746  19.08512  6.00989   1.000 46.27570  ?  104 LEU A C   1 
ATOM   815  O  O   . LEU A  1 104 ? 50.63320  19.43354  4.82292   1.000 45.60398  ?  104 LEU A O   1 
ATOM   816  C  CB  . LEU A  1 104 ? 49.13058  20.06753  7.76069   1.000 44.86461  ?  104 LEU A CB  1 
ATOM   817  C  CG  . LEU A  1 104 ? 49.32537  21.49839  7.25566   1.000 54.23480  ?  104 LEU A CG  1 
ATOM   818  C  CD1 . LEU A  1 104 ? 48.31363  21.86459  6.17461   1.000 44.97417  ?  104 LEU A CD1 1 
ATOM   819  C  CD2 . LEU A  1 104 ? 49.27734  22.48539  8.42100   1.000 46.42207  ?  104 LEU A CD2 1 
ATOM   820  N  N   . HIS A  1 105 ? 51.79697  18.85047  6.65705   1.000 46.61087  ?  105 HIS A N   1 
ATOM   821  C  CA  . HIS A  1 105 ? 53.07131  18.95288  5.95271   1.000 52.57400  ?  105 HIS A CA  1 
ATOM   822  C  C   . HIS A  1 105 ? 53.13056  17.98375  4.77410   1.000 51.62046  ?  105 HIS A C   1 
ATOM   823  O  O   . HIS A  1 105 ? 53.56330  18.34991  3.66949   1.000 49.91779  ?  105 HIS A O   1 
ATOM   824  C  CB  . HIS A  1 105 ? 54.22137  18.68988  6.91236   1.000 51.63523  ?  105 HIS A CB  1 
ATOM   825  C  CG  . HIS A  1 105 ? 55.55227  19.03397  6.33672   1.000 65.94720  ?  105 HIS A CG  1 
ATOM   826  N  ND1 . HIS A  1 105 ? 56.70318  18.34227  6.64713   1.000 64.03195  ?  105 HIS A ND1 1 
ATOM   827  C  CD2 . HIS A  1 105 ? 55.91685  20.00370  5.46253   1.000 70.22520  ?  105 HIS A CD2 1 
ATOM   828  C  CE1 . HIS A  1 105 ? 57.72167  18.87476  5.99302   1.000 70.17488  ?  105 HIS A CE1 1 
ATOM   829  N  NE2 . HIS A  1 105 ? 57.27385  19.88850  5.27276   1.000 69.42755  ?  105 HIS A NE2 1 
ATOM   830  N  N   . LEU A  1 106 ? 52.65401  16.75888  4.98246   1.000 46.33717  ?  106 LEU A N   1 
ATOM   831  C  CA  . LEU A  1 106 ? 52.62709  15.76906  3.91378   1.000 51.14459  ?  106 LEU A CA  1 
ATOM   832  C  C   . LEU A  1 106 ? 51.78688  16.24147  2.73221   1.000 49.85887  ?  106 LEU A C   1 
ATOM   833  O  O   . LEU A  1 106 ? 52.21222  16.13591  1.57687   1.000 45.44709  ?  106 LEU A O   1 
ATOM   834  C  CB  . LEU A  1 106 ? 52.09903  14.43718  4.44986   1.000 50.91195  ?  106 LEU A CB  1 
ATOM   835  C  CG  . LEU A  1 106 ? 51.92557  13.33213  3.39954   1.000 52.98806  ?  106 LEU A CG  1 
ATOM   836  C  CD1 . LEU A  1 106 ? 53.25632  12.67660  3.11833   1.000 45.38095  ?  106 LEU A CD1 1 
ATOM   837  C  CD2 . LEU A  1 106 ? 50.93884  12.31305  3.86088   1.000 49.46602  ?  106 LEU A CD2 1 
ATOM   838  N  N   . GLU A  1 107 ? 50.57043  16.73863  2.99339   1.000 55.89236  ?  107 GLU A N   1 
ATOM   839  C  CA  . GLU A  1 107 ? 49.73520  17.13801  1.86549   1.000 47.29466  ?  107 GLU A CA  1 
ATOM   840  C  C   . GLU A  1 107 ? 50.30144  18.37483  1.19261   1.000 44.69585  ?  107 GLU A C   1 
ATOM   841  O  O   . GLU A  1 107 ? 50.19652  18.51866  -0.02565  1.000 44.72864  ?  107 GLU A O   1 
ATOM   842  C  CB  . GLU A  1 107 ? 48.28344  17.35728  2.29822   1.000 49.51767  ?  107 GLU A CB  1 
ATOM   843  C  CG  . GLU A  1 107 ? 47.57901  16.07377  2.80677   1.000 49.49448  ?  107 GLU A CG  1 
ATOM   844  C  CD  . GLU A  1 107 ? 47.06247  15.09948  1.72232   1.000 60.83342  ?  107 GLU A CD  1 
ATOM   845  O  OE1 . GLU A  1 107 ? 45.84502  14.77455  1.72128   1.000 75.91088  ?  107 GLU A OE1 1 
ATOM   846  O  OE2 . GLU A  1 107 ? 47.85285  14.61625  0.88902   1.000 63.33316  -1 107 GLU A OE2 1 
ATOM   847  N  N   . LYS A  1 108 ? 50.95046  19.25192  1.94274   1.000 45.71379  ?  108 LYS A N   1 
ATOM   848  C  CA  . LYS A  1 108 ? 51.59421  20.36673  1.26542   1.000 47.43245  ?  108 LYS A CA  1 
ATOM   849  C  C   . LYS A  1 108 ? 52.71931  19.87869  0.35823   1.000 55.22297  ?  108 LYS A C   1 
ATOM   850  O  O   . LYS A  1 108 ? 52.90112  20.41948  -0.73637  1.000 48.32344  ?  108 LYS A O   1 
ATOM   851  C  CB  . LYS A  1 108 ? 52.07875  21.38808  2.28454   1.000 47.97771  ?  108 LYS A CB  1 
ATOM   852  C  CG  . LYS A  1 108 ? 51.01110  22.44646  2.55718   1.000 52.06152  ?  108 LYS A CG  1 
ATOM   853  C  CD  . LYS A  1 108 ? 51.06817  22.97014  3.97950   1.000 52.87369  ?  108 LYS A CD  1 
ATOM   854  C  CE  . LYS A  1 108 ? 51.99751  24.15202  4.10910   1.000 58.52840  ?  108 LYS A CE  1 
ATOM   855  N  NZ  . LYS A  1 108 ? 52.37727  24.36896  5.54028   1.000 62.75293  ?  108 LYS A NZ  1 
ATOM   856  N  N   . ASN A  1 109 ? 53.42260  18.80339  0.75027   1.000 61.09315  ?  109 ASN A N   1 
ATOM   857  C  CA  . ASN A  1 109 ? 54.46196  18.24704  -0.12113  1.000 56.71383  ?  109 ASN A CA  1 
ATOM   858  C  C   . ASN A  1 109 ? 53.85776  17.59230  -1.36061  1.000 47.79453  ?  109 ASN A C   1 
ATOM   859  O  O   . ASN A  1 109 ? 54.34237  17.79572  -2.48525  1.000 52.73118  ?  109 ASN A O   1 
ATOM   860  C  CB  . ASN A  1 109 ? 55.32342  17.24462  0.65062   1.000 58.84309  ?  109 ASN A CB  1 
ATOM   861  C  CG  . ASN A  1 109 ? 56.53421  17.90386  1.30378   1.000 73.51800  ?  109 ASN A CG  1 
ATOM   862  O  OD1 . ASN A  1 109 ? 57.27630  18.65349  0.65800   1.000 78.89893  ?  109 ASN A OD1 1 
ATOM   863  N  ND2 . ASN A  1 109 ? 56.73180  17.63729  2.59285   1.000 70.99694  ?  109 ASN A ND2 1 
ATOM   864  N  N   . VAL A  1 110 ? 52.78879  16.81748  -1.17882  1.000 46.36481  ?  110 VAL A N   1 
ATOM   865  C  CA  . VAL A  1 110 ? 52.13550  16.18706  -2.32518  1.000 49.45150  ?  110 VAL A CA  1 
ATOM   866  C  C   . VAL A  1 110 ? 51.61204  17.24621  -3.28423  1.000 56.62098  ?  110 VAL A C   1 
ATOM   867  O  O   . VAL A  1 110 ? 51.76706  17.13028  -4.50648  1.000 59.49097  ?  110 VAL A O   1 
ATOM   868  C  CB  . VAL A  1 110 ? 51.01511  15.23894  -1.86661  1.000 53.54348  ?  110 VAL A CB  1 
ATOM   869  C  CG1 . VAL A  1 110 ? 50.52072  14.44318  -3.04839  1.000 61.00725  ?  110 VAL A CG1 1 
ATOM   870  C  CG2 . VAL A  1 110 ? 51.53548  14.29550  -0.79292  1.000 48.66053  ?  110 VAL A CG2 1 
ATOM   871  N  N   . ASN A  1 111 ? 50.99252  18.29857  -2.73877  1.000 45.57499  ?  111 ASN A N   1 
ATOM   872  C  CA  . ASN A  1 111 ? 50.52637  19.41728  -3.54646  1.000 49.61153  ?  111 ASN A CA  1 
ATOM   873  C  C   . ASN A  1 111 ? 51.67510  20.05165  -4.31629  1.000 47.41054  ?  111 ASN A C   1 
ATOM   874  O  O   . ASN A  1 111 ? 51.53200  20.36243  -5.50106  1.000 47.70640  ?  111 ASN A O   1 
ATOM   875  C  CB  . ASN A  1 111 ? 49.84515  20.45465  -2.63916  1.000 52.36932  ?  111 ASN A CB  1 
ATOM   876  C  CG  . ASN A  1 111 ? 49.08623  21.51500  -3.41793  1.000 54.68660  ?  111 ASN A CG  1 
ATOM   877  O  OD1 . ASN A  1 111 ? 48.45746  21.21319  -4.43112  1.000 50.23557  ?  111 ASN A OD1 1 
ATOM   878  N  ND2 . ASN A  1 111 ? 49.13930  22.77068  -2.94515  1.000 46.72330  ?  111 ASN A ND2 1 
ATOM   879  N  N   . GLN A  1 112 ? 52.80841  20.28249  -3.64500  1.000 51.11398  ?  112 GLN A N   1 
ATOM   880  C  CA  . GLN A  1 112 ? 53.97007  20.89349  -4.29644  1.000 50.10863  ?  112 GLN A CA  1 
ATOM   881  C  C   . GLN A  1 112 ? 54.38617  20.08707  -5.51616  1.000 50.24503  ?  112 GLN A C   1 
ATOM   882  O  O   . GLN A  1 112 ? 54.63612  20.63897  -6.59991  1.000 51.07250  ?  112 GLN A O   1 
ATOM   883  C  CB  . GLN A  1 112 ? 55.11409  21.01665  -3.28477  1.000 51.20123  ?  112 GLN A CB  1 
ATOM   884  C  CG  . GLN A  1 112 ? 56.35470  21.70800  -3.80410  1.000 56.17657  ?  112 GLN A CG  1 
ATOM   885  C  CD  . GLN A  1 112 ? 57.61934  21.38869  -2.98398  1.000 74.27011  ?  112 GLN A CD  1 
ATOM   886  O  OE1 . GLN A  1 112 ? 57.55700  21.11764  -1.77984  1.000 76.91481  ?  112 GLN A OE1 1 
ATOM   887  N  NE2 . GLN A  1 112 ? 58.77609  21.43697  -3.64390  1.000 80.26958  ?  112 GLN A NE2 1 
ATOM   888  N  N   . SER A  1 113 ? 54.40712  18.75834  -5.36622  1.000 50.98702  ?  113 SER A N   1 
ATOM   889  C  CA  . SER A  1 113 ? 54.70052  17.88522  -6.50417  1.000 53.11335  ?  113 SER A CA  1 
ATOM   890  C  C   . SER A  1 113 ? 53.59133  17.92578  -7.56472  1.000 48.66563  ?  113 SER A C   1 
ATOM   891  O  O   . SER A  1 113 ? 53.87201  17.84260  -8.76482  1.000 49.19778  ?  113 SER A O   1 
ATOM   892  C  CB  . SER A  1 113 ? 54.93229  16.45673  -6.00634  1.000 56.99756  ?  113 SER A CB  1 
ATOM   893  O  OG  . SER A  1 113 ? 54.87012  15.54456  -7.07450  1.000 60.91510  ?  113 SER A OG  1 
ATOM   894  N  N   . LEU A  1 114 ? 52.33300  18.06232  -7.15425  1.000 47.46892  ?  114 LEU A N   1 
ATOM   895  C  CA  . LEU A  1 114 ? 51.25766  18.16486  -8.13686  1.000 52.08007  ?  114 LEU A CA  1 
ATOM   896  C  C   . LEU A  1 114 ? 51.38227  19.44637  -8.95332  1.000 51.05755  ?  114 LEU A C   1 
ATOM   897  O  O   . LEU A  1 114 ? 51.11787  19.45430  -10.16396 1.000 52.65062  ?  114 LEU A O   1 
ATOM   898  C  CB  . LEU A  1 114 ? 49.90231  18.09947  -7.43426  1.000 47.12260  ?  114 LEU A CB  1 
ATOM   899  C  CG  . LEU A  1 114 ? 49.54859  16.68369  -7.00133  1.000 49.91181  ?  114 LEU A CG  1 
ATOM   900  C  CD1 . LEU A  1 114 ? 48.41602  16.72245  -5.99425  1.000 53.83609  ?  114 LEU A CD1 1 
ATOM   901  C  CD2 . LEU A  1 114 ? 49.18310  15.83313  -8.22578  1.000 45.81982  ?  114 LEU A CD2 1 
ATOM   902  N  N   . LEU A  1 115 ? 51.78534  20.53650  -8.30032  1.000 54.01466  ?  115 LEU A N   1 
ATOM   903  C  CA  . LEU A  1 115 ? 52.02493  21.80260  -8.99605  1.000 50.27177  ?  115 LEU A CA  1 
ATOM   904  C  C   . LEU A  1 115 ? 53.19664  21.68223  -9.96381  1.000 54.37555  ?  115 LEU A C   1 
ATOM   905  O  O   . LEU A  1 115 ? 53.12837  22.18315  -11.08990 1.000 52.02961  ?  115 LEU A O   1 
ATOM   906  C  CB  . LEU A  1 115 ? 52.26954  22.93158  -7.98661  1.000 50.75029  ?  115 LEU A CB  1 
ATOM   907  C  CG  . LEU A  1 115 ? 51.12489  23.20836  -6.99375  1.000 55.20184  ?  115 LEU A CG  1 
ATOM   908  C  CD1 . LEU A  1 115 ? 51.50980  24.27226  -5.97557  1.000 50.51521  ?  115 LEU A CD1 1 
ATOM   909  C  CD2 . LEU A  1 115 ? 49.82517  23.57243  -7.70214  1.000 49.03038  ?  115 LEU A CD2 1 
ATOM   910  N  N   . GLU A  1 116 ? 54.27930  21.01326  -9.55392  1.000 51.76787  ?  116 GLU A N   1 
ATOM   911  C  CA  . GLU A  1 116 ? 55.35044  20.75681  -10.51555 1.000 55.85265  ?  116 GLU A CA  1 
ATOM   912  C  C   . GLU A  1 116 ? 54.85453  19.92241  -11.70217 1.000 60.10507  ?  116 GLU A C   1 
ATOM   913  O  O   . GLU A  1 116 ? 55.24089  20.17907  -12.84957 1.000 53.31511  ?  116 GLU A O   1 
ATOM   914  C  CB  . GLU A  1 116 ? 56.54981  20.08526  -9.83194  1.000 60.05688  ?  116 GLU A CB  1 
ATOM   915  C  CG  . GLU A  1 116 ? 56.99451  20.77145  -8.53218  1.000 72.01888  ?  116 GLU A CG  1 
ATOM   916  C  CD  . GLU A  1 116 ? 58.09764  20.02005  -7.77483  1.000 79.23290  ?  116 GLU A CD  1 
ATOM   917  O  OE1 . GLU A  1 116 ? 58.75517  20.64592  -6.91485  1.000 80.87609  ?  116 GLU A OE1 1 
ATOM   918  O  OE2 . GLU A  1 116 ? 58.30812  18.81114  -8.02732  1.000 85.10157  -1 116 GLU A OE2 1 
ATOM   919  N  N   . LEU A  1 117 ? 53.99569  18.91965  -11.45642 1.000 55.68450  ?  117 LEU A N   1 
ATOM   920  C  CA  . LEU A  1 117 ? 53.52863  18.09838  -12.57021 1.000 50.26825  ?  117 LEU A CA  1 
ATOM   921  C  C   . LEU A  1 117 ? 52.67713  18.92544  -13.52186 1.000 50.38395  ?  117 LEU A C   1 
ATOM   922  O  O   . LEU A  1 117 ? 52.77358  18.78681  -14.74620 1.000 50.91628  ?  117 LEU A O   1 
ATOM   923  C  CB  . LEU A  1 117 ? 52.74968  16.89143  -12.05350 1.000 59.41166  ?  117 LEU A CB  1 
ATOM   924  C  CG  . LEU A  1 117 ? 52.81556  15.63581  -12.92106 1.000 56.27640  ?  117 LEU A CG  1 
ATOM   925  C  CD1 . LEU A  1 117 ? 52.07321  14.52411  -12.23312 1.000 65.63494  ?  117 LEU A CD1 1 
ATOM   926  C  CD2 . LEU A  1 117 ? 52.27080  15.85303  -14.31395 1.000 66.90566  ?  117 LEU A CD2 1 
ATOM   927  N  N   . HIS A  1 118 ? 51.84465  19.79997  -12.97661 1.000 49.99073  ?  118 HIS A N   1 
ATOM   928  C  CA  . HIS A  1 118 ? 51.09628  20.71493  -13.82683 1.000 50.34721  ?  118 HIS A CA  1 
ATOM   929  C  C   . HIS A  1 118 ? 52.02553  21.66873  -14.60550 1.000 52.16410  ?  118 HIS A C   1 
ATOM   930  O  O   . HIS A  1 118 ? 51.81947  21.90394  -15.80009 1.000 52.75228  ?  118 HIS A O   1 
ATOM   931  C  CB  . HIS A  1 118 ? 50.08441  21.46964  -12.96749 1.000 50.91877  ?  118 HIS A CB  1 
ATOM   932  C  CG  . HIS A  1 118 ? 48.99550  22.10760  -13.75855 1.000 51.70270  ?  118 HIS A CG  1 
ATOM   933  N  ND1 . HIS A  1 118 ? 49.23638  23.09774  -14.68662 1.000 60.01266  ?  118 HIS A ND1 1 
ATOM   934  C  CD2 . HIS A  1 118 ? 47.66806  21.86305  -13.80105 1.000 54.51798  ?  118 HIS A CD2 1 
ATOM   935  C  CE1 . HIS A  1 118 ? 48.09687  23.46261  -15.24433 1.000 66.49932  ?  118 HIS A CE1 1 
ATOM   936  N  NE2 . HIS A  1 118 ? 47.12844  22.72714  -14.72614 1.000 64.09413  ?  118 HIS A NE2 1 
ATOM   937  N  N   . LYS A  1 119 ? 53.06086  22.20771  -13.95923 1.000 53.17160  ?  119 LYS A N   1 
ATOM   938  C  CA  . LYS A  1 119 ? 54.04900  23.00638  -14.68529 1.000 55.02807  ?  119 LYS A CA  1 
ATOM   939  C  C   . LYS A  1 119 ? 54.63289  22.22368  -15.86031 1.000 55.53564  ?  119 LYS A C   1 
ATOM   940  O  O   . LYS A  1 119 ? 54.69315  22.72357  -16.99285 1.000 56.56379  ?  119 LYS A O   1 
ATOM   941  C  CB  . LYS A  1 119 ? 55.16907  23.45959  -13.73846 1.000 60.45786  ?  119 LYS A CB  1 
ATOM   942  C  CG  . LYS A  1 119 ? 56.03551  24.65939  -14.26399 1.000 58.12698  ?  119 LYS A CG  1 
ATOM   943  N  N   . LEU A  1 120 ? 55.06300  20.98841  -15.60287 1.000 54.90161  ?  120 LEU A N   1 
ATOM   944  C  CA  . LEU A  1 120 ? 55.62297  20.14087  -16.65145 1.000 60.84493  ?  120 LEU A CA  1 
ATOM   945  C  C   . LEU A  1 120 ? 54.63420  19.92747  -17.79675 1.000 64.35458  ?  120 LEU A C   1 
ATOM   946  O  O   . LEU A  1 120 ? 54.98228  20.10559  -18.97241 1.000 55.94510  ?  120 LEU A O   1 
ATOM   947  C  CB  . LEU A  1 120 ? 56.04753  18.79233  -16.05943 1.000 61.24743  ?  120 LEU A CB  1 
ATOM   948  C  CG  . LEU A  1 120 ? 56.56307  17.76541  -17.07176 1.000 57.52428  ?  120 LEU A CG  1 
ATOM   949  C  CD1 . LEU A  1 120 ? 57.67166  18.39539  -17.92596 1.000 56.89165  ?  120 LEU A CD1 1 
ATOM   950  C  CD2 . LEU A  1 120 ? 57.07346  16.52888  -16.36571 1.000 54.40326  ?  120 LEU A CD2 1 
ATOM   951  N  N   . ALA A  1 121 ? 53.39860  19.52072  -17.46959 1.000 53.27904  ?  121 ALA A N   1 
ATOM   952  C  CA  . ALA A  1 121 ? 52.37895  19.29419  -18.49273 1.000 52.80805  ?  121 ALA A CA  1 
ATOM   953  C  C   . ALA A  1 121 ? 52.10631  20.55766  -19.30020 1.000 53.93116  ?  121 ALA A C   1 
ATOM   954  O  O   . ALA A  1 121 ? 51.98704  20.50342  -20.53092 1.000 54.54803  ?  121 ALA A O   1 
ATOM   955  C  CB  . ALA A  1 121 ? 51.09232  18.78811  -17.84474 1.000 51.06922  ?  121 ALA A CB  1 
ATOM   956  N  N   . THR A  1 122 ? 51.99130  21.70350  -18.62661 1.000 54.29150  ?  122 THR A N   1 
ATOM   957  C  CA  . THR A  1 122 ? 51.77418  22.95984  -19.34455 1.000 55.53714  ?  122 THR A CA  1 
ATOM   958  C  C   . THR A  1 122 ? 52.94418  23.26978  -20.27227 1.000 61.50668  ?  122 THR A C   1 
ATOM   959  O  O   . THR A  1 122 ? 52.74327  23.61478  -21.44109 1.000 68.20203  ?  122 THR A O   1 
ATOM   960  C  CB  . THR A  1 122 ? 51.54483  24.11580  -18.36369 1.000 55.71985  ?  122 THR A CB  1 
ATOM   961  O  OG1 . THR A  1 122 ? 50.33721  23.88599  -17.61656 1.000 66.07149  ?  122 THR A OG1 1 
ATOM   962  C  CG2 . THR A  1 122 ? 51.36135  25.39768  -19.12376 1.000 57.49937  ?  122 THR A CG2 1 
ATOM   963  N  N   . ASP A  1 123 ? 54.17564  23.10684  -19.79767 1.000 57.99955  ?  123 ASP A N   1 
ATOM   964  C  CA  . ASP A  1 123 ? 55.30360  23.47472  -20.64520 1.000 66.17579  ?  123 ASP A CA  1 
ATOM   965  C  C   . ASP A  1 123 ? 55.61825  22.43295  -21.71703 1.000 59.99249  ?  123 ASP A C   1 
ATOM   966  O  O   . ASP A  1 123 ? 56.22845  22.78038  -22.73355 1.000 61.53989  ?  123 ASP A O   1 
ATOM   967  C  CB  . ASP A  1 123 ? 56.51678  23.78051  -19.76977 1.000 72.79978  ?  123 ASP A CB  1 
ATOM   968  C  CG  . ASP A  1 123 ? 56.18305  24.77665  -18.65741 1.000 86.86198  ?  123 ASP A CG  1 
ATOM   969  O  OD1 . ASP A  1 123 ? 55.23317  25.58912  -18.84417 1.000 87.31131  -1 123 ASP A OD1 1 
ATOM   970  O  OD2 . ASP A  1 123 ? 56.87387  24.75441  -17.61172 1.000 91.57574  ?  123 ASP A OD2 1 
ATOM   971  N  N   . LYS A  1 124 ? 55.17941  21.18516  -21.54233 1.000 58.47593  ?  124 LYS A N   1 
ATOM   972  C  CA  . LYS A  1 124 ? 55.14656  20.23273  -22.64420 1.000 59.98415  ?  124 LYS A CA  1 
ATOM   973  C  C   . LYS A  1 124 ? 53.90196  20.39618  -23.51442 1.000 58.05132  ?  124 LYS A C   1 
ATOM   974  O  O   . LYS A  1 124 ? 53.72806  19.64217  -24.48086 1.000 58.02963  ?  124 LYS A O   1 
ATOM   975  C  CB  . LYS A  1 124 ? 55.23252  18.79474  -22.10357 1.000 57.14683  ?  124 LYS A CB  1 
ATOM   976  C  CG  . LYS A  1 124 ? 56.61806  18.15512  -22.27614 1.000 58.13918  ?  124 LYS A CG  1 
ATOM   977  C  CD  . LYS A  1 124 ? 57.71585  18.92775  -21.52900 1.000 62.86896  ?  124 LYS A CD  1 
ATOM   978  C  CE  . LYS A  1 124 ? 59.09340  18.22648  -21.57966 1.000 65.92338  ?  124 LYS A CE  1 
ATOM   979  N  NZ  . LYS A  1 124 ? 59.93598  18.55151  -22.80773 1.000 75.46868  ?  124 LYS A NZ  1 
ATOM   980  N  N   . ASN A  1 125 ? 53.05603  21.37213  -23.19667 1.000 57.86052  ?  125 ASN A N   1 
ATOM   981  C  CA  . ASN A  1 125 ? 51.83028  21.68540  -23.93191 1.000 63.61798  ?  125 ASN A CA  1 
ATOM   982  C  C   . ASN A  1 125 ? 50.92408  20.45486  -24.03475 1.000 59.89473  ?  125 ASN A C   1 
ATOM   983  O  O   . ASN A  1 125 ? 50.51679  20.03105  -25.11722 1.000 60.83588  ?  125 ASN A O   1 
ATOM   984  C  CB  . ASN A  1 125 ? 52.14982  22.28024  -25.30866 1.000 60.03977  ?  125 ASN A CB  1 
ATOM   985  C  CG  . ASN A  1 125 ? 53.14294  23.45754  -25.23689 1.000 68.92356  ?  125 ASN A CG  1 
ATOM   986  O  OD1 . ASN A  1 125 ? 53.02334  24.35292  -24.39188 1.000 74.25060  ?  125 ASN A OD1 1 
ATOM   987  N  ND2 . ASN A  1 125 ? 54.12340  23.45083  -26.13186 1.000 62.96477  ?  125 ASN A ND2 1 
ATOM   988  N  N   . ASP A  1 126 ? 50.61309  19.88655  -22.86272 1.000 55.39590  ?  126 ASP A N   1 
ATOM   989  C  CA  . ASP A  1 126 ? 49.79185  18.67950  -22.71806 1.000 53.04951  ?  126 ASP A CA  1 
ATOM   990  C  C   . ASP A  1 126 ? 48.53638  19.08301  -21.95670 1.000 51.94060  ?  126 ASP A C   1 
ATOM   991  O  O   . ASP A  1 126 ? 48.43750  18.83823  -20.74380 1.000 50.90416  ?  126 ASP A O   1 
ATOM   992  C  CB  . ASP A  1 126 ? 50.54791  17.57553  -21.97874 1.000 52.37863  ?  126 ASP A CB  1 
ATOM   993  C  CG  . ASP A  1 126 ? 49.79292  16.22536  -21.95090 1.000 62.34433  ?  126 ASP A CG  1 
ATOM   994  O  OD1 . ASP A  1 126 ? 48.53888  16.19059  -22.06831 1.000 52.98567  ?  126 ASP A OD1 1 
ATOM   995  O  OD2 . ASP A  1 126 ? 50.47147  15.18464  -21.77509 1.000 50.80254  -1 126 ASP A OD2 1 
ATOM   996  N  N   . PRO A  1 127 ? 47.55837  19.71132  -22.62492 1.000 52.21442  ?  127 PRO A N   1 
ATOM   997  C  CA  . PRO A  1 127 ? 46.41366  20.24486  -21.87293 1.000 51.37461  ?  127 PRO A CA  1 
ATOM   998  C  C   . PRO A  1 127 ? 45.53181  19.15331  -21.30139 1.000 49.71826  ?  127 PRO A C   1 
ATOM   999  O  O   . PRO A  1 127 ? 44.88082  19.37171  -20.27166 1.000 48.81946  ?  127 PRO A O   1 
ATOM   1000 C  CB  . PRO A  1 127 ? 45.66705  21.10823  -22.90591 1.000 52.33704  ?  127 PRO A CB  1 
ATOM   1001 C  CG  . PRO A  1 127 ? 46.01224  20.52907  -24.21377 1.000 53.08050  ?  127 PRO A CG  1 
ATOM   1002 C  CD  . PRO A  1 127 ? 47.42666  19.95163  -24.07389 1.000 54.44857  ?  127 PRO A CD  1 
ATOM   1003 N  N   . HIS A  1 128 ? 45.49699  17.97275  -21.91672 1.000 59.07174  ?  128 HIS A N   1 
ATOM   1004 C  CA  . HIS A  1 128 ? 44.69387  16.91160  -21.32664 1.000 50.07644  ?  128 HIS A CA  1 
ATOM   1005 C  C   . HIS A  1 128 ? 45.22447  16.54618  -19.95054 1.000 47.05014  ?  128 HIS A C   1 
ATOM   1006 O  O   . HIS A  1 128 ? 44.46124  16.43043  -18.98586 1.000 45.98274  ?  128 HIS A O   1 
ATOM   1007 C  CB  . HIS A  1 128 ? 44.65216  15.67723  -22.20717 1.000 47.76094  ?  128 HIS A CB  1 
ATOM   1008 C  CG  . HIS A  1 128 ? 44.00271  14.52976  -21.51628 1.000 48.77379  ?  128 HIS A CG  1 
ATOM   1009 N  ND1 . HIS A  1 128 ? 44.71315  13.61683  -20.76926 1.000 53.85797  ?  128 HIS A ND1 1 
ATOM   1010 C  CD2 . HIS A  1 128 ? 42.69694  14.20824  -21.36469 1.000 47.61181  ?  128 HIS A CD2 1 
ATOM   1011 C  CE1 . HIS A  1 128 ? 43.87715  12.74442  -20.23264 1.000 49.06962  ?  128 HIS A CE1 1 
ATOM   1012 N  NE2 . HIS A  1 128 ? 42.64833  13.08213  -20.57829 1.000 51.88115  ?  128 HIS A NE2 1 
ATOM   1013 N  N   . LEU A  1 129 ? 46.54361  16.41658  -19.83012 1.000 49.16645  ?  129 LEU A N   1 
ATOM   1014 C  CA  . LEU A  1 129 ? 47.11636  16.05714  -18.54454 1.000 47.03625  ?  129 LEU A CA  1 
ATOM   1015 C  C   . LEU A  1 129 ? 46.97488  17.20159  -17.55406 1.000 47.03074  ?  129 LEU A C   1 
ATOM   1016 O  O   . LEU A  1 129 ? 46.65033  16.97050  -16.38013 1.000 46.05336  ?  129 LEU A O   1 
ATOM   1017 C  CB  . LEU A  1 129 ? 48.57755  15.65444  -18.73005 1.000 47.88076  ?  129 LEU A CB  1 
ATOM   1018 C  CG  . LEU A  1 129 ? 49.39468  15.44215  -17.46205 1.000 50.04515  ?  129 LEU A CG  1 
ATOM   1019 C  CD1 . LEU A  1 129 ? 48.83853  14.24760  -16.75239 1.000 46.30834  ?  129 LEU A CD1 1 
ATOM   1020 C  CD2 . LEU A  1 129 ? 50.85773  15.19616  -17.80270 1.000 55.83262  ?  129 LEU A CD2 1 
ATOM   1021 N  N   . ALA A  1 130 ? 47.21168  18.44571  -18.01581 1.000 48.18160  ?  130 ALA A N   1 
ATOM   1022 C  CA  . ALA A  1 130 ? 47.07907  19.61742  -17.14886 1.000 50.44619  ?  130 ALA A CA  1 
ATOM   1023 C  C   . ALA A  1 130 ? 45.69152  19.69115  -16.54858 1.000 47.21890  ?  130 ALA A C   1 
ATOM   1024 O  O   . ALA A  1 130 ? 45.54253  19.94045  -15.34539 1.000 46.64464  ?  130 ALA A O   1 
ATOM   1025 C  CB  . ALA A  1 130 ? 47.38634  20.91877  -17.91963 1.000 49.94734  ?  130 ALA A CB  1 
ATOM   1026 N  N   . ASP A  1 131 ? 44.66618  19.46590  -17.38142 1.000 53.95624  ?  131 ASP A N   1 
ATOM   1027 C  CA  . ASP A  1 131 ? 43.27982  19.48665  -16.92414 1.000 52.55586  ?  131 ASP A CA  1 
ATOM   1028 C  C   . ASP A  1 131 ? 42.97849  18.31513  -16.00311 1.000 49.38895  ?  131 ASP A C   1 
ATOM   1029 O  O   . ASP A  1 131 ? 42.30317  18.48459  -14.98046 1.000 47.12470  ?  131 ASP A O   1 
ATOM   1030 C  CB  . ASP A  1 131 ? 42.32035  19.48057  -18.11754 1.000 56.77539  ?  131 ASP A CB  1 
ATOM   1031 C  CG  . ASP A  1 131 ? 40.84187  19.61799  -17.69331 1.000 60.32512  ?  131 ASP A CG  1 
ATOM   1032 O  OD1 . ASP A  1 131 ? 40.45515  20.69973  -17.18475 1.000 52.24040  ?  131 ASP A OD1 1 
ATOM   1033 O  OD2 . ASP A  1 131 ? 40.06768  18.64286  -17.87511 1.000 63.66333  -1 131 ASP A OD2 1 
ATOM   1034 N  N   . PHE A  1 132 ? 43.44309  17.11154  -16.35768 1.000 50.97655  ?  132 PHE A N   1 
ATOM   1035 C  CA  . PHE A  1 132 ? 43.26328  15.98121  -15.45876 1.000 45.75942  ?  132 PHE A CA  1 
ATOM   1036 C  C   . PHE A  1 132 ? 43.74040  16.34587  -14.06006 1.000 44.03667  ?  132 PHE A C   1 
ATOM   1037 O  O   . PHE A  1 132 ? 43.01218  16.17813  -13.07143 1.000 42.15223  ?  132 PHE A O   1 
ATOM   1038 C  CB  . PHE A  1 132 ? 44.01510  14.74948  -15.97856 1.000 47.09769  ?  132 PHE A CB  1 
ATOM   1039 C  CG  . PHE A  1 132 ? 43.69277  13.49364  -15.21262 1.000 51.84732  ?  132 PHE A CG  1 
ATOM   1040 C  CD1 . PHE A  1 132 ? 42.58068  12.72254  -15.54787 1.000 55.78316  ?  132 PHE A CD1 1 
ATOM   1041 C  CD2 . PHE A  1 132 ? 44.46454  13.10946  -14.12797 1.000 59.16541  ?  132 PHE A CD2 1 
ATOM   1042 C  CE1 . PHE A  1 132 ? 42.26105  11.56042  -14.83610 1.000 54.40780  ?  132 PHE A CE1 1 
ATOM   1043 C  CE2 . PHE A  1 132 ? 44.15601  11.95392  -13.41072 1.000 55.58142  ?  132 PHE A CE2 1 
ATOM   1044 C  CZ  . PHE A  1 132 ? 43.04513  11.18048  -13.76946 1.000 52.99361  ?  132 PHE A CZ  1 
ATOM   1045 N  N   . ILE A  1 133 ? 44.95135  16.91156  -13.97567 1.000 44.65008  ?  133 ILE A N   1 
ATOM   1046 C  CA  . ILE A  1 133 ? 45.51254  17.28748  -12.68052 1.000 43.75481  ?  133 ILE A CA  1 
ATOM   1047 C  C   . ILE A  1 133 ? 44.64051  18.33865  -11.99376 1.000 43.53024  ?  133 ILE A C   1 
ATOM   1048 O  O   . ILE A  1 133 ? 44.23227  18.16577  -10.84046 1.000 45.75905  ?  133 ILE A O   1 
ATOM   1049 C  CB  . ILE A  1 133 ? 46.96186  17.76874  -12.84025 1.000 45.95050  ?  133 ILE A CB  1 
ATOM   1050 C  CG1 . ILE A  1 133 ? 47.84833  16.60357  -13.24921 1.000 48.91045  ?  133 ILE A CG1 1 
ATOM   1051 C  CG2 . ILE A  1 133 ? 47.47202  18.36473  -11.54288 1.000 45.15235  ?  133 ILE A CG2 1 
ATOM   1052 C  CD1 . ILE A  1 133 ? 49.17064  17.07126  -13.81277 1.000 66.30419  ?  133 ILE A CD1 1 
ATOM   1053 N  N   . GLU A  1 134 ? 44.34210  19.44177  -12.67551 1.000 45.19659  ?  134 GLU A N   1 
ATOM   1054 C  CA  . GLU A  1 134 ? 43.61303  20.49377  -11.97334 1.000 54.98769  ?  134 GLU A CA  1 
ATOM   1055 C  C   . GLU A  1 134 ? 42.30319  19.94674  -11.41754 1.000 59.47952  ?  134 GLU A C   1 
ATOM   1056 O  O   . GLU A  1 134 ? 42.13159  19.89487  -10.19270 1.000 72.04970  ?  134 GLU A O   1 
ATOM   1057 C  CB  . GLU A  1 134 ? 43.40720  21.72494  -12.86020 1.000 59.36517  ?  134 GLU A CB  1 
ATOM   1058 C  CG  . GLU A  1 134 ? 42.80234  21.50966  -14.20954 1.000 60.04121  ?  134 GLU A CG  1 
ATOM   1059 C  CD  . GLU A  1 134 ? 43.07241  22.68554  -15.13633 1.000 67.28148  ?  134 GLU A CD  1 
ATOM   1060 O  OE1 . GLU A  1 134 ? 44.25261  22.97486  -15.39773 1.000 67.39077  ?  134 GLU A OE1 1 
ATOM   1061 O  OE2 . GLU A  1 134 ? 42.10759  23.33395  -15.58754 1.000 80.12798  -1 134 GLU A OE2 1 
ATOM   1062 N  N   . THR A  1 135 ? 41.47825  19.33558  -12.28555 1.000 53.50384  ?  135 THR A N   1 
ATOM   1063 C  CA  . THR A  1 135 ? 40.13042  18.92465  -11.89444 1.000 55.27642  ?  135 THR A CA  1 
ATOM   1064 C  C   . THR A  1 135 ? 40.13245  17.79000  -10.86946 1.000 61.23370  ?  135 THR A C   1 
ATOM   1065 O  O   . THR A  1 135 ? 39.29336  17.77967  -9.95670  1.000 62.10368  ?  135 THR A O   1 
ATOM   1066 C  CB  . THR A  1 135 ? 39.30395  18.50938  -13.11778 1.000 59.63299  ?  135 THR A CB  1 
ATOM   1067 O  OG1 . THR A  1 135 ? 39.64722  17.17675  -13.51023 1.000 75.54969  ?  135 THR A OG1 1 
ATOM   1068 C  CG2 . THR A  1 135 ? 39.52697  19.45022  -14.27362 1.000 57.58895  ?  135 THR A CG2 1 
ATOM   1069 N  N   . HIS A  1 136 ? 41.02952  16.81158  -10.99708 1.000 52.01467  ?  136 HIS A N   1 
ATOM   1070 C  CA  . HIS A  1 136 ? 40.91907  15.67073  -10.10736 1.000 46.66712  ?  136 HIS A CA  1 
ATOM   1071 C  C   . HIS A  1 136 ? 41.82994  15.75428  -8.89078  1.000 55.31236  ?  136 HIS A C   1 
ATOM   1072 O  O   . HIS A  1 136 ? 41.66892  14.94182  -7.96954  1.000 55.58215  ?  136 HIS A O   1 
ATOM   1073 C  CB  . HIS A  1 136 ? 41.18089  14.38610  -10.89287 1.000 50.76568  ?  136 HIS A CB  1 
ATOM   1074 C  CG  . HIS A  1 136 ? 40.07672  14.05069  -11.84906 1.000 65.02789  ?  136 HIS A CG  1 
ATOM   1075 N  ND1 . HIS A  1 136 ? 40.22515  14.12310  -13.21834 1.000 67.25585  ?  136 HIS A ND1 1 
ATOM   1076 C  CD2 . HIS A  1 136 ? 38.78947  13.67958  -11.62991 1.000 65.41483  ?  136 HIS A CD2 1 
ATOM   1077 C  CE1 . HIS A  1 136 ? 39.08291  13.79650  -13.80121 1.000 69.47707  ?  136 HIS A CE1 1 
ATOM   1078 N  NE2 . HIS A  1 136 ? 38.19536  13.52385  -12.85959 1.000 64.77214  ?  136 HIS A NE2 1 
ATOM   1079 N  N   . TYR A  1 137 ? 42.75421  16.71997  -8.82917  1.000 44.78685  ?  137 TYR A N   1 
ATOM   1080 C  CA  . TYR A  1 137 ? 43.72776  16.68339  -7.74937  1.000 52.28203  ?  137 TYR A CA  1 
ATOM   1081 C  C   . TYR A  1 137 ? 43.91193  18.02903  -7.06953  1.000 48.66837  ?  137 TYR A C   1 
ATOM   1082 O  O   . TYR A  1 137 ? 44.10224  18.05624  -5.85202  1.000 48.12943  ?  137 TYR A O   1 
ATOM   1083 C  CB  . TYR A  1 137 ? 45.08890  16.16034  -8.26311  1.000 60.79977  ?  137 TYR A CB  1 
ATOM   1084 C  CG  . TYR A  1 137 ? 45.03592  14.67561  -8.48025  1.000 52.82841  ?  137 TYR A CG  1 
ATOM   1085 C  CD1 . TYR A  1 137 ? 44.39634  14.16242  -9.60564  1.000 53.06374  ?  137 TYR A CD1 1 
ATOM   1086 C  CD2 . TYR A  1 137 ? 45.57855  13.77649  -7.54909  1.000 52.84593  ?  137 TYR A CD2 1 
ATOM   1087 C  CE1 . TYR A  1 137 ? 44.28381  12.80680  -9.81391  1.000 55.94161  ?  137 TYR A CE1 1 
ATOM   1088 C  CE2 . TYR A  1 137 ? 45.47937  12.39015  -7.76180  1.000 50.31406  ?  137 TYR A CE2 1 
ATOM   1089 C  CZ  . TYR A  1 137 ? 44.81831  11.92647  -8.90241  1.000 45.44313  ?  137 TYR A CZ  1 
ATOM   1090 O  OH  . TYR A  1 137 ? 44.66778  10.59667  -9.18333  1.000 47.41289  ?  137 TYR A OH  1 
ATOM   1091 N  N   . LEU A  1 138 ? 43.86042  19.14836  -7.80684  1.000 54.84219  ?  138 LEU A N   1 
ATOM   1092 C  CA  . LEU A  1 138 ? 44.33578  20.39884  -7.21317  1.000 48.91911  ?  138 LEU A CA  1 
ATOM   1093 C  C   . LEU A  1 138 ? 43.34867  20.93280  -6.18994  1.000 45.12768  ?  138 LEU A C   1 
ATOM   1094 O  O   . LEU A  1 138 ? 43.73970  21.31705  -5.07759  1.000 43.58602  ?  138 LEU A O   1 
ATOM   1095 C  CB  . LEU A  1 138 ? 44.61825  21.44047  -8.29905  1.000 46.22859  ?  138 LEU A CB  1 
ATOM   1096 C  CG  . LEU A  1 138 ? 45.91387  21.11757  -9.04840  1.000 46.94584  ?  138 LEU A CG  1 
ATOM   1097 C  CD1 . LEU A  1 138 ? 46.23151  22.17057  -10.08806 1.000 49.36658  ?  138 LEU A CD1 1 
ATOM   1098 C  CD2 . LEU A  1 138 ? 47.08439  20.93450  -8.08372  1.000 48.60765  ?  138 LEU A CD2 1 
ATOM   1099 N  N   . ASN A  1 139 ? 42.05839  20.95872  -6.53540  1.000 47.64776  ?  139 ASN A N   1 
ATOM   1100 C  CA  . ASN A  1 139 ? 41.10255  21.45517  -5.55452  1.000 45.63275  ?  139 ASN A CA  1 
ATOM   1101 C  C   . ASN A  1 139 ? 41.00561  20.50833  -4.37160  1.000 48.60416  ?  139 ASN A C   1 
ATOM   1102 O  O   . ASN A  1 139 ? 40.89467  20.96893  -3.22874  1.000 40.19352  ?  139 ASN A O   1 
ATOM   1103 C  CB  . ASN A  1 139 ? 39.72942  21.70339  -6.17960  1.000 50.28802  ?  139 ASN A CB  1 
ATOM   1104 C  CG  . ASN A  1 139 ? 39.09617  23.01031  -5.66706  1.000 69.29911  ?  139 ASN A CG  1 
ATOM   1105 O  OD1 . ASN A  1 139 ? 39.29284  23.38771  -4.50547  1.000 69.27922  ?  139 ASN A OD1 1 
ATOM   1106 N  ND2 . ASN A  1 139 ? 38.36325  23.71756  -6.53683  1.000 75.42806  ?  139 ASN A ND2 1 
ATOM   1107 N  N   . GLU A  1 140 ? 41.10394  19.19428  -4.61937  1.000 48.58986  ?  140 GLU A N   1 
ATOM   1108 C  CA  . GLU A  1 140 ? 41.09794  18.23066  -3.52524  1.000 43.25570  ?  140 GLU A CA  1 
ATOM   1109 C  C   . GLU A  1 140 ? 42.27822  18.45311  -2.58992  1.000 49.15197  ?  140 GLU A C   1 
ATOM   1110 O  O   . GLU A  1 140 ? 42.12737  18.40270  -1.36246  1.000 47.07759  ?  140 GLU A O   1 
ATOM   1111 C  CB  . GLU A  1 140 ? 41.10914  16.79993  -4.07431  1.000 45.27465  ?  140 GLU A CB  1 
ATOM   1112 N  N   . GLN A  1 141 ? 43.46335  18.68962  -3.14357  1.000 40.28377  ?  141 GLN A N   1 
ATOM   1113 C  CA  . GLN A  1 141 ? 44.60205  19.00583  -2.28944  1.000 47.84269  ?  141 GLN A CA  1 
ATOM   1114 C  C   . GLN A  1 141 ? 44.33752  20.26799  -1.47395  1.000 49.30968  ?  141 GLN A C   1 
ATOM   1115 O  O   . GLN A  1 141 ? 44.58645  20.29352  -0.26186  1.000 41.40741  ?  141 GLN A O   1 
ATOM   1116 C  CB  . GLN A  1 141 ? 45.86898  19.15817  -3.13722  1.000 42.90292  ?  141 GLN A CB  1 
ATOM   1117 C  CG  . GLN A  1 141 ? 47.09550  18.61831  -2.46252  1.000 57.12342  ?  141 GLN A CG  1 
ATOM   1118 C  CD  . GLN A  1 141 ? 47.03579  17.12687  -2.25039  1.000 63.84084  ?  141 GLN A CD  1 
ATOM   1119 O  OE1 . GLN A  1 141 ? 47.33407  16.63076  -1.16128  1.000 75.49330  ?  141 GLN A OE1 1 
ATOM   1120 N  NE2 . GLN A  1 141 ? 46.64334  16.39643  -3.28929  1.000 71.82145  ?  141 GLN A NE2 1 
ATOM   1121 N  N   . VAL A  1 142 ? 43.82227  21.31651  -2.12358  1.000 41.80479  ?  142 VAL A N   1 
ATOM   1122 C  CA  . VAL A  1 142 ? 43.58063  22.57892  -1.42891  1.000 49.76805  ?  142 VAL A CA  1 
ATOM   1123 C  C   . VAL A  1 142 ? 42.61430  22.37117  -0.26267  1.000 50.23574  ?  142 VAL A C   1 
ATOM   1124 O  O   . VAL A  1 142 ? 42.86462  22.82894  0.85981   1.000 43.27469  ?  142 VAL A O   1 
ATOM   1125 C  CB  . VAL A  1 142 ? 43.08663  23.64322  -2.43430  1.000 48.32651  ?  142 VAL A CB  1 
ATOM   1126 C  CG1 . VAL A  1 142 ? 42.29031  24.75775  -1.74079  1.000 43.16217  ?  142 VAL A CG1 1 
ATOM   1127 C  CG2 . VAL A  1 142 ? 44.29573  24.23363  -3.18772  1.000 44.29213  ?  142 VAL A CG2 1 
ATOM   1128 N  N   . LYS A  1 143 ? 41.52213  21.64031  -0.50042  1.000 40.40180  ?  143 LYS A N   1 
ATOM   1129 C  CA  . LYS A  1 143 ? 40.54995  21.34685  0.55335   1.000 46.03113  ?  143 LYS A CA  1 
ATOM   1130 C  C   . LYS A  1 143 ? 41.14355  20.49271  1.67435   1.000 44.40615  ?  143 LYS A C   1 
ATOM   1131 O  O   . LYS A  1 143 ? 40.91638  20.77876  2.86058   1.000 39.21180  ?  143 LYS A O   1 
ATOM   1132 C  CB  . LYS A  1 143 ? 39.32596  20.66316  -0.05661  1.000 45.86474  ?  143 LYS A CB  1 
ATOM   1133 C  CG  . LYS A  1 143 ? 38.45057  21.64590  -0.84185  1.000 46.78487  ?  143 LYS A CG  1 
ATOM   1134 C  CD  . LYS A  1 143 ? 37.55961  20.96471  -1.86981  1.000 44.46582  ?  143 LYS A CD  1 
ATOM   1135 N  N   . ALA A  1 144 ? 41.90553  19.44823  1.33337   1.000 39.15323  ?  144 ALA A N   1 
ATOM   1136 C  CA  . ALA A  1 144 ? 42.53675  18.64949  2.37909   1.000 41.04098  ?  144 ALA A CA  1 
ATOM   1137 C  C   . ALA A  1 144 ? 43.45044  19.51350  3.23450   1.000 40.88475  ?  144 ALA A C   1 
ATOM   1138 O  O   . ALA A  1 144 ? 43.45877  19.39270  4.46374   1.000 39.94324  ?  144 ALA A O   1 
ATOM   1139 C  CB  . ALA A  1 144 ? 43.31107  17.46056  1.77802   1.000 38.99872  ?  144 ALA A CB  1 
ATOM   1140 N  N   . ILE A  1 145 ? 44.21984  20.40105  2.60373   1.000 44.82730  ?  145 ILE A N   1 
ATOM   1141 C  CA  . ILE A  1 145 ? 45.16040  21.22748  3.35752   1.000 50.28215  ?  145 ILE A CA  1 
ATOM   1142 C  C   . ILE A  1 145 ? 44.40488  22.22550  4.23851   1.000 42.13248  ?  145 ILE A C   1 
ATOM   1143 O  O   . ILE A  1 145 ? 44.72451  22.39108  5.42395   1.000 42.46423  ?  145 ILE A O   1 
ATOM   1144 C  CB  . ILE A  1 145 ? 46.16048  21.89496  2.38453   1.000 43.23104  ?  145 ILE A CB  1 
ATOM   1145 C  CG1 . ILE A  1 145 ? 47.13146  20.82745  1.85248   1.000 47.11609  ?  145 ILE A CG1 1 
ATOM   1146 C  CG2 . ILE A  1 145 ? 46.91121  23.06814  3.02950   1.000 44.51555  ?  145 ILE A CG2 1 
ATOM   1147 C  CD1 . ILE A  1 145 ? 47.92302  21.21450  0.59777   1.000 45.65543  ?  145 ILE A CD1 1 
ATOM   1148 N  N   . LYS A  1 146 ? 43.36976  22.87075  3.69384   1.000 41.85912  ?  146 LYS A N   1 
ATOM   1149 C  CA  . LYS A  1 146 ? 42.51431  23.72711  4.51435   1.000 41.85072  ?  146 LYS A CA  1 
ATOM   1150 C  C   . LYS A  1 146 ? 41.92145  22.97652  5.70094   1.000 41.00189  ?  146 LYS A C   1 
ATOM   1151 O  O   . LYS A  1 146 ? 41.92044  23.48746  6.82493   1.000 46.20237  ?  146 LYS A O   1 
ATOM   1152 C  CB  . LYS A  1 146 ? 41.38314  24.32127  3.67722   1.000 43.97474  ?  146 LYS A CB  1 
ATOM   1153 C  CG  . LYS A  1 146 ? 40.36573  25.12501  4.50707   1.000 41.57265  ?  146 LYS A CG  1 
ATOM   1154 C  CD  . LYS A  1 146 ? 41.00184  26.42848  5.04460   1.000 43.21506  ?  146 LYS A CD  1 
ATOM   1155 C  CE  . LYS A  1 146 ? 39.95528  27.50590  5.36338   1.000 43.10072  ?  146 LYS A CE  1 
ATOM   1156 N  NZ  . LYS A  1 146 ? 39.10925  27.16408  6.54992   1.000 42.36189  ?  146 LYS A NZ  1 
ATOM   1157 N  N   . GLU A  1 147 ? 41.43037  21.75375  5.48023   1.000 39.98085  ?  147 GLU A N   1 
ATOM   1158 C  CA  . GLU A  1 147 ? 40.81285  21.00302  6.56286   1.000 39.24010  ?  147 GLU A CA  1 
ATOM   1159 C  C   . GLU A  1 147 ? 41.83474  20.60255  7.62488   1.000 43.38814  ?  147 GLU A C   1 
ATOM   1160 O  O   . GLU A  1 147 ? 41.56100  20.69579  8.83208   1.000 39.68202  ?  147 GLU A O   1 
ATOM   1161 C  CB  . GLU A  1 147 ? 40.10441  19.78032  5.96878   1.000 38.20739  ?  147 GLU A CB  1 
ATOM   1162 C  CG  . GLU A  1 147 ? 39.82463  18.66403  6.92683   1.000 50.52748  ?  147 GLU A CG  1 
ATOM   1163 C  CD  . GLU A  1 147 ? 39.09585  17.49873  6.24814   1.000 54.76630  ?  147 GLU A CD  1 
ATOM   1164 O  OE1 . GLU A  1 147 ? 37.94218  17.68501  5.79486   1.000 54.46231  ?  147 GLU A OE1 1 
ATOM   1165 O  OE2 . GLU A  1 147 ? 39.68577  16.40462  6.14950   1.000 56.99662  -1 147 GLU A OE2 1 
ATOM   1166 N  N   . LEU A  1 148 ? 43.01295  20.13618  7.19436   1.000 40.14932  ?  148 LEU A N   1 
ATOM   1167 C  CA  . LEU A  1 148 ? 44.06438  19.79915  8.14281   1.000 43.89591  ?  148 LEU A CA  1 
ATOM   1168 C  C   . LEU A  1 148 ? 44.47428  21.02315  8.95105   1.000 47.40706  ?  148 LEU A C   1 
ATOM   1169 O  O   . LEU A  1 148 ? 44.72262  20.91989  10.16019  1.000 42.08994  ?  148 LEU A O   1 
ATOM   1170 C  CB  . LEU A  1 148 ? 45.27161  19.20546  7.41036   1.000 46.48171  ?  148 LEU A CB  1 
ATOM   1171 C  CG  . LEU A  1 148 ? 45.06701  17.84788  6.72117   1.000 40.44781  ?  148 LEU A CG  1 
ATOM   1172 C  CD1 . LEU A  1 148 ? 46.11718  17.55594  5.67319   1.000 41.83008  ?  148 LEU A CD1 1 
ATOM   1173 C  CD2 . LEU A  1 148 ? 45.11916  16.77374  7.71066   1.000 40.16780  ?  148 LEU A CD2 1 
ATOM   1174 N  N   . GLY A  1 149 ? 44.53273  22.19363  8.30460   1.000 42.39748  ?  149 GLY A N   1 
ATOM   1175 C  CA  . GLY A  1 149 ? 44.86614  23.40930  9.02816   1.000 43.44735  ?  149 GLY A CA  1 
ATOM   1176 C  C   . GLY A  1 149 ? 43.80445  23.80100  10.03596  1.000 45.94648  ?  149 GLY A C   1 
ATOM   1177 O  O   . GLY A  1 149 ? 44.12646  24.20356  11.15597  1.000 43.70735  ?  149 GLY A O   1 
ATOM   1178 N  N   . ASP A  1 150 ? 42.52451  23.72048  9.64135   1.000 42.08991  ?  150 ASP A N   1 
ATOM   1179 C  CA  . ASP A  1 150 ? 41.43338  23.91968  10.58927  1.000 41.64355  ?  150 ASP A CA  1 
ATOM   1180 C  C   . ASP A  1 150 ? 41.60735  23.01361  11.81153  1.000 41.39782  ?  150 ASP A C   1 
ATOM   1181 O  O   . ASP A  1 150 ? 41.48965  23.45572  12.96023  1.000 41.79920  ?  150 ASP A O   1 
ATOM   1182 C  CB  . ASP A  1 150 ? 40.07819  23.63897  9.90654   1.000 40.59464  ?  150 ASP A CB  1 
ATOM   1183 C  CG  . ASP A  1 150 ? 39.74371  24.61911  8.77286   1.000 40.93425  ?  150 ASP A CG  1 
ATOM   1184 O  OD1 . ASP A  1 150 ? 40.30488  25.74715  8.71494   1.000 50.80266  ?  150 ASP A OD1 1 
ATOM   1185 O  OD2 . ASP A  1 150 ? 38.90842  24.25500  7.92327   1.000 41.59815  -1 150 ASP A OD2 1 
ATOM   1186 N  N   . HIS A  1 151 ? 41.87387  21.72854  11.57234  1.000 40.81035  ?  151 HIS A N   1 
ATOM   1187 C  CA  . HIS A  1 151 ? 42.06646  20.77451  12.66668  1.000 43.66723  ?  151 HIS A CA  1 
ATOM   1188 C  C   . HIS A  1 151 ? 43.24056  21.18076  13.56444  1.000 44.71436  ?  151 HIS A C   1 
ATOM   1189 O  O   . HIS A  1 151 ? 43.12232  21.19435  14.79442  1.000 47.81859  ?  151 HIS A O   1 
ATOM   1190 C  CB  . HIS A  1 151 ? 42.29014  19.36374  12.10189  1.000 40.03548  ?  151 HIS A CB  1 
ATOM   1191 C  CG  . HIS A  1 151 ? 41.08653  18.75444  11.45739  1.000 48.14983  ?  151 HIS A CG  1 
ATOM   1192 N  ND1 . HIS A  1 151 ? 39.83697  19.34797  11.48990  1.000 40.48276  ?  151 HIS A ND1 1 
ATOM   1193 C  CD2 . HIS A  1 151 ? 40.93069  17.58120  10.78388  1.000 41.35200  ?  151 HIS A CD2 1 
ATOM   1194 C  CE1 . HIS A  1 151 ? 38.96950  18.57060  10.85857  1.000 37.54051  ?  151 HIS A CE1 1 
ATOM   1195 N  NE2 . HIS A  1 151 ? 39.60761  17.50310  10.40998  1.000 40.22525  ?  151 HIS A NE2 1 
ATOM   1196 N  N   . VAL A  1 152 ? 44.39391  21.46880  12.96187  1.000 42.69589  ?  152 VAL A N   1 
ATOM   1197 C  CA  . VAL A  1 152 ? 45.56532  21.92586  13.71517  1.000 49.16456  ?  152 VAL A CA  1 
ATOM   1198 C  C   . VAL A  1 152 ? 45.21382  23.12924  14.58783  1.000 51.28619  ?  152 VAL A C   1 
ATOM   1199 O  O   . VAL A  1 152 ? 45.53238  23.18131  15.78740  1.000 45.27617  ?  152 VAL A O   1 
ATOM   1200 C  CB  . VAL A  1 152 ? 46.70946  22.25716  12.73960  1.000 45.50211  ?  152 VAL A CB  1 
ATOM   1201 C  CG1 . VAL A  1 152 ? 47.77505  23.10402  13.41183  1.000 48.11528  ?  152 VAL A CG1 1 
ATOM   1202 C  CG2 . VAL A  1 152 ? 47.31843  20.95282  12.16547  1.000 44.56559  ?  152 VAL A CG2 1 
ATOM   1203 N  N   . THR A  1 153 ? 44.54385  24.11312  13.99062  1.000 46.58742  ?  153 THR A N   1 
ATOM   1204 C  CA  . THR A  1 153 ? 44.20406  25.33465  14.70693  1.000 45.29794  ?  153 THR A CA  1 
ATOM   1205 C  C   . THR A  1 153 ? 43.30024  25.03052  15.89690  1.000 51.42981  ?  153 THR A C   1 
ATOM   1206 O  O   . THR A  1 153 ? 43.57109  25.46757  17.02187  1.000 54.40678  ?  153 THR A O   1 
ATOM   1207 C  CB  . THR A  1 153 ? 43.53899  26.31636  13.74255  1.000 45.73758  ?  153 THR A CB  1 
ATOM   1208 O  OG1 . THR A  1 153 ? 44.49804  26.74951  12.76668  1.000 50.83111  ?  153 THR A OG1 1 
ATOM   1209 C  CG2 . THR A  1 153 ? 42.99528  27.51732  14.48767  1.000 45.81784  ?  153 THR A CG2 1 
ATOM   1210 N  N   . ASN A  1 154 ? 42.23489  24.24524  15.67256  1.000 47.91929  ?  154 ASN A N   1 
ATOM   1211 C  CA  . ASN A  1 154 ? 41.34757  23.88524  16.76997  1.000 42.92617  ?  154 ASN A CA  1 
ATOM   1212 C  C   . ASN A  1 154 ? 42.08279  23.11745  17.86273  1.000 50.36572  ?  154 ASN A C   1 
ATOM   1213 O  O   . ASN A  1 154 ? 41.87785  23.37972  19.05365  1.000 50.67203  ?  154 ASN A O   1 
ATOM   1214 C  CB  . ASN A  1 154 ? 40.16035  23.07172  16.24748  1.000 41.57109  ?  154 ASN A CB  1 
ATOM   1215 C  CG  . ASN A  1 154 ? 39.08401  23.95411  15.66596  1.000 41.36240  ?  154 ASN A CG  1 
ATOM   1216 O  OD1 . ASN A  1 154 ? 38.37781  24.63945  16.39646  1.000 43.51681  ?  154 ASN A OD1 1 
ATOM   1217 N  ND2 . ASN A  1 154 ? 38.97788  23.97707  14.34191  1.000 52.07282  ?  154 ASN A ND2 1 
ATOM   1218 N  N   . LEU A  1 155 ? 42.93809  22.16183  17.48501  1.000 43.31320  ?  155 LEU A N   1 
ATOM   1219 C  CA  . LEU A  1 155 ? 43.62066  21.37730  18.50351  1.000 43.80156  ?  155 LEU A CA  1 
ATOM   1220 C  C   . LEU A  1 155 ? 44.50694  22.25292  19.36653  1.000 45.25188  ?  155 LEU A C   1 
ATOM   1221 O  O   . LEU A  1 155 ? 44.55157  22.08291  20.59175  1.000 45.72660  ?  155 LEU A O   1 
ATOM   1222 C  CB  . LEU A  1 155 ? 44.42141  20.24861  17.86331  1.000 55.72335  ?  155 LEU A CB  1 
ATOM   1223 C  CG  . LEU A  1 155 ? 43.52972  19.03336  17.55648  1.000 51.67505  ?  155 LEU A CG  1 
ATOM   1224 C  CD1 . LEU A  1 155 ? 44.20538  18.09988  16.57865  1.000 42.15598  ?  155 LEU A CD1 1 
ATOM   1225 C  CD2 . LEU A  1 155 ? 43.17065  18.29229  18.82859  1.000 46.37502  ?  155 LEU A CD2 1 
ATOM   1226 N  N   . ARG A  1 156 ? 45.19908  23.22276  18.77365  1.000 46.07637  ?  156 ARG A N   1 
ATOM   1227 C  CA  . ARG A  1 156 ? 46.08018  24.00759  19.62629  1.000 51.27949  ?  156 ARG A CA  1 
ATOM   1228 C  C   . ARG A  1 156 ? 45.29676  25.05088  20.42012  1.000 52.36563  ?  156 ARG A C   1 
ATOM   1229 O  O   . ARG A  1 156 ? 45.59555  25.28325  21.58563  1.000 62.22655  ?  156 ARG A O   1 
ATOM   1230 C  CB  . ARG A  1 156 ? 47.23922  24.62683  18.84291  1.000 49.88922  ?  156 ARG A CB  1 
ATOM   1231 C  CG  . ARG A  1 156 ? 46.87631  25.23490  17.53256  1.000 64.30362  ?  156 ARG A CG  1 
ATOM   1232 C  CD  . ARG A  1 156 ? 48.13188  25.74251  16.81805  1.000 70.48253  ?  156 ARG A CD  1 
ATOM   1233 N  NE  . ARG A  1 156 ? 49.25131  24.81611  16.91977  1.000 69.42303  ?  156 ARG A NE  1 
ATOM   1234 C  CZ  . ARG A  1 156 ? 50.13160  24.61206  15.94530  1.000 75.15066  ?  156 ARG A CZ  1 
ATOM   1235 N  NH1 . ARG A  1 156 ? 50.01480  25.27202  14.79547  1.000 83.34580  ?  156 ARG A NH1 1 
ATOM   1236 N  NH2 . ARG A  1 156 ? 51.13138  23.75652  16.12059  1.000 63.26239  ?  156 ARG A NH2 1 
ATOM   1237 N  N   . CYS A  1 157 ? 44.24203  25.63990  19.84007  1.000 50.08639  ?  157 CYS A N   1 
ATOM   1238 C  CA  . CYS A  1 157 ? 43.38940  26.53057  20.63496  1.000 47.37079  ?  157 CYS A CA  1 
ATOM   1239 C  C   . CYS A  1 157 ? 42.78573  25.80872  21.82701  1.000 48.57210  ?  157 CYS A C   1 
ATOM   1240 O  O   . CYS A  1 157 ? 42.67849  26.39864  22.90295  1.000 50.81419  ?  157 CYS A O   1 
ATOM   1241 C  CB  . CYS A  1 157 ? 42.25937  27.15730  19.79543  1.000 56.40263  ?  157 CYS A CB  1 
ATOM   1242 S  SG  . CYS A  1 157 ? 42.75852  28.49337  18.72249  1.000 74.05402  ?  157 CYS A SG  1 
ATOM   1243 N  N   . MET A  1 158 ? 42.39386  24.53853  21.66567  1.000 45.85033  ?  158 MET A N   1 
ATOM   1244 C  CA  . MET A  1 158 ? 41.85538  23.74175  22.76957  1.000 45.53222  ?  158 MET A CA  1 
ATOM   1245 C  C   . MET A  1 158 ? 42.89908  23.37909  23.82969  1.000 60.35572  ?  158 MET A C   1 
ATOM   1246 O  O   . MET A  1 158 ? 42.52000  22.87385  24.89501  1.000 62.13324  ?  158 MET A O   1 
ATOM   1247 C  CB  . MET A  1 158 ? 41.23390  22.45475  22.23343  1.000 52.89893  ?  158 MET A CB  1 
ATOM   1248 C  CG  . MET A  1 158 ? 39.95510  22.64632  21.43318  1.000 53.32805  ?  158 MET A CG  1 
ATOM   1249 S  SD  . MET A  1 158 ? 39.50878  21.15226  20.53575  1.000 51.25147  ?  158 MET A SD  1 
ATOM   1250 C  CE  . MET A  1 158 ? 38.56896  20.21201  21.73884  1.000 53.83487  ?  158 MET A CE  1 
ATOM   1251 N  N   . GLY A  1 159 ? 44.18486  23.60694  23.57589  1.000 54.58707  ?  159 GLY A N   1 
ATOM   1252 C  CA  . GLY A  1 159 ? 45.21466  23.29719  24.54246  1.000 57.68463  ?  159 GLY A CA  1 
ATOM   1253 C  C   . GLY A  1 159 ? 45.89698  21.95513  24.36037  1.000 63.67931  ?  159 GLY A C   1 
ATOM   1254 O  O   . GLY A  1 159 ? 46.45584  21.43118  25.32927  1.000 60.08635  ?  159 GLY A O   1 
ATOM   1255 N  N   . ALA A  1 160 ? 45.84703  21.37715  23.16392  1.000 55.51737  ?  160 ALA A N   1 
ATOM   1256 C  CA  . ALA A  1 160 ? 46.61531  20.20016  22.81862  1.000 56.53518  ?  160 ALA A CA  1 
ATOM   1257 C  C   . ALA A  1 160 ? 48.08461  20.57651  22.59690  1.000 66.60759  ?  160 ALA A C   1 
ATOM   1258 O  O   . ALA A  1 160 ? 48.39334  21.71190  22.21247  1.000 66.71830  ?  160 ALA A O   1 
ATOM   1259 C  CB  . ALA A  1 160 ? 46.03912  19.55299  21.56197  1.000 56.18382  ?  160 ALA A CB  1 
ATOM   1260 N  N   . PRO A  1 161 ? 49.02087  19.63523  22.83892  1.000 76.02060  ?  161 PRO A N   1 
ATOM   1261 C  CA  . PRO A  1 161 ? 48.74843  18.25034  23.25840  1.000 75.89380  ?  161 PRO A CA  1 
ATOM   1262 C  C   . PRO A  1 161 ? 48.73780  18.08101  24.78280  1.000 77.41792  ?  161 PRO A C   1 
ATOM   1263 O  O   . PRO A  1 161 ? 48.37121  17.00117  25.27319  1.000 75.81060  ?  161 PRO A O   1 
ATOM   1264 C  CB  . PRO A  1 161 ? 49.90555  17.47833  22.62569  1.000 63.84951  ?  161 PRO A CB  1 
ATOM   1265 C  CG  . PRO A  1 161 ? 51.06653  18.46822  22.70996  1.000 67.59265  ?  161 PRO A CG  1 
ATOM   1266 C  CD  . PRO A  1 161 ? 50.46881  19.86288  22.64301  1.000 72.54173  ?  161 PRO A CD  1 
ATOM   1267 N  N   . GLU A  1 162 ? 49.11566  19.15232  25.49601  1.000 66.53485  ?  162 GLU A N   1 
ATOM   1268 C  CA  . GLU A  1 162 ? 49.24463  19.11058  26.95072  1.000 69.35956  ?  162 GLU A CA  1 
ATOM   1269 C  C   . GLU A  1 162 ? 47.96747  18.61948  27.62238  1.000 69.08381  ?  162 GLU A C   1 
ATOM   1270 O  O   . GLU A  1 162 ? 48.00073  17.72398  28.47511  1.000 74.60462  ?  162 GLU A O   1 
ATOM   1271 C  CB  . GLU A  1 162 ? 49.62591  20.49951  27.46990  1.000 75.83564  ?  162 GLU A CB  1 
ATOM   1272 C  CG  . GLU A  1 162 ? 49.13631  20.78318  28.88237  1.000 73.42522  ?  162 GLU A CG  1 
ATOM   1273 N  N   . SER A  1 163 ? 46.83265  19.20499  27.25597  1.000 66.16821  ?  163 SER A N   1 
ATOM   1274 C  CA  . SER A  1 163 ? 45.52823  18.78190  27.74819  1.000 66.69389  ?  163 SER A CA  1 
ATOM   1275 C  C   . SER A  1 163 ? 45.07451  17.57333  26.93177  1.000 66.30514  ?  163 SER A C   1 
ATOM   1276 O  O   . SER A  1 163 ? 44.74975  17.70356  25.74443  1.000 66.93283  ?  163 SER A O   1 
ATOM   1277 C  CB  . SER A  1 163 ? 44.53651  19.94058  27.64180  1.000 66.38851  ?  163 SER A CB  1 
ATOM   1278 O  OG  . SER A  1 163 ? 43.24814  19.60907  28.11900  1.000 65.63450  ?  163 SER A OG  1 
ATOM   1279 N  N   . GLY A  1 164 ? 45.06468  16.39375  27.55866  1.000 64.28125  ?  164 GLY A N   1 
ATOM   1280 C  CA  . GLY A  1 164 ? 44.51770  15.21833  26.89143  1.000 60.87326  ?  164 GLY A CA  1 
ATOM   1281 C  C   . GLY A  1 164 ? 43.00456  15.24269  26.82983  1.000 54.80414  ?  164 GLY A C   1 
ATOM   1282 O  O   . GLY A  1 164 ? 42.39245  14.56196  25.99034  1.000 52.98639  ?  164 GLY A O   1 
ATOM   1283 N  N   . LEU A  1 165 ? 42.38353  16.03954  27.70347  1.000 58.36167  ?  165 LEU A N   1 
ATOM   1284 C  CA  . LEU A  1 165 ? 40.95764  16.30448  27.58370  1.000 58.54248  ?  165 LEU A CA  1 
ATOM   1285 C  C   . LEU A  1 165 ? 40.63688  16.95656  26.24820  1.000 55.09836  ?  165 LEU A C   1 
ATOM   1286 O  O   . LEU A  1 165 ? 39.62989  16.62402  25.60915  1.000 47.95010  ?  165 LEU A O   1 
ATOM   1287 C  CB  . LEU A  1 165 ? 40.48434  17.18315  28.73922  1.000 51.72846  ?  165 LEU A CB  1 
ATOM   1288 C  CG  . LEU A  1 165 ? 38.97304  17.41382  28.72588  1.000 57.18612  ?  165 LEU A CG  1 
ATOM   1289 C  CD1 . LEU A  1 165 ? 38.41654  17.25496  30.11479  1.000 68.14345  ?  165 LEU A CD1 1 
ATOM   1290 C  CD2 . LEU A  1 165 ? 38.66559  18.79410  28.23190  1.000 51.12136  ?  165 LEU A CD2 1 
ATOM   1291 N  N   . ALA A  1 166 ? 41.48705  17.88133  25.80511  1.000 52.35482  ?  166 ALA A N   1 
ATOM   1292 C  CA  . ALA A  1 166 ? 41.25355  18.53851  24.52352  1.000 48.58769  ?  166 ALA A CA  1 
ATOM   1293 C  C   . ALA A  1 166 ? 41.17653  17.52177  23.39307  1.000 47.31408  ?  166 ALA A C   1 
ATOM   1294 O  O   . ALA A  1 166 ? 40.19698  17.49431  22.64381  1.000 50.96768  ?  166 ALA A O   1 
ATOM   1295 C  CB  . ALA A  1 166 ? 42.35263  19.56980  24.25063  1.000 48.66637  ?  166 ALA A CB  1 
ATOM   1296 N  N   . GLU A  1 167 ? 42.20759  16.67798  23.25224  1.000 48.27158  ?  167 GLU A N   1 
ATOM   1297 C  CA  . GLU A  1 167 ? 42.24052  15.73802  22.13551  1.000 45.37915  ?  167 GLU A CA  1 
ATOM   1298 C  C   . GLU A  1 167 ? 41.09036  14.75131  22.22791  1.000 50.70928  ?  167 GLU A C   1 
ATOM   1299 O  O   . GLU A  1 167 ? 40.49705  14.38588  21.20157  1.000 47.47912  ?  167 GLU A O   1 
ATOM   1300 C  CB  . GLU A  1 167 ? 43.57856  14.99450  22.08780  1.000 47.92915  ?  167 GLU A CB  1 
ATOM   1301 C  CG  . GLU A  1 167 ? 44.79647  15.91128  22.09291  1.000 54.97282  ?  167 GLU A CG  1 
ATOM   1302 C  CD  . GLU A  1 167 ? 46.00628  15.33737  21.35702  1.000 68.97051  ?  167 GLU A CD  1 
ATOM   1303 O  OE1 . GLU A  1 167 ? 46.67095  16.13018  20.64702  1.000 68.58385  ?  167 GLU A OE1 1 
ATOM   1304 O  OE2 . GLU A  1 167 ? 46.30443  14.11632  21.49604  1.000 69.12423  -1 167 GLU A OE2 1 
ATOM   1305 N  N   . TYR A  1 168 ? 40.76176  14.30612  23.44797  1.000 49.30446  ?  168 TYR A N   1 
ATOM   1306 C  CA  . TYR A  1 168 ? 39.57592  13.47337  23.61245  1.000 47.52351  ?  168 TYR A CA  1 
ATOM   1307 C  C   . TYR A  1 168 ? 38.33338  14.16668  23.03299  1.000 43.40006  ?  168 TYR A C   1 
ATOM   1308 O  O   . TYR A  1 168 ? 37.63513  13.60819  22.17365  1.000 49.07085  ?  168 TYR A O   1 
ATOM   1309 C  CB  . TYR A  1 168 ? 39.39918  13.12869  25.09531  1.000 44.60176  ?  168 TYR A CB  1 
ATOM   1310 C  CG  . TYR A  1 168 ? 38.13113  12.35377  25.39693  1.000 52.49451  ?  168 TYR A CG  1 
ATOM   1311 C  CD1 . TYR A  1 168 ? 36.91169  13.00683  25.51618  1.000 47.70577  ?  168 TYR A CD1 1 
ATOM   1312 C  CD2 . TYR A  1 168 ? 38.15685  10.96847  25.57830  1.000 57.39553  ?  168 TYR A CD2 1 
ATOM   1313 C  CE1 . TYR A  1 168 ? 35.75437  12.31715  25.78736  1.000 45.29005  ?  168 TYR A CE1 1 
ATOM   1314 C  CE2 . TYR A  1 168 ? 37.00222  10.27070  25.85608  1.000 53.60480  ?  168 TYR A CE2 1 
ATOM   1315 C  CZ  . TYR A  1 168 ? 35.79917  10.95138  25.96066  1.000 49.97511  ?  168 TYR A CZ  1 
ATOM   1316 O  OH  . TYR A  1 168 ? 34.62695  10.26411  26.23511  1.000 43.29472  ?  168 TYR A OH  1 
ATOM   1317 N  N   . LEU A  1 169 ? 38.06900  15.41179  23.46302  1.000 53.55527  ?  169 LEU A N   1 
ATOM   1318 C  CA  . LEU A  1 169 ? 36.83838  16.10405  23.06402  1.000 44.39144  ?  169 LEU A CA  1 
ATOM   1319 C  C   . LEU A  1 169 ? 36.82123  16.39819  21.56699  1.000 44.52084  ?  169 LEU A C   1 
ATOM   1320 O  O   . LEU A  1 169 ? 35.77239  16.30803  20.92261  1.000 40.05267  ?  169 LEU A O   1 
ATOM   1321 C  CB  . LEU A  1 169 ? 36.67266  17.38789  23.88308  1.000 41.65391  ?  169 LEU A CB  1 
ATOM   1322 C  CG  . LEU A  1 169 ? 36.17898  17.21119  25.33035  1.000 45.80249  ?  169 LEU A CG  1 
ATOM   1323 C  CD1 . LEU A  1 169 ? 36.03685  18.53241  26.06772  1.000 41.46632  ?  169 LEU A CD1 1 
ATOM   1324 C  CD2 . LEU A  1 169 ? 34.84731  16.44090  25.36235  1.000 40.28447  ?  169 LEU A CD2 1 
ATOM   1325 N  N   . PHE A  1 170 ? 37.98405  16.71614  20.99298  1.000 54.62999  ?  170 PHE A N   1 
ATOM   1326 C  CA  . PHE A  1 170 ? 38.08494  16.93055  19.55109  1.000 42.78350  ?  170 PHE A CA  1 
ATOM   1327 C  C   . PHE A  1 170 ? 37.77138  15.65134  18.78764  1.000 43.05418  ?  170 PHE A C   1 
ATOM   1328 O  O   . PHE A  1 170 ? 37.18573  15.69290  17.69705  1.000 36.89462  ?  170 PHE A O   1 
ATOM   1329 C  CB  . PHE A  1 170 ? 39.49243  17.42995  19.20203  1.000 39.21895  ?  170 PHE A CB  1 
ATOM   1330 C  CG  . PHE A  1 170 ? 39.68130  17.74373  17.74913  1.000 42.38342  ?  170 PHE A CG  1 
ATOM   1331 C  CD1 . PHE A  1 170 ? 39.39780  19.01844  17.26379  1.000 38.61935  ?  170 PHE A CD1 1 
ATOM   1332 C  CD2 . PHE A  1 170 ? 40.14153  16.76982  16.86348  1.000 38.54404  ?  170 PHE A CD2 1 
ATOM   1333 C  CE1 . PHE A  1 170 ? 39.57063  19.32663  15.92597  1.000 38.37039  ?  170 PHE A CE1 1 
ATOM   1334 C  CE2 . PHE A  1 170 ? 40.30782  17.06125  15.51486  1.000 38.17597  ?  170 PHE A CE2 1 
ATOM   1335 C  CZ  . PHE A  1 170 ? 40.02885  18.34002  15.04682  1.000 44.29790  ?  170 PHE A CZ  1 
ATOM   1336 N  N   . ASP A  1 171 ? 38.20283  14.50584  19.32864  1.000 38.02352  ?  171 ASP A N   1 
ATOM   1337 C  CA  . ASP A  1 171 ? 37.90033  13.22261  18.70771  1.000 37.86309  ?  171 ASP A CA  1 
ATOM   1338 C  C   . ASP A  1 171 ? 36.39439  12.95297  18.72120  1.000 41.65191  ?  171 ASP A C   1 
ATOM   1339 O  O   . ASP A  1 171 ? 35.83842  12.41283  17.75568  1.000 37.21557  ?  171 ASP A O   1 
ATOM   1340 C  CB  . ASP A  1 171 ? 38.69790  12.13281  19.44143  1.000 39.95626  ?  171 ASP A CB  1 
ATOM   1341 C  CG  . ASP A  1 171 ? 38.26710  10.72960  19.10437  1.000 43.09134  ?  171 ASP A CG  1 
ATOM   1342 O  OD1 . ASP A  1 171 ? 37.20501  10.32659  19.61262  1.000 45.39197  ?  171 ASP A OD1 1 
ATOM   1343 O  OD2 . ASP A  1 171 ? 39.01773  10.00918  18.39493  1.000 44.00529  -1 171 ASP A OD2 1 
ATOM   1344 N  N   . LYS A  1 172 ? 35.71579  13.33031  19.80585  1.000 39.54516  ?  172 LYS A N   1 
ATOM   1345 C  CA  . LYS A  1 172 ? 34.26672  13.11107  19.84406  1.000 39.28921  ?  172 LYS A CA  1 
ATOM   1346 C  C   . LYS A  1 172 ? 33.51626  14.10023  18.94932  1.000 40.62981  ?  172 LYS A C   1 
ATOM   1347 O  O   . LYS A  1 172 ? 32.63157  13.69691  18.18969  1.000 38.73912  ?  172 LYS A O   1 
ATOM   1348 C  CB  . LYS A  1 172 ? 33.74045  13.17990  21.27942  1.000 39.07238  ?  172 LYS A CB  1 
ATOM   1349 C  CG  . LYS A  1 172 ? 34.42800  12.19573  22.24209  1.000 51.47925  ?  172 LYS A CG  1 
ATOM   1350 C  CD  . LYS A  1 172 ? 34.20332  10.70164  21.88823  1.000 45.36852  ?  172 LYS A CD  1 
ATOM   1351 C  CE  . LYS A  1 172 ? 35.27443  9.83258   22.57957  1.000 48.79300  ?  172 LYS A CE  1 
ATOM   1352 N  NZ  . LYS A  1 172 ? 36.67358  10.42175  22.42732  1.000 43.45542  ?  172 LYS A NZ  1 
ATOM   1353 N  N   . HIS A  1 173 ? 33.87718  15.38800  18.98512  1.000 41.48828  ?  173 HIS A N   1 
ATOM   1354 C  CA  . HIS A  1 173 ? 33.05681  16.41288  18.33857  1.000 44.45215  ?  173 HIS A CA  1 
ATOM   1355 C  C   . HIS A  1 173 ? 33.42059  16.67800  16.88152  1.000 43.82504  ?  173 HIS A C   1 
ATOM   1356 O  O   . HIS A  1 173 ? 32.53151  16.81198  16.04060  1.000 67.59246  ?  173 HIS A O   1 
ATOM   1357 C  CB  . HIS A  1 173 ? 33.11983  17.72378  19.11707  1.000 44.43433  ?  173 HIS A CB  1 
ATOM   1358 C  CG  . HIS A  1 173 ? 32.37983  17.68262  20.41347  1.000 43.74339  ?  173 HIS A CG  1 
ATOM   1359 N  ND1 . HIS A  1 173 ? 31.01015  17.56912  20.48388  1.000 43.47860  ?  173 HIS A ND1 1 
ATOM   1360 C  CD2 . HIS A  1 173 ? 32.82396  17.69897  21.69329  1.000 47.74444  ?  173 HIS A CD2 1 
ATOM   1361 C  CE1 . HIS A  1 173 ? 30.63623  17.53270  21.75121  1.000 47.13757  ?  173 HIS A CE1 1 
ATOM   1362 N  NE2 . HIS A  1 173 ? 31.71796  17.62005  22.50587  1.000 52.11329  ?  173 HIS A NE2 1 
ATOM   1363 N  N   . THR A  1 174 ? 34.69345  16.77835  16.54981  1.000 40.82836  ?  174 THR A N   1 
ATOM   1364 C  CA  . THR A  1 174 ? 34.98755  17.11109  15.16407  1.000 36.44498  ?  174 THR A CA  1 
ATOM   1365 C  C   . THR A  1 174 ? 35.15495  15.85964  14.31425  1.000 40.98225  ?  174 THR A C   1 
ATOM   1366 O  O   . THR A  1 174 ? 34.50986  15.71444  13.27484  1.000 41.19810  ?  174 THR A O   1 
ATOM   1367 C  CB  . THR A  1 174 ? 36.24292  17.97753  15.09604  1.000 40.75656  ?  174 THR A CB  1 
ATOM   1368 O  OG1 . THR A  1 174 ? 35.99256  19.22269  15.76083  1.000 45.98620  ?  174 THR A OG1 1 
ATOM   1369 C  CG2 . THR A  1 174 ? 36.63321  18.24269  13.65081  1.000 35.80925  ?  174 THR A CG2 1 
ATOM   1370 N  N   . LEU A  1 175 ? 36.01372  14.94209  14.74051  1.000 51.11414  ?  175 LEU A N   1 
ATOM   1371 C  CA  . LEU A  1 175 ? 36.17846  13.70564  13.99511  1.000 48.60506  ?  175 LEU A CA  1 
ATOM   1372 C  C   . LEU A  1 175 ? 35.04638  12.72244  14.24954  1.000 40.35407  ?  175 LEU A C   1 
ATOM   1373 O  O   . LEU A  1 175 ? 34.92633  11.74596  13.51152  1.000 42.13130  ?  175 LEU A O   1 
ATOM   1374 C  CB  . LEU A  1 175 ? 37.53196  13.08046  14.32870  1.000 36.39806  ?  175 LEU A CB  1 
ATOM   1375 C  CG  . LEU A  1 175 ? 38.66613  14.09493  14.15485  1.000 47.81655  ?  175 LEU A CG  1 
ATOM   1376 C  CD1 . LEU A  1 175 ? 40.01144  13.54331  14.64733  1.000 38.62072  ?  175 LEU A CD1 1 
ATOM   1377 C  CD2 . LEU A  1 175 ? 38.76334  14.56030  12.69974  1.000 45.20345  ?  175 LEU A CD2 1 
ATOM   1378 N  N   . GLY A  1 176 ? 34.20429  12.97141  15.24594  1.000 45.06326  ?  176 GLY A N   1 
ATOM   1379 C  CA  . GLY A  1 176 ? 33.12565  12.05749  15.58806  1.000 51.08381  ?  176 GLY A CA  1 
ATOM   1380 C  C   . GLY A  1 176 ? 31.84043  12.27050  14.81612  1.000 54.56428  ?  176 GLY A C   1 
ATOM   1381 O  O   . GLY A  1 176 ? 31.13755  11.31185  14.51644  1.000 59.72874  ?  176 GLY A O   1 
ATOM   1382 N  N   . THR B  1 5   ? 4.61810   61.66738  -6.64146  1.000 84.62955  ?  5   THR B N   1 
ATOM   1383 C  CA  . THR B  1 5   ? 3.47302   61.70530  -7.53831  1.000 80.40185  ?  5   THR B CA  1 
ATOM   1384 C  C   . THR B  1 5   ? 2.82807   60.32305  -7.67478  1.000 73.71905  ?  5   THR B C   1 
ATOM   1385 O  O   . THR B  1 5   ? 2.25648   60.00930  -8.71935  1.000 78.39001  ?  5   THR B O   1 
ATOM   1386 C  CB  . THR B  1 5   ? 3.86888   62.19775  -8.94350  1.000 82.21883  ?  5   THR B CB  1 
ATOM   1387 O  OG1 . THR B  1 5   ? 4.28516   61.07705  -9.73027  1.000 90.49707  ?  5   THR B OG1 1 
ATOM   1388 C  CG2 . THR B  1 5   ? 5.01893   63.18654  -8.86048  1.000 79.85789  ?  5   THR B CG2 1 
ATOM   1389 N  N   . SER B  1 6   ? 2.92515   59.48425  -6.64482  1.000 61.51791  ?  6   SER B N   1 
ATOM   1390 C  CA  . SER B  1 6   ? 2.46587   58.10847  -6.77866  1.000 57.98043  ?  6   SER B CA  1 
ATOM   1391 C  C   . SER B  1 6   ? 0.94812   57.99481  -6.65432  1.000 56.66873  ?  6   SER B C   1 
ATOM   1392 O  O   . SER B  1 6   ? 0.34475   58.53108  -5.72004  1.000 53.05407  ?  6   SER B O   1 
ATOM   1393 C  CB  . SER B  1 6   ? 3.12678   57.20026  -5.74666  1.000 52.69301  ?  6   SER B CB  1 
ATOM   1394 O  OG  . SER B  1 6   ? 2.61001   55.88492  -5.93249  1.000 49.85666  ?  6   SER B OG  1 
ATOM   1395 N  N   . GLN B  1 7   ? 0.34103   57.28334  -7.61811  1.000 52.40038  ?  7   GLN B N   1 
ATOM   1396 C  CA  . GLN B  1 7   ? -1.09418  57.00016  -7.60530  1.000 52.69955  ?  7   GLN B CA  1 
ATOM   1397 C  C   . GLN B  1 7   ? -1.52842  56.20574  -6.37646  1.000 60.22912  ?  7   GLN B C   1 
ATOM   1398 O  O   . GLN B  1 7   ? -2.70369  56.26230  -6.01001  1.000 52.27431  ?  7   GLN B O   1 
ATOM   1399 C  CB  . GLN B  1 7   ? -1.49353  56.21662  -8.86166  1.000 52.54214  ?  7   GLN B CB  1 
ATOM   1400 C  CG  . GLN B  1 7   ? -0.82950  54.83366  -8.96113  1.000 51.06208  ?  7   GLN B CG  1 
ATOM   1401 C  CD  . GLN B  1 7   ? -1.13297  54.09381  -10.26516 1.000 50.99257  ?  7   GLN B CD  1 
ATOM   1402 O  OE1 . GLN B  1 7   ? -2.09586  54.39524  -10.94307 1.000 51.92160  ?  7   GLN B OE1 1 
ATOM   1403 N  NE2 . GLN B  1 7   ? -0.28184  53.12924  -10.62109 1.000 49.93999  ?  7   GLN B NE2 1 
ATOM   1404 N  N   . VAL B  1 8   ? -0.61876  55.45282  -5.74136  1.000 50.59085  ?  8   VAL B N   1 
ATOM   1405 C  CA  . VAL B  1 8   ? -0.95855  54.69185  -4.54102  1.000 51.96457  ?  8   VAL B CA  1 
ATOM   1406 C  C   . VAL B  1 8   ? -0.65057  55.42990  -3.24680  1.000 50.03632  ?  8   VAL B C   1 
ATOM   1407 O  O   . VAL B  1 8   ? -1.02644  54.93898  -2.17000  1.000 56.10713  ?  8   VAL B O   1 
ATOM   1408 C  CB  . VAL B  1 8   ? -0.23330  53.32740  -4.49050  1.000 50.62669  ?  8   VAL B CB  1 
ATOM   1409 C  CG1 . VAL B  1 8   ? -0.40973  52.53555  -5.78888  1.000 47.90890  ?  8   VAL B CG1 1 
ATOM   1410 C  CG2 . VAL B  1 8   ? 1.23399   53.52832  -4.16435  1.000 47.77592  ?  8   VAL B CG2 1 
ATOM   1411 N  N   . ARG B  1 9   ? 0.05084   56.55132  -3.30101  1.000 50.80583  ?  9   ARG B N   1 
ATOM   1412 C  CA  . ARG B  1 9   ? 0.57206   57.15561  -2.07913  1.000 51.27971  ?  9   ARG B CA  1 
ATOM   1413 C  C   . ARG B  1 9   ? -0.56136  57.77773  -1.26472  1.000 60.29615  ?  9   ARG B C   1 
ATOM   1414 O  O   . ARG B  1 9   ? -1.41502  58.49911  -1.80131  1.000 52.96832  ?  9   ARG B O   1 
ATOM   1415 C  CB  . ARG B  1 9   ? 1.63237   58.21021  -2.41838  1.000 53.17166  ?  9   ARG B CB  1 
ATOM   1416 C  CG  . ARG B  1 9   ? 2.33419   58.83134  -1.21450  1.000 56.52569  ?  9   ARG B CG  1 
ATOM   1417 C  CD  . ARG B  1 9   ? 3.46590   59.82150  -1.62336  1.000 52.48001  ?  9   ARG B CD  1 
ATOM   1418 N  NE  . ARG B  1 9   ? 4.35480   60.07946  -0.48890  1.000 52.34543  ?  9   ARG B NE  1 
ATOM   1419 C  CZ  . ARG B  1 9   ? 5.67300   60.20125  -0.56772  1.000 52.12652  ?  9   ARG B CZ  1 
ATOM   1420 N  NH1 . ARG B  1 9   ? 6.28433   60.10506  -1.73529  1.000 52.01802  ?  9   ARG B NH1 1 
ATOM   1421 N  NH2 . ARG B  1 9   ? 6.38166   60.39465  0.52888   1.000 52.05478  ?  9   ARG B NH2 1 
ATOM   1422 N  N   . GLN B  1 10  ? -0.57553  57.48774  0.03292   1.000 51.45638  ?  10  GLN B N   1 
ATOM   1423 C  CA  . GLN B  1 10  ? -1.63328  57.99886  0.89760   1.000 52.29399  ?  10  GLN B CA  1 
ATOM   1424 C  C   . GLN B  1 10  ? -1.10810  58.04115  2.31999   1.000 52.06354  ?  10  GLN B C   1 
ATOM   1425 O  O   . GLN B  1 10  ? -0.63353  57.02274  2.82674   1.000 50.86671  ?  10  GLN B O   1 
ATOM   1426 C  CB  . GLN B  1 10  ? -2.87830  57.11755  0.80105   1.000 54.19786  ?  10  GLN B CB  1 
ATOM   1427 C  CG  . GLN B  1 10  ? -4.08301  57.61223  1.57131   1.000 52.96583  ?  10  GLN B CG  1 
ATOM   1428 C  CD  . GLN B  1 10  ? -5.35971  56.85764  1.18779   1.000 59.64491  ?  10  GLN B CD  1 
ATOM   1429 O  OE1 . GLN B  1 10  ? -5.32775  55.66072  0.87307   1.000 58.48984  ?  10  GLN B OE1 1 
ATOM   1430 N  NE2 . GLN B  1 10  ? -6.48439  57.56267  1.18726   1.000 54.13291  ?  10  GLN B NE2 1 
ATOM   1431 N  N   . ASN B  1 11  ? -1.20086  59.20508  2.96220   1.000 53.17944  ?  11  ASN B N   1 
ATOM   1432 C  CA  . ASN B  1 11  ? -0.75909  59.37035  4.34551   1.000 53.16593  ?  11  ASN B CA  1 
ATOM   1433 C  C   . ASN B  1 11  ? 0.68588   58.90552  4.54189   1.000 52.17630  ?  11  ASN B C   1 
ATOM   1434 O  O   . ASN B  1 11  ? 1.04610   58.36440  5.58304   1.000 51.56050  ?  11  ASN B O   1 
ATOM   1435 C  CB  . ASN B  1 11  ? -1.70809  58.65577  5.30955   1.000 52.88349  ?  11  ASN B CB  1 
ATOM   1436 C  CG  . ASN B  1 11  ? -1.45586  59.02483  6.76662   1.000 53.22785  ?  11  ASN B CG  1 
ATOM   1437 O  OD1 . ASN B  1 11  ? -1.22272  60.19476  7.09532   1.000 59.65103  ?  11  ASN B OD1 1 
ATOM   1438 N  ND2 . ASN B  1 11  ? -1.49271  58.02941  7.64706   1.000 52.35806  ?  11  ASN B ND2 1 
ATOM   1439 N  N   . TYR B  1 12  ? 1.52659   59.14640  3.54775   1.000 52.10532  ?  12  TYR B N   1 
ATOM   1440 C  CA  . TYR B  1 12  ? 2.92664   58.72873  3.58283   1.000 57.77203  ?  12  TYR B CA  1 
ATOM   1441 C  C   . TYR B  1 12  ? 3.83797   59.95255  3.51651   1.000 54.81552  ?  12  TYR B C   1 
ATOM   1442 O  O   . TYR B  1 12  ? 4.08394   60.49609  2.43556   1.000 57.79358  ?  12  TYR B O   1 
ATOM   1443 C  CB  . TYR B  1 12  ? 3.22488   57.76830  2.44567   1.000 58.13829  ?  12  TYR B CB  1 
ATOM   1444 C  CG  . TYR B  1 12  ? 4.51151   57.02578  2.63148   1.000 49.14055  ?  12  TYR B CG  1 
ATOM   1445 C  CD1 . TYR B  1 12  ? 4.79006   56.38159  3.83017   1.000 48.42845  ?  12  TYR B CD1 1 
ATOM   1446 C  CD2 . TYR B  1 12  ? 5.44352   56.96191  1.61057   1.000 48.86993  ?  12  TYR B CD2 1 
ATOM   1447 C  CE1 . TYR B  1 12  ? 5.97909   55.67143  4.00668   1.000 58.88923  ?  12  TYR B CE1 1 
ATOM   1448 C  CE2 . TYR B  1 12  ? 6.62808   56.25584  1.76901   1.000 47.89133  ?  12  TYR B CE2 1 
ATOM   1449 C  CZ  . TYR B  1 12  ? 6.89195   55.61620  2.96980   1.000 47.17364  ?  12  TYR B CZ  1 
ATOM   1450 O  OH  . TYR B  1 12  ? 8.06268   54.92626  3.13374   1.000 46.25612  ?  12  TYR B OH  1 
ATOM   1451 N  N   . HIS B  1 13  ? 4.36462   60.36172  4.66305   1.000 52.45065  ?  13  HIS B N   1 
ATOM   1452 C  CA  . HIS B  1 13  ? 5.07720   61.63044  4.74856   1.000 60.71692  ?  13  HIS B CA  1 
ATOM   1453 C  C   . HIS B  1 13  ? 6.50348   61.51982  4.19378   1.000 66.03818  ?  13  HIS B C   1 
ATOM   1454 O  O   . HIS B  1 13  ? 7.17376   60.49063  4.32948   1.000 51.89508  ?  13  HIS B O   1 
ATOM   1455 C  CB  . HIS B  1 13  ? 5.09619   62.12680  6.19470   1.000 54.12123  ?  13  HIS B CB  1 
ATOM   1456 C  CG  . HIS B  1 13  ? 5.60386   63.52912  6.33822   1.000 67.98201  ?  13  HIS B CG  1 
ATOM   1457 N  ND1 . HIS B  1 13  ? 6.94590   63.84748  6.28806   1.000 66.83889  ?  13  HIS B ND1 1 
ATOM   1458 C  CD2 . HIS B  1 13  ? 4.94339   64.70560  6.47600   1.000 56.83393  ?  13  HIS B CD2 1 
ATOM   1459 C  CE1 . HIS B  1 13  ? 7.09057   65.15510  6.41996   1.000 56.82768  ?  13  HIS B CE1 1 
ATOM   1460 N  NE2 . HIS B  1 13  ? 5.89182   65.69738  6.54017   1.000 62.27963  ?  13  HIS B NE2 1 
ATOM   1461 N  N   . GLN B  1 14  ? 6.95370   62.60644  3.55324   1.000 54.06602  ?  14  GLN B N   1 
ATOM   1462 C  CA  . GLN B  1 14  ? 8.28348   62.64281  2.93338   1.000 66.68926  ?  14  GLN B CA  1 
ATOM   1463 C  C   . GLN B  1 14  ? 9.39119   62.23037  3.91301   1.000 53.25134  ?  14  GLN B C   1 
ATOM   1464 O  O   . GLN B  1 14  ? 10.37007  61.56514  3.52363   1.000 52.42532  ?  14  GLN B O   1 
ATOM   1465 C  CB  . GLN B  1 14  ? 8.53516   64.04947  2.37031   1.000 67.35516  ?  14  GLN B CB  1 
ATOM   1466 C  CG  . GLN B  1 14  ? 9.28256   64.06860  1.04639   1.000 70.82908  ?  14  GLN B CG  1 
ATOM   1467 C  CD  . GLN B  1 14  ? 8.50857   63.41782  -0.09771  1.000 77.50695  ?  14  GLN B CD  1 
ATOM   1468 O  OE1 . GLN B  1 14  ? 9.09800   62.73655  -0.95161  1.000 85.89128  ?  14  GLN B OE1 1 
ATOM   1469 N  NE2 . GLN B  1 14  ? 7.19700   63.63824  -0.13614  1.000 72.94302  ?  14  GLN B NE2 1 
ATOM   1470 N  N   . ASP B  1 15  ? 9.24601   62.60138  5.19352   1.000 53.70730  ?  15  ASP B N   1 
ATOM   1471 C  CA  . ASP B  1 15  ? 10.19489  62.15595  6.21117   1.000 53.18593  ?  15  ASP B CA  1 
ATOM   1472 C  C   . ASP B  1 15  ? 10.13159  60.63990  6.40500   1.000 57.12127  ?  15  ASP B C   1 
ATOM   1473 O  O   . ASP B  1 15  ? 11.17040  59.99135  6.55455   1.000 50.87563  ?  15  ASP B O   1 
ATOM   1474 C  CB  . ASP B  1 15  ? 9.94198   62.87315  7.53713   1.000 54.09746  ?  15  ASP B CB  1 
ATOM   1475 C  CG  . ASP B  1 15  ? 10.15057  64.40614  7.44700   1.000 73.60679  ?  15  ASP B CG  1 
ATOM   1476 O  OD1 . ASP B  1 15  ? 10.42784  64.94465  6.34792   1.000 67.80859  ?  15  ASP B OD1 1 
ATOM   1477 O  OD2 . ASP B  1 15  ? 10.03245  65.07874  8.49522   1.000 64.91923  -1 15  ASP B OD2 1 
ATOM   1478 N  N   . SER B  1 16  ? 8.92176   60.05807  6.42731   1.000 59.34475  ?  16  SER B N   1 
ATOM   1479 C  CA  . SER B  1 16  ? 8.81161   58.59638  6.48868   1.000 51.72309  ?  16  SER B CA  1 
ATOM   1480 C  C   . SER B  1 16  ? 9.53066   57.93440  5.31880   1.000 48.94709  ?  16  SER B C   1 
ATOM   1481 O  O   . SER B  1 16  ? 10.29660  56.99274  5.52201   1.000 47.90822  ?  16  SER B O   1 
ATOM   1482 C  CB  . SER B  1 16  ? 7.34254   58.17881  6.54161   1.000 49.67149  ?  16  SER B CB  1 
ATOM   1483 O  OG  . SER B  1 16  ? 6.69207   58.86921  7.60359   1.000 50.59669  ?  16  SER B OG  1 
ATOM   1484 N  N   . GLU B  1 17  ? 9.31705   58.42710  4.09311   1.000 49.43023  ?  17  GLU B N   1 
ATOM   1485 C  CA  . GLU B  1 17  ? 10.02914  57.91011  2.91994   1.000 54.20787  ?  17  GLU B CA  1 
ATOM   1486 C  C   . GLU B  1 17  ? 11.54663  57.90997  3.13377   1.000 55.42397  ?  17  GLU B C   1 
ATOM   1487 O  O   . GLU B  1 17  ? 12.21986  56.87380  2.96233   1.000 47.50154  ?  17  GLU B O   1 
ATOM   1488 C  CB  . GLU B  1 17  ? 9.64861   58.75035  1.69266   1.000 49.72696  ?  17  GLU B CB  1 
ATOM   1489 C  CG  . GLU B  1 17  ? 10.04265  58.18461  0.31689   1.000 49.19261  ?  17  GLU B CG  1 
ATOM   1490 C  CD  . GLU B  1 17  ? 9.61301   59.09336  -0.85418  1.000 61.36594  ?  17  GLU B CD  1 
ATOM   1491 O  OE1 . GLU B  1 17  ? 8.95628   60.13301  -0.61524  1.000 63.63156  ?  17  GLU B OE1 1 
ATOM   1492 O  OE2 . GLU B  1 17  ? 9.92099   58.78275  -2.02304  1.000 50.05088  -1 17  GLU B OE2 1 
ATOM   1493 N  N   . ALA B  1 18  ? 12.10338  59.06881  3.51233   1.000 49.69678  ?  18  ALA B N   1 
ATOM   1494 C  CA  . ALA B  1 18  ? 13.55295  59.16113  3.71875   1.000 49.67513  ?  18  ALA B CA  1 
ATOM   1495 C  C   . ALA B  1 18  ? 14.02897  58.22724  4.83224   1.000 48.73551  ?  18  ALA B C   1 
ATOM   1496 O  O   . ALA B  1 18  ? 15.07414  57.57398  4.70855   1.000 48.02741  ?  18  ALA B O   1 
ATOM   1497 C  CB  . ALA B  1 18  ? 13.95721  60.61010  4.03094   1.000 51.13690  ?  18  ALA B CB  1 
ATOM   1498 N  N   . ALA B  1 19  ? 13.29011  58.16533  5.93753   1.000 48.78056  ?  19  ALA B N   1 
ATOM   1499 C  CA  . ALA B  1 19  ? 13.70052  57.31748  7.04947   1.000 51.19264  ?  19  ALA B CA  1 
ATOM   1500 C  C   . ALA B  1 19  ? 13.65796  55.84070  6.65990   1.000 48.15864  ?  19  ALA B C   1 
ATOM   1501 O  O   . ALA B  1 19  ? 14.48194  55.04289  7.12134   1.000 53.32352  ?  19  ALA B O   1 
ATOM   1502 C  CB  . ALA B  1 19  ? 12.80968  57.59493  8.26152   1.000 48.47141  ?  19  ALA B CB  1 
ATOM   1503 N  N   . ILE B  1 20  ? 12.72330  55.46570  5.78338   1.000 48.16853  ?  20  ILE B N   1 
ATOM   1504 C  CA  . ILE B  1 20  ? 12.69458  54.09431  5.28344   1.000 53.12748  ?  20  ILE B CA  1 
ATOM   1505 C  C   . ILE B  1 20  ? 13.92319  53.81073  4.42586   1.000 44.36182  ?  20  ILE B C   1 
ATOM   1506 O  O   . ILE B  1 20  ? 14.50729  52.72870  4.50645   1.000 46.31065  ?  20  ILE B O   1 
ATOM   1507 C  CB  . ILE B  1 20  ? 11.38436  53.81643  4.52116   1.000 44.63114  ?  20  ILE B CB  1 
ATOM   1508 C  CG1 . ILE B  1 20  ? 10.22429  53.75363  5.50815   1.000 45.07560  ?  20  ILE B CG1 1 
ATOM   1509 C  CG2 . ILE B  1 20  ? 11.45502  52.46763  3.73466   1.000 43.33450  ?  20  ILE B CG2 1 
ATOM   1510 C  CD1 . ILE B  1 20  ? 10.28654  52.51112  6.37774   1.000 48.87616  ?  20  ILE B CD1 1 
ATOM   1511 N  N   . ASN B  1 21  ? 14.30949  54.75368  3.56924   1.000 45.24546  ?  21  ASN B N   1 
ATOM   1512 C  CA  . ASN B  1 21  ? 15.54262  54.57411  2.80073   1.000 49.57061  ?  21  ASN B CA  1 
ATOM   1513 C  C   . ASN B  1 21  ? 16.75406  54.40105  3.72349   1.000 51.41605  ?  21  ASN B C   1 
ATOM   1514 O  O   . ASN B  1 21  ? 17.61036  53.51814  3.50710   1.000 45.08699  ?  21  ASN B O   1 
ATOM   1515 C  CB  . ASN B  1 21  ? 15.73415  55.75360  1.84122   1.000 46.46053  ?  21  ASN B CB  1 
ATOM   1516 C  CG  . ASN B  1 21  ? 14.81531  55.65499  0.61670   1.000 57.16665  ?  21  ASN B CG  1 
ATOM   1517 O  OD1 . ASN B  1 21  ? 14.66383  54.57803  0.03104   1.000 45.22653  ?  21  ASN B OD1 1 
ATOM   1518 N  ND2 . ASN B  1 21  ? 14.17367  56.75912  0.25652   1.000 47.35479  ?  21  ASN B ND2 1 
ATOM   1519 N  N   . ARG B  1 22  ? 16.82287  55.20637  4.78350   1.000 45.80950  ?  22  ARG B N   1 
ATOM   1520 C  CA  . ARG B  1 22  ? 17.93204  55.05744  5.72337   1.000 61.32226  ?  22  ARG B CA  1 
ATOM   1521 C  C   . ARG B  1 22  ? 17.88666  53.69766  6.42416   1.000 53.65722  ?  22  ARG B C   1 
ATOM   1522 O  O   . ARG B  1 22  ? 18.92847  53.10158  6.71559   1.000 49.94137  ?  22  ARG B O   1 
ATOM   1523 C  CB  . ARG B  1 22  ? 17.92108  56.19736  6.74292   1.000 56.32379  ?  22  ARG B CB  1 
ATOM   1524 C  CG  . ARG B  1 22  ? 18.47032  57.50065  6.18014   1.000 62.23801  ?  22  ARG B CG  1 
ATOM   1525 C  CD  . ARG B  1 22  ? 18.62992  58.58564  7.25670   1.000 59.75777  ?  22  ARG B CD  1 
ATOM   1526 N  NE  . ARG B  1 22  ? 17.36301  58.90758  7.90564   1.000 57.61852  ?  22  ARG B NE  1 
ATOM   1527 C  CZ  . ARG B  1 22  ? 16.54099  59.87778  7.51313   1.000 59.00006  ?  22  ARG B CZ  1 
ATOM   1528 N  NH1 . ARG B  1 22  ? 16.85391  60.63691  6.46695   1.000 57.76247  ?  22  ARG B NH1 1 
ATOM   1529 N  NH2 . ARG B  1 22  ? 15.40261  60.08076  8.16788   1.000 51.13334  ?  22  ARG B NH2 1 
ATOM   1530 N  N   . GLN B  1 23  ? 16.68671  53.19578  6.71692   1.000 46.20939  ?  23  GLN B N   1 
ATOM   1531 C  CA  . GLN B  1 23  ? 16.60642  51.91308  7.39601   1.000 43.20275  ?  23  GLN B CA  1 
ATOM   1532 C  C   . GLN B  1 23  ? 17.01663  50.78006  6.46145   1.000 50.89584  ?  23  GLN B C   1 
ATOM   1533 O  O   . GLN B  1 23  ? 17.65802  49.81190  6.89391   1.000 41.44603  ?  23  GLN B O   1 
ATOM   1534 C  CB  . GLN B  1 23  ? 15.19792  51.70414  7.93612   1.000 50.81412  ?  23  GLN B CB  1 
ATOM   1535 C  CG  . GLN B  1 23  ? 15.07942  50.55635  8.90744   1.000 56.42664  ?  23  GLN B CG  1 
ATOM   1536 C  CD  . GLN B  1 23  ? 15.84468  50.80685  10.19027  1.000 54.83504  ?  23  GLN B CD  1 
ATOM   1537 O  OE1 . GLN B  1 23  ? 16.48071  49.89867  10.74536  1.000 60.03386  ?  23  GLN B OE1 1 
ATOM   1538 N  NE2 . GLN B  1 23  ? 15.76551  52.02636  10.68136  1.000 46.30571  ?  23  GLN B NE2 1 
ATOM   1539 N  N   . ILE B  1 24  ? 16.63547  50.88341  5.18025   1.000 41.88271  ?  24  ILE B N   1 
ATOM   1540 C  CA  . ILE B  1 24  ? 17.08970  49.93454  4.16250   1.000 44.17992  ?  24  ILE B CA  1 
ATOM   1541 C  C   . ILE B  1 24  ? 18.61405  49.84908  4.15377   1.000 50.18115  ?  24  ILE B C   1 
ATOM   1542 O  O   . ILE B  1 24  ? 19.19572  48.75281  4.15747   1.000 47.06230  ?  24  ILE B O   1 
ATOM   1543 C  CB  . ILE B  1 24  ? 16.55610  50.34872  2.77963   1.000 45.39561  ?  24  ILE B CB  1 
ATOM   1544 C  CG1 . ILE B  1 24  ? 15.04979  50.07035  2.67354   1.000 50.80199  ?  24  ILE B CG1 1 
ATOM   1545 C  CG2 . ILE B  1 24  ? 17.34679  49.62945  1.68383   1.000 40.53419  ?  24  ILE B CG2 1 
ATOM   1546 C  CD1 . ILE B  1 24  ? 14.37599  50.79972  1.53423   1.000 41.54511  ?  24  ILE B CD1 1 
ATOM   1547 N  N   . ASN B  1 25  ? 19.28148  51.01522  4.11447   1.000 42.48280  ?  25  ASN B N   1 
ATOM   1548 C  CA  . ASN B  1 25  ? 20.74211  51.02636  4.15287   1.000 42.92098  ?  25  ASN B CA  1 
ATOM   1549 C  C   . ASN B  1 25  ? 21.25966  50.36487  5.42103   1.000 47.01808  ?  25  ASN B C   1 
ATOM   1550 O  O   . ASN B  1 25  ? 22.20816  49.56524  5.38291   1.000 45.18995  ?  25  ASN B O   1 
ATOM   1551 C  CB  . ASN B  1 25  ? 21.28229  52.46003  4.07391   1.000 47.77308  ?  25  ASN B CB  1 
ATOM   1552 C  CG  . ASN B  1 25  ? 22.79076  52.49304  3.99261   1.000 50.33697  ?  25  ASN B CG  1 
ATOM   1553 O  OD1 . ASN B  1 25  ? 23.34542  52.19133  2.93967   1.000 44.70101  ?  25  ASN B OD1 1 
ATOM   1554 N  ND2 . ASN B  1 25  ? 23.46452  52.78962  5.11217   1.000 45.59928  ?  25  ASN B ND2 1 
ATOM   1555 N  N   . LEU B  1 26  ? 20.66039  50.69392  6.56397   1.000 42.99353  ?  26  LEU B N   1 
ATOM   1556 C  CA  . LEU B  1 26  ? 21.14345  50.11324  7.81250   1.000 42.88311  ?  26  LEU B CA  1 
ATOM   1557 C  C   . LEU B  1 26  ? 21.02998  48.58325  7.80924   1.000 50.08172  ?  26  LEU B C   1 
ATOM   1558 O  O   . LEU B  1 26  ? 21.91705  47.88357  8.32576   1.000 43.78259  ?  26  LEU B O   1 
ATOM   1559 C  CB  . LEU B  1 26  ? 20.37598  50.71109  8.97990   1.000 47.64885  ?  26  LEU B CB  1 
ATOM   1560 C  CG  . LEU B  1 26  ? 20.94706  50.47343  10.36975  1.000 51.73798  ?  26  LEU B CG  1 
ATOM   1561 C  CD1 . LEU B  1 26  ? 22.43267  50.83639  10.41798  1.000 47.18819  ?  26  LEU B CD1 1 
ATOM   1562 C  CD2 . LEU B  1 26  ? 20.15113  51.32662  11.34107  1.000 60.08859  ?  26  LEU B CD2 1 
ATOM   1563 N  N   . GLU B  1 27  ? 19.95158  48.04260  7.23311   1.000 40.55195  ?  27  GLU B N   1 
ATOM   1564 C  CA  . GLU B  1 27  ? 19.79756  46.59205  7.24596   1.000 39.24194  ?  27  GLU B CA  1 
ATOM   1565 C  C   . GLU B  1 27  ? 20.77545  45.92480  6.27851   1.000 38.81531  ?  27  GLU B C   1 
ATOM   1566 O  O   . GLU B  1 27  ? 21.37413  44.89234  6.60968   1.000 39.04504  ?  27  GLU B O   1 
ATOM   1567 C  CB  . GLU B  1 27  ? 18.35214  46.18592  6.94303   1.000 39.55059  ?  27  GLU B CB  1 
ATOM   1568 C  CG  . GLU B  1 27  ? 17.29745  46.82739  7.85458   1.000 38.92461  ?  27  GLU B CG  1 
ATOM   1569 C  CD  . GLU B  1 27  ? 17.10419  46.11789  9.19241   1.000 59.23708  ?  27  GLU B CD  1 
ATOM   1570 O  OE1 . GLU B  1 27  ? 17.71836  45.03927  9.40450   1.000 60.79116  ?  27  GLU B OE1 1 
ATOM   1571 O  OE2 . GLU B  1 27  ? 16.32355  46.63948  10.03127  1.000 51.82062  -1 27  GLU B OE2 1 
ATOM   1572 N  N   . LEU B  1 28  ? 20.97079  46.49702  5.08810   1.000 39.13810  ?  28  LEU B N   1 
ATOM   1573 C  CA  . LEU B  1 28  ? 22.02039  45.97229  4.21315   1.000 39.37165  ?  28  LEU B CA  1 
ATOM   1574 C  C   . LEU B  1 28  ? 23.38763  46.02041  4.89950   1.000 42.39814  ?  28  LEU B C   1 
ATOM   1575 O  O   . LEU B  1 28  ? 24.22733  45.12511  4.71575   1.000 48.33485  ?  28  LEU B O   1 
ATOM   1576 C  CB  . LEU B  1 28  ? 22.04835  46.76018  2.90660   1.000 44.94801  ?  28  LEU B CB  1 
ATOM   1577 C  CG  . LEU B  1 28  ? 20.83107  46.54399  2.01568   1.000 42.39855  ?  28  LEU B CG  1 
ATOM   1578 C  CD1 . LEU B  1 28  ? 20.82619  47.58340  0.87020   1.000 39.60498  ?  28  LEU B CD1 1 
ATOM   1579 C  CD2 . LEU B  1 28  ? 20.85410  45.11167  1.49111   1.000 37.53840  ?  28  LEU B CD2 1 
ATOM   1580 N  N   . TYR B  1 29  ? 23.62204  47.04302  5.72486   1.000 51.63265  ?  29  TYR B N   1 
ATOM   1581 C  CA  . TYR B  1 29  ? 24.89557  47.12673  6.42783   1.000 51.67662  ?  29  TYR B CA  1 
ATOM   1582 C  C   . TYR B  1 29  ? 25.01667  46.03784  7.49369   1.000 52.87701  ?  29  TYR B C   1 
ATOM   1583 O  O   . TYR B  1 29  ? 26.07993  45.42072  7.64416   1.000 40.61563  ?  29  TYR B O   1 
ATOM   1584 C  CB  . TYR B  1 29  ? 25.04794  48.51647  7.03771   1.000 55.52136  ?  29  TYR B CB  1 
ATOM   1585 C  CG  . TYR B  1 29  ? 26.20749  48.68155  7.99615   1.000 43.60921  ?  29  TYR B CG  1 
ATOM   1586 C  CD1 . TYR B  1 29  ? 27.51752  48.73671  7.53957   1.000 44.83106  ?  29  TYR B CD1 1 
ATOM   1587 C  CD2 . TYR B  1 29  ? 25.98006  48.81821  9.36075   1.000 43.96826  ?  29  TYR B CD2 1 
ATOM   1588 C  CE1 . TYR B  1 29  ? 28.58673  48.91284  8.42811   1.000 45.06355  ?  29  TYR B CE1 1 
ATOM   1589 C  CE2 . TYR B  1 29  ? 27.02011  48.98790  10.25240  1.000 44.84692  ?  29  TYR B CE2 1 
ATOM   1590 C  CZ  . TYR B  1 29  ? 28.33068  49.03686  9.78703   1.000 45.40309  ?  29  TYR B CZ  1 
ATOM   1591 O  OH  . TYR B  1 29  ? 29.36856  49.20131  10.68903  1.000 46.35519  ?  29  TYR B OH  1 
ATOM   1592 N  N   . ALA B  1 30  ? 23.94954  45.81970  8.26793   1.000 46.94688  ?  30  ALA B N   1 
ATOM   1593 C  CA  . ALA B  1 30  ? 23.93757  44.71407  9.22793   1.000 41.84677  ?  30  ALA B CA  1 
ATOM   1594 C  C   . ALA B  1 30  ? 24.21685  43.38230  8.53276   1.000 40.23727  ?  30  ALA B C   1 
ATOM   1595 O  O   . ALA B  1 30  ? 24.97417  42.54510  9.04584   1.000 39.55828  ?  30  ALA B O   1 
ATOM   1596 C  CB  . ALA B  1 30  ? 22.60408  44.67419  9.97344   1.000 39.12745  ?  30  ALA B CB  1 
ATOM   1597 N  N   . SER B  1 31  ? 23.66445  43.20914  7.33297   1.000 37.66308  ?  31  SER B N   1 
ATOM   1598 C  CA  . SER B  1 31  ? 23.90882  42.01157  6.54296   1.000 36.60350  ?  31  SER B CA  1 
ATOM   1599 C  C   . SER B  1 31  ? 25.39301  41.87822  6.18587   1.000 44.74988  ?  31  SER B C   1 
ATOM   1600 O  O   . SER B  1 31  ? 25.98094  40.79169  6.29754   1.000 50.67723  ?  31  SER B O   1 
ATOM   1601 C  CB  . SER B  1 31  ? 23.02781  42.07732  5.29484   1.000 36.12237  ?  31  SER B CB  1 
ATOM   1602 O  OG  . SER B  1 31  ? 23.28365  41.03789  4.37283   1.000 47.59084  ?  31  SER B OG  1 
ATOM   1603 N  N   . TYR B  1 32  ? 26.00666  42.98148  5.76023   1.000 44.07520  ?  32  TYR B N   1 
ATOM   1604 C  CA  . TYR B  1 32  ? 27.42106  42.99996  5.40693   1.000 47.10649  ?  32  TYR B CA  1 
ATOM   1605 C  C   . TYR B  1 32  ? 28.31758  42.68978  6.60614   1.000 51.40484  ?  32  TYR B C   1 
ATOM   1606 O  O   . TYR B  1 32  ? 29.30717  41.95076  6.49028   1.000 38.99611  ?  32  TYR B O   1 
ATOM   1607 C  CB  . TYR B  1 32  ? 27.76700  44.36958  4.83775   1.000 45.22442  ?  32  TYR B CB  1 
ATOM   1608 C  CG  . TYR B  1 32  ? 28.94011  44.39494  3.89857   1.000 43.74806  ?  32  TYR B CG  1 
ATOM   1609 C  CD1 . TYR B  1 32  ? 29.45972  43.21485  3.35894   1.000 39.64832  ?  32  TYR B CD1 1 
ATOM   1610 C  CD2 . TYR B  1 32  ? 29.53524  45.61126  3.55321   1.000 41.74316  ?  32  TYR B CD2 1 
ATOM   1611 C  CE1 . TYR B  1 32  ? 30.53646  43.25429  2.48467   1.000 42.67650  ?  32  TYR B CE1 1 
ATOM   1612 C  CE2 . TYR B  1 32  ? 30.62546  45.66159  2.69396   1.000 43.38208  ?  32  TYR B CE2 1 
ATOM   1613 C  CZ  . TYR B  1 32  ? 31.12462  44.48348  2.15909   1.000 41.48440  ?  32  TYR B CZ  1 
ATOM   1614 O  OH  . TYR B  1 32  ? 32.20024  44.53399  1.30067   1.000 45.18756  ?  32  TYR B OH  1 
ATOM   1615 N  N   . VAL B  1 33  ? 28.01203  43.28182  7.75534   1.000 39.71729  ?  33  VAL B N   1 
ATOM   1616 C  CA  . VAL B  1 33  ? 28.76709  42.97913  8.96377   1.000 40.12359  ?  33  VAL B CA  1 
ATOM   1617 C  C   . VAL B  1 33  ? 28.68397  41.48656  9.27652   1.000 41.48999  ?  33  VAL B C   1 
ATOM   1618 O  O   . VAL B  1 33  ? 29.70146  40.83986  9.55404   1.000 45.29780  ?  33  VAL B O   1 
ATOM   1619 C  CB  . VAL B  1 33  ? 28.27255  43.85138  10.13346  1.000 40.92251  ?  33  VAL B CB  1 
ATOM   1620 C  CG1 . VAL B  1 33  ? 28.90348  43.43509  11.45931  1.000 41.27769  ?  33  VAL B CG1 1 
ATOM   1621 C  CG2 . VAL B  1 33  ? 28.54286  45.33601  9.85065   1.000 42.26220  ?  33  VAL B CG2 1 
ATOM   1622 N  N   . TYR B  1 34  ? 27.46855  40.90941  9.23538   1.000 38.49006  ?  34  TYR B N   1 
ATOM   1623 C  CA  . TYR B  1 34  ? 27.35700  39.48686  9.54302   1.000 36.65691  ?  34  TYR B CA  1 
ATOM   1624 C  C   . TYR B  1 34  ? 28.13895  38.64944  8.54116   1.000 36.11337  ?  34  TYR B C   1 
ATOM   1625 O  O   . TYR B  1 34  ? 28.76901  37.66092  8.91224   1.000 39.18760  ?  34  TYR B O   1 
ATOM   1626 C  CB  . TYR B  1 34  ? 25.89127  39.05387  9.59278   1.000 35.64120  ?  34  TYR B CB  1 
ATOM   1627 C  CG  . TYR B  1 34  ? 25.23400  39.46238  10.88794  1.000 43.50956  ?  34  TYR B CG  1 
ATOM   1628 C  CD1 . TYR B  1 34  ? 25.78802  39.09690  12.10700  1.000 55.92085  ?  34  TYR B CD1 1 
ATOM   1629 C  CD2 . TYR B  1 34  ? 24.08549  40.23750  10.89479  1.000 39.71399  ?  34  TYR B CD2 1 
ATOM   1630 C  CE1 . TYR B  1 34  ? 25.20350  39.48142  13.30112  1.000 57.81276  ?  34  TYR B CE1 1 
ATOM   1631 C  CE2 . TYR B  1 34  ? 23.48450  40.63129  12.08264  1.000 51.33396  ?  34  TYR B CE2 1 
ATOM   1632 C  CZ  . TYR B  1 34  ? 24.05434  40.25631  13.28541  1.000 58.21659  ?  34  TYR B CZ  1 
ATOM   1633 O  OH  . TYR B  1 34  ? 23.47381  40.63547  14.47823  1.000 61.75763  ?  34  TYR B OH  1 
ATOM   1634 N  N   . LEU B  1 35  ? 28.11523  39.02492  7.26507   1.000 43.14368  ?  35  LEU B N   1 
ATOM   1635 C  CA  . LEU B  1 35  ? 28.89346  38.27588  6.27792   1.000 39.77519  ?  35  LEU B CA  1 
ATOM   1636 C  C   . LEU B  1 35  ? 30.39154  38.32131  6.59576   1.000 45.03611  ?  35  LEU B C   1 
ATOM   1637 O  O   . LEU B  1 35  ? 31.10110  37.29092  6.50750   1.000 36.16895  ?  35  LEU B O   1 
ATOM   1638 C  CB  . LEU B  1 35  ? 28.60896  38.84733  4.88579   1.000 44.00871  ?  35  LEU B CB  1 
ATOM   1639 C  CG  . LEU B  1 35  ? 29.36773  38.33423  3.66629   1.000 40.98798  ?  35  LEU B CG  1 
ATOM   1640 C  CD1 . LEU B  1 35  ? 29.01040  36.86908  3.36061   1.000 42.50787  ?  35  LEU B CD1 1 
ATOM   1641 C  CD2 . LEU B  1 35  ? 29.02628  39.21269  2.49025   1.000 39.36935  ?  35  LEU B CD2 1 
ATOM   1642 N  N   . SER B  1 36  ? 30.89321  39.50798  6.97817   1.000 37.93262  ?  36  SER B N   1 
ATOM   1643 C  CA  . SER B  1 36  ? 32.31475  39.61563  7.27208   1.000 38.90367  ?  36  SER B CA  1 
ATOM   1644 C  C   . SER B  1 36  ? 32.67930  38.77398  8.49010   1.000 38.70729  ?  36  SER B C   1 
ATOM   1645 O  O   . SER B  1 36  ? 33.70121  38.07467  8.47996   1.000 44.74843  ?  36  SER B O   1 
ATOM   1646 C  CB  . SER B  1 36  ? 32.73036  41.08847  7.46964   1.000 40.41169  ?  36  SER B CB  1 
ATOM   1647 O  OG  . SER B  1 36  ? 33.86844  41.19226  8.31766   1.000 47.06704  ?  36  SER B OG  1 
ATOM   1648 N  N   . MET B  1 37  ? 31.85392  38.81449  9.54325   1.000 38.50741  ?  37  MET B N   1 
ATOM   1649 C  CA  . MET B  1 37  ? 32.09756  37.96819  10.71811  1.000 43.24942  ?  37  MET B CA  1 
ATOM   1650 C  C   . MET B  1 37  ? 32.07430  36.48140  10.36400  1.000 45.58970  ?  37  MET B C   1 
ATOM   1651 O  O   . MET B  1 37  ? 32.89559  35.68743  10.85971  1.000 48.60424  ?  37  MET B O   1 
ATOM   1652 C  CB  . MET B  1 37  ? 31.05506  38.23049  11.80233  1.000 41.63912  ?  37  MET B CB  1 
ATOM   1653 C  CG  . MET B  1 37  ? 30.97625  39.64445  12.32586  1.000 39.94788  ?  37  MET B CG  1 
ATOM   1654 S  SD  . MET B  1 37  ? 29.71412  39.82856  13.62668  1.000 47.95988  ?  37  MET B SD  1 
ATOM   1655 C  CE  . MET B  1 37  ? 30.27329  41.35408  14.38990  1.000 41.24926  ?  37  MET B CE  1 
ATOM   1656 N  N   . SER B  1 38  ? 31.13739  36.08182  9.51012   1.000 38.09000  ?  38  SER B N   1 
ATOM   1657 C  CA  . SER B  1 38  ? 31.00605  34.66717  9.19802   1.000 38.49282  ?  38  SER B CA  1 
ATOM   1658 C  C   . SER B  1 38  ? 32.25880  34.15648  8.50128   1.000 42.29984  ?  38  SER B C   1 
ATOM   1659 O  O   . SER B  1 38  ? 32.82461  33.11711  8.88108   1.000 36.97453  ?  38  SER B O   1 
ATOM   1660 C  CB  . SER B  1 38  ? 29.77474  34.44449  8.33302   1.000 33.56332  ?  38  SER B CB  1 
ATOM   1661 O  OG  . SER B  1 38  ? 29.90613  33.25927  7.59009   1.000 37.85370  ?  38  SER B OG  1 
ATOM   1662 N  N   . TYR B  1 39  ? 32.72282  34.88586  7.48825   1.000 39.23654  ?  39  TYR B N   1 
ATOM   1663 C  CA  . TYR B  1 39  ? 33.93663  34.42216  6.83200   1.000 44.57552  ?  39  TYR B CA  1 
ATOM   1664 C  C   . TYR B  1 39  ? 35.19568  34.66508  7.66208   1.000 43.16109  ?  39  TYR B C   1 
ATOM   1665 O  O   . TYR B  1 39  ? 36.22585  34.03357  7.40288   1.000 41.84748  ?  39  TYR B O   1 
ATOM   1666 C  CB  . TYR B  1 39  ? 34.04056  35.02584  5.42772   1.000 36.82921  ?  39  TYR B CB  1 
ATOM   1667 C  CG  . TYR B  1 39  ? 33.19681  34.17026  4.52126   1.000 46.98824  ?  39  TYR B CG  1 
ATOM   1668 C  CD1 . TYR B  1 39  ? 33.64649  32.90713  4.10356   1.000 37.63036  ?  39  TYR B CD1 1 
ATOM   1669 C  CD2 . TYR B  1 39  ? 31.90813  34.55275  4.18724   1.000 34.12081  ?  39  TYR B CD2 1 
ATOM   1670 C  CE1 . TYR B  1 39  ? 32.83231  32.07782  3.31166   1.000 35.75383  ?  39  TYR B CE1 1 
ATOM   1671 C  CE2 . TYR B  1 39  ? 31.10435  33.75654  3.39275   1.000 42.65554  ?  39  TYR B CE2 1 
ATOM   1672 C  CZ  . TYR B  1 39  ? 31.56315  32.51928  2.95912   1.000 41.72222  ?  39  TYR B CZ  1 
ATOM   1673 O  OH  . TYR B  1 39  ? 30.71682  31.76028  2.17937   1.000 43.90239  ?  39  TYR B OH  1 
ATOM   1674 N  N   . TYR B  1 40  ? 35.12972  35.48703  8.70280   1.000 39.81182  ?  40  TYR B N   1 
ATOM   1675 C  CA  . TYR B  1 40  ? 36.24780  35.46790  9.63309   1.000 43.65683  ?  40  TYR B CA  1 
ATOM   1676 C  C   . TYR B  1 40  ? 36.30180  34.12855  10.37365  1.000 42.52218  ?  40  TYR B C   1 
ATOM   1677 O  O   . TYR B  1 40  ? 37.38670  33.61529  10.64745  1.000 38.29759  ?  40  TYR B O   1 
ATOM   1678 C  CB  . TYR B  1 40  ? 36.14994  36.63295  10.62390  1.000 41.24369  ?  40  TYR B CB  1 
ATOM   1679 C  CG  . TYR B  1 40  ? 37.06855  36.50315  11.79889  1.000 43.95511  ?  40  TYR B CG  1 
ATOM   1680 C  CD1 . TYR B  1 40  ? 38.40222  36.88142  11.69313  1.000 42.79139  ?  40  TYR B CD1 1 
ATOM   1681 C  CD2 . TYR B  1 40  ? 36.62224  35.99355  13.01846  1.000 49.60268  ?  40  TYR B CD2 1 
ATOM   1682 C  CE1 . TYR B  1 40  ? 39.26914  36.75295  12.76321  1.000 48.47115  ?  40  TYR B CE1 1 
ATOM   1683 C  CE2 . TYR B  1 40  ? 37.50578  35.86269  14.11115  1.000 49.68291  ?  40  TYR B CE2 1 
ATOM   1684 C  CZ  . TYR B  1 40  ? 38.82823  36.24585  13.96945  1.000 45.63571  ?  40  TYR B CZ  1 
ATOM   1685 O  OH  . TYR B  1 40  ? 39.72154  36.12170  15.02057  1.000 47.17664  ?  40  TYR B OH  1 
ATOM   1686 N  N   . PHE B  1 41  ? 35.15873  33.53261  10.69820  1.000 43.30157  ?  41  PHE B N   1 
ATOM   1687 C  CA  . PHE B  1 41  ? 35.23783  32.27231  11.44019  1.000 47.68357  ?  41  PHE B CA  1 
ATOM   1688 C  C   . PHE B  1 41  ? 35.52676  31.05560  10.55996  1.000 37.88446  ?  41  PHE B C   1 
ATOM   1689 O  O   . PHE B  1 41  ? 35.75423  29.97770  11.09877  1.000 34.48456  ?  41  PHE B O   1 
ATOM   1690 C  CB  . PHE B  1 41  ? 33.95967  32.07709  12.27921  1.000 46.98436  ?  41  PHE B CB  1 
ATOM   1691 C  CG  . PHE B  1 41  ? 33.95971  32.94593  13.48071  1.000 45.19945  ?  41  PHE B CG  1 
ATOM   1692 C  CD1 . PHE B  1 41  ? 34.59909  32.54270  14.64044  1.000 41.79794  ?  41  PHE B CD1 1 
ATOM   1693 C  CD2 . PHE B  1 41  ? 33.41855  34.22497  13.42731  1.000 40.97899  ?  41  PHE B CD2 1 
ATOM   1694 C  CE1 . PHE B  1 41  ? 34.65751  33.38789  15.75106  1.000 37.96101  ?  41  PHE B CE1 1 
ATOM   1695 C  CE2 . PHE B  1 41  ? 33.47922  35.06199  14.52848  1.000 38.04768  ?  41  PHE B CE2 1 
ATOM   1696 C  CZ  . PHE B  1 41  ? 34.09648  34.63268  15.69330  1.000 38.55359  ?  41  PHE B CZ  1 
ATOM   1697 N  N   . ASP B  1 42  ? 35.52533  31.21894  9.24252   1.000 41.44489  ?  42  ASP B N   1 
ATOM   1698 C  CA  . ASP B  1 42  ? 35.94828  30.24693  8.24433   1.000 35.15416  ?  42  ASP B CA  1 
ATOM   1699 C  C   . ASP B  1 42  ? 37.44556  30.29885  7.99069   1.000 42.63380  ?  42  ASP B C   1 
ATOM   1700 O  O   . ASP B  1 42  ? 37.96615  29.50163  7.19886   1.000 39.16335  ?  42  ASP B O   1 
ATOM   1701 C  CB  . ASP B  1 42  ? 35.16357  30.50651  6.94270   1.000 39.74899  ?  42  ASP B CB  1 
ATOM   1702 C  CG  . ASP B  1 42  ? 35.53780  29.57948  5.79504   1.000 39.93210  ?  42  ASP B CG  1 
ATOM   1703 O  OD1 . ASP B  1 42  ? 35.43984  28.35558  5.95781   1.000 51.93538  ?  42  ASP B OD1 1 
ATOM   1704 O  OD2 . ASP B  1 42  ? 35.86183  30.11688  4.71347   1.000 40.37545  -1 42  ASP B OD2 1 
ATOM   1705 N  N   . ARG B  1 43  ? 38.14988  31.22008  8.63485   1.000 46.19898  ?  43  ARG B N   1 
ATOM   1706 C  CA  . ARG B  1 43  ? 39.59294  31.31157  8.46417   1.000 47.43457  ?  43  ARG B CA  1 
ATOM   1707 C  C   . ARG B  1 43  ? 40.28819  30.06422  8.99808   1.000 45.17086  ?  43  ARG B C   1 
ATOM   1708 O  O   . ARG B  1 43  ? 39.86659  29.47298  9.99421   1.000 36.82661  ?  43  ARG B O   1 
ATOM   1709 C  CB  . ARG B  1 43  ? 40.13150  32.53968  9.18304   1.000 50.76913  ?  43  ARG B CB  1 
ATOM   1710 C  CG  . ARG B  1 43  ? 40.15957  33.78675  8.33514   1.000 55.51026  ?  43  ARG B CG  1 
ATOM   1711 C  CD  . ARG B  1 43  ? 40.42740  34.95910  9.21364   1.000 54.27061  ?  43  ARG B CD  1 
ATOM   1712 N  NE  . ARG B  1 43  ? 41.86410  35.05947  9.38368   1.000 69.90156  ?  43  ARG B NE  1 
ATOM   1713 C  CZ  . ARG B  1 43  ? 42.50100  36.14700  9.78400   1.000 66.28166  ?  43  ARG B CZ  1 
ATOM   1714 N  NH1 . ARG B  1 43  ? 43.80879  36.14497  9.92835   1.000 70.35824  ?  43  ARG B NH1 1 
ATOM   1715 N  NH2 . ARG B  1 43  ? 41.84955  37.26610  10.06039  1.000 60.14027  ?  43  ARG B NH2 1 
ATOM   1716 N  N   . ASP B  1 44  ? 41.39274  29.68408  8.34737   1.000 37.79913  ?  44  ASP B N   1 
ATOM   1717 C  CA  . ASP B  1 44  ? 42.06640  28.45965  8.76452   1.000 37.54694  ?  44  ASP B CA  1 
ATOM   1718 C  C   . ASP B  1 44  ? 42.67992  28.60030  10.14860  1.000 41.97287  ?  44  ASP B C   1 
ATOM   1719 O  O   . ASP B  1 44  ? 42.93741  27.58726  10.80982  1.000 38.18526  ?  44  ASP B O   1 
ATOM   1720 C  CB  . ASP B  1 44  ? 43.11035  28.04165  7.72140   1.000 40.72985  ?  44  ASP B CB  1 
ATOM   1721 C  CG  . ASP B  1 44  ? 44.44032  28.81567  7.82464   1.000 51.32825  ?  44  ASP B CG  1 
ATOM   1722 O  OD1 . ASP B  1 44  ? 45.23080  28.55692  8.75150   1.000 50.52573  ?  44  ASP B OD1 1 
ATOM   1723 O  OD2 . ASP B  1 44  ? 44.67755  29.67553  6.95518   1.000 47.69213  -1 44  ASP B OD2 1 
ATOM   1724 N  N   . ASP B  1 45  ? 42.89660  29.84136  10.61794  1.000 47.47730  ?  45  ASP B N   1 
ATOM   1725 C  CA  . ASP B  1 45  ? 43.48276  30.11134  11.93327  1.000 47.49665  ?  45  ASP B CA  1 
ATOM   1726 C  C   . ASP B  1 45  ? 42.42011  30.40826  12.98284  1.000 40.54223  ?  45  ASP B C   1 
ATOM   1727 O  O   . ASP B  1 45  ? 42.75046  30.73359  14.12978  1.000 44.34791  ?  45  ASP B O   1 
ATOM   1728 C  CB  . ASP B  1 45  ? 44.47894  31.29226  11.87122  1.000 45.35151  ?  45  ASP B CB  1 
ATOM   1729 C  CG  . ASP B  1 45  ? 43.98803  32.42445  10.95647  1.000 55.52709  ?  45  ASP B CG  1 
ATOM   1730 O  OD1 . ASP B  1 45  ? 42.78121  32.72485  10.99170  1.000 56.68064  ?  45  ASP B OD1 1 
ATOM   1731 O  OD2 . ASP B  1 45  ? 44.80457  33.05696  10.26549  1.000 62.74949  -1 45  ASP B OD2 1 
ATOM   1732 N  N   . VAL B  1 46  ? 41.15722  30.33290  12.61074  1.000 39.29831  ?  46  VAL B N   1 
ATOM   1733 C  CA  . VAL B  1 46  ? 40.05953  30.50285  13.55149  1.000 38.86001  ?  46  VAL B CA  1 
ATOM   1734 C  C   . VAL B  1 46  ? 39.25614  29.21718  13.48653  1.000 41.55077  ?  46  VAL B C   1 
ATOM   1735 O  O   . VAL B  1 46  ? 39.17908  28.46708  14.46446  1.000 43.21770  ?  46  VAL B O   1 
ATOM   1736 C  CB  . VAL B  1 46  ? 39.21834  31.74952  13.21530  1.000 43.43433  ?  46  VAL B CB  1 
ATOM   1737 C  CG1 . VAL B  1 46  ? 38.02291  31.88435  14.16500  1.000 38.56703  ?  46  VAL B CG1 1 
ATOM   1738 C  CG2 . VAL B  1 46  ? 40.14217  32.99922  13.21331  1.000 40.73762  ?  46  VAL B CG2 1 
ATOM   1739 N  N   . ALA B  1 47  ? 38.69721  28.93494  12.31580  1.000 42.26645  ?  47  ALA B N   1 
ATOM   1740 C  CA  . ALA B  1 47  ? 38.13024  27.62130  12.01142  1.000 41.81266  ?  47  ALA B CA  1 
ATOM   1741 C  C   . ALA B  1 47  ? 37.05736  27.21541  13.02469  1.000 46.25129  ?  47  ALA B C   1 
ATOM   1742 O  O   . ALA B  1 47  ? 37.08714  26.11596  13.58670  1.000 46.52482  ?  47  ALA B O   1 
ATOM   1743 C  CB  . ALA B  1 47  ? 39.23510  26.57071  11.92265  1.000 34.74315  ?  47  ALA B CB  1 
ATOM   1744 N  N   . LEU B  1 48  ? 36.09448  28.11892  13.26087  1.000 41.05502  ?  48  LEU B N   1 
ATOM   1745 C  CA  . LEU B  1 48  ? 34.92692  27.80256  14.09007  1.000 46.99396  ?  48  LEU B CA  1 
ATOM   1746 C  C   . LEU B  1 48  ? 33.69639  27.70998  13.18704  1.000 40.17575  ?  48  LEU B C   1 
ATOM   1747 O  O   . LEU B  1 48  ? 32.97906  28.68687  12.98156  1.000 38.26817  ?  48  LEU B O   1 
ATOM   1748 C  CB  . LEU B  1 48  ? 34.74109  28.81595  15.19756  1.000 43.46452  ?  48  LEU B CB  1 
ATOM   1749 C  CG  . LEU B  1 48  ? 35.73407  28.53097  16.32319  1.000 45.96418  ?  48  LEU B CG  1 
ATOM   1750 C  CD1 . LEU B  1 48  ? 36.13815  29.83787  16.97600  1.000 47.04328  ?  48  LEU B CD1 1 
ATOM   1751 C  CD2 . LEU B  1 48  ? 35.19764  27.52307  17.34704  1.000 40.76427  ?  48  LEU B CD2 1 
ATOM   1752 N  N   . LYS B  1 49  ? 33.43530  26.49147  12.70966  1.000 34.37265  ?  49  LYS B N   1 
ATOM   1753 C  CA  . LYS B  1 49  ? 32.49136  26.25323  11.61989  1.000 38.11922  ?  49  LYS B CA  1 
ATOM   1754 C  C   . LYS B  1 49  ? 31.07507  26.72567  11.95406  1.000 49.12177  ?  49  LYS B C   1 
ATOM   1755 O  O   . LYS B  1 49  ? 30.35385  27.24557  11.08282  1.000 37.09743  ?  49  LYS B O   1 
ATOM   1756 C  CB  . LYS B  1 49  ? 32.48442  24.76413  11.29170  1.000 38.00397  ?  49  LYS B CB  1 
ATOM   1757 C  CG  . LYS B  1 49  ? 32.16600  24.42770  9.86278   1.000 58.89140  ?  49  LYS B CG  1 
ATOM   1758 N  N   . ASN B  1 50  ? 30.63298  26.51114  13.19242  1.000 40.98203  ?  50  ASN B N   1 
ATOM   1759 C  CA  . ASN B  1 50  ? 29.25221  26.86200  13.48894  1.000 39.14701  ?  50  ASN B CA  1 
ATOM   1760 C  C   . ASN B  1 50  ? 29.09660  28.35482  13.76107  1.000 41.57267  ?  50  ASN B C   1 
ATOM   1761 O  O   . ASN B  1 50  ? 28.05383  28.91540  13.41954  1.000 38.66522  ?  50  ASN B O   1 
ATOM   1762 C  CB  . ASN B  1 50  ? 28.73368  26.00414  14.63834  1.000 39.44195  ?  50  ASN B CB  1 
ATOM   1763 C  CG  . ASN B  1 50  ? 28.55982  24.54736  14.22269  1.000 41.73364  ?  50  ASN B CG  1 
ATOM   1764 O  OD1 . ASN B  1 50  ? 28.03622  24.26803  13.15461  1.000 43.19110  ?  50  ASN B OD1 1 
ATOM   1765 N  ND2 . ASN B  1 50  ? 28.99073  23.62119  15.06493  1.000 42.53689  ?  50  ASN B ND2 1 
ATOM   1766 N  N   . PHE B  1 51  ? 30.10937  29.02083  14.34092  1.000 35.07886  ?  51  PHE B N   1 
ATOM   1767 C  CA  . PHE B  1 51  ? 30.10694  30.48333  14.34935  1.000 44.60611  ?  51  PHE B CA  1 
ATOM   1768 C  C   . PHE B  1 51  ? 29.92545  31.01441  12.93322  1.000 38.84213  ?  51  PHE B C   1 
ATOM   1769 O  O   . PHE B  1 51  ? 29.09921  31.90224  12.68153  1.000 39.99190  ?  51  PHE B O   1 
ATOM   1770 C  CB  . PHE B  1 51  ? 31.40802  31.03521  14.95798  1.000 33.85568  ?  51  PHE B CB  1 
ATOM   1771 C  CG  . PHE B  1 51  ? 31.39352  31.12501  16.45683  1.000 34.68943  ?  51  PHE B CG  1 
ATOM   1772 C  CD1 . PHE B  1 51  ? 31.81937  30.05010  17.23090  1.000 34.76374  ?  51  PHE B CD1 1 
ATOM   1773 C  CD2 . PHE B  1 51  ? 30.94447  32.27721  17.09446  1.000 35.93990  ?  51  PHE B CD2 1 
ATOM   1774 C  CE1 . PHE B  1 51  ? 31.80211  30.10979  18.60392  1.000 36.10241  ?  51  PHE B CE1 1 
ATOM   1775 C  CE2 . PHE B  1 51  ? 30.92821  32.35738  18.47509  1.000 37.58569  ?  51  PHE B CE2 1 
ATOM   1776 C  CZ  . PHE B  1 51  ? 31.36753  31.26705  19.23714  1.000 42.68929  ?  51  PHE B CZ  1 
ATOM   1777 N  N   . ALA B  1 52  ? 30.69729  30.46463  11.99577  1.000 35.98520  ?  52  ALA B N   1 
ATOM   1778 C  CA  . ALA B  1 52  ? 30.60322  30.87842  10.60416  1.000 36.08089  ?  52  ALA B CA  1 
ATOM   1779 C  C   . ALA B  1 52  ? 29.17067  30.73645  10.08425  1.000 41.25236  ?  52  ALA B C   1 
ATOM   1780 O  O   . ALA B  1 52  ? 28.60511  31.68734  9.52183   1.000 35.89622  ?  52  ALA B O   1 
ATOM   1781 C  CB  . ALA B  1 52  ? 31.58673  30.06515  9.76310   1.000 35.45480  ?  52  ALA B CB  1 
ATOM   1782 N  N   . LYS B  1 53  ? 28.56200  29.55850  10.29207  1.000 36.82032  ?  53  LYS B N   1 
ATOM   1783 C  CA  . LYS B  1 53  ? 27.21282  29.30878  9.78230   1.000 38.47703  ?  53  LYS B CA  1 
ATOM   1784 C  C   . LYS B  1 53  ? 26.18199  30.21812  10.44766  1.000 38.24819  ?  53  LYS B C   1 
ATOM   1785 O  O   . LYS B  1 53  ? 25.25006  30.70258  9.79574   1.000 38.92186  ?  53  LYS B O   1 
ATOM   1786 C  CB  . LYS B  1 53  ? 26.82134  27.85175  10.00464  1.000 40.54475  ?  53  LYS B CB  1 
ATOM   1787 C  CG  . LYS B  1 53  ? 27.53540  26.87412  9.11451   1.000 58.98241  ?  53  LYS B CG  1 
ATOM   1788 N  N   . TYR B  1 54  ? 26.31760  30.42143  11.75513  1.000 37.74744  ?  54  TYR B N   1 
ATOM   1789 C  CA  . TYR B  1 54  ? 25.41217  31.28089  12.48782  1.000 38.25031  ?  54  TYR B CA  1 
ATOM   1790 C  C   . TYR B  1 54  ? 25.43339  32.69509  11.90824  1.000 46.51075  ?  54  TYR B C   1 
ATOM   1791 O  O   . TYR B  1 54  ? 24.38008  33.24518  11.54715  1.000 37.91326  ?  54  TYR B O   1 
ATOM   1792 C  CB  . TYR B  1 54  ? 25.80544  31.24990  13.96547  1.000 38.50727  ?  54  TYR B CB  1 
ATOM   1793 C  CG  . TYR B  1 54  ? 25.01085  32.16888  14.85981  1.000 46.46324  ?  54  TYR B CG  1 
ATOM   1794 C  CD1 . TYR B  1 54  ? 23.78572  31.77016  15.37873  1.000 45.92166  ?  54  TYR B CD1 1 
ATOM   1795 C  CD2 . TYR B  1 54  ? 25.48596  33.44298  15.18210  1.000 39.26495  ?  54  TYR B CD2 1 
ATOM   1796 C  CE1 . TYR B  1 54  ? 23.03770  32.62425  16.19230  1.000 52.80167  ?  54  TYR B CE1 1 
ATOM   1797 C  CE2 . TYR B  1 54  ? 24.76599  34.29654  15.99562  1.000 41.15550  ?  54  TYR B CE2 1 
ATOM   1798 C  CZ  . TYR B  1 54  ? 23.53942  33.88207  16.50310  1.000 54.53062  ?  54  TYR B CZ  1 
ATOM   1799 O  OH  . TYR B  1 54  ? 22.80961  34.71594  17.31696  1.000 46.18199  ?  54  TYR B OH  1 
ATOM   1800 N  N   . PHE B  1 55  ? 26.63427  33.27044  11.73374  1.000 36.00354  ?  55  PHE B N   1 
ATOM   1801 C  CA  . PHE B  1 55  ? 26.69388  34.63861  11.21109  1.000 35.77212  ?  55  PHE B CA  1 
ATOM   1802 C  C   . PHE B  1 55  ? 26.30160  34.71379  9.72555   1.000 38.56068  ?  55  PHE B C   1 
ATOM   1803 O  O   . PHE B  1 55  ? 25.78011  35.74135  9.27817   1.000 36.21143  ?  55  PHE B O   1 
ATOM   1804 C  CB  . PHE B  1 55  ? 28.07855  35.23686  11.49290  1.000 36.08113  ?  55  PHE B CB  1 
ATOM   1805 C  CG  . PHE B  1 55  ? 28.28784  35.55576  12.95900  1.000 44.13437  ?  55  PHE B CG  1 
ATOM   1806 C  CD1 . PHE B  1 55  ? 27.36494  36.33644  13.65215  1.000 41.39148  ?  55  PHE B CD1 1 
ATOM   1807 C  CD2 . PHE B  1 55  ? 29.34730  35.01574  13.66348  1.000 48.51316  ?  55  PHE B CD2 1 
ATOM   1808 C  CE1 . PHE B  1 55  ? 27.52484  36.62142  15.01035  1.000 38.52989  ?  55  PHE B CE1 1 
ATOM   1809 C  CE2 . PHE B  1 55  ? 29.51025  35.29500  15.02091  1.000 48.32413  ?  55  PHE B CE2 1 
ATOM   1810 C  CZ  . PHE B  1 55  ? 28.59174  36.09776  15.69245  1.000 39.47636  ?  55  PHE B CZ  1 
ATOM   1811 N  N   . LEU B  1 56  ? 26.46796  33.62834  8.96054   1.000 36.36332  ?  56  LEU B N   1 
ATOM   1812 C  CA  . LEU B  1 56  ? 25.96384  33.63202  7.58946   1.000 43.20125  ?  56  LEU B CA  1 
ATOM   1813 C  C   . LEU B  1 56  ? 24.43206  33.64972  7.56661   1.000 42.57851  ?  56  LEU B C   1 
ATOM   1814 O  O   . LEU B  1 56  ? 23.82094  34.37639  6.77013   1.000 38.51078  ?  56  LEU B O   1 
ATOM   1815 C  CB  . LEU B  1 56  ? 26.50453  32.42286  6.82455   1.000 42.81641  ?  56  LEU B CB  1 
ATOM   1816 C  CG  . LEU B  1 56  ? 26.28999  32.44198  5.30508   1.000 43.33599  ?  56  LEU B CG  1 
ATOM   1817 C  CD1 . LEU B  1 56  ? 26.89736  33.69434  4.72930   1.000 40.26520  ?  56  LEU B CD1 1 
ATOM   1818 C  CD2 . LEU B  1 56  ? 26.88418  31.19004  4.63276   1.000 42.46763  ?  56  LEU B CD2 1 
ATOM   1819 N  N   . HIS B  1 57  ? 23.80066  32.87464  8.45112   1.000 38.75673  ?  57  HIS B N   1 
ATOM   1820 C  CA  . HIS B  1 57  ? 22.34830  32.90279  8.54958   1.000 40.10260  ?  57  HIS B CA  1 
ATOM   1821 C  C   . HIS B  1 57  ? 21.85468  34.27446  9.00963   1.000 44.06067  ?  57  HIS B C   1 
ATOM   1822 O  O   . HIS B  1 57  ? 20.85116  34.78768  8.49273   1.000 43.87542  ?  57  HIS B O   1 
ATOM   1823 C  CB  . HIS B  1 57  ? 21.85273  31.79939  9.48858   1.000 42.45875  ?  57  HIS B CB  1 
ATOM   1824 C  CG  . HIS B  1 57  ? 20.36219  31.78132  9.64171   1.000 61.47284  ?  57  HIS B CG  1 
ATOM   1825 N  ND1 . HIS B  1 57  ? 19.51928  31.23408  8.69242   1.000 67.68518  ?  57  HIS B ND1 1 
ATOM   1826 C  CD2 . HIS B  1 57  ? 19.55943  32.28940  10.60893  1.000 61.83168  ?  57  HIS B CD2 1 
ATOM   1827 C  CE1 . HIS B  1 57  ? 18.26618  31.37975  9.08461   1.000 68.29297  ?  57  HIS B CE1 1 
ATOM   1828 N  NE2 . HIS B  1 57  ? 18.26278  32.01852  10.24317  1.000 67.31047  ?  57  HIS B NE2 1 
ATOM   1829 N  N   . GLN B  1 58  ? 22.55998  34.89849  9.96190   1.000 42.64689  ?  58  GLN B N   1 
ATOM   1830 C  CA  . GLN B  1 58  ? 22.19505  36.25887  10.35731  1.000 40.16506  ?  58  GLN B CA  1 
ATOM   1831 C  C   . GLN B  1 58  ? 22.27821  37.21246  9.16973   1.000 37.87416  ?  58  GLN B C   1 
ATOM   1832 O  O   . GLN B  1 58  ? 21.41674  38.07883  9.00006   1.000 46.46613  ?  58  GLN B O   1 
ATOM   1833 C  CB  . GLN B  1 58  ? 23.08182  36.75155  11.50103  1.000 38.35032  ?  58  GLN B CB  1 
ATOM   1834 C  CG  . GLN B  1 58  ? 22.80554  36.08698  12.83581  1.000 43.40832  ?  58  GLN B CG  1 
ATOM   1835 C  CD  . GLN B  1 58  ? 21.34186  36.10794  13.19197  1.000 57.93036  ?  58  GLN B CD  1 
ATOM   1836 O  OE1 . GLN B  1 58  ? 20.71045  37.17450  13.26027  1.000 77.25557  ?  58  GLN B OE1 1 
ATOM   1837 N  NE2 . GLN B  1 58  ? 20.77120  34.92662  13.38653  1.000 59.35499  ?  58  GLN B NE2 1 
ATOM   1838 N  N   . SER B  1 59  ? 23.29108  37.04215  8.31568   1.000 38.27154  ?  59  SER B N   1 
ATOM   1839 C  CA  . SER B  1 59  ? 23.47016  37.94969  7.17892   1.000 40.50603  ?  59  SER B CA  1 
ATOM   1840 C  C   . SER B  1 59  ? 22.35673  37.78504  6.14620   1.000 45.68830  ?  59  SER B C   1 
ATOM   1841 O  O   . SER B  1 59  ? 21.82223  38.78548  5.63349   1.000 47.02235  ?  59  SER B O   1 
ATOM   1842 C  CB  . SER B  1 59  ? 24.85708  37.73234  6.54429   1.000 37.55127  ?  59  SER B CB  1 
ATOM   1843 O  OG  . SER B  1 59  ? 24.90794  38.12716  5.17787   1.000 38.61766  ?  59  SER B OG  1 
ATOM   1844 N  N   . HIS B  1 60  ? 21.98428  36.52974  5.84475   1.000 38.80447  ?  60  HIS B N   1 
ATOM   1845 C  CA  . HIS B  1 60  ? 20.88031  36.28186  4.91646   1.000 40.11441  ?  60  HIS B CA  1 
ATOM   1846 C  C   . HIS B  1 60  ? 19.55959  36.82346  5.46233   1.000 40.26867  ?  60  HIS B C   1 
ATOM   1847 O  O   . HIS B  1 60  ? 18.73605  37.36558  4.71133   1.000 45.76736  ?  60  HIS B O   1 
ATOM   1848 C  CB  . HIS B  1 60  ? 20.75759  34.78254  4.62391   1.000 41.74685  ?  60  HIS B CB  1 
ATOM   1849 C  CG  . HIS B  1 60  ? 21.89821  34.22979  3.83220   1.000 52.38595  ?  60  HIS B CG  1 
ATOM   1850 N  ND1 . HIS B  1 60  ? 22.22262  32.89024  3.81869   1.000 65.03462  ?  60  HIS B ND1 1 
ATOM   1851 C  CD2 . HIS B  1 60  ? 22.80132  34.84091  3.03108   1.000 59.98145  ?  60  HIS B CD2 1 
ATOM   1852 C  CE1 . HIS B  1 60  ? 23.27277  32.70041  3.03792   1.000 65.16859  ?  60  HIS B CE1 1 
ATOM   1853 N  NE2 . HIS B  1 60  ? 23.64043  33.86984  2.54636   1.000 57.18710  ?  60  HIS B NE2 1 
ATOM   1854 N  N   . GLU B  1 61  ? 19.34922  36.69894  6.77357   1.000 40.63616  ?  61  GLU B N   1 
ATOM   1855 C  CA  . GLU B  1 61  ? 18.12700  37.20389  7.38238   1.000 41.04222  ?  61  GLU B CA  1 
ATOM   1856 C  C   . GLU B  1 61  ? 18.10098  38.73696  7.39274   1.000 43.32979  ?  61  GLU B C   1 
ATOM   1857 O  O   . GLU B  1 61  ? 17.05318  39.34644  7.11644   1.000 43.23231  ?  61  GLU B O   1 
ATOM   1858 C  CB  . GLU B  1 61  ? 17.99143  36.59436  8.78097   1.000 45.73670  ?  61  GLU B CB  1 
ATOM   1859 C  CG  . GLU B  1 61  ? 17.51068  37.51311  9.88265   1.000 64.96244  ?  61  GLU B CG  1 
ATOM   1860 C  CD  . GLU B  1 61  ? 17.60179  36.86447  11.26785  1.000 77.44594  ?  61  GLU B CD  1 
ATOM   1861 O  OE1 . GLU B  1 61  ? 17.15485  35.70036  11.41217  1.000 72.70376  ?  61  GLU B OE1 1 
ATOM   1862 O  OE2 . GLU B  1 61  ? 18.12494  37.51988  12.20666  1.000 86.47487  -1 61  GLU B OE2 1 
ATOM   1863 N  N   . GLU B  1 62  ? 19.24774  39.38318  7.67197   1.000 39.30422  ?  62  GLU B N   1 
ATOM   1864 C  CA  . GLU B  1 62  ? 19.29385  40.84845  7.64033   1.000 48.13250  ?  62  GLU B CA  1 
ATOM   1865 C  C   . GLU B  1 62  ? 19.01034  41.37703  6.24270   1.000 47.24074  ?  62  GLU B C   1 
ATOM   1866 O  O   . GLU B  1 62  ? 18.29455  42.37787  6.08472   1.000 42.53097  ?  62  GLU B O   1 
ATOM   1867 C  CB  . GLU B  1 62  ? 20.63980  41.38240  8.13513   1.000 39.20418  ?  62  GLU B CB  1 
ATOM   1868 C  CG  . GLU B  1 62  ? 20.81655  41.37142  9.64612   1.000 46.26152  ?  62  GLU B CG  1 
ATOM   1869 C  CD  . GLU B  1 62  ? 19.74850  42.14633  10.40496  1.000 55.96022  ?  62  GLU B CD  1 
ATOM   1870 O  OE1 . GLU B  1 62  ? 19.17437  41.58913  11.36220  1.000 65.50013  ?  62  GLU B OE1 1 
ATOM   1871 O  OE2 . GLU B  1 62  ? 19.48614  43.31271  10.06526  1.000 66.29224  -1 62  GLU B OE2 1 
ATOM   1872 N  N   . ARG B  1 63  ? 19.53675  40.71178  5.21154   1.000 39.05982  ?  63  ARG B N   1 
ATOM   1873 C  CA  . ARG B  1 63  ? 19.21660  41.16488  3.86235   1.000 39.61680  ?  63  ARG B CA  1 
ATOM   1874 C  C   . ARG B  1 63  ? 17.74305  40.91349  3.50539   1.000 42.00886  ?  63  ARG B C   1 
ATOM   1875 O  O   . ARG B  1 63  ? 17.13930  41.73100  2.79799   1.000 44.27973  ?  63  ARG B O   1 
ATOM   1876 C  CB  . ARG B  1 63  ? 20.15976  40.52523  2.84559   1.000 40.25356  ?  63  ARG B CB  1 
ATOM   1877 C  CG  . ARG B  1 63  ? 19.62686  39.36398  2.10821   1.000 61.48552  ?  63  ARG B CG  1 
ATOM   1878 C  CD  . ARG B  1 63  ? 20.20838  39.32121  0.70955   1.000 70.47840  ?  63  ARG B CD  1 
ATOM   1879 N  NE  . ARG B  1 63  ? 19.80210  40.44383  -0.14027  1.000 72.47781  ?  63  ARG B NE  1 
ATOM   1880 C  CZ  . ARG B  1 63  ? 20.25245  40.62487  -1.38260  1.000 68.08139  ?  63  ARG B CZ  1 
ATOM   1881 N  NH1 . ARG B  1 63  ? 19.83170  41.63766  -2.10307  1.000 62.78343  ?  63  ARG B NH1 1 
ATOM   1882 N  NH2 . ARG B  1 63  ? 21.13254  39.78017  -1.91175  1.000 80.44902  ?  63  ARG B NH2 1 
ATOM   1883 N  N   . GLU B  1 64  ? 17.13080  39.82546  3.99412   1.000 45.04253  ?  64  GLU B N   1 
ATOM   1884 C  CA  . GLU B  1 64  ? 15.67788  39.68179  3.80295   1.000 53.58811  ?  64  GLU B CA  1 
ATOM   1885 C  C   . GLU B  1 64  ? 14.91081  40.82748  4.46230   1.000 41.64947  ?  64  GLU B C   1 
ATOM   1886 O  O   . GLU B  1 64  ? 13.92643  41.32330  3.90815   1.000 42.20957  ?  64  GLU B O   1 
ATOM   1887 C  CB  . GLU B  1 64  ? 15.18635  38.34797  4.35628   1.000 49.22295  ?  64  GLU B CB  1 
ATOM   1888 C  CG  . GLU B  1 64  ? 15.50488  37.17204  3.48529   1.000 52.33209  ?  64  GLU B CG  1 
ATOM   1889 C  CD  . GLU B  1 64  ? 15.09526  35.86568  4.14540   1.000 61.33732  ?  64  GLU B CD  1 
ATOM   1890 O  OE1 . GLU B  1 64  ? 13.89315  35.71985  4.46926   1.000 69.21100  ?  64  GLU B OE1 1 
ATOM   1891 O  OE2 . GLU B  1 64  ? 15.98757  35.00833  4.37315   1.000 68.61469  -1 64  GLU B OE2 1 
ATOM   1892 N  N   . HIS B  1 65  ? 15.34015  41.24337  5.65887   1.000 42.07956  ?  65  HIS B N   1 
ATOM   1893 C  CA  . HIS B  1 65  ? 14.76211  42.42942  6.28842   1.000 47.31605  ?  65  HIS B CA  1 
ATOM   1894 C  C   . HIS B  1 65  ? 14.91845  43.66008  5.39037   1.000 43.93385  ?  65  HIS B C   1 
ATOM   1895 O  O   . HIS B  1 65  ? 13.99080  44.47540  5.25504   1.000 47.31452  ?  65  HIS B O   1 
ATOM   1896 C  CB  . HIS B  1 65  ? 15.41721  42.67283  7.65220   1.000 52.05270  ?  65  HIS B CB  1 
ATOM   1897 C  CG  . HIS B  1 65  ? 14.96883  41.72987  8.72658   1.000 67.91288  ?  65  HIS B CG  1 
ATOM   1898 N  ND1 . HIS B  1 65  ? 15.71720  41.48636  9.86010   1.000 74.59970  ?  65  HIS B ND1 1 
ATOM   1899 C  CD2 . HIS B  1 65  ? 13.84368  40.98498  8.85237   1.000 77.85689  ?  65  HIS B CD2 1 
ATOM   1900 C  CE1 . HIS B  1 65  ? 15.08413  40.61475  10.62622  1.000 76.16835  ?  65  HIS B CE1 1 
ATOM   1901 N  NE2 . HIS B  1 65  ? 13.94374  40.29575  10.03916  1.000 80.68008  ?  65  HIS B NE2 1 
ATOM   1902 N  N   . ALA B  1 66  ? 16.08232  43.80341  4.75538   1.000 40.59975  ?  66  ALA B N   1 
ATOM   1903 C  CA  . ALA B  1 66  ? 16.27196  44.93572  3.84611   1.000 55.05001  ?  66  ALA B CA  1 
ATOM   1904 C  C   . ALA B  1 66  ? 15.25990  44.89413  2.69836   1.000 52.33870  ?  66  ALA B C   1 
ATOM   1905 O  O   . ALA B  1 66  ? 14.67084  45.92119  2.32352   1.000 42.15340  ?  66  ALA B O   1 
ATOM   1906 C  CB  . ALA B  1 66  ? 17.70097  44.94350  3.30890   1.000 40.91247  ?  66  ALA B CB  1 
ATOM   1907 N  N   . GLU B  1 67  ? 15.04744  43.70562  2.13278   1.000 42.08675  ?  67  GLU B N   1 
ATOM   1908 C  CA  . GLU B  1 67  ? 14.17647  43.60771  0.97199   1.000 41.91929  ?  67  GLU B CA  1 
ATOM   1909 C  C   . GLU B  1 67  ? 12.72600  43.82766  1.36694   1.000 46.73137  ?  67  GLU B C   1 
ATOM   1910 O  O   . GLU B  1 67  ? 11.94489  44.35665  0.57538   1.000 42.74622  ?  67  GLU B O   1 
ATOM   1911 C  CB  . GLU B  1 67  ? 14.33936  42.25287  0.29084   1.000 42.89121  ?  67  GLU B CB  1 
ATOM   1912 C  CG  . GLU B  1 67  ? 15.62289  42.07761  -0.48030  1.000 52.60056  ?  67  GLU B CG  1 
ATOM   1913 C  CD  . GLU B  1 67  ? 15.85734  40.61714  -0.87493  1.000 55.61851  ?  67  GLU B CD  1 
ATOM   1914 O  OE1 . GLU B  1 67  ? 14.86791  39.87766  -1.06860  1.000 61.80199  ?  67  GLU B OE1 1 
ATOM   1915 O  OE2 . GLU B  1 67  ? 17.02716  40.21455  -0.99422  1.000 55.31925  -1 67  GLU B OE2 1 
ATOM   1916 N  N   . LYS B  1 68  ? 12.33779  43.35933  2.56183   1.000 45.22771  ?  68  LYS B N   1 
ATOM   1917 C  CA  . LYS B  1 68  ? 11.01157  43.65644  3.08096   1.000 43.50872  ?  68  LYS B CA  1 
ATOM   1918 C  C   . LYS B  1 68  ? 10.80456  45.15905  3.20419   1.000 52.18957  ?  68  LYS B C   1 
ATOM   1919 O  O   . LYS B  1 68  ? 9.72870   45.66824  2.87359   1.000 43.87489  ?  68  LYS B O   1 
ATOM   1920 C  CB  . LYS B  1 68  ? 10.79580  42.97834  4.43166   1.000 44.58912  ?  68  LYS B CB  1 
ATOM   1921 C  CG  . LYS B  1 68  ? 9.37200   43.24407  5.02181   1.000 52.92597  ?  68  LYS B CG  1 
ATOM   1922 C  CD  . LYS B  1 68  ? 8.90684   42.11455  5.96033   1.000 58.06168  ?  68  LYS B CD  1 
ATOM   1923 N  N   . LEU B  1 69  ? 11.84360  45.89267  3.64387   1.000 42.65617  ?  69  LEU B N   1 
ATOM   1924 C  CA  . LEU B  1 69  ? 11.70628  47.34247  3.75795   1.000 43.15518  ?  69  LEU B CA  1 
ATOM   1925 C  C   . LEU B  1 69  ? 11.63534  48.01010  2.38310   1.000 45.73888  ?  69  LEU B C   1 
ATOM   1926 O  O   . LEU B  1 69  ? 10.90225  48.98684  2.20207   1.000 43.45166  ?  69  LEU B O   1 
ATOM   1927 C  CB  . LEU B  1 69  ? 12.84362  47.90253  4.59703   1.000 43.55340  ?  69  LEU B CB  1 
ATOM   1928 C  CG  . LEU B  1 69  ? 12.67309  47.69757  6.10003   1.000 44.81320  ?  69  LEU B CG  1 
ATOM   1929 C  CD1 . LEU B  1 69  ? 14.02771  47.80691  6.77745   1.000 45.05917  ?  69  LEU B CD1 1 
ATOM   1930 C  CD2 . LEU B  1 69  ? 11.69552  48.69861  6.67620   1.000 53.82060  ?  69  LEU B CD2 1 
ATOM   1931 N  N   . MET B  1 70  ? 12.35929  47.47935  1.39376   1.000 44.41762  ?  70  MET B N   1 
ATOM   1932 C  CA  . MET B  1 70  ? 12.25228  48.01734  0.03569   1.000 42.76950  ?  70  MET B CA  1 
ATOM   1933 C  C   . MET B  1 70  ? 10.85156  47.78911  -0.54022  1.000 44.48280  ?  70  MET B C   1 
ATOM   1934 O  O   . MET B  1 70  ? 10.24411  48.69170  -1.15305  1.000 45.55103  ?  70  MET B O   1 
ATOM   1935 C  CB  . MET B  1 70  ? 13.32038  47.37854  -0.85490  1.000 43.09651  ?  70  MET B CB  1 
ATOM   1936 C  CG  . MET B  1 70  ? 14.74547  47.65730  -0.40234  1.000 43.29436  ?  70  MET B CG  1 
ATOM   1937 S  SD  . MET B  1 70  ? 16.03390  46.77005  -1.30325  1.000 44.19739  ?  70  MET B SD  1 
ATOM   1938 C  CE  . MET B  1 70  ? 16.00754  47.48575  -2.93252  1.000 46.46718  ?  70  MET B CE  1 
ATOM   1939 N  N   . LYS B  1 71  ? 10.31302  46.58988  -0.32393  1.000 43.12352  ?  71  LYS B N   1 
ATOM   1940 C  CA  . LYS B  1 71  ? 8.94842   46.29601  -0.72894  1.000 48.85238  ?  71  LYS B CA  1 
ATOM   1941 C  C   . LYS B  1 71  ? 7.94272   47.21818  -0.03183  1.000 45.94645  ?  71  LYS B C   1 
ATOM   1942 O  O   . LYS B  1 71  ? 6.96807   47.66104  -0.65101  1.000 50.95562  ?  71  LYS B O   1 
ATOM   1943 C  CB  . LYS B  1 71  ? 8.64390   44.82775  -0.43555  1.000 44.97301  ?  71  LYS B CB  1 
ATOM   1944 C  CG  . LYS B  1 71  ? 7.19419   44.49976  -0.47765  1.000 46.60501  ?  71  LYS B CG  1 
ATOM   1945 C  CD  . LYS B  1 71  ? 6.93876   42.97969  -0.52470  1.000 48.65542  ?  71  LYS B CD  1 
ATOM   1946 C  CE  . LYS B  1 71  ? 5.45342   42.74925  -0.71761  1.000 51.04676  ?  71  LYS B CE  1 
ATOM   1947 N  NZ  . LYS B  1 71  ? 5.15655   41.35328  -1.08471  1.000 67.07972  ?  71  LYS B NZ  1 
ATOM   1948 N  N   . LEU B  1 72  ? 8.13775   47.47270  1.26954   1.000 44.18525  ?  72  LEU B N   1 
ATOM   1949 C  CA  . LEU B  1 72  ? 7.27570   48.40350  1.98698   1.000 46.03399  ?  72  LEU B CA  1 
ATOM   1950 C  C   . LEU B  1 72  ? 7.36532   49.79774  1.37436   1.000 52.52325  ?  72  LEU B C   1 
ATOM   1951 O  O   . LEU B  1 72  ? 6.34427   50.46890  1.19581   1.000 45.49607  ?  72  LEU B O   1 
ATOM   1952 C  CB  . LEU B  1 72  ? 7.63780   48.44193  3.47886   1.000 45.97881  ?  72  LEU B CB  1 
ATOM   1953 C  CG  . LEU B  1 72  ? 6.79844   49.30761  4.46010   1.000 48.05220  ?  72  LEU B CG  1 
ATOM   1954 C  CD1 . LEU B  1 72  ? 7.30407   50.72575  4.57705   1.000 48.41343  ?  72  LEU B CD1 1 
ATOM   1955 C  CD2 . LEU B  1 72  ? 5.30475   49.32569  4.15927   1.000 49.25863  ?  72  LEU B CD2 1 
ATOM   1956 N  N   . GLN B  1 73  ? 8.58088   50.23982  1.03410   1.000 49.03451  ?  73  GLN B N   1 
ATOM   1957 C  CA  . GLN B  1 73  ? 8.73276   51.53747  0.38556   1.000 49.51865  ?  73  GLN B CA  1 
ATOM   1958 C  C   . GLN B  1 73  ? 7.87616   51.61426  -0.87035  1.000 44.56672  ?  73  GLN B C   1 
ATOM   1959 O  O   . GLN B  1 73  ? 7.17270   52.61256  -1.09913  1.000 47.36606  ?  73  GLN B O   1 
ATOM   1960 C  CB  . GLN B  1 73  ? 10.20440  51.80163  0.06306   1.000 44.89299  ?  73  GLN B CB  1 
ATOM   1961 C  CG  . GLN B  1 73  ? 10.48196  53.18404  -0.49146  1.000 58.40112  ?  73  GLN B CG  1 
ATOM   1962 C  CD  . GLN B  1 73  ? 10.46749  54.25137  0.59205   1.000 56.89533  ?  73  GLN B CD  1 
ATOM   1963 O  OE1 . GLN B  1 73  ? 9.41078   54.76116  0.96328   1.000 48.48509  ?  73  GLN B OE1 1 
ATOM   1964 N  NE2 . GLN B  1 73  ? 11.63440  54.56504  1.12299   1.000 49.25893  ?  73  GLN B NE2 1 
ATOM   1965 N  N   . ASN B  1 74  ? 7.89600   50.55751  -1.67492  1.000 51.35371  ?  74  ASN B N   1 
ATOM   1966 C  CA  . ASN B  1 74  ? 7.09475   50.56640  -2.89354  1.000 49.31326  ?  74  ASN B CA  1 
ATOM   1967 C  C   . ASN B  1 74  ? 5.59893   50.49180  -2.60588  1.000 45.35614  ?  74  ASN B C   1 
ATOM   1968 O  O   . ASN B  1 74  ? 4.80476   51.17364  -3.26961  1.000 46.51947  ?  74  ASN B O   1 
ATOM   1969 C  CB  . ASN B  1 74  ? 7.52498   49.44941  -3.83800  1.000 50.85536  ?  74  ASN B CB  1 
ATOM   1970 C  CG  . ASN B  1 74  ? 8.81197   49.78776  -4.55715  1.000 46.31912  ?  74  ASN B CG  1 
ATOM   1971 O  OD1 . ASN B  1 74  ? 9.02299   50.94457  -4.92343  1.000 54.29980  ?  74  ASN B OD1 1 
ATOM   1972 N  ND2 . ASN B  1 74  ? 9.61282   48.79423  -4.85205  1.000 46.18444  ?  74  ASN B ND2 1 
ATOM   1973 N  N   . GLN B  1 75  ? 5.18401   49.68132  -1.62308  1.000 46.93774  ?  75  GLN B N   1 
ATOM   1974 C  CA  . GLN B  1 75  ? 3.74550   49.57681  -1.33294  1.000 46.36205  ?  75  GLN B CA  1 
ATOM   1975 C  C   . GLN B  1 75  ? 3.13885   50.92572  -0.98291  1.000 63.27321  ?  75  GLN B C   1 
ATOM   1976 O  O   . GLN B  1 75  ? 1.98192   51.20905  -1.34985  1.000 51.82609  ?  75  GLN B O   1 
ATOM   1977 C  CB  . GLN B  1 75  ? 3.49223   48.58216  -0.20355  1.000 47.48704  ?  75  GLN B CB  1 
ATOM   1978 C  CG  . GLN B  1 75  ? 3.66888   47.14855  -0.66884  1.000 48.13531  ?  75  GLN B CG  1 
ATOM   1979 C  CD  . GLN B  1 75  ? 3.66718   46.15650  0.47010   1.000 59.63445  ?  75  GLN B CD  1 
ATOM   1980 O  OE1 . GLN B  1 75  ? 4.50534   46.23176  1.37308   1.000 53.57186  ?  75  GLN B OE1 1 
ATOM   1981 N  NE2 . GLN B  1 75  ? 2.70897   45.23073  0.45082   1.000 55.00391  ?  75  GLN B NE2 1 
ATOM   1982 N  N   . ARG B  1 76  ? 3.91671   51.78307  -0.30370  1.000 46.75116  ?  76  ARG B N   1 
ATOM   1983 C  CA  . ARG B  1 76  ? 3.41557   53.05340  0.16878   1.000 51.66522  ?  76  ARG B CA  1 
ATOM   1984 C  C   . ARG B  1 76  ? 3.54550   54.13734  -0.88613  1.000 59.90624  ?  76  ARG B C   1 
ATOM   1985 O  O   . ARG B  1 76  ? 3.02830   55.24446  -0.68932  1.000 49.38819  ?  76  ARG B O   1 
ATOM   1986 C  CB  . ARG B  1 76  ? 4.13238   53.43496  1.47143   1.000 47.92191  ?  76  ARG B CB  1 
ATOM   1987 C  CG  . ARG B  1 76  ? 3.84487   52.43117  2.61041   1.000 49.44961  ?  76  ARG B CG  1 
ATOM   1988 C  CD  . ARG B  1 76  ? 2.32691   52.36154  2.94089   1.000 49.02424  ?  76  ARG B CD  1 
ATOM   1989 N  NE  . ARG B  1 76  ? 1.77864   53.70736  3.10476   1.000 48.90170  ?  76  ARG B NE  1 
ATOM   1990 C  CZ  . ARG B  1 76  ? 1.68309   54.35652  4.26011   1.000 49.58839  ?  76  ARG B CZ  1 
ATOM   1991 N  NH1 . ARG B  1 76  ? 2.05562   53.78716  5.39184   1.000 49.28751  ?  76  ARG B NH1 1 
ATOM   1992 N  NH2 . ARG B  1 76  ? 1.20051   55.58619  4.28199   1.000 50.65447  ?  76  ARG B NH2 1 
ATOM   1993 N  N   . GLY B  1 77  ? 4.16453   53.80989  -2.01857  1.000 54.55517  ?  77  GLY B N   1 
ATOM   1994 C  CA  . GLY B  1 77  ? 4.32204   54.71812  -3.12424  1.000 48.78498  ?  77  GLY B CA  1 
ATOM   1995 C  C   . GLY B  1 77  ? 5.53579   55.61803  -3.05253  1.000 50.07903  ?  77  GLY B C   1 
ATOM   1996 O  O   . GLY B  1 77  ? 5.66576   56.52168  -3.89104  1.000 49.87288  ?  77  GLY B O   1 
ATOM   1997 N  N   . GLY B  1 78  ? 6.41633   55.41739  -2.07046  1.000 51.34625  ?  78  GLY B N   1 
ATOM   1998 C  CA  . GLY B  1 78  ? 7.68051   56.12254  -2.04483  1.000 49.19846  ?  78  GLY B CA  1 
ATOM   1999 C  C   . GLY B  1 78  ? 8.69682   55.50432  -2.99109  1.000 54.06579  ?  78  GLY B C   1 
ATOM   2000 O  O   . GLY B  1 78  ? 8.45221   54.51005  -3.68704  1.000 48.01977  ?  78  GLY B O   1 
ATOM   2001 N  N   . ARG B  1 79  ? 9.87595   56.10952  -3.02008  1.000 58.89037  ?  79  ARG B N   1 
ATOM   2002 C  CA  . ARG B  1 79  ? 10.88999  55.74375  -3.99412  1.000 57.18706  ?  79  ARG B CA  1 
ATOM   2003 C  C   . ARG B  1 79  ? 12.17099  55.27818  -3.31851  1.000 49.90458  ?  79  ARG B C   1 
ATOM   2004 O  O   . ARG B  1 79  ? 12.66823  55.92417  -2.39345  1.000 56.21478  ?  79  ARG B O   1 
ATOM   2005 C  CB  . ARG B  1 79  ? 11.14418  56.91510  -4.93815  1.000 53.50854  ?  79  ARG B CB  1 
ATOM   2006 C  CG  . ARG B  1 79  ? 9.88893   57.16008  -5.74051  1.000 66.32079  ?  79  ARG B CG  1 
ATOM   2007 C  CD  . ARG B  1 79  ? 9.80102   56.09457  -6.79214  1.000 69.18822  ?  79  ARG B CD  1 
ATOM   2008 N  NE  . ARG B  1 79  ? 8.48881   55.98171  -7.42662  1.000 73.83834  ?  79  ARG B NE  1 
ATOM   2009 C  CZ  . ARG B  1 79  ? 7.55200   55.08900  -7.10800  1.000 75.13809  ?  79  ARG B CZ  1 
ATOM   2010 N  NH1 . ARG B  1 79  ? 7.75347   54.18805  -6.15698  1.000 67.39163  ?  79  ARG B NH1 1 
ATOM   2011 N  NH2 . ARG B  1 79  ? 6.40352   55.09779  -7.76319  1.000 72.75166  ?  79  ARG B NH2 1 
ATOM   2012 N  N   . ILE B  1 80  ? 12.66298  54.12575  -3.77728  1.000 54.99553  ?  80  ILE B N   1 
ATOM   2013 C  CA  . ILE B  1 80  ? 13.88543  53.51172  -3.26912  1.000 48.59344  ?  80  ILE B CA  1 
ATOM   2014 C  C   . ILE B  1 80  ? 15.08340  54.37372  -3.66216  1.000 47.89702  ?  80  ILE B C   1 
ATOM   2015 O  O   . ILE B  1 80  ? 15.44700  54.46487  -4.84053  1.000 49.43408  ?  80  ILE B O   1 
ATOM   2016 C  CB  . ILE B  1 80  ? 14.05661  52.08574  -3.81765  1.000 46.14563  ?  80  ILE B CB  1 
ATOM   2017 C  CG1 . ILE B  1 80  ? 12.77600  51.22998  -3.78864  1.000 57.81559  ?  80  ILE B CG1 1 
ATOM   2018 C  CG2 . ILE B  1 80  ? 15.18530  51.37647  -3.08106  1.000 48.70441  ?  80  ILE B CG2 1 
ATOM   2019 C  CD1 . ILE B  1 80  ? 12.46570  50.55530  -2.48026  1.000 46.21945  ?  80  ILE B CD1 1 
ATOM   2020 N  N   . PHE B  1 81  ? 15.74755  54.96165  -2.68598  1.000 48.36673  ?  81  PHE B N   1 
ATOM   2021 C  CA  . PHE B  1 81  ? 17.02409  55.59263  -2.98585  1.000 49.05734  ?  81  PHE B CA  1 
ATOM   2022 C  C   . PHE B  1 81  ? 18.11479  54.86318  -2.20453  1.000 48.64486  ?  81  PHE B C   1 
ATOM   2023 O  O   . PHE B  1 81  ? 18.17201  54.93405  -0.97725  1.000 51.82231  ?  81  PHE B O   1 
ATOM   2024 C  CB  . PHE B  1 81  ? 16.95476  57.08859  -2.72342  1.000 51.62082  ?  81  PHE B CB  1 
ATOM   2025 C  CG  . PHE B  1 81  ? 16.22508  57.82195  -3.80937  1.000 50.77411  ?  81  PHE B CG  1 
ATOM   2026 C  CD1 . PHE B  1 81  ? 16.84737  58.05414  -5.03007  1.000 51.15101  ?  81  PHE B CD1 1 
ATOM   2027 C  CD2 . PHE B  1 81  ? 14.91094  58.19908  -3.64712  1.000 50.90031  ?  81  PHE B CD2 1 
ATOM   2028 C  CE1 . PHE B  1 81  ? 16.20209  58.70101  -6.04798  1.000 51.68493  ?  81  PHE B CE1 1 
ATOM   2029 C  CE2 . PHE B  1 81  ? 14.23226  58.85123  -4.67314  1.000 63.77314  ?  81  PHE B CE2 1 
ATOM   2030 C  CZ  . PHE B  1 81  ? 14.87434  59.10152  -5.87918  1.000 60.52885  ?  81  PHE B CZ  1 
ATOM   2031 N  N   . LEU B  1 82  ? 18.94243  54.10904  -2.91141  1.000 48.23197  ?  82  LEU B N   1 
ATOM   2032 C  CA  . LEU B  1 82  ? 19.93411  53.27400  -2.24996  1.000 47.76867  ?  82  LEU B CA  1 
ATOM   2033 C  C   . LEU B  1 82  ? 21.25007  54.01739  -2.12746  1.000 48.69789  ?  82  LEU B C   1 
ATOM   2034 O  O   . LEU B  1 82  ? 21.55594  54.89952  -2.93035  1.000 49.52291  ?  82  LEU B O   1 
ATOM   2035 C  CB  . LEU B  1 82  ? 20.14943  51.95771  -3.00613  1.000 46.83222  ?  82  LEU B CB  1 
ATOM   2036 C  CG  . LEU B  1 82  ? 18.98898  50.98608  -3.13430  1.000 45.86791  ?  82  LEU B CG  1 
ATOM   2037 C  CD1 . LEU B  1 82  ? 19.33102  49.94253  -4.15360  1.000 45.27898  ?  82  LEU B CD1 1 
ATOM   2038 C  CD2 . LEU B  1 82  ? 18.69492  50.34172  -1.79782  1.000 45.25673  ?  82  LEU B CD2 1 
ATOM   2039 N  N   . GLN B  1 83  ? 22.03054  53.66337  -1.10940  1.000 48.63971  ?  83  GLN B N   1 
ATOM   2040 C  CA  . GLN B  1 83  ? 23.35622  54.26717  -0.96260  1.000 55.42062  ?  83  GLN B CA  1 
ATOM   2041 C  C   . GLN B  1 83  ? 24.42949  53.18695  -0.84736  1.000 60.16932  ?  83  GLN B C   1 
ATOM   2042 O  O   . GLN B  1 83  ? 24.15880  51.97875  -0.91767  1.000 47.96909  ?  83  GLN B O   1 
ATOM   2043 C  CB  . GLN B  1 83  ? 23.41703  55.23131  0.23248   1.000 57.42056  ?  83  GLN B CB  1 
ATOM   2044 C  CG  . GLN B  1 83  ? 22.75743  54.77060  1.50959   1.000 70.65053  ?  83  GLN B CG  1 
ATOM   2045 C  CD  . GLN B  1 83  ? 22.31294  55.93516  2.39090   1.000 72.87689  ?  83  GLN B CD  1 
ATOM   2046 O  OE1 . GLN B  1 83  ? 21.52757  56.76987  1.95466   1.000 80.39872  ?  83  GLN B OE1 1 
ATOM   2047 N  NE2 . GLN B  1 83  ? 22.82155  55.99773  3.62703   1.000 74.62854  ?  83  GLN B NE2 1 
ATOM   2048 N  N   . ASP B  1 84  ? 25.66793  53.64791  -0.69881  1.000 58.71714  ?  84  ASP B N   1 
ATOM   2049 C  CA  . ASP B  1 84  ? 26.78234  52.74357  -0.48519  1.000 49.65126  ?  84  ASP B CA  1 
ATOM   2050 C  C   . ASP B  1 84  ? 26.51875  51.89781  0.75272   1.000 48.90589  ?  84  ASP B C   1 
ATOM   2051 O  O   . ASP B  1 84  ? 25.99744  52.38437  1.75763   1.000 49.19975  ?  84  ASP B O   1 
ATOM   2052 C  CB  . ASP B  1 84  ? 28.10130  53.53805  -0.32083  1.000 50.94396  ?  84  ASP B CB  1 
ATOM   2053 C  CG  . ASP B  1 84  ? 28.49151  54.31900  -1.57715  1.000 61.59614  ?  84  ASP B CG  1 
ATOM   2054 O  OD1 . ASP B  1 84  ? 27.92296  54.01646  -2.64947  1.000 51.22090  ?  84  ASP B OD1 1 
ATOM   2055 O  OD2 . ASP B  1 84  ? 29.38552  55.21302  -1.50240  1.000 62.38957  -1 84  ASP B OD2 1 
ATOM   2056 N  N   . ILE B  1 85  ? 26.87135  50.61881  0.68457   1.000 47.99096  ?  85  ILE B N   1 
ATOM   2057 C  CA  . ILE B  1 85  ? 26.86574  49.78133  1.87516   1.000 47.40624  ?  85  ILE B CA  1 
ATOM   2058 C  C   . ILE B  1 85  ? 28.27236  49.84848  2.42263   1.000 48.15299  ?  85  ILE B C   1 
ATOM   2059 O  O   . ILE B  1 85  ? 29.23334  49.49204  1.73612   1.000 48.81429  ?  85  ILE B O   1 
ATOM   2060 C  CB  . ILE B  1 85  ? 26.43845  48.34026  1.58412   1.000 54.06628  ?  85  ILE B CB  1 
ATOM   2061 C  CG1 . ILE B  1 85  ? 25.04747  48.36185  0.98333   1.000 45.49052  ?  85  ILE B CG1 1 
ATOM   2062 C  CG2 . ILE B  1 85  ? 26.45305  47.48136  2.87708   1.000 45.50195  ?  85  ILE B CG2 1 
ATOM   2063 C  CD1 . ILE B  1 85  ? 24.70440  47.08119  0.23544   1.000 57.61224  ?  85  ILE B CD1 1 
ATOM   2064 N  N   . GLN B  1 86  ? 28.40809  50.37193  3.62863   1.000 48.84183  ?  86  GLN B N   1 
ATOM   2065 C  CA  . GLN B  1 86  ? 29.75073  50.61138  4.10723   1.000 51.95755  ?  86  GLN B CA  1 
ATOM   2066 C  C   . GLN B  1 86  ? 30.37371  49.29608  4.53644   1.000 49.08570  ?  86  GLN B C   1 
ATOM   2067 O  O   . GLN B  1 86  ? 29.68877  48.37591  4.99085   1.000 48.58721  ?  86  GLN B O   1 
ATOM   2068 C  CB  . GLN B  1 86  ? 29.75613  51.62883  5.24960   1.000 50.96352  ?  86  GLN B CB  1 
ATOM   2069 C  CG  . GLN B  1 86  ? 29.38291  53.05743  4.81195   1.000 52.10599  ?  86  GLN B CG  1 
ATOM   2070 C  CD  . GLN B  1 86  ? 30.56340  53.76133  4.15693   1.000 69.16136  ?  86  GLN B CD  1 
ATOM   2071 O  OE1 . GLN B  1 86  ? 30.46127  54.24823  3.02386   1.000 72.53270  ?  86  GLN B OE1 1 
ATOM   2072 N  NE2 . GLN B  1 86  ? 31.72158  53.74538  4.83667   1.000 71.31213  ?  86  GLN B NE2 1 
ATOM   2073 N  N   . LYS B  1 87  ? 31.67802  49.20182  4.36318   1.000 49.68637  ?  87  LYS B N   1 
ATOM   2074 C  CA  . LYS B  1 87  ? 32.38058  48.06669  4.91216   1.000 52.11286  ?  87  LYS B CA  1 
ATOM   2075 C  C   . LYS B  1 87  ? 32.31929  48.11839  6.43988   1.000 49.60095  ?  87  LYS B C   1 
ATOM   2076 O  O   . LYS B  1 87  ? 32.18474  49.19325  7.03097   1.000 55.15695  ?  87  LYS B O   1 
ATOM   2077 C  CB  . LYS B  1 87  ? 33.82979  48.03695  4.42746   1.000 49.97916  ?  87  LYS B CB  1 
ATOM   2078 C  CG  . LYS B  1 87  ? 34.69493  49.13074  4.95986   1.000 51.60147  ?  87  LYS B CG  1 
ATOM   2079 C  CD  . LYS B  1 87  ? 36.15625  48.71713  4.90188   1.000 62.27485  ?  87  LYS B CD  1 
ATOM   2080 C  CE  . LYS B  1 87  ? 37.08001  49.78240  5.51147   1.000 59.59625  ?  87  LYS B CE  1 
ATOM   2081 N  NZ  . LYS B  1 87  ? 38.49140  49.35571  5.37525   1.000 54.62148  ?  87  LYS B NZ  1 
ATOM   2082 N  N   . PRO B  1 88  ? 32.36408  46.96440  7.09547   1.000 51.35194  ?  88  PRO B N   1 
ATOM   2083 C  CA  . PRO B  1 88  ? 32.33831  46.93119  8.56439   1.000 54.57738  ?  88  PRO B CA  1 
ATOM   2084 C  C   . PRO B  1 88  ? 33.55309  47.61599  9.17548   1.000 56.63685  ?  88  PRO B C   1 
ATOM   2085 O  O   . PRO B  1 88  ? 34.56671  47.85200  8.51963   1.000 51.38956  ?  88  PRO B O   1 
ATOM   2086 C  CB  . PRO B  1 88  ? 32.32829  45.42915  8.87961   1.000 48.02475  ?  88  PRO B CB  1 
ATOM   2087 C  CG  . PRO B  1 88  ? 31.73895  44.81498  7.65154   1.000 55.94626  ?  88  PRO B CG  1 
ATOM   2088 C  CD  . PRO B  1 88  ? 32.22776  45.62772  6.50332   1.000 47.44893  ?  88  PRO B CD  1 
ATOM   2089 N  N   . ASP B  1 89  ? 33.43239  47.91789  10.47683  1.000 51.46488  ?  89  ASP B N   1 
ATOM   2090 C  CA  . ASP B  1 89  ? 34.49657  48.57948  11.22747  1.000 57.35740  ?  89  ASP B CA  1 
ATOM   2091 C  C   . ASP B  1 89  ? 35.75366  47.71111  11.31410  1.000 57.05911  ?  89  ASP B C   1 
ATOM   2092 O  O   . ASP B  1 89  ? 36.87672  48.23396  11.37399  1.000 54.47720  ?  89  ASP B O   1 
ATOM   2093 C  CB  . ASP B  1 89  ? 33.99585  48.91505  12.63753  1.000 62.83010  ?  89  ASP B CB  1 
ATOM   2094 C  CG  . ASP B  1 89  ? 33.03718  50.10751  12.66474  1.000 83.58941  ?  89  ASP B CG  1 
ATOM   2095 O  OD1 . ASP B  1 89  ? 32.97014  50.84540  11.66568  1.000 91.53390  ?  89  ASP B OD1 1 
ATOM   2096 O  OD2 . ASP B  1 89  ? 32.33671  50.30380  13.68498  1.000 89.42668  -1 89  ASP B OD2 1 
ATOM   2097 N  N   . GLU B  1 90  ? 35.59334  46.39463  11.30674  1.000 51.84095  ?  90  GLU B N   1 
ATOM   2098 C  CA  . GLU B  1 90  ? 36.69339  45.48870  11.57013  1.000 54.33018  ?  90  GLU B CA  1 
ATOM   2099 C  C   . GLU B  1 90  ? 36.79142  44.44813  10.46871  1.000 62.13952  ?  90  GLU B C   1 
ATOM   2100 O  O   . GLU B  1 90  ? 35.77105  43.97702  9.94748   1.000 49.28469  ?  90  GLU B O   1 
ATOM   2101 C  CB  . GLU B  1 90  ? 36.51057  44.79829  12.93346  1.000 51.77172  ?  90  GLU B CB  1 
ATOM   2102 C  CG  . GLU B  1 90  ? 36.34850  45.76542  14.10234  1.000 60.29791  ?  90  GLU B CG  1 
ATOM   2103 C  CD  . GLU B  1 90  ? 37.67500  46.28953  14.63084  1.000 70.72249  ?  90  GLU B CD  1 
ATOM   2104 O  OE1 . GLU B  1 90  ? 38.70105  46.07263  13.96834  1.000 67.93676  ?  90  GLU B OE1 1 
ATOM   2105 O  OE2 . GLU B  1 90  ? 37.66738  46.93669  15.69207  1.000 77.55475  -1 90  GLU B OE2 1 
ATOM   2106 N  N   . ASP B  1 91  ? 38.03282  44.12149  10.10324  1.000 51.05062  ?  91  ASP B N   1 
ATOM   2107 C  CA  . ASP B  1 91  ? 38.31917  42.99271  9.22885   1.000 58.40004  ?  91  ASP B CA  1 
ATOM   2108 C  C   . ASP B  1 91  ? 38.59006  41.70630  9.99519   1.000 61.82020  ?  91  ASP B C   1 
ATOM   2109 O  O   . ASP B  1 91  ? 38.26594  40.61448  9.50676   1.000 50.41690  ?  91  ASP B O   1 
ATOM   2110 C  CB  . ASP B  1 91  ? 39.54076  43.28718  8.35240   1.000 65.05560  ?  91  ASP B CB  1 
ATOM   2111 C  CG  . ASP B  1 91  ? 39.50741  44.68289  7.73911   1.000 67.19533  ?  91  ASP B CG  1 
ATOM   2112 O  OD1 . ASP B  1 91  ? 38.78503  44.87466  6.74081   1.000 55.55456  ?  91  ASP B OD1 1 
ATOM   2113 O  OD2 . ASP B  1 91  ? 40.26825  45.55361  8.22628   1.000 69.83266  -1 91  ASP B OD2 1 
ATOM   2114 N  N   . ASP B  1 92  ? 39.19133  41.84356  11.17383  1.000 64.16272  ?  92  ASP B N   1 
ATOM   2115 C  CA  . ASP B  1 92  ? 39.58403  40.76132  12.06675  1.000 60.13014  ?  92  ASP B CA  1 
ATOM   2116 C  C   . ASP B  1 92  ? 38.71957  40.87681  13.31527  1.000 50.08313  ?  92  ASP B C   1 
ATOM   2117 O  O   . ASP B  1 92  ? 38.79639  41.87993  14.02541  1.000 51.35609  ?  92  ASP B O   1 
ATOM   2118 C  CB  . ASP B  1 92  ? 41.08238  40.89852  12.40304  1.000 51.51913  ?  92  ASP B CB  1 
ATOM   2119 C  CG  . ASP B  1 92  ? 41.56555  39.92225  13.45217  1.000 51.53775  ?  92  ASP B CG  1 
ATOM   2120 O  OD1 . ASP B  1 92  ? 40.76160  39.19108  14.05836  1.000 57.55480  ?  92  ASP B OD1 1 
ATOM   2121 O  OD2 . ASP B  1 92  ? 42.78439  39.91600  13.69874  1.000 67.42991  -1 92  ASP B OD2 1 
ATOM   2122 N  N   . TRP B  1 93  ? 37.91071  39.86063  13.60296  1.000 48.76593  ?  93  TRP B N   1 
ATOM   2123 C  CA  . TRP B  1 93  ? 36.96438  39.99630  14.69674  1.000 48.74979  ?  93  TRP B CA  1 
ATOM   2124 C  C   . TRP B  1 93  ? 37.45598  39.42146  16.01299  1.000 50.23256  ?  93  TRP B C   1 
ATOM   2125 O  O   . TRP B  1 93  ? 36.68555  39.38700  16.97351  1.000 49.27241  ?  93  TRP B O   1 
ATOM   2126 C  CB  . TRP B  1 93  ? 35.63654  39.39115  14.30455  1.000 47.17208  ?  93  TRP B CB  1 
ATOM   2127 C  CG  . TRP B  1 93  ? 35.01227  40.16597  13.22052  1.000 46.91420  ?  93  TRP B CG  1 
ATOM   2128 C  CD1 . TRP B  1 93  ? 35.00411  39.85679  11.89395  1.000 63.36890  ?  93  TRP B CD1 1 
ATOM   2129 C  CD2 . TRP B  1 93  ? 34.29974  41.40102  13.35185  1.000 47.56074  ?  93  TRP B CD2 1 
ATOM   2130 N  NE1 . TRP B  1 93  ? 34.31851  40.82033  11.18272  1.000 50.22257  ?  93  TRP B NE1 1 
ATOM   2131 C  CE2 . TRP B  1 93  ? 33.87316  41.77690  12.05641  1.000 47.04807  ?  93  TRP B CE2 1 
ATOM   2132 C  CE3 . TRP B  1 93  ? 33.97881  42.22809  14.43553  1.000 48.59185  ?  93  TRP B CE3 1 
ATOM   2133 C  CZ2 . TRP B  1 93  ? 33.13496  42.93144  11.81835  1.000 47.47776  ?  93  TRP B CZ2 1 
ATOM   2134 C  CZ3 . TRP B  1 93  ? 33.24409  43.39603  14.18911  1.000 49.03467  ?  93  TRP B CZ3 1 
ATOM   2135 C  CH2 . TRP B  1 93  ? 32.84065  43.73354  12.89148  1.000 48.46063  ?  93  TRP B CH2 1 
ATOM   2136 N  N   . GLU B  1 94  ? 38.72949  39.01302  16.08738  1.000 54.19546  ?  94  GLU B N   1 
ATOM   2137 C  CA  . GLU B  1 94  ? 39.45149  38.69415  17.32305  1.000 54.01400  ?  94  GLU B CA  1 
ATOM   2138 C  C   . GLU B  1 94  ? 39.03124  37.37322  17.94891  1.000 59.02063  ?  94  GLU B C   1 
ATOM   2139 O  O   . GLU B  1 94  ? 39.90639  36.58164  18.30792  1.000 49.98196  ?  94  GLU B O   1 
ATOM   2140 C  CB  . GLU B  1 94  ? 39.30775  39.78793  18.39520  1.000 54.54693  ?  94  GLU B CB  1 
ATOM   2141 C  CG  . GLU B  1 94  ? 39.96998  41.12680  18.10951  1.000 67.62898  ?  94  GLU B CG  1 
ATOM   2142 C  CD  . GLU B  1 94  ? 39.62754  42.16541  19.17609  1.000 76.87269  ?  94  GLU B CD  1 
ATOM   2143 O  OE1 . GLU B  1 94  ? 39.46994  41.77154  20.35745  1.000 71.06072  ?  94  GLU B OE1 1 
ATOM   2144 O  OE2 . GLU B  1 94  ? 39.46292  43.36128  18.82551  1.000 81.36733  -1 94  GLU B OE2 1 
ATOM   2145 N  N   . SER B  1 95  ? 37.72494  37.13610  18.12711  1.000 48.75861  ?  95  SER B N   1 
ATOM   2146 C  CA  . SER B  1 95  ? 37.26383  35.95300  18.85159  1.000 47.90204  ?  95  SER B CA  1 
ATOM   2147 C  C   . SER B  1 95  ? 35.75138  35.80780  18.71879  1.000 51.78387  ?  95  SER B C   1 
ATOM   2148 O  O   . SER B  1 95  ? 35.05379  36.69502  18.21414  1.000 55.81277  ?  95  SER B O   1 
ATOM   2149 C  CB  . SER B  1 95  ? 37.65996  36.01525  20.33149  1.000 49.17886  ?  95  SER B CB  1 
ATOM   2150 O  OG  . SER B  1 95  ? 36.83316  36.92492  21.03386  1.000 52.19926  ?  95  SER B OG  1 
ATOM   2151 N  N   . GLY B  1 96  ? 35.25356  34.65964  19.18816  1.000 52.12326  ?  96  GLY B N   1 
ATOM   2152 C  CA  . GLY B  1 96  ? 33.82303  34.40661  19.15473  1.000 44.72160  ?  96  GLY B CA  1 
ATOM   2153 C  C   . GLY B  1 96  ? 33.05750  35.28707  20.11792  1.000 46.90449  ?  96  GLY B C   1 
ATOM   2154 O  O   . GLY B  1 96  ? 31.96881  35.77872  19.79484  1.000 48.75598  ?  96  GLY B O   1 
ATOM   2155 N  N   . LEU B  1 97  ? 33.62050  35.52114  21.30555  1.000 46.89865  ?  97  LEU B N   1 
ATOM   2156 C  CA  . LEU B  1 97  ? 32.95651  36.39283  22.26701  1.000 50.30354  ?  97  LEU B CA  1 
ATOM   2157 C  C   . LEU B  1 97  ? 32.96544  37.84244  21.79388  1.000 55.54561  ?  97  LEU B C   1 
ATOM   2158 O  O   . LEU B  1 97  ? 31.95129  38.53964  21.91170  1.000 52.45071  ?  97  LEU B O   1 
ATOM   2159 C  CB  . LEU B  1 97  ? 33.61323  36.26931  23.64116  1.000 49.24799  ?  97  LEU B CB  1 
ATOM   2160 C  CG  . LEU B  1 97  ? 33.27886  37.36428  24.66083  1.000 53.55744  ?  97  LEU B CG  1 
ATOM   2161 C  CD1 . LEU B  1 97  ? 31.83824  37.25588  25.15883  1.000 50.34621  ?  97  LEU B CD1 1 
ATOM   2162 C  CD2 . LEU B  1 97  ? 34.26474  37.31291  25.81940  1.000 52.35012  ?  97  LEU B CD2 1 
ATOM   2163 N  N   . ASN B  1 98  ? 34.10489  38.31255  21.26293  1.000 57.09608  ?  98  ASN B N   1 
ATOM   2164 C  CA  . ASN B  1 98  ? 34.18316  39.67766  20.74631  1.000 54.10707  ?  98  ASN B CA  1 
ATOM   2165 C  C   . ASN B  1 98  ? 33.23423  39.88321  19.57356  1.000 55.06291  ?  98  ASN B C   1 
ATOM   2166 O  O   . ASN B  1 98  ? 32.59028  40.93557  19.46007  1.000 49.62146  ?  98  ASN B O   1 
ATOM   2167 C  CB  . ASN B  1 98  ? 35.61022  40.02179  20.31884  1.000 56.84556  ?  98  ASN B CB  1 
ATOM   2168 C  CG  . ASN B  1 98  ? 35.74056  41.48572  19.89456  1.000 60.83676  ?  98  ASN B CG  1 
ATOM   2169 O  OD1 . ASN B  1 98  ? 35.69789  42.38305  20.73452  1.000 59.84181  ?  98  ASN B OD1 1 
ATOM   2170 N  ND2 . ASN B  1 98  ? 35.86681  41.72980  18.59180  1.000 57.16392  ?  98  ASN B ND2 1 
ATOM   2171 N  N   . ALA B  1 99  ? 33.14793  38.89314  18.68304  1.000 52.30036  ?  99  ALA B N   1 
ATOM   2172 C  CA  . ALA B  1 99  ? 32.18228  38.96239  17.59298  1.000 46.53775  ?  99  ALA B CA  1 
ATOM   2173 C  C   . ALA B  1 99  ? 30.76081  39.04918  18.12849  1.000 49.43829  ?  99  ALA B C   1 
ATOM   2174 O  O   . ALA B  1 99  ? 29.94665  39.83411  17.62377  1.000 53.19623  ?  99  ALA B O   1 
ATOM   2175 C  CB  . ALA B  1 99  ? 32.34170  37.74851  16.67243  1.000 45.11533  ?  99  ALA B CB  1 
ATOM   2176 N  N   . MET B  1 100 ? 30.44017  38.24735  19.14927  1.000 53.32421  ?  100 MET B N   1 
ATOM   2177 C  CA  . MET B  1 100 ? 29.07714  38.25043  19.67147  1.000 45.70985  ?  100 MET B CA  1 
ATOM   2178 C  C   . MET B  1 100 ? 28.74683  39.59028  20.31792  1.000 47.09865  ?  100 MET B C   1 
ATOM   2179 O  O   . MET B  1 100 ? 27.62560  40.08847  20.17733  1.000 46.93293  ?  100 MET B O   1 
ATOM   2180 C  CB  . MET B  1 100 ? 28.87240  37.09922  20.66428  1.000 45.35053  ?  100 MET B CB  1 
ATOM   2181 C  CG  . MET B  1 100 ? 28.75589  35.69104  20.04832  1.000 43.78476  ?  100 MET B CG  1 
ATOM   2182 S  SD  . MET B  1 100 ? 27.26696  35.46889  19.08514  1.000 47.92741  ?  100 MET B SD  1 
ATOM   2183 C  CE  . MET B  1 100 ? 27.35023  33.74826  18.59087  1.000 40.89565  ?  100 MET B CE  1 
ATOM   2184 N  N   . GLU B  1 101 ? 29.72107  40.19141  21.01762  1.000 50.02048  ?  101 GLU B N   1 
ATOM   2185 C  CA  . GLU B  1 101 ? 29.55515  41.52987  21.59557  1.000 55.68016  ?  101 GLU B CA  1 
ATOM   2186 C  C   . GLU B  1 101 ? 29.34065  42.59202  20.52409  1.000 53.71249  ?  101 GLU B C   1 
ATOM   2187 O  O   . GLU B  1 101 ? 28.49539  43.48340  20.68494  1.000 61.46906  ?  101 GLU B O   1 
ATOM   2188 C  CB  . GLU B  1 101 ? 30.78424  41.89980  22.43522  1.000 51.66349  ?  101 GLU B CB  1 
ATOM   2189 C  CG  . GLU B  1 101 ? 30.92732  41.12802  23.72736  1.000 52.08526  ?  101 GLU B CG  1 
ATOM   2190 C  CD  . GLU B  1 101 ? 32.25978  41.37513  24.41162  1.000 64.88186  ?  101 GLU B CD  1 
ATOM   2191 O  OE1 . GLU B  1 101 ? 33.06058  42.19244  23.89745  1.000 83.26721  ?  101 GLU B OE1 1 
ATOM   2192 O  OE2 . GLU B  1 101 ? 32.50571  40.75397  25.46848  1.000 60.15053  -1 101 GLU B OE2 1 
ATOM   2193 N  N   . ALA B  1 102 ? 30.13247  42.55152  19.44592  1.000 53.39766  ?  102 ALA B N   1 
ATOM   2194 C  CA  . ALA B  1 102 ? 29.92865  43.51628  18.36813  1.000 49.73913  ?  102 ALA B CA  1 
ATOM   2195 C  C   . ALA B  1 102 ? 28.54946  43.34219  17.74530  1.000 54.17555  ?  102 ALA B C   1 
ATOM   2196 O  O   . ALA B  1 102 ? 27.88763  44.33014  17.41956  1.000 52.26602  ?  102 ALA B O   1 
ATOM   2197 C  CB  . ALA B  1 102 ? 31.02172  43.39025  17.30536  1.000 49.52240  ?  102 ALA B CB  1 
ATOM   2198 N  N   . ALA B  1 103 ? 28.09322  42.08996  17.59870  1.000 47.14936  ?  103 ALA B N   1 
ATOM   2199 C  CA  . ALA B  1 103 ? 26.76064  41.82988  17.05581  1.000 52.26627  ?  103 ALA B CA  1 
ATOM   2200 C  C   . ALA B  1 103 ? 25.67668  42.37764  17.97060  1.000 46.63974  ?  103 ALA B C   1 
ATOM   2201 O  O   . ALA B  1 103 ? 24.68477  42.93700  17.49978  1.000 49.51210  ?  103 ALA B O   1 
ATOM   2202 C  CB  . ALA B  1 103 ? 26.54992  40.32618  16.83682  1.000 44.61542  ?  103 ALA B CB  1 
ATOM   2203 N  N   . LEU B  1 104 ? 25.84320  42.20681  19.28040  1.000 47.40087  ?  104 LEU B N   1 
ATOM   2204 C  CA  . LEU B  1 104 ? 24.88088  42.72843  20.24125  1.000 48.15218  ?  104 LEU B CA  1 
ATOM   2205 C  C   . LEU B  1 104 ? 24.80090  44.25518  20.17187  1.000 51.95390  ?  104 LEU B C   1 
ATOM   2206 O  O   . LEU B  1 104 ? 23.70205  44.83313  20.13880  1.000 49.50497  ?  104 LEU B O   1 
ATOM   2207 C  CB  . LEU B  1 104 ? 25.26851  42.26052  21.64316  1.000 48.90874  ?  104 LEU B CB  1 
ATOM   2208 C  CG  . LEU B  1 104 ? 24.46350  42.90382  22.76133  1.000 62.59703  ?  104 LEU B CG  1 
ATOM   2209 C  CD1 . LEU B  1 104 ? 23.02688  42.36861  22.70406  1.000 49.07032  ?  104 LEU B CD1 1 
ATOM   2210 C  CD2 . LEU B  1 104 ? 25.10707  42.62059  24.10260  1.000 51.12749  ?  104 LEU B CD2 1 
ATOM   2211 N  N   . HIS B  1 105 ? 25.96135  44.91474  20.11652  1.000 50.39050  ?  105 HIS B N   1 
ATOM   2212 C  CA  . HIS B  1 105 ? 26.01107  46.37059  19.97922  1.000 51.63383  ?  105 HIS B CA  1 
ATOM   2213 C  C   . HIS B  1 105 ? 25.36602  46.81839  18.67430  1.000 50.86188  ?  105 HIS B C   1 
ATOM   2214 O  O   . HIS B  1 105 ? 24.53377  47.72703  18.65877  1.000 51.36299  ?  105 HIS B O   1 
ATOM   2215 C  CB  . HIS B  1 105 ? 27.46859  46.83669  20.06203  1.000 52.76090  ?  105 HIS B CB  1 
ATOM   2216 C  CG  . HIS B  1 105 ? 27.63006  48.32441  20.07804  1.000 63.38057  ?  105 HIS B CG  1 
ATOM   2217 N  ND1 . HIS B  1 105 ? 27.81833  49.04120  21.24034  1.000 62.93978  ?  105 HIS B ND1 1 
ATOM   2218 C  CD2 . HIS B  1 105 ? 27.61190  49.23496  19.07419  1.000 64.33449  ?  105 HIS B CD2 1 
ATOM   2219 C  CE1 . HIS B  1 105 ? 27.91870  50.32817  20.95246  1.000 57.04595  ?  105 HIS B CE1 1 
ATOM   2220 N  NE2 . HIS B  1 105 ? 27.80194  50.47342  19.64434  1.000 56.11311  ?  105 HIS B NE2 1 
ATOM   2221 N  N   . LEU B  1 106 ? 25.71950  46.15897  17.57059  1.000 49.67646  ?  106 LEU B N   1 
ATOM   2222 C  CA  . LEU B  1 106 ? 25.16658  46.48807  16.26204  1.000 50.06458  ?  106 LEU B CA  1 
ATOM   2223 C  C   . LEU B  1 106 ? 23.65051  46.34350  16.23907  1.000 55.77686  ?  106 LEU B C   1 
ATOM   2224 O  O   . LEU B  1 106 ? 22.94910  47.20236  15.68338  1.000 54.98827  ?  106 LEU B O   1 
ATOM   2225 C  CB  . LEU B  1 106 ? 25.80453  45.59266  15.19387  1.000 50.27832  ?  106 LEU B CB  1 
ATOM   2226 C  CG  . LEU B  1 106 ? 25.08104  45.41215  13.86056  1.000 49.04791  ?  106 LEU B CG  1 
ATOM   2227 C  CD1 . LEU B  1 106 ? 25.40380  46.55088  12.91306  1.000 47.30524  ?  106 LEU B CD1 1 
ATOM   2228 C  CD2 . LEU B  1 106 ? 25.40320  44.05265  13.21774  1.000 45.35461  ?  106 LEU B CD2 1 
ATOM   2229 N  N   . GLU B  1 107 ? 23.12066  45.26617  16.83731  1.000 54.34364  ?  107 GLU B N   1 
ATOM   2230 C  CA  . GLU B  1 107 ? 21.66845  45.07870  16.85042  1.000 46.94733  ?  107 GLU B CA  1 
ATOM   2231 C  C   . GLU B  1 107 ? 20.97869  46.07599  17.77112  1.000 55.92791  ?  107 GLU B C   1 
ATOM   2232 O  O   . GLU B  1 107 ? 19.85451  46.49414  17.48289  1.000 48.09100  ?  107 GLU B O   1 
ATOM   2233 C  CB  . GLU B  1 107 ? 21.31019  43.66076  17.26869  1.000 45.92369  ?  107 GLU B CB  1 
ATOM   2234 C  CG  . GLU B  1 107 ? 21.75352  42.63355  16.25508  1.000 54.79778  ?  107 GLU B CG  1 
ATOM   2235 C  CD  . GLU B  1 107 ? 20.83026  42.53708  15.05830  1.000 58.11985  ?  107 GLU B CD  1 
ATOM   2236 O  OE1 . GLU B  1 107 ? 21.14851  41.74027  14.15664  1.000 65.38617  ?  107 GLU B OE1 1 
ATOM   2237 O  OE2 . GLU B  1 107 ? 19.78125  43.22377  15.02326  1.000 64.63699  -1 107 GLU B OE2 1 
ATOM   2238 N  N   . LYS B  1 108 ? 21.62214  46.46984  18.87811  1.000 53.24793  ?  108 LYS B N   1 
ATOM   2239 C  CA  . LYS B  1 108 ? 21.02642  47.51072  19.71438  1.000 56.23762  ?  108 LYS B CA  1 
ATOM   2240 C  C   . LYS B  1 108 ? 20.95051  48.81997  18.95312  1.000 55.00659  ?  108 LYS B C   1 
ATOM   2241 O  O   . LYS B  1 108 ? 19.98132  49.57521  19.09082  1.000 55.95727  ?  108 LYS B O   1 
ATOM   2242 C  CB  . LYS B  1 108 ? 21.81697  47.66987  21.00939  1.000 52.11344  ?  108 LYS B CB  1 
ATOM   2243 C  CG  . LYS B  1 108 ? 21.68282  46.46925  21.92853  1.000 52.06893  ?  108 LYS B CG  1 
ATOM   2244 C  CD  . LYS B  1 108 ? 22.37146  46.67133  23.26674  1.000 55.93151  ?  108 LYS B CD  1 
ATOM   2245 C  CE  . LYS B  1 108 ? 21.44958  47.34243  24.26076  1.000 68.29851  ?  108 LYS B CE  1 
ATOM   2246 N  NZ  . LYS B  1 108 ? 22.13665  47.59889  25.54937  1.000 73.11350  ?  108 LYS B NZ  1 
ATOM   2247 N  N   . ASN B  1 109 ? 21.93700  49.09219  18.09422  1.000 53.16357  ?  109 ASN B N   1 
ATOM   2248 C  CA  A ASN B  1 109 ? 21.89065  50.29152  17.27653  0.500 51.89535  ?  109 ASN B CA  1 
ATOM   2249 C  CA  B ASN B  1 109 ? 21.90556  50.28351  17.26243  0.500 51.88328  ?  109 ASN B CA  1 
ATOM   2250 C  C   . ASN B  1 109 ? 20.78334  50.20434  16.21428  1.000 50.81474  ?  109 ASN B C   1 
ATOM   2251 O  O   . ASN B  1 109 ? 20.01174  51.14603  16.03564  1.000 64.08202  ?  109 ASN B O   1 
ATOM   2252 C  CB  A ASN B  1 109 ? 23.25892  50.55254  16.64405  0.500 55.22692  ?  109 ASN B CB  1 
ATOM   2253 C  CB  B ASN B  1 109 ? 23.28363  50.48142  16.62366  0.500 54.98576  ?  109 ASN B CB  1 
ATOM   2254 C  CG  A ASN B  1 109 ? 24.13796  51.49318  17.49065  0.500 61.66630  ?  109 ASN B CG  1 
ATOM   2255 C  CG  B ASN B  1 109 ? 23.25216  51.29205  15.34088  0.500 55.57251  ?  109 ASN B CG  1 
ATOM   2256 O  OD1 A ASN B  1 109 ? 23.79332  51.84831  18.61979  0.500 86.12875  ?  109 ASN B OD1 1 
ATOM   2257 O  OD1 B ASN B  1 109 ? 23.25661  52.53046  15.35914  0.500 54.61949  ?  109 ASN B OD1 1 
ATOM   2258 N  ND2 A ASN B  1 109 ? 25.28123  51.88354  16.94139  0.500 56.77800  ?  109 ASN B ND2 1 
ATOM   2259 N  ND2 B ASN B  1 109 ? 23.27616  50.59394  14.21436  0.500 54.10191  ?  109 ASN B ND2 1 
ATOM   2260 N  N   . VAL B  1 110 ? 20.69303  49.05886  15.51820  1.000 53.56468  ?  110 VAL B N   1 
ATOM   2261 C  CA  . VAL B  1 110 ? 19.60401  48.85765  14.55132  1.000 48.35883  ?  110 VAL B CA  1 
ATOM   2262 C  C   . VAL B  1 110 ? 18.25860  49.04809  15.23267  1.000 48.62021  ?  110 VAL B C   1 
ATOM   2263 O  O   . VAL B  1 110 ? 17.35259  49.69762  14.69136  1.000 62.08788  ?  110 VAL B O   1 
ATOM   2264 C  CB  . VAL B  1 110 ? 19.69708  47.46360  13.89534  1.000 51.61139  ?  110 VAL B CB  1 
ATOM   2265 C  CG1 . VAL B  1 110 ? 18.34341  47.07445  13.24169  1.000 47.19349  ?  110 VAL B CG1 1 
ATOM   2266 C  CG2 . VAL B  1 110 ? 20.80345  47.40798  12.85969  1.000 46.55369  ?  110 VAL B CG2 1 
ATOM   2267 N  N   . ASN B  1 111 ? 18.12805  48.53248  16.45792  1.000 48.86542  ?  111 ASN B N   1 
ATOM   2268 C  CA  . ASN B  1 111 ? 16.89057  48.65743  17.21912  1.000 49.23673  ?  111 ASN B CA  1 
ATOM   2269 C  C   . ASN B  1 111 ? 16.59799  50.10832  17.59459  1.000 50.71301  ?  111 ASN B C   1 
ATOM   2270 O  O   . ASN B  1 111 ? 15.44415  50.54621  17.54478  1.000 50.91314  ?  111 ASN B O   1 
ATOM   2271 C  CB  . ASN B  1 111 ? 16.97385  47.78809  18.47409  1.000 49.41462  ?  111 ASN B CB  1 
ATOM   2272 C  CG  . ASN B  1 111 ? 15.65522  47.70602  19.22458  1.000 52.33743  ?  111 ASN B CG  1 
ATOM   2273 O  OD1 . ASN B  1 111 ? 14.57363  47.74710  18.61869  1.000 49.09746  ?  111 ASN B OD1 1 
ATOM   2274 N  ND2 . ASN B  1 111 ? 15.73689  47.59311  20.55651  1.000 50.44447  ?  111 ASN B ND2 1 
ATOM   2275 N  N   . GLN B  1 112 ? 17.62380  50.86242  17.99005  1.000 55.71901  ?  112 GLN B N   1 
ATOM   2276 C  CA  . GLN B  1 112 ? 17.40417  52.25858  18.33567  1.000 53.32564  ?  112 GLN B CA  1 
ATOM   2277 C  C   . GLN B  1 112 ? 16.90589  53.04576  17.12805  1.000 61.98131  ?  112 GLN B C   1 
ATOM   2278 O  O   . GLN B  1 112 ? 15.98278  53.86817  17.24621  1.000 53.83840  ?  112 GLN B O   1 
ATOM   2279 C  CB  . GLN B  1 112 ? 18.68046  52.87610  18.91008  1.000 54.59800  ?  112 GLN B CB  1 
ATOM   2280 N  N   . SER B  1 113 ? 17.45617  52.77880  15.93897  1.000 57.62978  ?  113 SER B N   1 
ATOM   2281 C  CA  . SER B  1 113 ? 16.94303  53.56379  14.81392  1.000 52.17908  ?  113 SER B CA  1 
ATOM   2282 C  C   . SER B  1 113 ? 15.56637  53.05357  14.35864  1.000 58.96296  ?  113 SER B C   1 
ATOM   2283 O  O   . SER B  1 113 ? 14.75289  53.83372  13.84419  1.000 59.55168  ?  113 SER B O   1 
ATOM   2284 C  CB  . SER B  1 113 ? 17.95911  53.60239  13.66901  1.000 52.90089  ?  113 SER B CB  1 
ATOM   2285 O  OG  . SER B  1 113 ? 17.67210  52.70116  12.63666  1.000 62.85414  ?  113 SER B OG  1 
ATOM   2286 N  N   . LEU B  1 114 ? 15.25083  51.77363  14.59946  1.000 59.38537  ?  114 LEU B N   1 
ATOM   2287 C  CA  . LEU B  1 114 ? 13.89513  51.30076  14.31468  1.000 59.66395  ?  114 LEU B CA  1 
ATOM   2288 C  C   . LEU B  1 114 ? 12.87044  51.95380  15.24367  1.000 57.16559  ?  114 LEU B C   1 
ATOM   2289 O  O   . LEU B  1 114 ? 11.75536  52.29635  14.81898  1.000 50.52994  ?  114 LEU B O   1 
ATOM   2290 C  CB  . LEU B  1 114 ? 13.84453  49.78651  14.43890  1.000 48.25629  ?  114 LEU B CB  1 
ATOM   2291 C  CG  . LEU B  1 114 ? 14.35138  49.05741  13.20285  1.000 60.81861  ?  114 LEU B CG  1 
ATOM   2292 C  CD1 . LEU B  1 114 ? 14.67005  47.58023  13.52649  1.000 52.75893  ?  114 LEU B CD1 1 
ATOM   2293 C  CD2 . LEU B  1 114 ? 13.34433  49.17645  12.06235  1.000 46.56612  ?  114 LEU B CD2 1 
ATOM   2294 N  N   . LEU B  1 115 ? 13.23477  52.12660  16.51779  1.000 51.78976  ?  115 LEU B N   1 
ATOM   2295 C  CA  . LEU B  1 115 ? 12.36315  52.81599  17.46159  1.000 52.64221  ?  115 LEU B CA  1 
ATOM   2296 C  C   . LEU B  1 115 ? 12.18070  54.26875  17.05978  1.000 59.68111  ?  115 LEU B C   1 
ATOM   2297 O  O   . LEU B  1 115 ? 11.08221  54.82418  17.18882  1.000 58.20553  ?  115 LEU B O   1 
ATOM   2298 C  CB  . LEU B  1 115 ? 12.94496  52.73841  18.87323  1.000 58.16465  ?  115 LEU B CB  1 
ATOM   2299 C  CG  . LEU B  1 115 ? 13.10732  51.36617  19.52421  1.000 55.61643  ?  115 LEU B CG  1 
ATOM   2300 C  CD1 . LEU B  1 115 ? 13.67715  51.56060  20.90433  1.000 54.46290  ?  115 LEU B CD1 1 
ATOM   2301 C  CD2 . LEU B  1 115 ? 11.78652  50.62370  19.59602  1.000 57.74632  ?  115 LEU B CD2 1 
ATOM   2302 N  N   . GLU B  1 116 ? 13.25590  54.90964  16.58344  1.000 54.04535  ?  116 GLU B N   1 
ATOM   2303 C  CA  . GLU B  1 116 ? 13.11279  56.27447  16.08590  1.000 56.37867  ?  116 GLU B CA  1 
ATOM   2304 C  C   . GLU B  1 116 ? 12.20320  56.31422  14.85810  1.000 56.73371  ?  116 GLU B C   1 
ATOM   2305 O  O   . GLU B  1 116 ? 11.42808  57.26364  14.68302  1.000 54.94438  ?  116 GLU B O   1 
ATOM   2306 C  CB  . GLU B  1 116 ? 14.48565  56.88837  15.78229  1.000 61.72004  ?  116 GLU B CB  1 
ATOM   2307 N  N   . LEU B  1 117 ? 12.25980  55.28114  14.00607  1.000 52.74771  ?  117 LEU B N   1 
ATOM   2308 C  CA  . LEU B  1 117 ? 11.36867  55.26417  12.84959  1.000 52.07177  ?  117 LEU B CA  1 
ATOM   2309 C  C   . LEU B  1 117 ? 9.92923   55.12957  13.29934  1.000 52.18695  ?  117 LEU B C   1 
ATOM   2310 O  O   . LEU B  1 117 ? 9.03045   55.74795  12.72297  1.000 53.04790  ?  117 LEU B O   1 
ATOM   2311 C  CB  . LEU B  1 117 ? 11.72197  54.13706  11.89290  1.000 50.60613  ?  117 LEU B CB  1 
ATOM   2312 C  CG  . LEU B  1 117 ? 11.18114  54.29326  10.47336  1.000 63.05443  ?  117 LEU B CG  1 
ATOM   2313 C  CD1 . LEU B  1 117 ? 12.17987  53.66602  9.49893   1.000 65.74183  ?  117 LEU B CD1 1 
ATOM   2314 C  CD2 . LEU B  1 117 ? 9.82428   53.67051  10.30829  1.000 80.31980  ?  117 LEU B CD2 1 
ATOM   2315 N  N   . HIS B  1 118 ? 9.69571   54.34920  14.35315  1.000 52.07947  ?  118 HIS B N   1 
ATOM   2316 C  CA  . HIS B  1 118 ? 8.33767   54.21123  14.86804  1.000 53.04958  ?  118 HIS B CA  1 
ATOM   2317 C  C   . HIS B  1 118 ? 7.83808   55.51455  15.48488  1.000 62.88676  ?  118 HIS B C   1 
ATOM   2318 O  O   . HIS B  1 118 ? 6.66872   55.88990  15.30481  1.000 62.35998  ?  118 HIS B O   1 
ATOM   2319 C  CB  . HIS B  1 118 ? 8.26381   53.10131  15.90049  1.000 51.96871  ?  118 HIS B CB  1 
ATOM   2320 C  CG  . HIS B  1 118 ? 6.86816   52.81349  16.35037  1.000 52.39388  ?  118 HIS B CG  1 
ATOM   2321 N  ND1 . HIS B  1 118 ? 6.20629   53.59400  17.27056  1.000 55.10379  ?  118 HIS B ND1 1 
ATOM   2322 C  CD2 . HIS B  1 118 ? 5.99816   51.84602  15.98495  1.000 55.82171  ?  118 HIS B CD2 1 
ATOM   2323 C  CE1 . HIS B  1 118 ? 4.99517   53.11188  17.46760  1.000 53.37590  ?  118 HIS B CE1 1 
ATOM   2324 N  NE2 . HIS B  1 118 ? 4.84092   52.05214  16.69633  1.000 57.18840  ?  118 HIS B NE2 1 
ATOM   2325 N  N   . LYS B  1 119 ? 8.69760   56.19871  16.24298  1.000 56.33053  ?  119 LYS B N   1 
ATOM   2326 C  CA  . LYS B  1 119 ? 8.31117   57.48974  16.78819  1.000 64.02186  ?  119 LYS B CA  1 
ATOM   2327 C  C   . LYS B  1 119 ? 7.96634   58.46114  15.66870  1.000 56.71032  ?  119 LYS B C   1 
ATOM   2328 O  O   . LYS B  1 119 ? 6.93705   59.13217  15.72267  1.000 57.44879  ?  119 LYS B O   1 
ATOM   2329 C  CB  . LYS B  1 119 ? 9.41635   58.05232  17.67585  1.000 62.58293  ?  119 LYS B CB  1 
ATOM   2330 C  CG  . LYS B  1 119 ? 8.96632   59.25424  18.48576  1.000 59.41983  ?  119 LYS B CG  1 
ATOM   2331 C  CD  . LYS B  1 119 ? 10.02695  59.65002  19.49591  1.000 66.09680  ?  119 LYS B CD  1 
ATOM   2332 N  N   . LEU B  1 120 ? 8.81089   58.53166  14.63536  1.000 56.09544  ?  120 LEU B N   1 
ATOM   2333 C  CA  . LEU B  1 120 ? 8.49859   59.36078  13.47301  1.000 56.20097  ?  120 LEU B CA  1 
ATOM   2334 C  C   . LEU B  1 120 ? 7.12865   59.01445  12.90636  1.000 68.63510  ?  120 LEU B C   1 
ATOM   2335 O  O   . LEU B  1 120 ? 6.27787   59.90009  12.71177  1.000 65.20764  ?  120 LEU B O   1 
ATOM   2336 C  CB  . LEU B  1 120 ? 9.56848   59.17987  12.39805  1.000 59.76604  ?  120 LEU B CB  1 
ATOM   2337 C  CG  . LEU B  1 120 ? 9.32867   59.90118  11.06553  1.000 63.52579  ?  120 LEU B CG  1 
ATOM   2338 C  CD1 . LEU B  1 120 ? 8.92541   61.38639  11.26197  1.000 62.68507  ?  120 LEU B CD1 1 
ATOM   2339 C  CD2 . LEU B  1 120 ? 10.53567  59.77170  10.15544  1.000 54.85827  ?  120 LEU B CD2 1 
ATOM   2340 N  N   . ALA B  1 121 ? 6.88901   57.71490  12.66181  1.000 64.40272  ?  121 ALA B N   1 
ATOM   2341 C  CA  . ALA B  1 121 ? 5.66069   57.27658  12.00686  1.000 61.92625  ?  121 ALA B CA  1 
ATOM   2342 C  C   . ALA B  1 121 ? 4.42454   57.65229  12.81624  1.000 63.54173  ?  121 ALA B C   1 
ATOM   2343 O  O   . ALA B  1 121 ? 3.40307   58.06700  12.25055  1.000 54.94480  ?  121 ALA B O   1 
ATOM   2344 C  CB  . ALA B  1 121 ? 5.70452   55.76353  11.76818  1.000 52.31514  ?  121 ALA B CB  1 
ATOM   2345 N  N   . THR B  1 122 ? 4.47979   57.49229  14.13834  1.000 55.26178  ?  122 THR B N   1 
ATOM   2346 C  CA  . THR B  1 122 ? 3.30541   57.85941  14.92472  1.000 57.05063  ?  122 THR B CA  1 
ATOM   2347 C  C   . THR B  1 122 ? 3.19226   59.36437  15.12153  1.000 58.08139  ?  122 THR B C   1 
ATOM   2348 O  O   . THR B  1 122 ? 2.07628   59.88281  15.25292  1.000 60.79872  ?  122 THR B O   1 
ATOM   2349 C  CB  . THR B  1 122 ? 3.31392   57.12476  16.26599  1.000 66.14092  ?  122 THR B CB  1 
ATOM   2350 O  OG1 . THR B  1 122 ? 4.32692   57.66456  17.12223  1.000 71.11314  ?  122 THR B OG1 1 
ATOM   2351 C  CG2 . THR B  1 122 ? 3.57452   55.65013  16.04533  1.000 58.92532  ?  122 THR B CG2 1 
ATOM   2352 N  N   . ASP B  1 123 ? 4.31511   60.08400  15.09662  1.000 58.24781  ?  123 ASP B N   1 
ATOM   2353 C  CA  . ASP B  1 123 ? 4.24337   61.53645  15.04482  1.000 69.75340  ?  123 ASP B CA  1 
ATOM   2354 C  C   . ASP B  1 123 ? 3.57714   62.02378  13.75942  1.000 64.11438  ?  123 ASP B C   1 
ATOM   2355 O  O   . ASP B  1 123 ? 2.89159   63.04599  13.77798  1.000 60.49274  ?  123 ASP B O   1 
ATOM   2356 C  CB  . ASP B  1 123 ? 5.64777   62.12833  15.20695  1.000 71.54396  ?  123 ASP B CB  1 
ATOM   2357 C  CG  . ASP B  1 123 ? 6.09719   62.15178  16.66230  1.000 76.56732  ?  123 ASP B CG  1 
ATOM   2358 O  OD1 . ASP B  1 123 ? 5.20674   62.17046  17.54375  1.000 84.76570  ?  123 ASP B OD1 1 
ATOM   2359 O  OD2 . ASP B  1 123 ? 7.32260   62.13018  16.92972  1.000 72.03282  -1 123 ASP B OD2 1 
ATOM   2360 N  N   . LYS B  1 124 ? 3.74332   61.31287  12.64344  1.000 58.04112  ?  124 LYS B N   1 
ATOM   2361 C  CA  . LYS B  1 124 ? 3.11065   61.71548  11.39881  1.000 57.86535  ?  124 LYS B CA  1 
ATOM   2362 C  C   . LYS B  1 124 ? 1.74949   61.04975  11.19726  1.000 60.17495  ?  124 LYS B C   1 
ATOM   2363 O  O   . LYS B  1 124 ? 1.20535   61.10501  10.09015  1.000 59.14577  ?  124 LYS B O   1 
ATOM   2364 C  CB  . LYS B  1 124 ? 4.03960   61.43555  10.21436  1.000 56.87111  ?  124 LYS B CB  1 
ATOM   2365 C  CG  . LYS B  1 124 ? 5.42569   62.10360  10.33688  1.000 66.22354  ?  124 LYS B CG  1 
ATOM   2366 C  CD  . LYS B  1 124 ? 5.35336   63.62834  10.50382  1.000 58.90169  ?  124 LYS B CD  1 
ATOM   2367 C  CE  . LYS B  1 124 ? 6.63078   64.20432  11.12901  1.000 62.36954  ?  124 LYS B CE  1 
ATOM   2368 N  NZ  . LYS B  1 124 ? 6.37661   65.39181  12.03823  1.000 62.41757  ?  124 LYS B NZ  1 
ATOM   2369 N  N   . ASN B  1 125 ? 1.18530   60.45054  12.25102  1.000 57.56106  ?  125 ASN B N   1 
ATOM   2370 C  CA  . ASN B  1 125 ? -0.08241  59.71869  12.19135  1.000 57.21583  ?  125 ASN B CA  1 
ATOM   2371 C  C   . ASN B  1 125 ? -0.10482  58.76481  10.99956  1.000 60.76814  ?  125 ASN B C   1 
ATOM   2372 O  O   . ASN B  1 125 ? -1.01601  58.79323  10.16210  1.000 55.74538  ?  125 ASN B O   1 
ATOM   2373 C  CB  . ASN B  1 125 ? -1.27624  60.67938  12.14245  1.000 59.19775  ?  125 ASN B CB  1 
ATOM   2374 C  CG  . ASN B  1 125 ? -1.27014  61.66207  13.28402  1.000 60.93884  ?  125 ASN B CG  1 
ATOM   2375 O  OD1 . ASN B  1 125 ? -1.20900  61.27960  14.45405  1.000 65.10355  ?  125 ASN B OD1 1 
ATOM   2376 N  ND2 . ASN B  1 125 ? -1.28313  62.94814  12.94888  1.000 67.88215  ?  125 ASN B ND2 1 
ATOM   2377 N  N   . ASP B  1 126 ? 0.94487   57.92582  10.91452  1.000 54.75586  ?  126 ASP B N   1 
ATOM   2378 C  CA  . ASP B  1 126 ? 1.02486   56.89815  9.89183   1.000 53.43143  ?  126 ASP B CA  1 
ATOM   2379 C  C   . ASP B  1 126 ? 0.90345   55.54233  10.57507  1.000 56.23700  ?  126 ASP B C   1 
ATOM   2380 O  O   . ASP B  1 126 ? 1.91557   54.85880  10.80147  1.000 53.25359  ?  126 ASP B O   1 
ATOM   2381 C  CB  . ASP B  1 126 ? 2.32033   57.01621  9.10288   1.000 57.88258  ?  126 ASP B CB  1 
ATOM   2382 C  CG  . ASP B  1 126 ? 2.32055   56.18138  7.84273   1.000 53.04859  ?  126 ASP B CG  1 
ATOM   2383 O  OD1 . ASP B  1 126 ? 1.62254   55.14817  7.79338   1.000 53.69897  ?  126 ASP B OD1 1 
ATOM   2384 O  OD2 . ASP B  1 126 ? 3.02100   56.56586  6.88617   1.000 58.46305  -1 126 ASP B OD2 1 
ATOM   2385 N  N   . PRO B  1 127 ? -0.31918  55.13120  10.92735  1.000 52.83656  ?  127 PRO B N   1 
ATOM   2386 C  CA  . PRO B  1 127 ? -0.47167  53.92294  11.74145  1.000 52.28495  ?  127 PRO B CA  1 
ATOM   2387 C  C   . PRO B  1 127 ? -0.13656  52.64550  10.98392  1.000 55.76486  ?  127 PRO B C   1 
ATOM   2388 O  O   . PRO B  1 127 ? 0.33425   51.67866  11.60300  1.000 50.30607  ?  127 PRO B O   1 
ATOM   2389 C  CB  . PRO B  1 127 ? -1.94154  53.98414  12.17652  1.000 57.37561  ?  127 PRO B CB  1 
ATOM   2390 C  CG  . PRO B  1 127 ? -2.62446  54.74504  11.10755  1.000 53.44777  ?  127 PRO B CG  1 
ATOM   2391 C  CD  . PRO B  1 127 ? -1.61502  55.74656  10.59084  1.000 54.80954  ?  127 PRO B CD  1 
ATOM   2392 N  N   . HIS B  1 128 ? -0.30479  52.63167  9.65884   1.000 50.39706  ?  128 HIS B N   1 
ATOM   2393 C  CA  . HIS B  1 128 ? 0.21569   51.51930  8.87530   1.000 49.12854  ?  128 HIS B CA  1 
ATOM   2394 C  C   . HIS B  1 128 ? 1.72506   51.37681  9.05418   1.000 49.47740  ?  128 HIS B C   1 
ATOM   2395 O  O   . HIS B  1 128 ? 2.23345   50.26895  9.27742   1.000 49.68394  ?  128 HIS B O   1 
ATOM   2396 C  CB  . HIS B  1 128 ? -0.11273  51.68377  7.39293   1.000 48.92274  ?  128 HIS B CB  1 
ATOM   2397 C  CG  . HIS B  1 128 ? 0.48895   50.60504  6.54160   1.000 54.70291  ?  128 HIS B CG  1 
ATOM   2398 N  ND1 . HIS B  1 128 ? 1.68885   50.75442  5.87322   1.000 51.01047  ?  128 HIS B ND1 1 
ATOM   2399 C  CD2 . HIS B  1 128 ? 0.08381   49.33064  6.30684   1.000 46.95909  ?  128 HIS B CD2 1 
ATOM   2400 C  CE1 . HIS B  1 128 ? 1.97841   49.63051  5.23997   1.000 46.31842  ?  128 HIS B CE1 1 
ATOM   2401 N  NE2 . HIS B  1 128 ? 1.01988   48.75322  5.48217   1.000 46.08438  ?  128 HIS B NE2 1 
ATOM   2402 N  N   . LEU B  1 129 ? 2.47045   52.48548  8.92945   1.000 49.17972  ?  129 LEU B N   1 
ATOM   2403 C  CA  . LEU B  1 129 ? 3.92668   52.38971  9.02538   1.000 48.78087  ?  129 LEU B CA  1 
ATOM   2404 C  C   . LEU B  1 129 ? 4.34366   51.92941  10.41106  1.000 52.28592  ?  129 LEU B C   1 
ATOM   2405 O  O   . LEU B  1 129 ? 5.19437   51.03754  10.54735  1.000 48.03241  ?  129 LEU B O   1 
ATOM   2406 C  CB  . LEU B  1 129 ? 4.58307   53.72683  8.67476   1.000 57.54884  ?  129 LEU B CB  1 
ATOM   2407 C  CG  . LEU B  1 129 ? 6.12684   53.78188  8.72765   1.000 56.51591  ?  129 LEU B CG  1 
ATOM   2408 C  CD1 . LEU B  1 129 ? 6.75522   52.67410  7.90438   1.000 48.11841  ?  129 LEU B CD1 1 
ATOM   2409 C  CD2 . LEU B  1 129 ? 6.66516   55.14588  8.28216   1.000 50.23679  ?  129 LEU B CD2 1 
ATOM   2410 N  N   . ALA B  1 130 ? 3.73866   52.52173  11.44640  1.000 49.86244  ?  130 ALA B N   1 
ATOM   2411 C  CA  . ALA B  1 130 ? 3.94133   52.07563  12.82430  1.000 52.09624  ?  130 ALA B CA  1 
ATOM   2412 C  C   . ALA B  1 130 ? 3.76468   50.56710  12.96761  1.000 49.01190  ?  130 ALA B C   1 
ATOM   2413 O  O   . ALA B  1 130 ? 4.67162   49.87095  13.44034  1.000 48.49624  ?  130 ALA B O   1 
ATOM   2414 C  CB  . ALA B  1 130 ? 2.96233   52.78481  13.75635  1.000 52.69340  ?  130 ALA B CB  1 
ATOM   2415 N  N   . ASP B  1 131 ? 2.57526   50.05824  12.61994  1.000 48.76479  ?  131 ASP B N   1 
ATOM   2416 C  CA  . ASP B  1 131 ? 2.26826   48.65333  12.87490  1.000 54.62606  ?  131 ASP B CA  1 
ATOM   2417 C  C   . ASP B  1 131 ? 3.16041   47.73787  12.05182  1.000 46.65129  ?  131 ASP B C   1 
ATOM   2418 O  O   . ASP B  1 131 ? 3.53103   46.65855  12.51930  1.000 48.51745  ?  131 ASP B O   1 
ATOM   2419 C  CB  . ASP B  1 131 ? 0.78524   48.35810  12.59139  1.000 50.66359  ?  131 ASP B CB  1 
ATOM   2420 C  CG  . ASP B  1 131 ? 0.39273   46.91359  12.94565  1.000 58.33074  ?  131 ASP B CG  1 
ATOM   2421 O  OD1 . ASP B  1 131 ? 0.55319   46.51756  14.13368  1.000 57.01071  ?  131 ASP B OD1 1 
ATOM   2422 O  OD2 . ASP B  1 131 ? -0.06157  46.17529  12.03062  1.000 48.36184  -1 131 ASP B OD2 1 
ATOM   2423 N  N   . PHE B  1 132 ? 3.52182   48.15468  10.83381  1.000 50.56486  ?  132 PHE B N   1 
ATOM   2424 C  CA  . PHE B  1 132 ? 4.48758   47.39482  10.04968  1.000 50.16408  ?  132 PHE B CA  1 
ATOM   2425 C  C   . PHE B  1 132 ? 5.81875   47.28484  10.79019  1.000 46.52425  ?  132 PHE B C   1 
ATOM   2426 O  O   . PHE B  1 132 ? 6.37486   46.18350  10.93800  1.000 46.07905  ?  132 PHE B O   1 
ATOM   2427 C  CB  . PHE B  1 132 ? 4.67620   48.04944  8.67612   1.000 45.30451  ?  132 PHE B CB  1 
ATOM   2428 C  CG  . PHE B  1 132 ? 5.76341   47.42214  7.85678   1.000 55.59299  ?  132 PHE B CG  1 
ATOM   2429 C  CD1 . PHE B  1 132 ? 5.49327   46.33437  7.04452   1.000 62.59698  ?  132 PHE B CD1 1 
ATOM   2430 C  CD2 . PHE B  1 132 ? 7.06128   47.90301  7.91113   1.000 54.12464  ?  132 PHE B CD2 1 
ATOM   2431 C  CE1 . PHE B  1 132 ? 6.50245   45.73630  6.29614   1.000 48.49279  ?  132 PHE B CE1 1 
ATOM   2432 C  CE2 . PHE B  1 132 ? 8.06244   47.30688  7.16906   1.000 56.71210  ?  132 PHE B CE2 1 
ATOM   2433 C  CZ  . PHE B  1 132 ? 7.76859   46.21905  6.35921   1.000 48.51841  ?  132 PHE B CZ  1 
ATOM   2434 N  N   . ILE B  1 133 ? 6.34042   48.42185  11.26620  1.000 52.73868  ?  133 ILE B N   1 
ATOM   2435 C  CA  . ILE B  1 133 ? 7.60696   48.41513  11.99936  1.000 49.39532  ?  133 ILE B CA  1 
ATOM   2436 C  C   . ILE B  1 133 ? 7.49423   47.49474  13.20557  1.000 50.60500  ?  133 ILE B C   1 
ATOM   2437 O  O   . ILE B  1 133 ? 8.33999   46.61968  13.42131  1.000 55.53380  ?  133 ILE B O   1 
ATOM   2438 C  CB  . ILE B  1 133 ? 8.00860   49.84541  12.40191  1.000 49.45768  ?  133 ILE B CB  1 
ATOM   2439 C  CG1 . ILE B  1 133 ? 8.49290   50.65644  11.18499  1.000 47.51314  ?  133 ILE B CG1 1 
ATOM   2440 C  CG2 . ILE B  1 133 ? 9.07453   49.84467  13.50611  1.000 47.95293  ?  133 ILE B CG2 1 
ATOM   2441 C  CD1 . ILE B  1 133 ? 9.76985   50.18688  10.55662  1.000 47.87292  ?  133 ILE B CD1 1 
ATOM   2442 N  N   . GLU B  1 134 ? 6.40599   47.62862  13.95931  1.000 46.69987  ?  134 GLU B N   1 
ATOM   2443 C  CA  . GLU B  1 134 ? 6.12190   46.80026  15.12633  1.000 54.45216  ?  134 GLU B CA  1 
ATOM   2444 C  C   . GLU B  1 134 ? 6.20133   45.31618  14.78621  1.000 61.81189  ?  134 GLU B C   1 
ATOM   2445 O  O   . GLU B  1 134 ? 7.16030   44.63099  15.17066  1.000 74.91083  ?  134 GLU B O   1 
ATOM   2446 C  CB  . GLU B  1 134 ? 4.73249   47.12430  15.68996  1.000 54.92956  ?  134 GLU B CB  1 
ATOM   2447 C  CG  . GLU B  1 134 ? 4.62694   48.48428  16.37028  1.000 58.77893  ?  134 GLU B CG  1 
ATOM   2448 C  CD  . GLU B  1 134 ? 3.19121   48.82799  16.79444  1.000 72.64787  ?  134 GLU B CD  1 
ATOM   2449 O  OE1 . GLU B  1 134 ? 2.23225   48.42769  16.10191  1.000 65.39690  ?  134 GLU B OE1 1 
ATOM   2450 O  OE2 . GLU B  1 134 ? 3.01995   49.52340  17.82085  1.000 80.80261  -1 134 GLU B OE2 1 
ATOM   2451 N  N   . THR B  1 135 ? 5.26368   44.84967  13.96689  1.000 47.66218  ?  135 THR B N   1 
ATOM   2452 C  CA  . THR B  1 135 ? 5.06563   43.41733  13.83273  1.000 56.07971  ?  135 THR B CA  1 
ATOM   2453 C  C   . THR B  1 135 ? 6.13656   42.74245  12.97364  1.000 57.80270  ?  135 THR B C   1 
ATOM   2454 O  O   . THR B  1 135 ? 6.33681   41.52762  13.09548  1.000 59.09105  ?  135 THR B O   1 
ATOM   2455 C  CB  . THR B  1 135 ? 3.65032   43.14070  13.30724  1.000 55.78580  ?  135 THR B CB  1 
ATOM   2456 O  OG1 . THR B  1 135 ? 3.36069   44.00370  12.20374  1.000 58.76994  ?  135 THR B OG1 1 
ATOM   2457 C  CG2 . THR B  1 135 ? 2.63899   43.43643  14.41144  1.000 55.83027  ?  135 THR B CG2 1 
ATOM   2458 N  N   . HIS B  1 136 ? 6.85877   43.47161  12.12839  1.000 63.23237  ?  136 HIS B N   1 
ATOM   2459 C  CA  . HIS B  1 136 ? 7.89024   42.80388  11.34602  1.000 52.77455  ?  136 HIS B CA  1 
ATOM   2460 C  C   . HIS B  1 136 ? 9.30089   43.15005  11.79695  1.000 54.48428  ?  136 HIS B C   1 
ATOM   2461 O  O   . HIS B  1 136 ? 10.26738  42.60833  11.23763  1.000 51.12338  ?  136 HIS B O   1 
ATOM   2462 C  CB  . HIS B  1 136 ? 7.71977   43.13108  9.86040   1.000 53.02039  ?  136 HIS B CB  1 
ATOM   2463 C  CG  . HIS B  1 136 ? 6.46798   42.55709  9.26147   1.000 55.49764  ?  136 HIS B CG  1 
ATOM   2464 N  ND1 . HIS B  1 136 ? 5.59982   43.30632  8.49646   1.000 58.49012  ?  136 HIS B ND1 1 
ATOM   2465 C  CD2 . HIS B  1 136 ? 5.94680   41.30769  9.30285   1.000 55.44337  ?  136 HIS B CD2 1 
ATOM   2466 C  CE1 . HIS B  1 136 ? 4.58746   42.55140  8.10848   1.000 63.84112  ?  136 HIS B CE1 1 
ATOM   2467 N  NE2 . HIS B  1 136 ? 4.77594   41.33143  8.58136   1.000 60.45225  ?  136 HIS B NE2 1 
ATOM   2468 N  N   . TYR B  1 137 ? 9.47098   44.01898  12.79329  1.000 51.91463  ?  137 TYR B N   1 
ATOM   2469 C  CA  . TYR B  1 137 ? 10.84662  44.37699  13.10037  1.000 47.65097  ?  137 TYR B CA  1 
ATOM   2470 C  C   . TYR B  1 137 ? 11.10190  44.40003  14.59620  1.000 53.88568  ?  137 TYR B C   1 
ATOM   2471 O  O   . TYR B  1 137 ? 12.17875  43.97659  15.03215  1.000 65.35320  ?  137 TYR B O   1 
ATOM   2472 C  CB  . TYR B  1 137 ? 11.21922  45.72353  12.43076  1.000 54.06006  ?  137 TYR B CB  1 
ATOM   2473 C  CG  . TYR B  1 137 ? 11.47967  45.52442  10.94336  1.000 59.91152  ?  137 TYR B CG  1 
ATOM   2474 C  CD1 . TYR B  1 137 ? 10.40865  45.46929  10.04224  1.000 59.11984  ?  137 TYR B CD1 1 
ATOM   2475 C  CD2 . TYR B  1 137 ? 12.78246  45.33498  10.44363  1.000 47.29329  ?  137 TYR B CD2 1 
ATOM   2476 C  CE1 . TYR B  1 137 ? 10.60724  45.23269  8.69760   1.000 54.43040  ?  137 TYR B CE1 1 
ATOM   2477 C  CE2 . TYR B  1 137 ? 12.99483  45.10559  9.08712   1.000 46.76229  ?  137 TYR B CE2 1 
ATOM   2478 C  CZ  . TYR B  1 137 ? 11.89525  45.05261  8.21973   1.000 58.19829  ?  137 TYR B CZ  1 
ATOM   2479 O  OH  . TYR B  1 137 ? 12.05436  44.82534  6.86552   1.000 60.72302  ?  137 TYR B OH  1 
ATOM   2480 N  N   . LEU B  1 138 ? 10.14057  44.84926  15.40800  1.000 55.02936  ?  138 LEU B N   1 
ATOM   2481 C  CA  . LEU B  1 138 ? 10.53918  45.23445  16.76071  1.000 55.87642  ?  138 LEU B CA  1 
ATOM   2482 C  C   . LEU B  1 138 ? 10.65886  44.02589  17.68879  1.000 59.07624  ?  138 LEU B C   1 
ATOM   2483 O  O   . LEU B  1 138 ? 11.62875  43.92600  18.46002  1.000 48.56103  ?  138 LEU B O   1 
ATOM   2484 C  CB  . LEU B  1 138 ? 9.58074   46.28998  17.31135  1.000 58.05745  ?  138 LEU B CB  1 
ATOM   2485 C  CG  . LEU B  1 138 ? 9.55309   47.52673  16.40273  1.000 62.37479  ?  138 LEU B CG  1 
ATOM   2486 C  CD1 . LEU B  1 138 ? 8.94632   48.71182  17.10502  1.000 61.15594  ?  138 LEU B CD1 1 
ATOM   2487 C  CD2 . LEU B  1 138 ? 10.95770  47.88637  15.90174  1.000 69.29217  ?  138 LEU B CD2 1 
ATOM   2488 N  N   . ASN B  1 139 ? 9.73429   43.06525  17.60420  1.000 49.25177  ?  139 ASN B N   1 
ATOM   2489 C  CA  . ASN B  1 139 ? 9.93133   41.87803  18.42999  1.000 58.11506  ?  139 ASN B CA  1 
ATOM   2490 C  C   . ASN B  1 139 ? 11.06514  41.00110  17.90367  1.000 53.81052  ?  139 ASN B C   1 
ATOM   2491 O  O   . ASN B  1 139 ? 11.72758  40.30930  18.68650  1.000 53.90325  ?  139 ASN B O   1 
ATOM   2492 C  CB  . ASN B  1 139 ? 8.64242   41.07154  18.56112  1.000 61.95784  ?  139 ASN B CB  1 
ATOM   2493 C  CG  . ASN B  1 139 ? 8.72691   40.07072  19.69663  1.000 67.39413  ?  139 ASN B CG  1 
ATOM   2494 O  OD1 . ASN B  1 139 ? 8.89959   40.45012  20.86279  1.000 71.97916  ?  139 ASN B OD1 1 
ATOM   2495 N  ND2 . ASN B  1 139 ? 8.61288   38.79049  19.37003  1.000 59.58723  ?  139 ASN B ND2 1 
ATOM   2496 N  N   . GLU B  1 140 ? 11.31872  41.02760  16.59625  1.000 48.41989  ?  140 GLU B N   1 
ATOM   2497 C  CA  . GLU B  1 140 ? 12.43559  40.27094  16.07586  1.000 41.75281  ?  140 GLU B CA  1 
ATOM   2498 C  C   . GLU B  1 140 ? 13.74588  40.86517  16.57458  1.000 47.40965  ?  140 GLU B C   1 
ATOM   2499 O  O   . GLU B  1 140 ? 14.66829  40.13087  16.93748  1.000 55.51261  ?  140 GLU B O   1 
ATOM   2500 C  CB  . GLU B  1 140 ? 12.38298  40.22196  14.55217  1.000 43.76251  ?  140 GLU B CB  1 
ATOM   2501 C  CG  . GLU B  1 140 ? 11.95098  38.84317  13.99722  1.000 54.24661  ?  140 GLU B CG  1 
ATOM   2502 C  CD  . GLU B  1 140 ? 13.03192  37.73906  14.15985  1.000 77.97961  ?  140 GLU B CD  1 
ATOM   2503 O  OE1 . GLU B  1 140 ? 13.97810  37.66181  13.33017  1.000 79.19534  ?  140 GLU B OE1 1 
ATOM   2504 O  OE2 . GLU B  1 140 ? 12.92858  36.94412  15.12814  1.000 85.66545  -1 140 GLU B OE2 1 
ATOM   2505 N  N   . GLN B  1 141 ? 13.83047  42.19489  16.65403  1.000 45.76981  ?  141 GLN B N   1 
ATOM   2506 C  CA  . GLN B  1 141 ? 15.01371  42.81051  17.24090  1.000 45.99252  ?  141 GLN B CA  1 
ATOM   2507 C  C   . GLN B  1 141 ? 15.13850  42.46526  18.71915  1.000 45.04765  ?  141 GLN B C   1 
ATOM   2508 O  O   . GLN B  1 141 ? 16.24122  42.18379  19.20077  1.000 45.07365  ?  141 GLN B O   1 
ATOM   2509 C  CB  . GLN B  1 141 ? 14.98733  44.33030  17.04822  1.000 49.67968  ?  141 GLN B CB  1 
ATOM   2510 C  CG  . GLN B  1 141 ? 15.39786  44.76104  15.65271  1.000 61.41563  ?  141 GLN B CG  1 
ATOM   2511 C  CD  . GLN B  1 141 ? 16.86400  44.50763  15.36600  1.000 63.64595  ?  141 GLN B CD  1 
ATOM   2512 O  OE1 . GLN B  1 141 ? 17.72932  44.85855  16.17390  1.000 71.65217  ?  141 GLN B OE1 1 
ATOM   2513 N  NE2 . GLN B  1 141 ? 17.15762  43.90424  14.21004  1.000 62.32403  ?  141 GLN B NE2 1 
ATOM   2514 N  N   . VAL B  1 142 ? 14.03191  42.50998  19.46314  1.000 45.36339  ?  142 VAL B N   1 
ATOM   2515 C  CA  . VAL B  1 142 ? 14.10832  42.22105  20.89533  1.000 47.80024  ?  142 VAL B CA  1 
ATOM   2516 C  C   . VAL B  1 142 ? 14.58732  40.78974  21.11838  1.000 48.97475  ?  142 VAL B C   1 
ATOM   2517 O  O   . VAL B  1 142 ? 15.42510  40.52929  21.99483  1.000 47.55293  ?  142 VAL B O   1 
ATOM   2518 C  CB  . VAL B  1 142 ? 12.74947  42.49528  21.58083  1.000 51.02089  ?  142 VAL B CB  1 
ATOM   2519 C  CG1 . VAL B  1 142 ? 12.56342  41.63185  22.82105  1.000 47.04691  ?  142 VAL B CG1 1 
ATOM   2520 C  CG2 . VAL B  1 142 ? 12.61333  43.98499  21.95975  1.000 58.43639  ?  142 VAL B CG2 1 
ATOM   2521 N  N   . LYS B  1 143 ? 14.10076  39.84654  20.29986  1.000 43.89248  ?  143 LYS B N   1 
ATOM   2522 C  CA  . LYS B  1 143 ? 14.56743  38.45813  20.39524  1.000 42.94460  ?  143 LYS B CA  1 
ATOM   2523 C  C   . LYS B  1 143 ? 16.02605  38.33407  19.99220  1.000 44.32688  ?  143 LYS B C   1 
ATOM   2524 O  O   . LYS B  1 143 ? 16.77945  37.57739  20.61377  1.000 46.86143  ?  143 LYS B O   1 
ATOM   2525 C  CB  . LYS B  1 143 ? 13.71693  37.54517  19.51850  1.000 41.73836  ?  143 LYS B CB  1 
ATOM   2526 C  CG  . LYS B  1 143 ? 12.28240  37.36460  20.02325  1.000 46.26246  ?  143 LYS B CG  1 
ATOM   2527 N  N   . ALA B  1 144 ? 16.43467  39.05223  18.93790  1.000 42.55035  ?  144 ALA B N   1 
ATOM   2528 C  CA  . ALA B  1 144 ? 17.82199  39.00146  18.49153  1.000 51.60883  ?  144 ALA B CA  1 
ATOM   2529 C  C   . ALA B  1 144 ? 18.75886  39.49793  19.58297  1.000 48.31194  ?  144 ALA B C   1 
ATOM   2530 O  O   . ALA B  1 144 ? 19.80470  38.88741  19.84129  1.000 45.74864  ?  144 ALA B O   1 
ATOM   2531 C  CB  . ALA B  1 144 ? 17.99985  39.83033  17.21400  1.000 43.15098  ?  144 ALA B CB  1 
ATOM   2532 N  N   . ILE B  1 145 ? 18.37971  40.58692  20.25287  1.000 44.77375  ?  145 ILE B N   1 
ATOM   2533 C  CA  . ILE B  1 145 ? 19.21782  41.13849  21.30953  1.000 49.00007  ?  145 ILE B CA  1 
ATOM   2534 C  C   . ILE B  1 145 ? 19.26150  40.19408  22.50226  1.000 46.27235  ?  145 ILE B C   1 
ATOM   2535 O  O   . ILE B  1 145 ? 20.32942  39.95845  23.08655  1.000 46.66845  ?  145 ILE B O   1 
ATOM   2536 C  CB  . ILE B  1 145 ? 18.72476  42.54075  21.71686  1.000 47.43841  ?  145 ILE B CB  1 
ATOM   2537 C  CG1 . ILE B  1 145 ? 18.83503  43.51079  20.54647  1.000 47.41182  ?  145 ILE B CG1 1 
ATOM   2538 C  CG2 . ILE B  1 145 ? 19.49208  43.05520  22.92670  1.000 48.94433  ?  145 ILE B CG2 1 
ATOM   2539 C  CD1 . ILE B  1 145 ? 18.05877  44.83786  20.78667  1.000 48.56614  ?  145 ILE B CD1 1 
ATOM   2540 N  N   . LYS B  1 146 ? 18.10415  39.66291  22.90528  1.000 45.90974  ?  146 LYS B N   1 
ATOM   2541 C  CA  . LYS B  1 146 ? 18.09068  38.65653  23.96614  1.000 59.31859  ?  146 LYS B CA  1 
ATOM   2542 C  C   . LYS B  1 146 ? 19.01918  37.47479  23.63733  1.000 53.34900  ?  146 LYS B C   1 
ATOM   2543 O  O   . LYS B  1 146 ? 19.78660  37.01458  24.49389  1.000 45.33994  ?  146 LYS B O   1 
ATOM   2544 C  CB  . LYS B  1 146 ? 16.64707  38.19009  24.19760  1.000 57.55013  ?  146 LYS B CB  1 
ATOM   2545 C  CG  . LYS B  1 146 ? 16.45700  37.16307  25.30958  1.000 48.69025  ?  146 LYS B CG  1 
ATOM   2546 C  CD  . LYS B  1 146 ? 16.92554  37.71582  26.63915  1.000 47.80964  ?  146 LYS B CD  1 
ATOM   2547 C  CE  . LYS B  1 146 ? 16.67819  36.73918  27.76103  1.000 47.51008  ?  146 LYS B CE  1 
ATOM   2548 N  NZ  . LYS B  1 146 ? 17.28525  35.41769  27.48537  1.000 46.30200  ?  146 LYS B NZ  1 
ATOM   2549 N  N   . GLU B  1 147 ? 18.98373  36.99224  22.39285  1.000 48.55064  ?  147 GLU B N   1 
ATOM   2550 C  CA  . GLU B  1 147 ? 19.76931  35.81655  22.02492  1.000 42.58770  ?  147 GLU B CA  1 
ATOM   2551 C  C   . GLU B  1 147 ? 21.25721  36.11378  22.04073  1.000 50.88025  ?  147 GLU B C   1 
ATOM   2552 O  O   . GLU B  1 147 ? 22.05511  35.30787  22.54875  1.000 49.37150  ?  147 GLU B O   1 
ATOM   2553 C  CB  . GLU B  1 147 ? 19.35072  35.31874  20.64545  1.000 44.83502  ?  147 GLU B CB  1 
ATOM   2554 C  CG  . GLU B  1 147 ? 20.21665  34.19795  20.10254  1.000 41.32845  ?  147 GLU B CG  1 
ATOM   2555 C  CD  . GLU B  1 147 ? 19.71244  33.67709  18.77407  1.000 49.48181  ?  147 GLU B CD  1 
ATOM   2556 O  OE1 . GLU B  1 147 ? 18.73459  32.89835  18.74783  1.000 60.96537  ?  147 GLU B OE1 1 
ATOM   2557 O  OE2 . GLU B  1 147 ? 20.28124  34.06545  17.73805  1.000 61.28847  -1 147 GLU B OE2 1 
ATOM   2558 N  N   . LEU B  1 148 ? 21.65335  37.25644  21.47047  1.000 43.64172  ?  148 LEU B N   1 
ATOM   2559 C  CA  . LEU B  1 148 ? 23.05997  37.63399  21.50269  1.000 50.82944  ?  148 LEU B CA  1 
ATOM   2560 C  C   . LEU B  1 148 ? 23.53763  37.82291  22.93871  1.000 50.27131  ?  148 LEU B C   1 
ATOM   2561 O  O   . LEU B  1 148 ? 24.64782  37.40852  23.27714  1.000 54.68068  ?  148 LEU B O   1 
ATOM   2562 C  CB  . LEU B  1 148 ? 23.28330  38.90662  20.67597  1.000 54.30356  ?  148 LEU B CB  1 
ATOM   2563 C  CG  . LEU B  1 148 ? 23.15548  38.61629  19.17886  1.000 43.54846  ?  148 LEU B CG  1 
ATOM   2564 C  CD1 . LEU B  1 148 ? 23.03167  39.89405  18.37745  1.000 44.01625  ?  148 LEU B CD1 1 
ATOM   2565 C  CD2 . LEU B  1 148 ? 24.32314  37.77537  18.70023  1.000 42.94345  ?  148 LEU B CD2 1 
ATOM   2566 N  N   . GLY B  1 149 ? 22.72112  38.45813  23.79144  1.000 51.52302  ?  149 GLY B N   1 
ATOM   2567 C  CA  . GLY B  1 149 ? 23.06469  38.56187  25.20269  1.000 47.90607  ?  149 GLY B CA  1 
ATOM   2568 C  C   . GLY B  1 149 ? 23.28355  37.20700  25.85376  1.000 55.64361  ?  149 GLY B C   1 
ATOM   2569 O  O   . GLY B  1 149 ? 24.25874  37.00523  26.57668  1.000 48.16304  ?  149 GLY B O   1 
ATOM   2570 N  N   . ASP B  1 150 ? 22.35936  36.27489  25.63177  1.000 47.38624  ?  150 ASP B N   1 
ATOM   2571 C  CA  . ASP B  1 150 ? 22.52149  34.92243  26.13931  1.000 47.72135  ?  150 ASP B CA  1 
ATOM   2572 C  C   . ASP B  1 150 ? 23.84922  34.33227  25.68479  1.000 45.15394  ?  150 ASP B C   1 
ATOM   2573 O  O   . ASP B  1 150 ? 24.56544  33.70427  26.47188  1.000 45.53494  ?  150 ASP B O   1 
ATOM   2574 C  CB  . ASP B  1 150 ? 21.35906  34.04567  25.64845  1.000 44.30761  ?  150 ASP B CB  1 
ATOM   2575 C  CG  . ASP B  1 150 ? 20.00070  34.45015  26.23456  1.000 49.36675  ?  150 ASP B CG  1 
ATOM   2576 O  OD1 . ASP B  1 150 ? 19.90949  35.30372  27.13269  1.000 57.68415  ?  150 ASP B OD1 1 
ATOM   2577 O  OD2 . ASP B  1 150 ? 18.98473  33.92248  25.75769  1.000 62.89772  -1 150 ASP B OD2 1 
ATOM   2578 N  N   . HIS B  1 151 ? 24.17893  34.51208  24.40394  1.000 44.35626  ?  151 HIS B N   1 
ATOM   2579 C  CA  . HIS B  1 151 ? 25.39986  33.94026  23.85494  1.000 43.86801  ?  151 HIS B CA  1 
ATOM   2580 C  C   . HIS B  1 151 ? 26.62873  34.55688  24.50010  1.000 57.46704  ?  151 HIS B C   1 
ATOM   2581 O  O   . HIS B  1 151 ? 27.56103  33.84297  24.88453  1.000 46.59995  ?  151 HIS B O   1 
ATOM   2582 C  CB  . HIS B  1 151 ? 25.44722  34.15460  22.34951  1.000 44.15586  ?  151 HIS B CB  1 
ATOM   2583 C  CG  . HIS B  1 151 ? 24.48129  33.31282  21.59018  1.000 46.33713  ?  151 HIS B CG  1 
ATOM   2584 N  ND1 . HIS B  1 151 ? 23.81608  32.24870  22.16151  1.000 40.95653  ?  151 HIS B ND1 1 
ATOM   2585 C  CD2 . HIS B  1 151 ? 24.06882  33.37547  20.30252  1.000 40.61088  ?  151 HIS B CD2 1 
ATOM   2586 C  CE1 . HIS B  1 151 ? 23.02577  31.69796  21.25653  1.000 43.15623  ?  151 HIS B CE1 1 
ATOM   2587 N  NE2 . HIS B  1 151 ? 23.16575  32.35988  20.12010  1.000 39.56363  ?  151 HIS B NE2 1 
ATOM   2588 N  N   . VAL B  1 152 ? 26.66131  35.89410  24.57343  1.000 46.38854  ?  152 VAL B N   1 
ATOM   2589 C  CA  . VAL B  1 152 ? 27.74769  36.59920  25.23708  1.000 47.93034  ?  152 VAL B CA  1 
ATOM   2590 C  C   . VAL B  1 152 ? 27.90260  36.09898  26.66414  1.000 53.44966  ?  152 VAL B C   1 
ATOM   2591 O  O   . VAL B  1 152 ? 29.01787  35.81275  27.12208  1.000 54.51806  ?  152 VAL B O   1 
ATOM   2592 C  CB  . VAL B  1 152 ? 27.50950  38.12588  25.21307  1.000 49.09140  ?  152 VAL B CB  1 
ATOM   2593 C  CG1 . VAL B  1 152 ? 28.58303  38.83219  26.02478  1.000 52.49502  ?  152 VAL B CG1 1 
ATOM   2594 C  CG2 . VAL B  1 152 ? 27.51554  38.66635  23.80366  1.000 48.38781  ?  152 VAL B CG2 1 
ATOM   2595 N  N   . THR B  1 153 ? 26.79135  36.02265  27.39904  1.000 48.96132  ?  153 THR B N   1 
ATOM   2596 C  CA  . THR B  1 153 ? 26.82007  35.53250  28.77177  1.000 49.84153  ?  153 THR B CA  1 
ATOM   2597 C  C   . THR B  1 153 ? 27.44684  34.14371  28.85128  1.000 52.75721  ?  153 THR B C   1 
ATOM   2598 O  O   . THR B  1 153 ? 28.26726  33.88440  29.73332  1.000 55.31418  ?  153 THR B O   1 
ATOM   2599 C  CB  . THR B  1 153 ? 25.39983  35.50616  29.34337  1.000 49.85854  ?  153 THR B CB  1 
ATOM   2600 O  OG1 . THR B  1 153 ? 24.87153  36.83171  29.37683  1.000 50.82624  ?  153 THR B OG1 1 
ATOM   2601 C  CG2 . THR B  1 153 ? 25.37953  34.91947  30.75356  1.000 50.76526  ?  153 THR B CG2 1 
ATOM   2602 N  N   . ASN B  1 154 ? 27.08328  33.24059  27.93387  1.000 47.29467  ?  154 ASN B N   1 
ATOM   2603 C  CA  . ASN B  1 154 ? 27.64812  31.89562  27.98511  1.000 46.49523  ?  154 ASN B CA  1 
ATOM   2604 C  C   . ASN B  1 154 ? 29.13371  31.89123  27.63054  1.000 46.77216  ?  154 ASN B C   1 
ATOM   2605 O  O   . ASN B  1 154 ? 29.94004  31.27180  28.33116  1.000 47.26199  ?  154 ASN B O   1 
ATOM   2606 C  CB  . ASN B  1 154 ? 26.87370  30.95376  27.06909  1.000 48.36105  ?  154 ASN B CB  1 
ATOM   2607 C  CG  . ASN B  1 154 ? 25.60055  30.45034  27.71198  1.000 52.20401  ?  154 ASN B CG  1 
ATOM   2608 O  OD1 . ASN B  1 154 ? 25.63421  29.55551  28.55474  1.000 50.68768  ?  154 ASN B OD1 1 
ATOM   2609 N  ND2 . ASN B  1 154 ? 24.47314  31.04096  27.33818  1.000 44.23683  ?  154 ASN B ND2 1 
ATOM   2610 N  N   . LEU B  1 155 ? 29.51435  32.54903  26.53401  1.000 46.50120  ?  155 LEU B N   1 
ATOM   2611 C  CA  . LEU B  1 155 ? 30.93132  32.66723  26.21890  1.000 55.72597  ?  155 LEU B CA  1 
ATOM   2612 C  C   . LEU B  1 155 ? 31.71336  33.17480  27.42235  1.000 55.98581  ?  155 LEU B C   1 
ATOM   2613 O  O   . LEU B  1 155 ? 32.76761  32.62964  27.76618  1.000 61.87098  ?  155 LEU B O   1 
ATOM   2614 C  CB  . LEU B  1 155 ? 31.15416  33.59626  25.02884  1.000 52.70640  ?  155 LEU B CB  1 
ATOM   2615 C  CG  . LEU B  1 155 ? 31.12574  32.95246  23.64891  1.000 53.67815  ?  155 LEU B CG  1 
ATOM   2616 C  CD1 . LEU B  1 155 ? 32.08300  31.74791  23.51219  1.000 44.67927  ?  155 LEU B CD1 1 
ATOM   2617 C  CD2 . LEU B  1 155 ? 29.75789  32.55150  23.34383  1.000 57.44443  ?  155 LEU B CD2 1 
ATOM   2618 N  N   . ARG B  1 156 ? 31.18246  34.18810  28.10496  1.000 56.52683  ?  156 ARG B N   1 
ATOM   2619 C  CA  . ARG B  1 156 ? 31.89318  34.77471  29.23320  1.000 60.20008  ?  156 ARG B CA  1 
ATOM   2620 C  C   . ARG B  1 156 ? 31.97525  33.80105  30.39832  1.000 57.10522  ?  156 ARG B C   1 
ATOM   2621 O  O   . ARG B  1 156 ? 33.05862  33.58354  30.95276  1.000 58.68233  ?  156 ARG B O   1 
ATOM   2622 C  CB  . ARG B  1 156 ? 31.22096  36.07801  29.66713  1.000 55.07582  ?  156 ARG B CB  1 
ATOM   2623 C  CG  . ARG B  1 156 ? 31.85910  37.33449  29.08759  1.000 68.33969  ?  156 ARG B CG  1 
ATOM   2624 C  CD  . ARG B  1 156 ? 31.02889  38.60044  29.39092  1.000 71.14496  ?  156 ARG B CD  1 
ATOM   2625 N  NE  . ARG B  1 156 ? 31.14388  39.57310  28.30828  1.000 72.94055  ?  156 ARG B NE  1 
ATOM   2626 C  CZ  . ARG B  1 156 ? 30.50315  40.73917  28.26058  1.000 75.32031  ?  156 ARG B CZ  1 
ATOM   2627 N  NH1 . ARG B  1 156 ? 29.67984  41.09281  29.23843  1.000 78.37730  ?  156 ARG B NH1 1 
ATOM   2628 N  NH2 . ARG B  1 156 ? 30.67697  41.55000  27.22361  1.000 73.01134  ?  156 ARG B NH2 1 
ATOM   2629 N  N   . CYS B  1 157 ? 30.83933  33.21759  30.79562  1.000 51.63393  ?  157 CYS B N   1 
ATOM   2630 C  CA  . CYS B  1 157 ? 30.83978  32.27419  31.91231  1.000 63.16877  ?  157 CYS B CA  1 
ATOM   2631 C  C   . CYS B  1 157 ? 31.76275  31.09072  31.65813  1.000 53.07500  ?  157 CYS B C   1 
ATOM   2632 O  O   . CYS B  1 157 ? 32.41104  30.60410  32.58878  1.000 58.69440  ?  157 CYS B O   1 
ATOM   2633 C  CB  . CYS B  1 157 ? 29.42237  31.77870  32.20254  1.000 70.41160  ?  157 CYS B CB  1 
ATOM   2634 S  SG  . CYS B  1 157 ? 28.41658  32.94174  33.14320  1.000 93.03337  ?  157 CYS B SG  1 
ATOM   2635 N  N   . MET B  1 158 ? 31.84936  30.63175  30.40917  1.000 59.77893  ?  158 MET B N   1 
ATOM   2636 C  CA  . MET B  1 158 ? 32.72697  29.53133  30.03053  1.000 59.61314  ?  158 MET B CA  1 
ATOM   2637 C  C   . MET B  1 158 ? 34.20551  29.89735  30.04087  1.000 67.01588  ?  158 MET B C   1 
ATOM   2638 O  O   . MET B  1 158 ? 35.04552  29.00259  29.89541  1.000 62.82108  ?  158 MET B O   1 
ATOM   2639 C  CB  . MET B  1 158 ? 32.35638  29.03769  28.64474  1.000 52.78517  ?  158 MET B CB  1 
ATOM   2640 C  CG  . MET B  1 158 ? 31.01202  28.37957  28.60163  1.000 55.71598  ?  158 MET B CG  1 
ATOM   2641 S  SD  . MET B  1 158 ? 30.44462  28.09783  26.92325  1.000 54.11097  ?  158 MET B SD  1 
ATOM   2642 C  CE  . MET B  1 158 ? 31.40331  26.61991  26.53061  1.000 50.07886  ?  158 MET B CE  1 
ATOM   2643 N  N   . GLY B  1 159 ? 34.54871  31.17069  30.17627  1.000 62.27951  ?  159 GLY B N   1 
ATOM   2644 C  CA  . GLY B  1 159 ? 35.93629  31.57048  30.19501  1.000 65.60699  ?  159 GLY B CA  1 
ATOM   2645 C  C   . GLY B  1 159 ? 36.50312  32.00991  28.86620  1.000 64.84087  ?  159 GLY B C   1 
ATOM   2646 O  O   . GLY B  1 159 ? 37.72620  32.06792  28.73133  1.000 66.99362  ?  159 GLY B O   1 
ATOM   2647 N  N   . ALA B  1 160 ? 35.66053  32.29718  27.87299  1.000 64.41697  ?  160 ALA B N   1 
ATOM   2648 C  CA  . ALA B  1 160 ? 36.14794  32.93089  26.66026  1.000 62.17168  ?  160 ALA B CA  1 
ATOM   2649 C  C   . ALA B  1 160 ? 36.57377  34.36641  26.96340  1.000 66.45472  ?  160 ALA B C   1 
ATOM   2650 O  O   . ALA B  1 160 ? 36.16407  34.94364  27.97624  1.000 68.89528  ?  160 ALA B O   1 
ATOM   2651 C  CB  . ALA B  1 160 ? 35.07513  32.91023  25.57646  1.000 58.88257  ?  160 ALA B CB  1 
ATOM   2652 N  N   . PRO B  1 161 ? 37.44735  34.95133  26.11891  1.000 76.31321  ?  161 PRO B N   1 
ATOM   2653 C  CA  . PRO B  1 161 ? 38.12710  34.26638  25.00677  1.000 73.79399  ?  161 PRO B CA  1 
ATOM   2654 C  C   . PRO B  1 161 ? 39.39880  33.49571  25.40148  1.000 80.72665  ?  161 PRO B C   1 
ATOM   2655 O  O   . PRO B  1 161 ? 39.90859  32.75647  24.55421  1.000 82.46603  ?  161 PRO B O   1 
ATOM   2656 C  CB  . PRO B  1 161 ? 38.47363  35.41485  24.05714  1.000 73.00959  ?  161 PRO B CB  1 
ATOM   2657 C  CG  . PRO B  1 161 ? 38.70190  36.58368  24.97286  1.000 78.81195  ?  161 PRO B CG  1 
ATOM   2658 C  CD  . PRO B  1 161 ? 37.73901  36.39895  26.12962  1.000 77.94394  ?  161 PRO B CD  1 
ATOM   2659 N  N   . GLU B  1 162 ? 39.87382  33.64540  26.64861  1.000 75.54443  ?  162 GLU B N   1 
ATOM   2660 C  CA  . GLU B  1 162 ? 41.15591  33.05650  27.04677  1.000 83.78263  ?  162 GLU B CA  1 
ATOM   2661 C  C   . GLU B  1 162 ? 41.20246  31.55600  26.77630  1.000 78.97198  ?  162 GLU B C   1 
ATOM   2662 O  O   . GLU B  1 162 ? 42.23069  31.02791  26.33657  1.000 88.30022  ?  162 GLU B O   1 
ATOM   2663 C  CB  . GLU B  1 162 ? 41.44095  33.32573  28.52953  1.000 95.08288  ?  162 GLU B CB  1 
ATOM   2664 C  CG  . GLU B  1 162 ? 41.28658  34.77136  28.99590  1.000 104.08421 ?  162 GLU B CG  1 
ATOM   2665 C  CD  . GLU B  1 162 ? 39.83700  35.17867  29.17745  1.000 108.72035 ?  162 GLU B CD  1 
ATOM   2666 O  OE1 . GLU B  1 162 ? 39.17968  34.67434  30.11417  1.000 103.73223 ?  162 GLU B OE1 1 
ATOM   2667 O  OE2 . GLU B  1 162 ? 39.35729  36.00733  28.37957  1.000 110.75432 -1 162 GLU B OE2 1 
ATOM   2668 N  N   . SER B  1 163 ? 40.10278  30.86056  27.04776  1.000 67.08059  ?  163 SER B N   1 
ATOM   2669 C  CA  . SER B  1 163 ? 39.95091  29.42225  26.83350  1.000 62.89652  ?  163 SER B CA  1 
ATOM   2670 C  C   . SER B  1 163 ? 39.45024  29.16681  25.41144  1.000 66.62402  ?  163 SER B C   1 
ATOM   2671 O  O   . SER B  1 163 ? 38.26774  29.37608  25.10866  1.000 61.25142  ?  163 SER B O   1 
ATOM   2672 C  CB  . SER B  1 163 ? 38.98646  28.86479  27.87688  1.000 62.08620  ?  163 SER B CB  1 
ATOM   2673 O  OG  . SER B  1 163 ? 38.43645  27.61207  27.49219  1.000 58.66907  ?  163 SER B OG  1 
ATOM   2674 N  N   . GLY B  1 164 ? 40.34635  28.71632  24.52420  1.000 62.65458  ?  164 GLY B N   1 
ATOM   2675 C  CA  . GLY B  1 164 ? 39.91114  28.34569  23.18161  1.000 59.66645  ?  164 GLY B CA  1 
ATOM   2676 C  C   . GLY B  1 164 ? 38.97095  27.15465  23.19042  1.000 58.54257  ?  164 GLY B C   1 
ATOM   2677 O  O   . GLY B  1 164 ? 38.11617  27.00841  22.29858  1.000 51.42100  ?  164 GLY B O   1 
ATOM   2678 N  N   . LEU B  1 165 ? 39.09787  26.30884  24.21520  1.000 53.83090  ?  165 LEU B N   1 
ATOM   2679 C  CA  . LEU B  1 165 ? 38.16746  25.20778  24.42176  1.000 57.65896  ?  165 LEU B CA  1 
ATOM   2680 C  C   . LEU B  1 165 ? 36.74499  25.71096  24.64970  1.000 53.70582  ?  165 LEU B C   1 
ATOM   2681 O  O   . LEU B  1 165 ? 35.78679  25.12329  24.14225  1.000 52.43033  ?  165 LEU B O   1 
ATOM   2682 C  CB  . LEU B  1 165 ? 38.65693  24.36080  25.59849  1.000 62.65675  ?  165 LEU B CB  1 
ATOM   2683 C  CG  . LEU B  1 165 ? 37.86732  23.12502  26.01059  1.000 61.38360  ?  165 LEU B CG  1 
ATOM   2684 C  CD1 . LEU B  1 165 ? 37.95122  22.11580  24.89128  1.000 56.08194  ?  165 LEU B CD1 1 
ATOM   2685 C  CD2 . LEU B  1 165 ? 38.47105  22.53913  27.27374  1.000 53.88329  ?  165 LEU B CD2 1 
ATOM   2686 N  N   . ALA B  1 166 ? 36.58037  26.78610  25.42185  1.000 52.72345  ?  166 ALA B N   1 
ATOM   2687 C  CA  . ALA B  1 166 ? 35.24059  27.30140  25.66268  1.000 50.90132  ?  166 ALA B CA  1 
ATOM   2688 C  C   . ALA B  1 166 ? 34.54727  27.64908  24.34654  1.000 58.34755  ?  166 ALA B C   1 
ATOM   2689 O  O   . ALA B  1 166 ? 33.41186  27.21766  24.09464  1.000 47.30064  ?  166 ALA B O   1 
ATOM   2690 C  CB  . ALA B  1 166 ? 35.30022  28.51529  26.58782  1.000 62.18747  ?  166 ALA B CB  1 
ATOM   2691 N  N   . GLU B  1 167 ? 35.23198  28.40240  23.47673  1.000 51.03670  ?  167 GLU B N   1 
ATOM   2692 C  CA  . GLU B  1 167 ? 34.64916  28.75693  22.18399  1.000 49.23486  ?  167 GLU B CA  1 
ATOM   2693 C  C   . GLU B  1 167 ? 34.45640  27.53713  21.28208  1.000 47.35755  ?  167 GLU B C   1 
ATOM   2694 O  O   . GLU B  1 167 ? 33.49930  27.50150  20.49982  1.000 46.39395  ?  167 GLU B O   1 
ATOM   2695 C  CB  . GLU B  1 167 ? 35.51873  29.80124  21.48086  1.000 50.88221  ?  167 GLU B CB  1 
ATOM   2696 C  CG  . GLU B  1 167 ? 35.64885  31.10027  22.24044  1.000 56.28207  ?  167 GLU B CG  1 
ATOM   2697 C  CD  . GLU B  1 167 ? 36.00020  32.28276  21.34586  1.000 66.05717  ?  167 GLU B CD  1 
ATOM   2698 O  OE1 . GLU B  1 167 ? 36.64924  32.08103  20.28932  1.000 66.42133  ?  167 GLU B OE1 1 
ATOM   2699 O  OE2 . GLU B  1 167 ? 35.64536  33.42395  21.72418  1.000 71.05692  -1 167 GLU B OE2 1 
ATOM   2700 N  N   . TYR B  1 168 ? 35.34106  26.53744  21.37177  1.000 47.43081  ?  168 TYR B N   1 
ATOM   2701 C  CA  . TYR B  1 168 ? 35.14034  25.30010  20.61904  1.000 46.34471  ?  168 TYR B CA  1 
ATOM   2702 C  C   . TYR B  1 168 ? 33.86530  24.58341  21.06726  1.000 45.02384  ?  168 TYR B C   1 
ATOM   2703 O  O   . TYR B  1 168 ? 33.04989  24.15611  20.23853  1.000 44.39844  ?  168 TYR B O   1 
ATOM   2704 C  CB  . TYR B  1 168 ? 36.36349  24.39058  20.77616  1.000 47.05980  ?  168 TYR B CB  1 
ATOM   2705 C  CG  . TYR B  1 168 ? 36.23334  23.03546  20.10408  1.000 46.51934  ?  168 TYR B CG  1 
ATOM   2706 C  CD1 . TYR B  1 168 ? 35.65094  21.95331  20.76970  1.000 45.94754  ?  168 TYR B CD1 1 
ATOM   2707 C  CD2 . TYR B  1 168 ? 36.67274  22.83918  18.80337  1.000 47.00501  ?  168 TYR B CD2 1 
ATOM   2708 C  CE1 . TYR B  1 168 ? 35.51797  20.72659  20.16445  1.000 46.03992  ?  168 TYR B CE1 1 
ATOM   2709 C  CE2 . TYR B  1 168 ? 36.55251  21.61007  18.18704  1.000 47.15569  ?  168 TYR B CE2 1 
ATOM   2710 C  CZ  . TYR B  1 168 ? 35.97596  20.54530  18.87603  1.000 51.16921  ?  168 TYR B CZ  1 
ATOM   2711 O  OH  . TYR B  1 168 ? 35.84333  19.29853  18.27279  1.000 50.27431  ?  168 TYR B OH  1 
ATOM   2712 N  N   . LEU B  1 169 ? 33.66564  24.46664  22.38506  1.000 47.97562  ?  169 LEU B N   1 
ATOM   2713 C  CA  . LEU B  1 169 ? 32.51995  23.73059  22.91497  1.000 43.91079  ?  169 LEU B CA  1 
ATOM   2714 C  C   . LEU B  1 169 ? 31.23151  24.47885  22.66117  1.000 46.38025  ?  169 LEU B C   1 
ATOM   2715 O  O   . LEU B  1 169 ? 30.19797  23.86321  22.38775  1.000 45.65617  ?  169 LEU B O   1 
ATOM   2716 C  CB  . LEU B  1 169 ? 32.68887  23.47385  24.40837  1.000 44.46205  ?  169 LEU B CB  1 
ATOM   2717 C  CG  . LEU B  1 169 ? 33.79572  22.44677  24.67566  1.000 59.10524  ?  169 LEU B CG  1 
ATOM   2718 C  CD1 . LEU B  1 169 ? 34.03346  22.24049  26.16858  1.000 46.57902  ?  169 LEU B CD1 1 
ATOM   2719 C  CD2 . LEU B  1 169 ? 33.45560  21.13977  23.97007  1.000 44.64045  ?  169 LEU B CD2 1 
ATOM   2720 N  N   . PHE B  1 170 ? 31.28092  25.80955  22.76047  1.000 48.21962  ?  170 PHE B N   1 
ATOM   2721 C  CA  . PHE B  1 170 ? 30.14200  26.63870  22.41261  1.000 48.75983  ?  170 PHE B CA  1 
ATOM   2722 C  C   . PHE B  1 170 ? 29.79514  26.49406  20.94228  1.000 43.33870  ?  170 PHE B C   1 
ATOM   2723 O  O   . PHE B  1 170 ? 28.62415  26.37655  20.58461  1.000 42.89499  ?  170 PHE B O   1 
ATOM   2724 C  CB  . PHE B  1 170 ? 30.43936  28.10436  22.74672  1.000 44.86196  ?  170 PHE B CB  1 
ATOM   2725 C  CG  . PHE B  1 170 ? 29.23879  28.98813  22.63590  1.000 44.83639  ?  170 PHE B CG  1 
ATOM   2726 C  CD1 . PHE B  1 170 ? 28.36045  29.11140  23.69836  1.000 48.17250  ?  170 PHE B CD1 1 
ATOM   2727 C  CD2 . PHE B  1 170 ? 28.97192  29.67213  21.46716  1.000 47.17369  ?  170 PHE B CD2 1 
ATOM   2728 C  CE1 . PHE B  1 170 ? 27.24471  29.92303  23.60488  1.000 44.72698  ?  170 PHE B CE1 1 
ATOM   2729 C  CE2 . PHE B  1 170 ? 27.85657  30.47795  21.37472  1.000 49.64493  ?  170 PHE B CE2 1 
ATOM   2730 C  CZ  . PHE B  1 170 ? 26.99623  30.59673  22.45458  1.000 45.24089  ?  170 PHE B CZ  1 
ATOM   2731 N  N   . ASP B  1 171 ? 30.80332  26.51058  20.07199  1.000 53.36464  ?  171 ASP B N   1 
ATOM   2732 C  CA  . ASP B  1 171 ? 30.55090  26.26384  18.66034  1.000 50.84444  ?  171 ASP B CA  1 
ATOM   2733 C  C   . ASP B  1 171 ? 29.85269  24.92127  18.45523  1.000 48.94788  ?  171 ASP B C   1 
ATOM   2734 O  O   . ASP B  1 171 ? 28.95059  24.80271  17.61623  1.000 49.87932  ?  171 ASP B O   1 
ATOM   2735 C  CB  . ASP B  1 171 ? 31.87313  26.31504  17.88992  1.000 45.48469  ?  171 ASP B CB  1 
ATOM   2736 C  CG  . ASP B  1 171 ? 31.72040  25.88080  16.45437  1.000 54.86528  ?  171 ASP B CG  1 
ATOM   2737 O  OD1 . ASP B  1 171 ? 31.69431  24.64775  16.21214  1.000 46.28422  ?  171 ASP B OD1 1 
ATOM   2738 O  OD2 . ASP B  1 171 ? 31.60482  26.77328  15.57945  1.000 47.36295  -1 171 ASP B OD2 1 
ATOM   2739 N  N   . LYS B  1 172 ? 30.24753  23.90241  19.21520  1.000 43.47586  ?  172 LYS B N   1 
ATOM   2740 C  CA  . LYS B  1 172 ? 29.68665  22.58196  18.95304  1.000 43.59001  ?  172 LYS B CA  1 
ATOM   2741 C  C   . LYS B  1 172 ? 28.29725  22.41600  19.56882  1.000 45.94609  ?  172 LYS B C   1 
ATOM   2742 O  O   . LYS B  1 172 ? 27.43235  21.77909  18.96431  1.000 46.48617  ?  172 LYS B O   1 
ATOM   2743 C  CB  . LYS B  1 172 ? 30.63052  21.48530  19.46427  1.000 43.70676  ?  172 LYS B CB  1 
ATOM   2744 C  CG  . LYS B  1 172 ? 31.95874  21.36933  18.71865  1.000 59.57109  ?  172 LYS B CG  1 
ATOM   2745 C  CD  . LYS B  1 172 ? 31.77954  21.03983  17.24401  1.000 59.44741  ?  172 LYS B CD  1 
ATOM   2746 C  CE  . LYS B  1 172 ? 33.10690  20.71723  16.55251  1.000 55.42453  ?  172 LYS B CE  1 
ATOM   2747 N  NZ  . LYS B  1 172 ? 32.85677  20.45383  15.09169  1.000 65.76801  ?  172 LYS B NZ  1 
ATOM   2748 N  N   . HIS B  1 173 ? 28.05065  22.98676  20.75049  1.000 47.47148  ?  173 HIS B N   1 
ATOM   2749 C  CA  . HIS B  1 173 ? 26.82406  22.71246  21.49986  1.000 41.35510  ?  173 HIS B CA  1 
ATOM   2750 C  C   . HIS B  1 173 ? 25.74591  23.76861  21.28027  1.000 41.27485  ?  173 HIS B C   1 
ATOM   2751 O  O   . HIS B  1 173 ? 24.61104  23.42683  20.92752  1.000 41.50221  ?  173 HIS B O   1 
ATOM   2752 C  CB  . HIS B  1 173 ? 27.11692  22.59354  23.00236  1.000 46.23300  ?  173 HIS B CB  1 
ATOM   2753 C  CG  . HIS B  1 173 ? 27.84792  21.34792  23.38582  1.000 45.15048  ?  173 HIS B CG  1 
ATOM   2754 N  ND1 . HIS B  1 173 ? 27.22631  20.11798  23.49419  1.000 44.93771  ?  173 HIS B ND1 1 
ATOM   2755 C  CD2 . HIS B  1 173 ? 29.14957  21.14405  23.70994  1.000 46.79984  ?  173 HIS B CD2 1 
ATOM   2756 C  CE1 . HIS B  1 173 ? 28.11763  19.20827  23.85503  1.000 42.70787  ?  173 HIS B CE1 1 
ATOM   2757 N  NE2 . HIS B  1 173 ? 29.29213  19.80521  23.99208  1.000 46.15845  ?  173 HIS B NE2 1 
ATOM   2758 N  N   . THR B  1 174 ? 26.05845  25.05396  21.49986  1.000 44.84672  ?  174 THR B N   1 
ATOM   2759 C  CA  . THR B  1 174 ? 25.02107  26.06816  21.27670  1.000 46.86969  ?  174 THR B CA  1 
ATOM   2760 C  C   . THR B  1 174 ? 24.78172  26.28564  19.78851  1.000 42.69657  ?  174 THR B C   1 
ATOM   2761 O  O   . THR B  1 174 ? 23.64334  26.38112  19.34684  1.000 43.22231  ?  174 THR B O   1 
ATOM   2762 C  CB  . THR B  1 174 ? 25.37113  27.40939  21.94410  1.000 41.95334  ?  174 THR B CB  1 
ATOM   2763 O  OG1 . THR B  1 174 ? 25.42286  27.25221  23.36340  1.000 50.67753  ?  174 THR B OG1 1 
ATOM   2764 C  CG2 . THR B  1 174 ? 24.28816  28.46714  21.62043  1.000 43.86191  ?  174 THR B CG2 1 
ATOM   2765 N  N   . LEU B  1 175 ? 25.84476  26.40593  19.00180  1.000 46.32741  ?  175 LEU B N   1 
ATOM   2766 C  CA  . LEU B  1 175 ? 25.67049  26.82852  17.62236  1.000 44.91544  ?  175 LEU B CA  1 
ATOM   2767 C  C   . LEU B  1 175 ? 25.57042  25.67252  16.63403  1.000 45.93814  ?  175 LEU B C   1 
ATOM   2768 O  O   . LEU B  1 175 ? 25.33273  25.92190  15.45000  1.000 47.73837  ?  175 LEU B O   1 
ATOM   2769 C  CB  . LEU B  1 175 ? 26.81323  27.77182  17.22133  1.000 45.63592  ?  175 LEU B CB  1 
ATOM   2770 C  CG  . LEU B  1 175 ? 26.89539  29.12094  17.95766  1.000 49.51131  ?  175 LEU B CG  1 
ATOM   2771 C  CD1 . LEU B  1 175 ? 28.03905  29.99188  17.42407  1.000 46.99509  ?  175 LEU B CD1 1 
ATOM   2772 C  CD2 . LEU B  1 175 ? 25.57020  29.89816  17.87357  1.000 46.31867  ?  175 LEU B CD2 1 
ATOM   2773 N  N   . GLY B  1 176 ? 25.75607  24.43103  17.07781  1.000 47.01354  ?  176 GLY B N   1 
ATOM   2774 C  CA  . GLY B  1 176 ? 25.74262  23.28140  16.19194  1.000 46.82839  ?  176 GLY B CA  1 
ATOM   2775 C  C   . GLY B  1 176 ? 24.46673  22.47225  16.30466  1.000 52.36816  ?  176 GLY B C   1 
ATOM   2776 O  O   . GLY B  1 176 ? 23.37509  22.99542  16.06695  1.000 65.43459  ?  176 GLY B O   1 
ATOM   2777 N  N   . THR C  1 5   ? 30.46438  -43.08949 34.03243  1.000 86.27999  ?  5   THR C N   1 
ATOM   2778 C  CA  . THR C  1 5   ? 29.16801  -42.97927 34.69795  1.000 87.23460  ?  5   THR C CA  1 
ATOM   2779 C  C   . THR C  1 5   ? 28.11411  -42.41199 33.73608  1.000 79.74631  ?  5   THR C C   1 
ATOM   2780 O  O   . THR C  1 5   ? 26.94703  -42.82677 33.76030  1.000 86.38351  ?  5   THR C O   1 
ATOM   2781 C  CB  . THR C  1 5   ? 29.25153  -42.08946 35.96864  1.000 86.46975  ?  5   THR C CB  1 
ATOM   2782 O  OG1 . THR C  1 5   ? 30.28063  -42.57954 36.83346  1.000 90.27388  ?  5   THR C OG1 1 
ATOM   2783 C  CG2 . THR C  1 5   ? 27.92887  -42.09663 36.72808  1.000 82.85796  ?  5   THR C CG2 1 
ATOM   2784 N  N   . SER C  1 6   ? 28.54511  -41.48325 32.88137  1.000 62.96836  ?  6   SER C N   1 
ATOM   2785 C  CA  . SER C  1 6   ? 27.68965  -40.82589 31.90129  1.000 61.22498  ?  6   SER C CA  1 
ATOM   2786 C  C   . SER C  1 6   ? 27.82280  -41.46761 30.52382  1.000 57.72860  ?  6   SER C C   1 
ATOM   2787 O  O   . SER C  1 6   ? 28.93136  -41.69047 30.03136  1.000 62.22688  ?  6   SER C O   1 
ATOM   2788 C  CB  . SER C  1 6   ? 28.02756  -39.33392 31.79798  1.000 59.39325  ?  6   SER C CB  1 
ATOM   2789 O  OG  . SER C  1 6   ? 27.33635  -38.73051 30.71992  1.000 49.62493  ?  6   SER C OG  1 
ATOM   2790 N  N   . GLN C  1 7   ? 26.67816  -41.72299 29.89006  1.000 55.37476  ?  7   GLN C N   1 
ATOM   2791 C  CA  . GLN C  1 7   ? 26.64869  -42.31437 28.55776  1.000 58.39459  ?  7   GLN C CA  1 
ATOM   2792 C  C   . GLN C  1 7   ? 27.26287  -41.41201 27.47823  1.000 56.71109  ?  7   GLN C C   1 
ATOM   2793 O  O   . GLN C  1 7   ? 27.59209  -41.89338 26.38848  1.000 62.67532  ?  7   GLN C O   1 
ATOM   2794 C  CB  . GLN C  1 7   ? 25.19920  -42.62951 28.18987  1.000 48.36366  ?  7   GLN C CB  1 
ATOM   2795 C  CG  . GLN C  1 7   ? 24.42106  -41.34731 27.90606  1.000 54.18087  ?  7   GLN C CG  1 
ATOM   2796 C  CD  . GLN C  1 7   ? 22.92141  -41.54466 27.88240  1.000 56.18811  ?  7   GLN C CD  1 
ATOM   2797 O  OE1 . GLN C  1 7   ? 22.43260  -42.62656 27.54348  1.000 59.49607  ?  7   GLN C OE1 1 
ATOM   2798 N  NE2 . GLN C  1 7   ? 22.17960  -40.50074 28.25151  1.000 46.37914  ?  7   GLN C NE2 1 
ATOM   2799 N  N   . VAL C  1 8   ? 27.39783  -40.11168 27.71751  1.000 52.03518  ?  8   VAL C N   1 
ATOM   2800 C  CA  . VAL C  1 8   ? 27.93286  -39.24902 26.66940  1.000 53.07328  ?  8   VAL C CA  1 
ATOM   2801 C  C   . VAL C  1 8   ? 29.40125  -38.93133 26.86635  1.000 54.26303  ?  8   VAL C C   1 
ATOM   2802 O  O   . VAL C  1 8   ? 30.03454  -38.41442 25.93271  1.000 67.33360  ?  8   VAL C O   1 
ATOM   2803 C  CB  . VAL C  1 8   ? 27.14180  -37.92712 26.53733  1.000 52.51266  ?  8   VAL C CB  1 
ATOM   2804 C  CG1 . VAL C  1 8   ? 25.67819  -38.19097 26.14893  1.000 45.99031  ?  8   VAL C CG1 1 
ATOM   2805 C  CG2 . VAL C  1 8   ? 27.23711  -37.11371 27.82552  1.000 50.97286  ?  8   VAL C CG2 1 
ATOM   2806 N  N   . ARG C  1 9   ? 29.96431  -39.21498 28.03516  1.000 50.88228  ?  9   ARG C N   1 
ATOM   2807 C  CA  . ARG C  1 9   ? 31.32873  -38.78701 28.32730  1.000 53.55140  ?  9   ARG C CA  1 
ATOM   2808 C  C   . ARG C  1 9   ? 32.32975  -39.48590 27.41678  1.000 54.58199  ?  9   ARG C C   1 
ATOM   2809 O  O   . ARG C  1 9   ? 32.31217  -40.71167 27.26904  1.000 50.11281  ?  9   ARG C O   1 
ATOM   2810 C  CB  . ARG C  1 9   ? 31.67668  -39.06535 29.78320  1.000 50.49660  ?  9   ARG C CB  1 
ATOM   2811 C  CG  . ARG C  1 9   ? 33.03653  -38.55769 30.14781  1.000 55.00198  ?  9   ARG C CG  1 
ATOM   2812 C  CD  . ARG C  1 9   ? 33.20717  -38.53062 31.64106  1.000 55.36019  ?  9   ARG C CD  1 
ATOM   2813 N  NE  . ARG C  1 9   ? 34.37013  -37.75595 32.04720  1.000 53.39755  ?  9   ARG C NE  1 
ATOM   2814 C  CZ  . ARG C  1 9   ? 34.49754  -37.21113 33.25204  1.000 56.38857  ?  9   ARG C CZ  1 
ATOM   2815 N  NH1 . ARG C  1 9   ? 33.53077  -37.37023 34.15002  1.000 53.95178  ?  9   ARG C NH1 1 
ATOM   2816 N  NH2 . ARG C  1 9   ? 35.58664  -36.51688 33.56431  1.000 54.21241  ?  9   ARG C NH2 1 
ATOM   2817 N  N   . GLN C  1 10  ? 33.20241  -38.70162 26.79923  1.000 62.55395  ?  10  GLN C N   1 
ATOM   2818 C  CA  . GLN C  1 10  ? 34.20094  -39.26160 25.89302  1.000 61.38521  ?  10  GLN C CA  1 
ATOM   2819 C  C   . GLN C  1 10  ? 35.39349  -38.31910 25.85554  1.000 51.87411  ?  10  GLN C C   1 
ATOM   2820 O  O   . GLN C  1 10  ? 35.24643  -37.13158 25.53156  1.000 48.48352  ?  10  GLN C O   1 
ATOM   2821 C  CB  . GLN C  1 10  ? 33.60390  -39.47371 24.49142  1.000 53.86799  ?  10  GLN C CB  1 
ATOM   2822 C  CG  . GLN C  1 10  ? 34.44234  -40.34937 23.57625  1.000 55.83429  ?  10  GLN C CG  1 
ATOM   2823 C  CD  . GLN C  1 10  ? 33.79657  -40.57030 22.22227  1.000 59.16772  ?  10  GLN C CD  1 
ATOM   2824 O  OE1 . GLN C  1 10  ? 33.24807  -39.65079 21.62853  1.000 61.72289  ?  10  GLN C OE1 1 
ATOM   2825 N  NE2 . GLN C  1 10  ? 33.87311  -41.79771 21.71939  1.000 68.79592  ?  10  GLN C NE2 1 
ATOM   2826 N  N   . ASN C  1 11  ? 36.56166  -38.83708 26.21343  1.000 55.69385  ?  11  ASN C N   1 
ATOM   2827 C  CA  . ASN C  1 11  ? 37.80538  -38.08376 26.10877  1.000 51.06797  ?  11  ASN C CA  1 
ATOM   2828 C  C   . ASN C  1 11  ? 37.77586  -36.83592 26.99048  1.000 50.73421  ?  11  ASN C C   1 
ATOM   2829 O  O   . ASN C  1 11  ? 38.19157  -35.74851 26.57907  1.000 50.08732  ?  11  ASN C O   1 
ATOM   2830 C  CB  . ASN C  1 11  ? 38.08485  -37.71967 24.65113  1.000 49.89250  ?  11  ASN C CB  1 
ATOM   2831 C  CG  . ASN C  1 11  ? 39.48856  -37.24339 24.43695  1.000 50.32637  ?  11  ASN C CG  1 
ATOM   2832 O  OD1 . ASN C  1 11  ? 40.41963  -37.74226 25.06782  1.000 54.80302  ?  11  ASN C OD1 1 
ATOM   2833 N  ND2 . ASN C  1 11  ? 39.65644  -36.26136 23.56545  1.000 49.33336  ?  11  ASN C ND2 1 
ATOM   2834 N  N   . TYR C  1 12  ? 37.29712  -36.98924 28.22444  1.000 51.39747  ?  12  TYR C N   1 
ATOM   2835 C  CA  . TYR C  1 12  ? 36.98324  -35.84171 29.07422  1.000 59.04429  ?  12  TYR C CA  1 
ATOM   2836 C  C   . TYR C  1 12  ? 37.55434  -36.06319 30.46880  1.000 52.68547  ?  12  TYR C C   1 
ATOM   2837 O  O   . TYR C  1 12  ? 36.87857  -36.60527 31.34974  1.000 58.76404  ?  12  TYR C O   1 
ATOM   2838 C  CB  . TYR C  1 12  ? 35.47687  -35.58514 29.11444  1.000 50.13590  ?  12  TYR C CB  1 
ATOM   2839 C  CG  . TYR C  1 12  ? 35.16575  -34.26718 29.75199  1.000 49.68448  ?  12  TYR C CG  1 
ATOM   2840 C  CD1 . TYR C  1 12  ? 35.66065  -33.08795 29.21703  1.000 53.99404  ?  12  TYR C CD1 1 
ATOM   2841 C  CD2 . TYR C  1 12  ? 34.41654  -34.19982 30.91231  1.000 50.05857  ?  12  TYR C CD2 1 
ATOM   2842 C  CE1 . TYR C  1 12  ? 35.38588  -31.86593 29.80054  1.000 52.96025  ?  12  TYR C CE1 1 
ATOM   2843 C  CE2 . TYR C  1 12  ? 34.14204  -32.98905 31.51327  1.000 54.66141  ?  12  TYR C CE2 1 
ATOM   2844 C  CZ  . TYR C  1 12  ? 34.62882  -31.82315 30.95282  1.000 55.02159  ?  12  TYR C CZ  1 
ATOM   2845 O  OH  . TYR C  1 12  ? 34.34934  -30.61042 31.54032  1.000 51.91442  ?  12  TYR C OH  1 
ATOM   2846 N  N   . HIS C  1 13  ? 38.78443  -35.59599 30.66573  1.000 53.35821  ?  13  HIS C N   1 
ATOM   2847 C  CA  . HIS C  1 13  ? 39.55786  -35.93376 31.85205  1.000 60.56696  ?  13  HIS C CA  1 
ATOM   2848 C  C   . HIS C  1 13  ? 38.91280  -35.35126 33.10797  1.000 63.21835  ?  13  HIS C C   1 
ATOM   2849 O  O   . HIS C  1 13  ? 38.26453  -34.30538 33.07224  1.000 56.76937  ?  13  HIS C O   1 
ATOM   2850 C  CB  . HIS C  1 13  ? 40.98719  -35.41908 31.69477  1.000 55.59541  ?  13  HIS C CB  1 
ATOM   2851 C  CG  . HIS C  1 13  ? 41.98844  -36.13613 32.54371  1.000 59.31446  ?  13  HIS C CG  1 
ATOM   2852 N  ND1 . HIS C  1 13  ? 42.09753  -35.92224 33.90031  1.000 59.40868  ?  13  HIS C ND1 1 
ATOM   2853 C  CD2 . HIS C  1 13  ? 42.94751  -37.03809 32.22607  1.000 58.51750  ?  13  HIS C CD2 1 
ATOM   2854 C  CE1 . HIS C  1 13  ? 43.06931  -36.67457 34.38626  1.000 62.43729  ?  13  HIS C CE1 1 
ATOM   2855 N  NE2 . HIS C  1 13  ? 43.60310  -37.35927 33.39063  1.000 62.99108  ?  13  HIS C NE2 1 
ATOM   2856 N  N   . GLN C  1 14  ? 39.09121  -36.04459 34.23426  1.000 61.05374  ?  14  GLN C N   1 
ATOM   2857 C  CA  . GLN C  1 14  ? 38.49126  -35.55600 35.47469  1.000 66.61012  ?  14  GLN C CA  1 
ATOM   2858 C  C   . GLN C  1 14  ? 39.13779  -34.24719 35.94017  1.000 65.61085  ?  14  GLN C C   1 
ATOM   2859 O  O   . GLN C  1 14  ? 38.48604  -33.43986 36.63023  1.000 57.02138  ?  14  GLN C O   1 
ATOM   2860 C  CB  . GLN C  1 14  ? 38.57669  -36.64345 36.55572  1.000 65.29341  ?  14  GLN C CB  1 
ATOM   2861 N  N   . ASP C  1 15  ? 40.41022  -34.02091 35.57077  1.000 57.76578  ?  15  ASP C N   1 
ATOM   2862 C  CA  . ASP C  1 15  ? 41.02956  -32.71637 35.78835  1.000 57.64635  ?  15  ASP C CA  1 
ATOM   2863 C  C   . ASP C  1 15  ? 40.32738  -31.63111 34.98510  1.000 55.87292  ?  15  ASP C C   1 
ATOM   2864 O  O   . ASP C  1 15  ? 40.14357  -30.51669 35.47526  1.000 57.62551  ?  15  ASP C O   1 
ATOM   2865 C  CB  . ASP C  1 15  ? 42.50904  -32.75239 35.41389  1.000 60.08629  ?  15  ASP C CB  1 
ATOM   2866 C  CG  . ASP C  1 15  ? 43.31853  -33.64412 36.33349  1.000 69.23282  ?  15  ASP C CG  1 
ATOM   2867 O  OD1 . ASP C  1 15  ? 42.78142  -34.05744 37.38618  1.000 71.16984  ?  15  ASP C OD1 1 
ATOM   2868 O  OD2 . ASP C  1 15  ? 44.47827  -33.95430 35.98406  1.000 69.49242  -1 15  ASP C OD2 1 
ATOM   2869 N  N   . SER C  1 16  ? 39.95228  -31.93369 33.73901  1.000 57.59134  ?  16  SER C N   1 
ATOM   2870 C  CA  . SER C  1 16  ? 39.20431  -30.97839 32.92542  1.000 60.12726  ?  16  SER C CA  1 
ATOM   2871 C  C   . SER C  1 16  ? 37.85328  -30.65323 33.55047  1.000 52.33823  ?  16  SER C C   1 
ATOM   2872 O  O   . SER C  1 16  ? 37.44386  -29.49860 33.56783  1.000 51.50666  ?  16  SER C O   1 
ATOM   2873 C  CB  . SER C  1 16  ? 39.01819  -31.52462 31.50997  1.000 54.57574  ?  16  SER C CB  1 
ATOM   2874 O  OG  . SER C  1 16  ? 40.27342  -31.82896 30.91974  1.000 52.42258  ?  16  SER C OG  1 
ATOM   2875 N  N   . GLU C  1 17  ? 37.16278  -31.65230 34.09757  1.000 61.41699  ?  17  GLU C N   1 
ATOM   2876 C  CA  . GLU C  1 17  ? 35.86343  -31.41113 34.72018  1.000 57.01578  ?  17  GLU C CA  1 
ATOM   2877 C  C   . GLU C  1 17  ? 35.99402  -30.52669 35.96126  1.000 59.96312  ?  17  GLU C C   1 
ATOM   2878 O  O   . GLU C  1 17  ? 35.22151  -29.56993 36.14637  1.000 56.86636  ?  17  GLU C O   1 
ATOM   2879 C  CB  . GLU C  1 17  ? 35.21288  -32.75148 35.05967  1.000 53.04552  ?  17  GLU C CB  1 
ATOM   2880 C  CG  . GLU C  1 17  ? 33.85056  -32.66366 35.74061  1.000 64.12405  ?  17  GLU C CG  1 
ATOM   2881 C  CD  . GLU C  1 17  ? 33.39475  -34.01549 36.25992  1.000 71.36863  ?  17  GLU C CD  1 
ATOM   2882 O  OE1 . GLU C  1 17  ? 33.95440  -35.02732 35.78539  1.000 75.83095  ?  17  GLU C OE1 1 
ATOM   2883 O  OE2 . GLU C  1 17  ? 32.51383  -34.07263 37.15379  1.000 72.24016  -1 17  GLU C OE2 1 
ATOM   2884 N  N   . ALA C  1 18  ? 36.97077  -30.82255 36.82388  1.000 54.67702  ?  18  ALA C N   1 
ATOM   2885 C  CA  . ALA C  1 18  ? 37.19933  -29.95204 37.97825  1.000 60.28774  ?  18  ALA C CA  1 
ATOM   2886 C  C   . ALA C  1 18  ? 37.62142  -28.54622 37.54986  1.000 59.19968  ?  18  ALA C C   1 
ATOM   2887 O  O   . ALA C  1 18  ? 37.20818  -27.54927 38.15801  1.000 58.87270  ?  18  ALA C O   1 
ATOM   2888 C  CB  . ALA C  1 18  ? 38.25213  -30.55986 38.90583  1.000 57.36829  ?  18  ALA C CB  1 
ATOM   2889 N  N   . ALA C  1 19  ? 38.45934  -28.44531 36.51530  1.000 60.31104  ?  19  ALA C N   1 
ATOM   2890 C  CA  . ALA C  1 19  ? 38.91589  -27.13877 36.05793  1.000 64.66079  ?  19  ALA C CA  1 
ATOM   2891 C  C   . ALA C  1 19  ? 37.75707  -26.32661 35.48183  1.000 51.78855  ?  19  ALA C C   1 
ATOM   2892 O  O   . ALA C  1 19  ? 37.67957  -25.11092 35.67589  1.000 51.36529  ?  19  ALA C O   1 
ATOM   2893 C  CB  . ALA C  1 19  ? 40.03790  -27.31784 35.03232  1.000 53.37460  ?  19  ALA C CB  1 
ATOM   2894 N  N   . ILE C  1 20  ? 36.82644  -26.99363 34.80463  1.000 62.31453  ?  20  ILE C N   1 
ATOM   2895 C  CA  . ILE C  1 20  ? 35.63134  -26.32559 34.30522  1.000 54.50696  ?  20  ILE C CA  1 
ATOM   2896 C  C   . ILE C  1 20  ? 34.76254  -25.83598 35.46059  1.000 54.82200  ?  20  ILE C C   1 
ATOM   2897 O  O   . ILE C  1 20  ? 34.23092  -24.71710 35.42396  1.000 55.01435  ?  20  ILE C O   1 
ATOM   2898 C  CB  . ILE C  1 20  ? 34.86731  -27.27507 33.36873  1.000 56.14046  ?  20  ILE C CB  1 
ATOM   2899 C  CG1 . ILE C  1 20  ? 35.65942  -27.47461 32.07050  1.000 49.97861  ?  20  ILE C CG1 1 
ATOM   2900 C  CG2 . ILE C  1 20  ? 33.44151  -26.74091 33.07357  1.000 49.61360  ?  20  ILE C CG2 1 
ATOM   2901 C  CD1 . ILE C  1 20  ? 35.83487  -26.19933 31.26027  1.000 49.35214  ?  20  ILE C CD1 1 
ATOM   2902 N  N   . ASN C  1 21  ? 34.59408  -26.65822 36.49971  1.000 50.83621  ?  21  ASN C N   1 
ATOM   2903 C  CA  . ASN C  1 21  ? 33.84251  -26.19843 37.66910  1.000 53.36248  ?  21  ASN C CA  1 
ATOM   2904 C  C   . ASN C  1 21  ? 34.47557  -24.95393 38.28256  1.000 55.07057  ?  21  ASN C C   1 
ATOM   2905 O  O   . ASN C  1 21  ? 33.77836  -23.97943 38.61938  1.000 63.21755  ?  21  ASN C O   1 
ATOM   2906 C  CB  . ASN C  1 21  ? 33.74103  -27.31968 38.70323  1.000 52.86213  ?  21  ASN C CB  1 
ATOM   2907 C  CG  . ASN C  1 21  ? 32.64866  -28.29455 38.36670  1.000 54.46233  ?  21  ASN C CG  1 
ATOM   2908 O  OD1 . ASN C  1 21  ? 31.59915  -27.89519 37.88271  1.000 56.14906  ?  21  ASN C OD1 1 
ATOM   2909 N  ND2 . ASN C  1 21  ? 32.90616  -29.58195 38.55655  1.000 52.99590  ?  21  ASN C ND2 1 
ATOM   2910 N  N   . ARG C  1 22  ? 35.79973  -24.96257 38.41778  1.000 52.49076  ?  22  ARG C N   1 
ATOM   2911 C  CA  . ARG C  1 22  ? 36.48658  -23.80704 38.98517  1.000 54.28171  ?  22  ARG C CA  1 
ATOM   2912 C  C   . ARG C  1 22  ? 36.33371  -22.57904 38.09703  1.000 51.55366  ?  22  ARG C C   1 
ATOM   2913 O  O   . ARG C  1 22  ? 36.15148  -21.46092 38.59535  1.000 57.61404  ?  22  ARG C O   1 
ATOM   2914 C  CB  . ARG C  1 22  ? 37.96305  -24.14031 39.21292  1.000 55.29086  ?  22  ARG C CB  1 
ATOM   2915 C  CG  . ARG C  1 22  ? 38.18453  -25.21572 40.27216  1.000 58.27924  ?  22  ARG C CG  1 
ATOM   2916 C  CD  . ARG C  1 22  ? 39.63997  -25.25046 40.75419  1.000 68.20144  ?  22  ARG C CD  1 
ATOM   2917 N  NE  . ARG C  1 22  ? 40.56718  -25.46182 39.64218  1.000 70.63649  ?  22  ARG C NE  1 
ATOM   2918 C  CZ  . ARG C  1 22  ? 40.93115  -26.66094 39.19111  1.000 71.35087  ?  22  ARG C CZ  1 
ATOM   2919 N  NH1 . ARG C  1 22  ? 40.44834  -27.77157 39.75839  1.000 64.78575  ?  22  ARG C NH1 1 
ATOM   2920 N  NH2 . ARG C  1 22  ? 41.77204  -26.74689 38.16529  1.000 67.06771  ?  22  ARG C NH2 1 
ATOM   2921 N  N   . GLN C  1 23  ? 36.38980  -22.76786 36.77452  1.000 50.52697  ?  23  GLN C N   1 
ATOM   2922 C  CA  . GLN C  1 23  ? 36.21147  -21.64477 35.86320  1.000 53.47360  ?  23  GLN C CA  1 
ATOM   2923 C  C   . GLN C  1 23  ? 34.80003  -21.08125 35.94475  1.000 58.37716  ?  23  GLN C C   1 
ATOM   2924 O  O   . GLN C  1 23  ? 34.61104  -19.86030 35.83330  1.000 56.37499  ?  23  GLN C O   1 
ATOM   2925 C  CB  . GLN C  1 23  ? 36.53065  -22.05444 34.42871  1.000 48.44551  ?  23  GLN C CB  1 
ATOM   2926 C  CG  . GLN C  1 23  ? 36.61550  -20.85653 33.48642  1.000 47.35933  ?  23  GLN C CG  1 
ATOM   2927 C  CD  . GLN C  1 23  ? 37.73208  -19.89059 33.87846  1.000 49.33908  ?  23  GLN C CD  1 
ATOM   2928 O  OE1 . GLN C  1 23  ? 38.76224  -20.30105 34.41590  1.000 52.78901  ?  23  GLN C OE1 1 
ATOM   2929 N  NE2 . GLN C  1 23  ? 37.53919  -18.60638 33.59263  1.000 53.96740  ?  23  GLN C NE2 1 
ATOM   2930 N  N   . ILE C  1 24  ? 33.79845  -21.95652 36.11106  1.000 48.17908  ?  24  ILE C N   1 
ATOM   2931 C  CA  . ILE C  1 24  ? 32.42248  -21.49709 36.31472  1.000 51.40011  ?  24  ILE C CA  1 
ATOM   2932 C  C   . ILE C  1 24  ? 32.35329  -20.58592 37.52923  1.000 53.91214  ?  24  ILE C C   1 
ATOM   2933 O  O   . ILE C  1 24  ? 31.75917  -19.49852 37.48881  1.000 47.35624  ?  24  ILE C O   1 
ATOM   2934 C  CB  . ILE C  1 24  ? 31.47057  -22.69370 36.48834  1.000 53.57369  ?  24  ILE C CB  1 
ATOM   2935 C  CG1 . ILE C  1 24  ? 31.26342  -23.44582 35.17257  1.000 48.18286  ?  24  ILE C CG1 1 
ATOM   2936 C  CG2 . ILE C  1 24  ? 30.15417  -22.22114 37.09099  1.000 56.85977  ?  24  ILE C CG2 1 
ATOM   2937 C  CD1 . ILE C  1 24  ? 30.81534  -24.89213 35.37173  1.000 47.09062  ?  24  ILE C CD1 1 
ATOM   2938 N  N   . ASN C  1 25  ? 32.93096  -21.04764 38.64479  1.000 60.02537  ?  25  ASN C N   1 
ATOM   2939 C  CA  . ASN C  1 25  ? 32.99221  -20.21481 39.84486  1.000 61.09921  ?  25  ASN C CA  1 
ATOM   2940 C  C   . ASN C  1 25  ? 33.64110  -18.86475 39.54736  1.000 59.19998  ?  25  ASN C C   1 
ATOM   2941 O  O   . ASN C  1 25  ? 33.17609  -17.81800 40.01963  1.000 52.23522  ?  25  ASN C O   1 
ATOM   2942 C  CB  . ASN C  1 25  ? 33.76323  -20.93986 40.94707  1.000 51.89887  ?  25  ASN C CB  1 
ATOM   2943 C  CG  . ASN C  1 25  ? 33.76422  -20.17473 42.25974  1.000 54.69304  ?  25  ASN C CG  1 
ATOM   2944 O  OD1 . ASN C  1 25  ? 32.82920  -20.29047 43.05160  1.000 55.30359  ?  25  ASN C OD1 1 
ATOM   2945 N  ND2 . ASN C  1 25  ? 34.80904  -19.37986 42.49449  1.000 53.42073  ?  25  ASN C ND2 1 
ATOM   2946 N  N   . LEU C  1 26  ? 34.73108  -18.87091 38.77740  1.000 60.89660  ?  26  LEU C N   1 
ATOM   2947 C  CA  . LEU C  1 26  ? 35.41726  -17.61439 38.49602  1.000 60.72415  ?  26  LEU C CA  1 
ATOM   2948 C  C   . LEU C  1 26  ? 34.53089  -16.66574 37.69163  1.000 55.73271  ?  26  LEU C C   1 
ATOM   2949 O  O   . LEU C  1 26  ? 34.50023  -15.45813 37.95865  1.000 57.12656  ?  26  LEU C O   1 
ATOM   2950 C  CB  . LEU C  1 26  ? 36.72464  -17.88360 37.75875  1.000 62.51953  ?  26  LEU C CB  1 
ATOM   2951 C  CG  . LEU C  1 26  ? 37.70562  -16.71975 37.68569  1.000 60.59861  ?  26  LEU C CG  1 
ATOM   2952 C  CD1 . LEU C  1 26  ? 38.16269  -16.32910 39.07760  1.000 59.19353  ?  26  LEU C CD1 1 
ATOM   2953 C  CD2 . LEU C  1 26  ? 38.88988  -17.11890 36.83628  1.000 65.82894  ?  26  LEU C CD2 1 
ATOM   2954 N  N   . GLU C  1 27  ? 33.80941  -17.18849 36.69687  1.000 47.14952  ?  27  GLU C N   1 
ATOM   2955 C  CA  . GLU C  1 27  ? 32.94721  -16.31991 35.89456  1.000 53.03918  ?  27  GLU C CA  1 
ATOM   2956 C  C   . GLU C  1 27  ? 31.81036  -15.74722 36.72864  1.000 50.71700  ?  27  GLU C C   1 
ATOM   2957 O  O   . GLU C  1 27  ? 31.46197  -14.56488 36.59184  1.000 59.75164  ?  27  GLU C O   1 
ATOM   2958 C  CB  . GLU C  1 27  ? 32.39111  -17.06471 34.68517  1.000 51.52843  ?  27  GLU C CB  1 
ATOM   2959 C  CG  . GLU C  1 27  ? 33.44868  -17.70133 33.81632  1.000 54.49640  ?  27  GLU C CG  1 
ATOM   2960 C  CD  . GLU C  1 27  ? 34.19764  -16.71702 32.94303  1.000 65.97901  ?  27  GLU C CD  1 
ATOM   2961 O  OE1 . GLU C  1 27  ? 33.74129  -15.55692 32.78403  1.000 66.15531  ?  27  GLU C OE1 1 
ATOM   2962 O  OE2 . GLU C  1 27  ? 35.24838  -17.12461 32.40209  1.000 68.97420  -1 27  GLU C OE2 1 
ATOM   2963 N  N   . LEU C  1 28  ? 31.23260  -16.55647 37.60733  1.000 46.36536  ?  28  LEU C N   1 
ATOM   2964 C  CA  . LEU C  1 28  ? 30.20897  -16.02697 38.50122  1.000 48.90888  ?  28  LEU C CA  1 
ATOM   2965 C  C   . LEU C  1 28  ? 30.78514  -14.95916 39.42959  1.000 49.24666  ?  28  LEU C C   1 
ATOM   2966 O  O   . LEU C  1 28  ? 30.11511  -13.95947 39.73320  1.000 51.96490  ?  28  LEU C O   1 
ATOM   2967 C  CB  . LEU C  1 28  ? 29.55540  -17.16670 39.29722  1.000 49.05521  ?  28  LEU C CB  1 
ATOM   2968 C  CG  . LEU C  1 28  ? 28.66819  -18.12290 38.47083  1.000 49.74161  ?  28  LEU C CG  1 
ATOM   2969 C  CD1 . LEU C  1 28  ? 28.56805  -19.53621 39.06692  1.000 51.69757  ?  28  LEU C CD1 1 
ATOM   2970 C  CD2 . LEU C  1 28  ? 27.26694  -17.55072 38.16732  1.000 45.15276  ?  28  LEU C CD2 1 
ATOM   2971 N  N   . TYR C  1 29  ? 32.03230  -15.13535 39.87511  1.000 48.22445  ?  29  TYR C N   1 
ATOM   2972 C  CA  . TYR C  1 29  ? 32.63732  -14.13758 40.75830  1.000 53.09727  ?  29  TYR C CA  1 
ATOM   2973 C  C   . TYR C  1 29  ? 32.87811  -12.83269 40.01614  1.000 51.29484  ?  29  TYR C C   1 
ATOM   2974 O  O   . TYR C  1 29  ? 32.65028  -11.74349 40.55861  1.000 69.02652  ?  29  TYR C O   1 
ATOM   2975 C  CB  . TYR C  1 29  ? 33.95113  -14.66077 41.35907  1.000 55.18314  ?  29  TYR C CB  1 
ATOM   2976 C  CG  . TYR C  1 29  ? 34.80310  -13.59271 42.04674  1.000 60.07096  ?  29  TYR C CG  1 
ATOM   2977 C  CD1 . TYR C  1 29  ? 34.46065  -13.09774 43.29941  1.000 59.10674  ?  29  TYR C CD1 1 
ATOM   2978 C  CD2 . TYR C  1 29  ? 35.94897  -13.08065 41.43280  1.000 63.79158  ?  29  TYR C CD2 1 
ATOM   2979 C  CE1 . TYR C  1 29  ? 35.23271  -12.12451 43.92660  1.000 60.13800  ?  29  TYR C CE1 1 
ATOM   2980 C  CE2 . TYR C  1 29  ? 36.72486  -12.10452 42.04900  1.000 62.79189  ?  29  TYR C CE2 1 
ATOM   2981 C  CZ  . TYR C  1 29  ? 36.35805  -11.63134 43.29353  1.000 62.76429  ?  29  TYR C CZ  1 
ATOM   2982 O  OH  . TYR C  1 29  ? 37.11506  -10.66460 43.90790  1.000 65.99559  ?  29  TYR C OH  1 
ATOM   2983 N  N   . ALA C  1 30  ? 33.34945  -12.92089 38.77649  1.000 47.52287  ?  30  ALA C N   1 
ATOM   2984 C  CA  . ALA C  1 30  ? 33.49742  -11.71780 37.97022  1.000 46.73206  ?  30  ALA C CA  1 
ATOM   2985 C  C   . ALA C  1 30  ? 32.16142  -11.00760 37.81608  1.000 52.89123  ?  30  ALA C C   1 
ATOM   2986 O  O   . ALA C  1 30  ? 32.08437  -9.77558  37.92548  1.000 54.34036  ?  30  ALA C O   1 
ATOM   2987 C  CB  . ALA C  1 30  ? 34.07534  -12.07406 36.60353  1.000 48.89026  ?  30  ALA C CB  1 
ATOM   2988 N  N   . SER C  1 31  ? 31.10255  -11.77673 37.54116  1.000 51.05718  ?  31  SER C N   1 
ATOM   2989 C  CA  . SER C  1 31  ? 29.76476  -11.20853 37.42518  1.000 50.54512  ?  31  SER C CA  1 
ATOM   2990 C  C   . SER C  1 31  ? 29.37394  -10.46423 38.69787  1.000 54.25630  ?  31  SER C C   1 
ATOM   2991 O  O   . SER C  1 31  ? 28.81730  -9.35558  38.63393  1.000 50.07908  ?  31  SER C O   1 
ATOM   2992 C  CB  . SER C  1 31  ? 28.76871  -12.32800 37.10916  1.000 51.80307  ?  31  SER C CB  1 
ATOM   2993 O  OG  . SER C  1 31  ? 27.42345  -11.88799 37.18744  1.000 63.51640  ?  31  SER C OG  1 
ATOM   2994 N  N   . TYR C  1 32  ? 29.67958  -11.05455 39.86547  1.000 60.25192  ?  32  TYR C N   1 
ATOM   2995 C  CA  . TYR C  1 32  ? 29.39379  -10.40135 41.14967  1.000 60.98631  ?  32  TYR C CA  1 
ATOM   2996 C  C   . TYR C  1 32  ? 30.14944  -9.08197  41.28037  1.000 57.20573  ?  32  TYR C C   1 
ATOM   2997 O  O   . TYR C  1 32  ? 29.58865  -8.06185  41.70890  1.000 53.81653  ?  32  TYR C O   1 
ATOM   2998 C  CB  . TYR C  1 32  ? 29.75765  -11.33288 42.30925  1.000 55.78453  ?  32  TYR C CB  1 
ATOM   2999 C  CG  . TYR C  1 32  ? 28.95635  -11.13267 43.58771  1.000 53.40190  ?  32  TYR C CG  1 
ATOM   3000 C  CD1 . TYR C  1 32  ? 27.75248  -10.43540 43.58299  1.000 50.47025  ?  32  TYR C CD1 1 
ATOM   3001 C  CD2 . TYR C  1 32  ? 29.40844  -11.64817 44.80027  1.000 55.61416  ?  32  TYR C CD2 1 
ATOM   3002 C  CE1 . TYR C  1 32  ? 27.00550  -10.26175 44.74529  1.000 48.87428  ?  32  TYR C CE1 1 
ATOM   3003 C  CE2 . TYR C  1 32  ? 28.66923  -11.47549 45.97933  1.000 64.07960  ?  32  TYR C CE2 1 
ATOM   3004 C  CZ  . TYR C  1 32  ? 27.45873  -10.78348 45.93836  1.000 59.57801  ?  32  TYR C CZ  1 
ATOM   3005 O  OH  . TYR C  1 32  ? 26.71488  -10.60296 47.09614  1.000 58.44426  ?  32  TYR C OH  1 
ATOM   3006 N  N   . VAL C  1 33  ? 31.43479  -9.09065  40.93040  1.000 54.86132  ?  33  VAL C N   1 
ATOM   3007 C  CA  . VAL C  1 33  ? 32.23377  -7.87452  41.04986  1.000 55.12312  ?  33  VAL C CA  1 
ATOM   3008 C  C   . VAL C  1 33  ? 31.64012  -6.77218  40.18528  1.000 59.28838  ?  33  VAL C C   1 
ATOM   3009 O  O   . VAL C  1 33  ? 31.48514  -5.61971  40.62131  1.000 62.89665  ?  33  VAL C O   1 
ATOM   3010 C  CB  . VAL C  1 33  ? 33.69742  -8.15451  40.67361  1.000 54.10411  ?  33  VAL C CB  1 
ATOM   3011 C  CG1 . VAL C  1 33  ? 34.49349  -6.86428  40.68602  1.000 48.69405  ?  33  VAL C CG1 1 
ATOM   3012 C  CG2 . VAL C  1 33  ? 34.28916  -9.18773  41.62157  1.000 49.70037  ?  33  VAL C CG2 1 
ATOM   3013 N  N   . TYR C  1 34  ? 31.30628  -7.11563  38.93966  1.000 55.31514  ?  34  TYR C N   1 
ATOM   3014 C  CA  . TYR C  1 34  ? 30.77096  -6.13128  38.01012  1.000 50.31181  ?  34  TYR C CA  1 
ATOM   3015 C  C   . TYR C  1 34  ? 29.44034  -5.58069  38.50349  1.000 58.67695  ?  34  TYR C C   1 
ATOM   3016 O  O   . TYR C  1 34  ? 29.14435  -4.38994  38.32636  1.000 49.38734  ?  34  TYR C O   1 
ATOM   3017 C  CB  . TYR C  1 34  ? 30.60315  -6.76716  36.63688  1.000 52.96392  ?  34  TYR C CB  1 
ATOM   3018 C  CG  . TYR C  1 34  ? 31.86298  -6.83795  35.82958  1.000 58.32873  ?  34  TYR C CG  1 
ATOM   3019 C  CD1 . TYR C  1 34  ? 32.58183  -5.68461  35.54011  1.000 61.91558  ?  34  TYR C CD1 1 
ATOM   3020 C  CD2 . TYR C  1 34  ? 32.32552  -8.05419  35.32785  1.000 52.82072  ?  34  TYR C CD2 1 
ATOM   3021 C  CE1 . TYR C  1 34  ? 33.73305  -5.73474  34.78391  1.000 58.07787  ?  34  TYR C CE1 1 
ATOM   3022 C  CE2 . TYR C  1 34  ? 33.47358  -8.11471  34.56747  1.000 51.98521  ?  34  TYR C CE2 1 
ATOM   3023 C  CZ  . TYR C  1 34  ? 34.17117  -6.94715  34.30142  1.000 57.50928  ?  34  TYR C CZ  1 
ATOM   3024 O  OH  . TYR C  1 34  ? 35.31265  -6.98458  33.54961  1.000 70.05372  ?  34  TYR C OH  1 
ATOM   3025 N  N   . LEU C  1 35  ? 28.61763  -6.44579  39.10963  1.000 60.82053  ?  35  LEU C N   1 
ATOM   3026 C  CA  . LEU C  1 35  ? 27.35353  -6.00364  39.69124  1.000 57.08403  ?  35  LEU C CA  1 
ATOM   3027 C  C   . LEU C  1 35  ? 27.57693  -4.97791  40.80091  1.000 54.82911  ?  35  LEU C C   1 
ATOM   3028 O  O   . LEU C  1 35  ? 26.87721  -3.95035  40.87377  1.000 60.13615  ?  35  LEU C O   1 
ATOM   3029 C  CB  . LEU C  1 35  ? 26.59806  -7.22155  40.22605  1.000 49.38896  ?  35  LEU C CB  1 
ATOM   3030 C  CG  . LEU C  1 35  ? 25.41917  -6.85428  41.11362  1.000 52.39702  ?  35  LEU C CG  1 
ATOM   3031 C  CD1 . LEU C  1 35  ? 24.30538  -6.32493  40.22221  1.000 43.91352  ?  35  LEU C CD1 1 
ATOM   3032 C  CD2 . LEU C  1 35  ? 24.93967  -8.01657  41.94650  1.000 45.47733  ?  35  LEU C CD2 1 
ATOM   3033 N  N   . SER C  1 36  ? 28.54563  -5.24630  41.68081  1.000 52.20989  ?  36  SER C N   1 
ATOM   3034 C  CA  . SER C  1 36  ? 28.82470  -4.31552  42.76968  1.000 53.25783  ?  36  SER C CA  1 
ATOM   3035 C  C   . SER C  1 36  ? 29.34540  -2.98909  42.24376  1.000 56.74026  ?  36  SER C C   1 
ATOM   3036 O  O   . SER C  1 36  ? 28.95109  -1.92427  42.73250  1.000 67.36219  ?  36  SER C O   1 
ATOM   3037 C  CB  . SER C  1 36  ? 29.83910  -4.91127  43.73862  1.000 55.58892  ?  36  SER C CB  1 
ATOM   3038 O  OG  . SER C  1 36  ? 30.48000  -3.87563  44.46035  1.000 59.81362  ?  36  SER C OG  1 
ATOM   3039 N  N   . MET C  1 37  ? 30.26187  -3.03747  41.26942  1.000 55.39289  ?  37  MET C N   1 
ATOM   3040 C  CA  . MET C  1 37  ? 30.71658  -1.82096  40.59306  1.000 54.44323  ?  37  MET C CA  1 
ATOM   3041 C  C   . MET C  1 37  ? 29.54178  -1.02089  40.03809  1.000 55.80357  ?  37  MET C C   1 
ATOM   3042 O  O   . MET C  1 37  ? 29.39533  0.17993   40.31867  1.000 60.27127  ?  37  MET C O   1 
ATOM   3043 C  CB  . MET C  1 37  ? 31.67419  -2.18364  39.45669  1.000 55.67496  ?  37  MET C CB  1 
ATOM   3044 C  CG  . MET C  1 37  ? 33.02717  -2.70476  39.89012  1.000 61.06393  ?  37  MET C CG  1 
ATOM   3045 S  SD  . MET C  1 37  ? 34.11900  -2.99862  38.47098  1.000 52.18802  ?  37  MET C SD  1 
ATOM   3046 C  CE  . MET C  1 37  ? 35.57368  -3.62098  39.32612  1.000 53.32451  ?  37  MET C CE  1 
ATOM   3047 N  N   . SER C  1 38  ? 28.71672  -1.66986  39.21057  1.000 51.48629  ?  38  SER C N   1 
ATOM   3048 C  CA  . SER C  1 38  ? 27.56873  -1.01848  38.60229  1.000 50.10471  ?  38  SER C CA  1 
ATOM   3049 C  C   . SER C  1 38  ? 26.77161  -0.25283  39.64466  1.000 52.93976  ?  38  SER C C   1 
ATOM   3050 O  O   . SER C  1 38  ? 26.62910  0.96951   39.56323  1.000 56.33533  ?  38  SER C O   1 
ATOM   3051 C  CB  . SER C  1 38  ? 26.69471  -2.06410  37.90393  1.000 59.16775  ?  38  SER C CB  1 
ATOM   3052 O  OG  . SER C  1 38  ? 25.33804  -1.66025  37.80855  1.000 61.07915  ?  38  SER C OG  1 
ATOM   3053 N  N   . TYR C  1 39  ? 26.28021  -0.95001  40.66691  1.000 65.86594  ?  39  TYR C N   1 
ATOM   3054 C  CA  . TYR C  1 39  ? 25.42157  -0.21405  41.58777  1.000 61.07040  ?  39  TYR C CA  1 
ATOM   3055 C  C   . TYR C  1 39  ? 26.19850  0.74588   42.47763  1.000 58.04626  ?  39  TYR C C   1 
ATOM   3056 O  O   . TYR C  1 39  ? 25.58846  1.65329   43.05002  1.000 60.17858  ?  39  TYR C O   1 
ATOM   3057 C  CB  . TYR C  1 39  ? 24.56384  -1.18057  42.40356  1.000 52.68150  ?  39  TYR C CB  1 
ATOM   3058 C  CG  . TYR C  1 39  ? 23.36472  -1.59293  41.58845  1.000 44.60292  ?  39  TYR C CG  1 
ATOM   3059 C  CD1 . TYR C  1 39  ? 22.27303  -0.73859  41.42828  1.000 57.36723  ?  39  TYR C CD1 1 
ATOM   3060 C  CD2 . TYR C  1 39  ? 23.35892  -2.79656  40.90287  1.000 49.67157  ?  39  TYR C CD2 1 
ATOM   3061 C  CE1 . TYR C  1 39  ? 21.18649  -1.09628  40.63277  1.000 44.56744  ?  39  TYR C CE1 1 
ATOM   3062 C  CE2 . TYR C  1 39  ? 22.28581  -3.17581  40.12281  1.000 54.76321  ?  39  TYR C CE2 1 
ATOM   3063 C  CZ  . TYR C  1 39  ? 21.20814  -2.32167  39.98494  1.000 50.82848  ?  39  TYR C CZ  1 
ATOM   3064 O  OH  . TYR C  1 39  ? 20.16867  -2.73639  39.20634  1.000 54.32195  ?  39  TYR C OH  1 
ATOM   3065 N  N   . TYR C  1 40  ? 27.52309  0.61298   42.57087  1.000 57.43774  ?  40  TYR C N   1 
ATOM   3066 C  CA  . TYR C  1 40  ? 28.31124  1.69226   43.15512  1.000 55.46807  ?  40  TYR C CA  1 
ATOM   3067 C  C   . TYR C  1 40  ? 28.13656  2.97890   42.36188  1.000 57.58015  ?  40  TYR C C   1 
ATOM   3068 O  O   . TYR C  1 40  ? 28.00248  4.06779   42.93587  1.000 47.57100  ?  40  TYR C O   1 
ATOM   3069 C  CB  . TYR C  1 40  ? 29.78562  1.30851   43.19855  1.000 58.35450  ?  40  TYR C CB  1 
ATOM   3070 C  CG  . TYR C  1 40  ? 30.71159  2.48165   43.47851  1.000 56.10654  ?  40  TYR C CG  1 
ATOM   3071 C  CD1 . TYR C  1 40  ? 30.98110  2.87841   44.78291  1.000 58.23940  ?  40  TYR C CD1 1 
ATOM   3072 C  CD2 . TYR C  1 40  ? 31.31655  3.18481   42.44166  1.000 54.78557  ?  40  TYR C CD2 1 
ATOM   3073 C  CE1 . TYR C  1 40  ? 31.81762  3.94211   45.04895  1.000 62.72714  ?  40  TYR C CE1 1 
ATOM   3074 C  CE2 . TYR C  1 40  ? 32.15500  4.25695   42.69659  1.000 55.52973  ?  40  TYR C CE2 1 
ATOM   3075 C  CZ  . TYR C  1 40  ? 32.40070  4.63412   43.99942  1.000 62.18337  ?  40  TYR C CZ  1 
ATOM   3076 O  OH  . TYR C  1 40  ? 33.23700  5.69709   44.26303  1.000 64.32840  ?  40  TYR C OH  1 
ATOM   3077 N  N   . PHE C  1 41  ? 28.15682  2.87560   41.03638  1.000 60.70683  ?  41  PHE C N   1 
ATOM   3078 C  CA  . PHE C  1 41  ? 27.98421  4.07677   40.23243  1.000 51.78191  ?  41  PHE C CA  1 
ATOM   3079 C  C   . PHE C  1 41  ? 26.53649  4.55628   40.19143  1.000 51.02439  ?  41  PHE C C   1 
ATOM   3080 O  O   . PHE C  1 41  ? 26.27732  5.64956   39.68352  1.000 54.86794  ?  41  PHE C O   1 
ATOM   3081 C  CB  . PHE C  1 41  ? 28.53574  3.82946   38.82722  1.000 52.44685  ?  41  PHE C CB  1 
ATOM   3082 C  CG  . PHE C  1 41  ? 30.03606  3.76396   38.79106  1.000 57.21250  ?  41  PHE C CG  1 
ATOM   3083 C  CD1 . PHE C  1 41  ? 30.79166  4.92851   38.70898  1.000 61.32552  ?  41  PHE C CD1 1 
ATOM   3084 C  CD2 . PHE C  1 41  ? 30.69859  2.54845   38.88828  1.000 53.00081  ?  41  PHE C CD2 1 
ATOM   3085 C  CE1 . PHE C  1 41  ? 32.19133  4.87793   38.71065  1.000 50.67425  ?  41  PHE C CE1 1 
ATOM   3086 C  CE2 . PHE C  1 41  ? 32.08606  2.49265   38.88893  1.000 53.84539  ?  41  PHE C CE2 1 
ATOM   3087 C  CZ  . PHE C  1 41  ? 32.83228  3.66354   38.79944  1.000 50.67618  ?  41  PHE C CZ  1 
ATOM   3088 N  N   . ASP C  1 42  ? 25.59629  3.78453   40.73750  1.000 57.87269  ?  42  ASP C N   1 
ATOM   3089 C  CA  . ASP C  1 42  ? 24.21013  4.21785   40.87323  1.000 58.22823  ?  42  ASP C CA  1 
ATOM   3090 C  C   . ASP C  1 42  ? 23.98243  5.08726   42.10458  1.000 61.60711  ?  42  ASP C C   1 
ATOM   3091 O  O   . ASP C  1 42  ? 22.93113  5.73661   42.20349  1.000 61.23781  ?  42  ASP C O   1 
ATOM   3092 C  CB  . ASP C  1 42  ? 23.28182  2.99808   40.93328  1.000 46.28939  ?  42  ASP C CB  1 
ATOM   3093 C  CG  . ASP C  1 42  ? 21.82470  3.36646   40.77849  1.000 46.13195  ?  42  ASP C CG  1 
ATOM   3094 O  OD1 . ASP C  1 42  ? 21.43223  3.80671   39.68318  1.000 54.63661  ?  42  ASP C OD1 1 
ATOM   3095 O  OD2 . ASP C  1 42  ? 21.05931  3.22217   41.75019  1.000 58.33208  -1 42  ASP C OD2 1 
ATOM   3096 N  N   . ARG C  1 43  ? 24.93412  5.11003   43.03386  1.000 51.96029  ?  43  ARG C N   1 
ATOM   3097 C  CA  . ARG C  1 43  ? 24.78752  5.88498   44.25498  1.000 50.35262  ?  43  ARG C CA  1 
ATOM   3098 C  C   . ARG C  1 43  ? 24.60429  7.36297   43.92476  1.000 54.15611  ?  43  ARG C C   1 
ATOM   3099 O  O   . ARG C  1 43  ? 25.12981  7.87551   42.93025  1.000 46.98779  ?  43  ARG C O   1 
ATOM   3100 C  CB  . ARG C  1 43  ? 26.00932  5.69065   45.15901  1.000 51.37421  ?  43  ARG C CB  1 
ATOM   3101 C  CG  . ARG C  1 43  ? 26.17790  4.28134   45.71682  1.000 56.57077  ?  43  ARG C CG  1 
ATOM   3102 C  CD  . ARG C  1 43  ? 27.41064  4.16098   46.62381  1.000 61.22868  ?  43  ARG C CD  1 
ATOM   3103 N  NE  . ARG C  1 43  ? 27.46016  5.23093   47.62274  1.000 75.90980  ?  43  ARG C NE  1 
ATOM   3104 C  CZ  . ARG C  1 43  ? 26.91408  5.17223   48.84190  1.000 77.39424  ?  43  ARG C CZ  1 
ATOM   3105 N  NH1 . ARG C  1 43  ? 26.25624  4.09290   49.25139  1.000 77.23247  ?  43  ARG C NH1 1 
ATOM   3106 N  NH2 . ARG C  1 43  ? 27.02228  6.20701   49.66054  1.000 72.79122  ?  43  ARG C NH2 1 
ATOM   3107 N  N   . ASP C  1 44  ? 23.82922  8.04990   44.76569  1.000 51.38278  ?  44  ASP C N   1 
ATOM   3108 C  CA  . ASP C  1 44  ? 23.56376  9.45869   44.52396  1.000 51.62027  ?  44  ASP C CA  1 
ATOM   3109 C  C   . ASP C  1 44  ? 24.80091  10.32326  44.70400  1.000 56.37419  ?  44  ASP C C   1 
ATOM   3110 O  O   . ASP C  1 44  ? 24.79095  11.47323  44.26424  1.000 53.68909  ?  44  ASP C O   1 
ATOM   3111 C  CB  . ASP C  1 44  ? 22.47395  9.94838   45.46043  1.000 56.57279  ?  44  ASP C CB  1 
ATOM   3112 C  CG  . ASP C  1 44  ? 22.94412  10.01775  46.88040  1.000 66.04663  ?  44  ASP C CG  1 
ATOM   3113 O  OD1 . ASP C  1 44  ? 23.01680  8.95517   47.53685  1.000 70.10115  -1 44  ASP C OD1 1 
ATOM   3114 O  OD2 . ASP C  1 44  ? 23.25651  11.13643  47.33243  1.000 75.93530  -1 44  ASP C OD2 1 
ATOM   3115 N  N   . ASP C  1 45  ? 25.85743  9.80568   45.34679  1.000 62.15650  ?  45  ASP C N   1 
ATOM   3116 C  CA  . ASP C  1 45  ? 27.08651  10.56024  45.57338  1.000 59.90484  ?  45  ASP C CA  1 
ATOM   3117 C  C   . ASP C  1 45  ? 28.16054  10.26137  44.53380  1.000 58.36562  ?  45  ASP C C   1 
ATOM   3118 O  O   . ASP C  1 45  ? 29.26044  10.81532  44.61310  1.000 58.63106  ?  45  ASP C O   1 
ATOM   3119 C  CB  . ASP C  1 45  ? 27.61924  10.29474  46.98361  1.000 64.08620  ?  45  ASP C CB  1 
ATOM   3120 C  CG  . ASP C  1 45  ? 27.62953  8.81161   47.34786  1.000 74.93589  ?  45  ASP C CG  1 
ATOM   3121 O  OD1 . ASP C  1 45  ? 27.70832  7.95383   46.43969  1.000 76.98240  ?  45  ASP C OD1 1 
ATOM   3122 O  OD2 . ASP C  1 45  ? 27.55034  8.50052   48.55516  1.000 78.13601  -1 45  ASP C OD2 1 
ATOM   3123 N  N   . VAL C  1 46  ? 27.85860  9.39642   43.56900  1.000 58.95054  ?  46  VAL C N   1 
ATOM   3124 C  CA  . VAL C  1 46  ? 28.66384  9.21960   42.36447  1.000 57.56482  ?  46  VAL C CA  1 
ATOM   3125 C  C   . VAL C  1 46  ? 27.86949  9.62224   41.13197  1.000 60.30544  ?  46  VAL C C   1 
ATOM   3126 O  O   . VAL C  1 46  ? 28.26533  10.53849  40.39835  1.000 71.00070  ?  46  VAL C O   1 
ATOM   3127 C  CB  . VAL C  1 46  ? 29.16159  7.75117   42.24985  1.000 59.22728  ?  46  VAL C CB  1 
ATOM   3128 C  CG1 . VAL C  1 46  ? 30.34939  7.64709   41.28685  1.000 54.01076  ?  46  VAL C CG1 1 
ATOM   3129 C  CG2 . VAL C  1 46  ? 29.51456  7.20753   43.62933  1.000 55.21157  ?  46  VAL C CG2 1 
ATOM   3130 N  N   . ALA C  1 47  ? 26.73470  8.96558   40.88415  1.000 52.51006  ?  47  ALA C N   1 
ATOM   3131 C  CA  . ALA C  1 47  ? 25.78707  9.32314   39.82874  1.000 53.36110  ?  47  ALA C CA  1 
ATOM   3132 C  C   . ALA C  1 47  ? 26.46044  9.36949   38.45700  1.000 53.57557  ?  47  ALA C C   1 
ATOM   3133 O  O   . ALA C  1 47  ? 26.42198  10.37438  37.74585  1.000 59.45916  ?  47  ALA C O   1 
ATOM   3134 C  CB  . ALA C  1 47  ? 25.08239  10.64660  40.14625  1.000 51.49881  ?  47  ALA C CB  1 
ATOM   3135 N  N   . LEU C  1 48  ? 27.06490  8.25256   38.07211  1.000 55.21583  ?  48  LEU C N   1 
ATOM   3136 C  CA  . LEU C  1 48  ? 27.62688  8.09285   36.73171  1.000 52.39216  ?  48  LEU C CA  1 
ATOM   3137 C  C   . LEU C  1 48  ? 26.84696  6.96160   36.06823  1.000 48.73006  ?  48  LEU C C   1 
ATOM   3138 O  O   . LEU C  1 48  ? 27.30342  5.81456   36.06678  1.000 46.39335  ?  48  LEU C O   1 
ATOM   3139 C  CB  . LEU C  1 48  ? 29.12481  7.81724   36.78743  1.000 41.95066  ?  48  LEU C CB  1 
ATOM   3140 C  CG  . LEU C  1 48  ? 29.92579  9.08164   37.05537  1.000 45.94188  ?  48  LEU C CG  1 
ATOM   3141 C  CD1 . LEU C  1 48  ? 31.36885  8.74302   37.25174  1.000 50.93805  ?  48  LEU C CD1 1 
ATOM   3142 C  CD2 . LEU C  1 48  ? 29.75875  10.05499  35.90407  1.000 57.81679  ?  48  LEU C CD2 1 
ATOM   3143 N  N   . LYS C  1 49  ? 25.68003  7.31199   35.49384  1.000 42.18260  ?  49  LYS C N   1 
ATOM   3144 C  CA  . LYS C  1 49  ? 24.67710  6.31987   35.10793  1.000 42.74850  ?  49  LYS C CA  1 
ATOM   3145 C  C   . LYS C  1 49  ? 25.15418  5.43247   33.96684  1.000 42.46159  ?  49  LYS C C   1 
ATOM   3146 O  O   . LYS C  1 49  ? 24.76568  4.26434   33.88745  1.000 48.61842  ?  49  LYS C O   1 
ATOM   3147 C  CB  . LYS C  1 49  ? 23.35185  7.00601   34.71819  1.000 39.05469  ?  49  LYS C CB  1 
ATOM   3148 N  N   . ASN C  1 50  ? 25.98017  5.94993   33.07032  1.000 44.88410  ?  50  ASN C N   1 
ATOM   3149 C  CA  . ASN C  1 50  ? 26.43524  5.09014   31.98798  1.000 41.27348  ?  50  ASN C CA  1 
ATOM   3150 C  C   . ASN C  1 50  ? 27.55703  4.15855   32.42812  1.000 38.32200  ?  50  ASN C C   1 
ATOM   3151 O  O   . ASN C  1 50  ? 27.66106  3.05665   31.90031  1.000 57.74650  ?  50  ASN C O   1 
ATOM   3152 C  CB  . ASN C  1 50  ? 26.85891  5.93422   30.79371  1.000 39.45159  ?  50  ASN C CB  1 
ATOM   3153 C  CG  . ASN C  1 50  ? 25.67748  6.61581   30.12888  1.000 42.68931  ?  50  ASN C CG  1 
ATOM   3154 O  OD1 . ASN C  1 50  ? 24.72501  5.96187   29.70308  1.000 37.66085  ?  50  ASN C OD1 1 
ATOM   3155 N  ND2 . ASN C  1 50  ? 25.73680  7.93372   30.03275  1.000 42.66251  ?  50  ASN C ND2 1 
ATOM   3156 N  N   . PHE C  1 51  ? 28.39895  4.56708   33.37567  1.000 38.65013  ?  51  PHE C N   1 
ATOM   3157 C  CA  . PHE C  1 51  ? 29.29530  3.61252   34.02010  1.000 45.36120  ?  51  PHE C CA  1 
ATOM   3158 C  C   . PHE C  1 51  ? 28.50509  2.47183   34.63966  1.000 46.69729  ?  51  PHE C C   1 
ATOM   3159 O  O   . PHE C  1 51  ? 28.88712  1.29856   34.53682  1.000 51.75330  ?  51  PHE C O   1 
ATOM   3160 C  CB  . PHE C  1 51  ? 30.10837  4.30363   35.11724  1.000 44.07556  ?  51  PHE C CB  1 
ATOM   3161 C  CG  . PHE C  1 51  ? 31.33961  4.99569   34.63974  1.000 40.61284  ?  51  PHE C CG  1 
ATOM   3162 C  CD1 . PHE C  1 51  ? 31.28467  6.31603   34.22954  1.000 40.65123  ?  51  PHE C CD1 1 
ATOM   3163 C  CD2 . PHE C  1 51  ? 32.56759  4.35611   34.66383  1.000 44.22888  ?  51  PHE C CD2 1 
ATOM   3164 C  CE1 . PHE C  1 51  ? 32.42009  6.98580   33.81863  1.000 41.40315  ?  51  PHE C CE1 1 
ATOM   3165 C  CE2 . PHE C  1 51  ? 33.73172  5.02381   34.25073  1.000 44.28623  ?  51  PHE C CE2 1 
ATOM   3166 C  CZ  . PHE C  1 51  ? 33.65230  6.34203   33.82702  1.000 44.26483  ?  51  PHE C CZ  1 
ATOM   3167 N  N   . ALA C  1 52  ? 27.42007  2.81516   35.32824  1.000 47.54248  ?  52  ALA C N   1 
ATOM   3168 C  CA  . ALA C  1 52  ? 26.55005  1.81160   35.91268  1.000 48.76741  ?  52  ALA C CA  1 
ATOM   3169 C  C   . ALA C  1 52  ? 26.02574  0.86849   34.84000  1.000 50.40279  ?  52  ALA C C   1 
ATOM   3170 O  O   . ALA C  1 52  ? 26.07993  -0.35260  35.00063  1.000 58.99558  ?  52  ALA C O   1 
ATOM   3171 C  CB  . ALA C  1 52  ? 25.40419  2.49928   36.66071  1.000 43.19639  ?  52  ALA C CB  1 
ATOM   3172 N  N   . LYS C  1 53  ? 25.52720  1.42078   33.72822  1.000 51.39548  ?  53  LYS C N   1 
ATOM   3173 C  CA  . LYS C  1 53  ? 25.01558  0.58331   32.64570  1.000 45.36752  ?  53  LYS C CA  1 
ATOM   3174 C  C   . LYS C  1 53  ? 26.11250  -0.30438  32.07332  1.000 43.65335  ?  53  LYS C C   1 
ATOM   3175 O  O   . LYS C  1 53  ? 25.89172  -1.48903  31.79492  1.000 41.28847  ?  53  LYS C O   1 
ATOM   3176 C  CB  . LYS C  1 53  ? 24.42738  1.44944   31.53452  1.000 41.76796  ?  53  LYS C CB  1 
ATOM   3177 C  CG  . LYS C  1 53  ? 23.27472  2.30929   31.96118  1.000 52.21105  ?  53  LYS C CG  1 
ATOM   3178 N  N   . TYR C  1 54  ? 27.28830  0.27143   31.84030  1.000 37.94084  ?  54  TYR C N   1 
ATOM   3179 C  CA  . TYR C  1 54  ? 28.38392  -0.47905  31.24970  1.000 37.51888  ?  54  TYR C CA  1 
ATOM   3180 C  C   . TYR C  1 54  ? 28.75065  -1.66301  32.13137  1.000 37.66328  ?  54  TYR C C   1 
ATOM   3181 O  O   . TYR C  1 54  ? 28.86530  -2.80282  31.65635  1.000 39.35727  ?  54  TYR C O   1 
ATOM   3182 C  CB  . TYR C  1 54  ? 29.58105  0.44853   31.05094  1.000 39.40414  ?  54  TYR C CB  1 
ATOM   3183 C  CG  . TYR C  1 54  ? 30.83002  -0.23860  30.55034  1.000 43.39990  ?  54  TYR C CG  1 
ATOM   3184 C  CD1 . TYR C  1 54  ? 31.00962  -0.49234  29.19378  1.000 42.55232  ?  54  TYR C CD1 1 
ATOM   3185 C  CD2 . TYR C  1 54  ? 31.82614  -0.62638  31.43085  1.000 38.95253  ?  54  TYR C CD2 1 
ATOM   3186 C  CE1 . TYR C  1 54  ? 32.14567  -1.12435  28.73857  1.000 46.75079  ?  54  TYR C CE1 1 
ATOM   3187 C  CE2 . TYR C  1 54  ? 32.95875  -1.24990  30.98807  1.000 41.12921  ?  54  TYR C CE2 1 
ATOM   3188 C  CZ  . TYR C  1 54  ? 33.12470  -1.50025  29.64910  1.000 45.33341  ?  54  TYR C CZ  1 
ATOM   3189 O  OH  . TYR C  1 54  ? 34.27464  -2.13005  29.21856  1.000 45.84023  ?  54  TYR C OH  1 
ATOM   3190 N  N   . PHE C  1 55  ? 28.89470  -1.41059  33.43437  1.000 38.07713  ?  55  PHE C N   1 
ATOM   3191 C  CA  . PHE C  1 55  ? 29.27747  -2.46823  34.36085  1.000 47.11185  ?  55  PHE C CA  1 
ATOM   3192 C  C   . PHE C  1 55  ? 28.15580  -3.49178  34.55071  1.000 49.20078  ?  55  PHE C C   1 
ATOM   3193 O  O   . PHE C  1 55  ? 28.42545  -4.68827  34.70642  1.000 49.41036  ?  55  PHE C O   1 
ATOM   3194 C  CB  . PHE C  1 55  ? 29.69828  -1.84890  35.68616  1.000 42.27439  ?  55  PHE C CB  1 
ATOM   3195 C  CG  . PHE C  1 55  ? 31.08427  -1.30317  35.65944  1.000 48.26355  ?  55  PHE C CG  1 
ATOM   3196 C  CD1 . PHE C  1 55  ? 32.09977  -2.01061  35.02797  1.000 48.32033  ?  55  PHE C CD1 1 
ATOM   3197 C  CD2 . PHE C  1 55  ? 31.37449  -0.08150  36.22827  1.000 44.17105  ?  55  PHE C CD2 1 
ATOM   3198 C  CE1 . PHE C  1 55  ? 33.38900  -1.51626  34.96982  1.000 41.38182  ?  55  PHE C CE1 1 
ATOM   3199 C  CE2 . PHE C  1 55  ? 32.65681  0.41803   36.17554  1.000 52.23097  ?  55  PHE C CE2 1 
ATOM   3200 C  CZ  . PHE C  1 55  ? 33.67282  -0.31002  35.54705  1.000 48.98193  ?  55  PHE C CZ  1 
ATOM   3201 N  N   . LEU C  1 56  ? 26.89450  -3.05674  34.50537  1.000 38.04003  ?  56  LEU C N   1 
ATOM   3202 C  CA  . LEU C  1 56  ? 25.79516  -4.00842  34.65734  1.000 40.62946  ?  56  LEU C CA  1 
ATOM   3203 C  C   . LEU C  1 56  ? 25.69468  -4.92885  33.45071  1.000 38.19700  ?  56  LEU C C   1 
ATOM   3204 O  O   . LEU C  1 56  ? 25.47464  -6.13732  33.60287  1.000 41.78282  ?  56  LEU C O   1 
ATOM   3205 C  CB  . LEU C  1 56  ? 24.46607  -3.28385  34.87359  1.000 41.13284  ?  56  LEU C CB  1 
ATOM   3206 C  CG  . LEU C  1 56  ? 23.32863  -4.27291  35.19788  1.000 45.41452  ?  56  LEU C CG  1 
ATOM   3207 C  CD1 . LEU C  1 56  ? 23.55986  -4.81718  36.59271  1.000 44.40976  ?  56  LEU C CD1 1 
ATOM   3208 C  CD2 . LEU C  1 56  ? 21.93132  -3.66441  35.08407  1.000 39.18035  ?  56  LEU C CD2 1 
ATOM   3209 N  N   . HIS C  1 57  ? 25.83535  -4.36927  32.24495  1.000 37.29009  ?  57  HIS C N   1 
ATOM   3210 C  CA  . HIS C  1 57  ? 25.93945  -5.19138  31.05015  1.000 37.73666  ?  57  HIS C CA  1 
ATOM   3211 C  C   . HIS C  1 57  ? 27.07772  -6.20146  31.18426  1.000 47.66579  ?  57  HIS C C   1 
ATOM   3212 O  O   . HIS C  1 57  ? 26.86419  -7.40511  30.99951  1.000 51.14137  ?  57  HIS C O   1 
ATOM   3213 C  CB  . HIS C  1 57  ? 26.13343  -4.31446  29.81021  1.000 42.25994  ?  57  HIS C CB  1 
ATOM   3214 C  CG  . HIS C  1 57  ? 26.34990  -5.09480  28.54884  1.000 64.21188  ?  57  HIS C CG  1 
ATOM   3215 N  ND1 . HIS C  1 57  ? 25.32526  -5.74281  27.88451  1.000 72.29809  ?  57  HIS C ND1 1 
ATOM   3216 C  CD2 . HIS C  1 57  ? 27.47712  -5.35355  27.84142  1.000 64.50702  ?  57  HIS C CD2 1 
ATOM   3217 C  CE1 . HIS C  1 57  ? 25.80896  -6.35372  26.81637  1.000 63.40205  ?  57  HIS C CE1 1 
ATOM   3218 N  NE2 . HIS C  1 57  ? 27.11308  -6.13608  26.76921  1.000 71.30001  ?  57  HIS C NE2 1 
ATOM   3219 N  N   . GLN C  1 58  ? 28.29786  -5.73808  31.50815  1.000 49.50070  ?  58  GLN C N   1 
ATOM   3220 C  CA  . GLN C  1 58  ? 29.38950  -6.70795  31.65102  1.000 48.57189  ?  58  GLN C CA  1 
ATOM   3221 C  C   . GLN C  1 58  ? 29.06286  -7.75672  32.70747  1.000 46.70037  ?  58  GLN C C   1 
ATOM   3222 O  O   . GLN C  1 58  ? 29.48780  -8.91379  32.58368  1.000 53.40903  ?  58  GLN C O   1 
ATOM   3223 C  CB  . GLN C  1 58  ? 30.73910  -6.02546  31.95268  1.000 43.59183  ?  58  GLN C CB  1 
ATOM   3224 C  CG  . GLN C  1 58  ? 31.12783  -4.96482  30.91607  1.000 54.87466  ?  58  GLN C CG  1 
ATOM   3225 C  CD  . GLN C  1 58  ? 31.84119  -5.55327  29.69917  1.000 68.04220  ?  58  GLN C CD  1 
ATOM   3226 O  OE1 . GLN C  1 58  ? 32.63125  -6.49830  29.81988  1.000 76.73109  ?  58  GLN C OE1 1 
ATOM   3227 N  NE2 . GLN C  1 58  ? 31.52014  -5.02994  28.50940  1.000 62.70091  ?  58  GLN C NE2 1 
ATOM   3228 N  N   . SER C  1 59  ? 28.26391  -7.40258  33.71305  1.000 41.23883  ?  59  SER C N   1 
ATOM   3229 C  CA  . SER C  1 59  ? 27.93700  -8.37918  34.74299  1.000 45.31406  ?  59  SER C CA  1 
ATOM   3230 C  C   . SER C  1 59  ? 27.01950  -9.45792  34.18716  1.000 45.61998  ?  59  SER C C   1 
ATOM   3231 O  O   . SER C  1 59  ? 27.21088  -10.65710 34.44774  1.000 45.69008  ?  59  SER C O   1 
ATOM   3232 C  CB  . SER C  1 59  ? 27.30231  -7.67730  35.94234  1.000 46.34245  ?  59  SER C CB  1 
ATOM   3233 O  OG  . SER C  1 59  ? 26.48420  -8.55671  36.68235  1.000 40.22144  ?  59  SER C OG  1 
ATOM   3234 N  N   . HIS C  1 60  ? 26.02648  -9.04552  33.39531  1.000 45.13117  ?  60  HIS C N   1 
ATOM   3235 C  CA  . HIS C  1 60  ? 25.15722  -10.01855 32.74139  1.000 45.29990  ?  60  HIS C CA  1 
ATOM   3236 C  C   . HIS C  1 60  ? 25.94076  -10.87694 31.75618  1.000 47.85155  ?  60  HIS C C   1 
ATOM   3237 O  O   . HIS C  1 60  ? 25.65890  -12.07164 31.59385  1.000 55.11725  ?  60  HIS C O   1 
ATOM   3238 C  CB  . HIS C  1 60  ? 23.99711  -9.31120  32.03822  1.000 41.40178  ?  60  HIS C CB  1 
ATOM   3239 C  CG  . HIS C  1 60  ? 23.09143  -8.57427  32.97249  1.000 49.40043  ?  60  HIS C CG  1 
ATOM   3240 N  ND1 . HIS C  1 60  ? 22.22344  -7.58913  32.55113  1.000 51.35315  ?  60  HIS C ND1 1 
ATOM   3241 C  CD2 . HIS C  1 60  ? 22.92847  -8.66847  34.31365  1.000 51.67595  ?  60  HIS C CD2 1 
ATOM   3242 C  CE1 . HIS C  1 60  ? 21.56255  -7.11233  33.59152  1.000 49.87452  ?  60  HIS C CE1 1 
ATOM   3243 N  NE2 . HIS C  1 60  ? 21.97127  -7.75002  34.67294  1.000 49.17605  ?  60  HIS C NE2 1 
ATOM   3244 N  N   . GLU C  1 61  ? 26.93679  -10.29187 31.09382  1.000 43.80162  ?  61  GLU C N   1 
ATOM   3245 C  CA  . GLU C  1 61  ? 27.70131  -11.05838 30.11439  1.000 47.13070  ?  61  GLU C CA  1 
ATOM   3246 C  C   . GLU C  1 61  ? 28.59090  -12.09561 30.79790  1.000 44.71308  ?  61  GLU C C   1 
ATOM   3247 O  O   . GLU C  1 61  ? 28.72396  -13.22455 30.31047  1.000 56.14569  ?  61  GLU C O   1 
ATOM   3248 C  CB  . GLU C  1 61  ? 28.52359  -10.11920 29.23683  1.000 47.79112  ?  61  GLU C CB  1 
ATOM   3249 N  N   . GLU C  1 62  ? 29.19858  -11.74445 31.93156  1.000 39.77890  ?  62  GLU C N   1 
ATOM   3250 C  CA  . GLU C  1 62  ? 29.93585  -12.75631 32.68284  1.000 50.96731  ?  62  GLU C CA  1 
ATOM   3251 C  C   . GLU C  1 62  ? 29.00534  -13.88089 33.15781  1.000 57.31978  ?  62  GLU C C   1 
ATOM   3252 O  O   . GLU C  1 62  ? 29.36165  -15.07057 33.06871  1.000 49.43261  ?  62  GLU C O   1 
ATOM   3253 C  CB  . GLU C  1 62  ? 30.67817  -12.12361 33.86411  1.000 56.21973  ?  62  GLU C CB  1 
ATOM   3254 C  CG  . GLU C  1 62  ? 31.87997  -11.22243 33.48652  1.000 55.64419  ?  62  GLU C CG  1 
ATOM   3255 C  CD  . GLU C  1 62  ? 32.98555  -11.94765 32.73998  1.000 62.70186  ?  62  GLU C CD  1 
ATOM   3256 O  OE1 . GLU C  1 62  ? 33.32432  -11.51684 31.61961  1.000 75.41291  ?  62  GLU C OE1 1 
ATOM   3257 O  OE2 . GLU C  1 62  ? 33.52588  -12.93564 33.26771  1.000 64.41786  -1 62  GLU C OE2 1 
ATOM   3258 N  N   . ARG C  1 63  ? 27.81337  -13.53194 33.66849  1.000 47.30827  ?  63  ARG C N   1 
ATOM   3259 C  CA  . ARG C  1 63  ? 26.85810  -14.57152 34.05092  1.000 49.59621  ?  63  ARG C CA  1 
ATOM   3260 C  C   . ARG C  1 63  ? 26.53378  -15.48596 32.86699  1.000 55.53962  ?  63  ARG C C   1 
ATOM   3261 O  O   . ARG C  1 63  ? 26.42280  -16.71538 33.02241  1.000 48.70190  ?  63  ARG C O   1 
ATOM   3262 C  CB  . ARG C  1 63  ? 25.58786  -13.93112 34.60412  1.000 56.03467  ?  63  ARG C CB  1 
ATOM   3263 C  CG  . ARG C  1 63  ? 24.61954  -14.90600 35.24998  1.000 62.47741  ?  63  ARG C CG  1 
ATOM   3264 N  N   . GLU C  1 64  ? 26.39672  -14.90120 31.66944  1.000 45.20066  ?  64  GLU C N   1 
ATOM   3265 C  CA  . GLU C  1 64  ? 26.15433  -15.70664 30.47232  1.000 44.90146  ?  64  GLU C CA  1 
ATOM   3266 C  C   . GLU C  1 64  ? 27.31174  -16.65791 30.18563  1.000 47.25407  ?  64  GLU C C   1 
ATOM   3267 O  O   . GLU C  1 64  ? 27.09288  -17.80955 29.77372  1.000 44.37789  ?  64  GLU C O   1 
ATOM   3268 C  CB  . GLU C  1 64  ? 25.90536  -14.80711 29.26774  1.000 39.12952  ?  64  GLU C CB  1 
ATOM   3269 N  N   . HIS C  1 65  ? 28.55071  -16.19468 30.37483  1.000 45.10021  ?  65  HIS C N   1 
ATOM   3270 C  CA  . HIS C  1 65  ? 29.68100  -17.07934 30.10605  1.000 50.20470  ?  65  HIS C CA  1 
ATOM   3271 C  C   . HIS C  1 65  ? 29.77039  -18.20485 31.13404  1.000 45.12179  ?  65  HIS C C   1 
ATOM   3272 O  O   . HIS C  1 65  ? 30.12114  -19.33746 30.79124  1.000 53.13381  ?  65  HIS C O   1 
ATOM   3273 C  CB  . HIS C  1 65  ? 30.96436  -16.27460 30.01526  1.000 51.72886  ?  65  HIS C CB  1 
ATOM   3274 C  CG  . HIS C  1 65  ? 31.06132  -15.49994 28.74385  1.000 67.13239  ?  65  HIS C CG  1 
ATOM   3275 N  ND1 . HIS C  1 65  ? 32.24180  -15.35684 28.04633  1.000 73.17908  ?  65  HIS C ND1 1 
ATOM   3276 C  CD2 . HIS C  1 65  ? 30.10997  -14.86506 28.01563  1.000 71.91650  ?  65  HIS C CD2 1 
ATOM   3277 C  CE1 . HIS C  1 65  ? 32.01763  -14.64857 26.95201  1.000 77.77242  ?  65  HIS C CE1 1 
ATOM   3278 N  NE2 . HIS C  1 65  ? 30.73292  -14.33426 26.91119  1.000 77.48350  ?  65  HIS C NE2 1 
ATOM   3279 N  N   . ALA C  1 66  ? 29.38089  -17.93328 32.37911  1.000 40.54652  ?  66  ALA C N   1 
ATOM   3280 C  CA  . ALA C  1 66  ? 29.26481  -19.00267 33.37394  1.000 47.77165  ?  66  ALA C CA  1 
ATOM   3281 C  C   . ALA C  1 66  ? 28.19666  -20.02236 32.97772  1.000 47.92911  ?  66  ALA C C   1 
ATOM   3282 O  O   . ALA C  1 66  ? 28.41963  -21.23740 33.06779  1.000 46.81447  ?  66  ALA C O   1 
ATOM   3283 C  CB  . ALA C  1 66  ? 28.94943  -18.41383 34.75512  1.000 40.99163  ?  66  ALA C CB  1 
ATOM   3284 N  N   . GLU C  1 67  ? 27.03400  -19.54546 32.54224  1.000 44.67470  ?  67  GLU C N   1 
ATOM   3285 C  CA  . GLU C  1 67  ? 25.95729  -20.44886 32.13519  1.000 47.48096  ?  67  GLU C CA  1 
ATOM   3286 C  C   . GLU C  1 67  ? 26.38480  -21.31128 30.95301  1.000 46.74462  ?  67  GLU C C   1 
ATOM   3287 O  O   . GLU C  1 67  ? 26.02564  -22.49458 30.87167  1.000 50.55657  ?  67  GLU C O   1 
ATOM   3288 C  CB  . GLU C  1 67  ? 24.68422  -19.64496 31.80767  1.000 39.18874  ?  67  GLU C CB  1 
ATOM   3289 C  CG  . GLU C  1 67  ? 23.81082  -19.32318 33.05838  1.000 46.18468  ?  67  GLU C CG  1 
ATOM   3290 C  CD  . GLU C  1 67  ? 22.76915  -18.18989 32.87731  1.000 55.54023  ?  67  GLU C CD  1 
ATOM   3291 O  OE1 . GLU C  1 67  ? 22.23538  -17.99538 31.76289  1.000 69.58324  ?  67  GLU C OE1 1 
ATOM   3292 O  OE2 . GLU C  1 67  ? 22.48283  -17.48539 33.87632  1.000 59.41617  -1 67  GLU C OE2 1 
ATOM   3293 N  N   . LYS C  1 68  ? 27.19619  -20.75043 30.04974  1.000 41.40787  ?  68  LYS C N   1 
ATOM   3294 C  CA  . LYS C  1 68  ? 27.69116  -21.53392 28.91970  1.000 39.11395  ?  68  LYS C CA  1 
ATOM   3295 C  C   . LYS C  1 68  ? 28.73551  -22.57033 29.36279  1.000 47.86610  ?  68  LYS C C   1 
ATOM   3296 O  O   . LYS C  1 68  ? 28.82611  -23.66340 28.78289  1.000 42.57842  ?  68  LYS C O   1 
ATOM   3297 C  CB  . LYS C  1 68  ? 28.26240  -20.60481 27.86003  1.000 39.19046  ?  68  LYS C CB  1 
ATOM   3298 C  CG  . LYS C  1 68  ? 28.57810  -21.28109 26.54249  1.000 45.93563  ?  68  LYS C CG  1 
ATOM   3299 C  CD  . LYS C  1 68  ? 29.63113  -20.50086 25.77799  1.000 49.22711  ?  68  LYS C CD  1 
ATOM   3300 C  CE  . LYS C  1 68  ? 29.03214  -19.29161 25.09946  1.000 62.09152  ?  68  LYS C CE  1 
ATOM   3301 N  NZ  . LYS C  1 68  ? 28.48238  -19.66119 23.76665  1.000 69.01500  ?  68  LYS C NZ  1 
ATOM   3302 N  N   . LEU C  1 69  ? 29.52587  -22.25984 30.39000  1.000 38.97306  ?  69  LEU C N   1 
ATOM   3303 C  CA  . LEU C  1 69  ? 30.42940  -23.28010 30.89437  1.000 42.99278  ?  69  LEU C CA  1 
ATOM   3304 C  C   . LEU C  1 69  ? 29.65416  -24.41687 31.55519  1.000 43.66264  ?  69  LEU C C   1 
ATOM   3305 O  O   . LEU C  1 69  ? 30.02781  -25.58903 31.42781  1.000 39.82032  ?  69  LEU C O   1 
ATOM   3306 C  CB  . LEU C  1 69  ? 31.42111  -22.66155 31.86716  1.000 50.88750  ?  69  LEU C CB  1 
ATOM   3307 C  CG  . LEU C  1 69  ? 32.54356  -21.80635 31.26484  1.000 47.62085  ?  69  LEU C CG  1 
ATOM   3308 C  CD1 . LEU C  1 69  ? 33.17643  -20.98007 32.37035  1.000 40.52476  ?  69  LEU C CD1 1 
ATOM   3309 C  CD2 . LEU C  1 69  ? 33.57386  -22.66801 30.57703  1.000 46.58972  ?  69  LEU C CD2 1 
ATOM   3310 N  N   . MET C  1 70  ? 28.57171  -24.08947 32.26743  1.000 48.16348  ?  70  MET C N   1 
ATOM   3311 C  CA  . MET C  1 70  ? 27.74041  -25.14239 32.84733  1.000 51.14662  ?  70  MET C CA  1 
ATOM   3312 C  C   . MET C  1 70  ? 27.11002  -26.00526 31.75467  1.000 56.78692  ?  70  MET C C   1 
ATOM   3313 O  O   . MET C  1 70  ? 27.07632  -27.24743 31.86176  1.000 63.91855  ?  70  MET C O   1 
ATOM   3314 C  CB  . MET C  1 70  ? 26.66128  -24.53981 33.74208  1.000 52.45307  ?  70  MET C CB  1 
ATOM   3315 C  CG  . MET C  1 70  ? 27.18119  -23.82993 34.98424  1.000 46.30219  ?  70  MET C CG  1 
ATOM   3316 S  SD  . MET C  1 70  ? 25.88101  -22.85014 35.79231  1.000 49.94154  ?  70  MET C SD  1 
ATOM   3317 C  CE  . MET C  1 70  ? 24.96073  -24.09367 36.71179  1.000 45.94242  ?  70  MET C CE  1 
ATOM   3318 N  N   . LYS C  1 71  ? 26.62419  -25.36299 30.68866  1.000 46.63530  ?  71  LYS C N   1 
ATOM   3319 C  CA  . LYS C  1 71  ? 26.15696  -26.10396 29.52127  1.000 46.53039  ?  71  LYS C CA  1 
ATOM   3320 C  C   . LYS C  1 71  ? 27.24397  -27.03216 28.97817  1.000 43.95752  ?  71  LYS C C   1 
ATOM   3321 O  O   . LYS C  1 71  ? 26.98224  -28.20057 28.67967  1.000 56.07999  ?  71  LYS C O   1 
ATOM   3322 C  CB  . LYS C  1 71  ? 25.68449  -25.12940 28.43823  1.000 40.64450  ?  71  LYS C CB  1 
ATOM   3323 C  CG  . LYS C  1 71  ? 25.05462  -25.82150 27.23154  1.000 41.57787  ?  71  LYS C CG  1 
ATOM   3324 C  CD  . LYS C  1 71  ? 24.76931  -24.84951 26.08922  1.000 42.94946  ?  71  LYS C CD  1 
ATOM   3325 N  N   . LEU C  1 72  ? 28.47098  -26.53540 28.86681  1.000 42.07729  ?  72  LEU C N   1 
ATOM   3326 C  CA  . LEU C  1 72  ? 29.56891  -27.32988 28.32895  1.000 41.81119  ?  72  LEU C CA  1 
ATOM   3327 C  C   . LEU C  1 72  ? 29.88340  -28.52534 29.22184  1.000 48.36761  ?  72  LEU C C   1 
ATOM   3328 O  O   . LEU C  1 72  ? 30.19191  -29.61762 28.72557  1.000 42.12208  ?  72  LEU C O   1 
ATOM   3329 C  CB  . LEU C  1 72  ? 30.79748  -26.43283 28.16169  1.000 40.46853  ?  72  LEU C CB  1 
ATOM   3330 C  CG  . LEU C  1 72  ? 32.08652  -26.93067 27.49907  1.000 47.71814  ?  72  LEU C CG  1 
ATOM   3331 C  CD1 . LEU C  1 72  ? 33.01067  -27.55085 28.53747  1.000 45.50737  ?  72  LEU C CD1 1 
ATOM   3332 C  CD2 . LEU C  1 72  ? 31.80894  -27.90329 26.35693  1.000 46.84571  ?  72  LEU C CD2 1 
ATOM   3333 N  N   . GLN C  1 73  ? 29.84767  -28.32354 30.54231  1.000 47.75237  ?  73  GLN C N   1 
ATOM   3334 C  CA  . GLN C  1 73  ? 30.06684  -29.42423 31.47443  1.000 43.19596  ?  73  GLN C CA  1 
ATOM   3335 C  C   . GLN C  1 73  ? 29.03213  -30.51867 31.25738  1.000 47.71107  ?  73  GLN C C   1 
ATOM   3336 O  O   . GLN C  1 73  ? 29.37602  -31.70464 31.14945  1.000 50.18962  ?  73  GLN C O   1 
ATOM   3337 C  CB  . GLN C  1 73  ? 30.02287  -28.91248 32.91654  1.000 43.11023  ?  73  GLN C CB  1 
ATOM   3338 C  CG  . GLN C  1 73  ? 30.38778  -29.94285 33.96537  1.000 45.01771  ?  73  GLN C CG  1 
ATOM   3339 C  CD  . GLN C  1 73  ? 31.89976  -29.99120 34.24658  1.000 49.34736  ?  73  GLN C CD  1 
ATOM   3340 O  OE1 . GLN C  1 73  ? 32.68312  -30.39521 33.39154  1.000 48.69969  ?  73  GLN C OE1 1 
ATOM   3341 N  NE2 . GLN C  1 73  ? 32.30125  -29.58522 35.45111  1.000 44.53911  ?  73  GLN C NE2 1 
ATOM   3342 N  N   . ASN C  1 74  ? 27.75335  -30.13688 31.14217  1.000 41.60667  ?  74  ASN C N   1 
ATOM   3343 C  CA  . ASN C  1 74  ? 26.74929  -31.16852 30.87300  1.000 46.57116  ?  74  ASN C CA  1 
ATOM   3344 C  C   . ASN C  1 74  ? 26.94653  -31.79567 29.49787  1.000 48.62213  ?  74  ASN C C   1 
ATOM   3345 O  O   . ASN C  1 74  ? 26.72744  -33.00038 29.32951  1.000 45.35518  ?  74  ASN C O   1 
ATOM   3346 C  CB  . ASN C  1 74  ? 25.33979  -30.59566 31.00106  1.000 48.47309  ?  74  ASN C CB  1 
ATOM   3347 C  CG  . ASN C  1 74  ? 24.87323  -30.57627 32.42246  1.000 50.49528  ?  74  ASN C CG  1 
ATOM   3348 O  OD1 . ASN C  1 74  ? 25.45301  -31.24965 33.28502  1.000 58.98345  ?  74  ASN C OD1 1 
ATOM   3349 N  ND2 . ASN C  1 74  ? 23.84244  -29.79582 32.69532  1.000 44.45639  ?  74  ASN C ND2 1 
ATOM   3350 N  N   . GLN C  1 75  ? 27.37989  -31.00163 28.51257  1.000 47.71679  ?  75  GLN C N   1 
ATOM   3351 C  CA  . GLN C  1 75  ? 27.59296  -31.52610 27.16817  1.000 42.62087  ?  75  GLN C CA  1 
ATOM   3352 C  C   . GLN C  1 75  ? 28.67846  -32.59474 27.13698  1.000 53.52752  ?  75  GLN C C   1 
ATOM   3353 O  O   . GLN C  1 75  ? 28.65140  -33.47609 26.26595  1.000 49.47984  ?  75  GLN C O   1 
ATOM   3354 C  CB  . GLN C  1 75  ? 27.96558  -30.39695 26.22019  1.000 44.53138  ?  75  GLN C CB  1 
ATOM   3355 C  CG  . GLN C  1 75  ? 26.80369  -29.71855 25.54613  1.000 54.62549  ?  75  GLN C CG  1 
ATOM   3356 C  CD  . GLN C  1 75  ? 27.27227  -28.64165 24.59319  1.000 65.58364  ?  75  GLN C CD  1 
ATOM   3357 O  OE1 . GLN C  1 75  ? 28.12493  -27.81964 24.93827  1.000 70.96094  ?  75  GLN C OE1 1 
ATOM   3358 N  NE2 . GLN C  1 75  ? 26.72229  -28.63907 23.38523  1.000 70.91365  ?  75  GLN C NE2 1 
ATOM   3359 N  N   . ARG C  1 76  ? 29.64270  -32.53774 28.05869  1.000 47.51123  ?  76  ARG C N   1 
ATOM   3360 C  CA  . ARG C  1 76  ? 30.76459  -33.45945 28.01893  1.000 48.61123  ?  76  ARG C CA  1 
ATOM   3361 C  C   . ARG C  1 76  ? 30.59369  -34.62938 28.97775  1.000 55.00922  ?  76  ARG C C   1 
ATOM   3362 O  O   . ARG C  1 76  ? 31.50735  -35.45144 29.10627  1.000 52.64130  ?  76  ARG C O   1 
ATOM   3363 C  CB  . ARG C  1 76  ? 32.07870  -32.71640 28.30514  1.000 49.40553  ?  76  ARG C CB  1 
ATOM   3364 C  CG  . ARG C  1 76  ? 32.46165  -31.69439 27.22744  1.000 52.70838  ?  76  ARG C CG  1 
ATOM   3365 C  CD  . ARG C  1 76  ? 32.63755  -32.34797 25.84574  1.000 47.85625  ?  76  ARG C CD  1 
ATOM   3366 N  NE  . ARG C  1 76  ? 33.61926  -33.43344 25.87223  1.000 53.63034  ?  76  ARG C NE  1 
ATOM   3367 C  CZ  . ARG C  1 76  ? 34.92312  -33.27482 25.63588  1.000 58.70357  ?  76  ARG C CZ  1 
ATOM   3368 N  NH1 . ARG C  1 76  ? 35.40845  -32.07289 25.34454  1.000 56.44875  ?  76  ARG C NH1 1 
ATOM   3369 N  NH2 . ARG C  1 76  ? 35.74590  -34.31497 25.68306  1.000 55.16667  ?  76  ARG C NH2 1 
ATOM   3370 N  N   . GLY C  1 77  ? 29.43965  -34.74184 29.62430  1.000 50.84920  ?  77  GLY C N   1 
ATOM   3371 C  CA  . GLY C  1 77  ? 29.23830  -35.77263 30.60101  1.000 50.65150  ?  77  GLY C CA  1 
ATOM   3372 C  C   . GLY C  1 77  ? 29.83570  -35.46591 31.94381  1.000 61.41270  ?  77  GLY C C   1 
ATOM   3373 O  O   . GLY C  1 77  ? 29.74648  -36.31102 32.84408  1.000 61.30095  ?  77  GLY C O   1 
ATOM   3374 N  N   . GLY C  1 78  ? 30.46125  -34.30044 32.10064  1.000 52.09890  ?  78  GLY C N   1 
ATOM   3375 C  CA  . GLY C  1 78  ? 30.92874  -33.84602 33.39192  1.000 53.39160  ?  78  GLY C CA  1 
ATOM   3376 C  C   . GLY C  1 78  ? 29.76661  -33.53157 34.31316  1.000 58.81536  ?  78  GLY C C   1 
ATOM   3377 O  O   . GLY C  1 78  ? 28.59404  -33.55826 33.92825  1.000 65.77948  ?  78  GLY C O   1 
ATOM   3378 N  N   . ARG C  1 79  ? 30.09124  -33.23014 35.56995  1.000 54.67176  ?  79  ARG C N   1 
ATOM   3379 C  CA  . ARG C  1 79  ? 29.04498  -32.93583 36.54394  1.000 63.01340  ?  79  ARG C CA  1 
ATOM   3380 C  C   . ARG C  1 79  ? 29.34956  -31.64197 37.28252  1.000 62.60115  ?  79  ARG C C   1 
ATOM   3381 O  O   . ARG C  1 79  ? 30.41325  -31.50367 37.89984  1.000 58.84514  ?  79  ARG C O   1 
ATOM   3382 C  CB  . ARG C  1 79  ? 28.82720  -34.10874 37.50621  1.000 61.05562  ?  79  ARG C CB  1 
ATOM   3383 C  CG  . ARG C  1 79  ? 28.20806  -35.32016 36.77007  1.000 60.37566  ?  79  ARG C CG  1 
ATOM   3384 C  CD  . ARG C  1 79  ? 26.68630  -35.18359 36.58541  1.000 59.79747  ?  79  ARG C CD  1 
ATOM   3385 N  NE  . ARG C  1 79  ? 26.10864  -36.20894 35.69865  1.000 64.18561  ?  79  ARG C NE  1 
ATOM   3386 C  CZ  . ARG C  1 79  ? 25.98283  -36.10129 34.37316  1.000 63.71516  ?  79  ARG C CZ  1 
ATOM   3387 N  NH1 . ARG C  1 79  ? 26.36437  -34.96778 33.77335  1.000 63.91053  ?  79  ARG C NH1 1 
ATOM   3388 N  NH2 . ARG C  1 79  ? 25.44258  -37.07222 33.64491  1.000 56.43193  ?  79  ARG C NH2 1 
ATOM   3389 N  N   . ILE C  1 80  ? 28.39384  -30.70958 37.22303  1.000 54.35413  ?  80  ILE C N   1 
ATOM   3390 C  CA  . ILE C  1 80  ? 28.58107  -29.36293 37.73391  1.000 54.53184  ?  80  ILE C CA  1 
ATOM   3391 C  C   . ILE C  1 80  ? 28.64817  -29.37705 39.24915  1.000 56.38201  ?  80  ILE C C   1 
ATOM   3392 O  O   . ILE C  1 80  ? 27.84252  -30.02862 39.92504  1.000 67.26841  ?  80  ILE C O   1 
ATOM   3393 C  CB  . ILE C  1 80  ? 27.43652  -28.46338 37.23703  1.000 60.99641  ?  80  ILE C CB  1 
ATOM   3394 C  CG1 . ILE C  1 80  ? 27.41546  -28.42647 35.69609  1.000 51.39843  ?  80  ILE C CG1 1 
ATOM   3395 C  CG2 . ILE C  1 80  ? 27.54198  -27.06588 37.84570  1.000 53.28799  ?  80  ILE C CG2 1 
ATOM   3396 C  CD1 . ILE C  1 80  ? 26.08830  -28.03034 35.11547  1.000 49.99169  ?  80  ILE C CD1 1 
ATOM   3397 N  N   . PHE C  1 81  ? 29.61052  -28.64877 39.79985  1.000 61.37215  ?  81  PHE C N   1 
ATOM   3398 C  CA  . PHE C  1 81  ? 29.79956  -28.58638 41.24707  1.000 68.30031  ?  81  PHE C CA  1 
ATOM   3399 C  C   . PHE C  1 81  ? 30.09104  -27.15339 41.66057  1.000 59.24608  ?  81  PHE C C   1 
ATOM   3400 O  O   . PHE C  1 81  ? 31.19401  -26.65353 41.43830  1.000 64.58929  ?  81  PHE C O   1 
ATOM   3401 C  CB  . PHE C  1 81  ? 30.91793  -29.52352 41.69388  1.000 63.69795  ?  81  PHE C CB  1 
ATOM   3402 C  CG  . PHE C  1 81  ? 30.47809  -30.94472 41.77738  1.000 62.34015  ?  81  PHE C CG  1 
ATOM   3403 C  CD1 . PHE C  1 81  ? 29.46423  -31.31628 42.64373  1.000 61.48248  ?  81  PHE C CD1 1 
ATOM   3404 C  CD2 . PHE C  1 81  ? 31.02669  -31.90403 40.95432  1.000 64.40923  ?  81  PHE C CD2 1 
ATOM   3405 C  CE1 . PHE C  1 81  ? 29.03871  -32.63398 42.71355  1.000 65.76653  ?  81  PHE C CE1 1 
ATOM   3406 C  CE2 . PHE C  1 81  ? 30.60773  -33.21642 41.02629  1.000 71.19454  ?  81  PHE C CE2 1 
ATOM   3407 C  CZ  . PHE C  1 81  ? 29.60757  -33.57767 41.90553  1.000 69.37720  ?  81  PHE C CZ  1 
ATOM   3408 N  N   . LEU C  1 82  ? 29.11978  -26.51944 42.30043  1.000 59.24475  ?  82  LEU C N   1 
ATOM   3409 C  CA  . LEU C  1 82  ? 29.14136  -25.09324 42.57196  1.000 64.81474  ?  82  LEU C CA  1 
ATOM   3410 C  C   . LEU C  1 82  ? 29.70294  -24.81812 43.95583  1.000 61.19655  ?  82  LEU C C   1 
ATOM   3411 O  O   . LEU C  1 82  ? 29.49236  -25.58142 44.89560  1.000 75.81867  ?  82  LEU C O   1 
ATOM   3412 C  CB  . LEU C  1 82  ? 27.73143  -24.50315 42.45953  1.000 61.15032  ?  82  LEU C CB  1 
ATOM   3413 C  CG  . LEU C  1 82  ? 26.93666  -24.83227 41.19440  1.000 60.73952  ?  82  LEU C CG  1 
ATOM   3414 C  CD1 . LEU C  1 82  ? 25.50470  -24.33712 41.29912  1.000 55.46259  ?  82  LEU C CD1 1 
ATOM   3415 C  CD2 . LEU C  1 82  ? 27.61866  -24.22801 39.97929  1.000 64.41421  ?  82  LEU C CD2 1 
ATOM   3416 N  N   . GLN C  1 83  ? 30.41266  -23.71587 44.07378  1.000 64.71432  ?  83  GLN C N   1 
ATOM   3417 C  CA  . GLN C  1 83  ? 30.97027  -23.28706 45.33982  1.000 70.24852  ?  83  GLN C CA  1 
ATOM   3418 C  C   . GLN C  1 83  ? 30.32473  -21.96735 45.74266  1.000 79.35388  ?  83  GLN C C   1 
ATOM   3419 O  O   . GLN C  1 83  ? 29.54336  -21.37865 44.99394  1.000 81.41859  ?  83  GLN C O   1 
ATOM   3420 C  CB  . GLN C  1 83  ? 32.49036  -23.16062 45.22987  1.000 67.71735  ?  83  GLN C CB  1 
ATOM   3421 C  CG  . GLN C  1 83  ? 33.18723  -24.43775 44.77604  1.000 72.03125  ?  83  GLN C CG  1 
ATOM   3422 C  CD  . GLN C  1 83  ? 32.89507  -25.65037 45.64931  1.000 78.65339  ?  83  GLN C CD  1 
ATOM   3423 O  OE1 . GLN C  1 83  ? 32.46581  -25.52302 46.80311  1.000 74.92093  ?  83  GLN C OE1 1 
ATOM   3424 N  NE2 . GLN C  1 83  ? 33.12597  -26.84168 45.09548  1.000 74.83317  ?  83  GLN C NE2 1 
ATOM   3425 N  N   . ASP C  1 84  ? 30.64287  -21.50603 46.94511  1.000 83.02775  ?  84  ASP C N   1 
ATOM   3426 C  CA  . ASP C  1 84  ? 30.25284  -20.15819 47.31859  1.000 86.62305  ?  84  ASP C CA  1 
ATOM   3427 C  C   . ASP C  1 84  ? 30.83079  -19.15912 46.32823  1.000 82.26380  ?  84  ASP C C   1 
ATOM   3428 O  O   . ASP C  1 84  ? 31.91318  -19.35741 45.77416  1.000 86.56792  ?  84  ASP C O   1 
ATOM   3429 C  CB  . ASP C  1 84  ? 30.72183  -19.83677 48.73148  1.000 88.91823  ?  84  ASP C CB  1 
ATOM   3430 C  CG  . ASP C  1 84  ? 30.28152  -20.87949 49.72729  1.000 93.55424  ?  84  ASP C CG  1 
ATOM   3431 O  OD1 . ASP C  1 84  ? 30.72153  -22.03897 49.59836  1.000 97.34956  ?  84  ASP C OD1 1 
ATOM   3432 O  OD2 . ASP C  1 84  ? 29.48760  -20.53615 50.61731  1.000 97.19602  -1 84  ASP C OD2 1 
ATOM   3433 N  N   . ILE C  1 85  ? 30.07110  -18.10560 46.06380  1.000 77.54084  ?  85  ILE C N   1 
ATOM   3434 C  CA  . ILE C  1 85  ? 30.55383  -16.98733 45.26845  1.000 69.45705  ?  85  ILE C CA  1 
ATOM   3435 C  C   . ILE C  1 85  ? 31.04757  -15.95288 46.26464  1.000 66.54318  ?  85  ILE C C   1 
ATOM   3436 O  O   . ILE C  1 85  ? 30.24938  -15.36418 47.00328  1.000 63.27069  ?  85  ILE C O   1 
ATOM   3437 C  CB  . ILE C  1 85  ? 29.47028  -16.41874 44.33871  1.000 67.21462  ?  85  ILE C CB  1 
ATOM   3438 C  CG1 . ILE C  1 85  ? 28.97886  -17.49203 43.35100  1.000 61.66422  ?  85  ILE C CG1 1 
ATOM   3439 C  CG2 . ILE C  1 85  ? 29.98641  -15.17549 43.59353  1.000 58.28570  ?  85  ILE C CG2 1 
ATOM   3440 C  CD1 . ILE C  1 85  ? 27.57520  -17.25582 42.84936  1.000 59.87669  ?  85  ILE C CD1 1 
ATOM   3441 N  N   . GLN C  1 86  ? 32.36719  -15.77844 46.33558  1.000 66.14653  ?  86  GLN C N   1 
ATOM   3442 C  CA  . GLN C  1 86  ? 32.93491  -14.84859 47.30128  1.000 69.17163  ?  86  GLN C CA  1 
ATOM   3443 C  C   . GLN C  1 86  ? 32.50367  -13.41927 46.99727  1.000 70.20670  ?  86  GLN C C   1 
ATOM   3444 O  O   . GLN C  1 86  ? 32.41324  -13.01107 45.84289  1.000 65.27696  ?  86  GLN C O   1 
ATOM   3445 C  CB  . GLN C  1 86  ? 34.46011  -14.94948 47.31014  1.000 67.15359  ?  86  GLN C CB  1 
ATOM   3446 N  N   . LYS C  1 87  ? 32.25751  -12.64962 48.05211  1.000 71.19645  ?  87  LYS C N   1 
ATOM   3447 C  CA  . LYS C  1 87  ? 32.02017  -11.23126 47.86999  1.000 66.49511  ?  87  LYS C CA  1 
ATOM   3448 C  C   . LYS C  1 87  ? 33.24616  -10.56442 47.24553  1.000 66.58886  ?  87  LYS C C   1 
ATOM   3449 O  O   . LYS C  1 87  ? 34.37726  -11.03288 47.41813  1.000 68.49407  ?  87  LYS C O   1 
ATOM   3450 C  CB  . LYS C  1 87  ? 31.69380  -10.55689 49.20214  1.000 74.84245  ?  87  LYS C CB  1 
ATOM   3451 C  CG  . LYS C  1 87  ? 32.90853  -10.18703 50.06165  1.000 71.99641  ?  87  LYS C CG  1 
ATOM   3452 C  CD  . LYS C  1 87  ? 32.53055  -9.23297  51.18962  1.000 72.84943  ?  87  LYS C CD  1 
ATOM   3453 N  N   . PRO C  1 88  ? 33.04603  -9.46894  46.51088  1.000 63.35353  ?  88  PRO C N   1 
ATOM   3454 C  CA  . PRO C  1 88  ? 34.18678  -8.69493  46.01000  1.000 62.70437  ?  88  PRO C CA  1 
ATOM   3455 C  C   . PRO C  1 88  ? 35.04856  -8.16625  47.14935  1.000 68.39546  ?  88  PRO C C   1 
ATOM   3456 O  O   . PRO C  1 88  ? 34.59800  -8.00054  48.28765  1.000 67.13224  ?  88  PRO C O   1 
ATOM   3457 C  CB  . PRO C  1 88  ? 33.52832  -7.54641  45.21985  1.000 66.17570  ?  88  PRO C CB  1 
ATOM   3458 C  CG  . PRO C  1 88  ? 32.07062  -7.52545  45.65335  1.000 65.89211  ?  88  PRO C CG  1 
ATOM   3459 C  CD  . PRO C  1 88  ? 31.75882  -8.94854  46.01258  1.000 66.39050  ?  88  PRO C CD  1 
ATOM   3460 N  N   . ASP C  1 89  ? 36.31976  -7.89963  46.82372  1.000 74.26612  ?  89  ASP C N   1 
ATOM   3461 C  CA  . ASP C  1 89  ? 37.27799  -7.45920  47.83612  1.000 76.85572  ?  89  ASP C CA  1 
ATOM   3462 C  C   . ASP C  1 89  ? 37.03368  -6.02691  48.29216  1.000 69.61031  ?  89  ASP C C   1 
ATOM   3463 O  O   . ASP C  1 89  ? 37.47628  -5.65047  49.38324  1.000 69.48949  ?  89  ASP C O   1 
ATOM   3464 C  CB  . ASP C  1 89  ? 38.70745  -7.59709  47.30567  1.000 78.12169  ?  89  ASP C CB  1 
ATOM   3465 C  CG  . ASP C  1 89  ? 39.19324  -9.03772  47.29610  1.000 82.80980  ?  89  ASP C CG  1 
ATOM   3466 O  OD1 . ASP C  1 89  ? 39.14509  -9.71935  48.35500  1.000 80.43476  ?  89  ASP C OD1 1 
ATOM   3467 O  OD2 . ASP C  1 89  ? 39.61490  -9.48931  46.21022  1.000 86.19529  -1 89  ASP C OD2 1 
ATOM   3468 N  N   . GLU C  1 90  ? 36.34259  -5.22470  47.49162  1.000 74.38679  ?  90  GLU C N   1 
ATOM   3469 C  CA  . GLU C  1 90  ? 36.04263  -3.84631  47.84517  1.000 74.26205  ?  90  GLU C CA  1 
ATOM   3470 C  C   . GLU C  1 90  ? 34.55766  -3.58977  47.65936  1.000 69.71191  ?  90  GLU C C   1 
ATOM   3471 O  O   . GLU C  1 90  ? 33.92894  -4.15993  46.76385  1.000 78.04665  ?  90  GLU C O   1 
ATOM   3472 C  CB  . GLU C  1 90  ? 36.87657  -2.85684  47.01414  1.000 71.97147  ?  90  GLU C CB  1 
ATOM   3473 C  CG  . GLU C  1 90  ? 38.06299  -2.29398  47.79662  1.000 78.91406  ?  90  GLU C CG  1 
ATOM   3474 C  CD  . GLU C  1 90  ? 37.65281  -1.82377  49.17953  1.000 85.85174  ?  90  GLU C CD  1 
ATOM   3475 O  OE1 . GLU C  1 90  ? 38.02442  -2.49970  50.17358  1.000 92.18287  ?  90  GLU C OE1 1 
ATOM   3476 O  OE2 . GLU C  1 90  ? 36.94267  -0.78824  49.26098  1.000 86.27698  -1 90  GLU C OE2 1 
ATOM   3477 N  N   . ASP C  1 91  ? 33.99794  -2.75808  48.53856  1.000 72.15855  ?  91  ASP C N   1 
ATOM   3478 C  CA  . ASP C  1 91  ? 32.60727  -2.33348  48.45808  1.000 77.64807  ?  91  ASP C CA  1 
ATOM   3479 C  C   . ASP C  1 91  ? 32.45977  -0.91731  47.92043  1.000 79.77462  ?  91  ASP C C   1 
ATOM   3480 O  O   . ASP C  1 91  ? 31.38747  -0.56962  47.40970  1.000 70.69639  ?  91  ASP C O   1 
ATOM   3481 C  CB  . ASP C  1 91  ? 31.94545  -2.42482  49.84044  1.000 79.72070  ?  91  ASP C CB  1 
ATOM   3482 N  N   . ASP C  1 92  ? 33.51552  -0.10985  48.03246  1.000 86.93090  ?  92  ASP C N   1 
ATOM   3483 C  CA  . ASP C  1 92  ? 33.59415  1.24523   47.49805  1.000 83.38153  ?  92  ASP C CA  1 
ATOM   3484 C  C   . ASP C  1 92  ? 34.68357  1.26031   46.43649  1.000 76.19363  ?  92  ASP C C   1 
ATOM   3485 O  O   . ASP C  1 92  ? 35.84646  0.96799   46.73453  1.000 89.90697  ?  92  ASP C O   1 
ATOM   3486 C  CB  . ASP C  1 92  ? 33.90853  2.25095   48.61031  1.000 90.57076  ?  92  ASP C CB  1 
ATOM   3487 C  CG  . ASP C  1 92  ? 34.22091  3.63894   48.07983  1.000 97.37926  ?  92  ASP C CG  1 
ATOM   3488 O  OD1 . ASP C  1 92  ? 35.24312  3.79598   47.37843  1.000 101.67097 -1 92  ASP C OD1 1 
ATOM   3489 O  OD2 . ASP C  1 92  ? 33.45629  4.57945   48.38421  1.000 99.29832  ?  92  ASP C OD2 1 
ATOM   3490 N  N   . TRP C  1 93  ? 34.31260  1.60658   45.20747  1.000 66.44064  ?  93  TRP C N   1 
ATOM   3491 C  CA  . TRP C  1 93  ? 35.19792  1.48624   44.05742  1.000 66.27278  ?  93  TRP C CA  1 
ATOM   3492 C  C   . TRP C  1 93  ? 35.89160  2.79305   43.69964  1.000 67.43307  ?  93  TRP C C   1 
ATOM   3493 O  O   . TRP C  1 93  ? 36.40760  2.92520   42.58237  1.000 66.34846  ?  93  TRP C O   1 
ATOM   3494 C  CB  . TRP C  1 93  ? 34.41415  0.94571   42.86329  1.000 61.73505  ?  93  TRP C CB  1 
ATOM   3495 C  CG  . TRP C  1 93  ? 33.93855  -0.41388  43.14583  1.000 59.48771  ?  93  TRP C CG  1 
ATOM   3496 C  CD1 . TRP C  1 93  ? 32.69196  -0.78266  43.57673  1.000 58.26436  ?  93  TRP C CD1 1 
ATOM   3497 C  CD2 . TRP C  1 93  ? 34.71909  -1.60937  43.08718  1.000 63.82571  ?  93  TRP C CD2 1 
ATOM   3498 N  NE1 . TRP C  1 93  ? 32.64470  -2.14926  43.77308  1.000 58.75014  ?  93  TRP C NE1 1 
ATOM   3499 C  CE2 . TRP C  1 93  ? 33.87507  -2.67864  43.46808  1.000 62.39969  ?  93  TRP C CE2 1 
ATOM   3500 C  CE3 . TRP C  1 93  ? 36.04587  -1.88475  42.72895  1.000 57.82310  ?  93  TRP C CE3 1 
ATOM   3501 C  CZ2 . TRP C  1 93  ? 34.31602  -3.99500  43.49717  1.000 60.34894  ?  93  TRP C CZ2 1 
ATOM   3502 C  CZ3 . TRP C  1 93  ? 36.48132  -3.18583  42.76379  1.000 58.41211  ?  93  TRP C CZ3 1 
ATOM   3503 C  CH2 . TRP C  1 93  ? 35.62205  -4.22839  43.14715  1.000 65.74756  ?  93  TRP C CH2 1 
ATOM   3504 N  N   . GLU C  1 94  ? 35.88925  3.76046   44.62062  1.000 64.65564  ?  94  GLU C N   1 
ATOM   3505 C  CA  . GLU C  1 94  ? 36.69941  4.97000   44.54680  1.000 66.43068  ?  94  GLU C CA  1 
ATOM   3506 C  C   . GLU C  1 94  ? 36.33449  5.88693   43.38011  1.000 63.00138  ?  94  GLU C C   1 
ATOM   3507 O  O   . GLU C  1 94  ? 35.90731  7.02500   43.60118  1.000 62.60528  ?  94  GLU C O   1 
ATOM   3508 C  CB  . GLU C  1 94  ? 38.18547  4.59426   44.49151  1.000 74.93558  ?  94  GLU C CB  1 
ATOM   3509 N  N   . SER C  1 95  ? 36.50459  5.42191   42.14176  1.000 66.28592  ?  95  SER C N   1 
ATOM   3510 C  CA  . SER C  1 95  ? 36.30044  6.27518   40.97937  1.000 58.48232  ?  95  SER C CA  1 
ATOM   3511 C  C   . SER C  1 95  ? 36.01091  5.41896   39.75184  1.000 62.33797  ?  95  SER C C   1 
ATOM   3512 O  O   . SER C  1 95  ? 36.06874  4.18866   39.79718  1.000 68.42160  ?  95  SER C O   1 
ATOM   3513 C  CB  . SER C  1 95  ? 37.51849  7.16459   40.73304  1.000 54.45200  ?  95  SER C CB  1 
ATOM   3514 O  OG  . SER C  1 95  ? 38.53431  6.42471   40.07971  1.000 58.01157  ?  95  SER C OG  1 
ATOM   3515 N  N   . GLY C  1 96  ? 35.69251  6.09429   38.64296  1.000 57.42700  ?  96  GLY C N   1 
ATOM   3516 C  CA  . GLY C  1 96  ? 35.47394  5.38684   37.39235  1.000 55.93295  ?  96  GLY C CA  1 
ATOM   3517 C  C   . GLY C  1 96  ? 36.76831  4.86745   36.79875  1.000 62.69344  ?  96  GLY C C   1 
ATOM   3518 O  O   . GLY C  1 96  ? 36.81078  3.76606   36.23214  1.000 58.53732  ?  96  GLY C O   1 
ATOM   3519 N  N   . LEU C  1 97  ? 37.84494  5.65017   36.92753  1.000 60.87376  ?  97  LEU C N   1 
ATOM   3520 C  CA  . LEU C  1 97  ? 39.16735  5.16245   36.55197  1.000 63.48631  ?  97  LEU C CA  1 
ATOM   3521 C  C   . LEU C  1 97  ? 39.56455  3.95994   37.39432  1.000 59.65079  ?  97  LEU C C   1 
ATOM   3522 O  O   . LEU C  1 97  ? 40.11266  2.97855   36.87544  1.000 62.03598  ?  97  LEU C O   1 
ATOM   3523 C  CB  . LEU C  1 97  ? 40.20493  6.27223   36.69983  1.000 61.07147  ?  97  LEU C CB  1 
ATOM   3524 C  CG  . LEU C  1 97  ? 41.64772  5.81765   36.48162  1.000 56.52914  ?  97  LEU C CG  1 
ATOM   3525 C  CD1 . LEU C  1 97  ? 41.83880  5.45706   35.03065  1.000 52.91450  ?  97  LEU C CD1 1 
ATOM   3526 C  CD2 . LEU C  1 97  ? 42.59696  6.92773   36.89623  1.000 55.35571  ?  97  LEU C CD2 1 
ATOM   3527 N  N   . ASN C  1 98  ? 39.27568  4.00477   38.69415  1.000 54.89041  ?  98  ASN C N   1 
ATOM   3528 C  CA  . ASN C  1 98  ? 39.71295  2.91662   39.55533  1.000 57.85882  ?  98  ASN C CA  1 
ATOM   3529 C  C   . ASN C  1 98  ? 38.86115  1.67137   39.34609  1.000 58.52266  ?  98  ASN C C   1 
ATOM   3530 O  O   . ASN C  1 98  ? 39.37228  0.54323   39.39510  1.000 65.58822  ?  98  ASN C O   1 
ATOM   3531 C  CB  . ASN C  1 98  ? 39.69305  3.35114   41.01736  1.000 56.93570  ?  98  ASN C CB  1 
ATOM   3532 C  CG  . ASN C  1 98  ? 40.25924  2.29984   41.91374  1.000 65.41434  ?  98  ASN C CG  1 
ATOM   3533 O  OD1 . ASN C  1 98  ? 39.51860  1.47745   42.45300  1.000 68.13616  ?  98  ASN C OD1 1 
ATOM   3534 N  ND2 . ASN C  1 98  ? 41.58694  2.27420   42.04507  1.000 71.38502  ?  98  ASN C ND2 1 
ATOM   3535 N  N   . ALA C  1 99  ? 37.56181  1.85270   39.12357  1.000 53.24192  ?  99  ALA C N   1 
ATOM   3536 C  CA  . ALA C  1 99  ? 36.72935  0.72660   38.72670  1.000 56.17159  ?  99  ALA C CA  1 
ATOM   3537 C  C   . ALA C  1 99  ? 37.24421  0.10522   37.44146  1.000 54.95532  ?  99  ALA C C   1 
ATOM   3538 O  O   . ALA C  1 99  ? 37.35737  -1.12015  37.34084  1.000 53.55610  ?  99  ALA C O   1 
ATOM   3539 C  CB  . ALA C  1 99  ? 35.27674  1.16831   38.55300  1.000 55.18143  ?  99  ALA C CB  1 
ATOM   3540 N  N   . MET C  1 100 ? 37.56437  0.93915   36.44925  1.000 56.45520  ?  100 MET C N   1 
ATOM   3541 C  CA  . MET C  1 100 ? 38.04594  0.42442   35.17586  1.000 49.02794  ?  100 MET C CA  1 
ATOM   3542 C  C   . MET C  1 100 ? 39.35986  -0.32546  35.33890  1.000 55.95933  ?  100 MET C C   1 
ATOM   3543 O  O   . MET C  1 100 ? 39.59374  -1.32812  34.65461  1.000 51.13749  ?  100 MET C O   1 
ATOM   3544 C  CB  . MET C  1 100 ? 38.19227  1.57218   34.18756  1.000 47.74057  ?  100 MET C CB  1 
ATOM   3545 C  CG  . MET C  1 100 ? 37.84176  1.18492   32.76988  1.000 63.90593  ?  100 MET C CG  1 
ATOM   3546 S  SD  . MET C  1 100 ? 36.08041  0.87641   32.49036  1.000 57.48246  ?  100 MET C SD  1 
ATOM   3547 C  CE  . MET C  1 100 ? 35.44864  2.54931   32.41477  1.000 67.32520  ?  100 MET C CE  1 
ATOM   3548 N  N   . GLU C  1 101 ? 40.22825  0.13175   36.25773  1.000 54.42623  ?  101 GLU C N   1 
ATOM   3549 C  CA  . GLU C  1 101 ? 41.50049  -0.55428  36.47165  1.000 53.32846  ?  101 GLU C CA  1 
ATOM   3550 C  C   . GLU C  1 101 ? 41.29964  -1.87483  37.20476  1.000 56.77316  ?  101 GLU C C   1 
ATOM   3551 O  O   . GLU C  1 101 ? 41.94766  -2.87909  36.87717  1.000 54.78326  ?  101 GLU C O   1 
ATOM   3552 C  CB  . GLU C  1 101 ? 42.47678  0.34777   37.24077  1.000 62.09395  ?  101 GLU C CB  1 
ATOM   3553 C  CG  . GLU C  1 101 ? 43.09802  1.47117   36.39533  1.000 60.27327  ?  101 GLU C CG  1 
ATOM   3554 C  CD  . GLU C  1 101 ? 43.96437  2.43790   37.20329  1.000 77.15691  ?  101 GLU C CD  1 
ATOM   3555 O  OE1 . GLU C  1 101 ? 43.59697  2.73944   38.36270  1.000 81.36311  ?  101 GLU C OE1 1 
ATOM   3556 O  OE2 . GLU C  1 101 ? 44.99487  2.92213   36.66920  1.000 79.47788  -1 101 GLU C OE2 1 
ATOM   3557 N  N   . ALA C  1 102 ? 40.41046  -1.90340  38.20311  1.000 54.95463  ?  102 ALA C N   1 
ATOM   3558 C  CA  . ALA C  1 102 ? 40.09335  -3.17868  38.84485  1.000 58.57442  ?  102 ALA C CA  1 
ATOM   3559 C  C   . ALA C  1 102 ? 39.47784  -4.16304  37.84885  1.000 56.34541  ?  102 ALA C C   1 
ATOM   3560 O  O   . ALA C  1 102 ? 39.76402  -5.36322  37.89288  1.000 60.80691  ?  102 ALA C O   1 
ATOM   3561 C  CB  . ALA C  1 102 ? 39.15967  -2.96007  40.03568  1.000 59.33559  ?  102 ALA C CB  1 
ATOM   3562 N  N   . ALA C  1 103 ? 38.65121  -3.67707  36.92493  1.000 52.48298  ?  103 ALA C N   1 
ATOM   3563 C  CA  . ALA C  1 103 ? 38.09210  -4.58643  35.92966  1.000 51.13896  ?  103 ALA C CA  1 
ATOM   3564 C  C   . ALA C  1 103 ? 39.17355  -5.08992  34.98704  1.000 50.98777  ?  103 ALA C C   1 
ATOM   3565 O  O   . ALA C  1 103 ? 39.18475  -6.26925  34.62300  1.000 60.25943  ?  103 ALA C O   1 
ATOM   3566 C  CB  . ALA C  1 103 ? 36.97024  -3.91377  35.14706  1.000 49.29603  ?  103 ALA C CB  1 
ATOM   3567 N  N   . LEU C  1 104 ? 40.07952  -4.20791  34.56735  1.000 50.96611  ?  104 LEU C N   1 
ATOM   3568 C  CA  . LEU C  1 104 ? 41.24169  -4.64026  33.79270  1.000 54.90830  ?  104 LEU C CA  1 
ATOM   3569 C  C   . LEU C  1 104 ? 41.98098  -5.78146  34.48536  1.000 52.86800  ?  104 LEU C C   1 
ATOM   3570 O  O   . LEU C  1 104 ? 42.27134  -6.81598  33.86881  1.000 54.73350  ?  104 LEU C O   1 
ATOM   3571 C  CB  . LEU C  1 104 ? 42.18091  -3.45853  33.56794  1.000 53.47235  ?  104 LEU C CB  1 
ATOM   3572 C  CG  . LEU C  1 104 ? 43.40619  -3.80505  32.72906  1.000 61.18824  ?  104 LEU C CG  1 
ATOM   3573 C  CD1 . LEU C  1 104 ? 42.98385  -4.46010  31.42014  1.000 53.99072  ?  104 LEU C CD1 1 
ATOM   3574 C  CD2 . LEU C  1 104 ? 44.26089  -2.56770  32.47529  1.000 63.74398  ?  104 LEU C CD2 1 
ATOM   3575 N  N   . HIS C  1 105 ? 42.27594  -5.61905  35.77879  1.000 54.53678  ?  105 HIS C N   1 
ATOM   3576 C  CA  . HIS C  1 105 ? 42.97769  -6.67336  36.50996  1.000 57.09679  ?  105 HIS C CA  1 
ATOM   3577 C  C   . HIS C  1 105 ? 42.13786  -7.94576  36.58291  1.000 62.79411  ?  105 HIS C C   1 
ATOM   3578 O  O   . HIS C  1 105 ? 42.66654  -9.05917  36.44573  1.000 62.34654  ?  105 HIS C O   1 
ATOM   3579 C  CB  . HIS C  1 105 ? 43.34493  -6.18920  37.91205  1.000 61.93773  ?  105 HIS C CB  1 
ATOM   3580 C  CG  . HIS C  1 105 ? 44.29349  -7.09572  38.63752  1.000 71.14006  ?  105 HIS C CG  1 
ATOM   3581 N  ND1 . HIS C  1 105 ? 45.64511  -7.13739  38.36229  1.000 76.54270  ?  105 HIS C ND1 1 
ATOM   3582 C  CD2 . HIS C  1 105 ? 44.08600  -7.99232  39.63290  1.000 73.92303  ?  105 HIS C CD2 1 
ATOM   3583 C  CE1 . HIS C  1 105 ? 46.22685  -8.02248  39.15429  1.000 77.19196  ?  105 HIS C CE1 1 
ATOM   3584 N  NE2 . HIS C  1 105 ? 45.30304  -8.55708  39.93277  1.000 75.69126  ?  105 HIS C NE2 1 
ATOM   3585 N  N   . LEU C  1 106 ? 40.82455  -7.79472  36.78987  1.000 55.13482  ?  106 LEU C N   1 
ATOM   3586 C  CA  . LEU C  1 106 ? 39.93630  -8.94573  36.90877  1.000 57.70908  ?  106 LEU C CA  1 
ATOM   3587 C  C   . LEU C  1 106 ? 39.90389  -9.74386  35.61260  1.000 56.58824  ?  106 LEU C C   1 
ATOM   3588 O  O   . LEU C  1 106 ? 39.96090  -10.98005 35.62808  1.000 54.06236  ?  106 LEU C O   1 
ATOM   3589 C  CB  . LEU C  1 106 ? 38.52959  -8.47274  37.29706  1.000 60.56313  ?  106 LEU C CB  1 
ATOM   3590 C  CG  . LEU C  1 106 ? 37.36525  -9.47281  37.33474  1.000 59.68562  ?  106 LEU C CG  1 
ATOM   3591 C  CD1 . LEU C  1 106 ? 37.47538  -10.41663 38.54484  1.000 60.17402  ?  106 LEU C CD1 1 
ATOM   3592 C  CD2 . LEU C  1 106 ? 36.01251  -8.75816  37.30841  1.000 52.39125  ?  106 LEU C CD2 1 
ATOM   3593 N  N   . GLU C  1 107 ? 39.81881  -9.04653  34.47351  1.000 52.06606  ?  107 GLU C N   1 
ATOM   3594 C  CA  . GLU C  1 107 ? 39.83812  -9.74118  33.19112  1.000 50.92794  ?  107 GLU C CA  1 
ATOM   3595 C  C   . GLU C  1 107 ? 41.20298  -10.36564 32.91978  1.000 60.76399  ?  107 GLU C C   1 
ATOM   3596 O  O   . GLU C  1 107 ? 41.28147  -11.43417 32.30824  1.000 65.30971  ?  107 GLU C O   1 
ATOM   3597 C  CB  . GLU C  1 107 ? 39.45072  -8.79961  32.04870  1.000 49.14753  ?  107 GLU C CB  1 
ATOM   3598 C  CG  . GLU C  1 107 ? 37.97727  -8.31585  32.06859  1.000 52.00745  ?  107 GLU C CG  1 
ATOM   3599 C  CD  . GLU C  1 107 ? 36.94027  -9.40349  31.75606  1.000 59.36304  ?  107 GLU C CD  1 
ATOM   3600 O  OE1 . GLU C  1 107 ? 35.74211  -9.06198  31.62549  1.000 67.93866  ?  107 GLU C OE1 1 
ATOM   3601 O  OE2 . GLU C  1 107 ? 37.30508  -10.59212 31.64038  1.000 66.68283  -1 107 GLU C OE2 1 
ATOM   3602 N  N   . LYS C  1 108 ? 42.28763  -9.73491  33.36550  1.000 54.92980  ?  108 LYS C N   1 
ATOM   3603 C  CA  . LYS C  1 108 ? 43.58770  -10.35891 33.16797  1.000 54.36155  ?  108 LYS C CA  1 
ATOM   3604 C  C   . LYS C  1 108 ? 43.67793  -11.67317 33.93666  1.000 62.94634  ?  108 LYS C C   1 
ATOM   3605 O  O   . LYS C  1 108 ? 44.15687  -12.68105 33.40286  1.000 61.69587  ?  108 LYS C O   1 
ATOM   3606 C  CB  . LYS C  1 108 ? 44.68983  -9.39067  33.57451  1.000 55.49529  ?  108 LYS C CB  1 
ATOM   3607 C  CG  . LYS C  1 108 ? 44.72041  -8.14639  32.70618  1.000 56.74121  ?  108 LYS C CG  1 
ATOM   3608 C  CD  . LYS C  1 108 ? 45.51877  -8.39242  31.46332  1.000 61.30434  ?  108 LYS C CD  1 
ATOM   3609 C  CE  . LYS C  1 108 ? 46.99648  -8.17941  31.78148  1.000 68.49107  ?  108 LYS C CE  1 
ATOM   3610 N  NZ  . LYS C  1 108 ? 47.22395  -6.83829  32.38959  1.000 67.71111  ?  108 LYS C NZ  1 
ATOM   3611 N  N   . ASN C  1 109 ? 43.18125  -11.69062 35.17765  1.000 62.57207  ?  109 ASN C N   1 
ATOM   3612 C  CA  . ASN C  1 109 ? 43.16517  -12.92891 35.95442  1.000 62.37509  ?  109 ASN C CA  1 
ATOM   3613 C  C   . ASN C  1 109 ? 42.30277  -13.99019 35.28012  1.000 60.13760  ?  109 ASN C C   1 
ATOM   3614 O  O   . ASN C  1 109 ? 42.73082  -15.13877 35.12212  1.000 66.32093  ?  109 ASN C O   1 
ATOM   3615 C  CB  . ASN C  1 109 ? 42.66169  -12.65434 37.37091  1.000 67.39501  ?  109 ASN C CB  1 
ATOM   3616 C  CG  . ASN C  1 109 ? 43.75736  -12.15529 38.30299  1.000 81.51048  ?  109 ASN C CG  1 
ATOM   3617 O  OD1 . ASN C  1 109 ? 44.94964  -12.17610 37.97437  1.000 82.34824  ?  109 ASN C OD1 1 
ATOM   3618 N  ND2 . ASN C  1 109 ? 43.35039  -11.69061 39.47652  1.000 89.20316  ?  109 ASN C ND2 1 
ATOM   3619 N  N   . VAL C  1 110 ? 41.07345  -13.62483 34.89009  1.000 60.08358  ?  110 VAL C N   1 
ATOM   3620 C  CA  . VAL C  1 110 ? 40.17832  -14.57911 34.22719  1.000 59.43370  ?  110 VAL C CA  1 
ATOM   3621 C  C   . VAL C  1 110 ? 40.82918  -15.13704 32.96903  1.000 58.93096  ?  110 VAL C C   1 
ATOM   3622 O  O   . VAL C  1 110 ? 40.77230  -16.34224 32.70951  1.000 62.89899  ?  110 VAL C O   1 
ATOM   3623 C  CB  . VAL C  1 110 ? 38.81593  -13.92948 33.90401  1.000 57.29690  ?  110 VAL C CB  1 
ATOM   3624 C  CG1 . VAL C  1 110 ? 37.96823  -14.85450 33.01328  1.000 54.22456  ?  110 VAL C CG1 1 
ATOM   3625 C  CG2 . VAL C  1 110 ? 38.05520  -13.57908 35.17435  1.000 56.53912  ?  110 VAL C CG2 1 
ATOM   3626 N  N   . ASN C  1 111 ? 41.45203  -14.26953 32.16470  1.000 63.61451  ?  111 ASN C N   1 
ATOM   3627 C  CA  . ASN C  1 111 ? 42.16605  -14.72665 30.97752  1.000 59.84811  ?  111 ASN C CA  1 
ATOM   3628 C  C   . ASN C  1 111 ? 43.26652  -15.71867 31.33908  1.000 61.94899  ?  111 ASN C C   1 
ATOM   3629 O  O   . ASN C  1 111 ? 43.42340  -16.75010 30.67837  1.000 54.14779  ?  111 ASN C O   1 
ATOM   3630 C  CB  . ASN C  1 111 ? 42.76283  -13.53018 30.23398  1.000 57.19226  ?  111 ASN C CB  1 
ATOM   3631 C  CG  . ASN C  1 111 ? 43.19864  -13.87412 28.80835  1.000 59.42088  ?  111 ASN C CG  1 
ATOM   3632 O  OD1 . ASN C  1 111 ? 42.48954  -14.58304 28.07942  1.000 53.49456  ?  111 ASN C OD1 1 
ATOM   3633 N  ND2 . ASN C  1 111 ? 44.35416  -13.35050 28.39544  1.000 51.61274  ?  111 ASN C ND2 1 
ATOM   3634 N  N   . GLN C  1 112 ? 44.07038  -15.39443 32.35215  1.000 63.82094  ?  112 GLN C N   1 
ATOM   3635 C  CA  . GLN C  1 112 ? 45.18407  -16.26369 32.72068  1.000 65.52830  ?  112 GLN C CA  1 
ATOM   3636 C  C   . GLN C  1 112 ? 44.67805  -17.64173 33.12602  1.000 71.94179  ?  112 GLN C C   1 
ATOM   3637 O  O   . GLN C  1 112 ? 45.26769  -18.67456 32.76460  1.000 74.70738  ?  112 GLN C O   1 
ATOM   3638 C  CB  . GLN C  1 112 ? 45.98359  -15.62065 33.85266  1.000 60.66270  ?  112 GLN C CB  1 
ATOM   3639 C  CG  . GLN C  1 112 ? 46.85216  -16.58269 34.63698  1.000 65.95477  ?  112 GLN C CG  1 
ATOM   3640 C  CD  . GLN C  1 112 ? 47.34508  -15.98988 35.95272  1.000 72.90043  ?  112 GLN C CD  1 
ATOM   3641 O  OE1 . GLN C  1 112 ? 47.32990  -14.77075 36.15329  1.000 76.30609  ?  112 GLN C OE1 1 
ATOM   3642 N  NE2 . GLN C  1 112 ? 47.79115  -16.85588 36.85487  1.000 77.28905  ?  112 GLN C NE2 1 
ATOM   3643 N  N   . SER C  1 113 ? 43.56313  -17.67352 33.85576  1.000 60.00761  ?  113 SER C N   1 
ATOM   3644 C  CA  . SER C  1 113 ? 42.99379  -18.95172 34.24565  1.000 58.14975  ?  113 SER C CA  1 
ATOM   3645 C  C   . SER C  1 113 ? 42.43200  -19.68906 33.02787  1.000 67.76065  ?  113 SER C C   1 
ATOM   3646 O  O   . SER C  1 113 ? 42.56509  -20.91346 32.93257  1.000 65.85022  ?  113 SER C O   1 
ATOM   3647 C  CB  . SER C  1 113 ? 41.94274  -18.72229 35.33518  1.000 58.20880  ?  113 SER C CB  1 
ATOM   3648 O  OG  . SER C  1 113 ? 41.02631  -19.79155 35.43999  1.000 57.88265  ?  113 SER C OG  1 
ATOM   3649 N  N   . LEU C  1 114 ? 41.86000  -18.95423 32.06357  1.000 61.34044  ?  114 LEU C N   1 
ATOM   3650 C  CA  . LEU C  1 114 ? 41.41033  -19.55484 30.80661  1.000 56.61143  ?  114 LEU C CA  1 
ATOM   3651 C  C   . LEU C  1 114 ? 42.57513  -20.13932 30.00705  1.000 54.12154  ?  114 LEU C C   1 
ATOM   3652 O  O   . LEU C  1 114 ? 42.43118  -21.16566 29.33285  1.000 53.82907  ?  114 LEU C O   1 
ATOM   3653 C  CB  . LEU C  1 114 ? 40.66084  -18.50589 29.97577  1.000 51.64555  ?  114 LEU C CB  1 
ATOM   3654 C  CG  . LEU C  1 114 ? 39.24351  -18.19933 30.46682  1.000 55.48727  ?  114 LEU C CG  1 
ATOM   3655 C  CD1 . LEU C  1 114 ? 38.64144  -17.01374 29.74127  1.000 57.29881  ?  114 LEU C CD1 1 
ATOM   3656 C  CD2 . LEU C  1 114 ? 38.36811  -19.41404 30.30022  1.000 52.71605  ?  114 LEU C CD2 1 
ATOM   3657 N  N   . LEU C  1 115 ? 43.73583  -19.49493 30.06378  1.000 62.24273  ?  115 LEU C N   1 
ATOM   3658 C  CA  . LEU C  1 115 ? 44.88809  -19.98959 29.32199  1.000 55.76134  ?  115 LEU C CA  1 
ATOM   3659 C  C   . LEU C  1 115 ? 45.45243  -21.24243 29.97686  1.000 57.49876  ?  115 LEU C C   1 
ATOM   3660 O  O   . LEU C  1 115 ? 45.92416  -22.15526 29.28641  1.000 57.81793  ?  115 LEU C O   1 
ATOM   3661 C  CB  . LEU C  1 115 ? 45.95088  -18.89257 29.21324  1.000 56.29331  ?  115 LEU C CB  1 
ATOM   3662 C  CG  . LEU C  1 115 ? 45.56240  -17.73023 28.30217  1.000 61.59610  ?  115 LEU C CG  1 
ATOM   3663 C  CD1 . LEU C  1 115 ? 46.19709  -16.45339 28.77835  1.000 63.74599  ?  115 LEU C CD1 1 
ATOM   3664 C  CD2 . LEU C  1 115 ? 45.94416  -18.01839 26.86630  1.000 59.06492  ?  115 LEU C CD2 1 
ATOM   3665 N  N   . GLU C  1 116 ? 45.40505  -21.30019 31.31287  1.000 58.90542  ?  116 GLU C N   1 
ATOM   3666 C  CA  . GLU C  1 116 ? 45.74817  -22.53651 32.01474  1.000 60.29524  ?  116 GLU C CA  1 
ATOM   3667 C  C   . GLU C  1 116 ? 44.76324  -23.65133 31.66985  1.000 66.41297  ?  116 GLU C C   1 
ATOM   3668 O  O   . GLU C  1 116 ? 45.16178  -24.80902 31.48814  1.000 64.38584  ?  116 GLU C O   1 
ATOM   3669 C  CB  . GLU C  1 116 ? 45.75812  -22.30522 33.52369  1.000 61.68566  ?  116 GLU C CB  1 
ATOM   3670 C  CG  . GLU C  1 116 ? 46.86399  -21.41767 34.02927  1.000 69.50133  ?  116 GLU C CG  1 
ATOM   3671 C  CD  . GLU C  1 116 ? 46.91075  -21.38074 35.54484  1.000 80.60194  ?  116 GLU C CD  1 
ATOM   3672 O  OE1 . GLU C  1 116 ? 46.30344  -22.28165 36.17099  1.000 84.03755  ?  116 GLU C OE1 1 
ATOM   3673 O  OE2 . GLU C  1 116 ? 47.55347  -20.45852 36.10582  1.000 81.65796  -1 116 GLU C OE2 1 
ATOM   3674 N  N   . LEU C  1 117 ? 43.46533  -23.32437 31.58921  1.000 57.84408  ?  117 LEU C N   1 
ATOM   3675 C  CA  . LEU C  1 117 ? 42.48041  -24.33635 31.21806  1.000 66.03415  ?  117 LEU C CA  1 
ATOM   3676 C  C   . LEU C  1 117 ? 42.73621  -24.84512 29.80726  1.000 62.32225  ?  117 LEU C C   1 
ATOM   3677 O  O   . LEU C  1 117 ? 42.60454  -26.04227 29.53173  1.000 56.37691  ?  117 LEU C O   1 
ATOM   3678 C  CB  . LEU C  1 117 ? 41.06147  -23.77591 31.33277  1.000 59.17141  ?  117 LEU C CB  1 
ATOM   3679 C  CG  . LEU C  1 117 ? 39.99247  -24.77094 31.78019  1.000 60.64230  ?  117 LEU C CG  1 
ATOM   3680 C  CD1 . LEU C  1 117 ? 38.75735  -24.01627 32.25307  1.000 65.48791  ?  117 LEU C CD1 1 
ATOM   3681 C  CD2 . LEU C  1 117 ? 39.63806  -25.74234 30.66314  1.000 62.39343  ?  117 LEU C CD2 1 
ATOM   3682 N  N   . HIS C  1 118 ? 43.11841  -23.95044 28.90209  1.000 55.38617  ?  118 HIS C N   1 
ATOM   3683 C  CA  . HIS C  1 118 ? 43.47685  -24.38958 27.56024  1.000 58.49862  ?  118 HIS C CA  1 
ATOM   3684 C  C   . HIS C  1 118 ? 44.68726  -25.31882 27.58600  1.000 59.41797  ?  118 HIS C C   1 
ATOM   3685 O  O   . HIS C  1 118 ? 44.67936  -26.37597 26.94774  1.000 61.67278  ?  118 HIS C O   1 
ATOM   3686 C  CB  . HIS C  1 118 ? 43.74357  -23.18962 26.65411  1.000 53.84749  ?  118 HIS C CB  1 
ATOM   3687 C  CG  . HIS C  1 118 ? 43.75927  -23.54066 25.19883  1.000 54.24371  ?  118 HIS C CG  1 
ATOM   3688 N  ND1 . HIS C  1 118 ? 44.88092  -24.02633 24.56004  1.000 53.88817  ?  118 HIS C ND1 1 
ATOM   3689 C  CD2 . HIS C  1 118 ? 42.77835  -23.50882 24.26304  1.000 51.28240  ?  118 HIS C CD2 1 
ATOM   3690 C  CE1 . HIS C  1 118 ? 44.59558  -24.26378 23.29103  1.000 52.84344  ?  118 HIS C CE1 1 
ATOM   3691 N  NE2 . HIS C  1 118 ? 43.32760  -23.95602 23.08360  1.000 51.25437  ?  118 HIS C NE2 1 
ATOM   3692 N  N   . LYS C  1 119 ? 45.75070  -24.93893 28.29800  1.000 58.12544  ?  119 LYS C N   1 
ATOM   3693 C  CA  . LYS C  1 119 ? 46.92572  -25.80875 28.28470  1.000 60.46928  ?  119 LYS C CA  1 
ATOM   3694 C  C   . LYS C  1 119 ? 46.62210  -27.15564 28.92955  1.000 65.20740  ?  119 LYS C C   1 
ATOM   3695 O  O   . LYS C  1 119 ? 47.14066  -28.18742 28.48753  1.000 61.50198  ?  119 LYS C O   1 
ATOM   3696 C  CB  . LYS C  1 119 ? 48.11459  -25.15284 28.97284  1.000 61.48886  ?  119 LYS C CB  1 
ATOM   3697 C  CG  . LYS C  1 119 ? 49.37477  -26.02241 28.95843  1.000 63.43908  ?  119 LYS C CG  1 
ATOM   3698 N  N   . LEU C  1 120 ? 45.75601  -27.18085 29.93947  1.000 60.62752  ?  120 LEU C N   1 
ATOM   3699 C  CA  . LEU C  1 120 ? 45.32965  -28.45938 30.48761  1.000 61.26967  ?  120 LEU C CA  1 
ATOM   3700 C  C   . LEU C  1 120 ? 44.56926  -29.27552 29.44051  1.000 67.94434  ?  120 LEU C C   1 
ATOM   3701 O  O   . LEU C  1 120 ? 44.80116  -30.47954 29.28255  1.000 60.68266  ?  120 LEU C O   1 
ATOM   3702 C  CB  . LEU C  1 120 ? 44.47740  -28.23322 31.73259  1.000 61.33924  ?  120 LEU C CB  1 
ATOM   3703 C  CG  . LEU C  1 120 ? 43.75315  -29.49863 32.19790  1.000 70.87954  ?  120 LEU C CG  1 
ATOM   3704 C  CD1 . LEU C  1 120 ? 44.72441  -30.48458 32.87259  1.000 63.78933  ?  120 LEU C CD1 1 
ATOM   3705 C  CD2 . LEU C  1 120 ? 42.59517  -29.14136 33.10782  1.000 61.07091  ?  120 LEU C CD2 1 
ATOM   3706 N  N   . ALA C  1 121 ? 43.66030  -28.63093 28.70629  1.000 63.73177  ?  121 ALA C N   1 
ATOM   3707 C  CA  . ALA C  1 121 ? 42.91222  -29.33653 27.66984  1.000 56.77564  ?  121 ALA C CA  1 
ATOM   3708 C  C   . ALA C  1 121 ? 43.84227  -29.92422 26.61838  1.000 57.69882  ?  121 ALA C C   1 
ATOM   3709 O  O   . ALA C  1 121 ? 43.63757  -31.05159 26.15028  1.000 58.18365  ?  121 ALA C O   1 
ATOM   3710 C  CB  . ALA C  1 121 ? 41.91119  -28.38576 27.02077  1.000 58.84227  ?  121 ALA C CB  1 
ATOM   3711 N  N   . THR C  1 122 ? 44.86806  -29.16824 26.23949  1.000 58.47098  ?  122 THR C N   1 
ATOM   3712 C  CA  . THR C  1 122 ? 45.79818  -29.59956 25.19968  1.000 58.21667  ?  122 THR C CA  1 
ATOM   3713 C  C   . THR C  1 122 ? 46.71788  -30.71337 25.68810  1.000 65.22578  ?  122 THR C C   1 
ATOM   3714 O  O   . THR C  1 122 ? 46.98533  -31.67866 24.95721  1.000 60.56500  ?  122 THR C O   1 
ATOM   3715 C  CB  . THR C  1 122 ? 46.61893  -28.40719 24.71181  1.000 58.48479  ?  122 THR C CB  1 
ATOM   3716 O  OG1 . THR C  1 122 ? 47.54342  -28.02772 25.73780  1.000 72.07716  ?  122 THR C OG1 1 
ATOM   3717 C  CG2 . THR C  1 122 ? 45.72369  -27.23966 24.36476  1.000 56.30380  ?  122 THR C CG2 1 
ATOM   3718 N  N   . ASP C  1 123 ? 47.25218  -30.58524 26.90501  1.000 63.30510  ?  123 ASP C N   1 
ATOM   3719 C  CA  . ASP C  1 123 ? 48.11930  -31.64330 27.38777  1.000 63.67066  ?  123 ASP C CA  1 
ATOM   3720 C  C   . ASP C  1 123 ? 47.33545  -32.89785 27.75488  1.000 68.88957  ?  123 ASP C C   1 
ATOM   3721 O  O   . ASP C  1 123 ? 47.94085  -33.96672 27.87178  1.000 65.45826  ?  123 ASP C O   1 
ATOM   3722 C  CB  . ASP C  1 123 ? 48.96284  -31.16905 28.57085  1.000 70.76774  ?  123 ASP C CB  1 
ATOM   3723 C  CG  . ASP C  1 123 ? 49.71830  -29.86914 28.28271  1.000 83.79131  ?  123 ASP C CG  1 
ATOM   3724 O  OD1 . ASP C  1 123 ? 49.63581  -29.33509 27.13959  1.000 83.26490  -1 123 ASP C OD1 1 
ATOM   3725 O  OD2 . ASP C  1 123 ? 50.44276  -29.40983 29.19543  1.000 82.64198  ?  123 ASP C OD2 1 
ATOM   3726 N  N   . LYS C  1 124 ? 46.01162  -32.79967 27.91863  1.000 62.20347  ?  124 LYS C N   1 
ATOM   3727 C  CA  . LYS C  1 124 ? 45.14439  -33.97046 28.00709  1.000 61.91438  ?  124 LYS C CA  1 
ATOM   3728 C  C   . LYS C  1 124 ? 44.56346  -34.36699 26.65390  1.000 63.73390  ?  124 LYS C C   1 
ATOM   3729 O  O   . LYS C  1 124 ? 43.71593  -35.26081 26.60166  1.000 67.14319  ?  124 LYS C O   1 
ATOM   3730 C  CB  . LYS C  1 124 ? 43.99130  -33.73029 28.99772  1.000 61.26520  ?  124 LYS C CB  1 
ATOM   3731 C  CG  . LYS C  1 124 ? 44.39917  -33.42475 30.44774  1.000 63.39987  ?  124 LYS C CG  1 
ATOM   3732 C  CD  . LYS C  1 124 ? 45.22257  -34.55136 31.07824  1.000 64.84168  ?  124 LYS C CD  1 
ATOM   3733 C  CE  . LYS C  1 124 ? 45.43317  -34.31946 32.58348  1.000 70.05556  ?  124 LYS C CE  1 
ATOM   3734 N  NZ  . LYS C  1 124 ? 46.68430  -34.97956 33.13448  1.000 76.33735  ?  124 LYS C NZ  1 
ATOM   3735 N  N   . ASN C  1 125 ? 44.99270  -33.72050 25.57009  1.000 59.82220  ?  125 ASN C N   1 
ATOM   3736 C  CA  . ASN C  1 125 ? 44.55310  -34.01248 24.20384  1.000 58.57990  ?  125 ASN C CA  1 
ATOM   3737 C  C   . ASN C  1 125 ? 43.02834  -34.05948 24.11049  1.000 66.24465  ?  125 ASN C C   1 
ATOM   3738 O  O   . ASN C  1 125 ? 42.41035  -35.04223 23.69140  1.000 56.50426  ?  125 ASN C O   1 
ATOM   3739 C  CB  . ASN C  1 125 ? 45.19299  -35.29514 23.67984  1.000 61.62433  ?  125 ASN C CB  1 
ATOM   3740 C  CG  . ASN C  1 125 ? 46.65074  -35.08745 23.28114  1.000 74.93109  ?  125 ASN C CG  1 
ATOM   3741 O  OD1 . ASN C  1 125 ? 47.25605  -34.07286 23.61956  1.000 85.65826  ?  125 ASN C OD1 1 
ATOM   3742 N  ND2 . ASN C  1 125 ? 47.21956  -36.05168 22.57339  1.000 73.98913  ?  125 ASN C ND2 1 
ATOM   3743 N  N   . ASP C  1 126 ? 42.42922  -32.94909 24.49715  1.000 69.79064  ?  126 ASP C N   1 
ATOM   3744 C  CA  . ASP C  1 126 ? 40.99535  -32.77446 24.36506  1.000 54.24754  ?  126 ASP C CA  1 
ATOM   3745 C  C   . ASP C  1 126 ? 40.79538  -31.58559 23.44072  1.000 53.48068  ?  126 ASP C C   1 
ATOM   3746 O  O   . ASP C  1 126 ? 40.62443  -30.44832 23.90479  1.000 52.37669  ?  126 ASP C O   1 
ATOM   3747 C  CB  . ASP C  1 126 ? 40.35077  -32.56802 25.73360  1.000 54.42325  ?  126 ASP C CB  1 
ATOM   3748 C  CG  . ASP C  1 126 ? 38.84204  -32.52789 25.67103  1.000 57.21645  ?  126 ASP C CG  1 
ATOM   3749 O  OD1 . ASP C  1 126 ? 38.26647  -32.54797 24.55973  1.000 57.38309  ?  126 ASP C OD1 1 
ATOM   3750 O  OD2 . ASP C  1 126 ? 38.23594  -32.44976 26.75449  1.000 62.87554  -1 126 ASP C OD2 1 
ATOM   3751 N  N   . PRO C  1 127 ? 40.85417  -31.80319 22.12542  1.000 52.22062  ?  127 PRO C N   1 
ATOM   3752 C  CA  . PRO C  1 127 ? 40.77779  -30.66218 21.20322  1.000 51.02148  ?  127 PRO C CA  1 
ATOM   3753 C  C   . PRO C  1 127 ? 39.40509  -30.01939 21.18941  1.000 56.51191  ?  127 PRO C C   1 
ATOM   3754 O  O   . PRO C  1 127 ? 39.29101  -28.82213 20.87804  1.000 48.50285  ?  127 PRO C O   1 
ATOM   3755 C  CB  . PRO C  1 127 ? 41.14175  -31.28316 19.84959  1.000 50.99165  ?  127 PRO C CB  1 
ATOM   3756 C  CG  . PRO C  1 127 ? 40.77045  -32.72209 19.99561  1.000 51.48357  ?  127 PRO C CG  1 
ATOM   3757 C  CD  . PRO C  1 127 ? 40.99467  -33.08559 21.42463  1.000 52.65413  ?  127 PRO C CD  1 
ATOM   3758 N  N   . HIS C  1 128 ? 38.35543  -30.76410 21.55386  1.000 50.98538  ?  128 HIS C N   1 
ATOM   3759 C  CA  . HIS C  1 128 ? 37.05056  -30.12109 21.67514  1.000 53.48885  ?  128 HIS C CA  1 
ATOM   3760 C  C   . HIS C  1 128 ? 37.06001  -29.07341 22.78357  1.000 47.78431  ?  128 HIS C C   1 
ATOM   3761 O  O   . HIS C  1 128 ? 36.58110  -27.95239 22.58450  1.000 46.73528  ?  128 HIS C O   1 
ATOM   3762 C  CB  . HIS C  1 128 ? 35.94300  -31.14023 21.92716  1.000 50.53321  ?  128 HIS C CB  1 
ATOM   3763 C  CG  . HIS C  1 128 ? 34.62208  -30.49645 22.20382  1.000 52.72381  ?  128 HIS C CG  1 
ATOM   3764 N  ND1 . HIS C  1 128 ? 34.23418  -30.10897 23.46821  1.000 54.02852  ?  128 HIS C ND1 1 
ATOM   3765 C  CD2 . HIS C  1 128 ? 33.62440  -30.11924 21.37253  1.000 48.11983  ?  128 HIS C CD2 1 
ATOM   3766 C  CE1 . HIS C  1 128 ? 33.04560  -29.54084 23.40746  1.000 49.95985  ?  128 HIS C CE1 1 
ATOM   3767 N  NE2 . HIS C  1 128 ? 32.65400  -29.53559 22.14712  1.000 52.43753  ?  128 HIS C NE2 1 
ATOM   3768 N  N   . LEU C  1 129 ? 37.61151  -29.41438 23.95694  1.000 49.14951  ?  129 LEU C N   1 
ATOM   3769 C  CA  . LEU C  1 129 ? 37.65429  -28.45007 25.05307  1.000 49.45513  ?  129 LEU C CA  1 
ATOM   3770 C  C   . LEU C  1 129 ? 38.54489  -27.26623 24.71117  1.000 54.73538  ?  129 LEU C C   1 
ATOM   3771 O  O   . LEU C  1 129 ? 38.17720  -26.11049 24.97543  1.000 52.10063  ?  129 LEU C O   1 
ATOM   3772 C  CB  . LEU C  1 129 ? 38.12488  -29.11541 26.34494  1.000 51.08841  ?  129 LEU C CB  1 
ATOM   3773 C  CG  . LEU C  1 129 ? 38.18794  -28.23330 27.59526  1.000 51.66774  ?  129 LEU C CG  1 
ATOM   3774 C  CD1 . LEU C  1 129 ? 36.89239  -27.41483 27.81247  1.000 53.35471  ?  129 LEU C CD1 1 
ATOM   3775 C  CD2 . LEU C  1 129 ? 38.46825  -29.08625 28.79685  1.000 53.25960  ?  129 LEU C CD2 1 
ATOM   3776 N  N   . ALA C  1 130 ? 39.71355  -27.53260 24.11406  1.000 57.45811  ?  130 ALA C N   1 
ATOM   3777 C  CA  . ALA C  1 130 ? 40.60915  -26.44868 23.71002  1.000 58.89161  ?  130 ALA C CA  1 
ATOM   3778 C  C   . ALA C  1 130 ? 39.90641  -25.48146 22.75733  1.000 54.44577  ?  130 ALA C C   1 
ATOM   3779 O  O   . ALA C  1 130 ? 39.97098  -24.26153 22.93149  1.000 52.46349  ?  130 ALA C O   1 
ATOM   3780 C  CB  . ALA C  1 130 ? 41.86809  -27.02369 23.06098  1.000 51.31263  ?  130 ALA C CB  1 
ATOM   3781 N  N   . ASP C  1 131 ? 39.21644  -26.01979 21.74854  1.000 55.08515  ?  131 ASP C N   1 
ATOM   3782 C  CA  . ASP C  1 131 ? 38.59140  -25.18258 20.74029  1.000 53.40308  ?  131 ASP C CA  1 
ATOM   3783 C  C   . ASP C  1 131 ? 37.35964  -24.47300 21.28250  1.000 59.30279  ?  131 ASP C C   1 
ATOM   3784 O  O   . ASP C  1 131 ? 37.05292  -23.35228 20.85530  1.000 54.84149  ?  131 ASP C O   1 
ATOM   3785 C  CB  . ASP C  1 131 ? 38.23784  -26.02867 19.52131  1.000 55.62989  ?  131 ASP C CB  1 
ATOM   3786 C  CG  . ASP C  1 131 ? 37.51944  -25.23541 18.43578  1.000 56.37705  ?  131 ASP C CG  1 
ATOM   3787 O  OD1 . ASP C  1 131 ? 38.09020  -24.25416 17.88643  1.000 52.73938  ?  131 ASP C OD1 1 
ATOM   3788 O  OD2 . ASP C  1 131 ? 36.36788  -25.61905 18.13176  1.000 66.66213  -1 131 ASP C OD2 1 
ATOM   3789 N  N   . PHE C  1 132 ? 36.65663  -25.09194 22.22822  1.000 51.59442  ?  132 PHE C N   1 
ATOM   3790 C  CA  . PHE C  1 132 ? 35.58199  -24.38974 22.91319  1.000 49.92332  ?  132 PHE C CA  1 
ATOM   3791 C  C   . PHE C  1 132 ? 36.11855  -23.16978 23.65719  1.000 49.16785  ?  132 PHE C C   1 
ATOM   3792 O  O   . PHE C  1 132 ? 35.56976  -22.06122 23.54320  1.000 49.72781  ?  132 PHE C O   1 
ATOM   3793 C  CB  . PHE C  1 132 ? 34.87723  -25.34687 23.87256  1.000 50.98375  ?  132 PHE C CB  1 
ATOM   3794 C  CG  . PHE C  1 132 ? 33.86594  -24.68354 24.73978  1.000 50.47126  ?  132 PHE C CG  1 
ATOM   3795 C  CD1 . PHE C  1 132 ? 32.56425  -24.51136 24.29081  1.000 59.37102  ?  132 PHE C CD1 1 
ATOM   3796 C  CD2 . PHE C  1 132 ? 34.21361  -24.21194 25.99265  1.000 56.97694  ?  132 PHE C CD2 1 
ATOM   3797 C  CE1 . PHE C  1 132 ? 31.61763  -23.88711 25.08400  1.000 59.49419  ?  132 PHE C CE1 1 
ATOM   3798 C  CE2 . PHE C  1 132 ? 33.28416  -23.58053 26.79137  1.000 60.18950  ?  132 PHE C CE2 1 
ATOM   3799 C  CZ  . PHE C  1 132 ? 31.98427  -23.41874 26.34160  1.000 59.52787  ?  132 PHE C CZ  1 
ATOM   3800 N  N   . ILE C  1 133 ? 37.17996  -23.36832 24.45022  1.000 49.48149  ?  133 ILE C N   1 
ATOM   3801 C  CA  . ILE C  1 133 ? 37.80568  -22.25162 25.15297  1.000 52.02715  ?  133 ILE C CA  1 
ATOM   3802 C  C   . ILE C  1 133 ? 38.22472  -21.17354 24.16355  1.000 53.33506  ?  133 ILE C C   1 
ATOM   3803 O  O   . ILE C  1 133 ? 37.90382  -19.99794 24.32877  1.000 50.51417  ?  133 ILE C O   1 
ATOM   3804 C  CB  . ILE C  1 133 ? 39.00880  -22.73270 25.97770  1.000 59.81563  ?  133 ILE C CB  1 
ATOM   3805 C  CG1 . ILE C  1 133 ? 38.59886  -23.76700 27.04518  1.000 63.28195  ?  133 ILE C CG1 1 
ATOM   3806 C  CG2 . ILE C  1 133 ? 39.71706  -21.54423 26.60510  1.000 49.25731  ?  133 ILE C CG2 1 
ATOM   3807 C  CD1 . ILE C  1 133 ? 37.80549  -23.19069 28.20632  1.000 61.95306  ?  133 ILE C CD1 1 
ATOM   3808 N  N   . GLU C  1 134 ? 38.90561  -21.55574 23.09168  1.000 54.53562  ?  134 GLU C N   1 
ATOM   3809 C  CA  . GLU C  1 134 ? 39.34224  -20.59886 22.07502  1.000 51.47729  ?  134 GLU C CA  1 
ATOM   3810 C  C   . GLU C  1 134 ? 38.16727  -19.78338 21.57097  1.000 56.27497  ?  134 GLU C C   1 
ATOM   3811 O  O   . GLU C  1 134 ? 38.07338  -18.58349 21.86122  1.000 58.87345  ?  134 GLU C O   1 
ATOM   3812 C  CB  . GLU C  1 134 ? 39.99557  -21.30351 20.87897  1.000 50.99341  ?  134 GLU C CB  1 
ATOM   3813 C  CG  . GLU C  1 134 ? 41.33536  -21.92124 21.18900  1.000 61.30683  ?  134 GLU C CG  1 
ATOM   3814 C  CD  . GLU C  1 134 ? 41.74289  -22.95360 20.15158  1.000 67.32858  ?  134 GLU C CD  1 
ATOM   3815 O  OE1 . GLU C  1 134 ? 42.63917  -23.77582 20.44453  1.000 73.30814  ?  134 GLU C OE1 1 
ATOM   3816 O  OE2 . GLU C  1 134 ? 41.16228  -22.94456 19.04260  1.000 71.22985  -1 134 GLU C OE2 1 
ATOM   3817 N  N   . THR C  1 135 ? 37.22531  -20.49670 20.94274  1.000 49.19994  ?  135 THR C N   1 
ATOM   3818 C  CA  . THR C  1 135 ? 36.13886  -19.91152 20.17063  1.000 46.60116  ?  135 THR C CA  1 
ATOM   3819 C  C   . THR C  1 135 ? 35.21187  -19.05027 21.01682  1.000 48.39640  ?  135 THR C C   1 
ATOM   3820 O  O   . THR C  1 135 ? 34.67385  -18.05326 20.52752  1.000 54.09392  ?  135 THR C O   1 
ATOM   3821 C  CB  . THR C  1 135 ? 35.33851  -21.03583 19.50508  1.000 58.25907  ?  135 THR C CB  1 
ATOM   3822 O  OG1 . THR C  1 135 ? 36.21294  -21.83233 18.69110  1.000 67.92510  ?  135 THR C OG1 1 
ATOM   3823 C  CG2 . THR C  1 135 ? 34.21048  -20.48514 18.65313  1.000 50.00769  ?  135 THR C CG2 1 
ATOM   3824 N  N   . HIS C  1 136 ? 34.99022  -19.41256 22.27818  1.000 47.21907  ?  136 HIS C N   1 
ATOM   3825 C  CA  . HIS C  1 136 ? 33.98188  -18.69825 23.03795  1.000 41.14502  ?  136 HIS C CA  1 
ATOM   3826 C  C   . HIS C  1 136 ? 34.54986  -17.81654 24.12658  1.000 47.72199  ?  136 HIS C C   1 
ATOM   3827 O  O   . HIS C  1 136 ? 33.82817  -16.95768 24.63827  1.000 51.09309  ?  136 HIS C O   1 
ATOM   3828 C  CB  . HIS C  1 136 ? 32.97945  -19.68615 23.63976  1.000 43.73390  ?  136 HIS C CB  1 
ATOM   3829 C  CG  . HIS C  1 136 ? 32.16771  -20.39440 22.59659  1.000 53.31646  ?  136 HIS C CG  1 
ATOM   3830 N  ND1 . HIS C  1 136 ? 32.24643  -21.75757 22.38308  1.000 42.40517  ?  136 HIS C ND1 1 
ATOM   3831 C  CD2 . HIS C  1 136 ? 31.29723  -19.91397 21.67267  1.000 44.40712  ?  136 HIS C CD2 1 
ATOM   3832 C  CE1 . HIS C  1 136 ? 31.44940  -22.08716 21.38221  1.000 48.85716  ?  136 HIS C CE1 1 
ATOM   3833 N  NE2 . HIS C  1 136 ? 30.86622  -20.98571 20.93129  1.000 51.67167  ?  136 HIS C NE2 1 
ATOM   3834 N  N   . TYR C  1 137 ? 35.81885  -17.96152 24.47275  1.000 43.10809  ?  137 TYR C N   1 
ATOM   3835 C  CA  . TYR C  1 137 ? 36.31988  -17.20208 25.59299  1.000 53.30404  ?  137 TYR C CA  1 
ATOM   3836 C  C   . TYR C  1 137 ? 37.56406  -16.40752 25.22260  1.000 57.75804  ?  137 TYR C C   1 
ATOM   3837 O  O   . TYR C  1 137 ? 37.70737  -15.28458 25.70528  1.000 67.86790  ?  137 TYR C O   1 
ATOM   3838 C  CB  . TYR C  1 137 ? 36.59752  -18.15047 26.77064  1.000 62.90681  ?  137 TYR C CB  1 
ATOM   3839 C  CG  . TYR C  1 137 ? 35.31546  -18.57110 27.42229  1.000 58.01067  ?  137 TYR C CG  1 
ATOM   3840 C  CD1 . TYR C  1 137 ? 34.54789  -19.59212 26.88280  1.000 64.01642  ?  137 TYR C CD1 1 
ATOM   3841 C  CD2 . TYR C  1 137 ? 34.84250  -17.91361 28.54814  1.000 64.31221  ?  137 TYR C CD2 1 
ATOM   3842 C  CE1 . TYR C  1 137 ? 33.34162  -19.94911 27.44689  1.000 61.36508  ?  137 TYR C CE1 1 
ATOM   3843 C  CE2 . TYR C  1 137 ? 33.64171  -18.26647 29.12518  1.000 65.61238  ?  137 TYR C CE2 1 
ATOM   3844 C  CZ  . TYR C  1 137 ? 32.89554  -19.28583 28.56758  1.000 64.69275  ?  137 TYR C CZ  1 
ATOM   3845 O  OH  . TYR C  1 137 ? 31.69749  -19.65028 29.12962  1.000 69.06692  ?  137 TYR C OH  1 
ATOM   3846 N  N   . LEU C  1 138 ? 38.46876  -16.95012 24.38839  1.000 49.44841  ?  138 LEU C N   1 
ATOM   3847 C  CA  . LEU C  1 138 ? 39.80492  -16.35830 24.31479  1.000 54.16368  ?  138 LEU C CA  1 
ATOM   3848 C  C   . LEU C  1 138 ? 39.77034  -15.00175 23.62070  1.000 57.13027  ?  138 LEU C C   1 
ATOM   3849 O  O   . LEU C  1 138 ? 40.28435  -14.00509 24.15347  1.000 44.80021  ?  138 LEU C O   1 
ATOM   3850 C  CB  . LEU C  1 138 ? 40.78752  -17.30362 23.61049  1.000 46.18917  ?  138 LEU C CB  1 
ATOM   3851 C  CG  . LEU C  1 138 ? 41.28256  -18.46411 24.47103  1.000 48.21706  ?  138 LEU C CG  1 
ATOM   3852 C  CD1 . LEU C  1 138 ? 42.53482  -19.16215 23.89466  1.000 49.12604  ?  138 LEU C CD1 1 
ATOM   3853 C  CD2 . LEU C  1 138 ? 41.53525  -17.98528 25.90680  1.000 48.82185  ?  138 LEU C CD2 1 
ATOM   3854 N  N   . ASN C  1 139 ? 39.15825  -14.93201 22.43388  1.000 57.69281  ?  139 ASN C N   1 
ATOM   3855 C  CA  . ASN C  1 139 ? 39.13803  -13.63595 21.77012  1.000 60.53962  ?  139 ASN C CA  1 
ATOM   3856 C  C   . ASN C  1 139 ? 38.20178  -12.67109 22.47726  1.000 50.28776  ?  139 ASN C C   1 
ATOM   3857 O  O   . ASN C  1 139 ? 38.44179  -11.46388 22.45179  1.000 54.32835  ?  139 ASN C O   1 
ATOM   3858 C  CB  . ASN C  1 139 ? 38.76455  -13.75532 20.29529  1.000 55.47145  ?  139 ASN C CB  1 
ATOM   3859 C  CG  . ASN C  1 139 ? 39.00038  -12.45643 19.54747  1.000 63.19475  ?  139 ASN C CG  1 
ATOM   3860 O  OD1 . ASN C  1 139 ? 38.07080  -11.86432 19.00132  1.000 62.28897  ?  139 ASN C OD1 1 
ATOM   3861 N  ND2 . ASN C  1 139 ? 40.25074  -11.97285 19.56811  1.000 52.29585  ?  139 ASN C ND2 1 
ATOM   3862 N  N   . GLU C  1 140 ? 37.15922  -13.17254 23.14197  1.000 46.49945  ?  140 GLU C N   1 
ATOM   3863 C  CA  . GLU C  1 140 ? 36.31690  -12.27453 23.92332  1.000 50.42327  ?  140 GLU C CA  1 
ATOM   3864 C  C   . GLU C  1 140 ? 37.10290  -11.67170 25.08173  1.000 55.08367  ?  140 GLU C C   1 
ATOM   3865 O  O   . GLU C  1 140 ? 36.94467  -10.48796 25.39033  1.000 45.76228  ?  140 GLU C O   1 
ATOM   3866 C  CB  . GLU C  1 140 ? 35.06365  -12.99844 24.43007  1.000 51.03940  ?  140 GLU C CB  1 
ATOM   3867 N  N   . GLN C  1 141 ? 37.97317  -12.46275 25.72535  1.000 59.51402  ?  141 GLN C N   1 
ATOM   3868 C  CA  . GLN C  1 141 ? 38.80293  -11.89892 26.78950  1.000 61.18679  ?  141 GLN C CA  1 
ATOM   3869 C  C   . GLN C  1 141 ? 39.78925  -10.88714 26.22951  1.000 53.16212  ?  141 GLN C C   1 
ATOM   3870 O  O   . GLN C  1 141 ? 40.03222  -9.85133  26.85108  1.000 60.24845  ?  141 GLN C O   1 
ATOM   3871 C  CB  . GLN C  1 141 ? 39.54614  -12.98620 27.56937  1.000 54.73995  ?  141 GLN C CB  1 
ATOM   3872 C  CG  . GLN C  1 141 ? 38.66941  -13.73065 28.55540  1.000 65.28512  ?  141 GLN C CG  1 
ATOM   3873 C  CD  . GLN C  1 141 ? 38.25064  -12.88793 29.74985  1.000 64.99984  ?  141 GLN C CD  1 
ATOM   3874 O  OE1 . GLN C  1 141 ? 37.05747  -12.78152 30.06193  1.000 69.92822  ?  141 GLN C OE1 1 
ATOM   3875 N  NE2 . GLN C  1 141 ? 39.22434  -12.30286 30.43327  1.000 56.90075  ?  141 GLN C NE2 1 
ATOM   3876 N  N   . VAL C  1 142 ? 40.35279  -11.15815 25.05269  1.000 44.44379  ?  142 VAL C N   1 
ATOM   3877 C  CA  . VAL C  1 142 ? 41.30415  -10.21192 24.47558  1.000 50.56185  ?  142 VAL C CA  1 
ATOM   3878 C  C   . VAL C  1 142 ? 40.59404  -8.91367  24.08669  1.000 52.27470  ?  142 VAL C C   1 
ATOM   3879 O  O   . VAL C  1 142 ? 41.08432  -7.81266  24.36809  1.000 43.30491  ?  142 VAL C O   1 
ATOM   3880 C  CB  . VAL C  1 142 ? 42.06382  -10.86039 23.29778  1.000 44.46932  ?  142 VAL C CB  1 
ATOM   3881 C  CG1 . VAL C  1 142 ? 42.64784  -9.81343  22.37471  1.000 43.92323  ?  142 VAL C CG1 1 
ATOM   3882 C  CG2 . VAL C  1 142 ? 43.19377  -11.79468 23.84067  1.000 46.23599  ?  142 VAL C CG2 1 
ATOM   3883 N  N   . LYS C  1 143 ? 39.40465  -9.01186  23.49743  1.000 43.56243  ?  143 LYS C N   1 
ATOM   3884 C  CA  . LYS C  1 143 ? 38.66439  -7.79656  23.17100  1.000 45.62844  ?  143 LYS C CA  1 
ATOM   3885 C  C   . LYS C  1 143 ? 38.29040  -7.03144  24.43606  1.000 45.90853  ?  143 LYS C C   1 
ATOM   3886 O  O   . LYS C  1 143 ? 38.40393  -5.79863  24.48096  1.000 43.47448  ?  143 LYS C O   1 
ATOM   3887 C  CB  . LYS C  1 143 ? 37.42162  -8.13696  22.34891  1.000 45.94314  ?  143 LYS C CB  1 
ATOM   3888 C  CG  . LYS C  1 143 ? 37.72810  -8.68655  20.95029  1.000 46.62711  ?  143 LYS C CG  1 
ATOM   3889 C  CD  . LYS C  1 143 ? 36.46894  -9.12741  20.21372  1.000 46.49230  ?  143 LYS C CD  1 
ATOM   3890 N  N   . ALA C  1 144 ? 37.85729  -7.74795  25.48226  1.000 41.68771  ?  144 ALA C N   1 
ATOM   3891 C  CA  . ALA C  1 144 ? 37.50443  -7.09545  26.73838  1.000 42.25793  ?  144 ALA C CA  1 
ATOM   3892 C  C   . ALA C  1 144 ? 38.69890  -6.38340  27.34899  1.000 46.26766  ?  144 ALA C C   1 
ATOM   3893 O  O   . ALA C  1 144 ? 38.58002  -5.23889  27.79669  1.000 53.66641  ?  144 ALA C O   1 
ATOM   3894 C  CB  . ALA C  1 144 ? 36.93688  -8.11734  27.71913  1.000 43.02013  ?  144 ALA C CB  1 
ATOM   3895 N  N   . ILE C  1 145 ? 39.85759  -7.04773  27.38201  1.000 44.52352  ?  145 ILE C N   1 
ATOM   3896 C  CA  . ILE C  1 145 ? 41.05152  -6.45905  27.97951  1.000 45.80168  ?  145 ILE C CA  1 
ATOM   3897 C  C   . ILE C  1 145 ? 41.51507  -5.25126  27.17249  1.000 45.07315  ?  145 ILE C C   1 
ATOM   3898 O  O   . ILE C  1 145 ? 41.91267  -4.23004  27.74501  1.000 45.57320  ?  145 ILE C O   1 
ATOM   3899 C  CB  . ILE C  1 145 ? 42.15178  -7.52775  28.11508  1.000 48.41169  ?  145 ILE C CB  1 
ATOM   3900 C  CG1 . ILE C  1 145 ? 41.78052  -8.52237  29.21698  1.000 53.06766  ?  145 ILE C CG1 1 
ATOM   3901 C  CG2 . ILE C  1 145 ? 43.49785  -6.90702  28.38696  1.000 48.40423  ?  145 ILE C CG2 1 
ATOM   3902 C  CD1 . ILE C  1 145 ? 42.55820  -9.81857  29.12703  1.000 49.26717  ?  145 ILE C CD1 1 
ATOM   3903 N  N   . LYS C  1 146 ? 41.42870  -5.32995  25.83469  1.000 43.89593  ?  146 LYS C N   1 
ATOM   3904 C  CA  . LYS C  1 146 ? 41.79881  -4.19094  25.00023  1.000 50.64104  ?  146 LYS C CA  1 
ATOM   3905 C  C   . LYS C  1 146 ? 40.87765  -3.00521  25.25473  1.000 42.23012  ?  146 LYS C C   1 
ATOM   3906 O  O   . LYS C  1 146 ? 41.34085  -1.86763  25.37659  1.000 47.64699  ?  146 LYS C O   1 
ATOM   3907 C  CB  . LYS C  1 146 ? 41.77647  -4.57231  23.51764  1.000 42.09764  ?  146 LYS C CB  1 
ATOM   3908 C  CG  . LYS C  1 146 ? 41.96615  -3.37155  22.55607  1.000 41.13388  ?  146 LYS C CG  1 
ATOM   3909 C  CD  . LYS C  1 146 ? 43.37798  -2.74851  22.68665  1.000 46.17823  ?  146 LYS C CD  1 
ATOM   3910 C  CE  . LYS C  1 146 ? 43.70132  -1.72357  21.58513  1.000 49.92374  ?  146 LYS C CE  1 
ATOM   3911 N  NZ  . LYS C  1 146 ? 42.74643  -0.53656  21.51691  1.000 40.07745  ?  146 LYS C NZ  1 
ATOM   3912 N  N   . GLU C  1 147 ? 39.57850  -3.25980  25.38571  1.000 41.43530  ?  147 GLU C N   1 
ATOM   3913 C  CA  . GLU C  1 147 ? 38.61771  -2.17572  25.57699  1.000 40.58058  ?  147 GLU C CA  1 
ATOM   3914 C  C   . GLU C  1 147 ? 38.75792  -1.53349  26.95213  1.000 47.02009  ?  147 GLU C C   1 
ATOM   3915 O  O   . GLU C  1 147 ? 38.63843  -0.30390  27.09404  1.000 41.36519  ?  147 GLU C O   1 
ATOM   3916 C  CB  . GLU C  1 147 ? 37.21119  -2.71224  25.38528  1.000 45.09160  ?  147 GLU C CB  1 
ATOM   3917 C  CG  . GLU C  1 147 ? 36.15307  -1.88643  26.09483  1.000 47.48148  ?  147 GLU C CG  1 
ATOM   3918 C  CD  . GLU C  1 147 ? 34.77525  -2.37969  25.78236  1.000 49.86691  ?  147 GLU C CD  1 
ATOM   3919 O  OE1 . GLU C  1 147 ? 34.47844  -2.51426  24.58013  1.000 53.97487  ?  147 GLU C OE1 1 
ATOM   3920 O  OE2 . GLU C  1 147 ? 34.01248  -2.66892  26.73177  1.000 59.51314  -1 147 GLU C OE2 1 
ATOM   3921 N  N   . LEU C  1 148 ? 39.01000  -2.35038  27.97783  1.000 45.14873  ?  148 LEU C N   1 
ATOM   3922 C  CA  . LEU C  1 148 ? 39.26418  -1.80237  29.30287  1.000 46.66937  ?  148 LEU C CA  1 
ATOM   3923 C  C   . LEU C  1 148 ? 40.52831  -0.95102  29.31774  1.000 52.47543  ?  148 LEU C C   1 
ATOM   3924 O  O   . LEU C  1 148 ? 40.53942  0.12752   29.92568  1.000 47.28038  ?  148 LEU C O   1 
ATOM   3925 C  CB  . LEU C  1 148 ? 39.37106  -2.92686  30.32502  1.000 45.62365  ?  148 LEU C CB  1 
ATOM   3926 C  CG  . LEU C  1 148 ? 37.99926  -3.49283  30.66106  1.000 46.38241  ?  148 LEU C CG  1 
ATOM   3927 C  CD1 . LEU C  1 148 ? 38.13968  -4.80491  31.43059  1.000 48.52053  ?  148 LEU C CD1 1 
ATOM   3928 C  CD2 . LEU C  1 148 ? 37.19215  -2.45695  31.42829  1.000 47.51433  ?  148 LEU C CD2 1 
ATOM   3929 N  N   . GLY C  1 149 ? 41.60582  -1.43260  28.67427  1.000 48.15715  ?  149 GLY C N   1 
ATOM   3930 C  CA  . GLY C  1 149 ? 42.82008  -0.63612  28.56555  1.000 47.91833  ?  149 GLY C CA  1 
ATOM   3931 C  C   . GLY C  1 149 ? 42.59632  0.68234   27.84406  1.000 53.97800  ?  149 GLY C C   1 
ATOM   3932 O  O   . GLY C  1 149 ? 43.12407  1.71913   28.25861  1.000 47.43281  ?  149 GLY C O   1 
ATOM   3933 N  N   . ASP C  1 150 ? 41.80970  0.65785   26.75455  1.000 43.12124  ?  150 ASP C N   1 
ATOM   3934 C  CA  . ASP C  1 150 ? 41.40593  1.89196   26.08412  1.000 48.78339  ?  150 ASP C CA  1 
ATOM   3935 C  C   . ASP C  1 150 ? 40.74039  2.84906   27.05987  1.000 46.63367  ?  150 ASP C C   1 
ATOM   3936 O  O   . ASP C  1 150 ? 41.10892  4.02553   27.14657  1.000 48.81253  ?  150 ASP C O   1 
ATOM   3937 C  CB  . ASP C  1 150 ? 40.43595  1.59698   24.93499  1.000 44.22255  ?  150 ASP C CB  1 
ATOM   3938 C  CG  . ASP C  1 150 ? 41.13208  1.11438   23.67554  1.000 53.47544  ?  150 ASP C CG  1 
ATOM   3939 O  OD1 . ASP C  1 150 ? 42.31060  0.68009   23.75257  1.000 49.47911  ?  150 ASP C OD1 1 
ATOM   3940 O  OD2 . ASP C  1 150 ? 40.48411  1.16309   22.60155  1.000 58.27224  -1 150 ASP C OD2 1 
ATOM   3941 N  N   . HIS C  1 151 ? 39.71879  2.36900   27.76916  1.000 43.37651  ?  151 HIS C N   1 
ATOM   3942 C  CA  . HIS C  1 151 ? 39.01881  3.23270   28.71410  1.000 42.20633  ?  151 HIS C CA  1 
ATOM   3943 C  C   . HIS C  1 151 ? 39.97467  3.78966   29.76380  1.000 50.51043  ?  151 HIS C C   1 
ATOM   3944 O  O   . HIS C  1 151 ? 39.88695  4.96696   30.13690  1.000 54.39858  ?  151 HIS C O   1 
ATOM   3945 C  CB  . HIS C  1 151 ? 37.87251  2.46359   29.37901  1.000 42.35127  ?  151 HIS C CB  1 
ATOM   3946 C  CG  . HIS C  1 151 ? 36.77609  2.07847   28.43495  1.000 46.01286  ?  151 HIS C CG  1 
ATOM   3947 N  ND1 . HIS C  1 151 ? 36.70280  2.56394   27.14367  1.000 45.09817  ?  151 HIS C ND1 1 
ATOM   3948 C  CD2 . HIS C  1 151 ? 35.70005  1.26988   28.59742  1.000 40.53411  ?  151 HIS C CD2 1 
ATOM   3949 C  CE1 . HIS C  1 151 ? 35.63405  2.05561   26.54794  1.000 43.51803  ?  151 HIS C CE1 1 
ATOM   3950 N  NE2 . HIS C  1 151 ? 35.00012  1.28424   27.41331  1.000 41.70556  ?  151 HIS C NE2 1 
ATOM   3951 N  N   . VAL C  1 152 ? 40.89070  2.95551   30.25992  1.000 47.75104  ?  152 VAL C N   1 
ATOM   3952 C  CA  . VAL C  1 152 ? 41.79954  3.40147   31.30927  1.000 49.10508  ?  152 VAL C CA  1 
ATOM   3953 C  C   . VAL C  1 152 ? 42.66482  4.53950   30.78635  1.000 50.47669  ?  152 VAL C C   1 
ATOM   3954 O  O   . VAL C  1 152 ? 42.79810  5.59384   31.42108  1.000 55.32387  ?  152 VAL C O   1 
ATOM   3955 C  CB  . VAL C  1 152 ? 42.64610  2.21941   31.81802  1.000 49.35226  ?  152 VAL C CB  1 
ATOM   3956 C  CG1 . VAL C  1 152 ? 43.85007  2.72518   32.63602  1.000 50.01593  ?  152 VAL C CG1 1 
ATOM   3957 C  CG2 . VAL C  1 152 ? 41.80530  1.27910   32.64971  1.000 48.74115  ?  152 VAL C CG2 1 
ATOM   3958 N  N   . THR C  1 153 ? 43.22842  4.34557   29.59202  1.000 53.63719  ?  153 THR C N   1 
ATOM   3959 C  CA  . THR C  1 153 ? 44.02396  5.37004   28.93188  1.000 45.62658  ?  153 THR C CA  1 
ATOM   3960 C  C   . THR C  1 153 ? 43.23446  6.66830   28.76457  1.000 50.27432  ?  153 THR C C   1 
ATOM   3961 O  O   . THR C  1 153 ? 43.71053  7.74841   29.12433  1.000 60.88056  ?  153 THR C O   1 
ATOM   3962 C  CB  . THR C  1 153 ? 44.50676  4.82063   27.58658  1.000 44.88748  ?  153 THR C CB  1 
ATOM   3963 O  OG1 . THR C  1 153 ? 45.39596  3.71149   27.82866  1.000 46.19194  ?  153 THR C OG1 1 
ATOM   3964 C  CG2 . THR C  1 153 ? 45.23045  5.89424   26.76685  1.000 44.44616  ?  153 THR C CG2 1 
ATOM   3965 N  N   . ASN C  1 154 ? 42.01783  6.58571   28.23549  1.000 44.17913  ?  154 ASN C N   1 
ATOM   3966 C  CA  . ASN C  1 154 ? 41.24285  7.79917   28.00443  1.000 41.99419  ?  154 ASN C CA  1 
ATOM   3967 C  C   . ASN C  1 154 ? 40.94898  8.53769   29.31077  1.000 46.56249  ?  154 ASN C C   1 
ATOM   3968 O  O   . ASN C  1 154 ? 41.13903  9.75787   29.40991  1.000 43.81629  ?  154 ASN C O   1 
ATOM   3969 C  CB  . ASN C  1 154 ? 39.95821  7.45146   27.26736  1.000 40.48876  ?  154 ASN C CB  1 
ATOM   3970 C  CG  . ASN C  1 154 ? 40.16735  7.35502   25.79390  1.000 40.77648  ?  154 ASN C CG  1 
ATOM   3971 O  OD1 . ASN C  1 154 ? 40.46864  8.34814   25.14083  1.000 47.29379  ?  154 ASN C OD1 1 
ATOM   3972 N  ND2 . ASN C  1 154 ? 40.00094  6.16058   25.24729  1.000 48.14244  ?  154 ASN C ND2 1 
ATOM   3973 N  N   . LEU C  1 155 ? 40.50094  7.81390   30.33368  1.000 50.32212  ?  155 LEU C N   1 
ATOM   3974 C  CA  . LEU C  1 155 ? 40.24181  8.46695   31.60892  1.000 44.81989  ?  155 LEU C CA  1 
ATOM   3975 C  C   . LEU C  1 155 ? 41.48853  9.15122   32.13059  1.000 55.29344  ?  155 LEU C C   1 
ATOM   3976 O  O   . LEU C  1 155 ? 41.41790  10.27061  32.65438  1.000 60.68970  ?  155 LEU C O   1 
ATOM   3977 C  CB  . LEU C  1 155 ? 39.72369  7.45615   32.62011  1.000 45.77565  ?  155 LEU C CB  1 
ATOM   3978 C  CG  . LEU C  1 155 ? 38.28004  7.05906   32.31237  1.000 45.34233  ?  155 LEU C CG  1 
ATOM   3979 C  CD1 . LEU C  1 155 ? 37.92256  5.78416   33.03712  1.000 47.50622  ?  155 LEU C CD1 1 
ATOM   3980 C  CD2 . LEU C  1 155 ? 37.32728  8.19485   32.67579  1.000 44.18388  ?  155 LEU C CD2 1 
ATOM   3981 N  N   . ARG C  1 156 ? 42.64727  8.50191   31.98162  1.000 60.76308  ?  156 ARG C N   1 
ATOM   3982 C  CA  . ARG C  1 156 ? 43.87814  9.07457   32.52313  1.000 60.30731  ?  156 ARG C CA  1 
ATOM   3983 C  C   . ARG C  1 156 ? 44.30618  10.31405  31.74625  1.000 51.20452  ?  156 ARG C C   1 
ATOM   3984 O  O   . ARG C  1 156 ? 44.67786  11.32533  32.34764  1.000 60.24209  ?  156 ARG C O   1 
ATOM   3985 C  CB  . ARG C  1 156 ? 44.98761  8.02461   32.53110  1.000 49.54083  ?  156 ARG C CB  1 
ATOM   3986 C  CG  . ARG C  1 156 ? 45.22963  7.46535   33.90632  1.000 58.67863  ?  156 ARG C CG  1 
ATOM   3987 C  CD  . ARG C  1 156 ? 46.32035  6.38971   33.92712  1.000 63.87259  ?  156 ARG C CD  1 
ATOM   3988 N  NE  . ARG C  1 156 ? 46.10849  5.43055   35.01844  1.000 69.61108  ?  156 ARG C NE  1 
ATOM   3989 C  CZ  . ARG C  1 156 ? 46.28676  5.70621   36.31789  1.000 78.59226  ?  156 ARG C CZ  1 
ATOM   3990 N  NH1 . ARG C  1 156 ? 46.69985  6.91745   36.71129  1.000 79.82046  ?  156 ARG C NH1 1 
ATOM   3991 N  NH2 . ARG C  1 156 ? 46.06049  4.76632   37.23625  1.000 74.85704  ?  156 ARG C NH2 1 
ATOM   3992 N  N   . CYS C  1 157 ? 44.25916  10.25660  30.41454  1.000 50.43396  ?  157 CYS C N   1 
ATOM   3993 C  CA  . CYS C  1 157 ? 44.61093  11.42611  29.62101  1.000 63.80681  ?  157 CYS C CA  1 
ATOM   3994 C  C   . CYS C  1 157 ? 43.68346  12.60355  29.91675  1.000 58.68656  ?  157 CYS C C   1 
ATOM   3995 O  O   . CYS C  1 157 ? 44.15850  13.73547  30.03394  1.000 57.17881  ?  157 CYS C O   1 
ATOM   3996 C  CB  . CYS C  1 157 ? 44.61404  11.07322  28.13049  1.000 64.18532  ?  157 CYS C CB  1 
ATOM   3997 S  SG  . CYS C  1 157 ? 45.96404  9.92981   27.68183  1.000 83.56763  ?  157 CYS C SG  1 
ATOM   3998 N  N   . MET C  1 158 ? 42.38104  12.35353  30.10837  1.000 56.79250  ?  158 MET C N   1 
ATOM   3999 C  CA  . MET C  1 158 ? 41.43255  13.41779  30.42133  1.000 55.60563  ?  158 MET C CA  1 
ATOM   4000 C  C   . MET C  1 158 ? 41.63706  14.05084  31.79511  1.000 68.17923  ?  158 MET C C   1 
ATOM   4001 O  O   . MET C  1 158 ? 40.92403  15.00657  32.11627  1.000 76.32726  ?  158 MET C O   1 
ATOM   4002 C  CB  . MET C  1 158 ? 40.00275  12.90315  30.35556  1.000 52.01149  ?  158 MET C CB  1 
ATOM   4003 C  CG  . MET C  1 158 ? 39.56261  12.48330  28.98214  1.000 60.33437  ?  158 MET C CG  1 
ATOM   4004 S  SD  . MET C  1 158 ? 38.15309  11.35386  29.03845  1.000 52.53712  ?  158 MET C SD  1 
ATOM   4005 C  CE  . MET C  1 158 ? 36.80617  12.52517  29.19155  1.000 42.47114  ?  158 MET C CE  1 
ATOM   4006 N  N   . GLY C  1 159 ? 42.55180  13.55756  32.61831  1.000 58.92184  ?  159 GLY C N   1 
ATOM   4007 C  CA  . GLY C  1 159 ? 42.72344  14.11125  33.94384  1.000 62.70173  ?  159 GLY C CA  1 
ATOM   4008 C  C   . GLY C  1 159 ? 41.94348  13.44383  35.06155  1.000 68.32061  ?  159 GLY C C   1 
ATOM   4009 O  O   . GLY C  1 159 ? 41.89627  13.99337  36.17095  1.000 70.96020  ?  159 GLY C O   1 
ATOM   4010 N  N   . ALA C  1 160 ? 41.33823  12.28334  34.81756  1.000 66.50284  ?  160 ALA C N   1 
ATOM   4011 C  CA  . ALA C  1 160 ? 40.72361  11.52947  35.90142  1.000 68.71880  ?  160 ALA C CA  1 
ATOM   4012 C  C   . ALA C  1 160 ? 41.80649  10.96605  36.82760  1.000 72.69517  ?  160 ALA C C   1 
ATOM   4013 O  O   . ALA C  1 160 ? 42.95437  10.79008  36.41085  1.000 69.75536  ?  160 ALA C O   1 
ATOM   4014 C  CB  . ALA C  1 160 ? 39.86236  10.39310  35.34266  1.000 61.00745  ?  160 ALA C CB  1 
ATOM   4015 N  N   . PRO C  1 161 ? 41.46945  10.68109  38.10562  1.000 85.79036  ?  161 PRO C N   1 
ATOM   4016 C  CA  . PRO C  1 161 ? 40.17409  10.90480  38.76500  1.000 88.66253  ?  161 PRO C CA  1 
ATOM   4017 C  C   . PRO C  1 161 ? 40.06139  12.28555  39.40793  1.000 91.10577  ?  161 PRO C C   1 
ATOM   4018 O  O   . PRO C  1 161 ? 38.95313  12.69551  39.77062  1.000 87.03122  ?  161 PRO C O   1 
ATOM   4019 C  CB  . PRO C  1 161 ? 40.13731  9.80848   39.83163  1.000 88.81703  ?  161 PRO C CB  1 
ATOM   4020 C  CG  . PRO C  1 161 ? 41.56172  9.64802   40.22511  1.000 91.37189  ?  161 PRO C CG  1 
ATOM   4021 C  CD  . PRO C  1 161 ? 42.40500  9.96721   38.99627  1.000 92.81201  ?  161 PRO C CD  1 
ATOM   4022 N  N   . GLU C  1 162 ? 41.19875  12.98262  39.54219  1.000 87.90912  ?  162 GLU C N   1 
ATOM   4023 C  CA  . GLU C  1 162 ? 41.18202  14.33678  40.08577  1.000 86.08258  ?  162 GLU C CA  1 
ATOM   4024 C  C   . GLU C  1 162 ? 40.19894  15.22646  39.33530  1.000 79.00982  ?  162 GLU C C   1 
ATOM   4025 O  O   . GLU C  1 162 ? 39.63239  16.15752  39.91952  1.000 81.09975  ?  162 GLU C O   1 
ATOM   4026 C  CB  . GLU C  1 162 ? 42.58849  14.93892  40.04768  1.000 81.85226  ?  162 GLU C CB  1 
ATOM   4027 N  N   . SER C  1 163 ? 39.97983  14.95832  38.05420  1.000 66.73459  ?  163 SER C N   1 
ATOM   4028 C  CA  . SER C  1 163 ? 38.99285  15.68404  37.25730  1.000 65.58929  ?  163 SER C CA  1 
ATOM   4029 C  C   . SER C  1 163 ? 37.69448  14.88913  37.25005  1.000 64.56625  ?  163 SER C C   1 
ATOM   4030 O  O   . SER C  1 163 ? 37.56940  13.89183  36.53426  1.000 65.80127  ?  163 SER C O   1 
ATOM   4031 C  CB  . SER C  1 163 ? 39.48670  15.91792  35.83454  1.000 63.08251  ?  163 SER C CB  1 
ATOM   4032 O  OG  . SER C  1 163 ? 38.62843  16.81450  35.15273  1.000 61.38250  ?  163 SER C OG  1 
ATOM   4033 N  N   . GLY C  1 164 ? 36.72158  15.33995  38.04583  1.000 67.47681  ?  164 GLY C N   1 
ATOM   4034 C  CA  . GLY C  1 164 ? 35.38302  14.77948  37.95822  1.000 62.61485  ?  164 GLY C CA  1 
ATOM   4035 C  C   . GLY C  1 164 ? 34.67322  15.16602  36.67650  1.000 60.07067  ?  164 GLY C C   1 
ATOM   4036 O  O   . GLY C  1 164 ? 33.80240  14.42602  36.18935  1.000 51.97615  ?  164 GLY C O   1 
ATOM   4037 N  N   . LEU C  1 165 ? 35.03578  16.32002  36.10965  1.000 54.39701  ?  165 LEU C N   1 
ATOM   4038 C  CA  . LEU C  1 165 ? 34.54605  16.67627  34.78253  1.000 61.29497  ?  165 LEU C CA  1 
ATOM   4039 C  C   . LEU C  1 165 ? 34.97544  15.64260  33.74445  1.000 55.16341  ?  165 LEU C C   1 
ATOM   4040 O  O   . LEU C  1 165 ? 34.21188  15.31141  32.83022  1.000 47.38872  ?  165 LEU C O   1 
ATOM   4041 C  CB  . LEU C  1 165 ? 35.04507  18.07502  34.39897  1.000 54.01200  ?  165 LEU C CB  1 
ATOM   4042 C  CG  . LEU C  1 165 ? 34.66137  18.51474  32.98198  1.000 53.78671  ?  165 LEU C CG  1 
ATOM   4043 C  CD1 . LEU C  1 165 ? 33.17017  18.85759  32.91382  1.000 56.42993  ?  165 LEU C CD1 1 
ATOM   4044 C  CD2 . LEU C  1 165 ? 35.48934  19.69751  32.54088  1.000 55.00929  ?  165 LEU C CD2 1 
ATOM   4045 N  N   . ALA C  1 166 ? 36.19884  15.11858  33.87912  1.000 63.04068  ?  166 ALA C N   1 
ATOM   4046 C  CA  . ALA C  1 166 ? 36.68165  14.08710  32.96807  1.000 57.26002  ?  166 ALA C CA  1 
ATOM   4047 C  C   . ALA C  1 166 ? 35.78962  12.85589  33.01711  1.000 52.51907  ?  166 ALA C C   1 
ATOM   4048 O  O   . ALA C  1 166 ? 35.40776  12.30963  31.97674  1.000 53.60160  ?  166 ALA C O   1 
ATOM   4049 C  CB  . ALA C  1 166 ? 38.12348  13.71026  33.31639  1.000 50.90870  ?  166 ALA C CB  1 
ATOM   4050 N  N   . GLU C  1 167 ? 35.46179  12.39466  34.22620  1.000 54.25949  ?  167 GLU C N   1 
ATOM   4051 C  CA  . GLU C  1 167 ? 34.65258  11.19008  34.36527  1.000 48.68427  ?  167 GLU C CA  1 
ATOM   4052 C  C   . GLU C  1 167 ? 33.24722  11.42459  33.84495  1.000 58.58872  ?  167 GLU C C   1 
ATOM   4053 O  O   . GLU C  1 167 ? 32.67618  10.55638  33.16578  1.000 52.37083  ?  167 GLU C O   1 
ATOM   4054 C  CB  . GLU C  1 167 ? 34.61796  10.73747  35.82324  1.000 48.81624  ?  167 GLU C CB  1 
ATOM   4055 C  CG  . GLU C  1 167 ? 35.98829  10.40690  36.38091  1.000 56.87077  ?  167 GLU C CG  1 
ATOM   4056 C  CD  . GLU C  1 167 ? 35.94962  9.26187   37.39598  1.000 68.74271  ?  167 GLU C CD  1 
ATOM   4057 O  OE1 . GLU C  1 167 ? 34.94729  9.14000   38.13587  1.000 70.55747  ?  167 GLU C OE1 1 
ATOM   4058 O  OE2 . GLU C  1 167 ? 36.91645  8.47278   37.44428  1.000 68.65074  -1 167 GLU C OE2 1 
ATOM   4059 N  N   . TYR C  1 168 ? 32.68863  12.60497  34.13849  1.000 54.57025  ?  168 TYR C N   1 
ATOM   4060 C  CA  . TYR C  1 168 ? 31.36732  12.95876  33.63769  1.000 45.40901  ?  168 TYR C CA  1 
ATOM   4061 C  C   . TYR C  1 168 ? 31.33993  12.93733  32.11484  1.000 53.24353  ?  168 TYR C C   1 
ATOM   4062 O  O   . TYR C  1 168 ? 30.47888  12.28995  31.50239  1.000 64.77024  ?  168 TYR C O   1 
ATOM   4063 C  CB  . TYR C  1 168 ? 30.96914  14.33559  34.17775  1.000 49.52016  ?  168 TYR C CB  1 
ATOM   4064 C  CG  . TYR C  1 168 ? 29.66601  14.87781  33.64058  1.000 45.79846  ?  168 TYR C CG  1 
ATOM   4065 C  CD1 . TYR C  1 168 ? 29.62583  15.57998  32.44530  1.000 45.34599  ?  168 TYR C CD1 1 
ATOM   4066 C  CD2 . TYR C  1 168 ? 28.48122  14.71078  34.34291  1.000 50.80331  ?  168 TYR C CD2 1 
ATOM   4067 C  CE1 . TYR C  1 168 ? 28.43269  16.08004  31.94871  1.000 47.36839  ?  168 TYR C CE1 1 
ATOM   4068 C  CE2 . TYR C  1 168 ? 27.28152  15.20811  33.85673  1.000 49.92441  ?  168 TYR C CE2 1 
ATOM   4069 C  CZ  . TYR C  1 168 ? 27.26653  15.89721  32.66014  1.000 48.40489  ?  168 TYR C CZ  1 
ATOM   4070 O  OH  . TYR C  1 168 ? 26.08688  16.40261  32.16199  1.000 55.03094  ?  168 TYR C OH  1 
ATOM   4071 N  N   . LEU C  1 169 ? 32.27862  13.63922  31.47730  1.000 53.46023  ?  169 LEU C N   1 
ATOM   4072 C  CA  . LEU C  1 169 ? 32.26859  13.67343  30.01805  1.000 44.62308  ?  169 LEU C CA  1 
ATOM   4073 C  C   . LEU C  1 169 ? 32.54215  12.29735  29.41577  1.000 42.30714  ?  169 LEU C C   1 
ATOM   4074 O  O   . LEU C  1 169 ? 31.94072  11.96391  28.39996  1.000 44.12598  ?  169 LEU C O   1 
ATOM   4075 C  CB  . LEU C  1 169 ? 33.26521  14.71010  29.50310  1.000 43.82381  ?  169 LEU C CB  1 
ATOM   4076 C  CG  . LEU C  1 169 ? 32.91299  16.15794  29.88653  1.000 54.72626  ?  169 LEU C CG  1 
ATOM   4077 C  CD1 . LEU C  1 169 ? 34.00188  17.14294  29.48096  1.000 46.82902  ?  169 LEU C CD1 1 
ATOM   4078 C  CD2 . LEU C  1 169 ? 31.56982  16.58076  29.29692  1.000 44.45812  ?  169 LEU C CD2 1 
ATOM   4079 N  N   . PHE C  1 170 ? 33.43344  11.48597  30.01233  1.000 41.93584  ?  170 PHE C N   1 
ATOM   4080 C  CA  . PHE C  1 170 ? 33.65673  10.12831  29.51171  1.000 37.72776  ?  170 PHE C CA  1 
ATOM   4081 C  C   . PHE C  1 170 ? 32.38008  9.30001   29.58950  1.000 47.23548  ?  170 PHE C C   1 
ATOM   4082 O  O   . PHE C  1 170 ? 32.00865  8.61326   28.62637  1.000 47.35640  ?  170 PHE C O   1 
ATOM   4083 C  CB  . PHE C  1 170 ? 34.76353  9.45268   30.31572  1.000 43.38106  ?  170 PHE C CB  1 
ATOM   4084 C  CG  . PHE C  1 170 ? 35.14426  8.07339   29.81008  1.000 41.75545  ?  170 PHE C CG  1 
ATOM   4085 C  CD1 . PHE C  1 170 ? 36.03824  7.93032   28.75085  1.000 39.88405  ?  170 PHE C CD1 1 
ATOM   4086 C  CD2 . PHE C  1 170 ? 34.62232  6.92347   30.40280  1.000 39.58751  ?  170 PHE C CD2 1 
ATOM   4087 C  CE1 . PHE C  1 170 ? 36.40597  6.68633   28.29393  1.000 36.56653  ?  170 PHE C CE1 1 
ATOM   4088 C  CE2 . PHE C  1 170 ? 34.97710  5.66564   29.94247  1.000 37.51637  ?  170 PHE C CE2 1 
ATOM   4089 C  CZ  . PHE C  1 170 ? 35.87030  5.55108   28.89143  1.000 45.14838  ?  170 PHE C CZ  1 
ATOM   4090 N  N   . ASP C  1 171 ? 31.70870  9.35162   30.74172  1.000 46.63241  ?  171 ASP C N   1 
ATOM   4091 C  CA  . ASP C  1 171 ? 30.40785  8.72516   30.91872  1.000 45.35965  ?  171 ASP C CA  1 
ATOM   4092 C  C   . ASP C  1 171 ? 29.43666  9.15176   29.81445  1.000 53.05461  ?  171 ASP C C   1 
ATOM   4093 O  O   . ASP C  1 171 ? 28.71529  8.31956   29.24900  1.000 46.78193  ?  171 ASP C O   1 
ATOM   4094 C  CB  . ASP C  1 171 ? 29.89299  9.09745   32.31696  1.000 45.72009  ?  171 ASP C CB  1 
ATOM   4095 C  CG  . ASP C  1 171 ? 28.52394  8.54269   32.61185  1.000 53.50848  ?  171 ASP C CG  1 
ATOM   4096 O  OD1 . ASP C  1 171 ? 27.53089  9.24492   32.31950  1.000 57.32054  ?  171 ASP C OD1 1 
ATOM   4097 O  OD2 . ASP C  1 171 ? 28.44426  7.40821   33.13932  1.000 51.31650  -1 171 ASP C OD2 1 
ATOM   4098 N  N   . LYS C  1 172 ? 29.44555  10.44086  29.46133  1.000 43.41324  ?  172 LYS C N   1 
ATOM   4099 C  CA  . LYS C  1 172 ? 28.52328  10.93845  28.44309  1.000 46.31923  ?  172 LYS C CA  1 
ATOM   4100 C  C   . LYS C  1 172 ? 28.93231  10.49695  27.03368  1.000 42.22555  ?  172 LYS C C   1 
ATOM   4101 O  O   . LYS C  1 172 ? 28.08941  10.05639  26.24456  1.000 42.93032  ?  172 LYS C O   1 
ATOM   4102 C  CB  . LYS C  1 172 ? 28.41809  12.47333  28.53934  1.000 39.69001  ?  172 LYS C CB  1 
ATOM   4103 C  CG  . LYS C  1 172 ? 27.75190  12.97993  29.83598  1.000 42.87143  ?  172 LYS C CG  1 
ATOM   4104 C  CD  . LYS C  1 172 ? 26.34076  12.37556  29.96338  1.000 50.25319  ?  172 LYS C CD  1 
ATOM   4105 C  CE  . LYS C  1 172 ? 25.49025  13.00059  31.06362  1.000 50.87457  ?  172 LYS C CE  1 
ATOM   4106 N  NZ  . LYS C  1 172 ? 24.07707  12.48249  31.06093  1.000 58.88578  ?  172 LYS C NZ  1 
ATOM   4107 N  N   . HIS C  1 173 ? 30.21902  10.57835  26.70774  1.000 43.99446  ?  173 HIS C N   1 
ATOM   4108 C  CA  . HIS C  1 173 ? 30.72102  10.48384  25.33719  1.000 43.90953  ?  173 HIS C CA  1 
ATOM   4109 C  C   . HIS C  1 173 ? 31.16515  9.08407   24.94317  1.000 37.55608  ?  173 HIS C C   1 
ATOM   4110 O  O   . HIS C  1 173 ? 30.90404  8.65174   23.81812  1.000 40.97593  ?  173 HIS C O   1 
ATOM   4111 C  CB  . HIS C  1 173 ? 31.91052  11.42725  25.14405  1.000 47.61600  ?  173 HIS C CB  1 
ATOM   4112 C  CG  . HIS C  1 173 ? 31.52367  12.85463  24.99482  1.000 47.59754  ?  173 HIS C CG  1 
ATOM   4113 N  ND1 . HIS C  1 173 ? 30.90343  13.33714  23.86498  1.000 50.51371  ?  173 HIS C ND1 1 
ATOM   4114 C  CD2 . HIS C  1 173 ? 31.66122  13.90587  25.83387  1.000 47.48425  ?  173 HIS C CD2 1 
ATOM   4115 C  CE1 . HIS C  1 173 ? 30.67844  14.62975  24.01550  1.000 54.87018  ?  173 HIS C CE1 1 
ATOM   4116 N  NE2 . HIS C  1 173 ? 31.12831  14.99751  25.20076  1.000 48.18496  ?  173 HIS C NE2 1 
ATOM   4117 N  N   . THR C  1 174 ? 31.89109  8.39026   25.81719  1.000 33.68448  ?  174 THR C N   1 
ATOM   4118 C  CA  . THR C  1 174 ? 32.31358  7.04626   25.43825  1.000 45.57211  ?  174 THR C CA  1 
ATOM   4119 C  C   . THR C  1 174 ? 31.28977  6.00062   25.84989  1.000 37.66413  ?  174 THR C C   1 
ATOM   4120 O  O   . THR C  1 174 ? 30.90604  5.15674   25.04125  1.000 40.39713  ?  174 THR C O   1 
ATOM   4121 C  CB  . THR C  1 174 ? 33.67897  6.70754   26.04916  1.000 47.71523  ?  174 THR C CB  1 
ATOM   4122 O  OG1 . THR C  1 174 ? 34.66572  7.62333   25.55756  1.000 38.77539  ?  174 THR C OG1 1 
ATOM   4123 C  CG2 . THR C  1 174 ? 34.07640  5.24860   25.72139  1.000 41.08811  ?  174 THR C CG2 1 
ATOM   4124 N  N   . LEU C  1 175 ? 30.83688  6.05330   27.09293  1.000 40.13085  ?  175 LEU C N   1 
ATOM   4125 C  CA  . LEU C  1 175 ? 29.87882  5.09503   27.60890  1.000 46.04726  ?  175 LEU C CA  1 
ATOM   4126 C  C   . LEU C  1 175 ? 28.43418  5.43883   27.24039  1.000 51.64430  ?  175 LEU C C   1 
ATOM   4127 O  O   . LEU C  1 175 ? 27.52617  4.68280   27.59201  1.000 47.08643  ?  175 LEU C O   1 
ATOM   4128 C  CB  . LEU C  1 175 ? 30.03871  5.00390   29.12671  1.000 39.85717  ?  175 LEU C CB  1 
ATOM   4129 C  CG  . LEU C  1 175 ? 31.43457  4.62214   29.62694  1.000 42.03264  ?  175 LEU C CG  1 
ATOM   4130 C  CD1 . LEU C  1 175 ? 31.39188  4.23394   31.08235  1.000 44.10640  ?  175 LEU C CD1 1 
ATOM   4131 C  CD2 . LEU C  1 175 ? 32.03979  3.47807   28.80692  1.000 44.52281  ?  175 LEU C CD2 1 
ATOM   4132 N  N   . GLY C  1 176 ? 28.20157  6.55535   26.55507  1.000 54.85728  ?  176 GLY C N   1 
ATOM   4133 C  CA  . GLY C  1 176 ? 26.87494  6.94399   26.11638  1.000 47.56780  ?  176 GLY C CA  1 
ATOM   4134 C  C   . GLY C  1 176 ? 26.40778  6.21716   24.87372  1.000 58.52052  ?  176 GLY C C   1 
ATOM   4135 O  O   . GLY C  1 176 ? 25.22031  6.27703   24.52985  1.000 67.39747  ?  176 GLY C O   1 
ATOM   4136 N  N   . THR D  1 5   ? -22.94884 17.32183  56.16050  1.000 92.73153  ?  5   THR D N   1 
ATOM   4137 C  CA  . THR D  1 5   ? -22.19157 16.10931  55.87915  1.000 91.18695  ?  5   THR D CA  1 
ATOM   4138 C  C   . THR D  1 5   ? -22.36872 15.71617  54.41005  1.000 93.40649  ?  5   THR D C   1 
ATOM   4139 O  O   . THR D  1 5   ? -23.47212 15.83698  53.86200  1.000 98.25771  ?  5   THR D O   1 
ATOM   4140 C  CB  . THR D  1 5   ? -22.63256 14.93768  56.79060  1.000 93.30289  ?  5   THR D CB  1 
ATOM   4141 O  OG1 . THR D  1 5   ? -24.01124 14.63515  56.55015  1.000 96.11865  ?  5   THR D OG1 1 
ATOM   4142 C  CG2 . THR D  1 5   ? -22.45528 15.29533  58.26310  1.000 90.65989  ?  5   THR D CG2 1 
ATOM   4143 N  N   . SER D  1 6   ? -21.28579 15.26026  53.77497  1.000 81.89677  ?  6   SER D N   1 
ATOM   4144 C  CA  . SER D  1 6   ? -21.35079 14.81559  52.38715  1.000 80.57279  ?  6   SER D CA  1 
ATOM   4145 C  C   . SER D  1 6   ? -22.16662 13.53301  52.26143  1.000 78.83907  ?  6   SER D C   1 
ATOM   4146 O  O   . SER D  1 6   ? -22.28354 12.73830  53.19731  1.000 84.34273  ?  6   SER D O   1 
ATOM   4147 C  CB  . SER D  1 6   ? -19.95413 14.55740  51.81572  1.000 81.05268  ?  6   SER D CB  1 
ATOM   4148 O  OG  . SER D  1 6   ? -19.19994 15.74358  51.66033  1.000 85.27363  ?  6   SER D OG  1 
ATOM   4149 N  N   . GLN D  1 7   ? -22.73156 13.33158  51.07576  1.000 70.36515  ?  7   GLN D N   1 
ATOM   4150 C  CA  . GLN D  1 7   ? -23.34924 12.04972  50.77194  1.000 69.85660  ?  7   GLN D CA  1 
ATOM   4151 C  C   . GLN D  1 7   ? -22.31352 10.98203  50.43496  1.000 72.71979  ?  7   GLN D C   1 
ATOM   4152 O  O   . GLN D  1 7   ? -22.65385 9.79275   50.40033  1.000 73.67408  ?  7   GLN D O   1 
ATOM   4153 C  CB  . GLN D  1 7   ? -24.30747 12.20127  49.59699  1.000 65.66402  ?  7   GLN D CB  1 
ATOM   4154 C  CG  . GLN D  1 7   ? -23.59010 12.80821  48.41321  1.000 62.22117  ?  7   GLN D CG  1 
ATOM   4155 C  CD  . GLN D  1 7   ? -24.45892 12.94670  47.20781  1.000 63.03648  ?  7   GLN D CD  1 
ATOM   4156 O  OE1 . GLN D  1 7   ? -25.54575 12.37470  47.14091  1.000 66.96654  ?  7   GLN D OE1 1 
ATOM   4157 N  NE2 . GLN D  1 7   ? -23.99392 13.72387  46.23801  1.000 60.10819  ?  7   GLN D NE2 1 
ATOM   4158 N  N   . VAL D  1 8   ? -21.06883 11.37853  50.15907  1.000 67.20056  ?  8   VAL D N   1 
ATOM   4159 C  CA  . VAL D  1 8   ? -20.01377 10.42942  49.81678  1.000 65.99888  ?  8   VAL D CA  1 
ATOM   4160 C  C   . VAL D  1 8   ? -18.96879 10.29882  50.91034  1.000 65.58312  ?  8   VAL D C   1 
ATOM   4161 O  O   . VAL D  1 8   ? -18.11959 9.39531   50.82806  1.000 73.80165  ?  8   VAL D O   1 
ATOM   4162 C  CB  . VAL D  1 8   ? -19.32368 10.78727  48.47767  1.000 60.83900  ?  8   VAL D CB  1 
ATOM   4163 C  CG1 . VAL D  1 8   ? -20.29835 10.67651  47.31517  1.000 59.77746  ?  8   VAL D CG1 1 
ATOM   4164 C  CG2 . VAL D  1 8   ? -18.68928 12.16801  48.53527  1.000 62.45232  ?  8   VAL D CG2 1 
ATOM   4165 N  N   . ARG D  1 9   ? -18.98920 11.15672  51.92011  1.000 64.53834  ?  9   ARG D N   1 
ATOM   4166 C  CA  . ARG D  1 9   ? -17.96176 11.09809  52.94752  1.000 68.73172  ?  9   ARG D CA  1 
ATOM   4167 C  C   . ARG D  1 9   ? -18.08814 9.81697   53.76214  1.000 74.61386  ?  9   ARG D C   1 
ATOM   4168 O  O   . ARG D  1 9   ? -19.18867 9.43059   54.17441  1.000 75.73273  ?  9   ARG D O   1 
ATOM   4169 C  CB  . ARG D  1 9   ? -18.05297 12.31062  53.85774  1.000 65.01989  ?  9   ARG D CB  1 
ATOM   4170 C  CG  . ARG D  1 9   ? -16.81686 12.51507  54.69840  1.000 65.30469  ?  9   ARG D CG  1 
ATOM   4171 C  CD  . ARG D  1 9   ? -16.74499 13.95037  55.18070  1.000 67.31477  ?  9   ARG D CD  1 
ATOM   4172 N  NE  . ARG D  1 9   ? -15.61970 14.17236  56.08127  1.000 66.54248  ?  9   ARG D NE  1 
ATOM   4173 C  CZ  . ARG D  1 9   ? -15.10314 15.36713  56.34928  1.000 66.46800  ?  9   ARG D CZ  1 
ATOM   4174 N  NH1 . ARG D  1 9   ? -15.60282 16.46098  55.78355  1.000 66.13185  ?  9   ARG D NH1 1 
ATOM   4175 N  NH2 . ARG D  1 9   ? -14.08002 15.46440  57.18053  1.000 69.35654  ?  9   ARG D NH2 1 
ATOM   4176 N  N   . GLN D  1 10  ? -16.95231 9.15789   53.98352  1.000 72.27308  ?  10  GLN D N   1 
ATOM   4177 C  CA  . GLN D  1 10  ? -16.90255 7.92702   54.76490  1.000 65.50967  ?  10  GLN D CA  1 
ATOM   4178 C  C   . GLN D  1 10  ? -15.47509 7.70366   55.23895  1.000 72.43487  ?  10  GLN D C   1 
ATOM   4179 O  O   . GLN D  1 10  ? -14.57602 7.50569   54.41189  1.000 79.78136  ?  10  GLN D O   1 
ATOM   4180 C  CB  . GLN D  1 10  ? -17.38582 6.74701   53.93603  1.000 67.40976  ?  10  GLN D CB  1 
ATOM   4181 C  CG  . GLN D  1 10  ? -17.31219 5.43520   54.67206  1.000 68.35497  ?  10  GLN D CG  1 
ATOM   4182 C  CD  . GLN D  1 10  ? -18.24203 4.39807   54.09890  1.000 72.36005  ?  10  GLN D CD  1 
ATOM   4183 O  OE1 . GLN D  1 10  ? -18.37541 4.25328   52.87630  1.000 69.69956  ?  10  GLN D OE1 1 
ATOM   4184 N  NE2 . GLN D  1 10  ? -18.90563 3.67022   54.98048  1.000 74.10138  ?  10  GLN D NE2 1 
ATOM   4185 N  N   . ASN D  1 11  ? -15.26864 7.75112   56.56156  1.000 77.20404  ?  11  ASN D N   1 
ATOM   4186 C  CA  . ASN D  1 11  ? -13.97755 7.45370   57.19545  1.000 71.48311  ?  11  ASN D CA  1 
ATOM   4187 C  C   . ASN D  1 11  ? -12.91617 8.49717   56.84095  1.000 72.04481  ?  11  ASN D C   1 
ATOM   4188 O  O   . ASN D  1 11  ? -11.73399 8.18428   56.67936  1.000 76.20522  ?  11  ASN D O   1 
ATOM   4189 C  CB  . ASN D  1 11  ? -13.50300 6.03829   56.84624  1.000 74.11894  ?  11  ASN D CB  1 
ATOM   4190 C  CG  . ASN D  1 11  ? -12.32891 5.58429   57.69960  1.000 78.56590  ?  11  ASN D CG  1 
ATOM   4191 O  OD1 . ASN D  1 11  ? -12.02198 6.18732   58.73275  1.000 74.02181  ?  11  ASN D OD1 1 
ATOM   4192 N  ND2 . ASN D  1 11  ? -11.65380 4.52236   57.25913  1.000 76.78464  ?  11  ASN D ND2 1 
ATOM   4193 N  N   . TYR D  1 12  ? -13.33082 9.75743   56.75455  1.000 72.55817  ?  12  TYR D N   1 
ATOM   4194 C  CA  . TYR D  1 12  ? -12.44334 10.86735  56.40332  1.000 72.21166  ?  12  TYR D CA  1 
ATOM   4195 C  C   . TYR D  1 12  ? -12.43057 11.85830  57.56942  1.000 71.40839  ?  12  TYR D C   1 
ATOM   4196 O  O   . TYR D  1 12  ? -13.22342 12.80207  57.61379  1.000 76.70949  ?  12  TYR D O   1 
ATOM   4197 C  CB  . TYR D  1 12  ? -12.90140 11.52107  55.10085  1.000 63.63452  ?  12  TYR D CB  1 
ATOM   4198 C  CG  . TYR D  1 12  ? -11.89411 12.43730  54.44372  1.000 66.76484  ?  12  TYR D CG  1 
ATOM   4199 C  CD1 . TYR D  1 12  ? -10.59721 12.01517  54.17950  1.000 73.20902  ?  12  TYR D CD1 1 
ATOM   4200 C  CD2 . TYR D  1 12  ? -12.24791 13.72753  54.06818  1.000 67.03459  ?  12  TYR D CD2 1 
ATOM   4201 C  CE1 . TYR D  1 12  ? -9.68100  12.85704  53.55425  1.000 70.61618  ?  12  TYR D CE1 1 
ATOM   4202 C  CE2 . TYR D  1 12  ? -11.34245 14.57301  53.45677  1.000 63.44479  ?  12  TYR D CE2 1 
ATOM   4203 C  CZ  . TYR D  1 12  ? -10.06447 14.13411  53.19832  1.000 65.45532  ?  12  TYR D CZ  1 
ATOM   4204 O  OH  . TYR D  1 12  ? -9.16739  14.97878  52.58593  1.000 63.01892  ?  12  TYR D OH  1 
ATOM   4205 N  N   . HIS D  1 13  ? -11.51615 11.64191  58.50974  1.000 71.18759  ?  13  HIS D N   1 
ATOM   4206 C  CA  . HIS D  1 13  ? -11.40999 12.49109  59.68328  1.000 70.96185  ?  13  HIS D CA  1 
ATOM   4207 C  C   . HIS D  1 13  ? -11.08611 13.92636  59.27759  1.000 75.44297  ?  13  HIS D C   1 
ATOM   4208 O  O   . HIS D  1 13  ? -10.58721 14.19045  58.17952  1.000 74.63664  ?  13  HIS D O   1 
ATOM   4209 C  CB  . HIS D  1 13  ? -10.33532 11.94766  60.62279  1.000 73.71839  ?  13  HIS D CB  1 
ATOM   4210 C  CG  . HIS D  1 13  ? -10.43246 12.47200  62.02184  1.000 76.91840  ?  13  HIS D CG  1 
ATOM   4211 N  ND1 . HIS D  1 13  ? -9.66774  13.52394  62.47728  1.000 76.71787  ?  13  HIS D ND1 1 
ATOM   4212 C  CD2 . HIS D  1 13  ? -11.20474 12.08861  63.06523  1.000 75.74274  ?  13  HIS D CD2 1 
ATOM   4213 C  CE1 . HIS D  1 13  ? -9.96246  13.76487  63.74189  1.000 77.74816  ?  13  HIS D CE1 1 
ATOM   4214 N  NE2 . HIS D  1 13  ? -10.89144 12.90694  64.12323  1.000 80.92253  ?  13  HIS D NE2 1 
ATOM   4215 N  N   . GLN D  1 14  ? -11.37687 14.86562  60.18924  1.000 79.02604  ?  14  GLN D N   1 
ATOM   4216 C  CA  . GLN D  1 14  ? -11.20350 16.28538  59.87982  1.000 81.48265  ?  14  GLN D CA  1 
ATOM   4217 C  C   . GLN D  1 14  ? -9.73391  16.70259  59.89405  1.000 81.71195  ?  14  GLN D C   1 
ATOM   4218 O  O   . GLN D  1 14  ? -9.34818  17.64042  59.17814  1.000 81.45766  ?  14  GLN D O   1 
ATOM   4219 C  CB  . GLN D  1 14  ? -12.00674 17.14493  60.86322  1.000 88.70683  ?  14  GLN D CB  1 
ATOM   4220 C  CG  . GLN D  1 14  ? -13.47340 17.38241  60.47030  1.000 90.09442  ?  14  GLN D CG  1 
ATOM   4221 C  CD  . GLN D  1 14  ? -13.70990 18.74023  59.80666  1.000 90.29223  ?  14  GLN D CD  1 
ATOM   4222 O  OE1 . GLN D  1 14  ? -13.06812 19.08115  58.80866  1.000 86.36232  ?  14  GLN D OE1 1 
ATOM   4223 N  NE2 . GLN D  1 14  ? -14.62177 19.52823  60.37708  1.000 92.10305  ?  14  GLN D NE2 1 
ATOM   4224 N  N   . ASP D  1 15  ? -8.90453  16.02744  60.69878  1.000 82.37857  ?  15  ASP D N   1 
ATOM   4225 C  CA  . ASP D  1 15  ? -7.47403  16.32718  60.71442  1.000 81.43069  ?  15  ASP D CA  1 
ATOM   4226 C  C   . ASP D  1 15  ? -6.84164  16.07044  59.35254  1.000 83.21705  ?  15  ASP D C   1 
ATOM   4227 O  O   . ASP D  1 15  ? -6.05700  16.88868  58.85972  1.000 89.02985  ?  15  ASP D O   1 
ATOM   4228 C  CB  . ASP D  1 15  ? -6.75766  15.49925  61.78531  1.000 79.90194  ?  15  ASP D CB  1 
ATOM   4229 C  CG  . ASP D  1 15  ? -7.36826  15.65668  63.16747  1.000 91.37454  ?  15  ASP D CG  1 
ATOM   4230 O  OD1 . ASP D  1 15  ? -8.22808  16.54582  63.36324  1.000 92.70985  -1 15  ASP D OD1 1 
ATOM   4231 O  OD2 . ASP D  1 15  ? -6.97681  14.88167  64.06610  1.000 94.08237  ?  15  ASP D OD2 1 
ATOM   4232 N  N   . SER D  1 16  ? -7.16634  14.93801  58.72882  1.000 74.50701  ?  16  SER D N   1 
ATOM   4233 C  CA  . SER D  1 16  ? -6.58516  14.63940  57.42674  1.000 78.91255  ?  16  SER D CA  1 
ATOM   4234 C  C   . SER D  1 16  ? -7.17493  15.51076  56.32322  1.000 78.24655  ?  16  SER D C   1 
ATOM   4235 O  O   . SER D  1 16  ? -6.46845  15.84700  55.37139  1.000 80.50117  ?  16  SER D O   1 
ATOM   4236 C  CB  . SER D  1 16  ? -6.76123  13.15884  57.09571  1.000 76.08077  ?  16  SER D CB  1 
ATOM   4237 O  OG  . SER D  1 16  ? -8.05234  12.70693  57.45942  1.000 76.95768  ?  16  SER D OG  1 
ATOM   4238 N  N   . GLU D  1 17  ? -8.44475  15.90448  56.43239  1.000 74.94407  ?  17  GLU D N   1 
ATOM   4239 C  CA  . GLU D  1 17  ? -8.97943  16.89956  55.50989  1.000 71.15796  ?  17  GLU D CA  1 
ATOM   4240 C  C   . GLU D  1 17  ? -8.16866  18.19122  55.58000  1.000 77.20741  ?  17  GLU D C   1 
ATOM   4241 O  O   . GLU D  1 17  ? -7.73824  18.73182  54.54794  1.000 85.26073  ?  17  GLU D O   1 
ATOM   4242 C  CB  . GLU D  1 17  ? -10.45092 17.15613  55.82286  1.000 68.78362  ?  17  GLU D CB  1 
ATOM   4243 C  CG  . GLU D  1 17  ? -11.06923 18.25733  55.00103  1.000 70.11603  ?  17  GLU D CG  1 
ATOM   4244 C  CD  . GLU D  1 17  ? -12.48667 18.55789  55.42669  1.000 78.56230  ?  17  GLU D CD  1 
ATOM   4245 O  OE1 . GLU D  1 17  ? -13.03953 17.76925  56.21989  1.000 81.70499  ?  17  GLU D OE1 1 
ATOM   4246 O  OE2 . GLU D  1 17  ? -13.04471 19.58645  54.98324  1.000 82.75437  -1 17  GLU D OE2 1 
ATOM   4247 N  N   . ALA D  1 18  ? -7.91554  18.68220  56.79766  1.000 69.96932  ?  18  ALA D N   1 
ATOM   4248 C  CA  . ALA D  1 18  ? -7.14461  19.91225  56.94180  1.000 69.39338  ?  18  ALA D CA  1 
ATOM   4249 C  C   . ALA D  1 18  ? -5.70072  19.73060  56.48243  1.000 69.94785  ?  18  ALA D C   1 
ATOM   4250 O  O   . ALA D  1 18  ? -5.10666  20.64646  55.89822  1.000 75.44240  ?  18  ALA D O   1 
ATOM   4251 C  CB  . ALA D  1 18  ? -7.19318  20.38814  58.39088  1.000 76.23377  ?  18  ALA D CB  1 
ATOM   4252 N  N   . ALA D  1 19  ? -5.11582  18.55813  56.73628  1.000 66.67350  ?  19  ALA D N   1 
ATOM   4253 C  CA  . ALA D  1 19  ? -3.74596  18.31240  56.29702  1.000 71.54491  ?  19  ALA D CA  1 
ATOM   4254 C  C   . ALA D  1 19  ? -3.65877  18.21461  54.78163  1.000 70.99102  ?  19  ALA D C   1 
ATOM   4255 O  O   . ALA D  1 19  ? -2.65292  18.62079  54.19297  1.000 70.50350  ?  19  ALA D O   1 
ATOM   4256 C  CB  . ALA D  1 19  ? -3.19685  17.04092  56.94172  1.000 72.42138  ?  19  ALA D CB  1 
ATOM   4257 N  N   . ILE D  1 20  ? -4.70604  17.69673  54.13748  1.000 76.33593  ?  20  ILE D N   1 
ATOM   4258 C  CA  . ILE D  1 20  ? -4.77807  17.70223  52.68050  1.000 70.41548  ?  20  ILE D CA  1 
ATOM   4259 C  C   . ILE D  1 20  ? -4.85081  19.13083  52.15647  1.000 64.59774  ?  20  ILE D C   1 
ATOM   4260 O  O   . ILE D  1 20  ? -4.17778  19.48125  51.18312  1.000 70.79182  ?  20  ILE D O   1 
ATOM   4261 C  CB  . ILE D  1 20  ? -5.97697  16.86276  52.20833  1.000 68.97671  ?  20  ILE D CB  1 
ATOM   4262 C  CG1 . ILE D  1 20  ? -5.67077  15.37686  52.35775  1.000 66.48402  ?  20  ILE D CG1 1 
ATOM   4263 C  CG2 . ILE D  1 20  ? -6.28997  17.15731  50.76120  1.000 70.01859  ?  20  ILE D CG2 1 
ATOM   4264 C  CD1 . ILE D  1 20  ? -4.46742  14.93914  51.59725  1.000 67.18604  ?  20  ILE D CD1 1 
ATOM   4265 N  N   . ASN D  1 21  ? -5.67469  19.97627  52.77469  1.000 64.90240  ?  21  ASN D N   1 
ATOM   4266 C  CA  . ASN D  1 21  ? -5.70387  21.37677  52.35106  1.000 63.84023  ?  21  ASN D CA  1 
ATOM   4267 C  C   . ASN D  1 21  ? -4.32297  22.02232  52.48728  1.000 64.42196  ?  21  ASN D C   1 
ATOM   4268 O  O   . ASN D  1 21  ? -3.86943  22.76128  51.59221  1.000 69.27491  ?  21  ASN D O   1 
ATOM   4269 C  CB  . ASN D  1 21  ? -6.75532  22.14763  53.15206  1.000 64.56931  ?  21  ASN D CB  1 
ATOM   4270 C  CG  . ASN D  1 21  ? -8.15666  22.03758  52.54572  1.000 68.60068  ?  21  ASN D CG  1 
ATOM   4271 O  OD1 . ASN D  1 21  ? -8.35481  22.31186  51.36637  1.000 73.47368  ?  21  ASN D OD1 1 
ATOM   4272 N  ND2 . ASN D  1 21  ? -9.13069  21.65372  53.35829  1.000 64.21407  ?  21  ASN D ND2 1 
ATOM   4273 N  N   . ARG D  1 22  ? -3.62462  21.72199  53.58898  1.000 62.93142  ?  22  ARG D N   1 
ATOM   4274 C  CA  . ARG D  1 22  ? -2.27529  22.24709  53.78860  1.000 62.51041  ?  22  ARG D CA  1 
ATOM   4275 C  C   . ARG D  1 22  ? -1.31203  21.70909  52.73434  1.000 72.20022  ?  22  ARG D C   1 
ATOM   4276 O  O   . ARG D  1 22  ? -0.44741  22.43787  52.23337  1.000 77.51921  ?  22  ARG D O   1 
ATOM   4277 C  CB  . ARG D  1 22  ? -1.78263  21.89438  55.19241  1.000 66.67125  ?  22  ARG D CB  1 
ATOM   4278 C  CG  . ARG D  1 22  ? -2.23352  22.86971  56.28702  1.000 68.51563  ?  22  ARG D CG  1 
ATOM   4279 C  CD  . ARG D  1 22  ? -1.65734  22.49530  57.65743  1.000 71.94222  ?  22  ARG D CD  1 
ATOM   4280 N  NE  . ARG D  1 22  ? -2.55160  21.63224  58.42814  1.000 76.31654  ?  22  ARG D NE  1 
ATOM   4281 C  CZ  . ARG D  1 22  ? -2.25314  20.38908  58.79721  1.000 81.13165  ?  22  ARG D CZ  1 
ATOM   4282 N  NH1 . ARG D  1 22  ? -1.07942  19.85984  58.46394  1.000 81.67527  ?  22  ARG D NH1 1 
ATOM   4283 N  NH2 . ARG D  1 22  ? -3.12942  19.66583  59.48902  1.000 79.43613  ?  22  ARG D NH2 1 
ATOM   4284 N  N   . GLN D  1 23  ? -1.45008  20.43316  52.38245  1.000 66.49874  ?  23  GLN D N   1 
ATOM   4285 C  CA  . GLN D  1 23  ? -0.58534  19.83553  51.37646  1.000 64.22173  ?  23  GLN D CA  1 
ATOM   4286 C  C   . GLN D  1 23  ? -0.85286  20.40629  49.99354  1.000 67.99480  ?  23  GLN D C   1 
ATOM   4287 O  O   . GLN D  1 23  ? 0.07458   20.53321  49.18803  1.000 74.21953  ?  23  GLN D O   1 
ATOM   4288 C  CB  . GLN D  1 23  ? -0.77763  18.32588  51.36891  1.000 60.21845  ?  23  GLN D CB  1 
ATOM   4289 C  CG  . GLN D  1 23  ? 0.34204   17.57213  50.70815  1.000 58.56774  ?  23  GLN D CG  1 
ATOM   4290 C  CD  . GLN D  1 23  ? 1.60493   17.57927  51.51633  1.000 59.93213  ?  23  GLN D CD  1 
ATOM   4291 O  OE1 . GLN D  1 23  ? 1.57600   17.69155  52.73945  1.000 60.31434  ?  23  GLN D OE1 1 
ATOM   4292 N  NE2 . GLN D  1 23  ? 2.73443   17.43152  50.83579  1.000 67.35407  ?  23  GLN D NE2 1 
ATOM   4293 N  N   . ILE D  1 24  ? -2.11065  20.72735  49.69471  1.000 64.30392  ?  24  ILE D N   1 
ATOM   4294 C  CA  . ILE D  1 24  ? -2.43093  21.44834  48.46777  1.000 59.71494  ?  24  ILE D CA  1 
ATOM   4295 C  C   . ILE D  1 24  ? -1.66512  22.76479  48.42051  1.000 61.97442  ?  24  ILE D C   1 
ATOM   4296 O  O   . ILE D  1 24  ? -0.99569  23.07874  47.42360  1.000 63.15799  ?  24  ILE D O   1 
ATOM   4297 C  CB  . ILE D  1 24  ? -3.94929  21.67158  48.36180  1.000 56.50803  ?  24  ILE D CB  1 
ATOM   4298 C  CG1 . ILE D  1 24  ? -4.65202  20.33481  48.14982  1.000 59.41756  ?  24  ILE D CG1 1 
ATOM   4299 C  CG2 . ILE D  1 24  ? -4.27215  22.63744  47.23508  1.000 51.92688  ?  24  ILE D CG2 1 
ATOM   4300 C  CD1 . ILE D  1 24  ? -6.13514  20.37059  48.41428  1.000 62.06625  ?  24  ILE D CD1 1 
ATOM   4301 N  N   . ASN D  1 25  ? -1.74587  23.55514  49.50166  1.000 64.20764  ?  25  ASN D N   1 
ATOM   4302 C  CA  . ASN D  1 25  ? -1.00745  24.82242  49.50933  1.000 62.78201  ?  25  ASN D CA  1 
ATOM   4303 C  C   . ASN D  1 25  ? 0.49991   24.58990  49.39930  1.000 61.57731  ?  25  ASN D C   1 
ATOM   4304 O  O   . ASN D  1 25  ? 1.21491   25.35989  48.74603  1.000 62.86675  ?  25  ASN D O   1 
ATOM   4305 C  CB  . ASN D  1 25  ? -1.32363  25.64726  50.76009  1.000 62.99948  ?  25  ASN D CB  1 
ATOM   4306 C  CG  . ASN D  1 25  ? -0.62318  27.01473  50.74798  1.000 65.67466  ?  25  ASN D CG  1 
ATOM   4307 O  OD1 . ASN D  1 25  ? 0.46026   27.18820  51.31481  1.000 62.85714  ?  25  ASN D OD1 1 
ATOM   4308 N  ND2 . ASN D  1 25  ? -1.23330  27.97813  50.07165  1.000 67.05266  ?  25  ASN D ND2 1 
ATOM   4309 N  N   . LEU D  1 26  ? 1.00141   23.52425  50.01247  1.000 61.75169  ?  26  LEU D N   1 
ATOM   4310 C  CA  . LEU D  1 26  ? 2.43330   23.25957  49.93948  1.000 60.27292  ?  26  LEU D CA  1 
ATOM   4311 C  C   . LEU D  1 26  ? 2.86058   22.92633  48.51005  1.000 64.99077  ?  26  LEU D C   1 
ATOM   4312 O  O   . LEU D  1 26  ? 3.89162   23.41485  48.03466  1.000 60.89505  ?  26  LEU D O   1 
ATOM   4313 C  CB  . LEU D  1 26  ? 2.79560   22.13380  50.91041  1.000 62.90485  ?  26  LEU D CB  1 
ATOM   4314 C  CG  . LEU D  1 26  ? 4.27210   21.73701  51.04955  1.000 68.10165  ?  26  LEU D CG  1 
ATOM   4315 C  CD1 . LEU D  1 26  ? 5.14628   22.96018  51.26518  1.000 56.40185  ?  26  LEU D CD1 1 
ATOM   4316 C  CD2 . LEU D  1 26  ? 4.47184   20.70961  52.17842  1.000 66.18627  ?  26  LEU D CD2 1 
ATOM   4317 N  N   . GLU D  1 27  ? 2.07537   22.10419  47.80400  1.000 61.68234  ?  27  GLU D N   1 
ATOM   4318 C  CA  . GLU D  1 27  ? 2.42760   21.73602  46.43419  1.000 56.62076  ?  27  GLU D CA  1 
ATOM   4319 C  C   . GLU D  1 27  ? 2.28964   22.92829  45.48610  1.000 55.53924  ?  27  GLU D C   1 
ATOM   4320 O  O   . GLU D  1 27  ? 3.07971   23.08267  44.54180  1.000 56.92581  ?  27  GLU D O   1 
ATOM   4321 C  CB  . GLU D  1 27  ? 1.56970   20.55582  45.97642  1.000 54.45563  ?  27  GLU D CB  1 
ATOM   4322 C  CG  . GLU D  1 27  ? 1.74257   19.27929  46.81424  1.000 59.58022  ?  27  GLU D CG  1 
ATOM   4323 C  CD  . GLU D  1 27  ? 2.83526   18.33910  46.28890  1.000 71.48058  ?  27  GLU D CD  1 
ATOM   4324 O  OE1 . GLU D  1 27  ? 3.48800   18.68279  45.28091  1.000 73.50594  ?  27  GLU D OE1 1 
ATOM   4325 O  OE2 . GLU D  1 27  ? 3.02978   17.24174  46.87014  1.000 71.26470  -1 27  GLU D OE2 1 
ATOM   4326 N  N   . LEU D  1 28  ? 1.31957   23.80694  45.73494  1.000 54.40504  ?  28  LEU D N   1 
ATOM   4327 C  CA  . LEU D  1 28  ? 1.26898   25.03450  44.94739  1.000 55.49275  ?  28  LEU D CA  1 
ATOM   4328 C  C   . LEU D  1 28  ? 2.48910   25.91132  45.23081  1.000 59.74853  ?  28  LEU D C   1 
ATOM   4329 O  O   . LEU D  1 28  ? 3.05292   26.53088  44.31436  1.000 63.55501  ?  28  LEU D O   1 
ATOM   4330 C  CB  . LEU D  1 28  ? -0.02905  25.78758  45.22727  1.000 54.10279  ?  28  LEU D CB  1 
ATOM   4331 C  CG  . LEU D  1 28  ? -1.34199  25.09492  44.85564  1.000 56.58092  ?  28  LEU D CG  1 
ATOM   4332 C  CD1 . LEU D  1 28  ? -2.51525  25.81395  45.52024  1.000 59.26052  ?  28  LEU D CD1 1 
ATOM   4333 C  CD2 . LEU D  1 28  ? -1.54090  25.03874  43.35916  1.000 54.53563  ?  28  LEU D CD2 1 
ATOM   4334 N  N   . TYR D  1 29  ? 2.92365   25.96275  46.49461  1.000 54.44762  ?  29  TYR D N   1 
ATOM   4335 C  CA  . TYR D  1 29  ? 4.14945   26.68437  46.81481  1.000 56.87046  ?  29  TYR D CA  1 
ATOM   4336 C  C   . TYR D  1 29  ? 5.33922   26.08305  46.07708  1.000 55.39850  ?  29  TYR D C   1 
ATOM   4337 O  O   . TYR D  1 29  ? 6.16659   26.81535  45.51783  1.000 56.19423  ?  29  TYR D O   1 
ATOM   4338 C  CB  . TYR D  1 29  ? 4.38356   26.68931  48.33387  1.000 60.24299  ?  29  TYR D CB  1 
ATOM   4339 C  CG  . TYR D  1 29  ? 5.74367   27.20830  48.77069  1.000 55.67535  ?  29  TYR D CG  1 
ATOM   4340 C  CD1 . TYR D  1 29  ? 5.98766   28.56589  48.88430  1.000 61.26579  ?  29  TYR D CD1 1 
ATOM   4341 C  CD2 . TYR D  1 29  ? 6.78470   26.33322  49.07188  1.000 57.84250  ?  29  TYR D CD2 1 
ATOM   4342 C  CE1 . TYR D  1 29  ? 7.23790   29.03883  49.28871  1.000 62.44600  ?  29  TYR D CE1 1 
ATOM   4343 C  CE2 . TYR D  1 29  ? 8.03636   26.79676  49.46878  1.000 55.74839  ?  29  TYR D CE2 1 
ATOM   4344 C  CZ  . TYR D  1 29  ? 8.25581   28.14410  49.57205  1.000 59.69927  ?  29  TYR D CZ  1 
ATOM   4345 O  OH  . TYR D  1 29  ? 9.49491   28.59731  49.97273  1.000 64.57373  ?  29  TYR D OH  1 
ATOM   4346 N  N   . ALA D  1 30  ? 5.43733   24.74916  46.06286  1.000 60.00232  ?  30  ALA D N   1 
ATOM   4347 C  CA  . ALA D  1 30  ? 6.56413   24.09816  45.40127  1.000 57.13982  ?  30  ALA D CA  1 
ATOM   4348 C  C   . ALA D  1 30  ? 6.61684   24.48065  43.93081  1.000 66.24008  ?  30  ALA D C   1 
ATOM   4349 O  O   . ALA D  1 30  ? 7.68959   24.83021  43.40716  1.000 74.68698  ?  30  ALA D O   1 
ATOM   4350 C  CB  . ALA D  1 30  ? 6.48112   22.57907  45.56382  1.000 51.57620  ?  30  ALA D CB  1 
ATOM   4351 N  N   . SER D  1 31  ? 5.46189   24.45710  43.25193  1.000 59.08825  ?  31  SER D N   1 
ATOM   4352 C  CA  . SER D  1 31  ? 5.47863   24.81730  41.83768  1.000 59.68156  ?  31  SER D CA  1 
ATOM   4353 C  C   . SER D  1 31  ? 5.80868   26.29842  41.65255  1.000 61.43851  ?  31  SER D C   1 
ATOM   4354 O  O   . SER D  1 31  ? 6.47820   26.66842  40.67965  1.000 69.06773  ?  31  SER D O   1 
ATOM   4355 C  CB  . SER D  1 31  ? 4.15594   24.44547  41.16121  1.000 63.06423  ?  31  SER D CB  1 
ATOM   4356 O  OG  . SER D  1 31  ? 3.27037   25.53521  41.03402  1.000 58.03974  ?  31  SER D OG  1 
ATOM   4357 N  N   . TYR D  1 32  ? 5.38966   27.16060  42.58661  1.000 51.28770  ?  32  TYR D N   1 
ATOM   4358 C  CA  . TYR D  1 32  ? 5.77999   28.56793  42.49186  1.000 54.73839  ?  32  TYR D CA  1 
ATOM   4359 C  C   . TYR D  1 32  ? 7.29743   28.72513  42.56997  1.000 57.19821  ?  32  TYR D C   1 
ATOM   4360 O  O   . TYR D  1 32  ? 7.90330   29.47340  41.78665  1.000 48.49678  ?  32  TYR D O   1 
ATOM   4361 C  CB  . TYR D  1 32  ? 5.09925   29.37933  43.59929  1.000 54.82202  ?  32  TYR D CB  1 
ATOM   4362 C  CG  . TYR D  1 32  ? 4.91285   30.85563  43.29149  1.000 51.80434  ?  32  TYR D CG  1 
ATOM   4363 C  CD1 . TYR D  1 32  ? 5.00985   31.33944  41.98935  1.000 48.90578  ?  32  TYR D CD1 1 
ATOM   4364 C  CD2 . TYR D  1 32  ? 4.63235   31.76989  44.31113  1.000 52.38234  ?  32  TYR D CD2 1 
ATOM   4365 C  CE1 . TYR D  1 32  ? 4.83054   32.70651  41.70961  1.000 49.11317  ?  32  TYR D CE1 1 
ATOM   4366 C  CE2 . TYR D  1 32  ? 4.45494   33.12078  44.04262  1.000 52.54005  ?  32  TYR D CE2 1 
ATOM   4367 C  CZ  . TYR D  1 32  ? 4.55234   33.58271  42.74349  1.000 57.88981  ?  32  TYR D CZ  1 
ATOM   4368 O  OH  . TYR D  1 32  ? 4.37834   34.92468  42.48532  1.000 60.35067  ?  32  TYR D OH  1 
ATOM   4369 N  N   . VAL D  1 33  ? 7.92616   28.02900  43.51455  1.000 52.50504  ?  33  VAL D N   1 
ATOM   4370 C  CA  . VAL D  1 33  ? 9.37734   28.10037  43.64265  1.000 52.16730  ?  33  VAL D CA  1 
ATOM   4371 C  C   . VAL D  1 33  ? 10.04534  27.61078  42.35951  1.000 61.59310  ?  33  VAL D C   1 
ATOM   4372 O  O   . VAL D  1 33  ? 10.99144  28.23449  41.85080  1.000 63.86733  ?  33  VAL D O   1 
ATOM   4373 C  CB  . VAL D  1 33  ? 9.84748   27.30031  44.87074  1.000 57.63272  ?  33  VAL D CB  1 
ATOM   4374 C  CG1 . VAL D  1 33  ? 11.35240  27.06347  44.81385  1.000 58.24586  ?  33  VAL D CG1 1 
ATOM   4375 C  CG2 . VAL D  1 33  ? 9.47108   28.02287  46.14653  1.000 55.51382  ?  33  VAL D CG2 1 
ATOM   4376 N  N   . TYR D  1 34  ? 9.56074   26.48627  41.81296  1.000 56.49095  ?  34  TYR D N   1 
ATOM   4377 C  CA  . TYR D  1 34  ? 10.16364  25.96280  40.59233  1.000 46.70915  ?  34  TYR D CA  1 
ATOM   4378 C  C   . TYR D  1 34  ? 9.98910   26.93379  39.43383  1.000 52.44701  ?  34  TYR D C   1 
ATOM   4379 O  O   . TYR D  1 34  ? 10.87805  27.05602  38.58615  1.000 56.58496  ?  34  TYR D O   1 
ATOM   4380 C  CB  . TYR D  1 34  ? 9.57216   24.60205  40.23104  1.000 48.48053  ?  34  TYR D CB  1 
ATOM   4381 C  CG  . TYR D  1 34  ? 10.15641  23.45140  41.00601  1.000 51.38047  ?  34  TYR D CG  1 
ATOM   4382 C  CD1 . TYR D  1 34  ? 11.50907  23.17475  40.95330  1.000 55.64148  ?  34  TYR D CD1 1 
ATOM   4383 C  CD2 . TYR D  1 34  ? 9.34752   22.63086  41.78485  1.000 61.41381  ?  34  TYR D CD2 1 
ATOM   4384 C  CE1 . TYR D  1 34  ? 12.04766  22.12269  41.65988  1.000 64.37139  ?  34  TYR D CE1 1 
ATOM   4385 C  CE2 . TYR D  1 34  ? 9.87050   21.57218  42.49153  1.000 60.24162  ?  34  TYR D CE2 1 
ATOM   4386 C  CZ  . TYR D  1 34  ? 11.22234  21.32364  42.42770  1.000 68.60050  ?  34  TYR D CZ  1 
ATOM   4387 O  OH  . TYR D  1 34  ? 11.75363  20.27300  43.13310  1.000 72.96842  ?  34  TYR D OH  1 
ATOM   4388 N  N   . LEU D  1 35  ? 8.84868   27.63389  39.37800  1.000 55.28503  ?  35  LEU D N   1 
ATOM   4389 C  CA  . LEU D  1 35  ? 8.60298   28.59425  38.30081  1.000 51.19195  ?  35  LEU D CA  1 
ATOM   4390 C  C   . LEU D  1 35  ? 9.55836   29.77404  38.39704  1.000 47.36709  ?  35  LEU D C   1 
ATOM   4391 O  O   . LEU D  1 35  ? 10.09704  30.25882  37.38160  1.000 51.16583  ?  35  LEU D O   1 
ATOM   4392 C  CB  . LEU D  1 35  ? 7.15502   29.07857  38.36744  1.000 53.20125  ?  35  LEU D CB  1 
ATOM   4393 C  CG  . LEU D  1 35  ? 6.72542   30.30678  37.55810  1.000 54.33998  ?  35  LEU D CG  1 
ATOM   4394 C  CD1 . LEU D  1 35  ? 7.00394   30.15045  36.06117  1.000 52.66199  ?  35  LEU D CD1 1 
ATOM   4395 C  CD2 . LEU D  1 35  ? 5.26004   30.60957  37.79395  1.000 56.38300  ?  35  LEU D CD2 1 
ATOM   4396 N  N   . SER D  1 36  ? 9.77379   30.24711  39.61685  1.000 48.96492  ?  36  SER D N   1 
ATOM   4397 C  CA  . SER D  1 36  ? 10.73485  31.32077  39.83330  1.000 51.46101  ?  36  SER D CA  1 
ATOM   4398 C  C   . SER D  1 36  ? 12.13129  30.89632  39.40247  1.000 57.33992  ?  36  SER D C   1 
ATOM   4399 O  O   . SER D  1 36  ? 12.82160  31.63322  38.68732  1.000 58.50597  ?  36  SER D O   1 
ATOM   4400 C  CB  . SER D  1 36  ? 10.73352  31.73010  41.29779  1.000 49.41191  ?  36  SER D CB  1 
ATOM   4401 O  OG  . SER D  1 36  ? 11.74139  32.68834  41.48488  1.000 55.13047  ?  36  SER D OG  1 
ATOM   4402 N  N   . MET D  1 37  ? 12.56404  29.70229  39.83221  1.000 53.46327  ?  37  MET D N   1 
ATOM   4403 C  CA  . MET D  1 37  ? 13.86636  29.19439  39.40790  1.000 50.22805  ?  37  MET D CA  1 
ATOM   4404 C  C   . MET D  1 37  ? 13.95897  29.10285  37.89066  1.000 46.80604  ?  37  MET D C   1 
ATOM   4405 O  O   . MET D  1 37  ? 14.96467  29.51810  37.28505  1.000 54.23705  ?  37  MET D O   1 
ATOM   4406 C  CB  . MET D  1 37  ? 14.13450  27.83290  40.05138  1.000 53.61872  ?  37  MET D CB  1 
ATOM   4407 C  CG  . MET D  1 37  ? 14.10170  27.86600  41.57465  1.000 60.03443  ?  37  MET D CG  1 
ATOM   4408 S  SD  . MET D  1 37  ? 14.12371  26.25777  42.41183  1.000 72.50143  ?  37  MET D SD  1 
ATOM   4409 C  CE  . MET D  1 37  ? 15.51268  25.50079  41.63304  1.000 61.40787  ?  37  MET D CE  1 
ATOM   4410 N  N   . SER D  1 38  ? 12.90953  28.58974  37.25309  1.000 45.08593  ?  38  SER D N   1 
ATOM   4411 C  CA  . SER D  1 38  ? 12.95172  28.40150  35.80869  1.000 45.37668  ?  38  SER D CA  1 
ATOM   4412 C  C   . SER D  1 38  ? 13.21174  29.72246  35.10430  1.000 45.07455  ?  38  SER D C   1 
ATOM   4413 O  O   . SER D  1 38  ? 14.06988  29.81081  34.21951  1.000 60.94595  ?  38  SER D O   1 
ATOM   4414 C  CB  . SER D  1 38  ? 11.64436  27.77432  35.30742  1.000 47.52395  ?  38  SER D CB  1 
ATOM   4415 O  OG  . SER D  1 38  ? 11.49607  28.01185  33.91664  1.000 41.58970  ?  38  SER D OG  1 
ATOM   4416 N  N   . TYR D  1 39  ? 12.49836  30.77068  35.49275  1.000 44.14217  ?  39  TYR D N   1 
ATOM   4417 C  CA  . TYR D  1 39  ? 12.71163  32.01324  34.75527  1.000 48.41873  ?  39  TYR D CA  1 
ATOM   4418 C  C   . TYR D  1 39  ? 13.94724  32.77757  35.22678  1.000 47.34369  ?  39  TYR D C   1 
ATOM   4419 O  O   . TYR D  1 39  ? 14.48509  33.59475  34.47033  1.000 49.93427  ?  39  TYR D O   1 
ATOM   4420 C  CB  . TYR D  1 39  ? 11.44882  32.88120  34.80257  1.000 46.91812  ?  39  TYR D CB  1 
ATOM   4421 C  CG  . TYR D  1 39  ? 10.49285  32.43756  33.72175  1.000 44.36525  ?  39  TYR D CG  1 
ATOM   4422 C  CD1 . TYR D  1 39  ? 10.66049  32.85864  32.41080  1.000 41.76832  ?  39  TYR D CD1 1 
ATOM   4423 C  CD2 . TYR D  1 39  ? 9.47142   31.54288  33.99711  1.000 46.77493  ?  39  TYR D CD2 1 
ATOM   4424 C  CE1 . TYR D  1 39  ? 9.81885   32.42774  31.40516  1.000 40.55418  ?  39  TYR D CE1 1 
ATOM   4425 C  CE2 . TYR D  1 39  ? 8.60908   31.10552  32.99738  1.000 41.11515  ?  39  TYR D CE2 1 
ATOM   4426 C  CZ  . TYR D  1 39  ? 8.79218   31.55039  31.70591  1.000 43.56180  ?  39  TYR D CZ  1 
ATOM   4427 O  OH  . TYR D  1 39  ? 7.95686   31.10420  30.71017  1.000 45.65156  ?  39  TYR D OH  1 
ATOM   4428 N  N   . TYR D  1 40  ? 14.44170  32.51641  36.43356  1.000 47.90264  ?  40  TYR D N   1 
ATOM   4429 C  CA  . TYR D  1 40  ? 15.78907  32.97137  36.75041  1.000 48.51985  ?  40  TYR D CA  1 
ATOM   4430 C  C   . TYR D  1 40  ? 16.78569  32.45297  35.71853  1.000 53.93299  ?  40  TYR D C   1 
ATOM   4431 O  O   . TYR D  1 40  ? 17.64471  33.20608  35.24188  1.000 63.11836  ?  40  TYR D O   1 
ATOM   4432 C  CB  . TYR D  1 40  ? 16.18563  32.53277  38.15828  1.000 52.08713  ?  40  TYR D CB  1 
ATOM   4433 C  CG  . TYR D  1 40  ? 17.65306  32.71519  38.44760  1.000 58.30720  ?  40  TYR D CG  1 
ATOM   4434 C  CD1 . TYR D  1 40  ? 18.18390  33.97852  38.73094  1.000 57.16955  ?  40  TYR D CD1 1 
ATOM   4435 C  CD2 . TYR D  1 40  ? 18.51562  31.63024  38.42304  1.000 57.24861  ?  40  TYR D CD2 1 
ATOM   4436 C  CE1 . TYR D  1 40  ? 19.53015  34.13979  38.98378  1.000 54.02454  ?  40  TYR D CE1 1 
ATOM   4437 C  CE2 . TYR D  1 40  ? 19.85886  31.77720  38.67032  1.000 52.43182  ?  40  TYR D CE2 1 
ATOM   4438 C  CZ  . TYR D  1 40  ? 20.36969  33.02498  38.95033  1.000 61.54303  ?  40  TYR D CZ  1 
ATOM   4439 O  OH  . TYR D  1 40  ? 21.72841  33.13732  39.19999  1.000 62.70076  ?  40  TYR D OH  1 
ATOM   4440 N  N   . PHE D  1 41  ? 16.66014  31.18069  35.32126  1.000 56.68230  ?  41  PHE D N   1 
ATOM   4441 C  CA  . PHE D  1 41  ? 17.63229  30.62755  34.37482  1.000 50.82029  ?  41  PHE D CA  1 
ATOM   4442 C  C   . PHE D  1 41  ? 17.40499  31.06354  32.93543  1.000 44.95603  ?  41  PHE D C   1 
ATOM   4443 O  O   . PHE D  1 41  ? 18.22732  30.73398  32.07271  1.000 47.54178  ?  41  PHE D O   1 
ATOM   4444 C  CB  . PHE D  1 41  ? 17.65083  29.09679  34.47025  1.000 52.15060  ?  41  PHE D CB  1 
ATOM   4445 C  CG  . PHE D  1 41  ? 18.31730  28.61922  35.71598  1.000 58.86969  ?  41  PHE D CG  1 
ATOM   4446 C  CD1 . PHE D  1 41  ? 19.69999  28.72932  35.84927  1.000 58.28546  ?  41  PHE D CD1 1 
ATOM   4447 C  CD2 . PHE D  1 41  ? 17.57172  28.15140  36.79043  1.000 56.01411  ?  41  PHE D CD2 1 
ATOM   4448 C  CE1 . PHE D  1 41  ? 20.33890  28.35040  37.02618  1.000 55.12437  ?  41  PHE D CE1 1 
ATOM   4449 C  CE2 . PHE D  1 41  ? 18.19824  27.76757  37.97067  1.000 55.74625  ?  41  PHE D CE2 1 
ATOM   4450 C  CZ  . PHE D  1 41  ? 19.59260  27.86602  38.08650  1.000 55.00963  ?  41  PHE D CZ  1 
ATOM   4451 N  N   . ASP D  1 42  ? 16.31228  31.77308  32.66966  1.000 47.94335  ?  42  ASP D N   1 
ATOM   4452 C  CA  . ASP D  1 42  ? 15.98127  32.40707  31.39967  1.000 45.10212  ?  42  ASP D CA  1 
ATOM   4453 C  C   . ASP D  1 42  ? 16.47730  33.85112  31.31895  1.000 45.64654  ?  42  ASP D C   1 
ATOM   4454 O  O   . ASP D  1 42  ? 16.38541  34.46540  30.24686  1.000 45.52483  ?  42  ASP D O   1 
ATOM   4455 C  CB  . ASP D  1 42  ? 14.45385  32.36907  31.21504  1.000 42.46014  ?  42  ASP D CB  1 
ATOM   4456 C  CG  . ASP D  1 42  ? 13.99388  32.86604  29.85905  1.000 51.68492  ?  42  ASP D CG  1 
ATOM   4457 O  OD1 . ASP D  1 42  ? 14.18315  32.14947  28.85059  1.000 67.38702  ?  42  ASP D OD1 1 
ATOM   4458 O  OD2 . ASP D  1 42  ? 13.39923  33.96732  29.81105  1.000 57.66369  -1 42  ASP D OD2 1 
ATOM   4459 N  N   . ARG D  1 43  ? 16.98049  34.40912  32.41946  1.000 44.46754  ?  43  ARG D N   1 
ATOM   4460 C  CA  . ARG D  1 43  ? 17.56894  35.75017  32.38570  1.000 49.69733  ?  43  ARG D CA  1 
ATOM   4461 C  C   . ARG D  1 43  ? 18.72681  35.84458  31.39760  1.000 51.12077  ?  43  ARG D C   1 
ATOM   4462 O  O   . ARG D  1 43  ? 19.47280  34.88639  31.16869  1.000 45.44779  ?  43  ARG D O   1 
ATOM   4463 C  CB  . ARG D  1 43  ? 18.07290  36.15680  33.76068  1.000 46.77834  ?  43  ARG D CB  1 
ATOM   4464 C  CG  . ARG D  1 43  ? 16.98827  36.26642  34.77735  1.000 47.26186  ?  43  ARG D CG  1 
ATOM   4465 C  CD  . ARG D  1 43  ? 17.59529  36.35167  36.13424  1.000 48.71565  ?  43  ARG D CD  1 
ATOM   4466 N  NE  . ARG D  1 43  ? 18.80607  37.16342  36.11130  1.000 49.56445  ?  43  ARG D NE  1 
ATOM   4467 C  CZ  . ARG D  1 43  ? 19.20626  37.91595  37.13179  1.000 55.27724  ?  43  ARG D CZ  1 
ATOM   4468 N  NH1 . ARG D  1 43  ? 18.49155  37.94235  38.24881  1.000 52.42319  ?  43  ARG D NH1 1 
ATOM   4469 N  NH2 . ARG D  1 43  ? 20.32294  38.63316  37.04216  1.000 55.53441  ?  43  ARG D NH2 1 
ATOM   4470 N  N   . ASP D  1 44  ? 18.89301  37.04047  30.83137  1.000 53.60079  ?  44  ASP D N   1 
ATOM   4471 C  CA  . ASP D  1 44  ? 19.92511  37.22314  29.82137  1.000 48.25374  ?  44  ASP D CA  1 
ATOM   4472 C  C   . ASP D  1 44  ? 21.32181  37.02393  30.40902  1.000 54.71208  ?  44  ASP D C   1 
ATOM   4473 O  O   . ASP D  1 44  ? 22.22984  36.55111  29.71153  1.000 57.76777  ?  44  ASP D O   1 
ATOM   4474 C  CB  . ASP D  1 44  ? 19.77632  38.59948  29.17072  1.000 51.23881  ?  44  ASP D CB  1 
ATOM   4475 C  CG  . ASP D  1 44  ? 20.50745  39.69106  29.92152  1.000 54.07865  ?  44  ASP D CG  1 
ATOM   4476 O  OD1 . ASP D  1 44  ? 19.97340  40.22772  30.91604  1.000 57.66348  -1 44  ASP D OD1 1 
ATOM   4477 O  OD2 . ASP D  1 44  ? 21.63289  40.01689  29.50947  1.000 64.52141  ?  44  ASP D OD2 1 
ATOM   4478 N  N   . ASP D  1 45  ? 21.50610  37.30706  31.69394  1.000 47.14912  ?  45  ASP D N   1 
ATOM   4479 C  CA  . ASP D  1 45  ? 22.81043  37.11662  32.31667  1.000 53.39423  ?  45  ASP D CA  1 
ATOM   4480 C  C   . ASP D  1 45  ? 22.92369  35.78319  33.04630  1.000 48.28753  ?  45  ASP D C   1 
ATOM   4481 O  O   . ASP D  1 45  ? 23.74347  35.65522  33.95654  1.000 55.39479  ?  45  ASP D O   1 
ATOM   4482 C  CB  . ASP D  1 45  ? 23.13939  38.27749  33.26635  1.000 49.80237  ?  45  ASP D CB  1 
ATOM   4483 C  CG  . ASP D  1 45  ? 22.10084  38.45878  34.36501  1.000 62.73099  ?  45  ASP D CG  1 
ATOM   4484 O  OD1 . ASP D  1 45  ? 21.17092  37.62953  34.45808  1.000 68.01903  ?  45  ASP D OD1 1 
ATOM   4485 O  OD2 . ASP D  1 45  ? 22.21056  39.44271  35.14217  1.000 77.36113  -1 45  ASP D OD2 1 
ATOM   4486 N  N   . VAL D  1 46  ? 22.11651  34.79239  32.67258  1.000 55.95388  ?  46  VAL D N   1 
ATOM   4487 C  CA  . VAL D  1 46  ? 22.28434  33.42964  33.16828  1.000 50.08928  ?  46  VAL D CA  1 
ATOM   4488 C  C   . VAL D  1 46  ? 22.22636  32.47489  31.97875  1.000 48.00154  ?  46  VAL D C   1 
ATOM   4489 O  O   . VAL D  1 46  ? 23.19248  31.76280  31.68813  1.000 54.03536  ?  46  VAL D O   1 
ATOM   4490 C  CB  . VAL D  1 46  ? 21.22167  33.08356  34.22564  1.000 51.42020  ?  46  VAL D CB  1 
ATOM   4491 C  CG1 . VAL D  1 46  ? 21.39101  31.64712  34.67871  1.000 54.94478  ?  46  VAL D CG1 1 
ATOM   4492 C  CG2 . VAL D  1 46  ? 21.29262  34.05566  35.40093  1.000 48.63837  ?  46  VAL D CG2 1 
ATOM   4493 N  N   . ALA D  1 47  ? 21.08252  32.43496  31.30163  1.000 47.21600  ?  47  ALA D N   1 
ATOM   4494 C  CA  . ALA D  1 47  ? 20.99664  31.92810  29.93311  1.000 52.52042  ?  47  ALA D CA  1 
ATOM   4495 C  C   . ALA D  1 47  ? 21.35350  30.43736  29.82641  1.000 45.93933  ?  47  ALA D C   1 
ATOM   4496 O  O   . ALA D  1 47  ? 22.09193  30.01109  28.93566  1.000 42.30160  ?  47  ALA D O   1 
ATOM   4497 C  CB  . ALA D  1 47  ? 21.88067  32.77123  29.01180  1.000 57.20697  ?  47  ALA D CB  1 
ATOM   4498 N  N   . LEU D  1 48  ? 20.79639  29.63671  30.72722  1.000 43.89626  ?  48  LEU D N   1 
ATOM   4499 C  CA  . LEU D  1 48  ? 20.96909  28.18275  30.70466  1.000 49.00528  ?  48  LEU D CA  1 
ATOM   4500 C  C   . LEU D  1 48  ? 19.60218  27.60026  30.35944  1.000 46.09961  ?  48  LEU D C   1 
ATOM   4501 O  O   . LEU D  1 48  ? 18.78934  27.33940  31.24796  1.000 46.31343  ?  48  LEU D O   1 
ATOM   4502 C  CB  . LEU D  1 48  ? 21.52111  27.65695  32.05911  1.000 43.63788  ?  48  LEU D CB  1 
ATOM   4503 C  CG  . LEU D  1 48  ? 22.97152  28.06897  32.32804  1.000 44.67464  ?  48  LEU D CG  1 
ATOM   4504 C  CD1 . LEU D  1 48  ? 23.30245  28.04130  33.80290  1.000 46.01020  ?  48  LEU D CD1 1 
ATOM   4505 C  CD2 . LEU D  1 48  ? 23.95171  27.18000  31.55663  1.000 48.57635  ?  48  LEU D CD2 1 
ATOM   4506 N  N   . LYS D  1 49  ? 19.36223  27.39333  29.05824  1.000 45.45998  ?  49  LYS D N   1 
ATOM   4507 C  CA  . LYS D  1 49  ? 18.01444  27.10504  28.57557  1.000 43.54007  ?  49  LYS D CA  1 
ATOM   4508 C  C   . LYS D  1 49  ? 17.44968  25.80443  29.14508  1.000 54.51252  ?  49  LYS D C   1 
ATOM   4509 O  O   . LYS D  1 49  ? 16.23347  25.70421  29.38349  1.000 47.94540  ?  49  LYS D O   1 
ATOM   4510 C  CB  . LYS D  1 49  ? 18.01219  27.04122  27.04545  1.000 48.23082  ?  49  LYS D CB  1 
ATOM   4511 C  CG  . LYS D  1 49  ? 17.94654  28.38835  26.35525  1.000 49.09040  ?  49  LYS D CG  1 
ATOM   4512 N  N   . ASN D  1 50  ? 18.29465  24.78676  29.34451  1.000 44.46006  ?  50  ASN D N   1 
ATOM   4513 C  CA  . ASN D  1 50  ? 17.74899  23.49946  29.76787  1.000 47.62399  ?  50  ASN D CA  1 
ATOM   4514 C  C   . ASN D  1 50  ? 17.52489  23.44633  31.27465  1.000 47.20211  ?  50  ASN D C   1 
ATOM   4515 O  O   . ASN D  1 50  ? 16.64847  22.70717  31.73474  1.000 50.33678  ?  50  ASN D O   1 
ATOM   4516 C  CB  . ASN D  1 50  ? 18.65585  22.36252  29.30832  1.000 38.41804  ?  50  ASN D CB  1 
ATOM   4517 C  CG  . ASN D  1 50  ? 18.57434  22.14111  27.81818  1.000 47.39264  ?  50  ASN D CG  1 
ATOM   4518 O  OD1 . ASN D  1 50  ? 17.54226  22.38145  27.20280  1.000 44.74059  ?  50  ASN D OD1 1 
ATOM   4519 N  ND2 . ASN D  1 50  ? 19.67143  21.70821  27.22175  1.000 62.49338  ?  50  ASN D ND2 1 
ATOM   4520 N  N   . PHE D  1 51  ? 18.28030  24.22435  32.05562  1.000 41.51604  ?  51  PHE D N   1 
ATOM   4521 C  CA  . PHE D  1 51  ? 17.91654  24.42177  33.45777  1.000 42.89878  ?  51  PHE D CA  1 
ATOM   4522 C  C   . PHE D  1 51  ? 16.53521  25.04857  33.56534  1.000 50.89741  ?  51  PHE D C   1 
ATOM   4523 O  O   . PHE D  1 51  ? 15.70825  24.65418  34.40382  1.000 51.50473  ?  51  PHE D O   1 
ATOM   4524 C  CB  . PHE D  1 51  ? 18.93507  25.32902  34.12476  1.000 44.06989  ?  51  PHE D CB  1 
ATOM   4525 C  CG  . PHE D  1 51  ? 20.04419  24.60958  34.79627  1.000 44.70248  ?  51  PHE D CG  1 
ATOM   4526 C  CD1 . PHE D  1 51  ? 19.90992  24.18292  36.10602  1.000 47.52106  ?  51  PHE D CD1 1 
ATOM   4527 C  CD2 . PHE D  1 51  ? 21.23297  24.38332  34.13291  1.000 44.17023  ?  51  PHE D CD2 1 
ATOM   4528 C  CE1 . PHE D  1 51  ? 20.95611  23.52295  36.74820  1.000 51.05970  ?  51  PHE D CE1 1 
ATOM   4529 C  CE2 . PHE D  1 51  ? 22.26861  23.73311  34.75690  1.000 44.79102  ?  51  PHE D CE2 1 
ATOM   4530 C  CZ  . PHE D  1 51  ? 22.13455  23.30456  36.07431  1.000 45.99811  ?  51  PHE D CZ  1 
ATOM   4531 N  N   . ALA D  1 52  ? 16.28352  26.04189  32.71455  1.000 50.24654  ?  52  ALA D N   1 
ATOM   4532 C  CA  . ALA D  1 52  ? 14.98973  26.69832  32.66466  1.000 51.38432  ?  52  ALA D CA  1 
ATOM   4533 C  C   . ALA D  1 52  ? 13.88733  25.69860  32.33015  1.000 52.74630  ?  52  ALA D C   1 
ATOM   4534 O  O   . ALA D  1 52  ? 12.84964  25.64585  33.01029  1.000 50.67763  ?  52  ALA D O   1 
ATOM   4535 C  CB  . ALA D  1 52  ? 15.04044  27.82835  31.63657  1.000 41.92525  ?  52  ALA D CB  1 
ATOM   4536 N  N   . LYS D  1 53  ? 14.09358  24.90464  31.27148  1.000 53.01440  ?  53  LYS D N   1 
ATOM   4537 C  CA  . LYS D  1 53  ? 13.09119  23.92018  30.87044  1.000 43.74867  ?  53  LYS D CA  1 
ATOM   4538 C  C   . LYS D  1 53  ? 12.83962  22.91622  31.98927  1.000 48.03967  ?  53  LYS D C   1 
ATOM   4539 O  O   . LYS D  1 53  ? 11.68799  22.59239  32.30643  1.000 53.58452  ?  53  LYS D O   1 
ATOM   4540 C  CB  . LYS D  1 53  ? 13.54103  23.20770  29.59027  1.000 57.02134  ?  53  LYS D CB  1 
ATOM   4541 C  CG  . LYS D  1 53  ? 13.52232  24.08941  28.32468  1.000 59.05373  ?  53  LYS D CG  1 
ATOM   4542 N  N   . TYR D  1 54  ? 13.91785  22.42490  32.60691  1.000 48.37035  ?  54  TYR D N   1 
ATOM   4543 C  CA  . TYR D  1 54  ? 13.80680  21.45618  33.68960  1.000 45.22337  ?  54  TYR D CA  1 
ATOM   4544 C  C   . TYR D  1 54  ? 12.96023  21.99767  34.83215  1.000 45.71236  ?  54  TYR D C   1 
ATOM   4545 O  O   . TYR D  1 54  ? 12.04200  21.32310  35.31591  1.000 55.78205  ?  54  TYR D O   1 
ATOM   4546 C  CB  . TYR D  1 54  ? 15.20808  21.08876  34.18777  1.000 52.87258  ?  54  TYR D CB  1 
ATOM   4547 C  CG  . TYR D  1 54  ? 15.22336  20.05891  35.30539  1.000 51.55539  ?  54  TYR D CG  1 
ATOM   4548 C  CD1 . TYR D  1 54  ? 15.17538  18.69363  35.01815  1.000 43.38574  ?  54  TYR D CD1 1 
ATOM   4549 C  CD2 . TYR D  1 54  ? 15.28083  20.44759  36.63918  1.000 46.13343  ?  54  TYR D CD2 1 
ATOM   4550 C  CE1 . TYR D  1 54  ? 15.17223  17.74843  36.02831  1.000 43.23581  ?  54  TYR D CE1 1 
ATOM   4551 C  CE2 . TYR D  1 54  ? 15.28588  19.50380  37.65644  1.000 52.96686  ?  54  TYR D CE2 1 
ATOM   4552 C  CZ  . TYR D  1 54  ? 15.22972  18.15331  37.34312  1.000 51.43038  ?  54  TYR D CZ  1 
ATOM   4553 O  OH  . TYR D  1 54  ? 15.23552  17.19689  38.34236  1.000 57.27448  ?  54  TYR D OH  1 
ATOM   4554 N  N   . PHE D  1 55  ? 13.26416  23.21101  35.30026  1.000 43.66053  ?  55  PHE D N   1 
ATOM   4555 C  CA  . PHE D  1 55  ? 12.49505  23.71330  36.43322  1.000 44.88446  ?  55  PHE D CA  1 
ATOM   4556 C  C   . PHE D  1 55  ? 11.05604  24.06800  36.04195  1.000 52.13736  ?  55  PHE D C   1 
ATOM   4557 O  O   . PHE D  1 55  ? 10.15631  23.94554  36.87676  1.000 53.42863  ?  55  PHE D O   1 
ATOM   4558 C  CB  . PHE D  1 55  ? 13.22396  24.88522  37.08386  1.000 46.05986  ?  55  PHE D CB  1 
ATOM   4559 C  CG  . PHE D  1 55  ? 14.45982  24.45899  37.84178  1.000 51.42868  ?  55  PHE D CG  1 
ATOM   4560 C  CD1 . PHE D  1 55  ? 14.38918  23.45539  38.79528  1.000 48.72004  ?  55  PHE D CD1 1 
ATOM   4561 C  CD2 . PHE D  1 55  ? 15.69905  25.01734  37.55674  1.000 48.07893  ?  55  PHE D CD2 1 
ATOM   4562 C  CE1 . PHE D  1 55  ? 15.53355  23.03241  39.46986  1.000 59.18179  ?  55  PHE D CE1 1 
ATOM   4563 C  CE2 . PHE D  1 55  ? 16.84472  24.59518  38.22500  1.000 47.76328  ?  55  PHE D CE2 1 
ATOM   4564 C  CZ  . PHE D  1 55  ? 16.76736  23.61228  39.17931  1.000 48.46244  ?  55  PHE D CZ  1 
ATOM   4565 N  N   . LEU D  1 56  ? 10.79716  24.44886  34.78260  1.000 43.22552  ?  56  LEU D N   1 
ATOM   4566 C  CA  . LEU D  1 56  ? 9.41270   24.72373  34.38229  1.000 55.43258  ?  56  LEU D CA  1 
ATOM   4567 C  C   . LEU D  1 56  ? 8.58253   23.43917  34.33736  1.000 51.87212  ?  56  LEU D C   1 
ATOM   4568 O  O   . LEU D  1 56  ? 7.39661   23.43550  34.71230  1.000 50.03781  ?  56  LEU D O   1 
ATOM   4569 C  CB  . LEU D  1 56  ? 9.37331   25.43468  33.02019  1.000 47.21792  ?  56  LEU D CB  1 
ATOM   4570 C  CG  . LEU D  1 56  ? 7.97887   25.86138  32.52836  1.000 45.17566  ?  56  LEU D CG  1 
ATOM   4571 C  CD1 . LEU D  1 56  ? 7.33828   26.84472  33.48267  1.000 44.47107  ?  56  LEU D CD1 1 
ATOM   4572 C  CD2 . LEU D  1 56  ? 8.00934   26.42894  31.12608  1.000 43.46243  ?  56  LEU D CD2 1 
ATOM   4573 N  N   . HIS D  1 57  ? 9.19526   22.33623  33.88902  1.000 43.21469  ?  57  HIS D N   1 
ATOM   4574 C  CA  . HIS D  1 57  ? 8.51985   21.04475  33.95062  1.000 43.11282  ?  57  HIS D CA  1 
ATOM   4575 C  C   . HIS D  1 57  ? 8.29086   20.60014  35.39230  1.000 45.64669  ?  57  HIS D C   1 
ATOM   4576 O  O   . HIS D  1 57  ? 7.20951   20.09933  35.72707  1.000 44.37816  ?  57  HIS D O   1 
ATOM   4577 C  CB  . HIS D  1 57  ? 9.31317   19.98311  33.19926  1.000 51.67407  ?  57  HIS D CB  1 
ATOM   4578 C  CG  . HIS D  1 57  ? 8.61804   18.65805  33.13751  1.000 60.31367  ?  57  HIS D CG  1 
ATOM   4579 N  ND1 . HIS D  1 57  ? 7.54628   18.42016  32.29996  1.000 63.68599  ?  57  HIS D ND1 1 
ATOM   4580 C  CD2 . HIS D  1 57  ? 8.82292   17.50760  33.82650  1.000 63.51252  ?  57  HIS D CD2 1 
ATOM   4581 C  CE1 . HIS D  1 57  ? 7.13311   17.17422  32.46230  1.000 63.89985  ?  57  HIS D CE1 1 
ATOM   4582 N  NE2 . HIS D  1 57  ? 7.88996   16.59882  33.38233  1.000 65.41936  ?  57  HIS D NE2 1 
ATOM   4583 N  N   . GLN D  1 58  ? 9.29245   20.75304  36.26053  1.000 43.49641  ?  58  GLN D N   1 
ATOM   4584 C  CA  . GLN D  1 58  ? 9.03837   20.46300  37.66632  1.000 48.23170  ?  58  GLN D CA  1 
ATOM   4585 C  C   . GLN D  1 58  ? 7.86847   21.28954  38.19068  1.000 57.31711  ?  58  GLN D C   1 
ATOM   4586 O  O   . GLN D  1 58  ? 7.03514   20.78263  38.95391  1.000 67.92002  ?  58  GLN D O   1 
ATOM   4587 C  CB  . GLN D  1 58  ? 10.29062  20.71767  38.49866  1.000 48.17442  ?  58  GLN D CB  1 
ATOM   4588 C  CG  . GLN D  1 58  ? 11.49087  19.89913  38.08030  1.000 55.41406  ?  58  GLN D CG  1 
ATOM   4589 C  CD  . GLN D  1 58  ? 11.36793  18.43750  38.47319  1.000 67.18171  ?  58  GLN D CD  1 
ATOM   4590 O  OE1 . GLN D  1 58  ? 11.32639  18.10358  39.66865  1.000 69.35618  ?  58  GLN D OE1 1 
ATOM   4591 N  NE2 . GLN D  1 58  ? 11.30212  17.54994  37.46490  1.000 58.47770  ?  58  GLN D NE2 1 
ATOM   4592 N  N   . SER D  1 59  ? 7.79272   22.56532  37.79279  1.000 52.89364  ?  59  SER D N   1 
ATOM   4593 C  CA  . SER D  1 59  ? 6.70744   23.43508  38.24226  1.000 51.22580  ?  59  SER D CA  1 
ATOM   4594 C  C   . SER D  1 59  ? 5.35408   22.87447  37.84144  1.000 45.36243  ?  59  SER D C   1 
ATOM   4595 O  O   . SER D  1 59  ? 4.45090   22.73421  38.67650  1.000 54.05370  ?  59  SER D O   1 
ATOM   4596 C  CB  . SER D  1 59  ? 6.87685   24.83971  37.66602  1.000 46.80846  ?  59  SER D CB  1 
ATOM   4597 O  OG  . SER D  1 59  ? 5.83350   25.68348  38.11824  1.000 46.57505  ?  59  SER D OG  1 
ATOM   4598 N  N   . HIS D  1 60  ? 5.19330   22.56793  36.55766  1.000 43.93850  ?  60  HIS D N   1 
ATOM   4599 C  CA  . HIS D  1 60  ? 3.93718   21.99163  36.08873  1.000 43.23181  ?  60  HIS D CA  1 
ATOM   4600 C  C   . HIS D  1 60  ? 3.61187   20.66856  36.78043  1.000 50.61702  ?  60  HIS D C   1 
ATOM   4601 O  O   . HIS D  1 60  ? 2.44384   20.38952  37.07235  1.000 62.22256  ?  60  HIS D O   1 
ATOM   4602 C  CB  . HIS D  1 60  ? 3.99683   21.79924  34.58574  1.000 43.48154  ?  60  HIS D CB  1 
ATOM   4603 C  CG  . HIS D  1 60  ? 4.18793   23.07316  33.83366  1.000 56.39681  ?  60  HIS D CG  1 
ATOM   4604 N  ND1 . HIS D  1 60  ? 4.61497   23.10567  32.52468  1.000 59.22914  ?  60  HIS D ND1 1 
ATOM   4605 C  CD2 . HIS D  1 60  ? 4.03232   24.36431  34.21326  1.000 58.11487  ?  60  HIS D CD2 1 
ATOM   4606 C  CE1 . HIS D  1 60  ? 4.68797   24.36234  32.12244  1.000 56.52268  ?  60  HIS D CE1 1 
ATOM   4607 N  NE2 . HIS D  1 60  ? 4.34030   25.14530  33.12735  1.000 56.66879  ?  60  HIS D NE2 1 
ATOM   4608 N  N   . GLU D  1 61  ? 4.61775   19.82763  37.03569  1.000 54.59099  ?  61  GLU D N   1 
ATOM   4609 C  CA  . GLU D  1 61  ? 4.34863   18.56934  37.73333  1.000 54.31115  ?  61  GLU D CA  1 
ATOM   4610 C  C   . GLU D  1 61  ? 3.83217   18.81765  39.14742  1.000 51.66910  ?  61  GLU D C   1 
ATOM   4611 O  O   . GLU D  1 61  ? 2.89028   18.15333  39.59836  1.000 60.69228  ?  61  GLU D O   1 
ATOM   4612 C  CB  . GLU D  1 61  ? 5.60467   17.69809  37.75118  1.000 51.55538  ?  61  GLU D CB  1 
ATOM   4613 C  CG  . GLU D  1 61  ? 5.90623   17.05960  36.39339  1.000 56.00378  ?  61  GLU D CG  1 
ATOM   4614 N  N   . GLU D  1 62  ? 4.41054   19.78778  39.85436  1.000 49.33365  ?  62  GLU D N   1 
ATOM   4615 C  CA  . GLU D  1 62  ? 3.90283   20.09543  41.18697  1.000 57.90242  ?  62  GLU D CA  1 
ATOM   4616 C  C   . GLU D  1 62  ? 2.47484   20.63157  41.11819  1.000 55.32411  ?  62  GLU D C   1 
ATOM   4617 O  O   . GLU D  1 62  ? 1.63763   20.30720  41.97082  1.000 51.11602  ?  62  GLU D O   1 
ATOM   4618 C  CB  . GLU D  1 62  ? 4.82426   21.08714  41.89602  1.000 59.78884  ?  62  GLU D CB  1 
ATOM   4619 C  CG  . GLU D  1 62  ? 6.21517   20.54085  42.16456  1.000 63.55711  ?  62  GLU D CG  1 
ATOM   4620 C  CD  . GLU D  1 62  ? 6.21678   19.30005  43.04359  1.000 64.66714  ?  62  GLU D CD  1 
ATOM   4621 O  OE1 . GLU D  1 62  ? 6.75120   18.25770  42.60440  1.000 71.87943  ?  62  GLU D OE1 1 
ATOM   4622 O  OE2 . GLU D  1 62  ? 5.70505   19.36571  44.17668  1.000 64.72121  -1 62  GLU D OE2 1 
ATOM   4623 N  N   . ARG D  1 63  ? 2.16998   21.44532  40.10880  1.000 49.16088  ?  63  ARG D N   1 
ATOM   4624 C  CA  . ARG D  1 63  ? 0.79853   21.92882  39.99140  1.000 53.87367  ?  63  ARG D CA  1 
ATOM   4625 C  C   . ARG D  1 63  ? -0.16692  20.77435  39.74665  1.000 53.52240  ?  63  ARG D C   1 
ATOM   4626 O  O   . ARG D  1 63  ? -1.26356  20.74302  40.31518  1.000 53.85973  ?  63  ARG D O   1 
ATOM   4627 C  CB  . ARG D  1 63  ? 0.67540   22.96158  38.86640  1.000 58.56922  ?  63  ARG D CB  1 
ATOM   4628 C  CG  . ARG D  1 63  ? -0.32156  24.08879  39.19611  1.000 59.73432  ?  63  ARG D CG  1 
ATOM   4629 C  CD  . ARG D  1 63  ? -1.21757  24.43250  38.01421  1.000 59.93763  ?  63  ARG D CD  1 
ATOM   4630 N  N   . GLU D  1 64  ? 0.22923   19.81307  38.91569  1.000 56.49122  ?  64  GLU D N   1 
ATOM   4631 C  CA  . GLU D  1 64  ? -0.59420  18.62646  38.69207  1.000 54.06152  ?  64  GLU D CA  1 
ATOM   4632 C  C   . GLU D  1 64  ? -0.79663  17.82945  39.97585  1.000 53.71737  ?  64  GLU D C   1 
ATOM   4633 O  O   . GLU D  1 64  ? -1.86727  17.26719  40.18430  1.000 55.01208  ?  64  GLU D O   1 
ATOM   4634 C  CB  . GLU D  1 64  ? 0.03167   17.73884  37.61710  1.000 48.02893  ?  64  GLU D CB  1 
ATOM   4635 C  CG  . GLU D  1 64  ? -0.06848  18.31495  36.21710  1.000 58.73889  ?  64  GLU D CG  1 
ATOM   4636 N  N   . HIS D  1 65  ? 0.19613   17.77976  40.86199  1.000 50.25468  ?  65  HIS D N   1 
ATOM   4637 C  CA  . HIS D  1 65  ? -0.04337  17.08906  42.12791  1.000 59.54721  ?  65  HIS D CA  1 
ATOM   4638 C  C   . HIS D  1 65  ? -0.99485  17.87097  43.00967  1.000 59.43094  ?  65  HIS D C   1 
ATOM   4639 O  O   . HIS D  1 65  ? -1.81289  17.28186  43.71370  1.000 73.98666  ?  65  HIS D O   1 
ATOM   4640 C  CB  . HIS D  1 65  ? 1.23027   16.87222  42.91952  1.000 67.56067  ?  65  HIS D CB  1 
ATOM   4641 C  CG  . HIS D  1 65  ? 2.21085   15.99685  42.25803  1.000 72.50328  ?  65  HIS D CG  1 
ATOM   4642 N  ND1 . HIS D  1 65  ? 3.53500   16.05300  42.58200  1.000 74.66550  ?  65  HIS D ND1 1 
ATOM   4643 C  CD2 . HIS D  1 65  ? 2.08101   15.04040  41.31176  1.000 75.27837  ?  65  HIS D CD2 1 
ATOM   4644 C  CE1 . HIS D  1 65  ? 4.20044   15.17488  41.85334  1.000 76.93856  ?  65  HIS D CE1 1 
ATOM   4645 N  NE2 . HIS D  1 65  ? 3.33925   14.54573  41.07270  1.000 79.37674  ?  65  HIS D NE2 1 
ATOM   4646 N  N   . ALA D  1 66  ? -0.83237  19.18528  43.07567  1.000 54.18649  ?  66  ALA D N   1 
ATOM   4647 C  CA  . ALA D  1 66  ? -1.77061  19.97879  43.85748  1.000 57.96511  ?  66  ALA D CA  1 
ATOM   4648 C  C   . ALA D  1 66  ? -3.18812  19.71105  43.37798  1.000 54.10609  ?  66  ALA D C   1 
ATOM   4649 O  O   . ALA D  1 66  ? -4.09107  19.46004  44.17679  1.000 58.74816  ?  66  ALA D O   1 
ATOM   4650 C  CB  . ALA D  1 66  ? -1.40874  21.46298  43.75399  1.000 51.10690  ?  66  ALA D CB  1 
ATOM   4651 N  N   . GLU D  1 67  ? -3.38491  19.70301  42.06346  1.000 48.75674  ?  67  GLU D N   1 
ATOM   4652 C  CA  . GLU D  1 67  ? -4.70170  19.41214  41.51444  1.000 50.45903  ?  67  GLU D CA  1 
ATOM   4653 C  C   . GLU D  1 67  ? -5.14223  17.98432  41.82092  1.000 54.74317  ?  67  GLU D C   1 
ATOM   4654 O  O   . GLU D  1 67  ? -6.33700  17.73592  42.00991  1.000 57.11918  ?  67  GLU D O   1 
ATOM   4655 C  CB  . GLU D  1 67  ? -4.70259  19.64904  40.00299  1.000 54.16507  ?  67  GLU D CB  1 
ATOM   4656 C  CG  . GLU D  1 67  ? -4.65617  21.10713  39.57597  1.000 53.00327  ?  67  GLU D CG  1 
ATOM   4657 C  CD  . GLU D  1 67  ? -4.32011  21.26362  38.09970  1.000 55.89438  ?  67  GLU D CD  1 
ATOM   4658 O  OE1 . GLU D  1 67  ? -4.52129  20.29970  37.32151  1.000 64.94290  ?  67  GLU D OE1 1 
ATOM   4659 O  OE2 . GLU D  1 67  ? -3.82964  22.34309  37.71356  1.000 63.43724  -1 67  GLU D OE2 1 
ATOM   4660 N  N   . LYS D  1 68  ? -4.20598  17.03318  41.86592  1.000 48.06506  ?  68  LYS D N   1 
ATOM   4661 C  CA  . LYS D  1 68  ? -4.56937  15.67158  42.24468  1.000 54.70824  ?  68  LYS D CA  1 
ATOM   4662 C  C   . LYS D  1 68  ? -5.06895  15.62195  43.68769  1.000 58.55034  ?  68  LYS D C   1 
ATOM   4663 O  O   . LYS D  1 68  ? -6.05485  14.94176  43.99257  1.000 60.51513  ?  68  LYS D O   1 
ATOM   4664 C  CB  . LYS D  1 68  ? -3.36852  14.74294  42.04130  1.000 52.97210  ?  68  LYS D CB  1 
ATOM   4665 C  CG  . LYS D  1 68  ? -3.66133  13.25653  42.19157  1.000 52.38111  ?  68  LYS D CG  1 
ATOM   4666 N  N   . LEU D  1 69  ? -4.41588  16.35990  44.58104  1.000 54.96676  ?  69  LEU D N   1 
ATOM   4667 C  CA  . LEU D  1 69  ? -4.85704  16.40767  45.96990  1.000 57.51267  ?  69  LEU D CA  1 
ATOM   4668 C  C   . LEU D  1 69  ? -6.21049  17.09949  46.09518  1.000 67.80569  ?  69  LEU D C   1 
ATOM   4669 O  O   . LEU D  1 69  ? -7.04046  16.71407  46.92784  1.000 73.61985  ?  69  LEU D O   1 
ATOM   4670 C  CB  . LEU D  1 69  ? -3.80949  17.11895  46.82015  1.000 61.11898  ?  69  LEU D CB  1 
ATOM   4671 C  CG  . LEU D  1 69  ? -2.48439  16.39467  47.08352  1.000 63.93524  ?  69  LEU D CG  1 
ATOM   4672 C  CD1 . LEU D  1 69  ? -1.48983  17.34941  47.76237  1.000 64.11358  ?  69  LEU D CD1 1 
ATOM   4673 C  CD2 . LEU D  1 69  ? -2.69061  15.14037  47.92224  1.000 58.30475  ?  69  LEU D CD2 1 
ATOM   4674 N  N   . MET D  1 70  ? -6.44345  18.13922  45.29256  1.000 68.00772  ?  70  MET D N   1 
ATOM   4675 C  CA  . MET D  1 70  ? -7.77417  18.73719  45.24103  1.000 61.04540  ?  70  MET D CA  1 
ATOM   4676 C  C   . MET D  1 70  ? -8.81004  17.70745  44.80078  1.000 62.14270  ?  70  MET D C   1 
ATOM   4677 O  O   . MET D  1 70  ? -9.88363  17.58629  45.40969  1.000 67.58252  ?  70  MET D O   1 
ATOM   4678 C  CB  . MET D  1 70  ? -7.75879  19.94863  44.31127  1.000 51.34861  ?  70  MET D CB  1 
ATOM   4679 C  CG  . MET D  1 70  ? -6.76889  21.00874  44.77694  1.000 60.78858  ?  70  MET D CG  1 
ATOM   4680 S  SD  . MET D  1 70  ? -6.64232  22.48605  43.74624  1.000 58.18409  ?  70  MET D SD  1 
ATOM   4681 C  CE  . MET D  1 70  ? -8.27951  23.17053  43.97991  1.000 53.70860  ?  70  MET D CE  1 
ATOM   4682 N  N   . LYS D  1 71  ? -8.49044  16.94210  43.75687  1.000 58.38875  ?  71  LYS D N   1 
ATOM   4683 C  CA  . LYS D  1 71  ? -9.38909  15.89314  43.28921  1.000 53.36799  ?  71  LYS D CA  1 
ATOM   4684 C  C   . LYS D  1 71  ? -9.67030  14.87402  44.38281  1.000 58.31073  ?  71  LYS D C   1 
ATOM   4685 O  O   . LYS D  1 71  ? -10.80473 14.40222  44.52552  1.000 57.57106  ?  71  LYS D O   1 
ATOM   4686 C  CB  . LYS D  1 71  ? -8.79430  15.20311  42.07180  1.000 48.18810  ?  71  LYS D CB  1 
ATOM   4687 C  CG  . LYS D  1 71  ? -9.79455  14.34389  41.35126  1.000 55.51044  ?  71  LYS D CG  1 
ATOM   4688 C  CD  . LYS D  1 71  ? -9.16018  13.28627  40.49092  1.000 47.39290  ?  71  LYS D CD  1 
ATOM   4689 C  CE  . LYS D  1 71  ? -10.20299 12.68053  39.59264  1.000 47.03287  ?  71  LYS D CE  1 
ATOM   4690 N  NZ  . LYS D  1 71  ? -9.65450  12.45048  38.23169  1.000 59.75672  ?  71  LYS D NZ  1 
ATOM   4691 N  N   . LEU D  1 72  ? -8.65064  14.53258  45.17112  1.000 55.80375  ?  72  LEU D N   1 
ATOM   4692 C  CA  . LEU D  1 72  ? -8.84035  13.55755  46.23912  1.000 57.23684  ?  72  LEU D CA  1 
ATOM   4693 C  C   . LEU D  1 72  ? -9.71188  14.13068  47.34473  1.000 60.41934  ?  72  LEU D C   1 
ATOM   4694 O  O   . LEU D  1 72  ? -10.58321 13.43628  47.87798  1.000 61.79529  ?  72  LEU D O   1 
ATOM   4695 C  CB  . LEU D  1 72  ? -7.48702  13.11214  46.80030  1.000 57.74539  ?  72  LEU D CB  1 
ATOM   4696 C  CG  . LEU D  1 72  ? -7.45049  12.00507  47.86043  1.000 56.14274  ?  72  LEU D CG  1 
ATOM   4697 C  CD1 . LEU D  1 72  ? -7.50856  12.56618  49.26352  1.000 60.01746  ?  72  LEU D CD1 1 
ATOM   4698 C  CD2 . LEU D  1 72  ? -8.58891  11.01722  47.63929  1.000 55.99536  ?  72  LEU D CD2 1 
ATOM   4699 N  N   . GLN D  1 73  ? -9.47262  15.39072  47.71271  1.000 59.02636  ?  73  GLN D N   1 
ATOM   4700 C  CA  . GLN D  1 73  ? -10.33757 16.08789  48.65655  1.000 61.03250  ?  73  GLN D CA  1 
ATOM   4701 C  C   . GLN D  1 73  ? -11.79873 15.98176  48.23888  1.000 58.16478  ?  73  GLN D C   1 
ATOM   4702 O  O   . GLN D  1 73  ? -12.65129 15.52444  49.00936  1.000 59.74813  ?  73  GLN D O   1 
ATOM   4703 C  CB  . GLN D  1 73  ? -9.90213  17.54829  48.75946  1.000 62.40799  ?  73  GLN D CB  1 
ATOM   4704 C  CG  . GLN D  1 73  ? -10.67947 18.33484  49.77647  1.000 60.81042  ?  73  GLN D CG  1 
ATOM   4705 C  CD  . GLN D  1 73  ? -10.21704 18.05558  51.17953  1.000 64.74612  ?  73  GLN D CD  1 
ATOM   4706 O  OE1 . GLN D  1 73  ? -10.60712 17.05534  51.77424  1.000 69.18445  ?  73  GLN D OE1 1 
ATOM   4707 N  NE2 . GLN D  1 73  ? -9.38920  18.94635  51.72994  1.000 67.82006  ?  73  GLN D NE2 1 
ATOM   4708 N  N   . ASN D  1 74  ? -12.09772 16.36216  46.99973  1.000 60.25042  ?  74  ASN D N   1 
ATOM   4709 C  CA  . ASN D  1 74  ? -13.47480 16.26242  46.52728  1.000 60.43195  ?  74  ASN D CA  1 
ATOM   4710 C  C   . ASN D  1 74  ? -13.95982 14.81739  46.51071  1.000 66.99308  ?  74  ASN D C   1 
ATOM   4711 O  O   . ASN D  1 74  ? -15.12621 14.54621  46.82420  1.000 74.95992  ?  74  ASN D O   1 
ATOM   4712 C  CB  . ASN D  1 74  ? -13.59636 16.89487  45.14838  1.000 61.73881  ?  74  ASN D CB  1 
ATOM   4713 C  CG  . ASN D  1 74  ? -13.71929 18.39093  45.22596  1.000 60.28755  ?  74  ASN D CG  1 
ATOM   4714 O  OD1 . ASN D  1 74  ? -13.90460 18.94019  46.30338  1.000 65.78849  ?  74  ASN D OD1 1 
ATOM   4715 N  ND2 . ASN D  1 74  ? -13.61923 19.05921  44.08991  1.000 65.66492  ?  74  ASN D ND2 1 
ATOM   4716 N  N   . GLN D  1 75  ? -13.07382 13.87719  46.16818  1.000 65.07437  ?  75  GLN D N   1 
ATOM   4717 C  CA  . GLN D  1 75  ? -13.44605 12.46758  46.11182  1.000 56.88224  ?  75  GLN D CA  1 
ATOM   4718 C  C   . GLN D  1 75  ? -13.83957 11.93946  47.47080  1.000 60.29943  ?  75  GLN D C   1 
ATOM   4719 O  O   . GLN D  1 75  ? -14.63720 11.00148  47.56373  1.000 60.83412  ?  75  GLN D O   1 
ATOM   4720 C  CB  . GLN D  1 75  ? -12.28298 11.62468  45.60065  1.000 60.72138  ?  75  GLN D CB  1 
ATOM   4721 C  CG  . GLN D  1 75  ? -12.25461 11.41592  44.11366  1.000 68.84007  ?  75  GLN D CG  1 
ATOM   4722 C  CD  . GLN D  1 75  ? -11.03439 10.63208  43.68297  1.000 72.22643  ?  75  GLN D CD  1 
ATOM   4723 O  OE1 . GLN D  1 75  ? -9.91428  10.92402  44.11383  1.000 70.26666  ?  75  GLN D OE1 1 
ATOM   4724 N  NE2 . GLN D  1 75  ? -11.23875 9.64318   42.81411  1.000 63.17750  ?  75  GLN D NE2 1 
ATOM   4725 N  N   . ARG D  1 76  ? -13.25051 12.48350  48.52571  1.000 58.48437  ?  76  ARG D N   1 
ATOM   4726 C  CA  . ARG D  1 76  ? -13.43105 11.94702  49.85978  1.000 63.89055  ?  76  ARG D CA  1 
ATOM   4727 C  C   . ARG D  1 76  ? -14.55778 12.62276  50.61407  1.000 73.41929  ?  76  ARG D C   1 
ATOM   4728 O  O   . ARG D  1 76  ? -14.85617 12.21643  51.74099  1.000 75.67062  ?  76  ARG D O   1 
ATOM   4729 C  CB  . ARG D  1 76  ? -12.12855 12.06601  50.64895  1.000 70.82813  ?  76  ARG D CB  1 
ATOM   4730 C  CG  . ARG D  1 76  ? -11.32804 10.77998  50.65636  1.000 74.50639  ?  76  ARG D CG  1 
ATOM   4731 C  CD  . ARG D  1 76  ? -12.20566 9.61420   51.08428  1.000 77.93405  ?  76  ARG D CD  1 
ATOM   4732 N  NE  . ARG D  1 76  ? -11.43440 8.40346   51.33762  1.000 78.50599  ?  76  ARG D NE  1 
ATOM   4733 C  CZ  . ARG D  1 76  ? -10.66400 8.22000   52.40400  1.000 78.62126  ?  76  ARG D CZ  1 
ATOM   4734 N  NH1 . ARG D  1 76  ? -10.55970 9.16832   53.31506  1.000 82.45853  ?  76  ARG D NH1 1 
ATOM   4735 N  NH2 . ARG D  1 76  ? -9.99453  7.09282   52.56521  1.000 84.29285  ?  76  ARG D NH2 1 
ATOM   4736 N  N   . GLY D  1 77  ? -15.19617 13.62374  50.01345  1.000 76.19770  ?  77  GLY D N   1 
ATOM   4737 C  CA  . GLY D  1 77  ? -16.25577 14.36327  50.65797  1.000 69.38729  ?  77  GLY D CA  1 
ATOM   4738 C  C   . GLY D  1 77  ? -15.79205 15.57039  51.42829  1.000 72.00588  ?  77  GLY D C   1 
ATOM   4739 O  O   . GLY D  1 77  ? -16.60719 16.19500  52.11854  1.000 77.68198  ?  77  GLY D O   1 
ATOM   4740 N  N   . GLY D  1 78  ? -14.50652 15.90852  51.34794  1.000 70.94958  ?  78  GLY D N   1 
ATOM   4741 C  CA  . GLY D  1 78  ? -13.97167 17.04095  52.06234  1.000 70.09129  ?  78  GLY D CA  1 
ATOM   4742 C  C   . GLY D  1 78  ? -14.22339 18.33444  51.32389  1.000 71.51648  ?  78  GLY D C   1 
ATOM   4743 O  O   . GLY D  1 78  ? -14.74754 18.36267  50.20751  1.000 67.72886  ?  78  GLY D O   1 
ATOM   4744 N  N   . ARG D  1 79  ? -13.83681 19.42699  51.97902  1.000 63.21976  ?  79  ARG D N   1 
ATOM   4745 C  CA  . ARG D  1 79  ? -13.95832 20.77508  51.44192  1.000 63.72961  ?  79  ARG D CA  1 
ATOM   4746 C  C   . ARG D  1 79  ? -12.56622 21.34067  51.18571  1.000 61.44115  ?  79  ARG D C   1 
ATOM   4747 O  O   . ARG D  1 79  ? -11.74785 21.42949  52.10685  1.000 65.31052  ?  79  ARG D O   1 
ATOM   4748 C  CB  . ARG D  1 79  ? -14.73438 21.68146  52.40219  1.000 62.77561  ?  79  ARG D CB  1 
ATOM   4749 N  N   . ILE D  1 80  ? -12.30985 21.73054  49.93879  1.000 61.20484  ?  80  ILE D N   1 
ATOM   4750 C  CA  . ILE D  1 80  ? -11.08110 22.43239  49.58566  1.000 61.76917  ?  80  ILE D CA  1 
ATOM   4751 C  C   . ILE D  1 80  ? -11.12673 23.83511  50.17822  1.000 68.55185  ?  80  ILE D C   1 
ATOM   4752 O  O   . ILE D  1 80  ? -12.06886 24.59719  49.93473  1.000 76.98982  ?  80  ILE D O   1 
ATOM   4753 C  CB  . ILE D  1 80  ? -10.90146 22.48235  48.06245  1.000 61.90692  ?  80  ILE D CB  1 
ATOM   4754 C  CG1 . ILE D  1 80  ? -10.72844 21.07094  47.50305  1.000 55.39271  ?  80  ILE D CG1 1 
ATOM   4755 C  CG2 . ILE D  1 80  ? -9.70731  23.36243  47.68752  1.000 62.88270  ?  80  ILE D CG2 1 
ATOM   4756 C  CD1 . ILE D  1 80  ? -10.97332 20.94961  46.02411  1.000 53.62174  ?  80  ILE D CD1 1 
ATOM   4757 N  N   . PHE D  1 81  ? -10.11108 24.18110  50.96368  1.000 69.30616  ?  81  PHE D N   1 
ATOM   4758 C  CA  . PHE D  1 81  ? -9.95276  25.52501  51.51135  1.000 72.09692  ?  81  PHE D CA  1 
ATOM   4759 C  C   . PHE D  1 81  ? -8.57380  26.04128  51.11490  1.000 68.82639  ?  81  PHE D C   1 
ATOM   4760 O  O   . PHE D  1 81  ? -7.55450  25.56412  51.62399  1.000 68.33382  ?  81  PHE D O   1 
ATOM   4761 C  CB  . PHE D  1 81  ? -10.13681 25.52681  53.03161  1.000 74.94590  ?  81  PHE D CB  1 
ATOM   4762 C  CG  . PHE D  1 81  ? -11.57820 25.45756  53.46535  1.000 83.37558  ?  81  PHE D CG  1 
ATOM   4763 C  CD1 . PHE D  1 81  ? -12.43137 26.53958  53.26432  1.000 86.60052  ?  81  PHE D CD1 1 
ATOM   4764 C  CD2 . PHE D  1 81  ? -12.08810 24.30329  54.05393  1.000 82.93508  ?  81  PHE D CD2 1 
ATOM   4765 C  CE1 . PHE D  1 81  ? -13.76424 26.48058  53.65758  1.000 87.51169  ?  81  PHE D CE1 1 
ATOM   4766 C  CE2 . PHE D  1 81  ? -13.41889 24.23264  54.45117  1.000 86.74722  ?  81  PHE D CE2 1 
ATOM   4767 C  CZ  . PHE D  1 81  ? -14.25955 25.32392  54.25286  1.000 89.60514  ?  81  PHE D CZ  1 
ATOM   4768 N  N   . LEU D  1 82  ? -8.54391  27.01817  50.21658  1.000 63.73666  ?  82  LEU D N   1 
ATOM   4769 C  CA  . LEU D  1 82  ? -7.29307  27.55088  49.70012  1.000 65.52911  ?  82  LEU D CA  1 
ATOM   4770 C  C   . LEU D  1 82  ? -6.80798  28.74218  50.52396  1.000 69.17076  ?  82  LEU D C   1 
ATOM   4771 O  O   . LEU D  1 82  ? -7.58641  29.63863  50.87369  1.000 80.70838  ?  82  LEU D O   1 
ATOM   4772 C  CB  . LEU D  1 82  ? -7.46457  27.95397  48.23193  1.000 66.75464  ?  82  LEU D CB  1 
ATOM   4773 C  CG  . LEU D  1 82  ? -7.89063  26.82865  47.27329  1.000 62.59494  ?  82  LEU D CG  1 
ATOM   4774 C  CD1 . LEU D  1 82  ? -8.37682  27.39540  45.96052  1.000 57.64662  ?  82  LEU D CD1 1 
ATOM   4775 C  CD2 . LEU D  1 82  ? -6.76621  25.82899  47.01494  1.000 60.39395  ?  82  LEU D CD2 1 
ATOM   4776 N  N   . GLN D  1 83  ? -5.51542  28.74056  50.84330  1.000 66.95437  ?  83  GLN D N   1 
ATOM   4777 C  CA  . GLN D  1 83  ? -4.85249  29.88169  51.45636  1.000 67.02849  ?  83  GLN D CA  1 
ATOM   4778 C  C   . GLN D  1 83  ? -3.83210  30.44431  50.47776  1.000 67.09526  ?  83  GLN D C   1 
ATOM   4779 O  O   . GLN D  1 83  ? -3.52795  29.83486  49.45074  1.000 68.23815  ?  83  GLN D O   1 
ATOM   4780 C  CB  . GLN D  1 83  ? -4.18214  29.49515  52.77650  1.000 64.98715  ?  83  GLN D CB  1 
ATOM   4781 C  CG  . GLN D  1 83  ? -5.06267  29.72796  53.99613  1.000 70.71557  ?  83  GLN D CG  1 
ATOM   4782 C  CD  . GLN D  1 83  ? -5.24929  31.21534  54.32689  1.000 77.08889  ?  83  GLN D CD  1 
ATOM   4783 O  OE1 . GLN D  1 83  ? -4.71853  32.09934  53.64008  1.000 75.29988  ?  83  GLN D OE1 1 
ATOM   4784 N  NE2 . GLN D  1 83  ? -5.99592  31.49306  55.39757  1.000 81.26295  ?  83  GLN D NE2 1 
ATOM   4785 N  N   . ASP D  1 84  ? -3.31238  31.62662  50.80044  1.000 64.98672  ?  84  ASP D N   1 
ATOM   4786 C  CA  . ASP D  1 84  ? -2.35940  32.29600  49.92348  1.000 62.58139  ?  84  ASP D CA  1 
ATOM   4787 C  C   . ASP D  1 84  ? -1.17208  31.39100  49.62246  1.000 61.86295  ?  84  ASP D C   1 
ATOM   4788 O  O   . ASP D  1 84  ? -0.73389  30.60216  50.45843  1.000 67.19204  ?  84  ASP D O   1 
ATOM   4789 C  CB  . ASP D  1 84  ? -1.86134  33.59959  50.56318  1.000 66.61696  ?  84  ASP D CB  1 
ATOM   4790 C  CG  . ASP D  1 84  ? -3.00118  34.53857  50.95279  1.000 72.19030  ?  84  ASP D CG  1 
ATOM   4791 O  OD1 . ASP D  1 84  ? -4.17114  34.13946  50.80458  1.000 78.31106  ?  84  ASP D OD1 1 
ATOM   4792 O  OD2 . ASP D  1 84  ? -2.70401  35.65476  51.41019  1.000 75.96289  -1 84  ASP D OD2 1 
ATOM   4793 N  N   . ILE D  1 85  ? -0.65683  31.49698  48.40741  1.000 60.38808  ?  85  ILE D N   1 
ATOM   4794 C  CA  . ILE D  1 85  ? 0.58048   30.82765  48.03510  1.000 61.79261  ?  85  ILE D CA  1 
ATOM   4795 C  C   . ILE D  1 85  ? 1.72005   31.79574  48.31821  1.000 69.72226  ?  85  ILE D C   1 
ATOM   4796 O  O   . ILE D  1 85  ? 1.82325   32.84880  47.67489  1.000 65.20584  ?  85  ILE D O   1 
ATOM   4797 C  CB  . ILE D  1 85  ? 0.57275   30.38692  46.56489  1.000 58.87987  ?  85  ILE D CB  1 
ATOM   4798 C  CG1 . ILE D  1 85  ? -0.75982  29.70184  46.19300  1.000 56.81151  ?  85  ILE D CG1 1 
ATOM   4799 C  CG2 . ILE D  1 85  ? 1.79885   29.50108  46.26598  1.000 60.08104  ?  85  ILE D CG2 1 
ATOM   4800 C  CD1 . ILE D  1 85  ? -1.08228  29.78146  44.68241  1.000 54.99462  ?  85  ILE D CD1 1 
ATOM   4801 N  N   . GLN D  1 86  ? 2.54798   31.46551  49.30934  1.000 66.85452  ?  86  GLN D N   1 
ATOM   4802 C  CA  . GLN D  1 86  ? 3.61089   32.36866  49.72798  1.000 71.74426  ?  86  GLN D CA  1 
ATOM   4803 C  C   . GLN D  1 86  ? 4.66994   32.47103  48.63457  1.000 75.47561  ?  86  GLN D C   1 
ATOM   4804 O  O   . GLN D  1 86  ? 5.04944   31.46047  48.03202  1.000 68.20307  ?  86  GLN D O   1 
ATOM   4805 C  CB  . GLN D  1 86  ? 4.23407   31.87688  51.03609  1.000 75.06350  ?  86  GLN D CB  1 
ATOM   4806 C  CG  . GLN D  1 86  ? 3.44272   32.20921  52.30037  1.000 75.78111  ?  86  GLN D CG  1 
ATOM   4807 C  CD  . GLN D  1 86  ? 3.72915   33.59776  52.83026  1.000 83.05585  ?  86  GLN D CD  1 
ATOM   4808 O  OE1 . GLN D  1 86  ? 2.86515   34.47100  52.79298  1.000 90.16335  ?  86  GLN D OE1 1 
ATOM   4809 N  NE2 . GLN D  1 86  ? 4.94472   33.81149  53.32926  1.000 85.38643  ?  86  GLN D NE2 1 
ATOM   4810 N  N   . LYS D  1 87  ? 5.13300   33.69826  48.37423  1.000 73.28355  ?  87  LYS D N   1 
ATOM   4811 C  CA  . LYS D  1 87  ? 6.15660   33.94149  47.36846  1.000 77.46768  ?  87  LYS D CA  1 
ATOM   4812 C  C   . LYS D  1 87  ? 7.47131   33.29262  47.78829  1.000 79.31678  ?  87  LYS D C   1 
ATOM   4813 O  O   . LYS D  1 87  ? 7.77955   33.22485  48.97801  1.000 81.90628  ?  87  LYS D O   1 
ATOM   4814 C  CB  . LYS D  1 87  ? 6.36822   35.43925  47.16803  1.000 81.34297  ?  87  LYS D CB  1 
ATOM   4815 N  N   . PRO D  1 88  ? 8.25999   32.80053  46.83630  1.000 75.39924  ?  88  PRO D N   1 
ATOM   4816 C  CA  . PRO D  1 88  ? 9.50917   32.13545  47.21621  1.000 73.47831  ?  88  PRO D CA  1 
ATOM   4817 C  C   . PRO D  1 88  ? 10.41101  33.07738  48.00267  1.000 79.02505  ?  88  PRO D C   1 
ATOM   4818 O  O   . PRO D  1 88  ? 10.55764  34.25472  47.67367  1.000 78.37897  ?  88  PRO D O   1 
ATOM   4819 C  CB  . PRO D  1 88  ? 10.11618  31.73317  45.86662  1.000 74.73652  ?  88  PRO D CB  1 
ATOM   4820 C  CG  . PRO D  1 88  ? 9.45818   32.64076  44.86452  1.000 75.72325  ?  88  PRO D CG  1 
ATOM   4821 C  CD  . PRO D  1 88  ? 8.05223   32.75094  45.37700  1.000 73.98389  ?  88  PRO D CD  1 
ATOM   4822 N  N   . ASP D  1 89  ? 10.97764  32.56224  49.08643  1.000 76.48496  ?  89  ASP D N   1 
ATOM   4823 C  CA  . ASP D  1 89  ? 11.97085  33.31195  49.84792  1.000 83.30940  ?  89  ASP D CA  1 
ATOM   4824 C  C   . ASP D  1 89  ? 13.30473  33.18635  49.11719  1.000 85.78823  ?  89  ASP D C   1 
ATOM   4825 O  O   . ASP D  1 89  ? 14.23865  32.53802  49.58451  1.000 88.97128  ?  89  ASP D O   1 
ATOM   4826 C  CB  . ASP D  1 89  ? 12.04128  32.81708  51.29192  1.000 80.19620  ?  89  ASP D CB  1 
ATOM   4827 N  N   . GLU D  1 90  ? 13.34921  33.78594  47.91842  1.000 84.84491  ?  90  GLU D N   1 
ATOM   4828 C  CA  . GLU D  1 90  ? 14.53581  34.10489  47.11372  1.000 77.05159  ?  90  GLU D CA  1 
ATOM   4829 C  C   . GLU D  1 90  ? 14.07115  34.61451  45.75825  1.000 74.44712  ?  90  GLU D C   1 
ATOM   4830 O  O   . GLU D  1 90  ? 13.00776  34.22542  45.27912  1.000 69.41621  ?  90  GLU D O   1 
ATOM   4831 C  CB  . GLU D  1 90  ? 15.49569  32.91940  46.89713  1.000 67.75440  ?  90  GLU D CB  1 
ATOM   4832 C  CG  . GLU D  1 90  ? 16.67703  32.75616  47.89975  1.000 83.23918  ?  90  GLU D CG  1 
ATOM   4833 C  CD  . GLU D  1 90  ? 17.71174  33.89778  47.93777  1.000 87.25073  ?  90  GLU D CD  1 
ATOM   4834 O  OE1 . GLU D  1 90  ? 17.39599  35.05674  47.59044  1.000 86.41586  ?  90  GLU D OE1 1 
ATOM   4835 O  OE2 . GLU D  1 90  ? 18.85478  33.61117  48.34528  1.000 87.16773  -1 90  GLU D OE2 1 
ATOM   4836 N  N   . ASP D  1 91  ? 14.87387  35.46008  45.12770  1.000 77.68030  ?  91  ASP D N   1 
ATOM   4837 C  CA  . ASP D  1 91  ? 14.53084  36.12684  43.87984  1.000 66.86436  ?  91  ASP D CA  1 
ATOM   4838 C  C   . ASP D  1 91  ? 15.58509  35.73934  42.86041  1.000 67.98546  ?  91  ASP D C   1 
ATOM   4839 O  O   . ASP D  1 91  ? 15.28971  35.45395  41.69221  1.000 59.07175  ?  91  ASP D O   1 
ATOM   4840 C  CB  . ASP D  1 91  ? 14.51990  37.64017  44.09692  1.000 78.14348  ?  91  ASP D CB  1 
ATOM   4841 C  CG  . ASP D  1 91  ? 13.22117  38.14285  44.67753  1.000 85.20134  ?  91  ASP D CG  1 
ATOM   4842 O  OD1 . ASP D  1 91  ? 12.39719  37.32297  45.11605  1.000 81.82999  ?  91  ASP D OD1 1 
ATOM   4843 O  OD2 . ASP D  1 91  ? 13.03421  39.37414  44.76562  1.000 85.64801  -1 91  ASP D OD2 1 
ATOM   4844 N  N   . ASP D  1 92  ? 16.81847  35.70208  43.35076  1.000 65.90095  ?  92  ASP D N   1 
ATOM   4845 C  CA  . ASP D  1 92  ? 18.01657  35.38107  42.59820  1.000 65.02587  ?  92  ASP D CA  1 
ATOM   4846 C  C   . ASP D  1 92  ? 18.50283  34.03385  43.10758  1.000 62.34362  ?  92  ASP D C   1 
ATOM   4847 O  O   . ASP D  1 92  ? 18.80851  33.89642  44.29351  1.000 67.00956  ?  92  ASP D O   1 
ATOM   4848 C  CB  . ASP D  1 92  ? 19.05800  36.47743  42.82630  1.000 68.40142  ?  92  ASP D CB  1 
ATOM   4849 C  CG  . ASP D  1 92  ? 20.38588  36.21632  42.12857  1.000 78.04993  ?  92  ASP D CG  1 
ATOM   4850 O  OD1 . ASP D  1 92  ? 20.86317  35.06694  42.09337  1.000 78.91115  ?  92  ASP D OD1 1 
ATOM   4851 O  OD2 . ASP D  1 92  ? 20.97115  37.20072  41.64917  1.000 83.98448  -1 92  ASP D OD2 1 
ATOM   4852 N  N   . TRP D  1 93  ? 18.56178  33.03891  42.23326  1.000 58.76781  ?  93  TRP D N   1 
ATOM   4853 C  CA  . TRP D  1 93  ? 18.94885  31.70770  42.68282  1.000 63.63342  ?  93  TRP D CA  1 
ATOM   4854 C  C   . TRP D  1 93  ? 20.43966  31.42939  42.50584  1.000 64.18045  ?  93  TRP D C   1 
ATOM   4855 O  O   . TRP D  1 93  ? 20.87763  30.29466  42.72409  1.000 65.72770  ?  93  TRP D O   1 
ATOM   4856 C  CB  . TRP D  1 93  ? 18.09180  30.65266  41.98835  1.000 54.88238  ?  93  TRP D CB  1 
ATOM   4857 C  CG  . TRP D  1 93  ? 16.65118  30.83427  42.36486  1.000 61.72571  ?  93  TRP D CG  1 
ATOM   4858 C  CD1 . TRP D  1 93  ? 15.68529  31.51024  41.64983  1.000 61.62603  ?  93  TRP D CD1 1 
ATOM   4859 C  CD2 . TRP D  1 93  ? 16.00499  30.35973  43.55456  1.000 56.82291  ?  93  TRP D CD2 1 
ATOM   4860 N  NE1 . TRP D  1 93  ? 14.48511  31.47415  42.32624  1.000 54.95908  ?  93  TRP D NE1 1 
ATOM   4861 C  CE2 . TRP D  1 93  ? 14.65400  30.77303  43.49367  1.000 57.62748  ?  93  TRP D CE2 1 
ATOM   4862 C  CE3 . TRP D  1 93  ? 16.42937  29.61493  44.65410  1.000 58.29883  ?  93  TRP D CE3 1 
ATOM   4863 C  CZ2 . TRP D  1 93  ? 13.73452  30.46393  44.49411  1.000 58.20048  ?  93  TRP D CZ2 1 
ATOM   4864 C  CZ3 . TRP D  1 93  ? 15.51019  29.31854  45.65119  1.000 61.23132  ?  93  TRP D CZ3 1 
ATOM   4865 C  CH2 . TRP D  1 93  ? 14.18035  29.73987  45.56113  1.000 58.03506  ?  93  TRP D CH2 1 
ATOM   4866 N  N   . GLU D  1 94  ? 21.21861  32.44782  42.13452  1.000 59.68144  ?  94  GLU D N   1 
ATOM   4867 C  CA  . GLU D  1 94  ? 22.67533  32.44929  42.20883  1.000 62.79347  ?  94  GLU D CA  1 
ATOM   4868 C  C   . GLU D  1 94  ? 23.34226  31.55432  41.17104  1.000 69.25289  ?  94  GLU D C   1 
ATOM   4869 O  O   . GLU D  1 94  ? 24.24718  32.01592  40.46472  1.000 76.27776  ?  94  GLU D O   1 
ATOM   4870 C  CB  . GLU D  1 94  ? 23.14252  32.08072  43.62075  1.000 66.26612  ?  94  GLU D CB  1 
ATOM   4871 C  CG  . GLU D  1 94  ? 22.66181  33.04282  44.73014  1.000 68.83795  ?  94  GLU D CG  1 
ATOM   4872 C  CD  . GLU D  1 94  ? 22.95365  34.53334  44.45456  1.000 79.54422  ?  94  GLU D CD  1 
ATOM   4873 O  OE1 . GLU D  1 94  ? 23.85232  34.84778  43.63252  1.000 79.74704  ?  94  GLU D OE1 1 
ATOM   4874 O  OE2 . GLU D  1 94  ? 22.29440  35.39496  45.09573  1.000 78.79117  -1 94  GLU D OE2 1 
ATOM   4875 N  N   . SER D  1 95  ? 22.92407  30.29283  41.05257  1.000 69.76840  ?  95  SER D N   1 
ATOM   4876 C  CA  . SER D  1 95  ? 23.53704  29.40757  40.06851  1.000 59.71283  ?  95  SER D CA  1 
ATOM   4877 C  C   . SER D  1 95  ? 22.74156  28.11550  39.95760  1.000 57.01064  ?  95  SER D C   1 
ATOM   4878 O  O   . SER D  1 95  ? 21.91265  27.78845  40.81420  1.000 55.75467  ?  95  SER D O   1 
ATOM   4879 C  CB  . SER D  1 95  ? 24.98462  29.07440  40.43677  1.000 53.91806  ?  95  SER D CB  1 
ATOM   4880 O  OG  . SER D  1 95  ? 24.97670  28.13837  41.49297  1.000 54.73523  ?  95  SER D OG  1 
ATOM   4881 N  N   . GLY D  1 96  ? 23.06907  27.35465  38.90569  1.000 53.90717  ?  96  GLY D N   1 
ATOM   4882 C  CA  . GLY D  1 96  ? 22.39955  26.08460  38.65932  1.000 57.56351  ?  96  GLY D CA  1 
ATOM   4883 C  C   . GLY D  1 96  ? 22.58711  25.07748  39.77738  1.000 62.88313  ?  96  GLY D C   1 
ATOM   4884 O  O   . GLY D  1 96  ? 21.64322  24.36790  40.15017  1.000 63.08965  ?  96  GLY D O   1 
ATOM   4885 N  N   . LEU D  1 97  ? 23.80513  25.00138  40.33015  1.000 60.71967  ?  97  LEU D N   1 
ATOM   4886 C  CA  . LEU D  1 97  ? 24.05173  24.11304  41.45995  1.000 54.59252  ?  97  LEU D CA  1 
ATOM   4887 C  C   . LEU D  1 97  ? 23.24161  24.54994  42.66941  1.000 57.85605  ?  97  LEU D C   1 
ATOM   4888 O  O   . LEU D  1 97  ? 22.61728  23.72688  43.34809  1.000 69.71968  ?  97  LEU D O   1 
ATOM   4889 C  CB  . LEU D  1 97  ? 25.54668  24.08236  41.78809  1.000 60.14286  ?  97  LEU D CB  1 
ATOM   4890 C  CG  . LEU D  1 97  ? 26.01236  23.50144  43.13686  1.000 64.31122  ?  97  LEU D CG  1 
ATOM   4891 C  CD1 . LEU D  1 97  ? 25.51608  22.06958  43.35907  1.000 58.93646  ?  97  LEU D CD1 1 
ATOM   4892 C  CD2 . LEU D  1 97  ? 27.53565  23.57945  43.27163  1.000 55.66078  ?  97  LEU D CD2 1 
ATOM   4893 N  N   . ASN D  1 98  ? 23.23643  25.85006  42.95339  1.000 64.51248  ?  98  ASN D N   1 
ATOM   4894 C  CA  . ASN D  1 98  ? 22.50280  26.34250  44.11373  1.000 64.63804  ?  98  ASN D CA  1 
ATOM   4895 C  C   . ASN D  1 98  ? 21.00340  26.16100  43.93197  1.000 57.89469  ?  98  ASN D C   1 
ATOM   4896 O  O   . ASN D  1 98  ? 20.28529  25.83133  44.88561  1.000 59.14909  ?  98  ASN D O   1 
ATOM   4897 C  CB  . ASN D  1 98  ? 22.83830  27.80942  44.36158  1.000 66.64774  ?  98  ASN D CB  1 
ATOM   4898 C  CG  . ASN D  1 98  ? 22.75582  28.17620  45.82236  1.000 77.29892  ?  98  ASN D CG  1 
ATOM   4899 O  OD1 . ASN D  1 98  ? 21.65790  28.26387  46.39042  1.000 75.30317  ?  98  ASN D OD1 1 
ATOM   4900 N  ND2 . ASN D  1 98  ? 23.91686  28.38955  46.44983  1.000 83.24054  ?  98  ASN D ND2 1 
ATOM   4901 N  N   . ALA D  1 99  ? 20.51312  26.37194  42.71175  1.000 54.34884  ?  99  ALA D N   1 
ATOM   4902 C  CA  . ALA D  1 99  ? 19.11632  26.07001  42.41683  1.000 55.79002  ?  99  ALA D CA  1 
ATOM   4903 C  C   . ALA D  1 99  ? 18.78929  24.59724  42.66395  1.000 58.55360  ?  99  ALA D C   1 
ATOM   4904 O  O   . ALA D  1 99  ? 17.76719  24.28383  43.28966  1.000 54.64363  ?  99  ALA D O   1 
ATOM   4905 C  CB  . ALA D  1 99  ? 18.79958  26.46081  40.98018  1.000 51.96217  ?  99  ALA D CB  1 
ATOM   4906 N  N   . MET D  1 100 ? 19.63845  23.67424  42.17680  1.000 58.98884  ?  100 MET D N   1 
ATOM   4907 C  CA  . MET D  1 100 ? 19.39294  22.25139  42.42482  1.000 54.17608  ?  100 MET D CA  1 
ATOM   4908 C  C   . MET D  1 100 ? 19.40843  21.93157  43.91721  1.000 61.88388  ?  100 MET D C   1 
ATOM   4909 O  O   . MET D  1 100 ? 18.61983  21.10251  44.38629  1.000 59.42732  ?  100 MET D O   1 
ATOM   4910 C  CB  . MET D  1 100 ? 20.42266  21.39012  41.70057  1.000 53.56482  ?  100 MET D CB  1 
ATOM   4911 C  CG  . MET D  1 100 ? 20.25549  21.36223  40.20481  1.000 56.14128  ?  100 MET D CG  1 
ATOM   4912 S  SD  . MET D  1 100 ? 18.82456  20.41095  39.64465  1.000 52.20799  ?  100 MET D SD  1 
ATOM   4913 C  CE  . MET D  1 100 ? 19.05300  20.53214  37.88210  1.000 46.48122  ?  100 MET D CE  1 
ATOM   4914 N  N   . GLU D  1 101 ? 20.30208  22.57614  44.68057  1.000 58.32722  ?  101 GLU D N   1 
ATOM   4915 C  CA  . GLU D  1 101 ? 20.37984  22.30234  46.11567  1.000 62.03745  ?  101 GLU D CA  1 
ATOM   4916 C  C   . GLU D  1 101 ? 19.12549  22.79160  46.82756  1.000 66.71869  ?  101 GLU D C   1 
ATOM   4917 O  O   . GLU D  1 101 ? 18.58314  22.10827  47.71353  1.000 73.62734  ?  101 GLU D O   1 
ATOM   4918 C  CB  . GLU D  1 101 ? 21.62478  22.96049  46.71929  1.000 60.40878  ?  101 GLU D CB  1 
ATOM   4919 C  CG  . GLU D  1 101 ? 22.95978  22.41129  46.22610  1.000 65.46952  ?  101 GLU D CG  1 
ATOM   4920 C  CD  . GLU D  1 101 ? 24.16722  23.10633  46.87860  1.000 79.16992  ?  101 GLU D CD  1 
ATOM   4921 O  OE1 . GLU D  1 101 ? 24.23487  24.36433  46.85265  1.000 80.12605  ?  101 GLU D OE1 1 
ATOM   4922 O  OE2 . GLU D  1 101 ? 25.04524  22.39112  47.42657  1.000 79.32866  -1 101 GLU D OE2 1 
ATOM   4923 N  N   . ALA D  1 102 ? 18.64816  23.97587  46.44418  1.000 64.15796  ?  102 ALA D N   1 
ATOM   4924 C  CA  . ALA D  1 102 ? 17.41064  24.49494  47.01049  1.000 67.15328  ?  102 ALA D CA  1 
ATOM   4925 C  C   . ALA D  1 102 ? 16.21770  23.60613  46.65086  1.000 65.71426  ?  102 ALA D C   1 
ATOM   4926 O  O   . ALA D  1 102 ? 15.33124  23.37760  47.48154  1.000 67.32135  ?  102 ALA D O   1 
ATOM   4927 C  CB  . ALA D  1 102 ? 17.19792  25.93055  46.53340  1.000 63.85958  ?  102 ALA D CB  1 
ATOM   4928 N  N   . ALA D  1 103 ? 16.18401  23.08535  45.42101  1.000 58.53546  ?  103 ALA D N   1 
ATOM   4929 C  CA  . ALA D  1 103 ? 15.12312  22.15357  45.04576  1.000 58.35289  ?  103 ALA D CA  1 
ATOM   4930 C  C   . ALA D  1 103 ? 15.20148  20.87200  45.85836  1.000 63.17831  ?  103 ALA D C   1 
ATOM   4931 O  O   . ALA D  1 103 ? 14.17011  20.32283  46.26373  1.000 67.08868  ?  103 ALA D O   1 
ATOM   4932 C  CB  . ALA D  1 103 ? 15.20124  21.83010  43.55630  1.000 59.27283  ?  103 ALA D CB  1 
ATOM   4933 N  N   . LEU D  1 104 ? 16.41920  20.37209  46.07827  1.000 60.11645  ?  104 LEU D N   1 
ATOM   4934 C  CA  . LEU D  1 104 ? 16.61751  19.18223  46.89578  1.000 58.33713  ?  104 LEU D CA  1 
ATOM   4935 C  C   . LEU D  1 104 ? 16.03975  19.37960  48.29249  1.000 64.21959  ?  104 LEU D C   1 
ATOM   4936 O  O   . LEU D  1 104 ? 15.34403  18.50191  48.81995  1.000 70.95183  ?  104 LEU D O   1 
ATOM   4937 C  CB  . LEU D  1 104 ? 18.11238  18.84979  46.96201  1.000 57.47254  ?  104 LEU D CB  1 
ATOM   4938 C  CG  . LEU D  1 104 ? 18.48949  17.64504  47.82729  1.000 61.63370  ?  104 LEU D CG  1 
ATOM   4939 C  CD1 . LEU D  1 104 ? 17.76468  16.42980  47.31556  1.000 56.33645  ?  104 LEU D CD1 1 
ATOM   4940 C  CD2 . LEU D  1 104 ? 19.98962  17.39578  47.88423  1.000 57.72949  ?  104 LEU D CD2 1 
ATOM   4941 N  N   . HIS D  1 105 ? 16.29785  20.54615  48.90028  1.000 67.46255  ?  105 HIS D N   1 
ATOM   4942 C  CA  . HIS D  1 105 ? 15.77518  20.80121  50.24479  1.000 62.77080  ?  105 HIS D CA  1 
ATOM   4943 C  C   . HIS D  1 105 ? 14.26485  21.00488  50.22928  1.000 62.17823  ?  105 HIS D C   1 
ATOM   4944 O  O   . HIS D  1 105 ? 13.55312  20.53521  51.12706  1.000 66.14437  ?  105 HIS D O   1 
ATOM   4945 C  CB  . HIS D  1 105 ? 16.46547  22.01174  50.86796  1.000 65.60838  ?  105 HIS D CB  1 
ATOM   4946 C  CG  . HIS D  1 105 ? 16.24715  22.13386  52.34618  1.000 78.63047  ?  105 HIS D CG  1 
ATOM   4947 N  ND1 . HIS D  1 105 ? 15.45505  23.11516  52.90496  1.000 82.82691  ?  105 HIS D ND1 1 
ATOM   4948 C  CD2 . HIS D  1 105 ? 16.71530  21.39443  53.38152  1.000 81.20377  ?  105 HIS D CD2 1 
ATOM   4949 C  CE1 . HIS D  1 105 ? 15.44949  22.97935  54.22010  1.000 83.50123  ?  105 HIS D CE1 1 
ATOM   4950 N  NE2 . HIS D  1 105 ? 16.20568  21.94189  54.53474  1.000 85.11210  ?  105 HIS D NE2 1 
ATOM   4951 N  N   . LEU D  1 106 ? 13.76029  21.71660  49.22604  1.000 67.95203  ?  106 LEU D N   1 
ATOM   4952 C  CA  . LEU D  1 106 ? 12.32113  21.88302  49.07835  1.000 64.57076  ?  106 LEU D CA  1 
ATOM   4953 C  C   . LEU D  1 106 ? 11.62397  20.53428  49.01807  1.000 68.64148  ?  106 LEU D C   1 
ATOM   4954 O  O   . LEU D  1 106 ? 10.68594  20.27142  49.78220  1.000 72.91411  ?  106 LEU D O   1 
ATOM   4955 C  CB  . LEU D  1 106 ? 12.03037  22.69306  47.81762  1.000 65.04134  ?  106 LEU D CB  1 
ATOM   4956 C  CG  . LEU D  1 106 ? 10.60163  22.68982  47.29362  1.000 63.52151  ?  106 LEU D CG  1 
ATOM   4957 C  CD1 . LEU D  1 106 ? 9.72372   23.43832  48.27925  1.000 63.92114  ?  106 LEU D CD1 1 
ATOM   4958 C  CD2 . LEU D  1 106 ? 10.55272  23.32875  45.91453  1.000 58.71253  ?  106 LEU D CD2 1 
ATOM   4959 N  N   . GLU D  1 107 ? 12.07231  19.66694  48.10286  1.000 68.51308  ?  107 GLU D N   1 
ATOM   4960 C  CA  . GLU D  1 107 ? 11.46543  18.35092  47.95465  1.000 63.99631  ?  107 GLU D CA  1 
ATOM   4961 C  C   . GLU D  1 107 ? 11.61952  17.51787  49.21910  1.000 69.01319  ?  107 GLU D C   1 
ATOM   4962 O  O   . GLU D  1 107 ? 10.69943  16.77695  49.58135  1.000 66.70954  ?  107 GLU D O   1 
ATOM   4963 C  CB  . GLU D  1 107 ? 12.07029  17.61957  46.75708  1.000 66.45503  ?  107 GLU D CB  1 
ATOM   4964 C  CG  . GLU D  1 107 ? 11.63728  18.16586  45.40203  1.000 69.77732  ?  107 GLU D CG  1 
ATOM   4965 C  CD  . GLU D  1 107 ? 10.15134  17.98703  45.12426  1.000 71.29339  ?  107 GLU D CD  1 
ATOM   4966 O  OE1 . GLU D  1 107 ? 9.58632   18.77576  44.33521  1.000 71.83252  ?  107 GLU D OE1 1 
ATOM   4967 O  OE2 . GLU D  1 107 ? 9.54642   17.05798  45.69421  1.000 77.27295  -1 107 GLU D OE2 1 
ATOM   4968 N  N   . LYS D  1 108 ? 12.75819  17.62841  49.91322  1.000 68.59418  ?  108 LYS D N   1 
ATOM   4969 C  CA  . LYS D  1 108 ? 12.91606  16.88690  51.15903  1.000 66.85537  ?  108 LYS D CA  1 
ATOM   4970 C  C   . LYS D  1 108 ? 11.87482  17.32525  52.19004  1.000 68.38658  ?  108 LYS D C   1 
ATOM   4971 O  O   . LYS D  1 108 ? 11.29698  16.48932  52.90385  1.000 71.60029  ?  108 LYS D O   1 
ATOM   4972 C  CB  . LYS D  1 108 ? 14.34113  17.07089  51.69158  1.000 66.21323  ?  108 LYS D CB  1 
ATOM   4973 C  CG  . LYS D  1 108 ? 15.30815  15.96357  51.32505  1.000 61.05408  ?  108 LYS D CG  1 
ATOM   4974 N  N   . ASN D  1 109 ? 11.61119  18.63361  52.27307  1.000 71.64303  ?  109 ASN D N   1 
ATOM   4975 C  CA  . ASN D  1 109 ? 10.61679  19.12824  53.22612  1.000 78.27550  ?  109 ASN D CA  1 
ATOM   4976 C  C   . ASN D  1 109 ? 9.21862   18.66237  52.83685  1.000 75.05989  ?  109 ASN D C   1 
ATOM   4977 O  O   . ASN D  1 109 ? 8.43709   18.19743  53.68363  1.000 76.25858  ?  109 ASN D O   1 
ATOM   4978 C  CB  . ASN D  1 109 ? 10.67491  20.65681  53.31026  1.000 74.97964  ?  109 ASN D CB  1 
ATOM   4979 N  N   . VAL D  1 110 ? 8.88924   18.78679  51.54929  1.000 70.71158  ?  110 VAL D N   1 
ATOM   4980 C  CA  . VAL D  1 110 ? 7.61663   18.27646  51.05369  1.000 69.74414  ?  110 VAL D CA  1 
ATOM   4981 C  C   . VAL D  1 110 ? 7.47404   16.80139  51.40290  1.000 72.12461  ?  110 VAL D C   1 
ATOM   4982 O  O   . VAL D  1 110 ? 6.40067   16.34617  51.81416  1.000 76.90620  ?  110 VAL D O   1 
ATOM   4983 C  CB  . VAL D  1 110 ? 7.49901   18.52952  49.53811  1.000 64.03690  ?  110 VAL D CB  1 
ATOM   4984 C  CG1 . VAL D  1 110 ? 6.19253   17.95751  48.98379  1.000 57.15016  ?  110 VAL D CG1 1 
ATOM   4985 C  CG2 . VAL D  1 110 ? 7.59147   20.02253  49.25033  1.000 62.03181  ?  110 VAL D CG2 1 
ATOM   4986 N  N   . ASN D  1 111 ? 8.56651   16.04362  51.29518  1.000 67.75837  ?  111 ASN D N   1 
ATOM   4987 C  CA  . ASN D  1 111 ? 8.50270   14.61149  51.56029  1.000 72.03802  ?  111 ASN D CA  1 
ATOM   4988 C  C   . ASN D  1 111 ? 8.23474   14.32929  53.03178  1.000 67.02905  ?  111 ASN D C   1 
ATOM   4989 O  O   . ASN D  1 111 ? 7.39664   13.48442  53.36333  1.000 73.35210  ?  111 ASN D O   1 
ATOM   4990 C  CB  . ASN D  1 111 ? 9.79931   13.93161  51.11845  1.000 74.17656  ?  111 ASN D CB  1 
ATOM   4991 C  CG  . ASN D  1 111 ? 9.73164   12.41210  51.21459  1.000 71.42223  ?  111 ASN D CG  1 
ATOM   4992 O  OD1 . ASN D  1 111 ? 8.69794   11.80361  50.92739  1.000 71.29117  ?  111 ASN D OD1 1 
ATOM   4993 N  ND2 . ASN D  1 111 ? 10.83689  11.79526  51.61980  1.000 69.42244  ?  111 ASN D ND2 1 
ATOM   4994 N  N   . GLN D  1 112 ? 8.94376   14.99472  53.93596  1.000 68.81351  ?  112 GLN D N   1 
ATOM   4995 C  CA  . GLN D  1 112 ? 8.63876   14.70301  55.33450  1.000 78.93028  ?  112 GLN D CA  1 
ATOM   4996 C  C   . GLN D  1 112 ? 7.22076   15.13278  55.69521  1.000 78.84093  ?  112 GLN D C   1 
ATOM   4997 O  O   . GLN D  1 112 ? 6.55754   14.44895  56.48414  1.000 79.03786  ?  112 GLN D O   1 
ATOM   4998 C  CB  . GLN D  1 112 ? 9.66209   15.32156  56.28888  1.000 80.20952  ?  112 GLN D CB  1 
ATOM   4999 C  CG  . GLN D  1 112 ? 9.51055   14.78833  57.72723  1.000 84.75262  ?  112 GLN D CG  1 
ATOM   5000 C  CD  . GLN D  1 112 ? 10.35901  13.54399  58.00646  1.000 91.26712  ?  112 GLN D CD  1 
ATOM   5001 O  OE1 . GLN D  1 112 ? 11.57462  13.54419  57.80348  1.000 93.02280  ?  112 GLN D OE1 1 
ATOM   5002 N  NE2 . GLN D  1 112 ? 9.70932   12.47234  58.46112  1.000 92.26990  ?  112 GLN D NE2 1 
ATOM   5003 N  N   . SER D  1 113 ? 6.71134   16.21206  55.09144  1.000 76.70787  ?  113 SER D N   1 
ATOM   5004 C  CA  . SER D  1 113 ? 5.32268   16.58170  55.35849  1.000 72.68041  ?  113 SER D CA  1 
ATOM   5005 C  C   . SER D  1 113 ? 4.35199   15.53874  54.78878  1.000 72.58323  ?  113 SER D C   1 
ATOM   5006 O  O   . SER D  1 113 ? 3.29719   15.26681  55.37462  1.000 78.20238  ?  113 SER D O   1 
ATOM   5007 C  CB  . SER D  1 113 ? 5.03787   17.97266  54.79628  1.000 68.04851  ?  113 SER D CB  1 
ATOM   5008 O  OG  . SER D  1 113 ? 3.66276   18.15256  54.52847  1.000 70.32806  ?  113 SER D OG  1 
ATOM   5009 N  N   . LEU D  1 114 ? 4.70184   14.92427  53.65881  1.000 65.76120  ?  114 LEU D N   1 
ATOM   5010 C  CA  . LEU D  1 114 ? 3.88538   13.83658  53.11955  1.000 67.07903  ?  114 LEU D CA  1 
ATOM   5011 C  C   . LEU D  1 114 ? 3.89944   12.62993  54.04119  1.000 72.01148  ?  114 LEU D C   1 
ATOM   5012 O  O   . LEU D  1 114 ? 2.88073   11.94560  54.19864  1.000 72.47168  ?  114 LEU D O   1 
ATOM   5013 C  CB  . LEU D  1 114 ? 4.38542   13.43739  51.73781  1.000 59.76615  ?  114 LEU D CB  1 
ATOM   5014 C  CG  . LEU D  1 114 ? 3.80614   14.23397  50.58101  1.000 59.80677  ?  114 LEU D CG  1 
ATOM   5015 C  CD1 . LEU D  1 114 ? 4.54505   13.88480  49.30501  1.000 58.63667  ?  114 LEU D CD1 1 
ATOM   5016 C  CD2 . LEU D  1 114 ? 2.32458   13.93460  50.45801  1.000 58.01672  ?  114 LEU D CD2 1 
ATOM   5017 N  N   . LEU D  1 115 ? 5.04814   12.35293  54.65869  1.000 75.34092  ?  115 LEU D N   1 
ATOM   5018 C  CA  . LEU D  1 115 ? 5.10990   11.25278  55.61355  1.000 77.27506  ?  115 LEU D CA  1 
ATOM   5019 C  C   . LEU D  1 115 ? 4.29365   11.55578  56.85968  1.000 78.27821  ?  115 LEU D C   1 
ATOM   5020 O  O   . LEU D  1 115 ? 3.68039   10.64658  57.42091  1.000 73.39603  ?  115 LEU D O   1 
ATOM   5021 C  CB  . LEU D  1 115 ? 6.55876   10.93760  55.99106  1.000 77.07941  ?  115 LEU D CB  1 
ATOM   5022 C  CG  . LEU D  1 115 ? 7.52999   10.65076  54.84601  1.000 73.24059  ?  115 LEU D CG  1 
ATOM   5023 C  CD1 . LEU D  1 115 ? 8.94438   10.99988  55.25414  1.000 77.23662  ?  115 LEU D CD1 1 
ATOM   5024 C  CD2 . LEU D  1 115 ? 7.43355   9.20338   54.41744  1.000 72.47011  ?  115 LEU D CD2 1 
ATOM   5025 N  N   . GLU D  1 116 ? 4.28278   12.81830  57.30929  1.000 82.21699  ?  116 GLU D N   1 
ATOM   5026 C  CA  . GLU D  1 116 ? 3.43431   13.19590  58.44116  1.000 84.09879  ?  116 GLU D CA  1 
ATOM   5027 C  C   . GLU D  1 116 ? 1.95851   13.04609  58.09199  1.000 82.30307  ?  116 GLU D C   1 
ATOM   5028 O  O   . GLU D  1 116 ? 1.15792   12.58627  58.91906  1.000 86.87129  ?  116 GLU D O   1 
ATOM   5029 C  CB  . GLU D  1 116 ? 3.74085   14.62707  58.89602  1.000 88.50948  ?  116 GLU D CB  1 
ATOM   5030 C  CG  . GLU D  1 116 ? 5.22614   14.92436  59.04398  1.000 92.73679  ?  116 GLU D CG  1 
ATOM   5031 C  CD  . GLU D  1 116 ? 5.53735   16.01885  60.04591  1.000 94.49382  ?  116 GLU D CD  1 
ATOM   5032 O  OE1 . GLU D  1 116 ? 5.45925   15.75375  61.26251  1.000 97.05556  ?  116 GLU D OE1 1 
ATOM   5033 O  OE2 . GLU D  1 116 ? 5.87676   17.14135  59.61556  1.000 96.94020  -1 116 GLU D OE2 1 
ATOM   5034 N  N   . LEU D  1 117 ? 1.58476   13.41454  56.86535  1.000 81.53018  ?  117 LEU D N   1 
ATOM   5035 C  CA  . LEU D  1 117 ? 0.22743   13.15459  56.39807  1.000 79.24494  ?  117 LEU D CA  1 
ATOM   5036 C  C   . LEU D  1 117 ? -0.08522  11.66245  56.44270  1.000 78.70352  ?  117 LEU D C   1 
ATOM   5037 O  O   . LEU D  1 117 ? -1.15351  11.25719  56.91231  1.000 83.65467  ?  117 LEU D O   1 
ATOM   5038 C  CB  . LEU D  1 117 ? 0.04411   13.70347  54.98390  1.000 71.96099  ?  117 LEU D CB  1 
ATOM   5039 C  CG  . LEU D  1 117 ? -1.36297  14.13448  54.55683  1.000 72.58505  ?  117 LEU D CG  1 
ATOM   5040 C  CD1 . LEU D  1 117 ? -1.31688  14.62166  53.12570  1.000 71.14577  ?  117 LEU D CD1 1 
ATOM   5041 C  CD2 . LEU D  1 117 ? -2.38836  13.02247  54.70835  1.000 78.16065  ?  117 LEU D CD2 1 
ATOM   5042 N  N   . HIS D  1 118 ? 0.84114   10.82632  55.96406  1.000 65.49533  ?  118 HIS D N   1 
ATOM   5043 C  CA  . HIS D  1 118 ? 0.60079   9.38391   55.98425  1.000 68.12526  ?  118 HIS D CA  1 
ATOM   5044 C  C   . HIS D  1 118 ? 0.50185   8.84655   57.41194  1.000 77.42564  ?  118 HIS D C   1 
ATOM   5045 O  O   . HIS D  1 118 ? -0.30189  7.94302   57.69023  1.000 74.61989  ?  118 HIS D O   1 
ATOM   5046 C  CB  . HIS D  1 118 ? 1.70612   8.64786   55.22451  1.000 68.45584  ?  118 HIS D CB  1 
ATOM   5047 C  CG  . HIS D  1 118 ? 1.54178   7.15712   55.21607  1.000 70.72929  ?  118 HIS D CG  1 
ATOM   5048 N  ND1 . HIS D  1 118 ? 1.63840   6.38882   56.35851  1.000 70.81317  ?  118 HIS D ND1 1 
ATOM   5049 C  CD2 . HIS D  1 118 ? 1.28447   6.29338   54.20202  1.000 68.80829  ?  118 HIS D CD2 1 
ATOM   5050 C  CE1 . HIS D  1 118 ? 1.44456   5.11787   56.04831  1.000 71.31460  ?  118 HIS D CE1 1 
ATOM   5051 N  NE2 . HIS D  1 118 ? 1.22733   5.03303   54.74747  1.000 67.92414  ?  118 HIS D NE2 1 
ATOM   5052 N  N   . LYS D  1 119 ? 1.34605   9.35075   58.31772  1.000 72.11286  ?  119 LYS D N   1 
ATOM   5053 C  CA  . LYS D  1 119 ? 1.30829   8.88181   59.69604  1.000 74.47266  ?  119 LYS D CA  1 
ATOM   5054 C  C   . LYS D  1 119 ? -0.01921  9.24054   60.33882  1.000 79.71713  ?  119 LYS D C   1 
ATOM   5055 O  O   . LYS D  1 119 ? -0.62694  8.41610   61.02823  1.000 82.27037  ?  119 LYS D O   1 
ATOM   5056 C  CB  . LYS D  1 119 ? 2.47466   9.46961   60.49245  1.000 80.34952  ?  119 LYS D CB  1 
ATOM   5057 N  N   . LEU D  1 120 ? -0.49413  10.46610  60.10198  1.000 82.32101  ?  120 LEU D N   1 
ATOM   5058 C  CA  . LEU D  1 120 ? -1.83511  10.84053  60.53435  1.000 81.80781  ?  120 LEU D CA  1 
ATOM   5059 C  C   . LEU D  1 120 ? -2.89253  9.92624   59.91977  1.000 80.46832  ?  120 LEU D C   1 
ATOM   5060 O  O   . LEU D  1 120 ? -3.83508  9.50750   60.60275  1.000 83.81976  ?  120 LEU D O   1 
ATOM   5061 C  CB  . LEU D  1 120 ? -2.09954  12.29992  60.16810  1.000 79.88738  ?  120 LEU D CB  1 
ATOM   5062 C  CG  . LEU D  1 120 ? -3.46479  12.86738  60.54930  1.000 81.95778  ?  120 LEU D CG  1 
ATOM   5063 C  CD1 . LEU D  1 120 ? -3.54664  13.12682  62.04578  1.000 83.48436  ?  120 LEU D CD1 1 
ATOM   5064 C  CD2 . LEU D  1 120 ? -3.74151  14.13274  59.75434  1.000 79.88011  ?  120 LEU D CD2 1 
ATOM   5065 N  N   . ALA D  1 121 ? -2.74555  9.59544   58.63329  1.000 78.86389  ?  121 ALA D N   1 
ATOM   5066 C  CA  . ALA D  1 121 ? -3.75555  8.79338   57.94801  1.000 77.53083  ?  121 ALA D CA  1 
ATOM   5067 C  C   . ALA D  1 121 ? -3.85051  7.39557   58.53926  1.000 81.00686  ?  121 ALA D C   1 
ATOM   5068 O  O   . ALA D  1 121 ? -4.95116  6.85688   58.70377  1.000 86.29251  ?  121 ALA D O   1 
ATOM   5069 C  CB  . ALA D  1 121 ? -3.44897  8.71579   56.45003  1.000 71.79149  ?  121 ALA D CB  1 
ATOM   5070 N  N   . THR D  1 122 ? -2.71143  6.78470   58.84780  1.000 82.91623  ?  122 THR D N   1 
ATOM   5071 C  CA  . THR D  1 122 ? -2.74231  5.45370   59.43778  1.000 82.42127  ?  122 THR D CA  1 
ATOM   5072 C  C   . THR D  1 122 ? -3.04540  5.50134   60.93283  1.000 86.12358  ?  122 THR D C   1 
ATOM   5073 O  O   . THR D  1 122 ? -3.50584  4.50134   61.49821  1.000 87.15084  ?  122 THR D O   1 
ATOM   5074 C  CB  . THR D  1 122 ? -1.42130  4.72801   59.16015  1.000 83.99367  ?  122 THR D CB  1 
ATOM   5075 O  OG1 . THR D  1 122 ? -1.49180  3.38927   59.65880  1.000 90.79368  ?  122 THR D OG1 1 
ATOM   5076 C  CG2 . THR D  1 122 ? -0.25744  5.44211   59.82075  1.000 83.74150  ?  122 THR D CG2 1 
ATOM   5077 N  N   . ASP D  1 123 ? -2.82020  6.65011   61.57407  1.000 86.47040  ?  123 ASP D N   1 
ATOM   5078 C  CA  . ASP D  1 123 ? -3.27858  6.84748   62.94334  1.000 85.17454  ?  123 ASP D CA  1 
ATOM   5079 C  C   . ASP D  1 123 ? -4.79509  6.82179   63.01556  1.000 83.72462  ?  123 ASP D C   1 
ATOM   5080 O  O   . ASP D  1 123 ? -5.36477  6.32960   63.99577  1.000 84.86524  ?  123 ASP D O   1 
ATOM   5081 C  CB  . ASP D  1 123 ? -2.76170  8.17888   63.49042  1.000 88.64200  ?  123 ASP D CB  1 
ATOM   5082 C  CG  . ASP D  1 123 ? -1.37362  8.07104   64.07124  1.000 94.82911  ?  123 ASP D CG  1 
ATOM   5083 O  OD1 . ASP D  1 123 ? -0.69757  9.11810   64.20803  1.000 96.68232  ?  123 ASP D OD1 1 
ATOM   5084 O  OD2 . ASP D  1 123 ? -0.95658  6.93683   64.38033  1.000 97.77022  -1 123 ASP D OD2 1 
ATOM   5085 N  N   . LYS D  1 124 ? -5.46205  7.35571   61.99073  1.000 79.71766  ?  124 LYS D N   1 
ATOM   5086 C  CA  . LYS D  1 124 ? -6.90724  7.53320   61.99474  1.000 76.80677  ?  124 LYS D CA  1 
ATOM   5087 C  C   . LYS D  1 124 ? -7.65063  6.39432   61.30151  1.000 77.95356  ?  124 LYS D C   1 
ATOM   5088 O  O   . LYS D  1 124 ? -8.84630  6.53543   61.01259  1.000 74.05945  ?  124 LYS D O   1 
ATOM   5089 C  CB  . LYS D  1 124 ? -7.27130  8.87222   61.34641  1.000 72.34880  ?  124 LYS D CB  1 
ATOM   5090 N  N   . ASN D  1 125 ? -6.97091  5.27572   61.03163  1.000 79.27661  ?  125 ASN D N   1 
ATOM   5091 C  CA  . ASN D  1 125 ? -7.58705  4.09527   60.42472  1.000 80.72293  ?  125 ASN D CA  1 
ATOM   5092 C  C   . ASN D  1 125 ? -8.26141  4.44519   59.09481  1.000 85.92702  ?  125 ASN D C   1 
ATOM   5093 O  O   . ASN D  1 125 ? -9.43413  4.14016   58.86317  1.000 86.52212  ?  125 ASN D O   1 
ATOM   5094 C  CB  . ASN D  1 125 ? -8.57112  3.44025   61.39754  1.000 84.95148  ?  125 ASN D CB  1 
ATOM   5095 C  CG  . ASN D  1 125 ? -7.99351  3.30316   62.80050  1.000 94.11617  ?  125 ASN D CG  1 
ATOM   5096 O  OD1 . ASN D  1 125 ? -6.77096  3.29558   62.98040  1.000 94.52824  ?  125 ASN D OD1 1 
ATOM   5097 N  ND2 . ASN D  1 125 ? -8.87038  3.22533   63.80454  1.000 91.81993  ?  125 ASN D ND2 1 
ATOM   5098 N  N   . ASP D  1 126 ? -7.49359  5.08850   58.20541  1.000 84.67191  ?  126 ASP D N   1 
ATOM   5099 C  CA  . ASP D  1 126 ? -7.97121  5.54777   56.90159  1.000 78.02956  ?  126 ASP D CA  1 
ATOM   5100 C  C   . ASP D  1 126 ? -7.04966  4.97036   55.83147  1.000 76.11950  ?  126 ASP D C   1 
ATOM   5101 O  O   . ASP D  1 126 ? -6.16853  5.66701   55.30468  1.000 79.09044  ?  126 ASP D O   1 
ATOM   5102 C  CB  . ASP D  1 126 ? -8.03020  7.07471   56.84558  1.000 77.13734  ?  126 ASP D CB  1 
ATOM   5103 C  CG  . ASP D  1 126 ? -8.58971  7.59764   55.52832  1.000 85.33531  ?  126 ASP D CG  1 
ATOM   5104 O  OD1 . ASP D  1 126 ? -9.11678  6.79322   54.71986  1.000 79.30671  ?  126 ASP D OD1 1 
ATOM   5105 O  OD2 . ASP D  1 126 ? -8.52322  8.82924   55.31657  1.000 88.84474  -1 126 ASP D OD2 1 
ATOM   5106 N  N   . PRO D  1 127 ? -7.25555  3.70861   55.45040  1.000 73.82021  ?  127 PRO D N   1 
ATOM   5107 C  CA  . PRO D  1 127 ? -6.25645  3.02344   54.61915  1.000 69.12298  ?  127 PRO D CA  1 
ATOM   5108 C  C   . PRO D  1 127 ? -6.25776  3.47244   53.16835  1.000 71.47035  ?  127 PRO D C   1 
ATOM   5109 O  O   . PRO D  1 127 ? -5.22900  3.33979   52.48948  1.000 74.52514  ?  127 PRO D O   1 
ATOM   5110 C  CB  . PRO D  1 127 ? -6.66658  1.55447   54.74576  1.000 68.92386  ?  127 PRO D CB  1 
ATOM   5111 C  CG  . PRO D  1 127 ? -8.15799  1.62458   54.86116  1.000 70.16639  ?  127 PRO D CG  1 
ATOM   5112 C  CD  . PRO D  1 127 ? -8.48904  2.91863   55.58801  1.000 74.17532  ?  127 PRO D CD  1 
ATOM   5113 N  N   . HIS D  1 128 ? -7.38219  3.98702   52.66590  1.000 64.54440  ?  128 HIS D N   1 
ATOM   5114 C  CA  . HIS D  1 128 ? -7.40443  4.48987   51.30063  1.000 60.67619  ?  128 HIS D CA  1 
ATOM   5115 C  C   . HIS D  1 128 ? -6.53707  5.73387   51.15988  1.000 67.03351  ?  128 HIS D C   1 
ATOM   5116 O  O   . HIS D  1 128 ? -5.78721  5.86646   50.18704  1.000 67.55235  ?  128 HIS D O   1 
ATOM   5117 C  CB  . HIS D  1 128 ? -8.83727  4.78805   50.86443  1.000 60.82690  ?  128 HIS D CB  1 
ATOM   5118 C  CG  . HIS D  1 128 ? -8.92049  5.65744   49.64639  1.000 64.91704  ?  128 HIS D CG  1 
ATOM   5119 N  ND1 . HIS D  1 128 ? -8.94404  7.03544   49.71287  1.000 58.69412  ?  128 HIS D ND1 1 
ATOM   5120 C  CD2 . HIS D  1 128 ? -8.96149  5.34343   48.32874  1.000 60.30624  ?  128 HIS D CD2 1 
ATOM   5121 C  CE1 . HIS D  1 128 ? -9.00489  7.53091   48.49014  1.000 55.50458  ?  128 HIS D CE1 1 
ATOM   5122 N  NE2 . HIS D  1 128 ? -9.01683  6.52592   47.63193  1.000 59.31358  ?  128 HIS D NE2 1 
ATOM   5123 N  N   . LEU D  1 129 ? -6.62527  6.65849   52.11702  1.000 73.58671  ?  129 LEU D N   1 
ATOM   5124 C  CA  . LEU D  1 129 ? -5.80630  7.86444   52.04634  1.000 72.85310  ?  129 LEU D CA  1 
ATOM   5125 C  C   . LEU D  1 129 ? -4.32867  7.52410   52.17016  1.000 75.92680  ?  129 LEU D C   1 
ATOM   5126 O  O   . LEU D  1 129 ? -3.48076  8.11917   51.48800  1.000 73.24477  ?  129 LEU D O   1 
ATOM   5127 C  CB  . LEU D  1 129 ? -6.22459  8.84416   53.14024  1.000 69.43197  ?  129 LEU D CB  1 
ATOM   5128 C  CG  . LEU D  1 129 ? -5.40199  10.12767  53.21138  1.000 65.49507  ?  129 LEU D CG  1 
ATOM   5129 C  CD1 . LEU D  1 129 ? -5.71300  10.99168  52.01851  1.000 65.94693  ?  129 LEU D CD1 1 
ATOM   5130 C  CD2 . LEU D  1 129 ? -5.71059  10.86848  54.48341  1.000 63.85076  ?  129 LEU D CD2 1 
ATOM   5131 N  N   . ALA D  1 130 ? -4.00764  6.54533   53.02072  1.000 73.12057  ?  130 ALA D N   1 
ATOM   5132 C  CA  . ALA D  1 130 ? -2.61995  6.13724   53.20494  1.000 70.82223  ?  130 ALA D CA  1 
ATOM   5133 C  C   . ALA D  1 130 ? -2.06200  5.50406   51.93772  1.000 70.04958  ?  130 ALA D C   1 
ATOM   5134 O  O   . ALA D  1 130 ? -0.96388  5.85018   51.49207  1.000 78.41865  ?  130 ALA D O   1 
ATOM   5135 C  CB  . ALA D  1 130 ? -2.51168  5.17343   54.38604  1.000 70.03334  ?  130 ALA D CB  1 
ATOM   5136 N  N   . ASP D  1 131 ? -2.80286  4.56823   51.34081  1.000 65.65578  ?  131 ASP D N   1 
ATOM   5137 C  CA  . ASP D  1 131 ? -2.31294  3.94960   50.11698  1.000 65.72048  ?  131 ASP D CA  1 
ATOM   5138 C  C   . ASP D  1 131 ? -2.27778  4.94107   48.96210  1.000 66.66544  ?  131 ASP D C   1 
ATOM   5139 O  O   . ASP D  1 131 ? -1.41592  4.83454   48.08305  1.000 60.50588  ?  131 ASP D O   1 
ATOM   5140 C  CB  . ASP D  1 131 ? -3.17156  2.74356   49.74582  1.000 69.85584  ?  131 ASP D CB  1 
ATOM   5141 C  CG  . ASP D  1 131 ? -2.82560  2.18993   48.37554  1.000 75.42475  ?  131 ASP D CG  1 
ATOM   5142 O  OD1 . ASP D  1 131 ? -1.73829  1.57206   48.24815  1.000 79.74234  ?  131 ASP D OD1 1 
ATOM   5143 O  OD2 . ASP D  1 131 ? -3.63283  2.39209   47.43040  1.000 68.98124  -1 131 ASP D OD2 1 
ATOM   5144 N  N   . PHE D  1 132 ? -3.21636  5.89004   48.93518  1.000 69.50494  ?  132 PHE D N   1 
ATOM   5145 C  CA  . PHE D  1 132 ? -3.19050  6.95384   47.93995  1.000 67.03460  ?  132 PHE D CA  1 
ATOM   5146 C  C   . PHE D  1 132 ? -1.90878  7.77386   48.05486  1.000 62.39525  ?  132 PHE D C   1 
ATOM   5147 O  O   . PHE D  1 132 ? -1.21320  8.01047   47.05688  1.000 56.83303  ?  132 PHE D O   1 
ATOM   5148 C  CB  . PHE D  1 132 ? -4.43072  7.83299   48.12080  1.000 67.17021  ?  132 PHE D CB  1 
ATOM   5149 C  CG  . PHE D  1 132 ? -4.51290  8.97016   47.15965  1.000 66.32223  ?  132 PHE D CG  1 
ATOM   5150 C  CD1 . PHE D  1 132 ? -5.12343  8.79791   45.92053  1.000 69.27800  ?  132 PHE D CD1 1 
ATOM   5151 C  CD2 . PHE D  1 132 ? -3.98675  10.21260  47.48924  1.000 67.55120  ?  132 PHE D CD2 1 
ATOM   5152 C  CE1 . PHE D  1 132 ? -5.20709  9.84054   45.01970  1.000 65.74568  ?  132 PHE D CE1 1 
ATOM   5153 C  CE2 . PHE D  1 132 ? -4.06095  11.26780  46.59599  1.000 72.82436  ?  132 PHE D CE2 1 
ATOM   5154 C  CZ  . PHE D  1 132 ? -4.67289  11.08118  45.35452  1.000 67.36149  ?  132 PHE D CZ  1 
ATOM   5155 N  N   . ILE D  1 133 ? -1.58707  8.22196   49.27113  1.000 63.53236  ?  133 ILE D N   1 
ATOM   5156 C  CA  . ILE D  1 133 ? -0.32958  8.92787   49.49757  1.000 65.37894  ?  133 ILE D CA  1 
ATOM   5157 C  C   . ILE D  1 133 ? 0.84959   8.08405   49.02967  1.000 72.40559  ?  133 ILE D C   1 
ATOM   5158 O  O   . ILE D  1 133 ? 1.71020   8.56255   48.28293  1.000 73.86560  ?  133 ILE D O   1 
ATOM   5159 C  CB  . ILE D  1 133 ? -0.18324  9.31171   50.97465  1.000 69.91620  ?  133 ILE D CB  1 
ATOM   5160 C  CG1 . ILE D  1 133 ? -1.12282  10.46429  51.31231  1.000 73.72038  ?  133 ILE D CG1 1 
ATOM   5161 C  CG2 . ILE D  1 133 ? 1.24418   9.71971   51.24874  1.000 70.77816  ?  133 ILE D CG2 1 
ATOM   5162 C  CD1 . ILE D  1 133 ? -0.70800  11.76190  50.67575  1.000 71.90794  ?  133 ILE D CD1 1 
ATOM   5163 N  N   . GLU D  1 134 ? 0.90120   6.81475   49.45277  1.000 67.82772  ?  134 GLU D N   1 
ATOM   5164 C  CA  . GLU D  1 134 ? 1.94062   5.88425   49.01134  1.000 69.39161  ?  134 GLU D CA  1 
ATOM   5165 C  C   . GLU D  1 134 ? 2.07950   5.91017   47.49744  1.000 68.87274  ?  134 GLU D C   1 
ATOM   5166 O  O   . GLU D  1 134 ? 3.00372   6.53086   46.95516  1.000 80.42691  ?  134 GLU D O   1 
ATOM   5167 C  CB  . GLU D  1 134 ? 1.62027   4.44957   49.44093  1.000 71.52422  ?  134 GLU D CB  1 
ATOM   5168 C  CG  . GLU D  1 134 ? 1.58277   4.19683   50.93280  1.000 71.86921  ?  134 GLU D CG  1 
ATOM   5169 C  CD  . GLU D  1 134 ? 0.82731   2.92570   51.27929  1.000 72.36553  ?  134 GLU D CD  1 
ATOM   5170 O  OE1 . GLU D  1 134 ? 0.41911   2.19945   50.34411  1.000 71.21979  ?  134 GLU D OE1 1 
ATOM   5171 O  OE2 . GLU D  1 134 ? 0.63912   2.65744   52.48462  1.000 75.50399  -1 134 GLU D OE2 1 
ATOM   5172 N  N   . THR D  1 135 ? 1.11687   5.26081   46.84662  1.000 60.85713  ?  135 THR D N   1 
ATOM   5173 C  CA  . THR D  1 135 ? 0.90957   5.14680   45.41149  1.000 62.45787  ?  135 THR D CA  1 
ATOM   5174 C  C   . THR D  1 135 ? 1.28996   6.36814   44.58525  1.000 64.09722  ?  135 THR D C   1 
ATOM   5175 O  O   . THR D  1 135 ? 2.02277   6.24143   43.59501  1.000 65.37231  ?  135 THR D O   1 
ATOM   5176 C  CB  . THR D  1 135 ? -0.56897  4.82392   45.17477  1.000 64.34212  ?  135 THR D CB  1 
ATOM   5177 O  OG1 . THR D  1 135 ? -0.98927  3.81410   46.10589  1.000 70.56664  ?  135 THR D OG1 1 
ATOM   5178 C  CG2 . THR D  1 135 ? -0.81361  4.34664   43.75748  1.000 53.73310  ?  135 THR D CG2 1 
ATOM   5179 N  N   . HIS D  1 136 ? 0.77864   7.54498   44.94971  1.000 67.92110  ?  136 HIS D N   1 
ATOM   5180 C  CA  . HIS D  1 136 ? 0.86885   8.70798   44.07979  1.000 64.17482  ?  136 HIS D CA  1 
ATOM   5181 C  C   . HIS D  1 136 ? 1.86446   9.76265   44.54336  1.000 69.20882  ?  136 HIS D C   1 
ATOM   5182 O  O   . HIS D  1 136 ? 2.05524   10.75412  43.82934  1.000 70.17844  ?  136 HIS D O   1 
ATOM   5183 C  CB  . HIS D  1 136 ? -0.51671  9.33723   43.92203  1.000 65.41336  ?  136 HIS D CB  1 
ATOM   5184 C  CG  . HIS D  1 136 ? -1.50883  8.44021   43.24287  1.000 70.05214  ?  136 HIS D CG  1 
ATOM   5185 N  ND1 . HIS D  1 136 ? -2.71231  8.08936   43.81759  1.000 69.25213  ?  136 HIS D ND1 1 
ATOM   5186 C  CD2 . HIS D  1 136 ? -1.47683  7.82574   42.03509  1.000 66.58319  ?  136 HIS D CD2 1 
ATOM   5187 C  CE1 . HIS D  1 136 ? -3.37529  7.29216   42.99795  1.000 69.76947  ?  136 HIS D CE1 1 
ATOM   5188 N  NE2 . HIS D  1 136 ? -2.64757  7.11633   41.90920  1.000 67.53627  ?  136 HIS D NE2 1 
ATOM   5189 N  N   . TYR D  1 137 ? 2.52243   9.58401   45.69629  1.000 68.64471  ?  137 TYR D N   1 
ATOM   5190 C  CA  . TYR D  1 137 ? 3.42467   10.62022  46.17435  1.000 68.16846  ?  137 TYR D CA  1 
ATOM   5191 C  C   . TYR D  1 137 ? 4.71993   10.05813  46.73901  1.000 74.78266  ?  137 TYR D C   1 
ATOM   5192 O  O   . TYR D  1 137 ? 5.77284   10.65963  46.53168  1.000 79.15811  ?  137 TYR D O   1 
ATOM   5193 C  CB  . TYR D  1 137 ? 2.72076   11.48892  47.22724  1.000 68.35185  ?  137 TYR D CB  1 
ATOM   5194 C  CG  . TYR D  1 137 ? 1.64571   12.32422  46.59816  1.000 71.05362  ?  137 TYR D CG  1 
ATOM   5195 C  CD1 . TYR D  1 137 ? 0.37581   11.80112  46.39686  1.000 71.13410  ?  137 TYR D CD1 1 
ATOM   5196 C  CD2 . TYR D  1 137 ? 1.90540   13.61893  46.15969  1.000 72.84419  ?  137 TYR D CD2 1 
ATOM   5197 C  CE1 . TYR D  1 137 ? -0.61073  12.53678  45.78339  1.000 77.07486  ?  137 TYR D CE1 1 
ATOM   5198 C  CE2 . TYR D  1 137 ? 0.91437   14.37707  45.54916  1.000 75.48041  ?  137 TYR D CE2 1 
ATOM   5199 C  CZ  . TYR D  1 137 ? -0.34146  13.82560  45.36221  1.000 75.67064  ?  137 TYR D CZ  1 
ATOM   5200 O  OH  . TYR D  1 137 ? -1.33973  14.55043  44.75858  1.000 74.72458  ?  137 TYR D OH  1 
ATOM   5201 N  N   . LEU D  1 138 ? 4.68095   8.92866   47.45342  1.000 75.24033  ?  138 LEU D N   1 
ATOM   5202 C  CA  . LEU D  1 138 ? 5.85208   8.54336   48.24232  1.000 75.40312  ?  138 LEU D CA  1 
ATOM   5203 C  C   . LEU D  1 138 ? 7.02417   8.16046   47.34119  1.000 67.75456  ?  138 LEU D C   1 
ATOM   5204 O  O   . LEU D  1 138 ? 8.12747   8.71282   47.45839  1.000 69.68445  ?  138 LEU D O   1 
ATOM   5205 C  CB  . LEU D  1 138 ? 5.49299   7.39927   49.19722  1.000 75.59885  ?  138 LEU D CB  1 
ATOM   5206 N  N   . ASN D  1 139 ? 6.80088   7.22492   46.41759  1.000 61.09448  ?  139 ASN D N   1 
ATOM   5207 C  CA  . ASN D  1 139 ? 7.88876   6.82380   45.53644  1.000 62.65990  ?  139 ASN D CA  1 
ATOM   5208 C  C   . ASN D  1 139 ? 8.22178   7.91891   44.53006  1.000 61.46872  ?  139 ASN D C   1 
ATOM   5209 O  O   . ASN D  1 139 ? 9.38483   8.05574   44.13219  1.000 60.30772  ?  139 ASN D O   1 
ATOM   5210 C  CB  . ASN D  1 139 ? 7.54416   5.50905   44.83462  1.000 59.27171  ?  139 ASN D CB  1 
ATOM   5211 C  CG  . ASN D  1 139 ? 8.76219   4.83529   44.22584  1.000 60.96648  ?  139 ASN D CG  1 
ATOM   5212 O  OD1 . ASN D  1 139 ? 9.72907   4.48346   44.92515  1.000 64.66403  ?  139 ASN D OD1 1 
ATOM   5213 N  ND2 . ASN D  1 139 ? 8.72015   4.64029   42.91547  1.000 48.95268  ?  139 ASN D ND2 1 
ATOM   5214 N  N   . GLU D  1 140 ? 7.23177   8.72418   44.13450  1.000 58.72733  ?  140 GLU D N   1 
ATOM   5215 C  CA  . GLU D  1 140 ? 7.51054   9.87260   43.27207  1.000 63.08069  ?  140 GLU D CA  1 
ATOM   5216 C  C   . GLU D  1 140 ? 8.48200   10.84272  43.94077  1.000 64.49472  ?  140 GLU D C   1 
ATOM   5217 O  O   . GLU D  1 140 ? 9.46407   11.27396  43.32631  1.000 67.70127  ?  140 GLU D O   1 
ATOM   5218 C  CB  . GLU D  1 140 ? 6.20893   10.58513  42.89089  1.000 62.13525  ?  140 GLU D CB  1 
ATOM   5219 N  N   . GLN D  1 141 ? 8.23460   11.18868  45.20782  1.000 66.37622  ?  141 GLN D N   1 
ATOM   5220 C  CA  . GLN D  1 141 ? 9.14614   12.08973  45.90666  1.000 67.84037  ?  141 GLN D CA  1 
ATOM   5221 C  C   . GLN D  1 141 ? 10.48985  11.42914  46.15785  1.000 64.96126  ?  141 GLN D C   1 
ATOM   5222 O  O   . GLN D  1 141 ? 11.51790  12.10273  46.11780  1.000 63.63664  ?  141 GLN D O   1 
ATOM   5223 C  CB  . GLN D  1 141 ? 8.54725   12.57612  47.23003  1.000 72.39056  ?  141 GLN D CB  1 
ATOM   5224 C  CG  . GLN D  1 141 ? 7.23898   13.35740  47.09187  1.000 78.82594  ?  141 GLN D CG  1 
ATOM   5225 C  CD  . GLN D  1 141 ? 7.41292   14.74725  46.49729  1.000 82.09371  ?  141 GLN D CD  1 
ATOM   5226 O  OE1 . GLN D  1 141 ? 6.76749   15.09800  45.49848  1.000 84.73113  ?  141 GLN D OE1 1 
ATOM   5227 N  NE2 . GLN D  1 141 ? 8.27340   15.55105  47.11657  1.000 77.11997  ?  141 GLN D NE2 1 
ATOM   5228 N  N   . VAL D  1 142 ? 10.51848  10.11801  46.38957  1.000 69.46319  ?  142 VAL D N   1 
ATOM   5229 C  CA  . VAL D  1 142 ? 11.81127  9.45535   46.56203  1.000 67.73279  ?  142 VAL D CA  1 
ATOM   5230 C  C   . VAL D  1 142 ? 12.62587  9.55206   45.27633  1.000 59.15699  ?  142 VAL D C   1 
ATOM   5231 O  O   . VAL D  1 142 ? 13.80361  9.92979   45.29243  1.000 66.86728  ?  142 VAL D O   1 
ATOM   5232 C  CB  . VAL D  1 142 ? 11.61849  7.99588   47.02357  1.000 68.04769  ?  142 VAL D CB  1 
ATOM   5233 C  CG1 . VAL D  1 142 ? 12.79867  7.11935   46.61967  1.000 61.32899  ?  142 VAL D CG1 1 
ATOM   5234 C  CG2 . VAL D  1 142 ? 11.43540  7.95193   48.53877  1.000 65.68085  ?  142 VAL D CG2 1 
ATOM   5235 N  N   . LYS D  1 143 ? 12.00082  9.24454   44.13945  1.000 56.92560  ?  143 LYS D N   1 
ATOM   5236 C  CA  . LYS D  1 143 ? 12.70699  9.34105   42.86499  1.000 63.42401  ?  143 LYS D CA  1 
ATOM   5237 C  C   . LYS D  1 143 ? 13.14587  10.77509  42.58292  1.000 63.63814  ?  143 LYS D C   1 
ATOM   5238 O  O   . LYS D  1 143 ? 14.24793  11.00370  42.06510  1.000 63.95493  ?  143 LYS D O   1 
ATOM   5239 C  CB  . LYS D  1 143 ? 11.82710  8.81017   41.73062  1.000 58.49869  ?  143 LYS D CB  1 
ATOM   5240 N  N   . ALA D  1 144 ? 12.30208  11.75400  42.93176  1.000 61.45274  ?  144 ALA D N   1 
ATOM   5241 C  CA  . ALA D  1 144 ? 12.62812  13.15507  42.69437  1.000 49.38665  ?  144 ALA D CA  1 
ATOM   5242 C  C   . ALA D  1 144 ? 13.83442  13.58171  43.51337  1.000 55.38032  ?  144 ALA D C   1 
ATOM   5243 O  O   . ALA D  1 144 ? 14.75485  14.22461  42.99668  1.000 64.71212  ?  144 ALA D O   1 
ATOM   5244 C  CB  . ALA D  1 144 ? 11.42300  14.03219  43.02262  1.000 51.41230  ?  144 ALA D CB  1 
ATOM   5245 N  N   . ILE D  1 145 ? 13.84321  13.24180  44.80113  1.000 56.35502  ?  145 ILE D N   1 
ATOM   5246 C  CA  . ILE D  1 145 ? 14.96473  13.61512  45.65166  1.000 59.27263  ?  145 ILE D CA  1 
ATOM   5247 C  C   . ILE D  1 145 ? 16.24216  12.91701  45.19892  1.000 62.19011  ?  145 ILE D C   1 
ATOM   5248 O  O   . ILE D  1 145 ? 17.32161  13.52838  45.18856  1.000 59.41213  ?  145 ILE D O   1 
ATOM   5249 C  CB  . ILE D  1 145 ? 14.61652  13.32961  47.12669  1.000 62.67651  ?  145 ILE D CB  1 
ATOM   5250 C  CG1 . ILE D  1 145 ? 13.31062  14.02902  47.51754  1.000 61.69043  ?  145 ILE D CG1 1 
ATOM   5251 C  CG2 . ILE D  1 145 ? 15.72759  13.76668  48.04957  1.000 59.84212  ?  145 ILE D CG2 1 
ATOM   5252 C  CD1 . ILE D  1 145 ? 12.80815  13.64102  48.89137  1.000 63.24267  ?  145 ILE D CD1 1 
ATOM   5253 N  N   . LYS D  1 146 ? 16.14440  11.64874  44.78455  1.000 63.73529  ?  146 LYS D N   1 
ATOM   5254 C  CA  . LYS D  1 146 ? 17.31878  10.95136  44.26360  1.000 58.70291  ?  146 LYS D CA  1 
ATOM   5255 C  C   . LYS D  1 146 ? 17.85466  11.63208  43.01125  1.000 58.49316  ?  146 LYS D C   1 
ATOM   5256 O  O   . LYS D  1 146 ? 19.06712  11.83425  42.87521  1.000 65.48276  ?  146 LYS D O   1 
ATOM   5257 C  CB  . LYS D  1 146 ? 16.97668  9.48526   43.96990  1.000 58.61448  ?  146 LYS D CB  1 
ATOM   5258 C  CG  . LYS D  1 146 ? 18.11288  8.67265   43.34627  1.000 50.45292  ?  146 LYS D CG  1 
ATOM   5259 C  CD  . LYS D  1 146 ? 19.34453  8.68098   44.24320  1.000 51.70456  ?  146 LYS D CD  1 
ATOM   5260 C  CE  . LYS D  1 146 ? 20.29457  7.52046   43.92845  1.000 51.42107  ?  146 LYS D CE  1 
ATOM   5261 N  NZ  . LYS D  1 146 ? 20.77508  7.51927   42.50907  1.000 49.83898  ?  146 LYS D NZ  1 
ATOM   5262 N  N   . GLU D  1 147 ? 16.96531  11.98038  42.07787  1.000 60.42293  ?  147 GLU D N   1 
ATOM   5263 C  CA  . GLU D  1 147 ? 17.38801  12.65768  40.85666  1.000 51.89437  ?  147 GLU D CA  1 
ATOM   5264 C  C   . GLU D  1 147 ? 18.06955  13.98304  41.16829  1.000 54.03329  ?  147 GLU D C   1 
ATOM   5265 O  O   . GLU D  1 147 ? 19.13284  14.28903  40.61108  1.000 52.24867  ?  147 GLU D O   1 
ATOM   5266 C  CB  . GLU D  1 147 ? 16.18261  12.86064  39.94493  1.000 53.40401  ?  147 GLU D CB  1 
ATOM   5267 C  CG  . GLU D  1 147 ? 16.37135  13.89139  38.85172  1.000 62.52136  ?  147 GLU D CG  1 
ATOM   5268 C  CD  . GLU D  1 147 ? 15.23042  13.87899  37.84561  1.000 62.72663  ?  147 GLU D CD  1 
ATOM   5269 O  OE1 . GLU D  1 147 ? 15.07276  12.85499  37.14729  1.000 65.01161  ?  147 GLU D OE1 1 
ATOM   5270 O  OE2 . GLU D  1 147 ? 14.48614  14.88471  37.76076  1.000 69.46554  -1 147 GLU D OE2 1 
ATOM   5271 N  N   . LEU D  1 148 ? 17.48191  14.77702  42.07151  1.000 55.88022  ?  148 LEU D N   1 
ATOM   5272 C  CA  . LEU D  1 148 ? 18.08104  16.05995  42.41948  1.000 53.25704  ?  148 LEU D CA  1 
ATOM   5273 C  C   . LEU D  1 148 ? 19.43581  15.86560  43.08672  1.000 56.04836  ?  148 LEU D C   1 
ATOM   5274 O  O   . LEU D  1 148 ? 20.36606  16.64649  42.85992  1.000 51.39436  ?  148 LEU D O   1 
ATOM   5275 C  CB  . LEU D  1 148 ? 17.13449  16.85749  43.32128  1.000 56.36242  ?  148 LEU D CB  1 
ATOM   5276 C  CG  . LEU D  1 148 ? 15.93148  17.45241  42.58471  1.000 54.36223  ?  148 LEU D CG  1 
ATOM   5277 C  CD1 . LEU D  1 148 ? 14.89908  17.99460  43.54123  1.000 51.56452  ?  148 LEU D CD1 1 
ATOM   5278 C  CD2 . LEU D  1 148 ? 16.39114  18.53327  41.62144  1.000 52.34467  ?  148 LEU D CD2 1 
ATOM   5279 N  N   . GLY D  1 149 ? 19.57018  14.82403  43.90792  1.000 58.42676  ?  149 GLY D N   1 
ATOM   5280 C  CA  . GLY D  1 149 ? 20.86196  14.54056  44.51358  1.000 53.56085  ?  149 GLY D CA  1 
ATOM   5281 C  C   . GLY D  1 149 ? 21.90862  14.17475  43.48140  1.000 56.70960  ?  149 GLY D C   1 
ATOM   5282 O  O   . GLY D  1 149 ? 23.05252  14.63038  43.55428  1.000 61.02768  ?  149 GLY D O   1 
ATOM   5283 N  N   . ASP D  1 150 ? 21.53422  13.34168  42.51011  1.000 51.95048  ?  150 ASP D N   1 
ATOM   5284 C  CA  . ASP D  1 150 ? 22.43308  13.05212  41.39678  1.000 55.36149  ?  150 ASP D CA  1 
ATOM   5285 C  C   . ASP D  1 150 ? 22.85946  14.33407  40.68827  1.000 55.98982  ?  150 ASP D C   1 
ATOM   5286 O  O   . ASP D  1 150 ? 24.03061  14.50169  40.32511  1.000 60.09270  ?  150 ASP D O   1 
ATOM   5287 C  CB  . ASP D  1 150 ? 21.75807  12.10818  40.39394  1.000 56.03432  ?  150 ASP D CB  1 
ATOM   5288 C  CG  . ASP D  1 150 ? 21.33528  10.78804  41.00965  1.000 64.92122  ?  150 ASP D CG  1 
ATOM   5289 O  OD1 . ASP D  1 150 ? 22.14633  10.14654  41.71427  1.000 66.26452  ?  150 ASP D OD1 1 
ATOM   5290 O  OD2 . ASP D  1 150 ? 20.17941  10.38263  40.77031  1.000 70.53513  -1 150 ASP D OD2 1 
ATOM   5291 N  N   . HIS D  1 151 ? 21.90673  15.22512  40.43376  1.000 56.40087  ?  151 HIS D N   1 
ATOM   5292 C  CA  . HIS D  1 151 ? 22.21955  16.47257  39.74800  1.000 52.70687  ?  151 HIS D CA  1 
ATOM   5293 C  C   . HIS D  1 151 ? 23.21587  17.29833  40.55698  1.000 54.60342  ?  151 HIS D C   1 
ATOM   5294 O  O   . HIS D  1 151 ? 24.19356  17.83961  40.01590  1.000 56.02037  ?  151 HIS D O   1 
ATOM   5295 C  CB  . HIS D  1 151 ? 20.92730  17.25806  39.51451  1.000 52.24514  ?  151 HIS D CB  1 
ATOM   5296 C  CG  . HIS D  1 151 ? 20.06457  16.69901  38.43220  1.000 46.68461  ?  151 HIS D CG  1 
ATOM   5297 N  ND1 . HIS D  1 151 ? 20.42248  15.59348  37.69161  1.000 51.15672  ?  151 HIS D ND1 1 
ATOM   5298 C  CD2 . HIS D  1 151 ? 18.86811  17.10758  37.94702  1.000 49.07765  ?  151 HIS D CD2 1 
ATOM   5299 C  CE1 . HIS D  1 151 ? 19.47876  15.33954  36.80156  1.000 45.18977  ?  151 HIS D CE1 1 
ATOM   5300 N  NE2 . HIS D  1 151 ? 18.52662  16.24649  36.93422  1.000 48.55775  ?  151 HIS D NE2 1 
ATOM   5301 N  N   . VAL D  1 152 ? 22.97057  17.40397  41.86365  1.000 52.93528  ?  152 VAL D N   1 
ATOM   5302 C  CA  . VAL D  1 152 ? 23.85736  18.14875  42.75149  1.000 60.16400  ?  152 VAL D CA  1 
ATOM   5303 C  C   . VAL D  1 152 ? 25.26124  17.55271  42.71725  1.000 60.23497  ?  152 VAL D C   1 
ATOM   5304 O  O   . VAL D  1 152 ? 26.26414  18.27591  42.62041  1.000 61.91171  ?  152 VAL D O   1 
ATOM   5305 C  CB  . VAL D  1 152 ? 23.28034  18.15955  44.18195  1.000 59.84016  ?  152 VAL D CB  1 
ATOM   5306 C  CG1 . VAL D  1 152 ? 24.32534  18.61127  45.17644  1.000 57.70190  ?  152 VAL D CG1 1 
ATOM   5307 C  CG2 . VAL D  1 152 ? 22.03859  19.03619  44.26273  1.000 54.02952  ?  152 VAL D CG2 1 
ATOM   5308 N  N   . THR D  1 153 ? 25.33972  16.21866  42.78694  1.000 57.00042  ?  153 THR D N   1 
ATOM   5309 C  CA  . THR D  1 153 ? 26.61715  15.51232  42.80298  1.000 52.41886  ?  153 THR D CA  1 
ATOM   5310 C  C   . THR D  1 153 ? 27.38432  15.72907  41.50792  1.000 51.49619  ?  153 THR D C   1 
ATOM   5311 O  O   . THR D  1 153 ? 28.59495  15.98292  41.52147  1.000 58.61249  ?  153 THR D O   1 
ATOM   5312 C  CB  . THR D  1 153 ? 26.37425  14.02090  43.04363  1.000 57.85456  ?  153 THR D CB  1 
ATOM   5313 O  OG1 . THR D  1 153 ? 26.08018  13.80225  44.43104  1.000 58.99737  ?  153 THR D OG1 1 
ATOM   5314 C  CG2 . THR D  1 153 ? 27.58985  13.18804  42.64761  1.000 54.92574  ?  153 THR D CG2 1 
ATOM   5315 N  N   . ASN D  1 154 ? 26.69869  15.64084  40.37200  1.000 49.60882  ?  154 ASN D N   1 
ATOM   5316 C  CA  . ASN D  1 154 ? 27.38342  15.85768  39.10435  1.000 48.37407  ?  154 ASN D CA  1 
ATOM   5317 C  C   . ASN D  1 154 ? 27.91750  17.27887  39.00419  1.000 57.66158  ?  154 ASN D C   1 
ATOM   5318 O  O   . ASN D  1 154 ? 29.10487  17.48148  38.72683  1.000 54.70659  ?  154 ASN D O   1 
ATOM   5319 C  CB  . ASN D  1 154 ? 26.45934  15.55218  37.93899  1.000 46.80388  ?  154 ASN D CB  1 
ATOM   5320 C  CG  . ASN D  1 154 ? 26.30732  14.08399  37.70609  1.000 55.87210  ?  154 ASN D CG  1 
ATOM   5321 O  OD1 . ASN D  1 154 ? 27.26625  13.39016  37.37356  1.000 49.80696  ?  154 ASN D OD1 1 
ATOM   5322 N  ND2 . ASN D  1 154 ? 25.08919  13.59027  37.87497  1.000 65.65200  ?  154 ASN D ND2 1 
ATOM   5323 N  N   . LEU D  1 155 ? 27.05318  18.28107  39.23447  1.000 60.20218  ?  155 LEU D N   1 
ATOM   5324 C  CA  . LEU D  1 155 ? 27.49778  19.66973  39.12269  1.000 51.84881  ?  155 LEU D CA  1 
ATOM   5325 C  C   . LEU D  1 155 ? 28.66943  19.95118  40.05596  1.000 60.43869  ?  155 LEU D C   1 
ATOM   5326 O  O   . LEU D  1 155 ? 29.64936  20.58906  39.65824  1.000 72.73465  ?  155 LEU D O   1 
ATOM   5327 C  CB  . LEU D  1 155 ? 26.34004  20.62660  39.40478  1.000 58.73567  ?  155 LEU D CB  1 
ATOM   5328 C  CG  . LEU D  1 155 ? 25.18199  20.64685  38.39095  1.000 59.52277  ?  155 LEU D CG  1 
ATOM   5329 C  CD1 . LEU D  1 155 ? 23.83632  20.91072  39.06643  1.000 55.00396  ?  155 LEU D CD1 1 
ATOM   5330 C  CD2 . LEU D  1 155 ? 25.42803  21.67495  37.29847  1.000 62.82504  ?  155 LEU D CD2 1 
ATOM   5331 N  N   . ARG D  1 156 ? 28.60966  19.45469  41.29013  1.000 61.58881  ?  156 ARG D N   1 
ATOM   5332 C  CA  . ARG D  1 156 ? 29.75016  19.59419  42.19072  1.000 59.51648  ?  156 ARG D CA  1 
ATOM   5333 C  C   . ARG D  1 156 ? 31.00475  18.93623  41.61839  1.000 61.69574  ?  156 ARG D C   1 
ATOM   5334 O  O   . ARG D  1 156 ? 32.04429  19.58757  41.46491  1.000 64.09217  ?  156 ARG D O   1 
ATOM   5335 C  CB  . ARG D  1 156 ? 29.39335  19.00793  43.54984  1.000 58.64345  ?  156 ARG D CB  1 
ATOM   5336 C  CG  . ARG D  1 156 ? 28.62881  19.98586  44.40162  1.000 60.40763  ?  156 ARG D CG  1 
ATOM   5337 C  CD  . ARG D  1 156 ? 28.93968  19.75389  45.83749  1.000 80.43042  ?  156 ARG D CD  1 
ATOM   5338 N  NE  . ARG D  1 156 ? 28.07925  18.71039  46.37499  1.000 84.21081  ?  156 ARG D NE  1 
ATOM   5339 C  CZ  . ARG D  1 156 ? 27.02894  18.94934  47.15151  1.000 83.99928  ?  156 ARG D CZ  1 
ATOM   5340 N  NH1 . ARG D  1 156 ? 26.71781  20.20069  47.48937  1.000 87.40639  ?  156 ARG D NH1 1 
ATOM   5341 N  NH2 . ARG D  1 156 ? 26.29824  17.93854  47.60078  1.000 79.90036  ?  156 ARG D NH2 1 
ATOM   5342 N  N   . CYS D  1 157 ? 30.91987  17.64469  41.27952  1.000 68.61876  ?  157 CYS D N   1 
ATOM   5343 C  CA  . CYS D  1 157 ? 32.06468  16.92492  40.72322  1.000 65.46198  ?  157 CYS D CA  1 
ATOM   5344 C  C   . CYS D  1 157 ? 32.63919  17.61443  39.49199  1.000 65.48544  ?  157 CYS D C   1 
ATOM   5345 O  O   . CYS D  1 157 ? 33.83257  17.46731  39.20571  1.000 67.33496  ?  157 CYS D O   1 
ATOM   5346 C  CB  . CYS D  1 157 ? 31.66288  15.49541  40.35312  1.000 71.26916  ?  157 CYS D CB  1 
ATOM   5347 S  SG  . CYS D  1 157 ? 31.38369  14.39482  41.72802  1.000 88.75045  ?  157 CYS D SG  1 
ATOM   5348 N  N   . MET D  1 158 ? 31.81145  18.34069  38.73390  1.000 70.07111  ?  158 MET D N   1 
ATOM   5349 C  CA  . MET D  1 158 ? 32.28167  18.94973  37.49586  1.000 64.37343  ?  158 MET D CA  1 
ATOM   5350 C  C   . MET D  1 158 ? 33.04214  20.24935  37.71233  1.000 72.05544  ?  158 MET D C   1 
ATOM   5351 O  O   . MET D  1 158 ? 33.60742  20.77871  36.75097  1.000 70.77669  ?  158 MET D O   1 
ATOM   5352 C  CB  . MET D  1 158 ? 31.11498  19.20897  36.55198  1.000 55.07246  ?  158 MET D CB  1 
ATOM   5353 C  CG  . MET D  1 158 ? 30.52013  17.94945  35.98497  1.000 55.30461  ?  158 MET D CG  1 
ATOM   5354 S  SD  . MET D  1 158 ? 28.95307  18.20795  35.14611  1.000 55.47181  ?  158 MET D SD  1 
ATOM   5355 C  CE  . MET D  1 158 ? 29.48516  18.85699  33.56207  1.000 47.07651  ?  158 MET D CE  1 
ATOM   5356 N  N   . GLY D  1 159 ? 33.07296  20.77851  38.92940  1.000 67.34843  ?  159 GLY D N   1 
ATOM   5357 C  CA  . GLY D  1 159 ? 33.71867  22.05074  39.17642  1.000 77.29359  ?  159 GLY D CA  1 
ATOM   5358 C  C   . GLY D  1 159 ? 32.77619  23.20950  39.41686  1.000 74.96244  ?  159 GLY D C   1 
ATOM   5359 O  O   . GLY D  1 159 ? 33.24802  24.33661  39.59618  1.000 80.64594  ?  159 GLY D O   1 
ATOM   5360 N  N   . ALA D  1 160 ? 31.46758  22.98362  39.41649  1.000 76.39006  ?  160 ALA D N   1 
ATOM   5361 C  CA  . ALA D  1 160 ? 30.54948  24.04042  39.79898  1.000 81.18790  ?  160 ALA D CA  1 
ATOM   5362 C  C   . ALA D  1 160 ? 30.76358  24.39011  41.27360  1.000 86.50961  ?  160 ALA D C   1 
ATOM   5363 O  O   . ALA D  1 160 ? 31.22769  23.55324  42.05569  1.000 79.61336  ?  160 ALA D O   1 
ATOM   5364 C  CB  . ALA D  1 160 ? 29.09945  23.61435  39.54657  1.000 69.35262  ?  160 ALA D CB  1 
ATOM   5365 N  N   . PRO D  1 161 ? 30.46479  25.64082  41.67650  1.000 99.02543  ?  161 PRO D N   1 
ATOM   5366 C  CA  . PRO D  1 161 ? 29.98134  26.72392  40.81198  1.000 99.78287  ?  161 PRO D CA  1 
ATOM   5367 C  C   . PRO D  1 161 ? 31.10685  27.59876  40.26103  1.000 104.03916 ?  161 PRO D C   1 
ATOM   5368 O  O   . PRO D  1 161 ? 30.83507  28.51390  39.47954  1.000 106.55750 ?  161 PRO D O   1 
ATOM   5369 C  CB  . PRO D  1 161 ? 29.08194  27.52438  41.75023  1.000 101.97550 ?  161 PRO D CB  1 
ATOM   5370 C  CG  . PRO D  1 161 ? 29.75539  27.38505  43.08818  1.000 106.40121 ?  161 PRO D CG  1 
ATOM   5371 C  CD  . PRO D  1 161 ? 30.48594  26.05133  43.09369  1.000 102.58470 ?  161 PRO D CD  1 
ATOM   5372 N  N   . GLU D  1 162 ? 32.34864  27.30443  40.66047  1.000 101.16038 ?  162 GLU D N   1 
ATOM   5373 C  CA  . GLU D  1 162 ? 33.47721  28.14527  40.27287  1.000 105.38584 ?  162 GLU D CA  1 
ATOM   5374 C  C   . GLU D  1 162 ? 33.59133  28.25441  38.75592  1.000 100.22873 ?  162 GLU D C   1 
ATOM   5375 O  O   . GLU D  1 162 ? 33.77323  29.35141  38.21411  1.000 104.66930 ?  162 GLU D O   1 
ATOM   5376 C  CB  . GLU D  1 162 ? 34.77445  27.60166  40.87661  1.000 104.20130 ?  162 GLU D CB  1 
ATOM   5377 N  N   . SER D  1 163 ? 33.48198  27.13214  38.04761  1.000 89.77531  ?  163 SER D N   1 
ATOM   5378 C  CA  . SER D  1 163 ? 33.60869  27.12902  36.59384  1.000 87.18496  ?  163 SER D CA  1 
ATOM   5379 C  C   . SER D  1 163 ? 32.21497  27.07604  35.97288  1.000 81.86917  ?  163 SER D C   1 
ATOM   5380 O  O   . SER D  1 163 ? 31.49619  26.07563  36.10462  1.000 86.06547  ?  163 SER D O   1 
ATOM   5381 C  CB  . SER D  1 163 ? 34.49440  25.97692  36.11737  1.000 83.44099  ?  163 SER D CB  1 
ATOM   5382 O  OG  . SER D  1 163 ? 33.77711  24.76571  35.98952  1.000 83.58202  ?  163 SER D OG  1 
ATOM   5383 N  N   . GLY D  1 164 ? 31.83079  28.16875  35.31077  1.000 76.20549  ?  164 GLY D N   1 
ATOM   5384 C  CA  . GLY D  1 164 ? 30.60616  28.17266  34.53329  1.000 72.08667  ?  164 GLY D CA  1 
ATOM   5385 C  C   . GLY D  1 164 ? 30.62745  27.20314  33.37268  1.000 62.24239  ?  164 GLY D C   1 
ATOM   5386 O  O   . GLY D  1 164 ? 29.56938  26.91406  32.79502  1.000 68.47308  ?  164 GLY D O   1 
ATOM   5387 N  N   . LEU D  1 165 ? 31.80847  26.68266  33.02416  1.000 58.28875  ?  165 LEU D N   1 
ATOM   5388 C  CA  . LEU D  1 165 ? 31.89254  25.65231  31.99502  1.000 60.06313  ?  165 LEU D CA  1 
ATOM   5389 C  C   . LEU D  1 165 ? 31.19938  24.36205  32.44119  1.000 57.42810  ?  165 LEU D C   1 
ATOM   5390 O  O   . LEU D  1 165 ? 30.51678  23.70554  31.64289  1.000 58.35418  ?  165 LEU D O   1 
ATOM   5391 C  CB  . LEU D  1 165 ? 33.35754  25.39748  31.63514  1.000 55.43669  ?  165 LEU D CB  1 
ATOM   5392 C  CG  . LEU D  1 165 ? 33.62021  24.42891  30.47221  1.000 52.91333  ?  165 LEU D CG  1 
ATOM   5393 C  CD1 . LEU D  1 165 ? 33.23173  25.06302  29.15008  1.000 57.75775  ?  165 LEU D CD1 1 
ATOM   5394 C  CD2 . LEU D  1 165 ? 35.06801  23.98647  30.40768  1.000 55.35343  ?  165 LEU D CD2 1 
ATOM   5395 N  N   . ALA D  1 166 ? 31.33364  24.00420  33.72256  1.000 60.70545  ?  166 ALA D N   1 
ATOM   5396 C  CA  . ALA D  1 166 ? 30.62886  22.83956  34.25337  1.000 55.14714  ?  166 ALA D CA  1 
ATOM   5397 C  C   . ALA D  1 166 ? 29.12010  23.00026  34.12941  1.000 53.38522  ?  166 ALA D C   1 
ATOM   5398 O  O   . ALA D  1 166 ? 28.42470  22.07819  33.68934  1.000 58.83525  ?  166 ALA D O   1 
ATOM   5399 C  CB  . ALA D  1 166 ? 31.01366  22.61124  35.71287  1.000 55.87935  ?  166 ALA D CB  1 
ATOM   5400 N  N   . GLU D  1 167 ? 28.59031  24.14981  34.55576  1.000 54.69621  ?  167 GLU D N   1 
ATOM   5401 C  CA  . GLU D  1 167 ? 27.14589  24.36883  34.49076  1.000 59.81145  ?  167 GLU D CA  1 
ATOM   5402 C  C   . GLU D  1 167 ? 26.65778  24.34964  33.05032  1.000 54.17662  ?  167 GLU D C   1 
ATOM   5403 O  O   . GLU D  1 167 ? 25.63703  23.72751  32.74528  1.000 45.54808  ?  167 GLU D O   1 
ATOM   5404 C  CB  . GLU D  1 167 ? 26.76576  25.69340  35.17071  1.000 58.00572  ?  167 GLU D CB  1 
ATOM   5405 C  CG  . GLU D  1 167 ? 27.17904  25.79994  36.64808  1.000 68.42253  ?  167 GLU D CG  1 
ATOM   5406 C  CD  . GLU D  1 167 ? 26.19910  26.62454  37.50142  1.000 80.24685  ?  167 GLU D CD  1 
ATOM   5407 O  OE1 . GLU D  1 167 ? 25.96698  26.25568  38.67812  1.000 82.86801  ?  167 GLU D OE1 1 
ATOM   5408 O  OE2 . GLU D  1 167 ? 25.66648  27.64670  37.00314  1.000 85.72545  -1 167 GLU D OE2 1 
ATOM   5409 N  N   . TYR D  1 168 ? 27.38301  25.02024  32.14847  1.000 62.93805  ?  168 TYR D N   1 
ATOM   5410 C  CA  . TYR D  1 168 ? 27.04828  24.96898  30.72424  1.000 54.01913  ?  168 TYR D CA  1 
ATOM   5411 C  C   . TYR D  1 168 ? 26.97536  23.52362  30.20130  1.000 49.61488  ?  168 TYR D C   1 
ATOM   5412 O  O   . TYR D  1 168 ? 26.00398  23.12874  29.53653  1.000 41.35606  ?  168 TYR D O   1 
ATOM   5413 C  CB  . TYR D  1 168 ? 28.07983  25.79148  29.94591  1.000 49.47876  ?  168 TYR D CB  1 
ATOM   5414 C  CG  . TYR D  1 168 ? 27.88729  25.75427  28.44824  1.000 53.27091  ?  168 TYR D CG  1 
ATOM   5415 C  CD1 . TYR D  1 168 ? 27.05615  26.67175  27.81808  1.000 45.47716  ?  168 TYR D CD1 1 
ATOM   5416 C  CD2 . TYR D  1 168 ? 28.53675  24.79979  27.66097  1.000 49.10845  ?  168 TYR D CD2 1 
ATOM   5417 C  CE1 . TYR D  1 168 ? 26.87821  26.63971  26.46927  1.000 44.50986  ?  168 TYR D CE1 1 
ATOM   5418 C  CE2 . TYR D  1 168 ? 28.35593  24.76624  26.29580  1.000 41.96857  ?  168 TYR D CE2 1 
ATOM   5419 C  CZ  . TYR D  1 168 ? 27.52390  25.68583  25.70977  1.000 44.64540  ?  168 TYR D CZ  1 
ATOM   5420 O  OH  . TYR D  1 168 ? 27.33516  25.66331  24.34606  1.000 44.82052  ?  168 TYR D OH  1 
ATOM   5421 N  N   . LEU D  1 169 ? 27.99909  22.71099  30.48556  1.000 53.85552  ?  169 LEU D N   1 
ATOM   5422 C  CA  . LEU D  1 169 ? 28.01509  21.36909  29.90587  1.000 43.81120  ?  169 LEU D CA  1 
ATOM   5423 C  C   . LEU D  1 169 ? 26.98773  20.44867  30.55899  1.000 43.55400  ?  169 LEU D C   1 
ATOM   5424 O  O   . LEU D  1 169 ? 26.38072  19.63284  29.87310  1.000 44.18542  ?  169 LEU D O   1 
ATOM   5425 C  CB  . LEU D  1 169 ? 29.40870  20.76580  30.01786  1.000 48.12323  ?  169 LEU D CB  1 
ATOM   5426 C  CG  . LEU D  1 169 ? 30.48689  21.43484  29.17677  1.000 47.68670  ?  169 LEU D CG  1 
ATOM   5427 C  CD1 . LEU D  1 169 ? 31.85607  20.98701  29.66100  1.000 44.35132  ?  169 LEU D CD1 1 
ATOM   5428 C  CD2 . LEU D  1 169 ? 30.29424  21.13303  27.70313  1.000 40.66991  ?  169 LEU D CD2 1 
ATOM   5429 N  N   . PHE D  1 170 ? 26.77878  20.55690  31.87386  1.000 54.23277  ?  170 PHE D N   1 
ATOM   5430 C  CA  . PHE D  1 170 ? 25.69369  19.82225  32.52013  1.000 48.66322  ?  170 PHE D CA  1 
ATOM   5431 C  C   . PHE D  1 170 ? 24.34829  20.18000  31.90597  1.000 51.43133  ?  170 PHE D C   1 
ATOM   5432 O  O   . PHE D  1 170 ? 23.50451  19.30121  31.69044  1.000 54.40831  ?  170 PHE D O   1 
ATOM   5433 C  CB  . PHE D  1 170 ? 25.67353  20.12419  34.02138  1.000 47.77784  ?  170 PHE D CB  1 
ATOM   5434 C  CG  . PHE D  1 170 ? 24.58811  19.39472  34.77566  1.000 54.51400  ?  170 PHE D CG  1 
ATOM   5435 C  CD1 . PHE D  1 170 ? 24.79746  18.10964  35.24070  1.000 45.48502  ?  170 PHE D CD1 1 
ATOM   5436 C  CD2 . PHE D  1 170 ? 23.36305  20.00179  35.03924  1.000 62.66385  ?  170 PHE D CD2 1 
ATOM   5437 C  CE1 . PHE D  1 170 ? 23.81754  17.44595  35.95468  1.000 45.46202  ?  170 PHE D CE1 1 
ATOM   5438 C  CE2 . PHE D  1 170 ? 22.37153  19.32724  35.74451  1.000 52.77184  ?  170 PHE D CE2 1 
ATOM   5439 C  CZ  . PHE D  1 170 ? 22.60606  18.04486  36.19182  1.000 47.42123  ?  170 PHE D CZ  1 
ATOM   5440 N  N   . ASP D  1 171 ? 24.11683  21.47873  31.66289  1.000 49.99474  ?  171 ASP D N   1 
ATOM   5441 C  CA  . ASP D  1 171 ? 22.88772  21.92261  31.01989  1.000 46.32498  ?  171 ASP D CA  1 
ATOM   5442 C  C   . ASP D  1 171 ? 22.72841  21.26510  29.65553  1.000 52.83035  ?  171 ASP D C   1 
ATOM   5443 O  O   . ASP D  1 171 ? 21.62125  20.85895  29.27785  1.000 51.06699  ?  171 ASP D O   1 
ATOM   5444 C  CB  . ASP D  1 171 ? 22.90775  23.45410  30.92500  1.000 46.48019  ?  171 ASP D CB  1 
ATOM   5445 C  CG  . ASP D  1 171 ? 21.82890  24.02996  30.01918  1.000 44.68151  ?  171 ASP D CG  1 
ATOM   5446 O  OD1 . ASP D  1 171 ? 22.02976  24.06771  28.78680  1.000 46.41659  ?  171 ASP D OD1 1 
ATOM   5447 O  OD2 . ASP D  1 171 ? 20.79765  24.49835  30.55234  1.000 48.16523  -1 171 ASP D OD2 1 
ATOM   5448 N  N   . LYS D  1 172 ? 23.83618  21.09437  28.92549  1.000 44.30493  ?  172 LYS D N   1 
ATOM   5449 C  CA  . LYS D  1 172 ? 23.73070  20.48983  27.59633  1.000 41.20923  ?  172 LYS D CA  1 
ATOM   5450 C  C   . LYS D  1 172 ? 23.62252  18.95635  27.64280  1.000 50.14999  ?  172 LYS D C   1 
ATOM   5451 O  O   . LYS D  1 172 ? 22.75396  18.37123  26.98485  1.000 45.22459  ?  172 LYS D O   1 
ATOM   5452 C  CB  . LYS D  1 172 ? 24.91455  20.92766  26.73652  1.000 46.33438  ?  172 LYS D CB  1 
ATOM   5453 C  CG  . LYS D  1 172 ? 24.51385  21.72606  25.48419  1.000 60.98875  ?  172 LYS D CG  1 
ATOM   5454 C  CD  . LYS D  1 172 ? 24.57349  23.23981  25.67593  1.000 51.75466  ?  172 LYS D CD  1 
ATOM   5455 N  N   . HIS D  1 173 ? 24.47601  18.28135  28.40841  1.000 51.30808  ?  173 HIS D N   1 
ATOM   5456 C  CA  . HIS D  1 173 ? 24.56259  16.82478  28.37373  1.000 48.79592  ?  173 HIS D CA  1 
ATOM   5457 C  C   . HIS D  1 173 ? 23.55315  16.13254  29.27975  1.000 51.29439  ?  173 HIS D C   1 
ATOM   5458 O  O   . HIS D  1 173 ? 23.04655  15.06402  28.92582  1.000 60.56323  ?  173 HIS D O   1 
ATOM   5459 C  CB  . HIS D  1 173 ? 25.95849  16.37281  28.77120  1.000 51.10921  ?  173 HIS D CB  1 
ATOM   5460 C  CG  . HIS D  1 173 ? 26.98691  16.56741  27.70068  1.000 56.25005  ?  173 HIS D CG  1 
ATOM   5461 N  ND1 . HIS D  1 173 ? 27.07664  15.74569  26.59441  1.000 55.83967  ?  173 HIS D ND1 1 
ATOM   5462 C  CD2 . HIS D  1 173 ? 27.98768  17.47293  27.58133  1.000 47.22933  ?  173 HIS D CD2 1 
ATOM   5463 C  CE1 . HIS D  1 173 ? 28.08483  16.14583  25.83670  1.000 56.85319  ?  173 HIS D CE1 1 
ATOM   5464 N  NE2 . HIS D  1 173 ? 28.65212  17.19253  26.41203  1.000 50.64778  ?  173 HIS D NE2 1 
ATOM   5465 N  N   . THR D  1 174 ? 23.25338  16.68785  30.45234  1.000 51.50156  ?  174 THR D N   1 
ATOM   5466 C  CA  . THR D  1 174 ? 22.28673  15.99300  31.29530  1.000 52.27845  ?  174 THR D CA  1 
ATOM   5467 C  C   . THR D  1 174 ? 20.88519  16.55979  31.13018  1.000 46.98435  ?  174 THR D C   1 
ATOM   5468 O  O   . THR D  1 174 ? 19.93302  15.82181  30.89203  1.000 54.94237  ?  174 THR D O   1 
ATOM   5469 C  CB  . THR D  1 174 ? 22.68701  16.06525  32.76860  1.000 51.92718  ?  174 THR D CB  1 
ATOM   5470 O  OG1 . THR D  1 174 ? 23.76588  15.15563  33.02171  1.000 47.34209  ?  174 THR D OG1 1 
ATOM   5471 C  CG2 . THR D  1 174 ? 21.48106  15.69852  33.63712  1.000 48.65046  ?  174 THR D CG2 1 
ATOM   5472 N  N   . LEU D  1 175 ? 20.73644  17.86179  31.26296  1.000 49.81585  ?  175 LEU D N   1 
ATOM   5473 C  CA  . LEU D  1 175 ? 19.41291  18.43742  31.14216  1.000 44.86172  ?  175 LEU D CA  1 
ATOM   5474 C  C   . LEU D  1 175 ? 18.94537  18.51938  29.69845  1.000 52.42006  ?  175 LEU D C   1 
ATOM   5475 O  O   . LEU D  1 175 ? 17.84532  19.01990  29.44919  1.000 60.59401  ?  175 LEU D O   1 
ATOM   5476 C  CB  . LEU D  1 175 ? 19.39529  19.80783  31.80047  1.000 43.15457  ?  175 LEU D CB  1 
ATOM   5477 C  CG  . LEU D  1 175 ? 19.67079  19.76382  33.30380  1.000 43.73916  ?  175 LEU D CG  1 
ATOM   5478 C  CD1 . LEU D  1 175 ? 19.58340  21.14767  33.87944  1.000 45.02361  ?  175 LEU D CD1 1 
ATOM   5479 C  CD2 . LEU D  1 175 ? 18.68737  18.84949  33.99916  1.000 51.34349  ?  175 LEU D CD2 1 
ATOM   5480 N  N   . GLY D  1 176 ? 19.74201  18.03051  28.75450  1.000 55.26832  ?  176 GLY D N   1 
ATOM   5481 C  CA  . GLY D  1 176 ? 19.38946  18.06395  27.35149  1.000 53.87387  ?  176 GLY D CA  1 
ATOM   5482 C  C   . GLY D  1 176 ? 18.64129  16.82753  26.91657  1.000 53.55320  ?  176 GLY D C   1 
ATOM   5483 O  O   . GLY D  1 176 ? 17.69127  16.93702  26.14697  1.000 74.33001  ?  176 GLY D O   1 
HETATM 5484 FE FE  . FE  E  2 .   ? 46.47679  13.11382  -2.93633  0.400 56.85367  ?  201 FE  A FE  1 
HETATM 5485 FE FE  . FE  F  2 .   ? 45.32018  13.99297  -0.55331  0.250 46.61895  ?  202 FE  A FE  1 
HETATM 5486 FE FE  . FE  G  2 .   ? 31.32132  18.04222  25.50274  1.000 71.29801  ?  203 FE  A FE  1 
HETATM 5487 CA CA  . CA  H  3 .   ? 59.01183  20.15724  -0.31508  1.000 104.39528 ?  204 CA  A CA  1 
HETATM 5488 C  C15 . RFT I  4 .   ? 46.07771  32.10453  20.88652  1.000 63.51222  ?  205 RFT A C15 1 
HETATM 5489 C  C16 . RFT I  4 .   ? 44.69448  32.75329  20.96163  1.000 75.16210  ?  205 RFT A C16 1 
HETATM 5490 C  C18 . RFT I  4 .   ? 43.30983  30.56362  20.48269  1.000 74.81619  ?  205 RFT A C18 1 
HETATM 5491 C  C20 . RFT I  4 .   ? 42.34668  30.11858  19.44871  1.000 62.51886  ?  205 RFT A C20 1 
HETATM 5492 C  C21 . RFT I  4 .   ? 42.34826  31.19640  18.36932  1.000 73.34424  ?  205 RFT A C21 1 
HETATM 5493 C  C22 . RFT I  4 .   ? 43.09484  32.42295  18.94969  1.000 79.15583  ?  205 RFT A C22 1 
HETATM 5494 N  N17 . RFT I  4 .   ? 43.74362  31.98512  20.16827  1.000 80.20456  ?  205 RFT A N17 1 
HETATM 5495 O  O19 . RFT I  4 .   ? 43.67458  29.93212  21.42529  1.000 80.29389  ?  205 RFT A O19 1 
HETATM 5496 O  O23 . RFT I  4 .   ? 43.13042  33.51440  18.46233  1.000 81.25243  ?  205 RFT A O23 1 
HETATM 5497 FE FE  . FE  J  2 .   ? 17.43936  43.11162  11.31015  0.400 67.61618  ?  201 FE  B FE  1 
HETATM 5498 FE FE  . FE  K  2 .   ? 18.62395  41.36671  13.61368  0.250 42.07480  ?  202 FE  B FE  1 
HETATM 5499 CA CA  . CA  L  3 .   ? 29.43290  56.31106  -3.67756  1.000 65.04662  ?  203 CA  B CA  1 
HETATM 5500 CA CA  . CA  M  3 .   ? 17.71676  32.89662  16.02477  1.000 98.90429  ?  204 CA  B CA  1 
HETATM 5501 C  C18 . RFT N  4 .   ? 29.62160  33.87099  35.40601  1.000 84.87141  ?  205 RFT B C18 1 
HETATM 5502 C  C20 . RFT N  4 .   ? 28.70495  32.79840  34.93770  1.000 65.18889  ?  205 RFT B C20 1 
HETATM 5503 C  C21 . RFT N  4 .   ? 27.38291  33.00497  35.66622  1.000 75.93640  ?  205 RFT B C21 1 
HETATM 5504 C  C22 . RFT N  4 .   ? 27.59570  34.14258  36.70215  1.000 82.96813  ?  205 RFT B C22 1 
HETATM 5505 N  N17 . RFT N  4 .   ? 28.91674  34.68409  36.48373  1.000 86.06959  ?  205 RFT B N17 1 
HETATM 5506 O  O19 . RFT N  4 .   ? 30.73257  34.07973  35.01344  1.000 86.63463  ?  205 RFT B O19 1 
HETATM 5507 O  O23 . RFT N  4 .   ? 26.81437  34.50083  37.53266  1.000 85.97292  ?  205 RFT B O23 1 
HETATM 5508 FE FE  . FE  O  2 .   ? 34.38000  -14.13687 30.95255  0.400 82.97600  ?  201 FE  C FE  1 
HETATM 5509 FE FE  . FE  P  2 .   ? 35.24609  -11.59596 30.82532  0.250 40.60391  ?  202 FE  C FE  1 
HETATM 5510 CA CA  . CA  Q  3 .   ? 40.65730  -23.45437 17.03205  1.000 53.00830  ?  203 CA  C CA  1 
HETATM 5511 CA CA  . CA  R  3 .   ? 43.83078  -25.72301 17.37159  1.000 83.47394  ?  204 CA  C CA  1 
HETATM 5512 C  C16 . RFT S  4 .   ? 50.92619  11.63320  28.41758  1.000 74.90004  ?  205 RFT C C16 1 
HETATM 5513 C  C18 . RFT S  4 .   ? 48.30895  11.46708  27.99846  1.000 76.20027  ?  205 RFT C C18 1 
HETATM 5514 C  C20 . RFT S  4 .   ? 47.44149  10.78540  27.00768  1.000 64.05921  ?  205 RFT C C20 1 
HETATM 5515 C  C21 . RFT S  4 .   ? 48.34459  9.83030   26.23651  1.000 69.10338  ?  205 RFT C C21 1 
HETATM 5516 C  C22 . RFT S  4 .   ? 49.80535  10.26704  26.53819  1.000 82.07999  ?  205 RFT C C22 1 
HETATM 5517 N  N17 . RFT S  4 .   ? 49.76368  11.15121  27.68112  1.000 81.76820  ?  205 RFT C N17 1 
HETATM 5518 O  O19 . RFT S  4 .   ? 47.94410  12.17288  28.88080  1.000 82.40742  ?  205 RFT C O19 1 
HETATM 5519 O  O23 . RFT S  4 .   ? 50.78690  9.92198   25.94932  1.000 84.78725  ?  205 RFT C O23 1 
HETATM 5520 FE FE  . FE  T  2 .   ? 5.69393   17.00153  44.71988  0.400 71.14014  ?  201 FE  D FE  1 
HETATM 5521 FE FE  . FE  U  2 .   ? 7.95047   16.67581  44.00872  0.250 57.95400  ?  202 FE  D FE  1 
HETATM 5522 CA CA  . CA  V  3 .   ? 0.00000   0.00000   49.27886  0.33  68.14661  ?  203 CA  D CA  1 
HETATM 5523 CA CA  . CA  W  3 .   ? 0.00000   0.00000   53.41278  0.33  115.56583 ?  204 CA  D CA  1 
HETATM 5524 CA CA  . CA  X  3 .   ? 18.81462  35.46375  50.30708  0.500 47.44497  ?  205 CA  D CA  1 
HETATM 5525 C  C16 . RFT Y  4 .   ? 35.35441  13.80755  44.68100  1.000 74.93295  ?  206 RFT D C16 1 
HETATM 5526 C  C18 . RFT Y  4 .   ? 33.93099  13.94078  42.42341  1.000 67.09315  ?  206 RFT D C18 1 
HETATM 5527 C  C20 . RFT Y  4 .   ? 32.76047  13.22478  41.88512  1.000 55.55885  ?  206 RFT D C20 1 
HETATM 5528 C  C21 . RFT Y  4 .   ? 32.39246  12.13292  42.87646  1.000 65.93839  ?  206 RFT D C21 1 
HETATM 5529 C  C22 . RFT Y  4 .   ? 33.31856  12.32743  44.10288  1.000 77.70035  ?  206 RFT D C22 1 
HETATM 5530 N  N17 . RFT Y  4 .   ? 34.26593  13.37615  43.79994  1.000 79.73262  ?  206 RFT D N17 1 
HETATM 5531 O  O19 . RFT Y  4 .   ? 34.51007  14.81315  41.86040  1.000 63.98011  ?  206 RFT D O19 1 
HETATM 5532 O  O23 . RFT Y  4 .   ? 33.26198  11.71887  45.12159  1.000 85.14764  ?  206 RFT D O23 1 
HETATM 5533 O  O   . HOH Z  5 .   ? 59.46497  8.17800   4.67202   1.000 34.42190  ?  301 HOH A O   1 
HETATM 5534 O  O   . HOH Z  5 .   ? 52.37817  11.08461  23.42214  1.000 62.88272  ?  302 HOH A O   1 
HETATM 5535 O  O   . HOH Z  5 .   ? 46.05989  12.75914  23.37135  1.000 53.74609  ?  303 HOH A O   1 
HETATM 5536 O  O   . HOH Z  5 .   ? 54.29542  5.73243   -28.98477 1.000 42.84372  ?  304 HOH A O   1 
HETATM 5537 O  O   . HOH Z  5 .   ? 62.49605  8.92119   11.39929  1.000 40.04158  ?  305 HOH A O   1 
HETATM 5538 O  O   . HOH Z  5 .   ? 56.03221  1.97079   12.18784  1.000 33.51216  ?  306 HOH A O   1 
HETATM 5539 O  O   . HOH Z  5 .   ? 43.16347  -2.93053  18.07144  1.000 38.80115  ?  307 HOH A O   1 
HETATM 5540 O  O   . HOH Z  5 .   ? 39.93512  -0.29985  18.45904  1.000 47.89554  ?  308 HOH A O   1 
HETATM 5541 O  O   . HOH Z  5 .   ? 53.09899  15.39697  -21.83492 1.000 37.83081  ?  309 HOH A O   1 
HETATM 5542 O  O   . HOH Z  5 .   ? 52.89173  7.99747   21.78250  1.000 59.64330  ?  310 HOH A O   1 
HETATM 5543 O  O   . HOH Z  5 .   ? 59.67878  13.64008  14.35524  1.000 51.20285  ?  311 HOH A O   1 
HETATM 5544 O  O   . HOH Z  5 .   ? 59.23487  4.45104   -11.40103 1.000 37.74706  ?  312 HOH A O   1 
HETATM 5545 O  O   . HOH Z  5 .   ? 58.96402  7.39672   15.82295  1.000 32.92672  ?  313 HOH A O   1 
HETATM 5546 O  O   . HOH Z  5 .   ? 47.28603  16.59483  -24.31358 1.000 42.02890  ?  314 HOH A O   1 
HETATM 5547 O  O   . HOH Z  5 .   ? 52.80112  4.33069   26.67098  1.000 54.23491  ?  315 HOH A O   1 
HETATM 5548 O  O   . HOH Z  5 .   ? 57.58309  5.88083   -1.47891  1.000 41.84727  ?  316 HOH A O   1 
HETATM 5549 O  O   . HOH Z  5 .   ? 54.87192  15.04162  7.45851   1.000 31.92305  ?  317 HOH A O   1 
HETATM 5550 O  O   . HOH Z  5 .   ? 38.70131  13.95205  3.26481   1.000 55.50667  ?  318 HOH A O   1 
HETATM 5551 O  O   . HOH Z  5 .   ? 53.45950  22.43036  7.02961   1.000 31.13169  ?  319 HOH A O   1 
HETATM 5552 O  O   . HOH Z  5 .   ? 38.52492  21.47393  12.45789  1.000 38.90923  ?  320 HOH A O   1 
HETATM 5553 O  O   . HOH Z  5 .   ? 59.74592  12.81276  11.08025  1.000 42.54093  ?  321 HOH A O   1 
HETATM 5554 O  O   . HOH Z  5 .   ? 40.793    -1.926    12.479    1.000 43.14838  ?  322 HOH A O   1 
HETATM 5555 O  O   . HOH Z  5 .   ? 41.76814  10.61527  -17.74079 1.000 49.86052  ?  323 HOH A O   1 
HETATM 5556 O  O   . HOH Z  5 .   ? 37.32214  22.19772  7.14513   1.000 56.41708  ?  324 HOH A O   1 
HETATM 5557 O  O   . HOH Z  5 .   ? 51.17972  0.24929   -17.69988 1.000 29.59651  ?  325 HOH A O   1 
HETATM 5558 O  O   . HOH Z  5 .   ? 40.83623  -1.63234  16.01172  1.000 46.12189  ?  326 HOH A O   1 
HETATM 5559 O  O   . HOH Z  5 .   ? 46.35852  22.63100  -5.49173  1.000 36.55866  ?  327 HOH A O   1 
HETATM 5560 O  O   . HOH Z  5 .   ? 43.84290  7.58862   -25.11564 1.000 36.99021  ?  328 HOH A O   1 
HETATM 5561 O  O   . HOH Z  5 .   ? 36.82358  21.51114  14.46033  1.000 43.31866  ?  329 HOH A O   1 
HETATM 5562 O  O   . HOH Z  5 .   ? 59.08278  6.23613   -14.88339 1.000 31.35563  ?  330 HOH A O   1 
HETATM 5563 O  O   . HOH Z  5 .   ? 38.46252  21.97744  3.40501   1.000 40.43063  ?  331 HOH A O   1 
HETATM 5564 O  O   . HOH Z  5 .   ? 40.42840  18.70686  -7.55528  1.000 46.48960  ?  332 HOH A O   1 
HETATM 5565 O  O   . HOH Z  5 .   ? 58.72138  12.21937  -25.12215 1.000 39.73476  ?  333 HOH A O   1 
HETATM 5566 O  O   . HOH Z  5 .   ? 55.86425  3.75128   -22.36243 1.000 45.86711  ?  334 HOH A O   1 
HETATM 5567 O  O   . HOH Z  5 .   ? 53.02671  16.71688  -24.32531 1.000 37.55646  ?  335 HOH A O   1 
HETATM 5568 O  O   . HOH Z  5 .   ? 36.66374  15.45814  4.57064   1.000 65.58495  ?  336 HOH A O   1 
HETATM 5569 O  O   . HOH Z  5 .   ? 36.69246  25.68049  6.32517   1.000 58.89939  ?  337 HOH A O   1 
HETATM 5570 O  O   . HOH Z  5 .   ? 54.92870  4.19057   -9.41063  1.000 39.25257  ?  338 HOH A O   1 
HETATM 5571 O  O   . HOH Z  5 .   ? 32.57706  7.85662   14.47472  1.000 53.33166  ?  339 HOH A O   1 
HETATM 5572 O  O   . HOH Z  5 .   ? 46.312    12.156    -26.392   1.000 40.16296  ?  340 HOH A O   1 
HETATM 5573 O  O   . HOH Z  5 .   ? 57.81978  9.05481   -3.20871  1.000 47.05481  ?  341 HOH A O   1 
HETATM 5574 O  O   . HOH Z  5 .   ? 62.068    1.131     -5.622    1.000 38.03092  ?  342 HOH A O   1 
HETATM 5575 O  O   . HOH Z  5 .   ? 42.30882  16.53169  4.97823   1.000 53.33516  ?  343 HOH A O   1 
HETATM 5576 O  O   . HOH Z  5 .   ? 38.53311  8.25761   22.81140  1.000 38.90243  ?  344 HOH A O   1 
HETATM 5577 O  O   . HOH Z  5 .   ? 55.98106  16.53150  -10.23628 1.000 34.47037  ?  345 HOH A O   1 
HETATM 5578 O  O   . HOH Z  5 .   ? 55.24847  3.30879   -7.19417  1.000 38.03903  ?  346 HOH A O   1 
HETATM 5579 O  O   . HOH Z  5 .   ? 37.14738  4.61263   3.70139   1.000 49.83793  ?  347 HOH A O   1 
HETATM 5580 O  O   . HOH Z  5 .   ? 30.89349  11.35414  18.26227  1.000 54.00962  ?  348 HOH A O   1 
HETATM 5581 O  O   . HOH Z  5 .   ? 42.93157  1.94263   13.20446  1.000 34.57756  ?  349 HOH A O   1 
HETATM 5582 O  O   . HOH Z  5 .   ? 35.15239  6.26104   -2.55494  1.000 62.63608  ?  350 HOH A O   1 
HETATM 5583 O  O   . HOH Z  5 .   ? 41.26965  3.67239   19.24637  1.000 46.91105  ?  351 HOH A O   1 
HETATM 5584 O  O   . HOH Z  5 .   ? 44.879    25.879    -14.823   1.000 54.01959  ?  352 HOH A O   1 
HETATM 5585 O  O   . HOH Z  5 .   ? 56.36672  14.66742  3.08643   1.000 36.88877  ?  353 HOH A O   1 
HETATM 5586 O  O   . HOH Z  5 .   ? 58.55786  21.11532  1.91647   1.000 49.54591  ?  354 HOH A O   1 
HETATM 5587 O  O   . HOH Z  5 .   ? 37.20553  16.25729  8.98725   1.000 42.35310  ?  355 HOH A O   1 
HETATM 5588 O  O   . HOH Z  5 .   ? 64.635    5.604     1.084     1.000 34.85298  ?  356 HOH A O   1 
HETATM 5589 O  O   . HOH Z  5 .   ? 39.02659  3.22446   14.31882  1.000 48.98942  ?  357 HOH A O   1 
HETATM 5590 O  O   . HOH Z  5 .   ? 58.63619  5.95905   -17.07818 1.000 33.73631  ?  358 HOH A O   1 
HETATM 5591 O  O   . HOH Z  5 .   ? 32.20339  8.76322   18.76699  1.000 41.32835  ?  359 HOH A O   1 
HETATM 5592 O  O   . HOH Z  5 .   ? 60.13258  8.21869   -12.70811 1.000 63.86444  ?  360 HOH A O   1 
HETATM 5593 O  O   . HOH Z  5 .   ? 55.04905  22.73516  5.18651   1.000 53.05615  ?  361 HOH A O   1 
HETATM 5594 O  O   . HOH Z  5 .   ? 45.71637  27.64196  23.69477  1.000 60.49781  ?  362 HOH A O   1 
HETATM 5595 O  O   . HOH Z  5 .   ? 53.35186  10.76815  -27.78373 1.000 26.76108  ?  363 HOH A O   1 
HETATM 5596 O  O   . HOH Z  5 .   ? 56.39815  3.36702   19.62378  1.000 39.51857  ?  364 HOH A O   1 
HETATM 5597 O  O   . HOH Z  5 .   ? 35.31008  23.88711  15.58459  1.000 48.09588  ?  365 HOH A O   1 
HETATM 5598 O  O   . HOH Z  5 .   ? 45.694    0.876     3.370     1.000 46.10972  ?  366 HOH A O   1 
HETATM 5599 O  O   . HOH Z  5 .   ? 39.30878  4.65135   -20.33942 1.000 27.69108  ?  367 HOH A O   1 
HETATM 5600 O  O   . HOH Z  5 .   ? 40.50079  15.60160  3.02063   1.000 51.57773  ?  368 HOH A O   1 
HETATM 5601 O  O   . HOH Z  5 .   ? 41.82153  20.89933  30.94864  1.000 60.93223  ?  369 HOH A O   1 
HETATM 5602 O  O   . HOH Z  5 .   ? 55.66836  15.11358  5.26642   1.000 41.82633  ?  370 HOH A O   1 
HETATM 5603 O  O   . HOH Z  5 .   ? 38.88670  17.32565  2.42295   1.000 46.08697  ?  371 HOH A O   1 
HETATM 5604 O  O   . HOH Z  5 .   ? 55.27437  17.42182  11.41399  1.000 49.47617  ?  372 HOH A O   1 
HETATM 5605 O  O   . HOH Z  5 .   ? 40.653    -2.756    18.874    1.000 49.28374  ?  373 HOH A O   1 
HETATM 5606 O  O   . HOH Z  5 .   ? 52.99154  27.32811  -21.12095 1.000 69.34083  ?  374 HOH A O   1 
HETATM 5607 O  O   . HOH Z  5 .   ? 36.16125  10.84497  10.18854  1.000 49.29714  ?  375 HOH A O   1 
HETATM 5608 O  O   . HOH Z  5 .   ? 56.45950  13.83653  12.83535  1.000 27.86638  ?  376 HOH A O   1 
HETATM 5609 O  O   . HOH Z  5 .   ? 39.40582  12.88112  -1.74660  1.000 59.43891  ?  377 HOH A O   1 
HETATM 5610 O  O   . HOH Z  5 .   ? 60.05054  22.19403  -22.22089 1.000 52.42172  ?  378 HOH A O   1 
HETATM 5611 O  O   . HOH Z  5 .   ? 35.35168  5.27839   -6.53630  1.000 63.89417  ?  379 HOH A O   1 
HETATM 5612 O  O   . HOH Z  5 .   ? 63.16251  6.61428   10.21766  1.000 54.51565  ?  380 HOH A O   1 
HETATM 5613 O  O   . HOH Z  5 .   ? 59.05109  6.24018   -9.61851  1.000 34.82096  ?  381 HOH A O   1 
HETATM 5614 O  O   . HOH Z  5 .   ? 40.19540  5.20638   -11.09777 1.000 49.23504  ?  382 HOH A O   1 
HETATM 5615 O  O   . HOH Z  5 .   ? 59.65279  6.43214   -7.41028  1.000 42.04524  ?  383 HOH A O   1 
HETATM 5616 O  O   . HOH Z  5 .   ? 60.810    24.750    -4.967    1.000 60.84443  ?  384 HOH A O   1 
HETATM 5617 O  O   . HOH Z  5 .   ? 49.87996  -1.56197  -31.69182 1.000 56.96826  ?  385 HOH A O   1 
HETATM 5618 O  O   . HOH Z  5 .   ? 27.65691  15.94934  22.39894  1.000 29.85885  ?  386 HOH A O   1 
HETATM 5619 O  O   . HOH Z  5 .   ? 47.16470  29.65163  18.53246  1.000 63.45526  ?  387 HOH A O   1 
HETATM 5620 O  O   . HOH Z  5 .   ? 58.90080  8.52875   -0.48174  1.000 46.91190  ?  388 HOH A O   1 
HETATM 5621 O  O   . HOH Z  5 .   ? 62.41242  6.73674   16.38888  1.000 51.43169  ?  389 HOH A O   1 
HETATM 5622 O  O   . HOH Z  5 .   ? 32.79621  5.62721   -4.07567  1.000 55.40775  ?  390 HOH A O   1 
HETATM 5623 O  O   . HOH Z  5 .   ? 30.82144  12.06549  9.43480   1.000 60.33805  ?  391 HOH A O   1 
HETATM 5624 O  O   . HOH Z  5 .   ? 33.27544  3.83517   10.83310  1.000 65.77342  ?  392 HOH A O   1 
HETATM 5625 O  O   . HOH AA 5 .   ? 35.10702  41.84828  23.22889  1.000 43.34527  ?  301 HOH B O   1 
HETATM 5626 O  O   . HOH AA 5 .   ? 23.41951  53.89715  19.32226  1.000 59.67976  ?  302 HOH B O   1 
HETATM 5627 O  O   . HOH AA 5 .   ? 28.34910  44.40689  22.82851  1.000 46.17907  ?  303 HOH B O   1 
HETATM 5628 O  O   . HOH AA 5 .   ? 9.79179   55.22143  19.10449  1.000 45.10604  ?  304 HOH B O   1 
HETATM 5629 O  O   . HOH AA 5 .   ? 18.47555  53.05519  1.35635   1.000 43.41101  ?  305 HOH B O   1 
HETATM 5630 O  O   . HOH AA 5 .   ? 19.63950  39.29113  12.62937  1.000 53.30049  ?  306 HOH B O   1 
HETATM 5631 O  O   . HOH AA 5 .   ? -1.02444  62.48611  7.84919   1.000 45.77127  ?  307 HOH B O   1 
HETATM 5632 O  O   . HOH AA 5 .   ? 37.277    43.180    5.793     1.000 35.86986  ?  308 HOH B O   1 
HETATM 5633 O  O   . HOH AA 5 .   ? 0.94058   54.98633  1.17435   1.000 31.68099  ?  309 HOH B O   1 
HETATM 5634 O  O   . HOH AA 5 .   ? -0.52221  51.12932  -1.30105  1.000 39.20615  ?  310 HOH B O   1 
HETATM 5635 O  O   . HOH AA 5 .   ? 30.83688  29.27635  1.69858   1.000 38.43482  ?  311 HOH B O   1 
HETATM 5636 O  O   . HOH AA 5 .   ? 17.86747  34.19900  13.34325  1.000 64.82861  ?  312 HOH B O   1 
HETATM 5637 O  O   . HOH AA 5 .   ? 35.08311  43.44829  7.53697   1.000 36.32743  ?  313 HOH B O   1 
HETATM 5638 O  O   . HOH AA 5 .   ? 4.22170   58.87006  6.88235   1.000 33.55884  ?  314 HOH B O   1 
HETATM 5639 O  O   . HOH AA 5 .   ? 10.07791  64.91232  11.06628  1.000 48.96315  ?  315 HOH B O   1 
HETATM 5640 O  O   . HOH AA 5 .   ? 20.709    56.742    -4.530    1.000 45.06545  ?  316 HOH B O   1 
HETATM 5641 O  O   . HOH AA 5 .   ? 5.43699   51.85189  -5.70033  1.000 39.79111  ?  317 HOH B O   1 
HETATM 5642 O  O   . HOH AA 5 .   ? 18.65811  36.20759  14.53785  1.000 60.72054  ?  318 HOH B O   1 
HETATM 5643 O  O   . HOH AA 5 .   ? 30.53421  27.10256  8.46821   1.000 41.52030  ?  319 HOH B O   1 
HETATM 5644 O  O   . HOH AA 5 .   ? 42.39506  35.99850  17.68584  1.000 50.15903  ?  320 HOH B O   1 
HETATM 5645 O  O   . HOH AA 5 .   ? 40.08066  44.67535  12.20780  1.000 37.78976  ?  321 HOH B O   1 
HETATM 5646 O  O   . HOH AA 5 .   ? 28.92240  46.71224  16.87850  1.000 38.23413  ?  322 HOH B O   1 
HETATM 5647 O  O   . HOH AA 5 .   ? 41.93906  35.84196  19.84920  1.000 52.64705  ?  323 HOH B O   1 
HETATM 5648 O  O   . HOH AA 5 .   ? 37.702    50.577    12.367    1.000 39.66428  ?  324 HOH B O   1 
HETATM 5649 O  O   . HOH AA 5 .   ? 37.25060  28.30695  3.28520   1.000 25.26600  ?  325 HOH B O   1 
HETATM 5650 O  O   . HOH AA 5 .   ? 33.85297  23.50789  17.37605  1.000 37.95934  ?  326 HOH B O   1 
HETATM 5651 O  O   . HOH AA 5 .   ? 1.67264   60.21068  7.46426   1.000 38.00350  ?  327 HOH B O   1 
HETATM 5652 O  O   . HOH AA 5 .   ? 12.63202  38.87248  0.08842   1.000 50.04389  ?  328 HOH B O   1 
HETATM 5653 O  O   . HOH AA 5 .   ? 26.36525  51.49346  5.04250   1.000 43.03166  ?  329 HOH B O   1 
HETATM 5654 O  O   . HOH AA 5 .   ? 23.12408  31.07264  24.52152  1.000 36.49374  ?  330 HOH B O   1 
HETATM 5655 O  O   . HOH AA 5 .   ? 23.79485  27.83600  27.48778  1.000 36.61054  ?  331 HOH B O   1 
HETATM 5656 O  O   . HOH AA 5 .   ? 34.19672  43.90951  -0.48270  1.000 39.20619  ?  332 HOH B O   1 
HETATM 5657 O  O   . HOH AA 5 .   ? 12.247    46.918    19.880    1.000 42.74407  ?  333 HOH B O   1 
HETATM 5658 O  O   . HOH AA 5 .   ? 35.00234  44.32736  17.96750  1.000 47.18781  ?  334 HOH B O   1 
HETATM 5659 O  O   . HOH AA 5 .   ? 35.55287  38.47250  6.40130   1.000 30.45687  ?  335 HOH B O   1 
HETATM 5660 O  O   . HOH AA 5 .   ? 1.95276   44.20434  -2.07083  1.000 31.66905  ?  336 HOH B O   1 
HETATM 5661 O  O   . HOH AA 5 .   ? 2.02219   56.29282  -9.66194  1.000 47.08187  ?  337 HOH B O   1 
HETATM 5662 O  O   . HOH AA 5 .   ? 39.91995  38.54667  8.43580   1.000 37.83433  ?  338 HOH B O   1 
HETATM 5663 O  O   . HOH AA 5 .   ? -1.29662  53.50656  0.26616   1.000 30.48806  ?  339 HOH B O   1 
HETATM 5664 O  O   . HOH AA 5 .   ? 32.63399  23.22875  13.93712  1.000 53.34044  ?  340 HOH B O   1 
HETATM 5665 O  O   . HOH AA 5 .   ? 2.54838   41.39202  -2.21308  1.000 45.02977  ?  341 HOH B O   1 
HETATM 5666 O  O   . HOH AA 5 .   ? 34.75365  24.03190  13.31286  1.000 35.83993  ?  342 HOH B O   1 
HETATM 5667 O  O   . HOH AA 5 .   ? 15.94416  35.27897  22.10700  1.000 48.10508  ?  343 HOH B O   1 
HETATM 5668 O  O   . HOH AA 5 .   ? 11.98601  39.91770  2.33037   1.000 41.87727  ?  344 HOH B O   1 
HETATM 5669 O  O   . HOH AA 5 .   ? 17.62766  31.79890  21.17199  1.000 54.93277  ?  345 HOH B O   1 
HETATM 5670 O  O   . HOH AA 5 .   ? 13.684    55.459    -6.943    1.000 40.71887  ?  346 HOH B O   1 
HETATM 5671 O  O   . HOH AA 5 .   ? -2.60466  61.40688  1.60083   1.000 42.72209  ?  347 HOH B O   1 
HETATM 5672 O  O   . HOH AA 5 .   ? -1.63976  54.19922  2.52703   1.000 36.16795  ?  348 HOH B O   1 
HETATM 5673 O  O   . HOH AA 5 .   ? 40.38367  33.75423  16.77041  1.000 49.51010  ?  349 HOH B O   1 
HETATM 5674 O  O   . HOH AA 5 .   ? 11.97122  67.39984  8.65669   1.000 55.98437  ?  350 HOH B O   1 
HETATM 5675 O  O   . HOH AA 5 .   ? 8.78905   64.09437  13.33400  1.000 58.13168  ?  351 HOH B O   1 
HETATM 5676 O  O   . HOH AA 5 .   ? 11.46338  61.63525  0.60473   1.000 41.57825  ?  352 HOH B O   1 
HETATM 5677 O  O   . HOH AA 5 .   ? 38.28334  39.05136  22.66879  1.000 44.77104  ?  353 HOH B O   1 
HETATM 5678 O  O   . HOH AA 5 .   ? 5.10618   65.05802  3.11740   1.000 34.50442  ?  354 HOH B O   1 
HETATM 5679 O  O   . HOH AA 5 .   ? -4.15802  56.71348  -10.66563 1.000 45.29425  ?  355 HOH B O   1 
HETATM 5680 O  O   . HOH AA 5 .   ? 0.80595   61.08133  1.19607   1.000 21.26265  ?  356 HOH B O   1 
HETATM 5681 O  O   . HOH AA 5 .   ? 13.82869  59.85496  0.73170   1.000 37.08890  ?  357 HOH B O   1 
HETATM 5682 O  O   . HOH AA 5 .   ? 21.43036  54.07993  17.43678  1.000 55.39774  ?  358 HOH B O   1 
HETATM 5683 O  O   . HOH AA 5 .   ? 28.74593  20.43982  14.80991  1.000 43.23676  ?  359 HOH B O   1 
HETATM 5684 O  O   . HOH AA 5 .   ? 1.91348   61.83166  -4.58795  1.000 53.46607  ?  360 HOH B O   1 
HETATM 5685 O  O   . HOH AA 5 .   ? 43.27733  40.04429  9.04015   1.000 60.10298  ?  361 HOH B O   1 
HETATM 5686 O  O   . HOH AA 5 .   ? 19.72375  31.37439  5.34541   1.000 50.52482  ?  362 HOH B O   1 
HETATM 5687 O  O   . HOH AA 5 .   ? 2.77661   42.69922  2.57324   1.000 47.21319  ?  363 HOH B O   1 
HETATM 5688 O  O   . HOH AA 5 .   ? 38.052    36.887    7.079     1.000 41.27518  ?  364 HOH B O   1 
HETATM 5689 O  O   . HOH AA 5 .   ? 36.81952  25.89174  3.98316   1.000 38.00368  ?  365 HOH B O   1 
HETATM 5690 O  O   . HOH AA 5 .   ? 15.52046  55.46633  10.70910  1.000 59.63821  ?  366 HOH B O   1 
HETATM 5691 O  O   . HOH AA 5 .   ? 22.42943  30.34620  6.50919   1.000 68.16397  ?  367 HOH B O   1 
HETATM 5692 O  O   . HOH AA 5 .   ? 17.18833  35.43404  16.94627  1.000 66.46489  ?  368 HOH B O   1 
HETATM 5693 O  O   . HOH AA 5 .   ? 21.10359  50.85915  24.72974  1.000 43.69962  ?  369 HOH B O   1 
HETATM 5694 O  O   . HOH AA 5 .   ? -0.39863  56.37693  14.26181  1.000 37.90935  ?  370 HOH B O   1 
HETATM 5695 O  O   . HOH AA 5 .   ? 6.41661   68.04761  3.81550   1.000 59.53167  ?  371 HOH B O   1 
HETATM 5696 O  O   . HOH AA 5 .   ? 23.89926  29.47535  3.67875   1.000 53.62179  ?  372 HOH B O   1 
HETATM 5697 O  O   . HOH AA 5 .   ? 7.44736   38.94139  10.48190  1.000 59.36100  ?  373 HOH B O   1 
HETATM 5698 O  O   . HOH AA 5 .   ? 13.858    36.167    -1.017    1.000 56.16507  ?  374 HOH B O   1 
HETATM 5699 O  O   . HOH AA 5 .   ? 15.56776  30.00074  8.33970   1.000 61.53374  ?  375 HOH B O   1 
HETATM 5700 O  O   . HOH AA 5 .   ? 19.76505  31.20674  14.86457  1.000 58.68440  ?  376 HOH B O   1 
HETATM 5701 O  O   . HOH AA 5 .   ? -5.488    60.309    4.263     1.000 40.51620  ?  377 HOH B O   1 
HETATM 5702 O  O   . HOH AA 5 .   ? 25.67596  42.24876  1.06039   1.000 55.65101  ?  378 HOH B O   1 
HETATM 5703 O  O   . HOH AA 5 .   ? 26.21546  52.49036  8.71327   1.000 40.18589  ?  379 HOH B O   1 
HETATM 5704 O  O   . HOH AA 5 .   ? 41.89058  46.71702  3.74225   1.000 61.40173  ?  380 HOH B O   1 
HETATM 5705 O  O   . HOH AA 5 .   ? 9.68394   67.24401  2.19100   1.000 64.29152  ?  381 HOH B O   1 
HETATM 5706 O  O   . HOH AA 5 .   ? 11.41150  60.43135  -6.29028  1.000 50.69824  ?  382 HOH B O   1 
HETATM 5707 O  O   . HOH AA 5 .   ? 23.64135  61.69913  0.61106   1.000 55.36144  ?  383 HOH B O   1 
HETATM 5708 O  O   . HOH AA 5 .   ? 26.85235  27.77617  5.05010   1.000 53.50688  ?  384 HOH B O   1 
HETATM 5709 O  O   . HOH BA 5 .   ? 21.30399  -16.32611 30.83742  1.000 55.29976  ?  301 HOH C O   1 
HETATM 5710 O  O   . HOH BA 5 .   ? 34.15883  -16.09734 19.80127  1.000 40.34976  ?  302 HOH C O   1 
HETATM 5711 O  O   . HOH BA 5 .   ? 47.12739  -13.27282 37.81028  1.000 80.66711  ?  303 HOH C O   1 
HETATM 5712 O  O   . HOH BA 5 .   ? 45.44891  -38.65798 32.79982  1.000 68.88162  ?  304 HOH C O   1 
HETATM 5713 O  O   . HOH BA 5 .   ? 28.48768  -34.72058 24.25640  1.000 41.27351  ?  305 HOH C O   1 
HETATM 5714 O  O   . HOH BA 5 .   ? 30.19683  -42.66375 28.22599  1.000 59.94567  ?  306 HOH C O   1 
HETATM 5715 O  O   . HOH BA 5 .   ? 25.06662  5.83076   22.13913  1.000 63.09111  ?  307 HOH C O   1 
HETATM 5716 O  O   . HOH BA 5 .   ? 23.50265  0.11104   38.21043  1.000 50.98846  ?  308 HOH C O   1 
HETATM 5717 O  O   . HOH BA 5 .   ? 37.90968  -34.13763 22.55525  1.000 42.80698  ?  309 HOH C O   1 
HETATM 5718 O  O   . HOH BA 5 .   ? 33.90065  -10.07111 29.55148  1.000 62.92968  ?  310 HOH C O   1 
HETATM 5719 O  O   . HOH BA 5 .   ? 30.90023  5.42523   22.43099  1.000 55.53886  ?  311 HOH C O   1 
HETATM 5720 O  O   . HOH BA 5 .   ? 30.95915  -36.37178 24.56147  1.000 37.06829  ?  312 HOH C O   1 
HETATM 5721 O  O   . HOH BA 5 .   ? 33.35573  -35.89496 24.14076  1.000 46.84508  ?  313 HOH C O   1 
HETATM 5722 O  O   . HOH BA 5 .   ? 29.130    -22.772   52.153    1.000 61.65372  ?  314 HOH C O   1 
HETATM 5723 O  O   . HOH BA 5 .   ? 44.60025  -23.01797 18.67398  1.000 51.64969  ?  315 HOH C O   1 
HETATM 5724 O  O   . HOH BA 5 .   ? 27.36066  11.89676  33.08935  1.000 49.87471  ?  316 HOH C O   1 
HETATM 5725 O  O   . HOH BA 5 .   ? 37.75431  4.05946   25.06270  1.000 35.35367  ?  317 HOH C O   1 
HETATM 5726 O  O   . HOH BA 5 .   ? 32.43156  -35.94264 26.52902  1.000 39.71493  ?  318 HOH C O   1 
HETATM 5727 O  O   . HOH BA 5 .   ? 22.53030  -6.43594  30.02197  1.000 48.03765  ?  319 HOH C O   1 
HETATM 5728 O  O   . HOH BA 5 .   ? 31.48827  -3.60989  25.97030  1.000 57.60234  ?  320 HOH C O   1 
HETATM 5729 O  O   . HOH BA 5 .   ? 38.05034  -4.02537  22.31136  1.000 32.16340  ?  321 HOH C O   1 
HETATM 5730 O  O   . HOH BA 5 .   ? 37.35857  -19.78488 41.30161  1.000 54.42577  ?  322 HOH C O   1 
HETATM 5731 O  O   . HOH BA 5 .   ? 24.29652  8.93268   24.08717  1.000 64.87871  ?  323 HOH C O   1 
HETATM 5732 O  O   . HOH BA 5 .   ? 44.99758  -39.23944 35.01466  1.000 49.75785  ?  324 HOH C O   1 
HETATM 5733 O  O   . HOH BA 5 .   ? 40.97287  -35.68680 27.35975  1.000 45.05498  ?  325 HOH C O   1 
HETATM 5734 O  O   . HOH BA 5 .   ? 43.14699  -15.18104 25.29939  1.000 50.82825  ?  326 HOH C O   1 
HETATM 5735 O  O   . HOH BA 5 .   ? 32.65322  0.74123   25.75016  1.000 38.80000  ?  327 HOH C O   1 
HETATM 5736 O  O   . HOH BA 5 .   ? 46.94006  14.71723  30.51829  1.000 59.83914  ?  328 HOH C O   1 
HETATM 5737 O  O   . HOH BA 5 .   ? 47.75979  -20.95163 39.05019  1.000 63.64761  ?  329 HOH C O   1 
HETATM 5738 O  O   . HOH BA 5 .   ? 30.70963  -22.69312 41.25551  1.000 45.37949  ?  330 HOH C O   1 
HETATM 5739 O  O   . HOH BA 5 .   ? 34.81071  -30.35355 40.79562  1.000 49.08201  ?  331 HOH C O   1 
HETATM 5740 O  O   . HOH BA 5 .   ? 31.05849  -6.73884  26.03406  1.000 59.39835  ?  332 HOH C O   1 
HETATM 5741 O  O   . HOH BA 5 .   ? 46.72767  -4.88494  34.67157  1.000 46.58900  ?  333 HOH C O   1 
HETATM 5742 O  O   . HOH BA 5 .   ? 36.88621  -41.89086 26.34896  1.000 35.89283  ?  334 HOH C O   1 
HETATM 5743 O  O   . HOH BA 5 .   ? 23.767    -29.546   23.548    1.000 38.54237  ?  335 HOH C O   1 
HETATM 5744 O  O   . HOH BA 5 .   ? 40.11960  -1.00798  44.21679  1.000 55.76612  ?  336 HOH C O   1 
HETATM 5745 O  O   . HOH BA 5 .   ? 24.477    -40.851   31.950    1.000 53.24452  ?  337 HOH C O   1 
HETATM 5746 O  O   . HOH BA 5 .   ? 39.71489  -40.74895 24.47460  1.000 46.26793  ?  338 HOH C O   1 
HETATM 5747 O  O   . HOH BA 5 .   ? 23.15331  7.18488   26.81509  1.000 57.99808  ?  339 HOH C O   1 
HETATM 5748 O  O   . HOH BA 5 .   ? 49.16472  -33.63518 31.59258  1.000 56.95711  ?  340 HOH C O   1 
HETATM 5749 O  O   . HOH BA 5 .   ? 35.96689  -39.57519 29.71451  1.000 32.02932  ?  341 HOH C O   1 
HETATM 5750 O  O   . HOH BA 5 .   ? 27.03777  -25.71303 21.91193  1.000 43.39175  ?  342 HOH C O   1 
HETATM 5751 O  O   . HOH BA 5 .   ? 41.14608  3.88409   44.88228  1.000 49.19965  ?  343 HOH C O   1 
HETATM 5752 O  O   . HOH BA 5 .   ? 37.724    -16.444   19.380    1.000 65.03346  ?  344 HOH C O   1 
HETATM 5753 O  O   . HOH BA 5 .   ? 35.18047  -32.02442 39.32560  1.000 45.94552  ?  345 HOH C O   1 
HETATM 5754 O  O   . HOH BA 5 .   ? 23.95560  9.74058   27.89955  1.000 34.34906  ?  346 HOH C O   1 
HETATM 5755 O  O   . HOH BA 5 .   ? 38.57821  -9.19305  17.08381  1.000 54.06451  ?  347 HOH C O   1 
HETATM 5756 O  O   . HOH BA 5 .   ? 39.97696  -39.14979 33.43180  1.000 43.53088  ?  348 HOH C O   1 
HETATM 5757 O  O   . HOH BA 5 .   ? 28.64719  2.74787   24.47401  1.000 51.22336  ?  349 HOH C O   1 
HETATM 5758 O  O   . HOH BA 5 .   ? 24.75301  8.24560   21.69474  1.000 64.40173  ?  350 HOH C O   1 
HETATM 5759 O  O   . HOH BA 5 .   ? 40.79170  -9.49026  40.48892  1.000 55.56181  ?  351 HOH C O   1 
HETATM 5760 O  O   . HOH BA 5 .   ? 28.64399  6.45207   22.11292  1.000 62.78457  ?  352 HOH C O   1 
HETATM 5761 O  O   . HOH BA 5 .   ? 46.10219  -11.69939 41.78127  1.000 59.83751  ?  353 HOH C O   1 
HETATM 5762 O  O   . HOH BA 5 .   ? 24.515    -30.463   36.670    1.000 61.60345  ?  354 HOH C O   1 
HETATM 5763 O  O   . HOH BA 5 .   ? 52.85648  12.84103  25.31056  1.000 53.39208  ?  355 HOH C O   1 
HETATM 5764 O  O   . HOH BA 5 .   ? 49.58528  9.12708   30.72949  1.000 66.61237  ?  356 HOH C O   1 
HETATM 5765 O  O   . HOH BA 5 .   ? 22.59398  -16.00938 37.23711  1.000 58.42331  ?  357 HOH C O   1 
HETATM 5766 O  O   . HOH BA 5 .   ? 35.22458  -34.26644 21.96137  1.000 36.71211  ?  358 HOH C O   1 
HETATM 5767 O  O   . HOH BA 5 .   ? 30.45149  1.50326   25.80747  1.000 49.35013  ?  359 HOH C O   1 
HETATM 5768 O  O   . HOH BA 5 .   ? 37.77474  7.78602   46.88083  0.50  46.97352  ?  360 HOH C O   1 
HETATM 5769 O  O   . HOH BA 5 .   ? 38.29441  13.24887  43.64478  1.000 72.57496  ?  361 HOH C O   1 
HETATM 5770 O  O   . HOH BA 5 .   ? 26.83557  -0.64893  27.98849  1.000 46.32713  ?  362 HOH C O   1 
HETATM 5771 O  O   . HOH BA 5 .   ? 26.120    -13.842   40.520    1.000 55.73239  ?  363 HOH C O   1 
HETATM 5772 O  O   . HOH BA 5 .   ? 37.853    -41.585   22.817    1.000 46.47154  ?  364 HOH C O   1 
HETATM 5773 O  O   . HOH BA 5 .   ? 40.85161  -12.77795 43.66558  1.000 69.78525  ?  365 HOH C O   1 
HETATM 5774 O  O   . HOH BA 5 .   ? 29.22561  -2.04312  26.22685  1.000 56.70849  ?  366 HOH C O   1 
HETATM 5775 O  O   . HOH BA 5 .   ? 41.12642  1.98073   46.88083  0.50  48.99569  ?  367 HOH C O   1 
HETATM 5776 O  O   . HOH BA 5 .   ? 49.92472  -24.05876 32.76909  1.000 72.63478  ?  368 HOH C O   1 
HETATM 5777 O  O   . HOH BA 5 .   ? 28.86869  -8.75877  22.44578  1.000 52.27873  ?  369 HOH C O   1 
HETATM 5778 O  O   . HOH CA 5 .   ? 22.96032  13.58341  36.79456  1.000 48.88304  ?  301 HOH D O   1 
HETATM 5779 O  O   . HOH CA 5 .   ? 16.37553  36.99757  38.99071  1.000 50.21342  ?  302 HOH D O   1 
HETATM 5780 O  O   . HOH CA 5 .   ? 24.17786  25.04708  28.06555  1.000 35.95323  ?  303 HOH D O   1 
HETATM 5781 O  O   . HOH CA 5 .   ? 8.62327   31.24086  28.29511  1.000 46.36956  ?  304 HOH D O   1 
HETATM 5782 O  O   . HOH CA 5 .   ? 13.13995  35.64570  27.90305  1.000 49.01213  ?  305 HOH D O   1 
HETATM 5783 O  O   . HOH CA 5 .   ? 11.50794  29.54677  31.87083  1.000 44.23627  ?  306 HOH D O   1 
HETATM 5784 O  O   . HOH CA 5 .   ? 4.73331   6.80704   44.87259  1.000 49.12108  ?  307 HOH D O   1 
HETATM 5785 O  O   . HOH CA 5 .   ? 18.12106  9.24323   39.54370  1.000 56.34029  ?  308 HOH D O   1 
HETATM 5786 O  O   . HOH CA 5 .   ? 12.54695  14.52122  35.94196  1.000 56.93445  ?  309 HOH D O   1 
HETATM 5787 O  O   . HOH CA 5 .   ? -13.45458 10.03144  41.30039  1.000 41.14893  ?  310 HOH D O   1 
HETATM 5788 O  O   . HOH CA 5 .   ? -5.132    37.035    51.447    1.000 68.33377  ?  311 HOH D O   1 
HETATM 5789 O  O   . HOH CA 5 .   ? 8.75345   16.41774  41.92491  1.000 63.09520  ?  312 HOH D O   1 
HETATM 5790 O  O   . HOH CA 5 .   ? 5.79068   20.72296  31.45608  1.000 47.55585  ?  313 HOH D O   1 
HETATM 5791 O  O   . HOH CA 5 .   ? 10.85645  36.20850  42.94565  1.000 68.03033  ?  314 HOH D O   1 
HETATM 5792 O  O   . HOH CA 5 .   ? 26.23467  11.80760  35.10328  1.000 48.96654  ?  315 HOH D O   1 
HETATM 5793 O  O   . HOH CA 5 .   ? 15.76292  9.20156   40.24214  1.000 53.01341  ?  316 HOH D O   1 
HETATM 5794 O  O   . HOH CA 5 .   ? 9.53948   15.67364  39.25337  1.000 64.29620  ?  317 HOH D O   1 
HETATM 5795 O  O   . HOH CA 5 .   ? 18.25128  13.37004  31.86910  1.000 53.65917  ?  318 HOH D O   1 
HETATM 5796 O  O   . HOH CA 5 .   ? 3.164     37.741    53.691    1.000 63.89844  ?  319 HOH D O   1 
HETATM 5797 O  O   . HOH CA 5 .   ? 17.37913  31.04329  28.42079  1.000 63.93769  ?  320 HOH D O   1 
HETATM 5798 O  O   . HOH CA 5 .   ? 26.76596  34.13113  41.91277  1.000 70.02760  ?  321 HOH D O   1 
HETATM 5799 O  O   . HOH CA 5 .   ? -6.02256  12.92994  38.80605  1.000 59.93073  ?  322 HOH D O   1 
HETATM 5800 O  O   . HOH CA 5 .   ? 11.39924  20.17229  56.30778  1.000 67.85733  ?  323 HOH D O   1 
HETATM 5801 O  O   . HOH CA 5 .   ? 17.233    18.177    58.663    1.000 52.41794  ?  324 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 5   ? 0.85913 1.13222 1.38707 0.02590  0.34971  0.09497  5   THR A N   
2    C CA  . THR A 5   ? 0.81732 1.09246 1.32043 0.03565  0.36615  0.07889  5   THR A CA  
3    C C   . THR A 5   ? 0.79651 1.03643 1.27545 0.03888  0.36379  0.06658  5   THR A C   
4    O O   . THR A 5   ? 0.91393 1.14704 1.37034 0.04780  0.37478  0.05087  5   THR A O   
5    C CB  . THR A 5   ? 0.74967 1.03838 1.26573 0.05242  0.37421  0.06642  5   THR A CB  
6    O OG1 . THR A 5   ? 0.82010 1.10153 1.30989 0.06341  0.38715  0.04781  5   THR A OG1 
7    C CG2 . THR A 5   ? 0.65601 0.92616 1.19483 0.06068  0.36086  0.06304  5   THR A CG2 
8    N N   . SER A 6   ? 0.66430 0.88047 1.14423 0.03119  0.34658  0.07311  6   SER A N   
9    C CA  . SER A 6   ? 0.59681 0.77760 1.04652 0.03185  0.33663  0.06261  6   SER A CA  
10   C C   . SER A 6   ? 0.59088 0.76895 1.00720 0.02084  0.33917  0.06595  6   SER A C   
11   O O   . SER A 6   ? 0.54246 0.73705 0.96125 0.00821  0.33929  0.08151  6   SER A O   
12   C CB  . SER A 6   ? 0.64270 0.80020 1.10227 0.02804  0.31523  0.06772  6   SER A CB  
13   O OG  . SER A 6   ? 0.74294 0.87059 1.18425 0.03513  0.30787  0.05372  6   SER A OG  
14   N N   . GLN A 7   ? 0.49581 0.65239 0.88066 0.02517  0.34037  0.05176  7   GLN A N   
15   C CA  . GLN A 7   ? 0.54340 0.69588 0.89430 0.01533  0.34243  0.05363  7   GLN A CA  
16   C C   . GLN A 7   ? 0.55766 0.69540 0.90318 0.00216  0.32461  0.06695  7   GLN A C   
17   O O   . GLN A 7   ? 0.61197 0.75455 0.93920 -0.00911 0.32528  0.07571  7   GLN A O   
18   C CB  . GLN A 7   ? 0.57116 0.70179 0.89065 0.02298  0.34578  0.03501  7   GLN A CB  
19   C CG  . GLN A 7   ? 0.53132 0.62851 0.84288 0.02389  0.32780  0.03016  7   GLN A CG  
20   C CD  . GLN A 7   ? 0.59292 0.66861 0.87924 0.03234  0.33010  0.01180  7   GLN A CD  
21   O OE1 . GLN A 7   ? 0.64813 0.72548 0.90737 0.03158  0.34052  0.00460  7   GLN A OE1 
22   N NE2 . GLN A 7   ? 0.51425 0.56965 0.80914 0.04004  0.31997  0.00426  7   GLN A NE2 
23   N N   . VAL A 8   ? 0.47596 0.59542 0.83611 0.00379  0.30838  0.06817  8   VAL A N   
24   C CA  . VAL A 8   ? 0.46420 0.56932 0.82072 -0.00660 0.29116  0.07925  8   VAL A CA  
25   C C   . VAL A 8   ? 0.52714 0.64747 0.91146 -0.01485 0.28527  0.09649  8   VAL A C   
26   O O   . VAL A 8   ? 0.47694 0.58636 0.85919 -0.02389 0.27099  0.10672  8   VAL A O   
27   C CB  . VAL A 8   ? 0.45276 0.52973 0.80703 -0.00130 0.27552  0.07148  8   VAL A CB  
28   C CG1 . VAL A 8   ? 0.47886 0.53868 0.80580 0.00570  0.27913  0.05521  8   VAL A CG1 
29   C CG2 . VAL A 8   ? 0.43299 0.51159 0.81940 0.00539  0.26996  0.07141  8   VAL A CG2 
30   N N   . ARG A 9   ? 0.45541 0.60036 0.86588 -0.01206 0.29511  0.10022  9   ARG A N   
31   C CA  . ARG A 9   ? 0.50818 0.66548 0.94752 -0.02004 0.28713  0.11654  9   ARG A CA  
32   C C   . ARG A 9   ? 0.52324 0.69427 0.95534 -0.03511 0.28803  0.13299  9   ARG A C   
33   O O   . ARG A 9   ? 0.52311 0.71677 0.94672 -0.03769 0.30390  0.13498  9   ARG A O   
34   C CB  . ARG A 9   ? 0.44284 0.62446 0.91398 -0.01312 0.29676  0.11688  9   ARG A CB  
35   C CG  . ARG A 9   ? 0.43202 0.62369 0.93417 -0.02174 0.28588  0.13356  9   ARG A CG  
36   C CD  . ARG A 9   ? 0.44995 0.66684 0.98540 -0.01466 0.29461  0.13434  9   ARG A CD  
37   N NE  . ARG A 9   ? 0.47805 0.69979 1.04342 -0.02192 0.28118  0.14834  9   ARG A NE  
38   C CZ  . ARG A 9   ? 0.55273 0.77544 1.14156 -0.01413 0.27556  0.14511  9   ARG A CZ  
39   N NH1 . ARG A 9   ? 0.56446 0.78430 1.15393 0.00102  0.28346  0.12956  9   ARG A NH1 
40   N NH2 . ARG A 9   ? 0.40027 0.62470 1.01057 -0.02155 0.26085  0.15720  9   ARG A NH2 
41   N N   . GLN A 10  ? 0.46344 0.62049 0.89837 -0.04491 0.27056  0.14464  10  GLN A N   
42   C CA  . GLN A 10  ? 0.49565 0.66233 0.92623 -0.06017 0.26778  0.16220  10  GLN A CA  
43   C C   . GLN A 10  ? 0.46027 0.62023 0.91455 -0.06836 0.24956  0.17633  10  GLN A C   
44   O O   . GLN A 10  ? 0.44181 0.57642 0.89804 -0.06453 0.23383  0.17148  10  GLN A O   
45   C CB  . GLN A 10  ? 0.47000 0.61926 0.86557 -0.06444 0.26441  0.16006  10  GLN A CB  
46   C CG  . GLN A 10  ? 0.59260 0.75256 0.98016 -0.08042 0.26279  0.17831  10  GLN A CG  
47   C CD  . GLN A 10  ? 0.59065 0.73967 0.94256 -0.08393 0.26377  0.17551  10  GLN A CD  
48   O OE1 . GLN A 10  ? 0.72527 0.89218 1.06413 -0.09310 0.27309  0.18411  10  GLN A OE1 
49   N NE2 . GLN A 10  ? 0.48921 0.61073 0.82522 -0.07712 0.25428  0.16400  10  GLN A NE2 
50   N N   . ASN A 11  ? 0.50193 0.68530 0.97403 -0.07975 0.25160  0.19367  11  ASN A N   
51   C CA  . ASN A 11  ? 0.45427 0.63157 0.94772 -0.09001 0.23368  0.20909  11  ASN A CA  
52   C C   . ASN A 11  ? 0.46712 0.63315 0.98354 -0.08144 0.22381  0.20215  11  ASN A C   
53   O O   . ASN A 11  ? 0.47975 0.62424 1.00285 -0.08488 0.20453  0.20610  11  ASN A O   
54   C CB  . ASN A 11  ? 0.45975 0.61091 0.93444 -0.09856 0.21672  0.21574  11  ASN A CB  
55   C CG  . ASN A 11  ? 0.49744 0.64335 0.99217 -0.11126 0.19859  0.23369  11  ASN A CG  
56   O OD1 . ASN A 11  ? 0.48794 0.65532 0.99710 -0.11824 0.19880  0.24422  11  ASN A OD1 
57   N ND2 . ASN A 11  ? 0.45964 0.57403 0.94729 -0.11161 0.17891  0.23274  11  ASN A ND2 
58   N N   . TYR A 12  ? 0.47430 0.65406 1.00242 -0.06982 0.23638  0.19131  12  TYR A N   
59   C CA  . TYR A 12  ? 0.49519 0.66401 1.04246 -0.06057 0.22786  0.18321  12  TYR A CA  
60   C C   . TYR A 12  ? 0.56023 0.75818 1.13837 -0.06023 0.23468  0.18979  12  TYR A C   
61   O O   . TYR A 12  ? 0.50911 0.72708 1.08892 -0.05112 0.25129  0.18194  12  TYR A O   
62   C CB  . TYR A 12  ? 0.40699 0.56033 0.93805 -0.04542 0.23285  0.16273  12  TYR A CB  
63   C CG  . TYR A 12  ? 0.39088 0.52641 0.93545 -0.03747 0.21991  0.15484  12  TYR A CG  
64   C CD1 . TYR A 12  ? 0.38423 0.49633 0.92849 -0.04195 0.19956  0.15802  12  TYR A CD1 
65   C CD2 . TYR A 12  ? 0.38397 0.52582 0.94063 -0.02503 0.22781  0.14374  12  TYR A CD2 
66   C CE1 . TYR A 12  ? 0.41399 0.51150 0.96885 -0.03495 0.18812  0.15054  12  TYR A CE1 
67   C CE2 . TYR A 12  ? 0.37027 0.49686 0.93837 -0.01859 0.21574  0.13739  12  TYR A CE2 
68   C CZ  . TYR A 12  ? 0.42902 0.53442 0.99571 -0.02385 0.19629  0.14081  12  TYR A CZ  
69   O OH  . TYR A 12  ? 0.35107 0.44311 0.92781 -0.01765 0.18473  0.13427  12  TYR A OH  
70   N N   . HIS A 13  ? 0.41221 0.60838 1.00803 -0.06843 0.21830  0.20148  13  HIS A N   
71   C CA  . HIS A 13  ? 0.42900 0.65045 1.04760 -0.07004 0.21911  0.20915  13  HIS A CA  
72   C C   . HIS A 13  ? 0.44393 0.66599 1.08110 -0.05661 0.22054  0.19811  13  HIS A C   
73   O O   . HIS A 13  ? 0.38925 0.58727 1.02619 -0.05007 0.21273  0.18854  13  HIS A O   
74   C CB  . HIS A 13  ? 0.42235 0.63802 1.05141 -0.08413 0.19911  0.22527  13  HIS A CB  
75   C CG  . HIS A 13  ? 0.52196 0.76780 1.16927 -0.09039 0.20103  0.23730  13  HIS A CG  
76   N ND1 . HIS A 13  ? 0.42728 0.68545 1.09840 -0.08398 0.20055  0.23556  13  HIS A ND1 
77   C CD2 . HIS A 13  ? 0.45105 0.71802 1.09615 -0.10296 0.20309  0.25173  13  HIS A CD2 
78   C CE1 . HIS A 13  ? 0.47296 0.75903 1.15620 -0.09214 0.20253  0.24833  13  HIS A CE1 
79   N NE2 . HIS A 13  ? 0.45478 0.74699 1.12258 -0.10390 0.20422  0.25822  13  HIS A NE2 
80   N N   . GLN A 14  ? 0.40915 0.65998 1.06192 -0.05251 0.23057  0.19957  14  GLN A N   
81   C CA  . GLN A 14  ? 0.39945 0.65323 1.07102 -0.03976 0.23159  0.19052  14  GLN A CA  
82   C C   . GLN A 14  ? 0.38846 0.62556 1.07775 -0.04343 0.21066  0.19550  14  GLN A C   
83   O O   . GLN A 14  ? 0.40337 0.62814 1.10090 -0.03353 0.20646  0.18569  14  GLN A O   
84   C CB  . GLN A 14  ? 0.59652 0.88605 1.28247 -0.03606 0.24456  0.19341  14  GLN A CB  
85   C CG  . GLN A 14  ? 0.59549 0.90616 1.26457 -0.03276 0.26544  0.18868  14  GLN A CG  
86   C CD  . GLN A 14  ? 0.57200 0.88268 1.23666 -0.01452 0.27944  0.17000  14  GLN A CD  
87   O OE1 . GLN A 14  ? 0.73823 1.06235 1.42109 -0.00500 0.28242  0.16611  14  GLN A OE1 
88   N NE2 . GLN A 14  ? 0.48716 0.78171 1.12707 -0.00963 0.28722  0.15839  14  GLN A NE2 
89   N N   . ASP A 15  ? 0.39494 0.63184 1.08977 -0.05780 0.19678  0.21072  15  ASP A N   
90   C CA  . ASP A 15  ? 0.38780 0.60639 1.09605 -0.06213 0.17547  0.21495  15  ASP A CA  
91   C C   . ASP A 15  ? 0.37516 0.56019 1.07084 -0.05814 0.16592  0.20435  15  ASP A C   
92   O O   . ASP A 15  ? 0.36437 0.53545 1.07020 -0.05355 0.15465  0.19905  15  ASP A O   
93   C CB  . ASP A 15  ? 0.40103 0.62101 1.11210 -0.07864 0.16143  0.23216  15  ASP A CB  
94   C CG  . ASP A 15  ? 0.44302 0.69799 1.16852 -0.08448 0.16878  0.24444  15  ASP A CG  
95   O OD1 . ASP A 15  ? 0.48934 0.76794 1.22273 -0.07476 0.18515  0.23886  15  ASP A OD1 
96   O OD2 . ASP A 15  ? 0.43922 0.69782 1.16761 -0.09867 0.15771  0.25941  15  ASP A OD2 
97   N N   . SER A 16  ? 0.38182 0.55452 1.05478 -0.06027 0.16999  0.20151  16  SER A N   
98   C CA  . SER A 16  ? 0.36664 0.50909 1.02605 -0.05653 0.16197  0.19134  16  SER A CA  
99   C C   . SER A 16  ? 0.35290 0.49284 1.01412 -0.04204 0.17082  0.17568  16  SER A C   
100  O O   . SER A 16  ? 0.34370 0.46317 1.00343 -0.03712 0.15810  0.16767  16  SER A O   
101  C CB  . SER A 16  ? 0.37380 0.50625 1.00815 -0.06172 0.16585  0.19239  16  SER A CB  
102  O OG  . SER A 16  ? 0.47097 0.60295 1.10233 -0.07526 0.15551  0.20709  16  SER A OG  
103  N N   . GLU A 17  ? 0.40339 0.56153 1.06121 -0.03391 0.19032  0.16959  17  GLU A N   
104  C CA  . GLU A 17  ? 0.34781 0.50291 1.00545 -0.01914 0.19772  0.15436  17  GLU A CA  
105  C C   . GLU A 17  ? 0.44310 0.59898 1.12543 -0.01503 0.18740  0.15437  17  GLU A C   
106  O O   . GLU A 17  ? 0.32825 0.46695 1.00914 -0.00787 0.18018  0.14451  17  GLU A O   
107  C CB  . GLU A 17  ? 0.35773 0.53501 1.01125 -0.01177 0.21934  0.14957  17  GLU A CB  
108  C CG  . GLU A 17  ? 0.40752 0.58114 1.05991 0.00411  0.22772  0.13356  17  GLU A CG  
109  C CD  . GLU A 17  ? 0.46886 0.66359 1.11546 0.01182  0.24742  0.12817  17  GLU A CD  
110  O OE1 . GLU A 17  ? 0.47239 0.68557 1.11413 0.00423  0.25543  0.13673  17  GLU A OE1 
111  O OE2 . GLU A 17  ? 0.48443 0.67689 1.12998 0.02519  0.25424  0.11528  17  GLU A OE2 
112  N N   . ALA A 18  ? 0.34555 0.52012 1.04639 -0.01996 0.18460  0.16558  18  ALA A N   
113  C CA  . ALA A 18  ? 0.33980 0.51600 1.06239 -0.01660 0.17438  0.16657  18  ALA A CA  
114  C C   . ALA A 18  ? 0.33072 0.48317 1.05538 -0.02229 0.15337  0.16782  18  ALA A C   
115  O O   . ALA A 18  ? 0.35757 0.50033 1.08979 -0.01599 0.14557  0.16123  18  ALA A O   
116  C CB  . ALA A 18  ? 0.35069 0.55369 1.09193 -0.02188 0.17597  0.17944  18  ALA A CB  
117  N N   . ALA A 19  ? 0.33589 0.47844 1.05299 -0.03419 0.14308  0.17620  19  ALA A N   
118  C CA  . ALA A 19  ? 0.41031 0.52771 1.12502 -0.03884 0.12279  0.17542  19  ALA A CA  
119  C C   . ALA A 19  ? 0.32002 0.41636 1.01790 -0.03042 0.12203  0.16066  19  ALA A C   
120  O O   . ALA A 19  ? 0.31352 0.39449 1.01212 -0.02775 0.10823  0.15505  19  ALA A O   
121  C CB  . ALA A 19  ? 0.34269 0.44998 1.04696 -0.05150 0.11232  0.18534  19  ALA A CB  
122  N N   . ILE A 20  ? 0.32248 0.41615 0.99687 -0.02490 0.13486  0.15284  20  ILE A N   
123  C CA  . ILE A 20  ? 0.31690 0.38926 0.96649 -0.01571 0.13257  0.13784  20  ILE A CA  
124  C C   . ILE A 20  ? 0.30742 0.38255 0.96892 -0.00547 0.13389  0.12963  20  ILE A C   
125  O O   . ILE A 20  ? 0.37849 0.43641 1.03152 -0.00151 0.12272  0.12176  20  ILE A O   
126  C CB  . ILE A 20  ? 0.32318 0.39369 0.94614 -0.01294 0.14617  0.13219  20  ILE A CB  
127  C CG1 . ILE A 20  ? 0.33239 0.39486 0.94082 -0.02316 0.14068  0.14001  20  ILE A CG1 
128  C CG2 . ILE A 20  ? 0.42401 0.47645 1.02420 -0.00327 0.14541  0.11720  20  ILE A CG2 
129  C CD1 . ILE A 20  ? 0.33039 0.36727 0.92641 -0.02488 0.12166  0.13696  20  ILE A CD1 
130  N N   . ASN A 21  ? 0.31520 0.41302 0.99771 -0.00113 0.14682  0.13199  21  ASN A N   
131  C CA  . ASN A 21  ? 0.29990 0.40047 0.99770 0.00827  0.14626  0.12597  21  ASN A CA  
132  C C   . ASN A 21  ? 0.29315 0.38976 1.00991 0.00381  0.12824  0.13129  21  ASN A C   
133  O O   . ASN A 21  ? 0.28633 0.37130 1.00158 0.00918  0.11954  0.12423  21  ASN A O   
134  C CB  . ASN A 21  ? 0.36107 0.48538 1.07457 0.01456  0.16207  0.12746  21  ASN A CB  
135  C CG  . ASN A 21  ? 0.36027 0.48664 1.05556 0.02210  0.17988  0.11822  21  ASN A CG  
136  O OD1 . ASN A 21  ? 0.31061 0.41813 0.98368 0.02706  0.17941  0.10730  21  ASN A OD1 
137  N ND2 . ASN A 21  ? 0.32487 0.47152 1.02234 0.02256  0.19372  0.12191  21  ASN A ND2 
138  N N   . ARG A 22  ? 0.29742 0.40330 1.03017 -0.00635 0.12163  0.14397  22  ARG A N   
139  C CA  . ARG A 22  ? 0.29763 0.39631 1.04281 -0.01119 0.10259  0.14829  22  ARG A CA  
140  C C   . ARG A 22  ? 0.32028 0.39271 1.04629 -0.01231 0.08799  0.14051  22  ARG A C   
141  O O   . ARG A 22  ? 0.37848 0.44284 1.10881 -0.01020 0.07588  0.13671  22  ARG A O   
142  C CB  . ARG A 22  ? 0.30624 0.41361 1.06160 -0.02223 0.09554  0.16230  22  ARG A CB  
143  C CG  . ARG A 22  ? 0.41279 0.54660 1.18469 -0.02069 0.10648  0.17018  22  ARG A CG  
144  C CD  . ARG A 22  ? 0.46500 0.60852 1.24835 -0.03281 0.09705  0.18527  22  ARG A CD  
145  N NE  . ARG A 22  ? 0.43400 0.59663 1.21500 -0.03687 0.11094  0.19277  22  ARG A NE  
146  C CZ  . ARG A 22  ? 0.40889 0.56633 1.17789 -0.04678 0.10823  0.19911  22  ARG A CZ  
147  N NH1 . ARG A 22  ? 0.47983 0.61217 1.23821 -0.05294 0.09159  0.19834  22  ARG A NH1 
148  N NH2 . ARG A 22  ? 0.47764 0.65483 1.24421 -0.05046 0.12148  0.20610  22  ARG A NH2 
149  N N   . GLN A 23  ? 0.31651 0.37457 1.01620 -0.01452 0.08837  0.13729  23  GLN A N   
150  C CA  . GLN A 23  ? 0.29969 0.33272 0.97639 -0.01404 0.07414  0.12915  23  GLN A CA  
151  C C   . GLN A 23  ? 0.28726 0.31233 0.94883 -0.00353 0.07652  0.11623  23  GLN A C   
152  O O   . GLN A 23  ? 0.28372 0.29557 0.93762 -0.00191 0.06340  0.11028  23  GLN A O   
153  C CB  . GLN A 23  ? 0.30382 0.32498 0.95832 -0.01865 0.07385  0.12998  23  GLN A CB  
154  C CG  . GLN A 23  ? 0.30575 0.30233 0.93972 -0.01847 0.05742  0.12285  23  GLN A CG  
155  C CD  . GLN A 23  ? 0.52004 0.50933 1.16770 -0.02625 0.03924  0.12898  23  GLN A CD  
156  O OE1 . GLN A 23  ? 0.42229 0.42102 1.08910 -0.03531 0.03795  0.14133  23  GLN A OE1 
157  N NE2 . GLN A 23  ? 0.45510 0.42823 1.09272 -0.02316 0.02480  0.12050  23  GLN A NE2 
158  N N   . ILE A 24  ? 0.28599 0.31891 0.94221 0.00330  0.09276  0.11179  24  ILE A N   
159  C CA  . ILE A 24  ? 0.28000 0.30678 0.92584 0.01260  0.09501  0.10110  24  ILE A CA  
160  C C   . ILE A 24  ? 0.36527 0.39531 1.03140 0.01460  0.08531  0.10178  24  ILE A C   
161  O O   . ILE A 24  ? 0.26905 0.28710 0.92463 0.01686  0.07464  0.09550  24  ILE A O   
162  C CB  . ILE A 24  ? 0.30692 0.34331 0.94994 0.01924  0.11385  0.09751  24  ILE A CB  
163  C CG1 . ILE A 24  ? 0.28920 0.31752 0.90394 0.01802  0.12120  0.09389  24  ILE A CG1 
164  C CG2 . ILE A 24  ? 0.29338 0.32554 0.93491 0.02848  0.11498  0.08878  24  ILE A CG2 
165  C CD1 . ILE A 24  ? 0.29622 0.33670 0.90916 0.02208  0.14030  0.09241  24  ILE A CD1 
166  N N   . ASN A 25  ? 0.27342 0.32147 0.96944 0.01326  0.08848  0.11027  25  ASN A N   
167  C CA  . ASN A 25  ? 0.35998 0.41259 1.07734 0.01454  0.07870  0.11236  25  ASN A CA  
168  C C   . ASN A 25  ? 0.26734 0.30764 0.98120 0.00763  0.05908  0.11353  25  ASN A C   
169  O O   . ASN A 25  ? 0.26400 0.29867 0.97827 0.00969  0.04849  0.10992  25  ASN A O   
170  C CB  . ASN A 25  ? 0.29744 0.37083 1.04349 0.01369  0.08448  0.12206  25  ASN A CB  
171  C CG  . ASN A 25  ? 0.27741 0.35046 1.03445 0.01566  0.07450  0.12312  25  ASN A CG  
172  O OD1 . ASN A 25  ? 0.27981 0.35498 1.05050 0.00914  0.06176  0.13047  25  ASN A OD1 
173  N ND2 . ASN A 25  ? 0.28569 0.35380 1.03415 0.02361  0.07859  0.11557  25  ASN A ND2 
174  N N   . LEU A 26  ? 0.30510 0.34033 1.01431 -0.00061 0.05349  0.11832  26  LEU A N   
175  C CA  . LEU A 26  ? 0.27633 0.29767 0.98056 -0.00659 0.03443  0.11811  26  LEU A CA  
176  C C   . LEU A 26  ? 0.33475 0.33800 1.01017 -0.00164 0.02757  0.10595  26  LEU A C   
177  O O   . LEU A 26  ? 0.27311 0.26966 0.94696 -0.00201 0.01369  0.10259  26  LEU A O   
178  C CB  . LEU A 26  ? 0.38552 0.40287 1.08939 -0.01587 0.03027  0.12549  26  LEU A CB  
179  C CG  . LEU A 26  ? 0.39039 0.39408 1.09466 -0.02288 0.00963  0.12670  26  LEU A CG  
180  C CD1 . LEU A 26  ? 0.32749 0.34112 1.05525 -0.02442 0.00115  0.13081  26  LEU A CD1 
181  C CD2 . LEU A 26  ? 0.30589 0.30657 1.01098 -0.03202 0.00490  0.13547  26  LEU A CD2 
182  N N   . GLU A 27  ? 0.27412 0.27091 0.92639 0.00269  0.03706  0.09959  27  GLU A N   
183  C CA  . GLU A 27  ? 0.34878 0.33164 0.97452 0.00725  0.03136  0.08894  27  GLU A CA  
184  C C   . GLU A 27  ? 0.39875 0.38527 1.02661 0.01296  0.03104  0.08435  27  GLU A C   
185  O O   . GLU A 27  ? 0.34220 0.32143 0.95792 0.01426  0.02020  0.07850  27  GLU A O   
186  C CB  . GLU A 27  ? 0.28703 0.26392 0.88899 0.00993  0.04168  0.08443  27  GLU A CB  
187  C CG  . GLU A 27  ? 0.39582 0.36762 0.99279 0.00430  0.04133  0.08916  27  GLU A CG  
188  C CD  . GLU A 27  ? 0.57044 0.52747 1.15847 0.00141  0.02432  0.08688  27  GLU A CD  
189  O OE1 . GLU A 27  ? 0.67625 0.62718 1.25537 0.00508  0.01474  0.07933  27  GLU A OE1 
190  O OE2 . GLU A 27  ? 0.58352 0.53516 1.17339 -0.00456 0.02026  0.09272  27  GLU A OE2 
191  N N   . LEU A 28  ? 0.30182 0.29994 0.94493 0.01660  0.04253  0.08700  28  LEU A N   
192  C CA  . LEU A 28  ? 0.25598 0.25616 0.90314 0.02169  0.04079  0.08383  28  LEU A CA  
193  C C   . LEU A 28  ? 0.29428 0.29794 0.95919 0.01812  0.02610  0.08807  28  LEU A C   
194  O O   . LEU A 28  ? 0.25215 0.25257 0.90801 0.01860  0.01709  0.08398  28  LEU A O   
195  C CB  . LEU A 28  ? 0.25596 0.26645 0.91669 0.02725  0.05570  0.08528  28  LEU A CB  
196  C CG  . LEU A 28  ? 0.25905 0.26465 0.89901 0.03157  0.06962  0.07924  28  LEU A CG  
197  C CD1 . LEU A 28  ? 0.26375 0.28033 0.91630 0.03608  0.08478  0.08053  28  LEU A CD1 
198  C CD2 . LEU A 28  ? 0.25836 0.25221 0.87045 0.03353  0.06552  0.07054  28  LEU A CD2 
199  N N   . TYR A 29  ? 0.25705 0.26816 0.94335 0.01237  0.02261  0.09645  29  TYR A N   
200  C CA  . TYR A 29  ? 0.34565 0.35943 1.04797 0.00775  0.00740  0.10081  29  TYR A CA  
201  C C   . TYR A 29  ? 0.31284 0.31215 0.99303 0.00506  -0.00766 0.09416  29  TYR A C   
202  O O   . TYR A 29  ? 0.34782 0.34637 1.02712 0.00504  -0.01860 0.09205  29  TYR A O   
203  C CB  . TYR A 29  ? 0.26102 0.28574 0.98990 0.00091  0.00643  0.11187  29  TYR A CB  
204  C CG  . TYR A 29  ? 0.26397 0.28939 1.00750 -0.00611 -0.01122 0.11694  29  TYR A CG  
205  C CD1 . TYR A 29  ? 0.39097 0.42507 1.15145 -0.00477 -0.01643 0.12033  29  TYR A CD1 
206  C CD2 . TYR A 29  ? 0.27272 0.28792 1.01059 -0.01409 -0.02350 0.11820  29  TYR A CD2 
207  C CE1 . TYR A 29  ? 0.31443 0.34722 1.08188 -0.01074 -0.03304 0.12477  29  TYR A CE1 
208  C CE2 . TYR A 29  ? 0.27885 0.29350 1.02554 -0.01988 -0.04064 0.12174  29  TYR A CE2 
209  C CZ  . TYR A 29  ? 0.32328 0.34771 1.08465 -0.01811 -0.04505 0.12515  29  TYR A CZ  
210  O OH  . TYR A 29  ? 0.28406 0.30729 1.04970 -0.02322 -0.06193 0.12847  29  TYR A OH  
211  N N   . ALA A 30  ? 0.27973 0.26810 0.94173 0.00316  -0.00845 0.09072  30  ALA A N   
212  C CA  . ALA A 30  ? 0.27066 0.24536 0.90995 0.00271  -0.02153 0.08266  30  ALA A CA  
213  C C   . ALA A 30  ? 0.30888 0.28206 0.92859 0.00876  -0.02134 0.07421  30  ALA A C   
214  O O   . ALA A 30  ? 0.29688 0.26732 0.90807 0.00841  -0.03376 0.06970  30  ALA A O   
215  C CB  . ALA A 30  ? 0.28051 0.24377 0.90359 0.00160  -0.02019 0.08026  30  ALA A CB  
216  N N   . SER A 31  ? 0.25963 0.23503 0.87123 0.01377  -0.00775 0.07217  31  SER A N   
217  C CA  . SER A 31  ? 0.33394 0.30928 0.92958 0.01818  -0.00761 0.06618  31  SER A CA  
218  C C   . SER A 31  ? 0.25220 0.23491 0.86173 0.01688  -0.01627 0.06915  31  SER A C   
219  O O   . SER A 31  ? 0.33489 0.31634 0.93224 0.01710  -0.02608 0.06508  31  SER A O   
220  C CB  . SER A 31  ? 0.25207 0.22955 0.84002 0.02196  0.00821  0.06490  31  SER A CB  
221  O OG  . SER A 31  ? 0.31929 0.29665 0.89192 0.02462  0.00788  0.06032  31  SER A OG  
222  N N   . TYR A 32  ? 0.25123 0.24312 0.88664 0.01509  -0.01330 0.07681  32  TYR A N   
223  C CA  . TYR A 32  ? 0.24977 0.24918 0.89979 0.01345  -0.02117 0.08087  32  TYR A CA  
224  C C   . TYR A 32  ? 0.25261 0.24989 0.90723 0.00951  -0.03883 0.08179  32  TYR A C   
225  O O   . TYR A 32  ? 0.25813 0.25772 0.90893 0.00870  -0.04849 0.08097  32  TYR A O   
226  C CB  . TYR A 32  ? 0.31736 0.32700 0.99444 0.01257  -0.01379 0.08908  32  TYR A CB  
227  C CG  . TYR A 32  ? 0.28837 0.30355 0.97420 0.01269  -0.01586 0.09221  32  TYR A CG  
228  C CD1 . TYR A 32  ? 0.24971 0.26149 0.91966 0.01394  -0.02120 0.08814  32  TYR A CD1 
229  C CD2 . TYR A 32  ? 0.29247 0.31581 1.00252 0.01177  -0.01262 0.10008  32  TYR A CD2 
230  C CE1 . TYR A 32  ? 0.25194 0.26736 0.93058 0.01391  -0.02402 0.09192  32  TYR A CE1 
231  C CE2 . TYR A 32  ? 0.43252 0.45885 1.14956 0.01252  -0.01501 0.10296  32  TYR A CE2 
232  C CZ  . TYR A 32  ? 0.36796 0.38990 1.06970 0.01336  -0.02103 0.09891  32  TYR A CZ  
233  O OH  . TYR A 32  ? 0.26019 0.28448 0.97052 0.01379  -0.02460 0.10271  32  TYR A OH  
234  N N   . VAL A 33  ? 0.25832 0.25215 0.91761 0.00495  -0.04345 0.08339  33  VAL A N   
235  C CA  . VAL A 33  ? 0.26980 0.25970 0.92643 -0.00049 -0.06045 0.08210  33  VAL A CA  
236  C C   . VAL A 33  ? 0.26795 0.25127 0.89473 0.00200  -0.06724 0.07171  33  VAL A C   
237  O O   . VAL A 33  ? 0.41373 0.39999 1.03701 -0.00007 -0.07911 0.07031  33  VAL A O   
238  C CB  . VAL A 33  ? 0.37009 0.35312 1.03198 -0.00559 -0.06406 0.08435  33  VAL A CB  
239  C CG1 . VAL A 33  ? 0.28544 0.25842 0.93421 -0.00943 -0.08167 0.07856  33  VAL A CG1 
240  C CG2 . VAL A 33  ? 0.27333 0.26729 0.96819 -0.01032 -0.06177 0.09646  33  VAL A CG2 
241  N N   . TYR A 34  ? 0.30053 0.27644 0.90537 0.00629  -0.05992 0.06464  34  TYR A N   
242  C CA  . TYR A 34  ? 0.32794 0.30050 0.90458 0.00949  -0.06514 0.05478  34  TYR A CA  
243  C C   . TYR A 34  ? 0.26362 0.24552 0.83590 0.01085  -0.06532 0.05514  34  TYR A C   
244  O O   . TYR A 34  ? 0.30129 0.28600 0.85864 0.01046  -0.07505 0.05025  34  TYR A O   
245  C CB  . TYR A 34  ? 0.27017 0.23538 0.82698 0.01416  -0.05593 0.04875  34  TYR A CB  
246  C CG  . TYR A 34  ? 0.30483 0.25852 0.85842 0.01300  -0.06020 0.04636  34  TYR A CG  
247  C CD1 . TYR A 34  ? 0.53697 0.48410 1.08480 0.01127  -0.07519 0.04136  34  TYR A CD1 
248  C CD2 . TYR A 34  ? 0.29162 0.24019 0.84733 0.01339  -0.04992 0.04916  34  TYR A CD2 
249  C CE1 . TYR A 34  ? 0.63534 0.56883 1.17987 0.01029  -0.08069 0.03896  34  TYR A CE1 
250  C CE2 . TYR A 34  ? 0.33073 0.26754 0.88369 0.01164  -0.05500 0.04813  34  TYR A CE2 
251  C CZ  . TYR A 34  ? 0.59096 0.51918 1.13871 0.01022  -0.07082 0.04300  34  TYR A CZ  
252  O OH  . TYR A 34  ? 0.59138 0.50505 1.13642 0.00851  -0.07760 0.04185  34  TYR A OH  
253  N N   . LEU A 35  ? 0.25613 0.24294 0.84083 0.01241  -0.05509 0.06088  35  LEU A N   
254  C CA  . LEU A 35  ? 0.25213 0.24581 0.83387 0.01291  -0.05690 0.06240  35  LEU A CA  
255  C C   . LEU A 35  ? 0.47403 0.47467 1.07000 0.00811  -0.07036 0.06759  35  LEU A C   
256  O O   . LEU A 35  ? 0.29105 0.29699 0.87545 0.00647  -0.07869 0.06645  35  LEU A O   
257  C CB  . LEU A 35  ? 0.24676 0.24124 0.83937 0.01629  -0.04393 0.06673  35  LEU A CB  
258  C CG  . LEU A 35  ? 0.35950 0.35858 0.95435 0.01652  -0.04617 0.07026  35  LEU A CG  
259  C CD1 . LEU A 35  ? 0.29261 0.29149 0.85903 0.01672  -0.04797 0.06478  35  LEU A CD1 
260  C CD2 . LEU A 35  ? 0.37035 0.36855 0.97587 0.01900  -0.03358 0.07328  35  LEU A CD2 
261  N N   . SER A 36  ? 0.25614 0.25827 0.87717 0.00509  -0.07307 0.07406  36  SER A N   
262  C CA  . SER A 36  ? 0.25993 0.26835 0.89410 -0.00037 -0.08730 0.07910  36  SER A CA  
263  C C   . SER A 36  ? 0.26828 0.27439 0.88078 -0.00332 -0.10064 0.07160  36  SER A C   
264  O O   . SER A 36  ? 0.27076 0.28360 0.87768 -0.00620 -0.11087 0.07219  36  SER A O   
265  C CB  . SER A 36  ? 0.42662 0.43735 1.08999 -0.00386 -0.08859 0.08708  36  SER A CB  
266  O OG  . SER A 36  ? 0.26648 0.28272 0.93956 -0.00987 -0.10390 0.09141  36  SER A OG  
267  N N   . MET A 37  ? 0.27435 0.27100 0.87425 -0.00247 -0.10112 0.06441  37  MET A N   
268  C CA  . MET A 37  ? 0.32607 0.31949 0.90509 -0.00376 -0.11395 0.05558  37  MET A CA  
269  C C   . MET A 37  ? 0.28350 0.28298 0.83644 -0.00024 -0.11356 0.04878  37  MET A C   
270  O O   . MET A 37  ? 0.35808 0.36342 0.89847 -0.00240 -0.12494 0.04497  37  MET A O   
271  C CB  . MET A 37  ? 0.40335 0.38319 0.97368 -0.00224 -0.11442 0.04875  37  MET A CB  
272  C CG  . MET A 37  ? 0.44270 0.41722 1.03782 -0.00635 -0.11289 0.05665  37  MET A CG  
273  S SD  . MET A 37  ? 0.51992 0.47707 1.10292 -0.00431 -0.11149 0.04995  37  MET A SD  
274  C CE  . MET A 37  ? 0.42970 0.37816 0.99531 -0.00584 -0.13078 0.03974  37  MET A CE  
275  N N   . SER A 38  ? 0.30121 0.30081 0.84546 0.00461  -0.10075 0.04762  38  SER A N   
276  C CA  . SER A 38  ? 0.28601 0.29297 0.80603 0.00710  -0.10036 0.04229  38  SER A CA  
277  C C   . SER A 38  ? 0.34777 0.36681 0.87208 0.00238  -0.10802 0.04863  38  SER A C   
278  O O   . SER A 38  ? 0.27886 0.30640 0.78696 0.00059  -0.11751 0.04465  38  SER A O   
279  C CB  . SER A 38  ? 0.32157 0.32642 0.83437 0.01167  -0.08585 0.04190  38  SER A CB  
280  O OG  . SER A 38  ? 0.26350 0.27797 0.75766 0.01219  -0.08598 0.04015  38  SER A OG  
281  N N   . TYR A 39  ? 0.37825 0.39868 0.92520 0.00033  -0.10472 0.05875  39  TYR A N   
282  C CA  . TYR A 39  ? 0.42609 0.45707 0.97682 -0.00426 -0.11290 0.06564  39  TYR A CA  
283  C C   . TYR A 39  ? 0.37337 0.40918 0.93203 -0.01017 -0.12800 0.06798  39  TYR A C   
284  O O   . TYR A 39  ? 0.27820 0.32446 0.83101 -0.01471 -0.13763 0.07118  39  TYR A O   
285  C CB  . TYR A 39  ? 0.33691 0.36683 0.90792 -0.00335 -0.10529 0.07494  39  TYR A CB  
286  C CG  . TYR A 39  ? 0.31308 0.34195 0.86612 -0.00008 -0.09604 0.07223  39  TYR A CG  
287  C CD1 . TYR A 39  ? 0.31954 0.35709 0.85781 -0.00338 -0.10174 0.07433  39  TYR A CD1 
288  C CD2 . TYR A 39  ? 0.35358 0.37364 0.90251 0.00531  -0.08252 0.06775  39  TYR A CD2 
289  C CE1 . TYR A 39  ? 0.25472 0.29177 0.77573 -0.00156 -0.09433 0.07237  39  TYR A CE1 
290  C CE2 . TYR A 39  ? 0.24953 0.26849 0.78091 0.00750  -0.07501 0.06527  39  TYR A CE2 
291  C CZ  . TYR A 39  ? 0.25091 0.27819 0.76872 0.00395  -0.08115 0.06765  39  TYR A CZ  
292  O OH  . TYR A 39  ? 0.28151 0.30803 0.78218 0.00504  -0.07453 0.06603  39  TYR A OH  
293  N N   . TYR A 40  ? 0.27959 0.30828 0.84894 -0.01105 -0.13132 0.06630  40  TYR A N   
294  C CA  . TYR A 40  ? 0.36596 0.39800 0.93594 -0.01695 -0.14706 0.06601  40  TYR A CA  
295  C C   . TYR A 40  ? 0.39028 0.42726 0.92877 -0.01646 -0.15429 0.05539  40  TYR A C   
296  O O   . TYR A 40  ? 0.30647 0.35324 0.83949 -0.02171 -0.16638 0.05679  40  TYR A O   
297  C CB  . TYR A 40  ? 0.33140 0.35317 0.91520 -0.01855 -0.15028 0.06526  40  TYR A CB  
298  C CG  . TYR A 40  ? 0.31825 0.34025 0.89611 -0.02426 -0.16715 0.06184  40  TYR A CG  
299  C CD1 . TYR A 40  ? 0.38799 0.41806 0.98351 -0.03170 -0.17853 0.07132  40  TYR A CD1 
300  C CD2 . TYR A 40  ? 0.32306 0.33670 0.87733 -0.02191 -0.17234 0.04878  40  TYR A CD2 
301  C CE1 . TYR A 40  ? 0.35298 0.38284 0.94147 -0.03770 -0.19492 0.06784  40  TYR A CE1 
302  C CE2 . TYR A 40  ? 0.36953 0.38164 0.91657 -0.02676 -0.18828 0.04418  40  TYR A CE2 
303  C CZ  . TYR A 40  ? 0.38076 0.40104 0.94403 -0.03511 -0.19961 0.05363  40  TYR A CZ  
304  O OH  . TYR A 40  ? 0.41139 0.42947 0.96492 -0.04036 -0.21609 0.04821  40  TYR A OH  
305  N N   . PHE A 41  ? 0.44658 0.47840 0.96400 -0.00996 -0.14705 0.04477  41  PHE A N   
306  C CA  . PHE A 41  ? 0.30925 0.34817 0.79733 -0.00805 -0.15319 0.03393  41  PHE A CA  
307  C C   . PHE A 41  ? 0.37172 0.42752 0.84586 -0.00917 -0.15172 0.03683  41  PHE A C   
308  O O   . PHE A 41  ? 0.37288 0.43968 0.82349 -0.00842 -0.15719 0.02923  41  PHE A O   
309  C CB  . PHE A 41  ? 0.31951 0.34771 0.79129 -0.00013 -0.14733 0.02167  41  PHE A CB  
310  C CG  . PHE A 41  ? 0.32559 0.33783 0.80531 -0.00056 -0.15397 0.01749  41  PHE A CG  
311  C CD1 . PHE A 41  ? 0.40068 0.41191 0.87202 -0.00323 -0.16874 0.01101  41  PHE A CD1 
312  C CD2 . PHE A 41  ? 0.32624 0.32495 0.82243 0.00051  -0.14644 0.02107  41  PHE A CD2 
313  C CE1 . PHE A 41  ? 0.43746 0.43207 0.91669 -0.00499 -0.17685 0.00794  41  PHE A CE1 
314  C CE2 . PHE A 41  ? 0.39955 0.38370 0.90442 -0.00167 -0.15401 0.01915  41  PHE A CE2 
315  C CZ  . PHE A 41  ? 0.34846 0.32957 0.84499 -0.00459 -0.16972 0.01263  41  PHE A CZ  
316  N N   . ASP A 42  ? 0.37768 0.43623 0.86592 -0.01121 -0.14532 0.04779  42  ASP A N   
317  C CA  . ASP A 42  ? 0.32092 0.39380 0.79977 -0.01434 -0.14572 0.05353  42  ASP A CA  
318  C C   . ASP A 42  ? 0.40899 0.49188 0.89849 -0.02283 -0.15838 0.06360  42  ASP A C   
319  O O   . ASP A 42  ? 0.44717 0.54326 0.92782 -0.02716 -0.16173 0.06930  42  ASP A O   
320  C CB  . ASP A 42  ? 0.30462 0.37177 0.79212 -0.01181 -0.13296 0.05947  42  ASP A CB  
321  C CG  . ASP A 42  ? 0.38371 0.46304 0.86264 -0.01606 -0.13409 0.06687  42  ASP A CG  
322  O OD1 . ASP A 42  ? 0.35086 0.44332 0.80545 -0.01663 -0.13590 0.06233  42  ASP A OD1 
323  O OD2 . ASP A 42  ? 0.33646 0.41217 0.83367 -0.01866 -0.13319 0.07745  42  ASP A OD2 
324  N N   . ARG A 43  ? 0.43110 0.50872 0.93935 -0.02609 -0.16626 0.06678  43  ARG A N   
325  C CA  . ARG A 43  ? 0.36669 0.45421 0.88515 -0.03451 -0.17961 0.07656  43  ARG A CA  
326  C C   . ARG A 43  ? 0.42463 0.52811 0.91620 -0.03857 -0.18982 0.07162  43  ARG A C   
327  O O   . ARG A 43  ? 0.37866 0.48304 0.84772 -0.03456 -0.19001 0.05834  43  ARG A O   
328  C CB  . ARG A 43  ? 0.30834 0.38817 0.84972 -0.03743 -0.18700 0.07958  43  ARG A CB  
329  C CG  . ARG A 43  ? 0.29821 0.36684 0.86928 -0.03419 -0.17742 0.08633  43  ARG A CG  
330  C CD  . ARG A 43  ? 0.32935 0.39085 0.91914 -0.03647 -0.18307 0.08711  43  ARG A CD  
331  N NE  . ARG A 43  ? 0.41770 0.48746 1.01143 -0.04489 -0.19991 0.09200  43  ARG A NE  
332  C CZ  . ARG A 43  ? 0.43866 0.50466 1.05257 -0.04919 -0.20592 0.09947  43  ARG A CZ  
333  N NH1 . ARG A 43  ? 0.31456 0.37091 0.94886 -0.04588 -0.19661 0.10331  43  ARG A NH1 
334  N NH2 . ARG A 43  ? 0.33313 0.40382 0.94095 -0.05644 -0.21963 0.10301  43  ARG A NH2 
335  N N   . ASP A 44  ? 0.31732 0.43403 0.81161 -0.04642 -0.19872 0.08257  44  ASP A N   
336  C CA  . ASP A 44  ? 0.32828 0.46376 0.79712 -0.05140 -0.20816 0.07970  44  ASP A CA  
337  C C   . ASP A 44  ? 0.39428 0.53025 0.85484 -0.05319 -0.21934 0.07090  44  ASP A C   
338  O O   . ASP A 44  ? 0.42280 0.57147 0.85610 -0.05312 -0.22376 0.06142  44  ASP A O   
339  C CB  . ASP A 44  ? 0.42889 0.57759 0.90491 -0.06085 -0.21662 0.09551  44  ASP A CB  
340  C CG  . ASP A 44  ? 0.48838 0.63168 0.99362 -0.06647 -0.22631 0.10696  44  ASP A CG  
341  O OD1 . ASP A 44  ? 0.51348 0.64326 1.04257 -0.06342 -0.21913 0.11436  44  ASP A OD1 
342  O OD2 . ASP A 44  ? 0.38302 0.53436 0.88357 -0.07307 -0.23944 0.10768  44  ASP A OD2 
343  N N   . ASP A 45  ? 0.39072 0.51360 0.87395 -0.05475 -0.22419 0.07361  45  ASP A N   
344  C CA  . ASP A 45  ? 0.38468 0.50425 0.86164 -0.05713 -0.23587 0.06543  45  ASP A CA  
345  C C   . ASP A 45  ? 0.39394 0.49622 0.86387 -0.04860 -0.22999 0.05050  45  ASP A C   
346  O O   . ASP A 45  ? 0.43857 0.53175 0.90876 -0.05040 -0.23960 0.04440  45  ASP A O   
347  C CB  . ASP A 45  ? 0.36247 0.47899 0.86829 -0.06535 -0.24686 0.07806  45  ASP A CB  
348  C CG  . ASP A 45  ? 0.44541 0.54651 0.98245 -0.06188 -0.23830 0.08417  45  ASP A CG  
349  O OD1 . ASP A 45  ? 0.38277 0.47678 0.92025 -0.05416 -0.22352 0.08129  45  ASP A OD1 
350  O OD2 . ASP A 45  ? 0.62069 0.71674 1.17941 -0.06672 -0.24528 0.09184  45  ASP A OD2 
351  N N   . VAL A 46  ? 0.39204 0.48869 0.85602 -0.04001 -0.21548 0.04516  46  VAL A N   
352  C CA  . VAL A 46  ? 0.41012 0.49184 0.86335 -0.03146 -0.21017 0.03071  46  VAL A CA  
353  C C   . VAL A 46  ? 0.40665 0.49762 0.83157 -0.02382 -0.20202 0.02015  46  VAL A C   
354  O O   . VAL A 46  ? 0.44072 0.53510 0.84155 -0.01980 -0.20694 0.00637  46  VAL A O   
355  C CB  . VAL A 46  ? 0.50169 0.56589 0.97955 -0.02833 -0.20006 0.03548  46  VAL A CB  
356  C CG1 . VAL A 46  ? 0.40884 0.45739 0.87499 -0.02012 -0.19525 0.02178  46  VAL A CG1 
357  C CG2 . VAL A 46  ? 0.34702 0.40564 0.85479 -0.03589 -0.20807 0.04673  46  VAL A CG2 
358  N N   . ALA A 47  ? 0.34217 0.43722 0.77005 -0.02138 -0.18966 0.02622  47  ALA A N   
359  C CA  . ALA A 47  ? 0.38202 0.49245 0.78566 -0.01719 -0.18314 0.02115  47  ALA A CA  
360  C C   . ALA A 47  ? 0.45283 0.55740 0.83646 -0.00659 -0.17834 0.00437  47  ALA A C   
361  O O   . ALA A 47  ? 0.35757 0.47631 0.71644 -0.00310 -0.18131 -0.00582 47  ALA A O   
362  C CB  . ALA A 47  ? 0.34847 0.48261 0.73646 -0.02389 -0.19286 0.02382  47  ALA A CB  
363  N N   . LEU A 48  ? 0.34183 0.42622 0.73669 -0.00119 -0.17089 0.00182  48  LEU A N   
364  C CA  . LEU A 48  ? 0.34693 0.42307 0.72634 0.00923  -0.16537 -0.01203 48  LEU A CA  
365  C C   . LEU A 48  ? 0.33060 0.40492 0.71346 0.01310  -0.15042 -0.00757 48  LEU A C   
366  O O   . LEU A 48  ? 0.32375 0.38083 0.72292 0.01435  -0.14395 -0.00424 48  LEU A O   
367  C CB  . LEU A 48  ? 0.39360 0.44630 0.78160 0.01123  -0.17146 -0.01870 48  LEU A CB  
368  C CG  . LEU A 48  ? 0.42100 0.47430 0.80261 0.00725  -0.18744 -0.02453 48  LEU A CG  
369  C CD1 . LEU A 48  ? 0.48913 0.52180 0.89144 0.00217  -0.19556 -0.02126 48  LEU A CD1 
370  C CD2 . LEU A 48  ? 0.45895 0.51516 0.81156 0.01663  -0.19109 -0.04292 48  LEU A CD2 
371  N N   . LYS A 49  ? 0.26688 0.33941 0.79473 0.03854  -0.15931 -0.07426 49  LYS A N   
372  C CA  . LYS A 49  ? 0.26578 0.35558 0.77708 0.02948  -0.14884 -0.07030 49  LYS A CA  
373  C C   . LYS A 49  ? 0.26199 0.36803 0.78558 0.03489  -0.14490 -0.05996 49  LYS A C   
374  O O   . LYS A 49  ? 0.31310 0.42540 0.83311 0.02879  -0.13637 -0.05335 49  LYS A O   
375  C CB  . LYS A 49  ? 0.31647 0.42348 0.80045 0.02248  -0.14654 -0.07943 49  LYS A CB  
376  N N   . ASN A 50  ? 0.27123 0.38236 0.80759 0.04687  -0.15039 -0.05815 50  ASN A N   
377  C CA  . ASN A 50  ? 0.26302 0.38899 0.80561 0.05417  -0.14601 -0.04853 50  ASN A CA  
378  C C   . ASN A 50  ? 0.26560 0.37028 0.82691 0.05759  -0.14287 -0.03923 50  ASN A C   
379  O O   . ASN A 50  ? 0.29263 0.40553 0.85765 0.05892  -0.13638 -0.03037 50  ASN A O   
380  C CB  . ASN A 50  ? 0.29626 0.43492 0.83566 0.06599  -0.15066 -0.05028 50  ASN A CB  
381  C CG  . ASN A 50  ? 0.26421 0.43150 0.78444 0.06183  -0.15152 -0.05903 50  ASN A CG  
382  O OD1 . ASN A 50  ? 0.26190 0.44794 0.76727 0.05236  -0.14448 -0.05962 50  ASN A OD1 
383  N ND2 . ASN A 50  ? 0.41386 0.58300 0.93115 0.06719  -0.15870 -0.06655 50  ASN A ND2 
384  N N   . PHE A 51  ? 0.27181 0.34787 0.83891 0.05695  -0.14545 -0.04177 51  PHE A N   
385  C CA  . PHE A 51  ? 0.27491 0.33109 0.85594 0.05467  -0.14066 -0.03564 51  PHE A CA  
386  C C   . PHE A 51  ? 0.28542 0.34802 0.87119 0.04660  -0.13574 -0.03180 51  PHE A C   
387  O O   . PHE A 51  ? 0.31521 0.37772 0.90980 0.04653  -0.12899 -0.02286 51  PHE A O   
388  C CB  . PHE A 51  ? 0.35738 0.38887 0.94336 0.05202  -0.14503 -0.04240 51  PHE A CB  
389  C CG  . PHE A 51  ? 0.34430 0.36465 0.93381 0.05773  -0.14603 -0.04261 51  PHE A CG  
390  C CD1 . PHE A 51  ? 0.29915 0.30809 0.90132 0.05840  -0.14015 -0.03660 51  PHE A CD1 
391  C CD2 . PHE A 51  ? 0.29631 0.31712 0.87675 0.06177  -0.15222 -0.04921 51  PHE A CD2 
392  C CE1 . PHE A 51  ? 0.31081 0.30960 0.91629 0.06321  -0.13998 -0.03716 51  PHE A CE1 
393  C CE2 . PHE A 51  ? 0.30696 0.31788 0.89092 0.06660  -0.15247 -0.04920 51  PHE A CE2 
394  C CZ  . PHE A 51  ? 0.31452 0.31432 0.91112 0.06724  -0.14619 -0.04331 51  PHE A CZ  
395  N N   . ALA A 52  ? 0.25987 0.32638 0.83581 0.03897  -0.13773 -0.03848 52  ALA A N   
396  C CA  . ALA A 52  ? 0.33249 0.39877 0.89764 0.02803  -0.12943 -0.03528 52  ALA A CA  
397  C C   . ALA A 52  ? 0.25696 0.34484 0.81064 0.02492  -0.12079 -0.02812 52  ALA A C   
398  O O   . ALA A 52  ? 0.32003 0.40553 0.87711 0.02046  -0.11318 -0.02027 52  ALA A O   
399  C CB  . ALA A 52  ? 0.29963 0.36199 0.84312 0.02005  -0.13023 -0.04434 52  ALA A CB  
400  N N   . LYS A 53  ? 0.25722 0.36796 0.79711 0.02735  -0.12191 -0.03132 53  LYS A N   
401  C CA  . LYS A 53  ? 0.25641 0.39312 0.78475 0.02547  -0.11444 -0.02606 53  LYS A CA  
402  C C   . LYS A 53  ? 0.36434 0.49982 0.90869 0.03569  -0.11200 -0.01480 53  LYS A C   
403  O O   . LYS A 53  ? 0.25827 0.40195 0.79919 0.03209  -0.10388 -0.00724 53  LYS A O   
404  C CB  . LYS A 53  ? 0.31222 0.47615 0.82451 0.02762  -0.11732 -0.03363 53  LYS A CB  
405  C CG  . LYS A 53  ? 0.54584 0.74221 1.04747 0.02822  -0.11115 -0.02984 53  LYS A CG  
406  N N   . TYR A 54  ? 0.26289 0.38623 0.82301 0.04833  -0.11806 -0.01369 54  TYR A N   
407  C CA  . TYR A 54  ? 0.26957 0.38614 0.84170 0.05867  -0.11439 -0.00352 54  TYR A CA  
408  C C   . TYR A 54  ? 0.26905 0.36624 0.85287 0.05170  -0.10758 0.00327  54  TYR A C   
409  O O   . TYR A 54  ? 0.34936 0.45101 0.93146 0.05281  -0.09994 0.01230  54  TYR A O   
410  C CB  . TYR A 54  ? 0.27693 0.37766 0.86231 0.07123  -0.12078 -0.00505 54  TYR A CB  
411  C CG  . TYR A 54  ? 0.29022 0.37434 0.88207 0.08030  -0.11451 0.00458  54  TYR A CG  
412  C CD1 . TYR A 54  ? 0.41328 0.51202 0.99729 0.09400  -0.11189 0.01121  54  TYR A CD1 
413  C CD2 . TYR A 54  ? 0.29639 0.35054 0.90016 0.07517  -0.11058 0.00625  54  TYR A CD2 
414  C CE1 . TYR A 54  ? 0.51006 0.58953 1.09589 0.10301  -0.10485 0.02001  54  TYR A CE1 
415  C CE2 . TYR A 54  ? 0.31120 0.34806 0.91853 0.08174  -0.10322 0.01399  54  TYR A CE2 
416  C CZ  . TYR A 54  ? 0.48480 0.53205 1.08204 0.09589  -0.10002 0.02122  54  TYR A CZ  
417  O OH  . TYR A 54  ? 0.56073 0.58701 1.15776 0.10327  -0.09150 0.02897  54  TYR A OH  
418  N N   . PHE A 55  ? 0.26568 0.34237 0.86079 0.04482  -0.11026 -0.00136 55  PHE A N   
419  C CA  . PHE A 55  ? 0.26513 0.32436 0.87276 0.03841  -0.10410 0.00403  55  PHE A CA  
420  C C   . PHE A 55  ? 0.36678 0.43694 0.95942 0.02682  -0.09636 0.00759  55  PHE A C   
421  O O   . PHE A 55  ? 0.26131 0.32608 0.85904 0.02400  -0.08855 0.01595  55  PHE A O   
422  C CB  . PHE A 55  ? 0.26371 0.30168 0.88803 0.03608  -0.10977 -0.00305 55  PHE A CB  
423  C CG  . PHE A 55  ? 0.27609 0.29575 0.90673 0.04181  -0.11153 -0.00518 55  PHE A CG  
424  C CD1 . PHE A 55  ? 0.38479 0.39520 1.02206 0.04596  -0.10444 0.00249  55  PHE A CD1 
425  C CD2 . PHE A 55  ? 0.27965 0.29198 0.90687 0.04209  -0.11907 -0.01493 55  PHE A CD2 
426  C CE1 . PHE A 55  ? 0.29895 0.29397 0.93978 0.04933  -0.10416 0.00009  55  PHE A CE1 
427  C CE2 . PHE A 55  ? 0.42289 0.42209 1.05541 0.04502  -0.11961 -0.01726 55  PHE A CE2 
428  C CZ  . PHE A 55  ? 0.30057 0.29139 0.94022 0.04845  -0.11179 -0.00985 55  PHE A CZ  
429  N N   . LEU A 56  ? 0.34440 0.42941 0.91679 0.01955  -0.09717 0.00130  56  LEU A N   
430  C CA  . LEU A 56  ? 0.29847 0.39419 0.85347 0.00744  -0.08811 0.00412  56  LEU A CA  
431  C C   . LEU A 56  ? 0.26900 0.38438 0.81895 0.01009  -0.08150 0.01260  56  LEU A C   
432  O O   . LEU A 56  ? 0.25477 0.36897 0.80313 0.00333  -0.07295 0.01981  56  LEU A O   
433  C CB  . LEU A 56  ? 0.25352 0.36135 0.78444 -0.00105 -0.08870 -0.00557 56  LEU A CB  
434  C CG  . LEU A 56  ? 0.32996 0.44156 0.84038 -0.01617 -0.07824 -0.00495 56  LEU A CG  
435  C CD1 . LEU A 56  ? 0.25491 0.33972 0.77368 -0.02059 -0.07548 -0.00178 56  LEU A CD1 
436  C CD2 . LEU A 56  ? 0.25735 0.38012 0.74002 -0.02549 -0.07666 -0.01573 56  LEU A CD2 
437  N N   . HIS A 57  ? 0.25796 0.39145 0.80497 0.02109  -0.08546 0.01195  57  HIS A N   
438  C CA  . HIS A 57  ? 0.26134 0.41488 0.80265 0.02722  -0.08016 0.01976  57  HIS A CA  
439  C C   . HIS A 57  ? 0.30166 0.43395 0.85950 0.03453  -0.07600 0.03069  57  HIS A C   
440  O O   . HIS A 57  ? 0.33732 0.47651 0.89057 0.03321  -0.06818 0.03882  57  HIS A O   
441  C CB  . HIS A 57  ? 0.26556 0.44306 0.79916 0.03961  -0.08602 0.01578  57  HIS A CB  
442  C CG  . HIS A 57  ? 0.46671 0.66726 0.99286 0.04948  -0.08163 0.02317  57  HIS A CG  
443  N ND1 . HIS A 57  ? 0.45610 0.68879 0.96512 0.04218  -0.07587 0.02249  57  HIS A ND1 
444  C CD2 . HIS A 57  ? 0.47279 0.66811 1.00462 0.06675  -0.08153 0.03121  57  HIS A CD2 
445  C CE1 . HIS A 57  ? 0.36712 0.61613 0.87267 0.05563  -0.07362 0.02970  57  HIS A CE1 
446  N NE2 . HIS A 57  ? 0.48900 0.71421 1.00694 0.07132  -0.07675 0.03549  57  HIS A NE2 
447  N N   . GLN A 58  ? 0.31189 0.41798 0.88810 0.04163  -0.08031 0.03047  58  GLN A N   
448  C CA  . GLN A 58  ? 0.38317 0.46524 0.97450 0.04519  -0.07441 0.03921  58  GLN A CA  
449  C C   . GLN A 58  ? 0.27424 0.34643 0.86936 0.03126  -0.06727 0.04283  58  GLN A C   
450  O O   . GLN A 58  ? 0.28441 0.34932 0.88235 0.03150  -0.05920 0.05186  58  GLN A O   
451  C CB  . GLN A 58  ? 0.28610 0.34184 0.89649 0.05177  -0.07918 0.03580  58  GLN A CB  
452  C CG  . GLN A 58  ? 0.38012 0.44011 0.98678 0.06701  -0.08413 0.03442  58  GLN A CG  
453  C CD  . GLN A 58  ? 0.55110 0.61417 1.14889 0.07994  -0.07742 0.04451  58  GLN A CD  
454  O OE1 . GLN A 58  ? 0.47725 0.56601 1.05860 0.08897  -0.07902 0.04551  58  GLN A OE1 
455  N NE2 . GLN A 58  ? 0.66351 0.70027 1.27122 0.08162  -0.06953 0.05149  58  GLN A NE2 
456  N N   . SER A 59  ? 0.26542 0.33666 0.85820 0.01967  -0.06950 0.03612  59  SER A N   
457  C CA  . SER A 59  ? 0.26144 0.32279 0.85569 0.00726  -0.06238 0.03959  59  SER A CA  
458  C C   . SER A 59  ? 0.26053 0.34109 0.83725 0.00117  -0.05361 0.04626  59  SER A C   
459  O O   . SER A 59  ? 0.26205 0.33392 0.84314 -0.00288 -0.04553 0.05450  59  SER A O   
460  C CB  . SER A 59  ? 0.25580 0.31108 0.84637 -0.00165 -0.06622 0.03086  59  SER A CB  
461  O OG  . SER A 59  ? 0.25347 0.30354 0.83776 -0.01351 -0.05824 0.03431  59  SER A OG  
462  N N   . HIS A 60  ? 0.26071 0.36880 0.81741 -0.00009 -0.05478 0.04200  60  HIS A N   
463  C CA  . HIS A 60  ? 0.25800 0.38957 0.79759 -0.00592 -0.04661 0.04667  60  HIS A CA  
464  C C   . HIS A 60  ? 0.28817 0.42225 0.83301 0.00536  -0.04286 0.05702  60  HIS A C   
465  O O   . HIS A 60  ? 0.32623 0.46413 0.86607 -0.00004 -0.03425 0.06448  60  HIS A O   
466  C CB  . HIS A 60  ? 0.30441 0.46816 0.82316 -0.00842 -0.04898 0.03796  60  HIS A CB  
467  C CG  . HIS A 60  ? 0.42966 0.58945 0.93654 -0.02143 -0.04947 0.02816  60  HIS A CG  
468  N ND1 . HIS A 60  ? 0.48803 0.62387 0.99588 -0.03219 -0.04498 0.02903  60  HIS A ND1 
469  C CD2 . HIS A 60  ? 0.47598 0.65128 0.96743 -0.02487 -0.05307 0.01714  60  HIS A CD2 
470  C CE1 . HIS A 60  ? 0.38521 0.51996 0.87702 -0.04068 -0.04559 0.01945  60  HIS A CE1 
471  N NE2 . HIS A 60  ? 0.50533 0.66325 0.98695 -0.03731 -0.05016 0.01189  60  HIS A NE2 
472  N N   . GLU A 61  ? 0.32231 0.45206 0.87542 0.02151  -0.04850 0.05779  61  GLU A N   
473  C CA  . GLU A 61  ? 0.34526 0.47330 0.89931 0.03447  -0.04408 0.06771  61  GLU A CA  
474  C C   . GLU A 61  ? 0.32973 0.42582 0.89853 0.03112  -0.03684 0.07584  61  GLU A C   
475  O O   . GLU A 61  ? 0.36761 0.46477 0.93134 0.03270  -0.02896 0.08485  61  GLU A O   
476  C CB  . GLU A 61  ? 0.40370 0.52971 0.96031 0.05309  -0.05051 0.06658  61  GLU A CB  
477  C CG  . GLU A 61  ? 0.48701 0.64737 1.02877 0.05947  -0.05746 0.05915  61  GLU A CG  
478  C CD  . GLU A 61  ? 0.65775 0.85664 1.18021 0.05931  -0.05333 0.06089  61  GLU A CD  
479  O OE1 . GLU A 61  ? 0.69040 0.89695 1.20670 0.07434  -0.05051 0.06849  61  GLU A OE1 
480  O OE2 . GLU A 61  ? 0.69187 0.91344 1.20380 0.04445  -0.05242 0.05400  61  GLU A OE2 
481  N N   . GLU A 62  ? 0.28641 0.35500 0.87344 0.02658  -0.03917 0.07223  62  GLU A N   
482  C CA  . GLU A 62  ? 0.30783 0.34887 0.90941 0.02156  -0.03169 0.07838  62  GLU A CA  
483  C C   . GLU A 62  ? 0.34395 0.39068 0.93899 0.00675  -0.02443 0.08222  62  GLU A C   
484  O O   . GLU A 62  ? 0.37984 0.41311 0.97926 0.00432  -0.01589 0.09045  62  GLU A O   
485  C CB  . GLU A 62  ? 0.29273 0.30804 0.91604 0.01917  -0.03585 0.07183  62  GLU A CB  
486  C CG  . GLU A 62  ? 0.42068 0.42375 1.05240 0.03255  -0.04065 0.06865  62  GLU A CG  
487  C CD  . GLU A 62  ? 0.57654 0.56552 1.20598 0.04420  -0.03292 0.07756  62  GLU A CD  
488  O OE1 . GLU A 62  ? 0.78235 0.74305 1.42620 0.04312  -0.02686 0.07917  62  GLU A OE1 
489  O OE2 . GLU A 62  ? 0.77622 0.78228 1.38804 0.05514  -0.03245 0.08236  62  GLU A OE2 
490  N N   . ARG A 63  ? 0.27158 0.33579 0.85460 -0.00362 -0.02660 0.07630  63  ARG A N   
491  C CA  . ARG A 63  ? 0.26643 0.33650 0.83883 -0.01778 -0.01824 0.08005  63  ARG A CA  
492  C C   . ARG A 63  ? 0.36378 0.45256 0.92289 -0.01520 -0.01125 0.08837  63  ARG A C   
493  O O   . ARG A 63  ? 0.27274 0.35261 0.83288 -0.02118 -0.00245 0.09645  63  ARG A O   
494  C CB  . ARG A 63  ? 0.36206 0.44605 0.91901 -0.02858 -0.02051 0.07126  63  ARG A CB  
495  C CG  . ARG A 63  ? 0.44054 0.52522 0.98420 -0.04506 -0.01084 0.07368  63  ARG A CG  
496  N N   . GLU A 64  ? 0.27355 0.38954 0.81995 -0.00562 -0.01523 0.08616  64  GLU A N   
497  C CA  . GLU A 64  ? 0.27991 0.41681 0.81375 0.00091  -0.01003 0.09336  64  GLU A CA  
498  C C   . GLU A 64  ? 0.31880 0.42985 0.86323 0.01054  -0.00467 0.10415  64  GLU A C   
499  O O   . GLU A 64  ? 0.31996 0.43541 0.85706 0.00945  0.00330  0.11237  64  GLU A O   
500  C CB  . GLU A 64  ? 0.37558 0.54262 0.89815 0.01453  -0.01696 0.08850  64  GLU A CB  
501  C CG  . GLU A 64  ? 0.50739 0.71404 1.01084 0.00536  -0.01752 0.08015  64  GLU A CG  
502  C CD  . GLU A 64  ? 0.62434 0.85961 1.12004 0.02004  -0.02573 0.07374  64  GLU A CD  
503  O OE1 . GLU A 64  ? 0.62344 0.86393 1.11815 0.01659  -0.03228 0.06347  64  GLU A OE1 
504  O OE2 . GLU A 64  ? 0.58943 0.84129 1.07909 0.03596  -0.02556 0.07895  64  GLU A OE2 
505  N N   . HIS A 65  ? 0.38878 0.47254 0.94894 0.01996  -0.00828 0.10369  65  HIS A N   
506  C CA  . HIS A 65  ? 0.45215 0.50759 1.02033 0.02894  -0.00184 0.11256  65  HIS A CA  
507  C C   . HIS A 65  ? 0.35881 0.39166 0.93750 0.01494  0.00683  0.11755  65  HIS A C   
508  O O   . HIS A 65  ? 0.35681 0.37878 0.93250 0.01740  0.01559  0.12686  65  HIS A O   
509  C CB  . HIS A 65  ? 0.48246 0.51417 1.06386 0.03973  -0.00676 0.10867  65  HIS A CB  
510  C CG  . HIS A 65  ? 0.57683 0.61631 1.14600 0.06008  -0.00908 0.11089  65  HIS A CG  
511  N ND1 . HIS A 65  ? 0.70930 0.72915 1.28551 0.07151  -0.01265 0.10774  65  HIS A ND1 
512  C CD2 . HIS A 65  ? 0.60845 0.67326 1.15775 0.07193  -0.00784 0.11591  65  HIS A CD2 
513  C CE1 . HIS A 65  ? 0.70819 0.73835 1.26819 0.09025  -0.01307 0.11153  65  HIS A CE1 
514  N NE2 . HIS A 65  ? 0.75546 0.81434 1.29928 0.09156  -0.01070 0.11633  65  HIS A NE2 
515  N N   . ALA A 66  ? 0.29942 0.32498 0.88910 0.00104  0.00466  0.11143  66  ALA A N   
516  C CA  . ALA A 66  ? 0.30980 0.31985 0.90687 -0.01319 0.01253  0.11539  66  ALA A CA  
517  C C   . ALA A 66  ? 0.33906 0.36781 0.91836 -0.02028 0.02022  0.12246  66  ALA A C   
518  O O   . ALA A 66  ? 0.29767 0.31214 0.87931 -0.02396 0.02930  0.13082  66  ALA A O   
519  C CB  . ALA A 66  ? 0.28219 0.28833 0.88756 -0.02475 0.00799  0.10690  66  ALA A CB  
520  N N   . GLU A 67  ? 0.32855 0.38969 0.88969 -0.02318 0.01728  0.11843  67  GLU A N   
521  C CA  . GLU A 67  ? 0.34982 0.43186 0.89348 -0.03237 0.02503  0.12319  67  GLU A CA  
522  C C   . GLU A 67  ? 0.33998 0.42846 0.87637 -0.02026 0.02964  0.13240  67  GLU A C   
523  O O   . GLU A 67  ? 0.36589 0.45508 0.89592 -0.02682 0.03850  0.13989  67  GLU A O   
524  C CB  . GLU A 67  ? 0.27463 0.39104 0.79988 -0.03907 0.02161  0.11452  67  GLU A CB  
525  C CG  . GLU A 67  ? 0.30046 0.40737 0.82699 -0.05230 0.01968  0.10642  67  GLU A CG  
526  C CD  . GLU A 67  ? 0.31263 0.44957 0.81841 -0.05998 0.01810  0.09700  67  GLU A CD  
527  O OE1 . GLU A 67  ? 0.48644 0.65550 0.97825 -0.05676 0.01879  0.09627  67  GLU A OE1 
528  O OE2 . GLU A 67  ? 0.39622 0.52498 0.89851 -0.06902 0.01663  0.08969  67  GLU A OE2 
529  N N   . LYS A 68  ? 0.34071 0.43262 0.87638 -0.00165 0.02410  0.13218  68  LYS A N   
530  C CA  . LYS A 68  ? 0.32128 0.41422 0.84801 0.01329  0.02874  0.14137  68  LYS A CA  
531  C C   . LYS A 68  ? 0.33813 0.39071 0.87660 0.01276  0.03750  0.15023  68  LYS A C   
532  O O   . LYS A 68  ? 0.34612 0.39720 0.87536 0.01579  0.04543  0.15927  68  LYS A O   
533  C CB  . LYS A 68  ? 0.33264 0.43390 0.85437 0.03470  0.02134  0.13900  68  LYS A CB  
534  C CG  . LYS A 68  ? 0.42383 0.52782 0.93131 0.05420  0.02560  0.14807  68  LYS A CG  
535  C CD  . LYS A 68  ? 0.48513 0.60546 0.98309 0.07586  0.01775  0.14472  68  LYS A CD  
536  N N   . LEU A 69  ? 0.33150 0.35205 0.89008 0.00844  0.03659  0.14706  69  LEU A N   
537  C CA  . LEU A 69  ? 0.41845 0.40165 0.98918 0.00554  0.04584  0.15365  69  LEU A CA  
538  C C   . LEU A 69  ? 0.49077 0.47334 1.06200 -0.01222 0.05365  0.15811  69  LEU A C   
539  O O   . LEU A 69  ? 0.34206 0.30536 0.91342 -0.01318 0.06332  0.16663  69  LEU A O   
540  C CB  . LEU A 69  ? 0.34283 0.29701 0.93581 0.00419  0.04288  0.14696  69  LEU A CB  
541  C CG  . LEU A 69  ? 0.39662 0.33823 0.98998 0.02177  0.03940  0.14477  69  LEU A CG  
542  C CD1 . LEU A 69  ? 0.48329 0.40547 1.09871 0.01687  0.03485  0.13532  69  LEU A CD1 
543  C CD2 . LEU A 69  ? 0.38522 0.30110 0.97080 0.03352  0.04970  0.15401  69  LEU A CD2 
544  N N   . MET A 70  ? 0.36589 0.36718 0.93554 -0.02638 0.05048  0.15249  70  MET A N   
545  C CA  . MET A 70  ? 0.32743 0.32995 0.89051 -0.04206 0.05819  0.15590  70  MET A CA  
546  C C   . MET A 70  ? 0.40909 0.43342 0.95458 -0.04146 0.06475  0.16446  70  MET A C   
547  O O   . MET A 70  ? 0.44240 0.45623 0.98077 -0.04675 0.07314  0.17042  70  MET A O   
548  C CB  . MET A 70  ? 0.36307 0.37897 0.91082 -0.05155 0.05247  0.14408  70  MET A CB  
549  C CG  . MET A 70  ? 0.29405 0.29385 0.84869 -0.04751 0.04425  0.13271  70  MET A CG  
550  S SD  . MET A 70  ? 0.75717 0.76736 1.29226 -0.05678 0.03902  0.12127  70  MET A SD  
551  C CE  . MET A 70  ? 0.35508 0.35511 0.85536 -0.06277 0.04605  0.11856  70  MET A CE  
552  N N   . LYS A 71  ? 0.31213 0.36921 0.84209 -0.03157 0.05913  0.16143  71  LYS A N   
553  C CA  . LYS A 71  ? 0.31825 0.40167 0.82880 -0.02674 0.06352  0.16723  71  LYS A CA  
554  C C   . LYS A 71  ? 0.34062 0.39966 0.85161 -0.01364 0.06990  0.17792  71  LYS A C   
555  O O   . LYS A 71  ? 0.34180 0.40369 0.84327 -0.01691 0.07813  0.18577  71  LYS A O   
556  C CB  . LYS A 71  ? 0.31799 0.44058 0.81465 -0.01490 0.05502  0.16050  71  LYS A CB  
557  C CG  . LYS A 71  ? 0.41350 0.56962 0.89014 -0.00714 0.05808  0.16468  71  LYS A CG  
558  C CD  . LYS A 71  ? 0.35424 0.55303 0.81843 0.00399  0.04929  0.15620  71  LYS A CD  
559  C CE  . LYS A 71  ? 0.41913 0.65787 0.86334 0.01077  0.05227  0.15876  71  LYS A CE  
560  N NZ  . LYS A 71  ? 0.62156 0.91205 1.05306 0.00201  0.04851  0.14666  71  LYS A NZ  
561  N N   . LEU A 72  ? 0.40681 0.43953 0.92742 0.00080  0.06710  0.17808  72  LEU A N   
562  C CA  . LEU A 72  ? 0.37270 0.37681 0.89064 0.01405  0.07454  0.18751  72  LEU A CA  
563  C C   . LEU A 72  ? 0.46135 0.43325 0.99045 -0.00035 0.08508  0.19352  72  LEU A C   
564  O O   . LEU A 72  ? 0.38506 0.34946 0.90398 0.00203  0.09387  0.20279  72  LEU A O   
565  C CB  . LEU A 72  ? 0.38775 0.36745 0.91270 0.03000  0.07067  0.18474  72  LEU A CB  
566  C CG  . LEU A 72  ? 0.41401 0.35235 0.93778 0.04020  0.08072  0.19299  72  LEU A CG  
567  C CD1 . LEU A 72  ? 0.43309 0.38531 0.93119 0.05913  0.08375  0.20119  72  LEU A CD1 
568  C CD2 . LEU A 72  ? 0.51171 0.42148 1.04659 0.04865  0.07835  0.18774  72  LEU A CD2 
569  N N   . GLN A 73  ? 0.36500 0.31803 0.91480 -0.01461 0.08429  0.18806  73  GLN A N   
570  C CA  . GLN A 73  ? 0.42246 0.36584 0.95748 -0.02145 0.08744  0.17842  73  GLN A CA  
571  C C   . GLN A 73  ? 0.41904 0.37756 0.93697 -0.02950 0.09288  0.18441  73  GLN A C   
572  O O   . GLN A 73  ? 0.44177 0.38886 0.94751 -0.02715 0.09970  0.18768  73  GLN A O   
573  C CB  . GLN A 73  ? 0.44282 0.38809 0.97673 -0.02834 0.07937  0.16163  73  GLN A CB  
574  C CG  . GLN A 73  ? 0.52481 0.46125 1.04125 -0.03281 0.08120  0.15178  73  GLN A CG  
575  C CD  . GLN A 73  ? 0.52406 0.44104 1.04531 -0.02732 0.08417  0.14650  73  GLN A CD  
576  O OE1 . GLN A 73  ? 0.38236 0.28645 0.89891 -0.02275 0.09165  0.15252  73  GLN A OE1 
577  N NE2 . GLN A 73  ? 0.44957 0.36443 0.97813 -0.02827 0.07902  0.13519  73  GLN A NE2 
578  N N   . ASN A 74  ? 0.34384 0.33030 0.85844 -0.03949 0.09040  0.18497  74  ASN A N   
579  C CA  . ASN A 74  ? 0.40117 0.40532 0.89418 -0.04855 0.09532  0.18739  74  ASN A CA  
580  C C   . ASN A 74  ? 0.46083 0.47479 0.95848 -0.04259 0.10526  0.20587  74  ASN A C   
581  O O   . ASN A 74  ? 0.48882 0.49973 0.96824 -0.04485 0.11067  0.20775  74  ASN A O   
582  C CB  . ASN A 74  ? 0.32641 0.36183 0.80990 -0.06066 0.09141  0.18097  74  ASN A CB  
583  C CG  . ASN A 74  ? 0.37659 0.39850 0.83718 -0.06832 0.08596  0.16477  74  ASN A CG  
584  O OD1 . ASN A 74  ? 0.41760 0.41636 0.86706 -0.06651 0.08610  0.15912  74  ASN A OD1 
585  N ND2 . ASN A 74  ? 0.31669 0.35559 0.76966 -0.07654 0.08195  0.15732  74  ASN A ND2 
586  N N   . GLN A 75  ? 0.42806 0.45844 0.92149 -0.02458 0.09979  0.20636  75  GLN A N   
587  C CA  . GLN A 75  ? 0.37534 0.41972 0.84923 -0.00928 0.10323  0.21387  75  GLN A CA  
588  C C   . GLN A 75  ? 0.39841 0.39953 0.87377 0.00148  0.11161  0.22377  75  GLN A C   
589  O O   . GLN A 75  ? 0.42246 0.42813 0.88113 0.01035  0.11745  0.23192  75  GLN A O   
590  C CB  . GLN A 75  ? 0.50310 0.58238 0.96332 0.01045  0.09373  0.20888  75  GLN A CB  
591  C CG  . GLN A 75  ? 0.60028 0.66228 1.06966 0.02453  0.08629  0.20418  75  GLN A CG  
592  C CD  . GLN A 75  ? 0.58119 0.68555 1.03909 0.03752  0.07585  0.19659  75  GLN A CD  
593  O OE1 . GLN A 75  ? 0.48747 0.58636 0.95303 0.04498  0.06820  0.19032  75  GLN A OE1 
594  N NE2 . GLN A 75  ? 0.66243 0.81094 1.10196 0.04012  0.07565  0.19646  75  GLN A NE2 
595  N N   . ARG A 76  ? 0.38505 0.44590 0.87779 0.00542  0.24157  0.11833  76  ARG A N   
596  C CA  . ARG A 76  ? 0.45428 0.51132 0.95668 0.00462  0.25417  0.12807  76  ARG A CA  
597  C C   . ARG A 76  ? 0.48835 0.54981 1.00951 0.00194  0.27124  0.12799  76  ARG A C   
598  O O   . ARG A 76  ? 0.41272 0.47184 0.94710 0.00009  0.28303  0.13575  76  ARG A O   
599  C CB  . ARG A 76  ? 0.46664 0.51523 0.99214 0.00260  0.24538  0.13560  76  ARG A CB  
600  C CG  . ARG A 76  ? 0.44949 0.49081 0.95451 0.00599  0.23220  0.13807  76  ARG A CG  
601  C CD  . ARG A 76  ? 0.41893 0.45738 0.89156 0.01077  0.24038  0.14293  76  ARG A CD  
602  N NE  . ARG A 76  ? 0.45407 0.48644 0.93486 0.00868  0.25662  0.15252  76  ARG A NE  
603  C CZ  . ARG A 76  ? 0.49082 0.51095 0.98452 0.00636  0.25685  0.16152  76  ARG A CZ  
604  N NH1 . ARG A 76  ? 0.43880 0.45155 0.93936 0.00613  0.24109  0.16184  76  ARG A NH1 
605  N NH2 . ARG A 76  ? 0.46210 0.47682 0.96175 0.00362  0.27352  0.16984  76  ARG A NH2 
606  N N   . GLY A 77  ? 0.39520 0.46219 0.91704 0.00165  0.27358  0.11929  77  GLY A N   
607  C CA  . GLY A 77  ? 0.40403 0.47045 0.93364 0.00116  0.28448  0.11645  77  GLY A CA  
608  C C   . GLY A 77  ? 0.48071 0.54332 1.04313 0.00019  0.27989  0.11869  77  GLY A C   
609  O O   . GLY A 77  ? 0.49321 0.55493 1.06309 0.00044  0.28894  0.11770  77  GLY A O   
610  N N   . GLY A 78  ? 0.41353 0.47502 0.99595 -0.00082 0.26618  0.12150  78  GLY A N   
611  C CA  . GLY A 78  ? 0.44001 0.50084 1.05347 -0.00107 0.25937  0.12122  78  GLY A CA  
612  C C   . GLY A 78  ? 0.49445 0.55660 1.11231 0.00135  0.25608  0.11342  78  GLY A C   
613  O O   . GLY A 78  ? 0.44357 0.50611 1.04082 0.00214  0.25751  0.10761  78  GLY A O   
614  N N   . ARG A 79  ? 0.37667 0.43960 1.02247 0.00252  0.25222  0.11329  79  ARG A N   
615  C CA  . ARG A 79  ? 0.40442 0.46737 1.05973 0.00577  0.24895  0.10766  79  ARG A CA  
616  C C   . ARG A 79  ? 0.35806 0.42262 1.03687 0.00630  0.23180  0.10894  79  ARG A C   
617  O O   . ARG A 79  ? 0.35799 0.42528 1.05940 0.00500  0.22587  0.11310  79  ARG A O   
618  C CB  . ARG A 79  ? 0.38318 0.44704 1.05166 0.00821  0.26011  0.10622  79  ARG A CB  
619  C CG  . ARG A 79  ? 0.39670 0.45839 1.03949 0.00812  0.27655  0.10293  79  ARG A CG  
620  C CD  . ARG A 79  ? 0.52365 0.58190 1.14204 0.00870  0.27726  0.09594  79  ARG A CD  
621  N NE  . ARG A 79  ? 0.53204 0.58999 1.11872 0.00684  0.28893  0.09298  79  ARG A NE  
622  C CZ  . ARG A 79  ? 0.57949 0.63896 1.14087 0.00468  0.28683  0.09127  79  ARG A CZ  
623  N NH1 . ARG A 79  ? 0.42930 0.48987 0.99284 0.00384  0.27383  0.09223  79  ARG A NH1 
624  N NH2 . ARG A 79  ? 0.63686 0.69797 1.17072 0.00351  0.29770  0.08820  79  ARG A NH2 
625  N N   . ILE A 80  ? 0.43183 0.49487 1.10437 0.00767  0.22395  0.10496  80  ILE A N   
626  C CA  . ILE A 80  ? 0.41437 0.47900 1.10661 0.00850  0.20691  0.10581  80  ILE A CA  
627  C C   . ILE A 80  ? 0.51449 0.58181 1.23529 0.01289  0.20478  0.10557  80  ILE A C   
628  O O   . ILE A 80  ? 0.38287 0.44821 1.10289 0.01673  0.21406  0.10228  80  ILE A O   
629  C CB  . ILE A 80  ? 0.38139 0.44144 1.05332 0.00899  0.19914  0.10098  80  ILE A CB  
630  C CG1 . ILE A 80  ? 0.34639 0.40322 0.98393 0.00569  0.19853  0.09965  80  ILE A CG1 
631  C CG2 . ILE A 80  ? 0.45969 0.51778 1.14480 0.01096  0.17946  0.10108  80  ILE A CG2 
632  C CD1 . ILE A 80  ? 0.32884 0.37877 0.93534 0.00598  0.19328  0.09199  80  ILE A CD1 
633  N N   . PHE A 81  ? 0.42916 0.50116 1.17520 0.01257  0.19218  0.10857  81  PHE A N   
634  C CA  . PHE A 81  ? 0.47540 0.55214 1.24912 0.01747  0.18674  0.10798  81  PHE A CA  
635  C C   . PHE A 81  ? 0.32427 0.40355 1.11165 0.01839  0.16661  0.10832  81  PHE A C   
636  O O   . PHE A 81  ? 0.33044 0.41216 1.12504 0.01393  0.15694  0.11060  81  PHE A O   
637  C CB  . PHE A 81  ? 0.34529 0.42836 1.13953 0.01641  0.19341  0.11012  81  PHE A CB  
638  C CG  . PHE A 81  ? 0.35747 0.43884 1.14297 0.01803  0.21231  0.10869  81  PHE A CG  
639  C CD1 . PHE A 81  ? 0.42902 0.50907 1.21767 0.02430  0.21789  0.10541  81  PHE A CD1 
640  C CD2 . PHE A 81  ? 0.36628 0.44625 1.13845 0.01369  0.22477  0.11052  81  PHE A CD2 
641  C CE1 . PHE A 81  ? 0.40925 0.48703 1.18909 0.02567  0.23545  0.10338  81  PHE A CE1 
642  C CE2 . PHE A 81  ? 0.45942 0.53791 1.22205 0.01515  0.24182  0.10868  81  PHE A CE2 
643  C CZ  . PHE A 81  ? 0.38247 0.45992 1.14905 0.02089  0.24705  0.10477  81  PHE A CZ  
644  N N   . LEU A 82  ? 0.32076 0.39818 1.10981 0.02444  0.16057  0.10586  82  LEU A N   
645  C CA  . LEU A 82  ? 0.31227 0.39048 1.10869 0.02662  0.14098  0.10563  82  LEU A CA  
646  C C   . LEU A 82  ? 0.32994 0.41558 1.15481 0.03074  0.13024  0.10638  82  LEU A C   
647  O O   . LEU A 82  ? 0.32556 0.41507 1.16391 0.03447  0.13831  0.10627  82  LEU A O   
648  C CB  . LEU A 82  ? 0.31649 0.37912 1.08048 0.03046  0.13671  0.10154  82  LEU A CB  
649  C CG  . LEU A 82  ? 0.38181 0.43453 1.10713 0.02519  0.14495  0.09865  82  LEU A CG  
650  C CD1 . LEU A 82  ? 0.32535 0.36421 1.02232 0.02795  0.14863  0.09364  82  LEU A CD1 
651  C CD2 . LEU A 82  ? 0.38269 0.43379 1.09364 0.01986  0.13181  0.09901  82  LEU A CD2 
652  N N   . GLN A 83  ? 0.31083 0.39911 1.14366 0.02995  0.11144  0.10659  83  GLN A N   
653  C CA  . GLN A 83  ? 0.37184 0.46850 1.22891 0.03318  0.09844  0.10639  83  GLN A CA  
654  C C   . GLN A 83  ? 0.34268 0.43475 1.19317 0.03871  0.07985  0.10507  83  GLN A C   
655  O O   . GLN A 83  ? 0.30679 0.38890 1.13478 0.03892  0.07667  0.10430  83  GLN A O   
656  C CB  . GLN A 83  ? 0.31570 0.42110 1.19076 0.02533  0.09364  0.10728  83  GLN A CB  
657  C CG  . GLN A 83  ? 0.35595 0.46266 1.23246 0.01975  0.11187  0.10903  83  GLN A CG  
658  C CD  . GLN A 83  ? 0.47536 0.58830 1.36566 0.02414  0.12470  0.10861  83  GLN A CD  
659  O OE1 . GLN A 83  ? 0.51578 0.63421 1.41934 0.03139  0.11898  0.10712  83  GLN A OE1 
660  N NE2 . GLN A 83  ? 0.53129 0.64326 1.41721 0.02028  0.14201  0.10990  83  GLN A NE2 
661  N N   . ASP A 84  ? 0.31908 0.41825 1.18704 0.04358  0.06774  0.10446  84  ASP A N   
662  C CA  . ASP A 84  ? 0.32013 0.41496 1.18074 0.04883  0.04837  0.10340  84  ASP A CA  
663  C C   . ASP A 84  ? 0.44456 0.53652 1.29552 0.04203  0.03635  0.10273  84  ASP A C   
664  O O   . ASP A 84  ? 0.30622 0.40477 1.16795 0.03353  0.03649  0.10288  84  ASP A O   
665  C CB  . ASP A 84  ? 0.43124 0.53847 1.31449 0.05342  0.03605  0.10251  84  ASP A CB  
666  C CG  . ASP A 84  ? 0.40551 0.51517 1.29670 0.06260  0.04528  0.10297  84  ASP A CG  
667  O OD1 . ASP A 84  ? 0.34154 0.44356 1.22321 0.06393  0.06300  0.10378  84  ASP A OD1 
668  O OD2 . ASP A 84  ? 0.51272 0.63208 1.41890 0.06906  0.03453  0.10214  84  ASP A OD2 
669  N N   . ILE A 85  ? 0.30966 0.38978 1.13832 0.04600  0.02655  0.10190  85  ILE A N   
670  C CA  . ILE A 85  ? 0.30447 0.38093 1.12113 0.04090  0.01159  0.10037  85  ILE A CA  
671  C C   . ILE A 85  ? 0.31030 0.39390 1.14104 0.04424  -0.00796 0.09916  85  ILE A C   
672  O O   . ILE A 85  ? 0.31904 0.39636 1.13950 0.05249  -0.01626 0.09903  85  ILE A O   
673  C CB  . ILE A 85  ? 0.33035 0.38677 1.10251 0.04025  0.01105  0.09836  85  ILE A CB  
674  C CG1 . ILE A 85  ? 0.31434 0.36360 1.06796 0.03764  0.03182  0.09827  85  ILE A CG1 
675  C CG2 . ILE A 85  ? 0.30303 0.35558 1.05950 0.03351  -0.00166 0.09617  85  ILE A CG2 
676  C CD1 . ILE A 85  ? 0.41507 0.44644 1.12558 0.03648  0.03347  0.09514  85  ILE A CD1 
677  N N   . GLN A 86  ? 0.30865 0.40401 1.15993 0.03740  -0.01461 0.09793  86  GLN A N   
678  C CA  . GLN A 86  ? 0.31585 0.41937 1.17928 0.03934  -0.03320 0.09547  86  GLN A CA  
679  C C   . GLN A 86  ? 0.31669 0.40950 1.15658 0.04209  -0.04992 0.09394  86  GLN A C   
680  O O   . GLN A 86  ? 0.31785 0.40090 1.13931 0.03818  -0.05005 0.09368  86  GLN A O   
681  C CB  . GLN A 86  ? 0.31477 0.43036 1.20190 0.02988  -0.03675 0.09336  86  GLN A CB  
682  C CG  . GLN A 86  ? 0.31649 0.44224 1.22663 0.02615  -0.02029 0.09461  86  GLN A CG  
683  C CD  . GLN A 86  ? 0.39720 0.53207 1.32076 0.03488  -0.01628 0.09498  86  GLN A CD  
684  O OE1 . GLN A 86  ? 0.37456 0.51629 1.30410 0.04149  -0.03037 0.09302  86  GLN A OE1 
685  N NE2 . GLN A 86  ? 0.40707 0.54209 1.33429 0.03560  0.00306  0.09739  86  GLN A NE2 
686  N N   . LYS A 87  ? 0.32729 0.42206 1.16666 0.04944  -0.06384 0.09292  87  LYS A N   
687  C CA  . LYS A 87  ? 0.33088 0.41609 1.14825 0.05175  -0.08088 0.09126  87  LYS A CA  
688  C C   . LYS A 87  ? 0.32629 0.41746 1.15130 0.04271  -0.09312 0.08749  87  LYS A C   
689  O O   . LYS A 87  ? 0.32572 0.43040 1.17657 0.03690  -0.09263 0.08577  87  LYS A O   
690  C CB  . LYS A 87  ? 0.34614 0.43277 1.16133 0.06242  -0.09300 0.09141  87  LYS A CB  
691  C CG  . LYS A 87  ? 0.35243 0.45906 1.19579 0.06228  -0.10385 0.08854  87  LYS A CG  
692  C CD  . LYS A 87  ? 0.42004 0.52839 1.25847 0.07460  -0.11663 0.08893  87  LYS A CD  
693  C CE  . LYS A 87  ? 0.37543 0.50355 1.23670 0.07348  -0.13182 0.08450  87  LYS A CE  
694  N NZ  . LYS A 87  ? 0.39327 0.52466 1.24903 0.08663  -0.14528 0.08494  87  LYS A NZ  
695  N N   . PRO A 88  ? 0.43174 0.51223 1.23423 0.04136  -0.10401 0.08573  88  PRO A N   
696  C CA  . PRO A 88  ? 0.32235 0.40696 1.13097 0.03298  -0.11573 0.08155  88  PRO A CA  
697  C C   . PRO A 88  ? 0.33398 0.43211 1.16193 0.03358  -0.13026 0.07798  88  PRO A C   
698  O O   . PRO A 88  ? 0.34282 0.44576 1.17301 0.04223  -0.13558 0.07867  88  PRO A O   
699  C CB  . PRO A 88  ? 0.32190 0.39177 1.09915 0.03416  -0.12537 0.08019  88  PRO A CB  
700  C CG  . PRO A 88  ? 0.32243 0.37822 1.07461 0.04050  -0.11268 0.08395  88  PRO A CG  
701  C CD  . PRO A 88  ? 0.32811 0.39130 1.09786 0.04756  -0.10623 0.08701  88  PRO A CD  
702  N N   . ASP A 89  ? 0.35687 0.46102 1.19863 0.02448  -0.13627 0.07389  89  ASP A N   
703  C CA  . ASP A 89  ? 0.40798 0.52603 1.26929 0.02306  -0.14974 0.06900  89  ASP A CA  
704  C C   . ASP A 89  ? 0.35166 0.46682 1.19540 0.02826  -0.17001 0.06564  89  ASP A C   
705  O O   . ASP A 89  ? 0.36218 0.49014 1.21950 0.02971  -0.18213 0.06166  89  ASP A O   
706  C CB  . ASP A 89  ? 0.49918 0.62070 1.37664 0.01094  -0.14931 0.06511  89  ASP A CB  
707  C CG  . ASP A 89  ? 0.59222 0.71593 1.48618 0.00524  -0.12935 0.06854  89  ASP A CG  
708  O OD1 . ASP A 89  ? 0.79842 0.92541 1.69698 0.01072  -0.11701 0.07287  89  ASP A OD1 
709  O OD2 . ASP A 89  ? 0.53633 0.65733 1.43701 -0.00434 -0.12561 0.06698  89  ASP A OD2 
710  N N   . GLU A 90  ? 0.34968 0.44918 1.16357 0.03052  -0.17423 0.06653  90  GLU A N   
711  C CA  . GLU A 90  ? 0.46126 0.55659 1.25573 0.03555  -0.19282 0.06362  90  GLU A CA  
712  C C   . GLU A 90  ? 0.36384 0.44516 1.13051 0.04525  -0.19034 0.06852  90  GLU A C   
713  O O   . GLU A 90  ? 0.40399 0.47528 1.16040 0.04493  -0.17611 0.07230  90  GLU A O   
714  C CB  . GLU A 90  ? 0.35966 0.44761 1.14143 0.02775  -0.20320 0.05831  90  GLU A CB  
715  C CG  . GLU A 90  ? 0.36002 0.45813 1.16638 0.01764  -0.20589 0.05291  90  GLU A CG  
716  C CD  . GLU A 90  ? 0.44449 0.55995 1.27115 0.01954  -0.21773 0.04858  90  GLU A CD  
717  O OE1 . GLU A 90  ? 0.41426 0.53256 1.23092 0.02874  -0.22896 0.04861  90  GLU A OE1 
718  O OE2 . GLU A 90  ? 0.47704 0.60382 1.32980 0.01191  -0.21550 0.04502  90  GLU A OE2 
719  N N   . ASP A 91  ? 0.37872 0.45891 1.13275 0.05404  -0.20375 0.06841  91  ASP A N   
720  C CA  . ASP A 91  ? 0.46075 0.52336 1.18267 0.06258  -0.20461 0.07237  91  ASP A CA  
721  C C   . ASP A 91  ? 0.39182 0.44381 1.08731 0.06114  -0.21949 0.06888  91  ASP A C   
722  O O   . ASP A 91  ? 0.41448 0.44900 1.08146 0.06394  -0.21735 0.07130  91  ASP A O   
723  C CB  . ASP A 91  ? 0.50838 0.57326 1.22957 0.07543  -0.20828 0.07605  91  ASP A CB  
724  C CG  . ASP A 91  ? 0.48394 0.56543 1.23668 0.07753  -0.19864 0.07750  91  ASP A CG  
725  O OD1 . ASP A 91  ? 0.55212 0.63171 1.31283 0.07545  -0.18086 0.08053  91  ASP A OD1 
726  O OD2 . ASP A 91  ? 0.60382 0.70126 1.37330 0.08160  -0.20915 0.07522  91  ASP A OD2 
727  N N   . ASP A 92  ? 0.40718 0.46912 1.11119 0.05702  -0.23430 0.06289  92  ASP A N   
728  C CA  . ASP A 92  ? 0.51812 0.57185 1.19956 0.05438  -0.24872 0.05819  92  ASP A CA  
729  C C   . ASP A 92  ? 0.39032 0.44666 1.08242 0.04203  -0.24686 0.05283  92  ASP A C   
730  O O   . ASP A 92  ? 0.38858 0.45847 1.10777 0.03607  -0.24747 0.04931  92  ASP A O   
731  C CB  . ASP A 92  ? 0.48277 0.54509 1.16402 0.05969  -0.26717 0.05484  92  ASP A CB  
732  C CG  . ASP A 92  ? 0.55830 0.61102 1.21259 0.05816  -0.28243 0.05003  92  ASP A CG  
733  O OD1 . ASP A 92  ? 0.52140 0.56708 1.16767 0.04959  -0.28123 0.04624  92  ASP A OD1 
734  O OD2 . ASP A 92  ? 0.59493 0.64754 1.23568 0.06615  -0.29580 0.04995  92  ASP A OD2 
735  N N   . TRP A 93  ? 0.38295 0.42604 1.05404 0.03855  -0.24387 0.05230  93  TRP A N   
736  C CA  . TRP A 93  ? 0.37220 0.41589 1.05166 0.02823  -0.24062 0.04811  93  TRP A CA  
737  C C   . TRP A 93  ? 0.38091 0.42172 1.04857 0.02385  -0.25676 0.04039  93  TRP A C   
738  O O   . TRP A 93  ? 0.37498 0.41400 1.04704 0.01566  -0.25535 0.03631  93  TRP A O   
739  C CB  . TRP A 93  ? 0.36119 0.39224 1.02166 0.02620  -0.22441 0.05106  93  TRP A CB  
740  C CG  . TRP A 93  ? 0.35276 0.38708 1.02691 0.02833  -0.20677 0.05733  93  TRP A CG  
741  C CD1 . TRP A 93  ? 0.35536 0.38167 1.01333 0.03502  -0.19740 0.06231  93  TRP A CD1 
742  C CD2 . TRP A 93  ? 0.39505 0.44077 1.10154 0.02347  -0.19572 0.05902  93  TRP A CD2 
743  N NE1 . TRP A 93  ? 0.34655 0.37895 1.02450 0.03495  -0.18145 0.06660  93  TRP A NE1 
744  C CE2 . TRP A 93  ? 0.40712 0.45182 1.11476 0.02799  -0.18001 0.06490  93  TRP A CE2 
745  C CE3 . TRP A 93  ? 0.44101 0.49624 1.17417 0.01520  -0.19669 0.05598  93  TRP A CE3 
746  C CZ2 . TRP A 93  ? 0.32913 0.38337 1.06394 0.02500  -0.16570 0.06790  93  TRP A CZ2 
747  C CZ3 . TRP A 93  ? 0.41067 0.47372 1.16879 0.01160  -0.18151 0.05929  93  TRP A CZ3 
748  C CH2 . TRP A 93  ? 0.32493 0.38872 1.08505 0.01696  -0.16671 0.06536  93  TRP A CH2 
749  N N   . GLU A 94  ? 0.39631 0.43516 1.04699 0.02964  -0.27143 0.03851  94  GLU A N   
750  C CA  . GLU A 94  ? 0.40905 0.44843 1.05187 0.02657  -0.28817 0.03060  94  GLU A CA  
751  C C   . GLU A 94  ? 0.52401 0.54988 1.13976 0.02291  -0.29245 0.02618  94  GLU A C   
752  O O   . GLU A 94  ? 0.51274 0.53332 1.10607 0.02535  -0.30604 0.02220  94  GLU A O   
753  C CB  . GLU A 94  ? 0.50751 0.55989 1.18121 0.01862  -0.28984 0.02525  94  GLU A CB  
754  N N   . SER A 95  ? 0.47158 0.49242 1.08844 0.01754  -0.28120 0.02661  95  SER A N   
755  C CA  . SER A 95  ? 0.39736 0.40492 0.98559 0.01325  -0.28278 0.02081  95  SER A CA  
756  C C   . SER A 95  ? 0.38564 0.38397 0.96240 0.00987  -0.26360 0.02313  95  SER A C   
757  O O   . SER A 95  ? 0.37480 0.37809 0.97137 0.00854  -0.25023 0.02805  95  SER A O   
758  C CB  . SER A 95  ? 0.40349 0.41568 1.00609 0.00646  -0.29571 0.01232  95  SER A CB  
759  O OG  . SER A 95  ? 0.48269 0.49734 1.10873 -0.00112 -0.28607 0.01179  95  SER A OG  
760  N N   . GLY A 96  ? 0.38883 0.37468 0.93298 0.00881  -0.26258 0.01915  96  GLY A N   
761  C CA  . GLY A 96  ? 0.37924 0.35822 0.91261 0.00577  -0.24672 0.01976  96  GLY A CA  
762  C C   . GLY A 96  ? 0.41411 0.39655 0.97379 -0.00026 -0.24231 0.01893  96  GLY A C   
763  O O   . GLY A 96  ? 0.37587 0.35963 0.94589 -0.00145 -0.22721 0.02390  96  GLY A O   
764  N N   . LEU A 97  ? 0.45382 0.43732 1.02486 -0.00447 -0.25529 0.01260  97  LEU A N   
765  C CA  . LEU A 97  ? 0.46875 0.45267 1.06346 -0.01136 -0.25154 0.01107  97  LEU A CA  
766  C C   . LEU A 97  ? 0.37315 0.36961 1.00433 -0.01345 -0.24456 0.01679  97  LEU A C   
767  O O   . LEU A 97  ? 0.38100 0.37551 1.02402 -0.01718 -0.23096 0.02015  97  LEU A O   
768  C CB  . LEU A 97  ? 0.39345 0.37604 0.99329 -0.01604 -0.26784 0.00214  97  LEU A CB  
769  C CG  . LEU A 97  ? 0.45514 0.43713 1.08150 -0.02466 -0.26621 -0.00075 97  LEU A CG  
770  C CD1 . LEU A 97  ? 0.39627 0.36302 1.00792 -0.02621 -0.25273 0.00011  97  LEU A CD1 
771  C CD2 . LEU A 97  ? 0.41114 0.39467 1.04487 -0.02951 -0.28468 -0.01060 97  LEU A CD2 
772  N N   . ASN A 98  ? 0.37458 0.38438 1.02440 -0.01086 -0.25399 0.01772  98  ASN A N   
773  C CA  . ASN A 98  ? 0.36778 0.39189 1.05433 -0.01244 -0.24753 0.02243  98  ASN A CA  
774  C C   . ASN A 98  ? 0.35654 0.37863 1.03895 -0.00906 -0.22838 0.03068  98  ASN A C   
775  O O   . ASN A 98  ? 0.35021 0.37718 1.05560 -0.01295 -0.21611 0.03434  98  ASN A O   
776  C CB  . ASN A 98  ? 0.37547 0.41212 1.07393 -0.00796 -0.25881 0.02189  98  ASN A CB  
777  C CG  . ASN A 98  ? 0.43758 0.48783 1.16985 -0.00999 -0.25034 0.02505  98  ASN A CG  
778  O OD1 . ASN A 98  ? 0.45395 0.50730 1.20729 -0.01807 -0.24701 0.02223  98  ASN A OD1 
779  N ND2 . ASN A 98  ? 0.37090 0.42846 1.10752 -0.00269 -0.24624 0.03069  98  ASN A ND2 
780  N N   . ALA A 99  ? 0.35527 0.36996 1.00795 -0.00238 -0.22506 0.03334  99  ALA A N   
781  C CA  . ALA A 99  ? 0.34586 0.35757 0.99114 0.00010  -0.20661 0.03988  99  ALA A CA  
782  C C   . ALA A 99  ? 0.36079 0.36442 0.99939 -0.00484 -0.19336 0.04017  99  ALA A C   
783  O O   . ALA A 99  ? 0.37561 0.38239 1.02854 -0.00635 -0.17875 0.04519  99  ALA A O   
784  C CB  . ALA A 99  ? 0.34824 0.35216 0.96084 0.00668  -0.20628 0.04112  99  ALA A CB  
785  N N   . MET A 100 ? 0.34624 0.33930 0.96286 -0.00677 -0.19818 0.03488  100 MET A N   
786  C CA  . MET A 100 ? 0.34455 0.32939 0.95506 -0.01008 -0.18679 0.03534  100 MET A CA  
787  C C   . MET A 100 ? 0.41819 0.40675 1.06178 -0.01655 -0.18239 0.03712  100 MET A C   
788  O O   . MET A 100 ? 0.34197 0.32768 0.98923 -0.01809 -0.16736 0.04180  100 MET A O   
789  C CB  . MET A 100 ? 0.41280 0.38627 0.99758 -0.01035 -0.19465 0.02858  100 MET A CB  
790  C CG  . MET A 100 ? 0.53593 0.50433 1.08395 -0.00508 -0.19407 0.02659  100 MET A CG  
791  S SD  . MET A 100 ? 0.44846 0.41683 0.97651 -0.00136 -0.17436 0.03177  100 MET A SD  
792  C CE  . MET A 100 ? 0.33918 0.30458 0.87999 -0.00403 -0.16217 0.03517  100 MET A CE  
793  N N   . GLU A 101 ? 0.35176 0.34678 1.01923 -0.02090 -0.19503 0.03313  101 GLU A N   
794  C CA  . GLU A 101 ? 0.38874 0.38821 1.08928 -0.02854 -0.19002 0.03418  101 GLU A CA  
795  C C   . GLU A 101 ? 0.35993 0.37149 1.08394 -0.02787 -0.17719 0.04137  101 GLU A C   
796  O O   . GLU A 101 ? 0.34388 0.35371 1.08114 -0.03237 -0.16345 0.04532  101 GLU A O   
797  C CB  . GLU A 101 ? 0.36273 0.36961 1.08629 -0.03428 -0.20646 0.02716  101 GLU A CB  
798  C CG  . GLU A 101 ? 0.51286 0.50796 1.21467 -0.03535 -0.21967 0.01914  101 GLU A CG  
799  C CD  . GLU A 101 ? 0.52171 0.52563 1.24374 -0.04055 -0.23747 0.01116  101 GLU A CD  
800  O OE1 . GLU A 101 ? 0.65427 0.67354 1.39041 -0.03760 -0.24484 0.01118  101 GLU A OE1 
801  O OE2 . GLU A 101 ? 0.50903 0.50222 1.22729 -0.04643 -0.24268 0.00464  101 GLU A OE2 
802  N N   . ALA A 102 ? 0.33945 0.36277 1.06921 -0.02210 -0.18154 0.04308  102 ALA A N   
803  C CA  . ALA A 102 ? 0.33148 0.36616 1.08254 -0.02028 -0.16919 0.04949  102 ALA A CA  
804  C C   . ALA A 102 ? 0.32548 0.35108 1.05830 -0.01865 -0.15014 0.05521  102 ALA A C   
805  O O   . ALA A 102 ? 0.37708 0.40713 1.12824 -0.02135 -0.13602 0.05990  102 ALA A O   
806  C CB  . ALA A 102 ? 0.32954 0.37453 1.08284 -0.01215 -0.17695 0.05059  102 ALA A CB  
807  N N   . ALA A 103 ? 0.44063 0.45419 1.13713 -0.01465 -0.14944 0.05432  103 ALA A N   
808  C CA  . ALA A 103 ? 0.32012 0.32685 0.99726 -0.01275 -0.13248 0.05867  103 ALA A CA  
809  C C   . ALA A 103 ? 0.44503 0.44413 1.12521 -0.01801 -0.12330 0.06013  103 ALA A C   
810  O O   . ALA A 103 ? 0.44806 0.44662 1.12902 -0.01811 -0.10715 0.06549  103 ALA A O   
811  C CB  . ALA A 103 ? 0.31978 0.31800 0.95872 -0.00780 -0.13523 0.05596  103 ALA A CB  
812  N N   . LEU A 104 ? 0.33284 0.32461 1.01316 -0.02217 -0.13306 0.05545  104 LEU A N   
813  C CA  . LEU A 104 ? 0.34040 0.32199 1.02386 -0.02713 -0.12444 0.05717  104 LEU A CA  
814  C C   . LEU A 104 ? 0.34989 0.33957 1.06881 -0.03340 -0.11509 0.06146  104 LEU A C   
815  O O   . LEU A 104 ? 0.34276 0.32740 1.06258 -0.03503 -0.09941 0.06706  104 LEU A O   
816  C CB  . LEU A 104 ? 0.35209 0.32300 1.02956 -0.03056 -0.13748 0.05041  104 LEU A CB  
817  C CG  . LEU A 104 ? 0.47256 0.43048 1.15764 -0.03706 -0.13161 0.05100  104 LEU A CG  
818  C CD1 . LEU A 104 ? 0.36793 0.31285 1.02803 -0.03270 -0.11720 0.05616  104 LEU A CD1 
819  C CD2 . LEU A 104 ? 0.37727 0.32640 1.06015 -0.04091 -0.14691 0.04270  104 LEU A CD2 
820  N N   . HIS A 105 ? 0.33980 0.34309 1.08811 -0.03673 -0.12454 0.05874  105 HIS A N   
821  C CA  . HIS A 105 ? 0.39941 0.41397 1.18419 -0.04287 -0.11578 0.06191  105 HIS A CA  
822  C C   . HIS A 105 ? 0.38492 0.40564 1.17079 -0.03858 -0.09896 0.06919  105 HIS A C   
823  O O   . HIS A 105 ? 0.35902 0.37935 1.15828 -0.04299 -0.08370 0.07403  105 HIS A O   
824  C CB  . HIS A 105 ? 0.37149 0.40364 1.18677 -0.04527 -0.13019 0.05697  105 HIS A CB  
825  C CG  . HIS A 105 ? 0.53832 0.58114 1.38624 -0.05146 -0.12201 0.05795  105 HIS A CG  
826  N ND1 . HIS A 105 ? 0.50126 0.56188 1.36978 -0.04870 -0.12603 0.05635  105 HIS A ND1 
827  C CD2 . HIS A 105 ? 0.59217 0.62806 1.44801 -0.05862 -0.10865 0.06009  105 HIS A CD2 
828  C CE1 . HIS A 105 ? 0.57008 0.63618 1.46007 -0.05469 -0.11579 0.05678  105 HIS A CE1 
829  N NE2 . HIS A 105 ? 0.56806 0.61928 1.45059 -0.06095 -0.10496 0.05912  105 HIS A NE2 
830  N N   . LEU A 106 ? 0.32207 0.34679 1.09174 -0.03025 -0.10077 0.06989  106 LEU A N   
831  C CA  . LEU A 106 ? 0.38211 0.41138 1.14977 -0.02595 -0.08506 0.07576  106 LEU A CA  
832  C C   . LEU A 106 ? 0.37694 0.39396 1.12351 -0.02638 -0.06915 0.08011  106 LEU A C   
833  O O   . LEU A 106 ? 0.31620 0.33648 1.07410 -0.02797 -0.05331 0.08537  106 LEU A O   
834  C CB  . LEU A 106 ? 0.38483 0.41622 1.13337 -0.01752 -0.09031 0.07482  106 LEU A CB  
835  C CG  . LEU A 106 ? 0.41260 0.44640 1.15430 -0.01293 -0.07415 0.07974  106 LEU A CG  
836  C CD1 . LEU A 106 ? 0.29971 0.34880 1.07576 -0.01230 -0.07009 0.08220  106 LEU A CD1 
837  C CD2 . LEU A 106 ? 0.38014 0.40841 1.09093 -0.00637 -0.07746 0.07804  106 LEU A CD2 
838  N N   . GLU A 107 ? 0.46840 0.47199 1.18326 -0.02421 -0.07301 0.07793  107 GLU A N   
839  C CA  . GLU A 107 ? 0.37000 0.36355 1.06343 -0.02285 -0.05865 0.08211  107 GLU A CA  
840  C C   . GLU A 107 ? 0.33428 0.32073 1.04323 -0.02959 -0.05063 0.08555  107 GLU A C   
841  O O   . GLU A 107 ? 0.33744 0.32020 1.04185 -0.02949 -0.03469 0.09140  107 GLU A O   
842  C CB  . GLU A 107 ? 0.41392 0.39703 1.07050 -0.01790 -0.06472 0.07851  107 GLU A CB  
843  C CG  . GLU A 107 ? 0.41833 0.40695 1.05528 -0.01200 -0.06926 0.07544  107 GLU A CG  
844  C CD  . GLU A 107 ? 0.56545 0.55792 1.18803 -0.00814 -0.05411 0.07884  107 GLU A CD  
845  O OE1 . GLU A 107 ? 0.76731 0.75710 1.35986 -0.00408 -0.05339 0.07618  107 GLU A OE1 
846  O OE2 . GLU A 107 ? 0.58874 0.58787 1.22976 -0.00934 -0.04284 0.08339  107 GLU A OE2 
847  N N   . LYS A 108 ? 0.34171 0.32598 1.06923 -0.03597 -0.06071 0.08197  108 LYS A N   
848  C CA  . LYS A 108 ? 0.36039 0.33717 1.10465 -0.04383 -0.05128 0.08530  108 LYS A CA  
849  C C   . LYS A 108 ? 0.44485 0.43481 1.21856 -0.04772 -0.03778 0.09019  108 LYS A C   
850  O O   . LYS A 108 ? 0.35904 0.34198 1.13505 -0.05120 -0.02216 0.09602  108 LYS A O   
851  C CB  . LYS A 108 ? 0.36403 0.33598 1.12293 -0.05115 -0.06471 0.07919  108 LYS A CB  
852  C CG  . LYS A 108 ? 0.43266 0.38326 1.16218 -0.04937 -0.06879 0.07721  108 LYS A CG  
853  C CD  . LYS A 108 ? 0.44278 0.39097 1.17521 -0.05241 -0.08781 0.06835  108 LYS A CD  
854  C CE  . LYS A 108 ? 0.50838 0.44984 1.26559 -0.06394 -0.08823 0.06601  108 LYS A CE  
855  N NZ  . LYS A 108 ? 0.55622 0.50315 1.32495 -0.06798 -0.10783 0.05630  108 LYS A NZ  
856  N N   . ASN A 109 ? 0.50629 0.51482 1.30015 -0.04603 -0.04268 0.08832  109 ASN A N   
857  C CA  . ASN A 109 ? 0.43687 0.45946 1.25853 -0.04837 -0.02939 0.09254  109 ASN A CA  
858  C C   . ASN A 109 ? 0.33163 0.35121 1.13313 -0.04274 -0.01224 0.09876  109 ASN A C   
859  O O   . ASN A 109 ? 0.39036 0.41044 1.20275 -0.04638 0.00437  0.10412  109 ASN A O   
860  C CB  . ASN A 109 ? 0.44895 0.49167 1.29516 -0.04587 -0.03975 0.08880  109 ASN A CB  
861  C CG  . ASN A 109 ? 0.62439 0.67474 1.49422 -0.05087 -0.04832 0.08342  109 ASN A CG  
862  O OD1 . ASN A 109 ? 0.68865 0.73837 1.57077 -0.05682 -0.03796 0.08447  109 ASN A OD1 
863  N ND2 . ASN A 109 ? 0.58832 0.64597 1.46327 -0.04875 -0.06709 0.07732  109 ASN A ND2 
864  N N   . VAL A 110 ? 0.32456 0.34109 1.09600 -0.03442 -0.01560 0.09770  110 VAL A N   
865  C CA  . VAL A 110 ? 0.37135 0.38580 1.12178 -0.02944 -0.00012 0.10226  110 VAL A CA  
866  C C   . VAL A 110 ? 0.47248 0.47253 1.20633 -0.03135 0.01143  0.10702  110 VAL A C   
867  O O   . VAL A 110 ? 0.50875 0.50918 1.24246 -0.03159 0.02835  0.11259  110 VAL A O   
868  C CB  . VAL A 110 ? 0.43353 0.44703 1.15386 -0.02158 -0.00657 0.09890  110 VAL A CB  
869  C CG1 . VAL A 110 ? 0.53313 0.54798 1.23688 -0.01751 0.00959  0.10238  110 VAL A CG1 
870  C CG2 . VAL A 110 ? 0.36346 0.38753 1.09788 -0.01929 -0.01927 0.09474  110 VAL A CG2 
871  N N   . ASN A 111 ? 0.34218 0.32856 1.06090 -0.03215 0.00255  0.10497  111 ASN A N   
872  C CA  . ASN A 111 ? 0.40416 0.37419 1.10667 -0.03304 0.01218  0.10978  111 ASN A CA  
873  C C   . ASN A 111 ? 0.36777 0.33644 1.09717 -0.04152 0.02503  0.11502  111 ASN A C   
874  O O   . ASN A 111 ? 0.37747 0.33856 1.09659 -0.04107 0.04092  0.12172  111 ASN A O   
875  C CB  . ASN A 111 ? 0.44920 0.40469 1.13590 -0.03267 -0.00126 0.10566  111 ASN A CB  
876  C CG  . ASN A 111 ? 0.49317 0.42971 1.15496 -0.03009 0.00745  0.11056  111 ASN A CG  
877  O OD1 . ASN A 111 ? 0.44382 0.37966 1.08524 -0.02425 0.01903  0.11520  111 ASN A OD1 
878  N ND2 . ASN A 111 ? 0.39744 0.31795 1.05989 -0.03403 0.00182  0.10937  111 ASN A ND2 
879  N N   . GLN A 112 ? 0.40084 0.37707 1.16420 -0.04953 0.01832  0.11176  112 GLN A N   
880  C CA  . GLN A 112 ? 0.37941 0.35723 1.16726 -0.05771 0.03014  0.11475  112 GLN A CA  
881  C C   . GLN A 112 ? 0.37602 0.36424 1.16882 -0.05558 0.04783  0.12006  112 GLN A C   
882  O O   . GLN A 112 ? 0.39033 0.37124 1.17895 -0.05799 0.06390  0.12561  112 GLN A O   
883  C CB  . GLN A 112 ? 0.37915 0.37046 1.19580 -0.06279 0.01780  0.10726  112 GLN A CB  
884  C CG  . GLN A 112 ? 0.43436 0.42896 1.27114 -0.07026 0.02800  0.10748  112 GLN A CG  
885  C CD  . GLN A 112 ? 0.64618 0.66096 1.51479 -0.07342 0.01793  0.10026  112 GLN A CD  
886  O OE1 . GLN A 112 ? 0.67577 0.69698 1.54966 -0.07179 -0.00006 0.09417  112 GLN A OE1 
887  N NE2 . GLN A 112 ? 0.71214 0.73674 1.60100 -0.07782 0.02959  0.10085  112 GLN A NE2 
888  N N   . SER A 113 ? 0.37812 0.38194 1.17722 -0.05065 0.04550  0.11845  113 SER A N   
889  C CA  . SER A 113 ? 0.40145 0.41438 1.20224 -0.04759 0.06212  0.12265  113 SER A CA  
890  C C   . SER A 113 ? 0.35996 0.36031 1.12880 -0.04356 0.07486  0.12883  113 SER A C   
891  O O   . SER A 113 ? 0.36651 0.36728 1.13550 -0.04436 0.09256  0.13437  113 SER A O   
892  C CB  . SER A 113 ? 0.44118 0.47125 1.25322 -0.04238 0.05581  0.11884  113 SER A CB  
893  O OG  . SER A 113 ? 0.49114 0.52643 1.29693 -0.03829 0.07131  0.12239  113 SER A OG  
894  N N   . LEU A 114 ? 0.35914 0.34941 1.09505 -0.03724 0.06557  0.12672  114 LEU A N   
895  C CA  . LEU A 114 ? 0.43255 0.41300 1.13326 -0.03113 0.07580  0.13101  114 LEU A CA  
896  C C   . LEU A 114 ? 0.42661 0.39068 1.12266 -0.03499 0.08720  0.13807  114 LEU A C   
897  O O   . LEU A 114 ? 0.45347 0.41342 1.13359 -0.03232 0.10262  0.14414  114 LEU A O   
898  C CB  . LEU A 114 ? 0.38207 0.35737 1.05101 -0.02376 0.06246  0.12624  114 LEU A CB  
899  C CG  . LEU A 114 ? 0.41455 0.40346 1.07841 -0.01899 0.05679  0.12079  114 LEU A CG  
900  C CD1 . LEU A 114 ? 0.47369 0.45846 1.11337 -0.01420 0.04111  0.11478  114 LEU A CD1 
901  C CD2 . LEU A 114 ? 0.36591 0.36044 1.01460 -0.01490 0.07245  0.12352  114 LEU A CD2 
902  N N   . LEU A 115 ? 0.46337 0.41694 1.17201 -0.04137 0.08002  0.13726  115 LEU A N   
903  C CA  . LEU A 115 ? 0.42295 0.35794 1.12921 -0.04639 0.09128  0.14403  115 LEU A CA  
904  C C   . LEU A 115 ? 0.46494 0.40771 1.19337 -0.05275 0.10858  0.14832  115 LEU A C   
905  O O   . LEU A 115 ? 0.44381 0.37498 1.15809 -0.05262 0.12447  0.15584  115 LEU A O   
906  C CB  . LEU A 115 ? 0.42982 0.35214 1.14633 -0.05292 0.07931  0.14049  115 LEU A CB  
907  C CG  . LEU A 115 ? 0.49750 0.41140 1.18851 -0.04579 0.06187  0.13500  115 LEU A CG  
908  C CD1 . LEU A 115 ? 0.43750 0.33987 1.14197 -0.05335 0.05044  0.13050  115 LEU A CD1 
909  C CD2 . LEU A 115 ? 0.43804 0.33726 1.08763 -0.03540 0.06714  0.13973  115 LEU A CD2 
910  N N   . GLU A 116 ? 0.41528 0.37880 1.17286 -0.05595 0.10503  0.14247  116 GLU A N   
911  C CA  . GLU A 116 ? 0.45866 0.43234 1.23114 -0.05877 0.12086  0.14456  116 GLU A CA  
912  C C   . GLU A 116 ? 0.51717 0.49339 1.27316 -0.05289 0.13595  0.15029  116 GLU A C   
913  O O   . GLU A 116 ? 0.43390 0.40631 1.18552 -0.05444 0.15307  0.15563  116 GLU A O   
914  C CB  . GLU A 116 ? 0.49365 0.48907 1.29916 -0.06106 0.11332  0.13713  116 GLU A CB  
915  C CG  . GLU A 116 ? 0.63942 0.63536 1.46161 -0.06646 0.09629  0.13033  116 GLU A CG  
916  C CD  . GLU A 116 ? 0.71299 0.73111 1.56639 -0.06704 0.08696  0.12321  116 GLU A CD  
917  O OE1 . GLU A 116 ? 0.72704 0.74802 1.59787 -0.07293 0.07640  0.11761  116 GLU A OE1 
918  O OE2 . GLU A 116 ? 0.78064 0.81260 1.64024 -0.06137 0.09008  0.12303  116 GLU A OE2 
919  N N   . LEU A 117 ? 0.46254 0.44496 1.20826 -0.04660 0.13038  0.14893  117 LEU A N   
920  C CA  . LEU A 117 ? 0.39795 0.38403 1.12798 -0.04171 0.14495  0.15325  117 LEU A CA  
921  C C   . LEU A 117 ? 0.41683 0.38443 1.11310 -0.03844 0.15500  0.16057  117 LEU A C   
922  O O   . LEU A 117 ? 0.42662 0.39358 1.11439 -0.03766 0.17243  0.16630  117 LEU A O   
923  C CB  . LEU A 117 ? 0.51480 0.51125 1.23132 -0.03384 0.13479  0.14710  117 LEU A CB  
924  C CG  . LEU A 117 ? 0.47183 0.48065 1.18576 -0.03006 0.14748  0.14707  117 LEU A CG  
925  C CD1 . LEU A 117 ? 0.59232 0.60860 1.29291 -0.02351 0.13598  0.14003  117 LEU A CD1 
926  C CD2 . LEU A 117 ? 0.61802 0.61930 1.30479 -0.02715 0.16423  0.15322  117 LEU A CD2 
927  N N   . HIS A 118 ? 0.42395 0.37632 1.09915 -0.03551 0.14400  0.16026  118 HIS A N   
928  C CA  . HIS A 118 ? 0.44555 0.37884 1.08858 -0.03109 0.15249  0.16754  118 HIS A CA  
929  C C   . HIS A 118 ? 0.46863 0.38871 1.12466 -0.03955 0.16866  0.17589  118 HIS A C   
930  O O   . HIS A 118 ? 0.48558 0.39708 1.12168 -0.03667 0.18425  0.18361  118 HIS A O   
931  C CB  . HIS A 118 ? 0.46461 0.38456 1.08551 -0.02582 0.13652  0.16474  118 HIS A CB  
932  C CG  . HIS A 118 ? 0.49282 0.39749 1.07415 -0.01662 0.14194  0.17057  118 HIS A CG  
933  N ND1 . HIS A 118 ? 0.60735 0.49311 1.17974 -0.01805 0.15617  0.18022  118 HIS A ND1 
934  C CD2 . HIS A 118 ? 0.53891 0.44551 1.08701 -0.00541 0.13558  0.16816  118 HIS A CD2 
935  C CE1 . HIS A 118 ? 0.70543 0.58138 1.23986 -0.00693 0.15739  0.18393  118 HIS A CE1 
936  N NE2 . HIS A 118 ? 0.67515 0.56494 1.19520 0.00080  0.14484  0.17631  118 HIS A NE2 
937  N N   . LYS A 119 ? 0.47161 0.39196 1.15671 -0.04902 0.16447  0.17275  119 LYS A N   
938  C CA  . LYS A 119 ? 0.49515 0.40885 1.18682 -0.05566 0.17807  0.17609  119 LYS A CA  
939  C C   . LYS A 119 ? 0.49588 0.42257 1.19166 -0.05525 0.19541  0.17878  119 LYS A C   
940  O O   . LYS A 119 ? 0.51815 0.43278 1.19824 -0.05556 0.21195  0.18651  119 LYS A O   
941  C CB  . LYS A 119 ? 0.55170 0.47222 1.27321 -0.06461 0.16850  0.16811  119 LYS A CB  
942  C CG  . LYS A 119 ? 0.52565 0.43244 1.25047 -0.07339 0.18020  0.17105  119 LYS A CG  
943  N N   . LEU A 120 ? 0.47366 0.42366 1.18869 -0.05391 0.19181  0.17240  120 LEU A N   
944  C CA  . LEU A 120 ? 0.54347 0.50617 1.26219 -0.05257 0.20708  0.17341  120 LEU A CA  
945  C C   . LEU A 120 ? 0.60126 0.55570 1.28823 -0.04627 0.22046  0.18141  120 LEU A C   
946  O O   . LEU A 120 ? 0.49916 0.44933 1.17717 -0.04701 0.23769  0.18682  120 LEU A O   
947  C CB  . LEU A 120 ? 0.53381 0.51957 1.27374 -0.04996 0.19878  0.16508  120 LEU A CB  
948  C CG  . LEU A 120 ? 0.48176 0.48008 1.22382 -0.04717 0.21318  0.16480  120 LEU A CG  
949  C CD1 . LEU A 120 ? 0.47155 0.46724 1.22283 -0.05328 0.22793  0.16745  120 LEU A CD1 
950  C CD2 . LEU A 120 ? 0.42877 0.44616 1.19215 -0.04426 0.20382  0.15663  120 LEU A CD2 
951  N N   . ALA A 121 ? 0.46734 0.42024 1.13678 -0.04015 0.21289  0.18206  121 ALA A N   
952  C CA  . ALA A 121 ? 0.47493 0.42294 1.10860 -0.03196 0.22247  0.18723  121 ALA A CA  
953  C C   . ALA A 121 ? 0.50506 0.42962 1.11446 -0.03112 0.23287  0.19739  121 ALA A C   
954  O O   . ALA A 121 ? 0.52029 0.44171 1.11058 -0.02808 0.24900  0.20373  121 ALA A O   
955  C CB  . ALA A 121 ? 0.45976 0.41225 1.06838 -0.02232 0.20584  0.18046  121 ALA A CB  
956  N N   . THR A 122 ? 0.51604 0.42268 1.12411 -0.03332 0.22402  0.19909  122 THR A N   
957  C CA  . THR A 122 ? 0.54832 0.42890 1.13294 -0.03229 0.23416  0.20934  122 THR A CA  
958  C C   . THR A 122 ? 0.62053 0.49846 1.21799 -0.04055 0.25310  0.21420  122 THR A C   
959  O O   . THR A 122 ? 0.71753 0.58295 1.29089 -0.03734 0.26901  0.22354  122 THR A O   
960  C CB  . THR A 122 ? 0.55756 0.41860 1.14095 -0.03392 0.22095  0.20879  122 THR A CB  
961  O OG1 . THR A 122 ? 0.69463 0.55931 1.25647 -0.02332 0.20257  0.20246  122 THR A OG1 
962  C CG2 . THR A 122 ? 0.59832 0.42962 1.15678 -0.03247 0.23256  0.21991  122 THR A CG2 
963  N N   . ASP A 123 ? 0.56033 0.45264 1.19074 -0.04918 0.25000  0.20591  123 ASP A N   
964  C CA  . ASP A 123 ? 0.66160 0.55265 1.30014 -0.05596 0.26563  0.20781  123 ASP A CA  
965  C C   . ASP A 123 ? 0.57833 0.48510 1.21601 -0.05336 0.27994  0.20833  123 ASP A C   
966  O O   . ASP A 123 ? 0.60172 0.50247 1.23405 -0.05658 0.29626  0.21289  123 ASP A O   
967  C CB  . ASP A 123 ? 0.73100 0.63083 1.40423 -0.06606 0.25764  0.19914  123 ASP A CB  
968  C CG  . ASP A 123 ? 0.91410 0.79896 1.58730 -0.06882 0.24267  0.19724  123 ASP A CG  
969  O OD1 . ASP A 123 ? 0.93776 0.79831 1.58137 -0.06428 0.24347  0.20470  123 ASP A OD1 
970  O OD2 . ASP A 123 ? 0.96040 0.85720 1.66186 -0.07483 0.23019  0.18828  123 ASP A OD2 
971  N N   . LYS A 124 ? 0.55214 0.47725 1.19243 -0.04762 0.27471  0.20367  124 LYS A N   
972  C CA  . LYS A 124 ? 0.57121 0.50703 1.20089 -0.04326 0.28854  0.20487  124 LYS A CA  
973  C C   . LYS A 124 ? 0.56393 0.48680 1.15496 -0.03551 0.29753  0.21467  124 LYS A C   
974  O O   . LYS A 124 ? 0.56542 0.49662 1.14282 -0.03138 0.30932  0.21581  124 LYS A O   
975  C CB  . LYS A 124 ? 0.52146 0.48123 1.16863 -0.04045 0.27977  0.19498  124 LYS A CB  
976  C CG  . LYS A 124 ? 0.51967 0.49532 1.19404 -0.04443 0.28452  0.18820  124 LYS A CG  
977  C CD  . LYS A 124 ? 0.57011 0.54541 1.27321 -0.05285 0.27805  0.18492  124 LYS A CD  
978  C CE  . LYS A 124 ? 0.59288 0.58632 1.32559 -0.05608 0.28127  0.17786  124 LYS A CE  
979  N NZ  . LYS A 124 ? 0.71531 0.70565 1.44651 -0.06057 0.30073  0.18152  124 LYS A NZ  
980  N N   . ASN A 125 ? 0.57466 0.47698 1.14679 -0.03287 0.29212  0.22158  125 ASN A N   
981  C CA  . ASN A 125 ? 0.66648 0.55560 1.19511 -0.02205 0.29599  0.22933  125 ASN A CA  
982  C C   . ASN A 125 ? 0.61821 0.52802 1.12950 -0.01242 0.28903  0.22144  125 ASN A C   
983  O O   . ASN A 125 ? 0.63697 0.55100 1.12352 -0.00637 0.30003  0.22397  125 ASN A O   
984  C CB  . ASN A 125 ? 0.63233 0.50583 1.14308 -0.02290 0.31843  0.24129  125 ASN A CB  
985  C CG  . ASN A 125 ? 0.74670 0.60276 1.26932 -0.03178 0.32213  0.24352  125 ASN A CG  
986  O OD1 . ASN A 125 ? 0.81822 0.65918 1.34378 -0.03382 0.31121  0.24361  125 ASN A OD1 
987  N ND2 . ASN A 125 ? 0.66863 0.52723 1.19651 -0.03707 0.33720  0.24407  125 ASN A ND2 
988  N N   . ASP A 126 ? 0.55271 0.47508 1.07700 -0.01163 0.27054  0.21136  126 ASP A N   
989  C CA  . ASP A 126 ? 0.52061 0.46226 1.03277 -0.00459 0.26220  0.20216  126 ASP A CA  
990  C C   . ASP A 126 ? 0.51638 0.45288 1.00425 0.00388  0.24365  0.19867  126 ASP A C   
991  O O   . ASP A 126 ? 0.49621 0.43860 0.99931 0.00225  0.22749  0.19107  126 ASP A O   
992  C CB  . ASP A 126 ? 0.49368 0.45428 1.04219 -0.01100 0.25752  0.19326  126 ASP A CB  
993  C CG  . ASP A 126 ? 0.61816 0.59670 1.15394 -0.00501 0.25242  0.18396  126 ASP A CG  
994  O OD1 . ASP A 126 ? 0.51080 0.48942 1.01299 0.00350  0.24574  0.18165  126 ASP A OD1 
995  O OD2 . ASP A 126 ? 0.45900 0.45181 1.01945 -0.00898 0.25501  0.17844  126 ASP A OD2 
996  N N   . PRO A 127 ? 0.53606 0.46207 0.98578 0.01359  0.24533  0.20398  127 PRO A N   
997  C CA  . PRO A 127 ? 0.53437 0.45475 0.96288 0.02199  0.22796  0.20100  127 PRO A CA  
998  C C   . PRO A 127 ? 0.50855 0.44995 0.93057 0.02639  0.21502  0.18910  127 PRO A C   
999  O O   . PRO A 127 ? 0.49837 0.43933 0.91722 0.02942  0.19841  0.18366  127 PRO A O   
1000 C CB  . PRO A 127 ? 0.56451 0.47025 0.95381 0.03245  0.23531  0.21027  127 PRO A CB  
1001 C CG  . PRO A 127 ? 0.57389 0.48689 0.95604 0.03192  0.25361  0.21410  127 PRO A CG  
1002 C CD  . PRO A 127 ? 0.57525 0.49492 0.99863 0.01833  0.26256  0.21267  127 PRO A CD  
1003 N N   . HIS A 128 ? 0.62179 0.58096 1.04171 0.02624  0.22263  0.18441  128 HIS A N   
1004 C CA  . HIS A 128 ? 0.50354 0.48099 0.91815 0.02880  0.21117  0.17261  128 HIS A CA  
1005 C C   . HIS A 128 ? 0.45365 0.43437 0.89968 0.02174  0.19869  0.16618  128 HIS A C   
1006 O O   . HIS A 128 ? 0.44079 0.42547 0.88087 0.02452  0.18305  0.15912  128 HIS A O   
1007 C CB  . HIS A 128 ? 0.47073 0.46475 0.87922 0.02853  0.22250  0.16807  128 HIS A CB  
1008 C CG  . HIS A 128 ? 0.47835 0.48887 0.88597 0.02859  0.21209  0.15565  128 HIS A CG  
1009 N ND1 . HIS A 128 ? 0.53089 0.54803 0.96743 0.02140  0.20937  0.14976  128 HIS A ND1 
1010 C CD2 . HIS A 128 ? 0.46891 0.48965 0.85047 0.03488  0.20295  0.14796  128 HIS A CD2 
1011 C CE1 . HIS A 128 ? 0.46972 0.49841 0.89629 0.02291  0.20019  0.13946  128 HIS A CE1 
1012 N NE2 . HIS A 128 ? 0.51505 0.54699 0.90921 0.03036  0.19634  0.13776  128 HIS A NE2 
1013 N N   . LEU A 129 ? 0.46970 0.44904 0.94936 0.01281  0.20530  0.16867  129 LEU A N   
1014 C CA  . LEU A 129 ? 0.43115 0.41484 0.94118 0.00683  0.19323  0.16281  129 LEU A CA  
1015 C C   . LEU A 129 ? 0.43472 0.40466 0.94757 0.00657  0.17933  0.16423  129 LEU A C   
1016 O O   . LEU A 129 ? 0.41924 0.39307 0.93750 0.00663  0.16342  0.15715  129 LEU A O   
1017 C CB  . LEU A 129 ? 0.42838 0.41654 0.97434 -0.00172 0.20406  0.16487  129 LEU A CB  
1018 C CG  . LEU A 129 ? 0.44260 0.43504 1.02385 -0.00790 0.19245  0.16034  129 LEU A CG  
1019 C CD1 . LEU A 129 ? 0.39236 0.39718 0.96997 -0.00484 0.18181  0.15076  129 LEU A CD1 
1020 C CD2 . LEU A 129 ? 0.50218 0.50031 1.11890 -0.01552 0.20475  0.16314  129 LEU A CD2 
1021 N N   . ALA A 130 ? 0.45679 0.40918 0.96471 0.00618  0.18571  0.17331  130 ALA A N   
1022 C CA  . ALA A 130 ? 0.49057 0.42684 0.99932 0.00586  0.17394  0.17478  130 ALA A CA  
1023 C C   . ALA A 130 ? 0.45851 0.39589 0.93971 0.01518  0.15881  0.16909  130 ALA A C   
1024 O O   . ALA A 130 ? 0.44928 0.38436 0.93864 0.01401  0.14348  0.16391  130 ALA A O   
1025 C CB  . ALA A 130 ? 0.49443 0.40867 0.99467 0.00529  0.18551  0.18600  130 ALA A CB  
1026 N N   . ASP A 131 ? 0.55303 0.49542 1.00163 0.02446  0.16302  0.16945  131 ASP A N   
1027 C CA  . ASP A 131 ? 0.54272 0.48982 0.96434 0.03385  0.14986  0.16334  131 ASP A CA  
1028 C C   . ASP A 131 ? 0.49362 0.45883 0.92410 0.03149  0.13879  0.15180  131 ASP A C   
1029 O O   . ASP A 131 ? 0.46662 0.43226 0.89164 0.03413  0.12376  0.14576  131 ASP A O   
1030 C CB  . ASP A 131 ? 0.60652 0.55788 0.99281 0.04411  0.15775  0.16601  131 ASP A CB  
1031 C CG  . ASP A 131 ? 0.65864 0.61658 1.01686 0.05468  0.14431  0.15954  131 ASP A CG  
1032 O OD1 . ASP A 131 ? 0.56399 0.50739 0.91352 0.05985  0.13575  0.16199  131 ASP A OD1 
1033 O OD2 . ASP A 131 ? 0.69865 0.67653 1.04374 0.05757  0.14281  0.15151  131 ASP A OD2 
1034 N N   . PHE A 132 ? 0.50506 0.48429 0.94753 0.02685  0.14655  0.14856  132 PHE A N   
1035 C CA  . PHE A 132 ? 0.43140 0.42438 0.88287 0.02407  0.13712  0.13840  132 PHE A CA  
1036 C C   . PHE A 132 ? 0.40425 0.39078 0.87816 0.01945  0.12292  0.13614  132 PHE A C   
1037 O O   . PHE A 132 ? 0.38172 0.37176 0.84812 0.02149  0.10891  0.12895  132 PHE A O   
1038 C CB  . PHE A 132 ? 0.43933 0.44341 0.90676 0.01883  0.14865  0.13672  132 PHE A CB  
1039 C CG  . PHE A 132 ? 0.49445 0.51081 0.96470 0.01720  0.14100  0.12658  132 PHE A CG  
1040 C CD1 . PHE A 132 ? 0.54920 0.57686 0.99345 0.02101  0.14171  0.11947  132 PHE A CD1 
1041 C CD2 . PHE A 132 ? 0.57805 0.59433 1.07563 0.01191  0.13272  0.12389  132 PHE A CD2 
1042 C CE1 . PHE A 132 ? 0.52851 0.56507 0.97367 0.01863  0.13578  0.11010  132 PHE A CE1 
1043 C CE2 . PHE A 132 ? 0.52984 0.55461 1.02740 0.01094  0.12613  0.11535  132 PHE A CE2 
1044 C CZ  . PHE A 132 ? 0.50298 0.53674 0.97380 0.01391  0.12822  0.10857  132 PHE A CZ  
1045 N N   . ILE A 133 ? 0.40614 0.38336 0.90700 0.01299  0.12656  0.14203  133 ILE A N   
1046 C CA  . ILE A 133 ? 0.38872 0.36091 0.91286 0.00787  0.11326  0.13955  133 ILE A CA  
1047 C C   . ILE A 133 ? 0.39582 0.35639 0.90174 0.01268  0.10049  0.13842  133 ILE A C   
1048 O O   . ILE A 133 ? 0.42301 0.38652 0.92910 0.01310  0.08562  0.13135  133 ILE A O   
1049 C CB  . ILE A 133 ? 0.40782 0.37388 0.96421 -0.00056 0.12088  0.14561  133 ILE A CB  
1050 C CG1 . ILE A 133 ? 0.43327 0.41352 1.01159 -0.00476 0.13067  0.14472  133 ILE A CG1 
1051 C CG2 . ILE A 133 ? 0.39248 0.35269 0.97042 -0.00574 0.10654  0.14283  133 ILE A CG2 
1052 C CD1 . ILE A 133 ? 0.64564 0.62230 1.25132 -0.01219 0.14321  0.15147  133 ILE A CD1 
1053 N N   . GLU A 134 ? 0.42730 0.37361 0.91636 0.01686  0.10630  0.14541  134 GLU A N   
1054 C CA  . GLU A 134 ? 0.56065 0.49399 1.03465 0.02175  0.09431  0.14436  134 GLU A CA  
1055 C C   . GLU A 134 ? 0.62109 0.56634 1.07252 0.02906  0.08277  0.13554  134 GLU A C   
1056 O O   . GLU A 134 ? 0.77778 0.72435 1.23543 0.02749  0.06853  0.12875  134 GLU A O   
1057 C CB  . GLU A 134 ? 0.62863 0.54306 1.08391 0.02698  0.10312  0.15375  134 GLU A CB  
1058 C CG  . GLU A 134 ? 0.64442 0.56329 1.07359 0.03481  0.11555  0.15841  134 GLU A CG  
1059 C CD  . GLU A 134 ? 0.74686 0.64409 1.16544 0.03720  0.12742  0.17003  134 GLU A CD  
1060 O OE1 . GLU A 134 ? 0.74379 0.63172 1.18502 0.02794  0.13713  0.17587  134 GLU A OE1 
1061 O OE2 . GLU A 134 ? 0.92257 0.81186 1.31006 0.04850  0.12713  0.17330  134 GLU A OE2 
1062 N N   . THR A 135 ? 0.54915 0.50626 0.97749 0.03546  0.08941  0.13445  135 THR A N   
1063 C CA  . THR A 135 ? 0.57549 0.54480 0.97996 0.04248  0.08000  0.12591  135 THR A CA  
1064 C C   . THR A 135 ? 0.64252 0.62496 1.05912 0.03694  0.07102  0.11632  135 THR A C   
1065 O O   . THR A 135 ? 0.65584 0.64210 1.06171 0.03978  0.05855  0.10899  135 THR A O   
1066 C CB  . THR A 135 ? 0.63546 0.61647 1.01386 0.04961  0.08975  0.12622  135 THR A CB  
1067 O OG1 . THR A 135 ? 0.82921 0.82500 1.21634 0.04397  0.09758  0.12267  135 THR A OG1 
1068 C CG2 . THR A 135 ? 0.61747 0.58514 0.98551 0.05436  0.10139  0.13724  135 THR A CG2 
1069 N N   . HIS A 136 ? 0.51658 0.50570 0.95403 0.02966  0.07743  0.11615  136 HIS A N   
1070 C CA  . HIS A 136 ? 0.44305 0.44317 0.88692 0.02597  0.06987  0.10752  136 HIS A CA  
1071 C C   . HIS A 136 ? 0.54559 0.53965 1.01638 0.01982  0.05947  0.10661  136 HIS A C   
1072 O O   . HIS A 136 ? 0.54599 0.54644 1.01944 0.01782  0.05085  0.09974  136 HIS A O   
1073 C CB  . HIS A 136 ? 0.49016 0.50200 0.93670 0.02322  0.08204  0.10618  136 HIS A CB  
1074 C CG  . HIS A 136 ? 0.67704 0.69922 1.09450 0.02869  0.08915  0.10331  136 HIS A CG  
1075 N ND1 . HIS A 136 ? 0.70722 0.73070 1.11749 0.03076  0.10367  0.10894  136 HIS A ND1 
1076 C CD2 . HIS A 136 ? 0.68635 0.71926 1.07986 0.03245  0.08352  0.09493  136 HIS A CD2 
1077 C CE1 . HIS A 136 ? 0.74052 0.77567 1.12361 0.03589  0.10598  0.10396  136 HIS A CE1 
1078 N NE2 . HIS A 136 ? 0.68199 0.72374 1.05531 0.03674  0.09401  0.09517  136 HIS A NE2 
1079 N N   . TYR A 137 ? 0.41000 0.39189 0.89980 0.01662  0.05973  0.11294  137 TYR A N   
1080 C CA  . TYR A 137 ? 0.49623 0.47594 1.01430 0.01014  0.05045  0.11137  137 TYR A CA  
1081 C C   . TYR A 137 ? 0.45341 0.41865 0.97711 0.00898  0.04122  0.11290  137 TYR A C   
1082 O O   . TYR A 137 ? 0.44324 0.40786 0.97760 0.00628  0.02765  0.10797  137 TYR A O   
1083 C CB  . TYR A 137 ? 0.59286 0.57693 1.14032 0.00399  0.06103  0.11575  137 TYR A CB  
1084 C CG  . TYR A 137 ? 0.48776 0.48510 1.03437 0.00432  0.06602  0.11195  137 TYR A CG  
1085 C CD1 . TYR A 137 ? 0.49578 0.49870 1.02170 0.00787  0.07830  0.11243  137 TYR A CD1 
1086 C CD2 . TYR A 137 ? 0.48000 0.48352 1.04439 0.00154  0.05827  0.10754  137 TYR A CD2 
1087 C CE1 . TYR A 137 ? 0.52972 0.54305 1.05275 0.00768  0.08347  0.10807  137 TYR A CE1 
1088 C CE2 . TYR A 137 ? 0.44606 0.45872 1.00693 0.00231  0.06375  0.10410  137 TYR A CE2 
1089 C CZ  . TYR A 137 ? 0.38985 0.40685 0.92994 0.00489  0.07667  0.10409  137 TYR A CZ  
1090 O OH  . TYR A 137 ? 0.41416 0.43855 0.94876 0.00501  0.08330  0.10006  137 TYR A OH  
1091 N N   . LEU A 138 ? 0.53858 0.49093 1.05424 0.01100  0.04829  0.11949  138 LEU A N   
1092 C CA  . LEU A 138 ? 0.46518 0.40143 0.99209 0.00753  0.04188  0.12138  138 LEU A CA  
1093 C C   . LEU A 138 ? 0.42516 0.35568 0.93381 0.01255  0.02673  0.11519  138 LEU A C   
1094 O O   . LEU A 138 ? 0.40259 0.32816 0.92532 0.00811  0.01479  0.11120  138 LEU A O   
1095 C CB  . LEU A 138 ? 0.43760 0.35841 0.96047 0.00780  0.05512  0.13080  138 LEU A CB  
1096 C CG  . LEU A 138 ? 0.43650 0.36108 0.98615 -0.00023 0.06885  0.13643  138 LEU A CG  
1097 C CD1 . LEU A 138 ? 0.47441 0.38184 1.01946 -0.00101 0.08281  0.14610  138 LEU A CD1 
1098 C CD2 . LEU A 138 ? 0.44371 0.37350 1.02966 -0.00995 0.06118  0.13270  138 LEU A CD2 
1099 N N   . ASN A 139 ? 0.46682 0.39933 0.94425 0.02196  0.02679  0.11365  139 ASN A N   
1100 C CA  . ASN A 139 ? 0.44826 0.37676 0.90882 0.02716  0.01284  0.10716  139 ASN A CA  
1101 C C   . ASN A 139 ? 0.47947 0.42053 0.94673 0.02391  0.00071  0.09822  139 ASN A C   
1102 O O   . ASN A 139 ? 0.37436 0.30958 0.84323 0.02305  -0.01238 0.09315  139 ASN A O   
1103 C CB  . ASN A 139 ? 0.51782 0.44831 0.94458 0.03866  0.01530  0.10686  139 ASN A CB  
1104 C CG  . ASN A 139 ? 0.76904 0.68328 1.18073 0.04521  0.00696  0.10604  139 ASN A CG  
1105 O OD1 . ASN A 139 ? 0.76793 0.67538 1.18898 0.04161  -0.00481 0.10121  139 ASN A OD1 
1106 N ND2 . ASN A 139 ? 0.85690 0.76418 1.24485 0.05532  0.01309  0.11080  139 ASN A ND2 
1107 N N   . GLU A 140 ? 0.47280 0.42943 0.94396 0.02185  0.00531  0.09638  140 GLU A N   
1108 C CA  . GLU A 140 ? 0.40011 0.36627 0.87714 0.01868  -0.00494 0.08899  140 GLU A CA  
1109 C C   . GLU A 140 ? 0.46700 0.42782 0.97274 0.01151  -0.01348 0.08894  140 GLU A C   
1110 O O   . GLU A 140 ? 0.44069 0.40139 0.94666 0.01056  -0.02718 0.08281  140 GLU A O   
1111 C CB  . GLU A 140 ? 0.42100 0.40148 0.89776 0.01750  0.00370  0.08799  140 GLU A CB  
1112 N N   . GLN A 141 ? 0.34758 0.30521 0.87781 0.00623  -0.00559 0.09524  141 GLN A N   
1113 C CA  . GLN A 141 ? 0.43471 0.38929 0.99380 -0.00087 -0.01392 0.09451  141 GLN A CA  
1114 C C   . GLN A 141 ? 0.45967 0.40023 1.01364 -0.00096 -0.02512 0.09173  141 GLN A C   
1115 O O   . GLN A 141 ? 0.35638 0.29740 0.91951 -0.00386 -0.03901 0.08608  141 GLN A O   
1116 C CB  . GLN A 141 ? 0.36317 0.31765 0.94929 -0.00688 -0.00182 0.10147  141 GLN A CB  
1117 C CG  . GLN A 141 ? 0.52924 0.49302 1.14817 -0.01330 -0.00748 0.09960  141 GLN A CG  
1118 C CD  . GLN A 141 ? 0.60971 0.58762 1.22833 -0.01074 -0.00860 0.09668  141 GLN A CD  
1119 O OE1 . GLN A 141 ? 0.75223 0.73557 1.38060 -0.01163 -0.02103 0.09196  141 GLN A OE1 
1120 N NE2 . GLN A 141 ? 0.71330 0.69623 1.31936 -0.00738 0.00456  0.09938  141 GLN A NE2 
1121 N N   . VAL A 142 ? 0.37438 0.30162 0.91238 0.00276  -0.01922 0.09557  142 VAL A N   
1122 C CA  . VAL A 142 ? 0.48260 0.39356 1.01480 0.00311  -0.02834 0.09317  142 VAL A CA  
1123 C C   . VAL A 142 ? 0.49323 0.40781 1.00769 0.00766  -0.04319 0.08425  142 VAL A C   
1124 O O   . VAL A 142 ? 0.40428 0.31335 0.92661 0.00418  -0.05582 0.07898  142 VAL A O   
1125 C CB  . VAL A 142 ? 0.47586 0.37073 0.98960 0.00855  -0.01803 0.09969  142 VAL A CB  
1126 C CG1 . VAL A 142 ? 0.42198 0.30101 0.91698 0.01373  -0.02777 0.09577  142 VAL A CG1 
1127 C CG2 . VAL A 142 ? 0.42059 0.30540 0.95690 0.00072  -0.00633 0.10754  142 VAL A CG2 
1128 N N   . LYS A 143 ? 0.37307 0.29807 0.86394 0.01476  -0.04162 0.08185  143 LYS A N   
1129 C CA  . LYS A 143 ? 0.44859 0.37876 0.92163 0.01862  -0.05401 0.07314  143 LYS A CA  
1130 C C   . LYS A 143 ? 0.41994 0.35841 0.90888 0.01265  -0.06446 0.06810  143 LYS A C   
1131 O O   . LYS A 143 ? 0.35653 0.29159 0.84174 0.01230  -0.07780 0.06167  143 LYS A O   
1132 C CB  . LYS A 143 ? 0.45125 0.39328 0.89812 0.02600  -0.04813 0.07140  143 LYS A CB  
1133 C CG  . LYS A 143 ? 0.47282 0.40705 0.89774 0.03485  -0.04267 0.07419  143 LYS A CG  
1134 C CD  . LYS A 143 ? 0.44537 0.39359 0.85054 0.04101  -0.03286 0.07472  143 LYS A CD  
1135 N N   . ALA A 144 ? 0.34435 0.29319 0.85010 0.00862  -0.05872 0.07091  144 ALA A N   
1136 C CA  . ALA A 144 ? 0.36097 0.31663 0.88177 0.00432  -0.06875 0.06707  144 ALA A CA  
1137 C C   . ALA A 144 ? 0.35449 0.30244 0.89651 -0.00109 -0.07947 0.06566  144 ALA A C   
1138 O O   . ALA A 144 ? 0.34224 0.29103 0.88440 -0.00215 -0.09335 0.05968  144 ALA A O   
1139 C CB  . ALA A 144 ? 0.32596 0.29254 0.86327 0.00186  -0.05971 0.07107  144 ALA A CB  
1140 N N   . ILE A 145 ? 0.40125 0.34143 0.96056 -0.00504 -0.07297 0.07073  145 ILE A N   
1141 C CA  . ILE A 145 ? 0.46495 0.39874 1.04680 -0.01186 -0.08216 0.06861  145 ILE A CA  
1142 C C   . ILE A 145 ? 0.37199 0.29290 0.93595 -0.00974 -0.09346 0.06251  145 ILE A C   
1143 O O   . ILE A 145 ? 0.37365 0.29442 0.94538 -0.01309 -0.10753 0.05629  145 ILE A O   
1144 C CB  . ILE A 145 ? 0.36988 0.29828 0.97442 -0.01783 -0.07018 0.07544  145 ILE A CB  
1145 C CG1 . ILE A 145 ? 0.40588 0.34995 1.03437 -0.02089 -0.06249 0.07938  145 ILE A CG1 
1146 C CG2 . ILE A 145 ? 0.38364 0.30129 1.00646 -0.02551 -0.07778 0.07258  145 ILE A CG2 
1147 C CD1 . ILE A 145 ? 0.38243 0.32403 1.02824 -0.02542 -0.04611 0.08711  145 ILE A CD1 
1148 N N   . LYS A 146 ? 0.38030 0.29100 0.91915 -0.00334 -0.08785 0.06380  146 LYS A N   
1149 C CA  . LYS A 146 ? 0.39062 0.28993 0.90959 0.00056  -0.09801 0.05749  146 LYS A CA  
1150 C C   . LYS A 146 ? 0.38065 0.28969 0.88755 0.00279  -0.11100 0.04941  146 LYS A C   
1151 O O   . LYS A 146 ? 0.44872 0.35185 0.95491 0.00105  -0.12389 0.04277  146 LYS A O   
1152 C CB  . LYS A 146 ? 0.42947 0.32012 0.92125 0.00962  -0.08952 0.06029  146 LYS A CB  
1153 C CG  . LYS A 146 ? 0.40999 0.29057 0.87901 0.01566  -0.09954 0.05320  146 LYS A CG  
1154 C CD  . LYS A 146 ? 0.43356 0.29431 0.91410 0.01040  -0.10523 0.05147  146 LYS A CD  
1155 C CE  . LYS A 146 ? 0.44586 0.29068 0.90109 0.01866  -0.10927 0.04735  146 LYS A CE  
1156 N NZ  . LYS A 146 ? 0.43915 0.29194 0.87847 0.02251  -0.12233 0.03743  146 LYS A NZ  
1157 N N   . GLU A 147 ? 0.36640 0.28954 0.86314 0.00608  -0.10739 0.04961  147 GLU A N   
1158 C CA  . GLU A 147 ? 0.35917 0.28996 0.84182 0.00785  -0.11800 0.04242  147 GLU A CA  
1159 C C   . GLU A 147 ? 0.40363 0.33805 0.90687 0.00172  -0.12971 0.03975  147 GLU A C   
1160 O O   . GLU A 147 ? 0.36006 0.29277 0.85491 0.00178  -0.14283 0.03285  147 GLU A O   
1161 C CB  . GLU A 147 ? 0.34682 0.29037 0.81451 0.01152  -0.10932 0.04349  147 GLU A CB  
1162 C CG  . GLU A 147 ? 0.50277 0.45486 0.96218 0.01093  -0.11692 0.03823  147 GLU A CG  
1163 C CD  . GLU A 147 ? 0.55797 0.52094 1.00197 0.01338  -0.10652 0.03878  147 GLU A CD  
1164 O OE1 . GLU A 147 ? 0.56059 0.52625 0.98248 0.01821  -0.10149 0.03639  147 GLU A OE1 
1165 O OE2 . GLU A 147 ? 0.58074 0.54982 1.03505 0.01062  -0.10319 0.04127  147 GLU A OE2 
1166 N N   . LEU A 148 ? 0.35169 0.29220 0.88159 -0.00302 -0.12522 0.04495  148 LEU A N   
1167 C CA  . LEU A 148 ? 0.39005 0.33596 0.94183 -0.00788 -0.13665 0.04266  148 LEU A CA  
1168 C C   . LEU A 148 ? 0.43460 0.37097 0.99568 -0.01227 -0.14800 0.03778  148 LEU A C   
1169 O O   . LEU A 148 ? 0.36566 0.30433 0.92924 -0.01386 -0.16247 0.03192  148 LEU A O   
1170 C CB  . LEU A 148 ? 0.41002 0.36524 0.99083 -0.01151 -0.12852 0.04904  148 LEU A CB  
1171 C CG  . LEU A 148 ? 0.33234 0.29721 0.90728 -0.00789 -0.11812 0.05315  148 LEU A CG  
1172 C CD1 . LEU A 148 ? 0.33889 0.31031 0.94016 -0.01078 -0.10605 0.06001  148 LEU A CD1 
1173 C CD2 . LEU A 148 ? 0.32780 0.29928 0.89911 -0.00616 -0.12789 0.04994  148 LEU A CD2 
1174 N N   . GLY A 149 ? 0.37391 0.29838 0.93861 -0.01425 -0.14143 0.03995  149 GLY A N   
1175 C CA  . GLY A 149 ? 0.38877 0.30150 0.96054 -0.01904 -0.15094 0.03469  149 GLY A CA  
1176 C C   . GLY A 149 ? 0.43194 0.33707 0.97675 -0.01445 -0.16196 0.02674  149 GLY A C   
1177 O O   . GLY A 149 ? 0.40278 0.30536 0.95254 -0.01813 -0.17563 0.01973  149 GLY A O   
1178 N N   . ASP A 150 ? 0.39355 0.29593 0.90974 -0.00638 -0.15606 0.02717  150 ASP A N   
1179 C CA  . ASP A 150 ? 0.39799 0.29658 0.88770 -0.00126 -0.16559 0.01924  150 ASP A CA  
1180 C C   . ASP A 150 ? 0.39141 0.30052 0.88100 -0.00296 -0.17856 0.01385  150 ASP A C   
1181 O O   . ASP A 150 ? 0.40022 0.30447 0.88349 -0.00392 -0.19146 0.00620  150 ASP A O   
1182 C CB  . ASP A 150 ? 0.39314 0.29427 0.85500 0.00767  -0.15640 0.02058  150 ASP A CB  
1183 C CG  . ASP A 150 ? 0.40325 0.29256 0.85951 0.01176  -0.14489 0.02567  150 ASP A CG  
1184 O OD1 . ASP A 150 ? 0.52975 0.40359 0.99693 0.00840  -0.14519 0.02654  150 ASP A OD1 
1185 O OD2 . ASP A 150 ? 0.41514 0.31028 0.85511 0.01839  -0.13523 0.02878  150 ASP A OD2 
1186 N N   . HIS A 151 ? 0.37775 0.30021 0.87265 -0.00289 -0.17491 0.01786  151 HIS A N   
1187 C CA  . HIS A 151 ? 0.41170 0.34258 0.90488 -0.00352 -0.18608 0.01423  151 HIS A CA  
1188 C C   . HIS A 151 ? 0.41725 0.34806 0.93363 -0.00950 -0.19946 0.01097  151 HIS A C   
1189 O O   . HIS A 151 ? 0.45979 0.38986 0.96723 -0.00956 -0.21321 0.00422  151 HIS A O   
1190 C CB  . HIS A 151 ? 0.36041 0.30297 0.85779 -0.00237 -0.17792 0.02021  151 HIS A CB  
1191 C CG  . HIS A 151 ? 0.47063 0.41587 0.94297 0.00263  -0.16703 0.02123  151 HIS A CG  
1192 N ND1 . HIS A 151 ? 0.38356 0.32393 0.83068 0.00677  -0.16601 0.01666  151 HIS A ND1 
1193 C CD2 . HIS A 151 ? 0.38307 0.33636 0.85176 0.00407  -0.15679 0.02545  151 HIS A CD2 
1194 C CE1 . HIS A 151 ? 0.34970 0.29691 0.77975 0.01011  -0.15594 0.01777  151 HIS A CE1 
1195 N NE2 . HIS A 151 ? 0.37731 0.33150 0.81957 0.00809  -0.14992 0.02299  151 HIS A NE2 
1196 N N   . VAL A 152 ? 0.38089 0.31400 0.92736 -0.01480 -0.19545 0.01537  152 VAL A N   
1197 C CA  . VAL A 152 ? 0.45350 0.38910 1.02543 -0.02145 -0.20750 0.01154  152 VAL A CA  
1198 C C   . VAL A 152 ? 0.48805 0.41086 1.04974 -0.02359 -0.21802 0.00289  152 VAL A C   
1199 O O   . VAL A 152 ? 0.41053 0.33588 0.97388 -0.02567 -0.23334 -0.00403 152 VAL A O   
1200 C CB  . VAL A 152 ? 0.39504 0.33397 0.99987 -0.02763 -0.19826 0.01717  152 VAL A CB  
1201 C CG1 . VAL A 152 ? 0.41953 0.35880 1.04983 -0.03612 -0.20920 0.01150  152 VAL A CG1 
1202 C CG2 . VAL A 152 ? 0.37305 0.32748 0.99276 -0.02579 -0.19150 0.02409  152 VAL A CG2 
1203 N N   . THR A 153 ? 0.43732 0.34563 0.98715 -0.02246 -0.20985 0.00312  153 THR A N   
1204 C CA  . THR A 153 ? 0.42926 0.32264 0.96921 -0.02406 -0.21796 -0.00494 153 THR A CA  
1205 C C   . THR A 153 ? 0.51572 0.40969 1.02868 -0.01900 -0.22971 -0.01256 153 THR A C   
1206 O O   . THR A 153 ? 0.55400 0.44530 1.06792 -0.02240 -0.24365 -0.02075 153 THR A O   
1207 C CB  . THR A 153 ? 0.44416 0.32101 0.97264 -0.02120 -0.20538 -0.00185 153 THR A CB  
1208 O OG1 . THR A 153 ? 0.50115 0.37485 1.05536 -0.02758 -0.19528 0.00450  153 THR A OG1 
1209 C CG2 . THR A 153 ? 0.45611 0.31556 0.96920 -0.02068 -0.21292 -0.01040 153 THR A CG2 
1210 N N   . ASN A 154 ? 0.47786 0.37626 0.96660 -0.01145 -0.22402 -0.01041 154 ASN A N   
1211 C CA  . ASN A 154 ? 0.42297 0.32263 0.88540 -0.00722 -0.23353 -0.01746 154 ASN A CA  
1212 C C   . ASN A 154 ? 0.51131 0.42068 0.98168 -0.01023 -0.24711 -0.02018 154 ASN A C   
1213 O O   . ASN A 154 ? 0.52026 0.42648 0.97857 -0.01045 -0.26000 -0.02829 154 ASN A O   
1214 C CB  . ASN A 154 ? 0.41205 0.31722 0.85024 -0.00012 -0.22351 -0.01460 154 ASN A CB  
1215 C CG  . ASN A 154 ? 0.41859 0.31431 0.83869 0.00543  -0.21559 -0.01596 154 ASN A CG  
1216 O OD1 . ASN A 154 ? 0.45431 0.34230 0.85683 0.00821  -0.22210 -0.02368 154 ASN A OD1 
1217 N ND2 . ASN A 154 ? 0.55272 0.44882 0.97699 0.00768  -0.20161 -0.00852 154 ASN A ND2 
1218 N N   . LEU A 155 ? 0.41165 0.33278 0.90128 -0.01180 -0.24455 -0.01352 155 LEU A N   
1219 C CA  . LEU A 155 ? 0.41273 0.34316 0.90837 -0.01274 -0.25758 -0.01532 155 LEU A CA  
1220 C C   . LEU A 155 ? 0.42578 0.35492 0.93867 -0.01867 -0.27205 -0.02226 155 LEU A C   
1221 O O   . LEU A 155 ? 0.43425 0.36533 0.93782 -0.01822 -0.28651 -0.02836 155 LEU A O   
1222 C CB  . LEU A 155 ? 0.55324 0.49593 1.06806 -0.01229 -0.25144 -0.00675 155 LEU A CB  
1223 C CG  . LEU A 155 ? 0.50896 0.45397 1.00049 -0.00643 -0.24246 -0.00245 155 LEU A CG  
1224 C CD1 . LEU A 155 ? 0.37921 0.33310 0.88942 -0.00588 -0.23182 0.00640  155 LEU A CD1 
1225 C CD2 . LEU A 155 ? 0.44887 0.39444 0.91873 -0.00345 -0.25394 -0.00644 155 LEU A CD2 
1226 N N   . ARG A 156 ? 0.42953 0.35485 0.96632 -0.02475 -0.26838 -0.02203 156 ARG A N   
1227 C CA  . ARG A 156 ? 0.48950 0.41502 1.04387 -0.03172 -0.28234 -0.02981 156 ARG A CA  
1228 C C   . ARG A 156 ? 0.51572 0.42600 1.04794 -0.03196 -0.28952 -0.03958 156 ARG A C   
1229 O O   . ARG A 156 ? 0.64048 0.55223 1.17161 -0.03453 -0.30490 -0.04796 156 ARG A O   
1230 C CB  . ARG A 156 ? 0.45905 0.38710 1.04941 -0.03999 -0.27678 -0.02727 156 ARG A CB  
1231 C CG  . ARG A 156 ? 0.64543 0.56166 1.23615 -0.04052 -0.25915 -0.02136 156 ARG A CG  
1232 C CD  . ARG A 156 ? 0.71023 0.63006 1.33773 -0.04978 -0.25342 -0.01870 156 ARG A CD  
1233 N NE  . ARG A 156 ? 0.68061 0.62201 1.33514 -0.05163 -0.25813 -0.01617 156 ARG A NE  
1234 C CZ  . ARG A 156 ? 0.74069 0.69124 1.42346 -0.05553 -0.24761 -0.00958 156 ARG A CZ  
1235 N NH1 . ARG A 156 ? 0.84728 0.78608 1.53340 -0.05849 -0.23159 -0.00445 156 ARG A NH1 
1236 N NH2 . ARG A 156 ? 0.57515 0.54642 1.28211 -0.05586 -0.25291 -0.00804 156 ARG A NH2 
1237 N N   . CYS A 157 ? 0.49813 0.39432 1.01060 -0.02825 -0.27893 -0.03895 157 CYS A N   
1238 C CA  . CYS A 157 ? 0.47642 0.35849 0.96497 -0.02656 -0.28546 -0.04845 157 CYS A CA  
1239 C C   . CYS A 157 ? 0.49789 0.38570 0.96193 -0.02192 -0.29672 -0.05373 157 CYS A C   
1240 O O   . CYS A 157 ? 0.53156 0.41339 0.98576 -0.02353 -0.30887 -0.06352 157 CYS A O   
1241 C CB  . CYS A 157 ? 0.60193 0.46994 1.07117 -0.02077 -0.27202 -0.04632 157 CYS A CB  
1242 S SG  . CYS A 157 ? 0.82468 0.67604 1.31299 -0.02596 -0.26111 -0.04333 157 CYS A SG  
1243 N N   . MET A 158 ? 0.46360 0.36188 0.91663 -0.01660 -0.29245 -0.04766 158 MET A N   
1244 C CA  . MET A 158 ? 0.46611 0.36895 0.89496 -0.01269 -0.30172 -0.05154 158 MET A CA  
1245 C C   . MET A 158 ? 0.64693 0.55830 1.08801 -0.01607 -0.31815 -0.05466 158 MET A C   
1246 O O   . MET A 158 ? 0.67616 0.58889 1.09574 -0.01318 -0.32770 -0.05876 158 MET A O   
1247 C CB  . MET A 158 ? 0.56148 0.47172 0.97672 -0.00729 -0.29123 -0.04385 158 MET A CB  
1248 C CG  . MET A 158 ? 0.57521 0.48029 0.97072 -0.00255 -0.27725 -0.04275 158 MET A CG  
1249 S SD  . MET A 158 ? 0.54782 0.46333 0.93618 0.00119  -0.26313 -0.03336 158 MET A SD  
1250 C CE  . MET A 158 ? 0.59121 0.50876 0.94551 0.00424  -0.26914 -0.03842 158 MET A CE  
1251 N N   . GLY A 159 ? 0.54368 0.61725 0.91313 -0.17418 -0.26882 -0.06537 159 GLY A N   
1252 C CA  . GLY A 159 ? 0.55227 0.69840 0.94108 -0.19169 -0.29790 -0.07160 159 GLY A CA  
1253 C C   . GLY A 159 ? 0.58428 0.80597 1.02927 -0.16271 -0.31732 -0.05315 159 GLY A C   
1254 O O   . GLY A 159 ? 0.51996 0.79797 0.96508 -0.15785 -0.33690 -0.04788 159 GLY A O   
1255 N N   . ALA A 160 ? 0.47114 0.68881 0.94946 -0.13932 -0.30308 -0.04156 160 ALA A N   
1256 C CA  . ALA A 160 ? 0.45182 0.72576 0.97050 -0.11152 -0.30515 -0.02562 160 ALA A CA  
1257 C C   . ALA A 160 ? 0.54547 0.88870 1.09662 -0.13393 -0.30364 -0.03785 160 ALA A C   
1258 O O   . ALA A 160 ? 0.55279 0.88402 1.09818 -0.17099 -0.29128 -0.05901 160 ALA A O   
1259 C CB  . ALA A 160 ? 0.45344 0.69180 0.98949 -0.08748 -0.28613 -0.01350 160 ALA A CB  
1260 N N   . PRO A 161 ? 0.62913 1.04645 1.21286 -0.11208 -0.31400 -0.02486 161 PRO A N   
1261 C CA  . PRO A 161 ? 0.62476 1.04810 1.21076 -0.06700 -0.32297 0.00112  161 PRO A CA  
1262 C C   . PRO A 161 ? 0.64346 1.09729 1.20078 -0.06325 -0.34805 0.00627  161 PRO A C   
1263 O O   . PRO A 161 ? 0.62964 1.07481 1.17601 -0.02732 -0.35435 0.02771  161 PRO A O   
1264 C CB  . PRO A 161 ? 0.43395 0.92101 1.07103 -0.04601 -0.31651 0.01148  161 PRO A CB  
1265 C CG  . PRO A 161 ? 0.45051 1.01052 1.10719 -0.08402 -0.32110 -0.00986 161 PRO A CG  
1266 C CD  . PRO A 161 ? 0.54408 1.04669 1.16549 -0.12960 -0.31413 -0.03468 161 PRO A CD  
1267 N N   . GLU A 162 ? 0.50134 0.98485 1.04182 -0.10313 -0.35928 -0.01485 162 GLU A N   
1268 C CA  . GLU A 162 ? 0.53331 1.05614 1.04589 -0.10684 -0.38349 -0.01440 162 GLU A CA  
1269 C C   . GLU A 162 ? 0.56808 1.02070 1.03609 -0.08590 -0.38945 -0.00019 162 GLU A C   
1270 O O   . GLU A 162 ? 0.63368 1.11067 1.09028 -0.05727 -0.40417 0.01838  162 GLU A O   
1271 C CB  . GLU A 162 ? 0.61599 1.15775 1.10767 -0.16328 -0.38728 -0.04709 162 GLU A CB  
1272 C CG  . GLU A 162 ? 0.60717 1.13562 1.04703 -0.17785 -0.40524 -0.05331 162 GLU A CG  
1273 N N   . SER A 163 ? 0.56875 0.93559 1.00975 -0.09877 -0.37730 -0.00898 163 SER A N   
1274 C CA  . SER A 163 ? 0.61090 0.91112 1.01204 -0.08060 -0.37984 0.00143  163 SER A CA  
1275 C C   . SER A 163 ? 0.60822 0.88299 1.02808 -0.04004 -0.36622 0.02240  163 SER A C   
1276 O O   . SER A 163 ? 0.62002 0.86417 1.05895 -0.03982 -0.34718 0.01937  163 SER A O   
1277 C CB  . SER A 163 ? 0.64219 0.87037 1.00990 -0.10929 -0.37126 -0.01731 163 SER A CB  
1278 O OG  . SER A 163 ? 0.66571 0.83510 0.99300 -0.09301 -0.37072 -0.00961 163 SER A OG  
1279 N N   . GLY A 164 ? 0.58222 0.86760 0.99258 -0.00775 -0.37385 0.04315  164 GLY A N   
1280 C CA  . GLY A 164 ? 0.54988 0.79755 0.96548 0.02518  -0.35739 0.06046  164 GLY A CA  
1281 C C   . GLY A 164 ? 0.50953 0.68394 0.88883 0.02280  -0.34937 0.05733  164 GLY A C   
1282 O O   . GLY A 164 ? 0.49616 0.63649 0.88059 0.03695  -0.33140 0.06399  164 GLY A O   
1283 N N   . LEU A 165 ? 0.57412 0.72736 0.91599 0.00293  -0.36191 0.04616  165 LEU A N   
1284 C CA  . LEU A 165 ? 0.60950 0.70010 0.91475 -0.00166 -0.34693 0.03982  165 LEU A CA  
1285 C C   . LEU A 165 ? 0.56507 0.63839 0.89003 -0.01151 -0.32382 0.03048  165 LEU A C   
1286 O O   . LEU A 165 ? 0.48936 0.52995 0.80258 -0.00301 -0.30405 0.03352  165 LEU A O   
1287 C CB  . LEU A 165 ? 0.54607 0.61524 0.80413 -0.02219 -0.35606 0.02752  165 LEU A CB  
1288 C CG  . LEU A 165 ? 0.64867 0.65820 0.86594 -0.02149 -0.33524 0.02297  165 LEU A CG  
1289 C CD1 . LEU A 165 ? 0.81206 0.79887 0.97821 -0.02276 -0.34531 0.02309  165 LEU A CD1 
1290 C CD2 . LEU A 165 ? 0.58136 0.56756 0.79346 -0.04089 -0.31887 0.00756  165 LEU A CD2 
1291 N N   . ALA A 166 ? 0.51288 0.61110 0.86526 -0.03133 -0.32527 0.01900  166 ALA A N   
1292 C CA  . ALA A 166 ? 0.46691 0.54552 0.83368 -0.03948 -0.30247 0.01199  166 ALA A CA  
1293 C C   . ALA A 166 ? 0.43964 0.52270 0.83538 -0.02036 -0.28865 0.02382  166 ALA A C   
1294 O O   . ALA A 166 ? 0.50023 0.55360 0.88272 -0.01642 -0.26948 0.02547  166 ALA A O   
1295 C CB  . ALA A 166 ? 0.45157 0.55572 0.84182 -0.06622 -0.30437 -0.00286 166 ALA A CB  
1296 N N   . GLU A 167 ? 0.42567 0.54878 0.85965 -0.00854 -0.29637 0.03253  167 GLU A N   
1297 C CA  . GLU A 167 ? 0.38193 0.50200 0.84028 0.00628  -0.27756 0.04165  167 GLU A CA  
1298 C C   . GLU A 167 ? 0.47470 0.55520 0.89682 0.02064  -0.26495 0.05056  167 GLU A C   
1299 O O   . GLU A 167 ? 0.44114 0.50166 0.86119 0.01916  -0.24260 0.05070  167 GLU A O   
1300 C CB  . GLU A 167 ? 0.38583 0.55126 0.88400 0.02140  -0.28153 0.05103  167 GLU A CB  
1301 C CG  . GLU A 167 ? 0.45006 0.66403 0.97464 0.00295  -0.28878 0.03960  167 GLU A CG  
1302 C CD  . GLU A 167 ? 0.59724 0.85433 1.16900 0.01467  -0.27906 0.04561  167 GLU A CD  
1303 O OE1 . GLU A 167 ? 0.57680 0.85507 1.17400 -0.00639 -0.27232 0.03241  167 GLU A OE1 
1304 O OE2 . GLU A 167 ? 0.59247 0.85971 1.17422 0.04553  -0.27613 0.06372  167 GLU A OE2 
1305 N N   . TYR A 168 ? 0.47112 0.54136 0.86086 0.03080  -0.27780 0.05679  168 TYR A N   
1306 C CA  . TYR A 168 ? 0.47624 0.50526 0.82417 0.03780  -0.26328 0.06136  168 TYR A CA  
1307 C C   . TYR A 168 ? 0.43720 0.44656 0.76524 0.02171  -0.24889 0.05094  168 TYR A C   
1308 O O   . TYR A 168 ? 0.51546 0.51247 0.83654 0.01898  -0.22747 0.05126  168 TYR A O   
1309 C CB  . TYR A 168 ? 0.45506 0.47346 0.76615 0.04742  -0.28015 0.06757  168 TYR A CB  
1310 C CG  . TYR A 168 ? 0.58635 0.55993 0.84828 0.04958  -0.26400 0.06911  168 TYR A CG  
1311 C CD1 . TYR A 168 ? 0.54056 0.49777 0.77427 0.03438  -0.25848 0.05804  168 TYR A CD1 
1312 C CD2 . TYR A 168 ? 0.66433 0.61103 0.90541 0.06713  -0.25091 0.08180  168 TYR A CD2 
1313 C CE1 . TYR A 168 ? 0.53420 0.46081 0.72580 0.03236  -0.24305 0.05719  168 TYR A CE1 
1314 C CE2 . TYR A 168 ? 0.64732 0.55084 0.83858 0.06250  -0.23267 0.07978  168 TYR A CE2 
1315 C CZ  . TYR A 168 ? 0.61024 0.50931 0.77927 0.04300  -0.23020 0.06630  168 TYR A CZ  
1316 O OH  . TYR A 168 ? 0.55247 0.41839 0.67413 0.03453  -0.21119 0.06211  168 TYR A OH  
1317 N N   . LEU A 169 ? 0.56952 0.57843 0.88691 0.01077  -0.25830 0.04214  169 LEU A N   
1318 C CA  . LEU A 169 ? 0.46602 0.45901 0.76164 0.00427  -0.24409 0.03707  169 LEU A CA  
1319 C C   . LEU A 169 ? 0.45571 0.45951 0.77636 -0.00047 -0.22741 0.03674  169 LEU A C   
1320 O O   . LEU A 169 ? 0.40336 0.40756 0.71090 -0.00105 -0.21204 0.03849  169 LEU A O   
1321 C CB  . LEU A 169 ? 0.44290 0.42245 0.71731 -0.00286 -0.25214 0.02921  169 LEU A CB  
1322 C CG  . LEU A 169 ? 0.51463 0.47622 0.74944 -0.00108 -0.26289 0.02822  169 LEU A CG  
1323 C CD1 . LEU A 169 ? 0.47524 0.41578 0.68451 -0.01178 -0.26481 0.01828  169 LEU A CD1 
1324 C CD2 . LEU A 169 ? 0.45776 0.40740 0.66546 0.00614  -0.24935 0.03223  169 LEU A CD2 
1325 N N   . PHE A 170 ? 0.56688 0.58556 0.92325 -0.00528 -0.23020 0.03459  170 PHE A N   
1326 C CA  . PHE A 170 ? 0.40700 0.43308 0.78549 -0.01093 -0.21376 0.03445  170 PHE A CA  
1327 C C   . PHE A 170 ? 0.40828 0.43786 0.78972 -0.00896 -0.19865 0.03971  170 PHE A C   
1328 O O   . PHE A 170 ? 0.32939 0.36372 0.70871 -0.01576 -0.18242 0.04024  170 PHE A O   
1329 C CB  . PHE A 170 ? 0.34410 0.38590 0.76014 -0.01909 -0.21881 0.02910  170 PHE A CB  
1330 C CG  . PHE A 170 ? 0.37681 0.42107 0.81250 -0.02682 -0.20116 0.02798  170 PHE A CG  
1331 C CD1 . PHE A 170 ? 0.33894 0.36673 0.76169 -0.03406 -0.19207 0.02451  170 PHE A CD1 
1332 C CD2 . PHE A 170 ? 0.31546 0.37196 0.77708 -0.02603 -0.19015 0.03123  170 PHE A CD2 
1333 C CE1 . PHE A 170 ? 0.33167 0.35910 0.76713 -0.04055 -0.17553 0.02508  170 PHE A CE1 
1334 C CE2 . PHE A 170 ? 0.30581 0.36310 0.78160 -0.03584 -0.17318 0.02950  170 PHE A CE2 
1335 C CZ  . PHE A 170 ? 0.39170 0.43665 0.85477 -0.04318 -0.16754 0.02683  170 PHE A CZ  
1336 N N   . ASP A 171 ? 0.34547 0.37115 0.72810 -0.00037 -0.20142 0.04412  171 ASP A N   
1337 C CA  . ASP A 171 ? 0.35030 0.36421 0.72412 -0.00114 -0.18023 0.04736  171 ASP A CA  
1338 C C   . ASP A 171 ? 0.41492 0.42023 0.74744 -0.01049 -0.16885 0.04480  171 ASP A C   
1339 O O   . ASP A 171 ? 0.36110 0.36867 0.68426 -0.02436 -0.14775 0.04221  171 ASP A O   
1340 C CB  . ASP A 171 ? 0.38000 0.38198 0.75618 0.01632  -0.18267 0.05576  171 ASP A CB  
1341 C CG  . ASP A 171 ? 0.43964 0.40917 0.78847 0.01602  -0.15512 0.05873  171 ASP A CG  
1342 O OD1 . ASP A 171 ? 0.49006 0.43892 0.79571 0.00990  -0.14918 0.05644  171 ASP A OD1 
1343 O OD2 . ASP A 171 ? 0.44791 0.40897 0.81513 0.02111  -0.13662 0.06259  171 ASP A OD2 
1344 N N   . LYS A 172 ? 0.39854 0.39879 0.70521 -0.00606 -0.18153 0.04424  172 LYS A N   
1345 C CA  . LYS A 172 ? 0.40617 0.40904 0.67761 -0.01526 -0.17026 0.04115  172 LYS A CA  
1346 C C   . LYS A 172 ? 0.41076 0.44474 0.68825 -0.02100 -0.16533 0.04069  172 LYS A C   
1347 O O   . LYS A 172 ? 0.38338 0.43993 0.64860 -0.03424 -0.14957 0.03909  172 LYS A O   
1348 C CB  . LYS A 172 ? 0.41892 0.40599 0.65966 -0.00812 -0.18222 0.04070  172 LYS A CB  
1349 C CG  . LYS A 172 ? 0.59062 0.54726 0.81810 0.00172  -0.18786 0.04514  172 LYS A CG  
1350 C CD  . LYS A 172 ? 0.52966 0.46083 0.73331 -0.00483 -0.16242 0.04562  172 LYS A CD  
1351 C CE  . LYS A 172 ? 0.58408 0.48483 0.78501 0.01563  -0.16587 0.05667  172 LYS A CE  
1352 N NZ  . LYS A 172 ? 0.49087 0.41807 0.74217 0.03078  -0.18520 0.06351  172 LYS A NZ  
1353 N N   . HIS A 173 ? 0.41570 0.45199 0.70868 -0.01208 -0.17629 0.04263  173 HIS A N   
1354 C CA  . HIS A 173 ? 0.44727 0.50518 0.73654 -0.00863 -0.16971 0.04688  173 HIS A CA  
1355 C C   . HIS A 173 ? 0.42656 0.50120 0.73740 -0.01465 -0.15965 0.05002  173 HIS A C   
1356 O O   . HIS A 173 ? 0.71929 0.82644 1.02247 -0.01673 -0.14918 0.05550  173 HIS A O   
1357 C CB  . HIS A 173 ? 0.45647 0.49385 0.73798 0.00429  -0.17820 0.04775  173 HIS A CB  
1358 C CG  . HIS A 173 ? 0.46120 0.48709 0.71376 0.01017  -0.18353 0.04572  173 HIS A CG  
1359 N ND1 . HIS A 173 ? 0.45682 0.50637 0.68880 0.01462  -0.17429 0.04905  173 HIS A ND1 
1360 C CD2 . HIS A 173 ? 0.52543 0.52325 0.76539 0.01045  -0.19688 0.04031  173 HIS A CD2 
1361 C CE1 . HIS A 173 ? 0.51787 0.54763 0.72552 0.01781  -0.17975 0.04498  173 HIS A CE1 
1362 N NE2 . HIS A 173 ? 0.59150 0.58740 0.80117 0.01510  -0.19387 0.03994  173 HIS A NE2 
1363 N N   . THR A 174 ? 0.38489 0.44421 0.72219 -0.01796 -0.16249 0.04714  174 THR A N   
1364 C CA  . THR A 174 ? 0.32002 0.39131 0.67341 -0.02478 -0.15101 0.04964  174 THR A CA  
1365 C C   . THR A 174 ? 0.37157 0.45329 0.73228 -0.04100 -0.13786 0.04647  174 THR A C   
1366 O O   . THR A 174 ? 0.36887 0.47574 0.72072 -0.05205 -0.12500 0.04889  174 THR A O   
1367 C CB  . THR A 174 ? 0.37371 0.42448 0.75037 -0.02438 -0.15574 0.04608  174 THR A CB  
1368 O OG1 . THR A 174 ? 0.45221 0.48392 0.81113 -0.01426 -0.16021 0.04735  174 THR A OG1 
1369 C CG2 . THR A 174 ? 0.30394 0.36133 0.69532 -0.03332 -0.14182 0.04772  174 THR A CG2 
1370 N N   . LEU A 175 ? 0.50195 0.56477 0.87538 -0.04226 -0.13870 0.04194  175 LEU A N   
1371 C CA  . LEU A 175 ? 0.47183 0.53032 0.84462 -0.05644 -0.11902 0.03870  175 LEU A CA  
1372 C C   . LEU A 175 ? 0.37965 0.43911 0.71451 -0.06783 -0.10752 0.03586  175 LEU A C   
1373 O O   . LEU A 175 ? 0.40851 0.46211 0.73018 -0.08723 -0.08478 0.03071  175 LEU A O   
1374 C CB  . LEU A 175 ? 0.31567 0.35233 0.71495 -0.04719 -0.11928 0.03842  175 LEU A CB  
1375 C CG  . LEU A 175 ? 0.44436 0.49004 0.88241 -0.04140 -0.13107 0.03804  175 LEU A CG  
1376 C CD1 . LEU A 175 ? 0.31787 0.36143 0.78811 -0.02846 -0.13577 0.03973  175 LEU A CD1 
1377 C CD2 . LEU A 175 ? 0.40486 0.45921 0.85345 -0.05637 -0.11612 0.03575  175 LEU A CD2 
1378 N N   . GLY A 176 ? 0.44455 0.50946 0.75818 -0.06008 -0.11924 0.03715  176 GLY A N   
1379 C CA  . GLY A 176 ? 0.53264 0.59971 0.80860 -0.07401 -0.10730 0.03212  176 GLY A CA  
1380 C C   . GLY A 176 ? 0.56520 0.68356 0.82444 -0.09198 -0.09868 0.03060  176 GLY A C   
1381 O O   . GLY A 176 ? 0.63670 0.76510 0.86762 -0.11807 -0.07968 0.02206  176 GLY A O   
1382 N N   . THR B 5   ? 0.84942 0.71291 1.65321 -0.03050 -0.15826 0.07023  5   THR B N   
1383 C CA  . THR B 5   ? 0.79364 0.65660 1.60467 -0.03084 -0.16600 0.07782  5   THR B CA  
1384 C C   . THR B 5   ? 0.71274 0.57979 1.50846 -0.02953 -0.16774 0.07972  5   THR B C   
1385 O O   . THR B 5   ? 0.77480 0.63884 1.56483 -0.03103 -0.17461 0.08813  5   THR B O   
1386 C CB  . THR B 5   ? 0.82208 0.67524 1.62662 -0.03477 -0.17142 0.08847  5   THR B CB  
1387 O OG1 . THR B 5   ? 0.93762 0.78682 1.71404 -0.03642 -0.17243 0.09479  5   THR B OG1 
1388 C CG2 . THR B 5   ? 0.79271 0.64044 1.60109 -0.03687 -0.16753 0.08695  5   THR B CG2 
1389 N N   . SER B 6   ? 0.55875 0.43186 1.34680 -0.02699 -0.16171 0.07200  6   SER B N   
1390 C CA  . SER B 6   ? 0.51871 0.39488 1.28940 -0.02604 -0.16255 0.07378  6   SER B CA  
1391 C C   . SER B 6   ? 0.49431 0.37666 1.28218 -0.02417 -0.16663 0.07351  6   SER B C   
1392 O O   . SER B 6   ? 0.43946 0.32737 1.24898 -0.02185 -0.16379 0.06640  6   SER B O   
1393 C CB  . SER B 6   ? 0.45577 0.33555 1.21077 -0.02416 -0.15456 0.06594  6   SER B CB  
1394 O OG  . SER B 6   ? 0.42446 0.30672 1.16315 -0.02337 -0.15557 0.06811  6   SER B OG  
1395 N N   . GLN B 7   ? 0.44410 0.32494 1.22194 -0.02543 -0.17322 0.08133  7   GLN B N   
1396 C CA  . GLN B 7   ? 0.44108 0.32789 1.23337 -0.02410 -0.17785 0.08196  7   GLN B CA  
1397 C C   . GLN B 7   ? 0.53330 0.42851 1.32662 -0.02084 -0.17109 0.07313  7   GLN B C   
1398 O O   . GLN B 7   ? 0.42389 0.32539 1.23691 -0.01924 -0.17247 0.07098  7   GLN B O   
1399 C CB  . GLN B 7   ? 0.44594 0.32841 1.22201 -0.02651 -0.18601 0.09161  7   GLN B CB  
1400 C CG  . GLN B 7   ? 0.43872 0.31905 1.18236 -0.02685 -0.18250 0.09220  7   GLN B CG  
1401 C CD  . GLN B 7   ? 0.44617 0.32014 1.17118 -0.02965 -0.19039 0.10173  7   GLN B CD  
1402 O OE1 . GLN B 7   ? 0.45398 0.32727 1.19153 -0.03087 -0.19900 0.10693  7   GLN B OE1 
1403 N NE2 . GLN B 7   ? 0.44477 0.31341 1.13931 -0.03081 -0.18743 0.10395  7   GLN B NE2 
1404 N N   . VAL B 8   ? 0.41816 0.31330 1.19077 -0.01996 -0.16372 0.06812  8   VAL B N   
1405 C CA  . VAL B 8   ? 0.43376 0.33557 1.20509 -0.01704 -0.15671 0.05946  8   VAL B CA  
1406 C C   . VAL B 8   ? 0.40389 0.30817 1.18909 -0.01505 -0.14902 0.04910  8   VAL B C   
1407 O O   . VAL B 8   ? 0.47872 0.38783 1.26527 -0.01271 -0.14280 0.04122  8   VAL B O   
1408 C CB  . VAL B 8   ? 0.42782 0.32808 1.16768 -0.01705 -0.15287 0.05925  8   VAL B CB  
1409 C CG1 . VAL B 8   ? 0.40077 0.29684 1.12271 -0.01935 -0.15986 0.06924  8   VAL B CG1 
1410 C CG2 . VAL B 8   ? 0.39758 0.29368 1.12401 -0.01759 -0.14746 0.05613  8   VAL B CG2 
1411 N N   . ARG B 9   ? 0.41211 0.31239 1.20589 -0.01614 -0.14891 0.04862  9   ARG B N   
1412 C CA  . ARG B 9   ? 0.41532 0.31625 1.21682 -0.01474 -0.14144 0.03841  9   ARG B CA  
1413 C C   . ARG B 9   ? 0.51888 0.42479 1.34731 -0.01268 -0.13928 0.03224  9   ARG B C   
1414 O O   . ARG B 9   ? 0.41871 0.32561 1.26824 -0.01307 -0.14463 0.03664  9   ARG B O   
1415 C CB  . ARG B 9   ? 0.44052 0.33533 1.24443 -0.01687 -0.14225 0.03990  9   ARG B CB  
1416 C CG  . ARG B 9   ? 0.48141 0.37558 1.29073 -0.01606 -0.13520 0.02941  9   ARG B CG  
1417 C CD  . ARG B 9   ? 0.43184 0.31964 1.24252 -0.01867 -0.13622 0.03141  9   ARG B CD  
1418 N NE  . ARG B 9   ? 0.43126 0.31802 1.23960 -0.01835 -0.12966 0.02139  9   ARG B NE  
1419 C CZ  . ARG B 9   ? 0.43376 0.31627 1.23054 -0.02040 -0.12827 0.02124  9   ARG B CZ  
1420 N NH1 . ARG B 9   ? 0.43724 0.31581 1.22340 -0.02294 -0.13212 0.03072  9   ARG B NH1 
1421 N NH2 . ARG B 9   ? 0.43353 0.31538 1.22894 -0.02016 -0.12295 0.01151  9   ARG B NH2 
1422 N N   . GLN B 10  ? 0.40640 0.31495 1.23376 -0.01063 -0.13125 0.02205  10  GLN B N   
1423 C CA  . GLN B 10  ? 0.40775 0.32035 1.25883 -0.00880 -0.12759 0.01548  10  GLN B CA  
1424 C C   . GLN B 10  ? 0.40687 0.31824 1.25307 -0.00756 -0.11831 0.00352  10  GLN B C   
1425 O O   . GLN B 10  ? 0.39897 0.31036 1.22338 -0.00691 -0.11406 -0.00014 10  GLN B O   
1426 C CB  . GLN B 10  ? 0.42870 0.34726 1.28331 -0.00764 -0.12878 0.01779  10  GLN B CB  
1427 C CG  . GLN B 10  ? 0.40276 0.32584 1.28386 -0.00603 -0.12508 0.01226  10  GLN B CG  
1428 C CD  . GLN B 10  ? 0.48288 0.41202 1.37134 -0.00554 -0.12836 0.01689  10  GLN B CD  
1429 O OE1 . GLN B 10  ? 0.47453 0.40476 1.34306 -0.00567 -0.12960 0.02006  10  GLN B OE1 
1430 N NE2 . GLN B 10  ? 0.40207 0.33500 1.31974 -0.00514 -0.12998 0.01745  10  GLN B NE2 
1431 N N   . ASN B 11  ? 0.41511 0.32473 1.28073 -0.00739 -0.11531 -0.00263 11  ASN B N   
1432 C CA  . ASN B 11  ? 0.41703 0.32410 1.27894 -0.00660 -0.10686 -0.01459 11  ASN B CA  
1433 C C   . ASN B 11  ? 0.41436 0.31736 1.25074 -0.00756 -0.10530 -0.01699 11  ASN B C   
1434 O O   . ASN B 11  ? 0.41153 0.31335 1.23418 -0.00673 -0.09907 -0.02545 11  ASN B O   
1435 C CB  . ASN B 11  ? 0.41198 0.32269 1.27466 -0.00457 -0.10028 -0.02107 11  ASN B CB  
1436 C CG  . ASN B 11  ? 0.41785 0.32450 1.28006 -0.00398 -0.09156 -0.03376 11  ASN B CG  
1437 O OD1 . ASN B 11  ? 0.49596 0.39862 1.37189 -0.00475 -0.09053 -0.03797 11  ASN B OD1 
1438 N ND2 . ASN B 11  ? 0.41246 0.31915 1.25775 -0.00280 -0.08532 -0.04000 11  ASN B ND2 
1439 N N   . TYR B 12  ? 0.41636 0.31672 1.24669 -0.00950 -0.11088 -0.00958 12  TYR B N   
1440 C CA  . TYR B 12  ? 0.49675 0.39360 1.30473 -0.01076 -0.10994 -0.01049 12  TYR B CA  
1441 C C   . TYR B 12  ? 0.45815 0.34980 1.27479 -0.01290 -0.11103 -0.01177 12  TYR B C   
1442 O O   . TYR B 12  ? 0.49477 0.38442 1.31670 -0.01474 -0.11652 -0.00332 12  TYR B O   
1443 C CB  . TYR B 12  ? 0.50724 0.40486 1.29689 -0.01160 -0.11463 -0.00030 12  TYR B CB  
1444 C CG  . TYR B 12  ? 0.40233 0.29757 1.16721 -0.01238 -0.11223 -0.00192 12  TYR B CG  
1445 C CD1 . TYR B 12  ? 0.39726 0.29295 1.14986 -0.01096 -0.10596 -0.01144 12  TYR B CD1 
1446 C CD2 . TYR B 12  ? 0.40369 0.29580 1.15734 -0.01469 -0.11605 0.00612  12  TYR B CD2 
1447 C CE1 . TYR B 12  ? 0.53782 0.43154 1.26816 -0.01166 -0.10410 -0.01287 12  TYR B CE1 
1448 C CE2 . TYR B 12  ? 0.39912 0.28940 1.13113 -0.01548 -0.11360 0.00490  12  TYR B CE2 
1449 C CZ  . TYR B 12  ? 0.39332 0.28473 1.11433 -0.01389 -0.10790 -0.00461 12  TYR B CZ  
1450 O OH  . TYR B 12  ? 0.38902 0.27879 1.08971 -0.01468 -0.10585 -0.00580 12  TYR B OH  
1451 N N   . HIS B 13  ? 0.42911 0.31786 1.24592 -0.01297 -0.10587 -0.02235 13  HIS B N   
1452 C CA  . HIS B 13  ? 0.53163 0.41533 1.36001 -0.01512 -0.10648 -0.02500 13  HIS B CA  
1453 C C   . HIS B 13  ? 0.60500 0.48559 1.41856 -0.01766 -0.10877 -0.02110 13  HIS B C   
1454 O O   . HIS B 13  ? 0.43269 0.31409 1.22500 -0.01756 -0.10736 -0.02157 13  HIS B O   
1455 C CB  . HIS B 13  ? 0.44737 0.32814 1.28085 -0.01470 -0.10041 -0.03816 13  HIS B CB  
1456 C CG  . HIS B 13  ? 0.61966 0.49504 1.46831 -0.01697 -0.10096 -0.04151 13  HIS B CG  
1457 N ND1 . HIS B 13  ? 0.60913 0.48040 1.45004 -0.01969 -0.10210 -0.04257 13  HIS B ND1 
1458 C CD2 . HIS B 13  ? 0.47143 0.34477 1.34323 -0.01713 -0.10065 -0.04357 13  HIS B CD2 
1459 C CE1 . HIS B 13  ? 0.47812 0.34487 1.33620 -0.02153 -0.10243 -0.04550 13  HIS B CE1 
1460 N NE2 . HIS B 13  ? 0.54070 0.40838 1.41726 -0.01994 -0.10148 -0.04621 13  HIS B NE2 
1461 N N   . GLN B 14  ? 0.45057 0.32742 1.27627 -0.02009 -0.11207 -0.01704 14  GLN B N   
1462 C CA  . GLN B 14  ? 0.61518 0.48872 1.42999 -0.02302 -0.11402 -0.01254 14  GLN B CA  
1463 C C   . GLN B 14  ? 0.45034 0.32259 1.25037 -0.02376 -0.11003 -0.02134 14  GLN B C   
1464 O O   . GLN B 14  ? 0.44556 0.31756 1.22880 -0.02515 -0.11053 -0.01770 14  GLN B O   
1465 C CB  . GLN B 14  ? 0.61906 0.48799 1.45214 -0.02565 -0.11689 -0.00933 14  GLN B CB  
1466 C CG  . GLN B 14  ? 0.66626 0.53245 1.49247 -0.02845 -0.12093 0.00179  14  GLN B CG  
1467 C CD  . GLN B 14  ? 0.75193 0.62020 1.57278 -0.02755 -0.12522 0.01281  14  GLN B CD  
1468 O OE1 . GLN B 14  ? 0.86412 0.73121 1.66815 -0.02902 -0.12687 0.02051  14  GLN B OE1 
1469 N NE2 . GLN B 14  ? 0.68845 0.55939 1.52367 -0.02545 -0.12709 0.01365  14  GLN B NE2 
1470 N N   . ASP B 15  ? 0.45467 0.32567 1.26029 -0.02303 -0.10607 -0.03303 15  ASP B N   
1471 C CA  . ASP B 15  ? 0.45352 0.32300 1.24430 -0.02370 -0.10281 -0.04219 15  ASP B CA  
1472 C C   . ASP B 15  ? 0.50936 0.38269 1.27830 -0.02146 -0.10092 -0.04191 15  ASP B C   
1473 O O   . ASP B 15  ? 0.43592 0.30894 1.18819 -0.02251 -0.10042 -0.04307 15  ASP B O   
1474 C CB  . ASP B 15  ? 0.46314 0.32917 1.26315 -0.02358 -0.09912 -0.05486 15  ASP B CB  
1475 C CG  . ASP B 15  ? 0.70498 0.56622 1.52553 -0.02626 -0.10065 -0.05628 15  ASP B CG  
1476 O OD1 . ASP B 15  ? 0.62898 0.48973 1.45771 -0.02807 -0.10452 -0.04724 15  ASP B OD1 
1477 O OD2 . ASP B 15  ? 0.59391 0.45109 1.42164 -0.02674 -0.09776 -0.06665 15  ASP B OD2 
1478 N N   . SER B 16  ? 0.53619 0.41317 1.30547 -0.01851 -0.09973 -0.04056 16  SER B N   
1479 C CA  . SER B 16  ? 0.44544 0.32588 1.19392 -0.01656 -0.09809 -0.03919 16  SER B CA  
1480 C C   . SER B 16  ? 0.41449 0.29596 1.14931 -0.01784 -0.10153 -0.02860 16  SER B C   
1481 O O   . SER B 16  ? 0.40778 0.28955 1.12297 -0.01788 -0.10001 -0.02965 16  SER B O   
1482 C CB  . SER B 16  ? 0.41633 0.30062 1.17034 -0.01375 -0.09678 -0.03815 16  SER B CB  
1483 O OG  . SER B 16  ? 0.42410 0.30666 1.19169 -0.01286 -0.09289 -0.04775 16  SER B OG  
1484 N N   . GLU B 17  ? 0.41748 0.29876 1.16188 -0.01907 -0.10604 -0.01843 17  GLU B N   
1485 C CA  . GLU B 17  ? 0.48260 0.36321 1.21384 -0.02086 -0.10902 -0.00806 17  GLU B CA  
1486 C C   . GLU B 17  ? 0.50220 0.38014 1.22352 -0.02332 -0.10769 -0.01055 17  GLU B C   
1487 O O   . GLU B 17  ? 0.40818 0.28684 1.10982 -0.02352 -0.10664 -0.00811 17  GLU B O   
1488 C CB  . GLU B 17  ? 0.42172 0.30052 1.16715 -0.02245 -0.11402 0.00171  17  GLU B CB  
1489 C CG  . GLU B 17  ? 0.42008 0.29732 1.15170 -0.02425 -0.11737 0.01383  17  GLU B CG  
1490 C CD  . GLU B 17  ? 0.57060 0.44482 1.31620 -0.02605 -0.12257 0.02295  17  GLU B CD  
1491 O OE1 . GLU B 17  ? 0.59221 0.46630 1.35920 -0.02561 -0.12375 0.02020  17  GLU B OE1 
1492 O OE2 . GLU B 17  ? 0.43184 0.30316 1.16670 -0.02803 -0.12540 0.03289  17  GLU B OE2 
1493 N N   . ALA B 18  ? 0.42605 0.30084 1.16137 -0.02542 -0.10773 -0.01547 18  ALA B N   
1494 C CA  . ALA B 18  ? 0.42872 0.30126 1.15744 -0.02831 -0.10694 -0.01802 18  ALA B CA  
1495 C C   . ALA B 18  ? 0.42175 0.29582 1.13416 -0.02709 -0.10355 -0.02691 18  ALA B C   
1496 O O   . ALA B 18  ? 0.41746 0.29175 1.11562 -0.02851 -0.10305 -0.02537 18  ALA B O   
1497 C CB  . ALA B 18  ? 0.44212 0.31087 1.18998 -0.03095 -0.10767 -0.02282 18  ALA B CB  
1498 N N   . ALA B 19  ? 0.42151 0.29620 1.13573 -0.02464 -0.10101 -0.03635 19  ALA B N   
1499 C CA  . ALA B 19  ? 0.45733 0.33241 1.15535 -0.02355 -0.09787 -0.04537 19  ALA B CA  
1500 C C   . ALA B 19  ? 0.42481 0.30309 1.10190 -0.02165 -0.09689 -0.03987 19  ALA B C   
1501 O O   . ALA B 19  ? 0.49564 0.37407 1.15634 -0.02182 -0.09541 -0.04329 19  ALA B O   
1502 C CB  . ALA B 19  ? 0.42130 0.29518 1.12521 -0.02146 -0.09484 -0.05613 19  ALA B CB  
1503 N N   . ILE B 20  ? 0.42408 0.30469 1.10142 -0.02007 -0.09802 -0.03119 20  ILE B N   
1504 C CA  . ILE B 20  ? 0.49283 0.37575 1.15002 -0.01875 -0.09739 -0.02507 20  ILE B CA  
1505 C C   . ILE B 20  ? 0.38559 0.26736 1.03259 -0.02142 -0.09881 -0.01765 20  ILE B C   
1506 O O   . ILE B 20  ? 0.41640 0.29889 1.04431 -0.02103 -0.09700 -0.01715 20  ILE B O   
1507 C CB  . ILE B 20  ? 0.38329 0.26857 1.04392 -0.01699 -0.09897 -0.01765 20  ILE B CB  
1508 C CG1 . ILE B 20  ? 0.38632 0.27340 1.05294 -0.01418 -0.09608 -0.02556 20  ILE B CG1 
1509 C CG2 . ILE B 20  ? 0.37357 0.26013 1.01282 -0.01649 -0.09916 -0.00939 20  ILE B CG2 
1510 C CD1 . ILE B 20  ? 0.44099 0.32890 1.08718 -0.01212 -0.09180 -0.03153 20  ILE B CD1 
1511 N N   . ASN B 21  ? 0.39339 0.27303 1.05270 -0.02421 -0.10169 -0.01147 21  ASN B N   
1512 C CA  . ASN B 21  ? 0.45152 0.32951 1.10243 -0.02723 -0.10220 -0.00482 21  ASN B CA  
1513 C C   . ASN B 21  ? 0.47595 0.35447 1.12316 -0.02838 -0.10048 -0.01291 21  ASN B C   
1514 O O   . ASN B 21  ? 0.39844 0.27877 1.03589 -0.02880 -0.10007 -0.00993 21  ASN B O   
1515 C CB  . ASN B 21  ? 0.40786 0.28278 1.07465 -0.03027 -0.10517 0.00206  21  ASN B CB  
1516 C CG  . ASN B 21  ? 0.54375 0.41790 1.21043 -0.02979 -0.10796 0.01286  21  ASN B CG  
1517 O OD1 . ASN B 21  ? 0.39810 0.27281 1.04750 -0.02899 -0.10770 0.01906  21  ASN B OD1 
1518 N ND2 . ASN B 21  ? 0.41375 0.28628 1.09924 -0.03034 -0.11083 0.01479  21  ASN B ND2 
1519 N N   . ARG B 22  ? 0.40019 0.27843 1.06193 -0.02851 -0.10065 -0.02348 22  ARG B N   
1520 C CA  . ARG B 22  ? 0.59458 0.47471 1.26068 -0.02927 -0.10103 -0.03226 22  ARG B CA  
1521 C C   . ARG B 22  ? 0.50185 0.38495 1.15193 -0.02616 -0.09913 -0.03689 22  ARG B C   
1522 O O   . ARG B 22  ? 0.45492 0.34036 1.10227 -0.02669 -0.09979 -0.03924 22  ARG B O   
1523 C CB  . ARG B 22  ? 0.52647 0.40450 1.20908 -0.03024 -0.10167 -0.04335 22  ARG B CB  
1524 C CG  . ARG B 22  ? 0.59657 0.47188 1.29631 -0.03420 -0.10390 -0.04016 22  ARG B CG  
1525 C CD  . ARG B 22  ? 0.56082 0.43364 1.27607 -0.03570 -0.10467 -0.05197 22  ARG B CD  
1526 N NE  . ARG B 22  ? 0.53430 0.40482 1.25012 -0.03319 -0.10256 -0.05775 22  ARG B NE  
1527 C CZ  . ARG B 22  ? 0.54966 0.41699 1.27508 -0.03358 -0.10233 -0.05482 22  ARG B CZ  
1528 N NH1 . ARG B 22  ? 0.53160 0.39722 1.26589 -0.03638 -0.10428 -0.04632 22  ARG B NH1 
1529 N NH2 . ARG B 22  ? 0.44966 0.31564 1.17753 -0.03110 -0.10015 -0.06039 22  ARG B NH2 
1530 N N   . GLN B 23  ? 0.41096 0.29396 1.05082 -0.02298 -0.09671 -0.03836 23  GLN B N   
1531 C CA  . GLN B 23  ? 0.37755 0.26265 1.00130 -0.02009 -0.09447 -0.04287 23  GLN B CA  
1532 C C   . GLN B 23  ? 0.47956 0.36644 1.08782 -0.01997 -0.09429 -0.03289 23  GLN B C   
1533 O O   . GLN B 23  ? 0.36237 0.25126 0.96113 -0.01890 -0.09363 -0.03584 23  GLN B O   
1534 C CB  . GLN B 23  ? 0.47647 0.36059 1.09365 -0.01709 -0.09132 -0.04669 23  GLN B CB  
1535 C CG  . GLN B 23  ? 0.55240 0.43741 1.15415 -0.01416 -0.08839 -0.05399 23  GLN B CG  
1536 C CD  . GLN B 23  ? 0.53065 0.41481 1.13802 -0.01437 -0.08889 -0.06698 23  GLN B CD  
1537 O OE1 . GLN B 23  ? 0.59957 0.48498 1.19646 -0.01316 -0.08866 -0.07165 23  GLN B OE1 
1538 N NE2 . GLN B 23  ? 0.41829 0.29981 1.04131 -0.01591 -0.08972 -0.07321 23  GLN B NE2 
1539 N N   . ILE B 24  ? 0.36705 0.25258 0.97172 -0.02111 -0.09488 -0.02124 24  ILE B N   
1540 C CA  . ILE B 24  ? 0.40113 0.28688 0.99063 -0.02174 -0.09460 -0.01095 24  ILE B CA  
1541 C C   . ILE B 24  ? 0.47477 0.36209 1.06980 -0.02397 -0.09566 -0.01078 24  ILE B C   
1542 O O   . ILE B 24  ? 0.43870 0.32777 1.02169 -0.02319 -0.09448 -0.00925 24  ILE B O   
1543 C CB  . ILE B 24  ? 0.41846 0.30101 1.00536 -0.02347 -0.09571 0.00059  24  ILE B CB  
1544 C CG1 . ILE B 24  ? 0.48804 0.37100 1.07121 -0.02081 -0.09569 0.00181  24  ILE B CG1 
1545 C CG2 . ILE B 24  ? 0.36174 0.24305 0.93532 -0.02530 -0.09537 0.01103  24  ILE B CG2 
1546 C CD1 . ILE B 24  ? 0.36714 0.24881 0.96257 -0.02205 -0.09947 0.01061  24  ILE B CD1 
1547 N N   . ASN B 25  ? 0.37120 0.25785 0.98511 -0.02696 -0.09783 -0.01204 25  ASN B N   
1548 C CA  . ASN B 25  ? 0.37336 0.26197 0.99548 -0.02951 -0.09897 -0.01235 25  ASN B CA  
1549 C C   . ASN B 25  ? 0.42437 0.31640 1.04570 -0.02765 -0.09915 -0.02344 25  ASN B C   
1550 O O   . ASN B 25  ? 0.40174 0.29640 1.01887 -0.02803 -0.09909 -0.02187 25  ASN B O   
1551 C CB  . ASN B 25  ? 0.42821 0.31533 1.07162 -0.03310 -0.10119 -0.01369 25  ASN B CB  
1552 C CG  . ASN B 25  ? 0.45675 0.34620 1.10962 -0.03631 -0.10226 -0.01282 25  ASN B CG  
1553 O OD1 . ASN B 25  ? 0.38707 0.27608 1.03529 -0.03831 -0.10112 -0.00214 25  ASN B OD1 
1554 N ND2 . ASN B 25  ? 0.39189 0.28374 1.05693 -0.03694 -0.10429 -0.02415 25  ASN B ND2 
1555 N N   . LEU B 26  ? 0.37225 0.26391 0.99740 -0.02573 -0.09930 -0.03493 26  LEU B N   
1556 C CA  . LEU B 26  ? 0.37084 0.26471 0.99382 -0.02409 -0.09980 -0.04656 26  LEU B CA  
1557 C C   . LEU B 26  ? 0.46826 0.36379 1.07082 -0.02105 -0.09751 -0.04429 26  LEU B C   
1558 O O   . LEU B 26  ? 0.38840 0.28653 0.98861 -0.02061 -0.09852 -0.04885 26  LEU B O   
1559 C CB  . LEU B 26  ? 0.43056 0.32223 1.05765 -0.02257 -0.09945 -0.05869 26  LEU B CB  
1560 C CG  . LEU B 26  ? 0.48203 0.37445 1.10932 -0.02172 -0.10088 -0.07283 26  LEU B CG  
1561 C CD1 . LEU B 26  ? 0.41892 0.31391 1.06010 -0.02525 -0.10513 -0.07497 26  LEU B CD1 
1562 C CD2 . LEU B 26  ? 0.58742 0.47593 1.21975 -0.02114 -0.10003 -0.08319 26  LEU B CD2 
1563 N N   . GLU B 27  ? 0.35308 0.24704 0.94067 -0.01904 -0.09464 -0.03744 27  GLU B N   
1564 C CA  . GLU B 27  ? 0.34314 0.23787 0.91000 -0.01627 -0.09211 -0.03544 27  GLU B CA  
1565 C C   . GLU B 27  ? 0.33908 0.23506 0.90067 -0.01794 -0.09221 -0.02517 27  GLU B C   
1566 O O   . GLU B 27  ? 0.34445 0.24214 0.89695 -0.01652 -0.09151 -0.02692 27  GLU B O   
1567 C CB  . GLU B 27  ? 0.35280 0.24531 0.90464 -0.01398 -0.08905 -0.03152 27  GLU B CB  
1568 C CG  . GLU B 27  ? 0.34354 0.23463 0.90079 -0.01241 -0.08796 -0.04059 27  GLU B CG  
1569 C CD  . GLU B 27  ? 0.60421 0.49502 1.15151 -0.00923 -0.08557 -0.05218 27  GLU B CD  
1570 O OE1 . GLU B 27  ? 0.62768 0.51955 1.16256 -0.00780 -0.08496 -0.05317 27  GLU B OE1 
1571 O OE2 . GLU B 27  ? 0.50967 0.39853 1.06074 -0.00812 -0.08400 -0.06023 27  GLU B OE2 
1572 N N   . LEU B 28  ? 0.34191 0.23656 0.90859 -0.02098 -0.09279 -0.01446 28  LEU B N   
1573 C CA  . LEU B 28  ? 0.34581 0.24116 0.90898 -0.02308 -0.09223 -0.00496 28  LEU B CA  
1574 C C   . LEU B 28  ? 0.37790 0.27728 0.95575 -0.02445 -0.09435 -0.01128 28  LEU B C   
1575 O O   . LEU B 28  ? 0.45428 0.35564 1.02658 -0.02456 -0.09335 -0.00757 28  LEU B O   
1576 C CB  . LEU B 28  ? 0.41603 0.30839 0.98340 -0.02649 -0.09240 0.00622  28  LEU B CB  
1577 C CG  . LEU B 28  ? 0.39086 0.27898 0.94112 -0.02557 -0.09088 0.01400  28  LEU B CG  
1578 C CD1 . LEU B 28  ? 0.35440 0.23876 0.91165 -0.02904 -0.09195 0.02260  28  LEU B CD1 
1579 C CD2 . LEU B 28  ? 0.33781 0.22470 0.86378 -0.02416 -0.08778 0.02085  28  LEU B CD2 
1580 N N   . TYR B 29  ? 0.48829 0.38880 1.08471 -0.02556 -0.09738 -0.02120 29  TYR B N   
1581 C CA  . TYR B 29  ? 0.48287 0.38729 1.09332 -0.02721 -0.10027 -0.02841 29  TYR B CA  
1582 C C   . TYR B 29  ? 0.50068 0.40732 1.10108 -0.02378 -0.10064 -0.03800 29  TYR B C   
1583 O O   . TYR B 29  ? 0.34332 0.25360 0.94628 -0.02445 -0.10190 -0.03864 29  TYR B O   
1584 C CB  . TYR B 29  ? 0.52505 0.42909 1.15541 -0.02953 -0.10352 -0.03705 29  TYR B CB  
1585 C CG  . TYR B 29  ? 0.36837 0.27628 1.01230 -0.03127 -0.10750 -0.04763 29  TYR B CG  
1586 C CD1 . TYR B 29  ? 0.37860 0.29030 1.03447 -0.03504 -0.10889 -0.04273 29  TYR B CD1 
1587 C CD2 . TYR B 29  ? 0.37280 0.28051 1.01729 -0.02948 -0.10990 -0.06270 29  TYR B CD2 
1588 C CE1 . TYR B 29  ? 0.37568 0.29184 1.04468 -0.03717 -0.11334 -0.05284 29  TYR B CE1 
1589 C CE2 . TYR B 29  ? 0.37917 0.29029 1.03451 -0.03138 -0.11450 -0.07321 29  TYR B CE2 
1590 C CZ  . TYR B 29  ? 0.38037 0.29622 1.04852 -0.03533 -0.11663 -0.06838 29  TYR B CZ  
1591 O OH  . TYR B 29  ? 0.38727 0.30760 1.06642 -0.03764 -0.12199 -0.07916 29  TYR B OH  
1592 N N   . ALA B 30  ? 0.42996 0.33439 1.01942 -0.02021 -0.09948 -0.04586 30  ALA B N   
1593 C CA  . ALA B 30  ? 0.36962 0.27488 0.94548 -0.01647 -0.09907 -0.05460 30  ALA B CA  
1594 C C   . ALA B 30  ? 0.35432 0.26020 0.91432 -0.01512 -0.09638 -0.04510 30  ALA B C   
1595 O O   . ALA B 30  ? 0.34608 0.25428 0.90267 -0.01372 -0.09751 -0.04972 30  ALA B O   
1596 C CB  . ALA B 30  ? 0.34030 0.24210 0.90426 -0.01303 -0.09656 -0.06191 30  ALA B CB  
1597 N N   . SER B 31  ? 0.32577 0.22928 0.87597 -0.01572 -0.09309 -0.03180 31  SER B N   
1598 C CA  . SER B 31  ? 0.31822 0.22103 0.85151 -0.01488 -0.08991 -0.02137 31  SER B CA  
1599 C C   . SER B 31  ? 0.41620 0.32262 0.96147 -0.01771 -0.09124 -0.01676 31  SER B C   
1600 O O   . SER B 31  ? 0.49376 0.40129 1.03045 -0.01606 -0.09003 -0.01568 31  SER B O   
1601 C CB  . SER B 31  ? 0.31753 0.21643 0.83853 -0.01575 -0.08693 -0.00883 31  SER B CB  
1602 O OG  . SER B 31  ? 0.46937 0.36638 0.97249 -0.01555 -0.08352 0.00246  31  SER B OG  
1603 N N   . TYR B 32  ? 0.40041 0.30851 0.96574 -0.02194 -0.09336 -0.01382 32  TYR B N   
1604 C CA  . TYR B 32  ? 0.43269 0.34488 1.01227 -0.02539 -0.09419 -0.00907 32  TYR B CA  
1605 C C   . TYR B 32  ? 0.48180 0.39926 1.07210 -0.02487 -0.09827 -0.02148 32  TYR B C   
1606 O O   . TYR B 32  ? 0.32259 0.24385 0.91523 -0.02569 -0.09792 -0.01802 32  TYR B O   
1607 C CB  . TYR B 32  ? 0.40252 0.31481 1.00099 -0.02991 -0.09553 -0.00524 32  TYR B CB  
1608 C CG  . TYR B 32  ? 0.38005 0.29468 0.98749 -0.03396 -0.09359 0.00602  32  TYR B CG  
1609 C CD1 . TYR B 32  ? 0.33170 0.24729 0.92746 -0.03339 -0.08968 0.01512  32  TYR B CD1 
1610 C CD2 . TYR B 32  ? 0.34771 0.26329 0.97505 -0.03838 -0.09498 0.00780  32  TYR B CD2 
1611 C CE1 . TYR B 32  ? 0.36651 0.28438 0.97062 -0.03718 -0.08671 0.02611  32  TYR B CE1 
1612 C CE2 . TYR B 32  ? 0.36481 0.28271 1.00080 -0.04228 -0.09233 0.01824  32  TYR B CE2 
1613 C CZ  . TYR B 32  ? 0.34410 0.26339 0.96873 -0.04169 -0.08798 0.02751  32  TYR B CZ  
1614 O OH  . TYR B 32  ? 0.38737 0.30907 1.02048 -0.04550 -0.08420 0.03838  32  TYR B OH  
1615 N N   . VAL B 33  ? 0.33142 0.24926 0.92840 -0.02379 -0.10227 -0.03604 33  VAL B N   
1616 C CA  . VAL B 33  ? 0.33290 0.25525 0.93637 -0.02311 -0.10706 -0.04975 33  VAL B CA  
1617 C C   . VAL B 33  ? 0.35673 0.27859 0.94111 -0.01861 -0.10536 -0.05123 33  VAL B C   
1618 O O   . VAL B 33  ? 0.40171 0.32854 0.99086 -0.01914 -0.10780 -0.05361 33  VAL B O   
1619 C CB  . VAL B 33  ? 0.34185 0.26278 0.95024 -0.02227 -0.11078 -0.06509 33  VAL B CB  
1620 C CG1 . VAL B 33  ? 0.34492 0.26959 0.95386 -0.02084 -0.11613 -0.08084 33  VAL B CG1 
1621 C CG2 . VAL B 33  ? 0.35198 0.27311 0.98068 -0.02697 -0.11273 -0.06385 33  VAL B CG2 
1622 N N   . TYR B 34  ? 0.32805 0.24417 0.89022 -0.01422 -0.10110 -0.04981 34  TYR B N   
1623 C CA  . TYR B 34  ? 0.31246 0.22664 0.85370 -0.00925 -0.09879 -0.05128 34  TYR B CA  
1624 C C   . TYR B 34  ? 0.30627 0.22129 0.84458 -0.01022 -0.09575 -0.03727 34  TYR B C   
1625 O O   . TYR B 34  ? 0.34679 0.26264 0.87952 -0.00731 -0.09619 -0.03995 34  TYR B O   
1626 C CB  . TYR B 34  ? 0.30971 0.21788 0.82661 -0.00492 -0.09388 -0.05085 34  TYR B CB  
1627 C CG  . TYR B 34  ? 0.41042 0.31740 0.92535 -0.00240 -0.09571 -0.06663 34  TYR B CG  
1628 C CD1 . TYR B 34  ? 0.56759 0.47604 1.08111 0.00050  -0.09945 -0.08130 34  TYR B CD1 
1629 C CD2 . TYR B 34  ? 0.36354 0.26776 0.87765 -0.00291 -0.09372 -0.06695 34  TYR B CD2 
1630 C CE1 . TYR B 34  ? 0.59377 0.50022 1.10263 0.00278  -0.10045 -0.09548 34  TYR B CE1 
1631 C CE2 . TYR B 34  ? 0.51207 0.41446 1.02392 -0.00082 -0.09428 -0.08049 34  TYR B CE2 
1632 C CZ  . TYR B 34  ? 0.60016 0.50331 1.10850 0.00192  -0.09735 -0.09457 34  TYR B CZ  
1633 O OH  . TYR B 34  ? 0.64773 0.54796 1.15082 0.00400  -0.09729 -0.10777 34  TYR B OH  
1634 N N   . LEU B 35  ? 0.39484 0.30899 0.93543 -0.01379 -0.09233 -0.02222 35  LEU B N   
1635 C CA  . LEU B 35  ? 0.35340 0.26790 0.88997 -0.01493 -0.08824 -0.00783 35  LEU B CA  
1636 C C   . LEU B 35  ? 0.40963 0.33183 0.96970 -0.01836 -0.09187 -0.01032 35  LEU B C   
1637 O O   . LEU B 35  ? 0.29846 0.22163 0.85417 -0.01679 -0.08976 -0.00565 35  LEU B O   
1638 C CB  . LEU B 35  ? 0.40864 0.32062 0.94287 -0.01847 -0.08433 0.00708  35  LEU B CB  
1639 C CG  . LEU B 35  ? 0.37223 0.28385 0.90128 -0.02049 -0.07886 0.02368  35  LEU B CG  
1640 C CD1 . LEU B 35  ? 0.40348 0.30993 0.90170 -0.01539 -0.07312 0.03054  35  LEU B CD1 
1641 C CD2 . LEU B 35  ? 0.35286 0.26151 0.88149 -0.02411 -0.07682 0.03373  35  LEU B CD2 
1642 N N   . SER B 36  ? 0.30952 0.23760 0.89415 -0.02297 -0.09716 -0.01751 36  SER B N   
1643 C CA  . SER B 36  ? 0.31070 0.24929 0.91817 -0.02750 -0.10105 -0.02016 36  SER B CA  
1644 C C   . SER B 36  ? 0.30703 0.25094 0.91273 -0.02506 -0.10631 -0.03445 36  SER B C   
1645 O O   . SER B 36  ? 0.37914 0.33714 0.98396 -0.02409 -0.10532 -0.03075 36  SER B O   
1646 C CB  . SER B 36  ? 0.32065 0.26383 0.95098 -0.03227 -0.10553 -0.02550 36  SER B CB  
1647 O OG  . SER B 36  ? 0.39491 0.35016 1.04326 -0.03532 -0.11195 -0.03567 36  SER B OG  
1648 N N   . MET B 37  ? 0.30994 0.24887 0.90429 -0.02041 -0.10977 -0.04959 37  MET B N   
1649 C CA  . MET B 37  ? 0.37233 0.31815 0.95280 -0.01455 -0.11338 -0.06326 37  MET B CA  
1650 C C   . MET B 37  ? 0.41161 0.36157 0.95902 -0.00528 -0.10536 -0.05326 37  MET B C   
1651 O O   . MET B 37  ? 0.44857 0.41454 0.98362 -0.00002 -0.10561 -0.05558 37  MET B O   
1652 C CB  . MET B 37  ? 0.35851 0.29294 0.93064 -0.01113 -0.11681 -0.08022 37  MET B CB  
1653 C CG  . MET B 37  ? 0.33117 0.26818 0.91849 -0.01469 -0.12119 -0.08871 37  MET B CG  
1654 S SD  . MET B 37  ? 0.44198 0.37066 1.00962 -0.00832 -0.12146 -0.10548 37  MET B SD  
1655 C CE  . MET B 37  ? 0.34782 0.28146 0.93800 -0.01367 -0.12893 -0.11682 37  MET B CE  
1656 N N   . SER B 38  ? 0.32643 0.26173 0.85909 -0.00314 -0.09854 -0.04205 38  SER B N   
1657 C CA  . SER B 38  ? 0.34196 0.27898 0.84160 0.00571  -0.09090 -0.03324 38  SER B CA  
1658 C C   . SER B 38  ? 0.38504 0.33715 0.88501 0.00524  -0.08686 -0.02006 38  SER B C   
1659 O O   . SER B 38  ? 0.31988 0.28480 0.80019 0.01247  -0.08439 -0.02040 38  SER B O   
1660 C CB  . SER B 38  ? 0.29041 0.20771 0.77713 0.00679  -0.08540 -0.02311 38  SER B CB  
1661 O OG  . SER B 38  ? 0.35288 0.27152 0.81387 0.01226  -0.07753 -0.00917 38  SER B OG  
1662 N N   . TYR B 39  ? 0.33922 0.28973 0.86186 -0.00311 -0.08576 -0.00829 39  TYR B N   
1663 C CA  . TYR B 39  ? 0.40162 0.36611 0.92594 -0.00355 -0.08085 0.00431  39  TYR B CA  
1664 C C   . TYR B 39  ? 0.37021 0.35647 0.91325 -0.00507 -0.08696 -0.00500 39  TYR B C   
1665 O O   . TYR B 39  ? 0.34942 0.35056 0.89003 -0.00288 -0.08302 0.00284  39  TYR B O   
1666 C CB  . TYR B 39  ? 0.30177 0.25630 0.84127 -0.01141 -0.07625 0.02111  39  TYR B CB  
1667 C CG  . TYR B 39  ? 0.44553 0.38437 0.95544 -0.00671 -0.06820 0.03428  39  TYR B CG  
1668 C CD1 . TYR B 39  ? 0.33368 0.27860 0.81751 0.00008  -0.05999 0.04477  39  TYR B CD1 
1669 C CD2 . TYR B 39  ? 0.29065 0.20870 0.79709 -0.00828 -0.06929 0.03504  39  TYR B CD2 
1670 C CE1 . TYR B 39  ? 0.32488 0.25427 0.77933 0.00453  -0.05311 0.05615  39  TYR B CE1 
1671 C CE2 . TYR B 39  ? 0.41265 0.32057 0.88749 -0.00407 -0.06254 0.04582  39  TYR B CE2 
1672 C CZ  . TYR B 39  ? 0.40800 0.31663 0.86063 0.00221  -0.05517 0.05692  39  TYR B CZ  
1673 O OH  . TYR B 39  ? 0.45014 0.35082 0.86713 0.00517  -0.04871 0.06567  39  TYR B OH  
1674 N N   . TYR B 40  ? 0.32147 0.30987 0.88133 -0.00810 -0.09656 -0.02188 40  TYR B N   
1675 C CA  . TYR B 40  ? 0.35983 0.36873 0.93021 -0.00755 -0.10324 -0.03191 40  TYR B CA  
1676 C C   . TYR B 40  ? 0.35345 0.37096 0.89125 0.00385  -0.10161 -0.03669 40  TYR B C   
1677 O O   . TYR B 40  ? 0.29346 0.32955 0.83213 0.00651  -0.10265 -0.03601 40  TYR B O   
1678 C CB  . TYR B 40  ? 0.32217 0.32970 0.91521 -0.01328 -0.11440 -0.04966 40  TYR B CB  
1679 C CG  . TYR B 40  ? 0.34923 0.37479 0.94607 -0.01119 -0.12297 -0.06302 40  TYR B CG  
1680 C CD1 . TYR B 40  ? 0.31955 0.36299 0.94333 -0.01681 -0.12693 -0.06020 40  TYR B CD1 
1681 C CD2 . TYR B 40  ? 0.42889 0.45333 1.00245 -0.00356 -0.12727 -0.07830 40  TYR B CD2 
1682 C CE1 . TYR B 40  ? 0.38448 0.44472 1.01249 -0.01499 -0.13600 -0.07214 40  TYR B CE1 
1683 C CE2 . TYR B 40  ? 0.42392 0.46427 0.99953 -0.00155 -0.13619 -0.09054 40  TYR B CE2 
1684 C CZ  . TYR B 40  ? 0.35740 0.41585 0.96070 -0.00738 -0.14105 -0.08729 40  TYR B CZ  
1685 O OH  . TYR B 40  ? 0.37051 0.44486 0.97713 -0.00565 -0.15099 -0.09885 40  TYR B OH  
1686 N N   . PHE B 41  ? 0.37711 0.38155 0.88660 0.01081  -0.09886 -0.04119 41  PHE B N   
1687 C CA  . PHE B 41  ? 0.44031 0.45266 0.91879 0.02165  -0.09720 -0.04611 41  PHE B CA  
1688 C C   . PHE B 41  ? 0.32216 0.33864 0.77864 0.02754  -0.08675 -0.02944 41  PHE B C   
1689 O O   . PHE B 41  ? 0.28439 0.30928 0.71658 0.03643  -0.08489 -0.03194 41  PHE B O   
1690 C CB  . PHE B 41  ? 0.44366 0.44125 0.90028 0.02728  -0.09818 -0.05902 41  PHE B CB  
1691 C CG  . PHE B 41  ? 0.41623 0.41419 0.88696 0.02444  -0.10854 -0.07808 41  PHE B CG  
1692 C CD1 . PHE B 41  ? 0.37201 0.38264 0.83348 0.02947  -0.11465 -0.09049 41  PHE B CD1 
1693 C CD2 . PHE B 41  ? 0.35879 0.34457 0.85365 0.01616  -0.11276 -0.08328 41  PHE B CD2 
1694 C CE1 . PHE B 41  ? 0.31954 0.32935 0.79346 0.02631  -0.12493 -0.10832 41  PHE B CE1 
1695 C CE2 . PHE B 41  ? 0.31739 0.30283 0.82542 0.01311  -0.12229 -0.10096 41  PHE B CE2 
1696 C CZ  . PHE B 41  ? 0.32372 0.32077 0.82037 0.01818  -0.12842 -0.11359 41  PHE B CZ  
1697 N N   . ASP B 42  ? 0.36712 0.37685 0.83075 0.02283  -0.07994 -0.01283 42  ASP B N   
1698 C CA  . ASP B 42  ? 0.29191 0.30455 0.73924 0.02650  -0.06966 0.00463  42  ASP B CA  
1699 C C   . ASP B 42  ? 0.37336 0.40574 0.84079 0.02365  -0.06917 0.01125  42  ASP B C   
1700 O O   . ASP B 42  ? 0.33184 0.36841 0.78778 0.02674  -0.06009 0.02570  42  ASP B O   
1701 C CB  . ASP B 42  ? 0.35740 0.35016 0.80272 0.02212  -0.06314 0.01888  42  ASP B CB  
1702 C CG  . ASP B 42  ? 0.36603 0.35790 0.79331 0.02508  -0.05198 0.03782  42  ASP B CG  
1703 O OD1 . ASP B 42  ? 0.52736 0.52153 0.92442 0.03413  -0.04679 0.03966  42  ASP B OD1 
1704 O OD2 . ASP B 42  ? 0.36824 0.35495 0.81090 0.01814  -0.04816 0.05080  42  ASP B OD2 
1705 N N   . ARG B 43  ? 0.40450 0.44865 0.90220 0.01775  -0.07851 0.00118  43  ARG B N   
1706 C CA  . ARG B 43  ? 0.40589 0.47004 0.92636 0.01475  -0.07886 0.00666  43  ARG B CA  
1707 C C   . ARG B 43  ? 0.37830 0.45915 0.87884 0.02452  -0.07704 0.00616  43  ARG B C   
1708 O O   . ARG B 43  ? 0.27989 0.36132 0.75803 0.03203  -0.08100 -0.00566 43  ARG B O   
1709 C CB  . ARG B 43  ? 0.43333 0.50624 0.98943 0.00662  -0.09083 -0.00605 43  ARG B CB  
1710 C CG  . ARG B 43  ? 0.48567 0.55045 1.07302 -0.00480 -0.09058 0.00054  43  ARG B CG  
1711 C CD  . ARG B 43  ? 0.45830 0.52827 1.07547 -0.01195 -0.10320 -0.01491 43  ARG B CD  
1712 N NE  . ARG B 43  ? 0.64054 0.73289 1.28252 -0.01473 -0.10675 -0.01396 43  ARG B NE  
1713 C CZ  . ARG B 43  ? 0.58036 0.68078 1.25727 -0.02331 -0.11619 -0.02193 43  ARG B CZ  
1714 N NH1 . ARG B 43  ? 0.61748 0.73902 1.31679 -0.02534 -0.11934 -0.02043 43  ARG B NH1 
1715 N NH2 . ARG B 43  ? 0.50212 0.58967 1.19326 -0.03012 -0.12282 -0.03167 43  ARG B NH2 
1716 N N   . ASP B 44  ? 0.27734 0.37179 0.78707 0.02444  -0.07082 0.01905  44  ASP B N   
1717 C CA  . ASP B 44  ? 0.27517 0.38524 0.76620 0.03406  -0.06817 0.02019  44  ASP B CA  
1718 C C   . ASP B 44  ? 0.32188 0.44914 0.82377 0.03578  -0.08113 0.00345  44  ASP B C   
1719 O O   . ASP B 44  ? 0.27781 0.41476 0.75830 0.04507  -0.08162 -0.00033 44  ASP B O   
1720 C CB  . ASP B 44  ? 0.30923 0.42930 0.80903 0.03360  -0.05765 0.03833  44  ASP B CB  
1721 C CG  . ASP B 44  ? 0.42281 0.56269 0.96473 0.02647  -0.06322 0.03799  44  ASP B CG  
1722 O OD1 . ASP B 44  ? 0.40372 0.56286 0.95317 0.02988  -0.07089 0.02938  44  ASP B OD1 
1723 O OD2 . ASP B 44  ? 0.36981 0.50523 0.93704 0.01743  -0.05990 0.04672  44  ASP B OD2 
1724 N N   . ASP B 45  ? 0.38008 0.51016 0.91368 0.02703  -0.09207 -0.00696 45  ASP B N   
1725 C CA  . ASP B 45  ? 0.37150 0.51611 0.91705 0.02738  -0.10597 -0.02356 45  ASP B CA  
1726 C C   . ASP B 45  ? 0.29329 0.42429 0.82283 0.02911  -0.11422 -0.04149 45  ASP B C   
1727 O O   . ASP B 45  ? 0.33656 0.47528 0.87319 0.02893  -0.12653 -0.05694 45  ASP B O   
1728 C CB  . ASP B 45  ? 0.32495 0.48184 0.91636 0.01645  -0.11367 -0.02473 45  ASP B CB  
1729 C CG  . ASP B 45  ? 0.45190 0.59358 1.06430 0.00602  -0.11031 -0.01870 45  ASP B CG  
1730 O OD1 . ASP B 45  ? 0.47786 0.59981 1.07593 0.00558  -0.11005 -0.02372 45  ASP B OD1 
1731 O OD2 . ASP B 45  ? 0.53013 0.67948 1.17458 -0.00183 -0.10852 -0.00979 45  ASP B OD2 
1732 N N   . VAL B 46  ? 0.29133 0.40158 0.80024 0.03052  -0.10782 -0.03974 46  VAL B N   
1733 C CA  . VAL B 46  ? 0.29645 0.39231 0.78775 0.03320  -0.11326 -0.05558 46  VAL B CA  
1734 C C   . VAL B 46  ? 0.34728 0.43426 0.79720 0.04395  -0.10400 -0.05159 46  VAL B C   
1735 O O   . VAL B 46  ? 0.37525 0.46559 0.80124 0.05241  -0.10685 -0.06142 46  VAL B O   
1736 C CB  . VAL B 46  ? 0.35411 0.43247 0.86373 0.02409  -0.11495 -0.05830 46  VAL B CB  
1737 C CG1 . VAL B 46  ? 0.30407 0.36637 0.79493 0.02743  -0.11895 -0.07417 46  VAL B CG1 
1738 C CG2 . VAL B 46  ? 0.30241 0.39084 0.85460 0.01309  -0.12358 -0.06103 46  VAL B CG2 
1739 N N   . ALA B 47  ? 0.36319 0.43865 0.80409 0.04364  -0.09294 -0.03670 47  ALA B N   
1740 C CA  . ALA B 47  ? 0.37205 0.44102 0.77562 0.05329  -0.08279 -0.02907 47  ALA B CA  
1741 C C   . ALA B 47  ? 0.44134 0.49893 0.81707 0.06034  -0.08498 -0.04318 47  ALA B C   
1742 O O   . ALA B 47  ? 0.45264 0.51479 0.80030 0.07005  -0.08273 -0.04599 47  ALA B O   
1743 C CB  . ALA B 47  ? 0.27939 0.36679 0.67391 0.05971  -0.07864 -0.02096 47  ALA B CB  
1744 N N   . LEU B 48  ? 0.37798 0.42005 0.76187 0.05552  -0.08888 -0.05204 48  LEU B N   
1745 C CA  . LEU B 48  ? 0.46623 0.49427 0.82506 0.06164  -0.08897 -0.06416 48  LEU B CA  
1746 C C   . LEU B 48  ? 0.38993 0.39830 0.73827 0.06112  -0.08058 -0.05491 48  LEU B C   
1747 O O   . LEU B 48  ? 0.36456 0.35988 0.72958 0.05451  -0.08282 -0.05746 48  LEU B O   
1748 C CB  . LEU B 48  ? 0.41764 0.44247 0.79134 0.05779  -0.09970 -0.08280 48  LEU B CB  
1749 C CG  . LEU B 48  ? 0.44479 0.48623 0.81541 0.06179  -0.10797 -0.09399 48  LEU B CG  
1750 C CD1 . LEU B 48  ? 0.44763 0.49167 0.84813 0.05340  -0.12006 -0.10687 48  LEU B CD1 
1751 C CD2 . LEU B 48  ? 0.39285 0.42967 0.72634 0.07298  -0.10654 -0.10426 48  LEU B CD2 
1752 N N   . LYS B 49  ? 0.44029 0.28303 0.58268 -0.04287 -0.18612 -0.09443 49  LYS B N   
1753 C CA  . LYS B 49  ? 0.50469 0.30871 0.63496 -0.02914 -0.22178 -0.08844 49  LYS B CA  
1754 C C   . LYS B 49  ? 0.61692 0.44532 0.80417 -0.05466 -0.22148 -0.06923 49  LYS B C   
1755 O O   . LYS B 49  ? 0.46928 0.28223 0.65803 -0.04382 -0.22654 -0.06645 49  LYS B O   
1756 C CB  . LYS B 49  ? 0.52999 0.28630 0.62768 -0.01719 -0.28002 -0.08899 49  LYS B CB  
1757 C CG  . LYS B 49  ? 0.82926 0.52876 0.87959 0.02472  -0.32456 -0.09935 49  LYS B CG  
1758 N N   . ASN B 50  ? 0.48387 0.35625 0.71701 -0.08315 -0.21573 -0.05138 50  ASN B N   
1759 C CA  . ASN B 50  ? 0.43116 0.33720 0.71904 -0.10002 -0.21575 -0.02361 50  ASN B CA  
1760 C C   . ASN B 50  ? 0.44377 0.39109 0.74472 -0.09489 -0.16621 -0.03433 50  ASN B C   
1761 O O   . ASN B 50  ? 0.39527 0.35141 0.72243 -0.09709 -0.16502 -0.02137 50  ASN B O   
1762 C CB  . ASN B 50  ? 0.40480 0.35648 0.73734 -0.11984 -0.22609 0.01434  50  ASN B CB  
1763 C CG  . ASN B 50  ? 0.45354 0.35716 0.77499 -0.11456 -0.27331 0.03520  50  ASN B CG  
1764 O OD1 . ASN B 50  ? 0.49290 0.34465 0.80351 -0.10051 -0.30778 0.03631  50  ASN B OD1 
1765 N ND2 . ASN B 50  ? 0.45592 0.37510 0.78519 -0.12227 -0.27950 0.05099  50  ASN B ND2 
1766 N N   . PHE B 51  ? 0.35894 0.32643 0.64746 -0.08683 -0.13244 -0.05894 51  PHE B N   
1767 C CA  . PHE B 51  ? 0.46778 0.45365 0.77341 -0.07736 -0.10117 -0.07559 51  PHE B CA  
1768 C C   . PHE B 51  ? 0.40962 0.35801 0.70820 -0.06754 -0.10324 -0.07496 51  PHE B C   
1769 O O   . PHE B 51  ? 0.41196 0.37157 0.73599 -0.06698 -0.09348 -0.07125 51  PHE B O   
1770 C CB  . PHE B 51  ? 0.32948 0.32367 0.63321 -0.06899 -0.08157 -0.10260 51  PHE B CB  
1771 C CG  . PHE B 51  ? 0.32045 0.36312 0.63447 -0.06524 -0.07305 -0.11286 51  PHE B CG  
1772 C CD1 . PHE B 51  ? 0.32258 0.37996 0.61832 -0.06969 -0.07995 -0.10704 51  PHE B CD1 
1773 C CD2 . PHE B 51  ? 0.31753 0.39277 0.65526 -0.04957 -0.06131 -0.12939 51  PHE B CD2 
1774 C CE1 . PHE B 51  ? 0.32108 0.43159 0.61905 -0.05608 -0.07045 -0.11365 51  PHE B CE1 
1775 C CE2 . PHE B 51  ? 0.32360 0.44774 0.65675 -0.02960 -0.05673 -0.14270 51  PHE B CE2 
1776 C CZ  . PHE B 51  ? 0.38830 0.53379 0.69991 -0.03144 -0.05878 -0.13313 51  PHE B CZ  
1777 N N   . ALA B 52  ? 0.39980 0.30823 0.65925 -0.05291 -0.11565 -0.07731 52  ALA B N   
1778 C CA  . ALA B 52  ? 0.41584 0.29744 0.65763 -0.03008 -0.11652 -0.07264 52  ALA B CA  
1779 C C   . ALA B 52  ? 0.48428 0.34995 0.73318 -0.03446 -0.14162 -0.06146 52  ALA B C   
1780 O O   . ALA B 52  ? 0.40854 0.27971 0.67565 -0.02906 -0.12710 -0.05705 52  ALA B O   
1781 C CB  . ALA B 52  ? 0.43812 0.28744 0.62156 0.00072  -0.13149 -0.07517 52  ALA B CB  
1782 N N   . LYS B 53  ? 0.43536 0.28191 0.68173 -0.04624 -0.18329 -0.05271 53  LYS B N   
1783 C CA  . LYS B 53  ? 0.45584 0.28276 0.72336 -0.05215 -0.21838 -0.03652 53  LYS B CA  
1784 C C   . LYS B 53  ? 0.41663 0.29534 0.74128 -0.07383 -0.19046 -0.01918 53  LYS B C   
1785 O O   . LYS B 53  ? 0.42275 0.29336 0.76274 -0.07172 -0.19620 -0.01112 53  LYS B O   
1786 C CB  . LYS B 53  ? 0.48693 0.28712 0.76647 -0.06441 -0.27629 -0.02130 53  LYS B CB  
1787 C CG  . LYS B 53  ? 0.76259 0.50047 0.97801 -0.03057 -0.32040 -0.04161 53  LYS B CG  
1788 N N   . TYR B 54  ? 0.38303 0.31690 0.73430 -0.08802 -0.16286 -0.01416 54  TYR B N   
1789 C CA  . TYR B 54  ? 0.35627 0.34758 0.74949 -0.09416 -0.13641 -0.00094 54  TYR B CA  
1790 C C   . TYR B 54  ? 0.46340 0.44931 0.85449 -0.08102 -0.10916 -0.02256 54  TYR B C   
1791 O O   . TYR B 54  ? 0.34406 0.33797 0.75850 -0.08231 -0.10810 -0.01046 54  TYR B O   
1792 C CB  . TYR B 54  ? 0.33700 0.38730 0.73880 -0.09349 -0.11379 -0.00101 54  TYR B CB  
1793 C CG  . TYR B 54  ? 0.40607 0.52438 0.83494 -0.08172 -0.08620 0.00594  54  TYR B CG  
1794 C CD1 . TYR B 54  ? 0.36626 0.54232 0.83623 -0.08557 -0.08967 0.05462  54  TYR B CD1 
1795 C CD2 . TYR B 54  ? 0.31516 0.44233 0.73440 -0.06151 -0.06171 -0.03298 54  TYR B CD2 
1796 C CE1 . TYR B 54  ? 0.42425 0.67272 0.90925 -0.06179 -0.06214 0.06284  54  TYR B CE1 
1797 C CE2 . TYR B 54  ? 0.31527 0.49998 0.74847 -0.03858 -0.04443 -0.03510 54  TYR B CE2 
1798 C CZ  . TYR B 54  ? 0.45497 0.70410 0.91284 -0.03481 -0.04105 0.01200  54  TYR B CZ  
1799 O OH  . TYR B 54  ? 0.32526 0.64187 0.78757 0.00019  -0.02168 0.01236  54  TYR B OH  
1800 N N   . PHE B 55  ? 0.34125 0.31283 0.71389 -0.06917 -0.09062 -0.04863 55  PHE B N   
1801 C CA  . PHE B 55  ? 0.33220 0.30271 0.72427 -0.05906 -0.06941 -0.05968 55  PHE B CA  
1802 C C   . PHE B 55  ? 0.38426 0.31888 0.76199 -0.04889 -0.07846 -0.04794 55  PHE B C   
1803 O O   . PHE B 55  ? 0.34422 0.28448 0.74717 -0.04512 -0.06560 -0.04590 55  PHE B O   
1804 C CB  . PHE B 55  ? 0.33238 0.30420 0.73434 -0.05138 -0.05335 -0.07842 55  PHE B CB  
1805 C CG  . PHE B 55  ? 0.41702 0.42309 0.83680 -0.05151 -0.04849 -0.09959 55  PHE B CG  
1806 C CD1 . PHE B 55  ? 0.36388 0.40278 0.80603 -0.04412 -0.04452 -0.10851 55  PHE B CD1 
1807 C CD2 . PHE B 55  ? 0.47642 0.48452 0.88234 -0.05123 -0.05048 -0.11173 55  PHE B CD2 
1808 C CE1 . PHE B 55  ? 0.31524 0.38913 0.75959 -0.02759 -0.04462 -0.13257 55  PHE B CE1 
1809 C CE2 . PHE B 55  ? 0.46084 0.50073 0.87453 -0.04153 -0.05029 -0.13508 55  PHE B CE2 
1810 C CZ  . PHE B 55  ? 0.33243 0.40587 0.76162 -0.02544 -0.04854 -0.14677 55  PHE B CZ  
1811 N N   . LEU B 56  ? 0.38335 0.28010 0.71819 -0.03880 -0.10570 -0.04233 56  LEU B N   
1812 C CA  . LEU B 56  ? 0.48936 0.35198 0.80011 -0.01749 -0.12238 -0.03577 56  LEU B CA  
1813 C C   . LEU B 56  ? 0.47189 0.33415 0.81175 -0.03374 -0.14177 -0.02328 56  LEU B C   
1814 O O   . LEU B 56  ? 0.42033 0.27641 0.76650 -0.02376 -0.13624 -0.01942 56  LEU B O   
1815 C CB  . LEU B 56  ? 0.52032 0.33745 0.76906 0.01014  -0.15880 -0.04123 56  LEU B CB  
1816 C CG  . LEU B 56  ? 0.55395 0.33631 0.75631 0.05430  -0.17729 -0.04155 56  LEU B CG  
1817 C CD1 . LEU B 56  ? 0.50049 0.31687 0.71253 0.07608  -0.12779 -0.02934 56  LEU B CD1 
1818 C CD2 . LEU B 56  ? 0.58344 0.31874 0.71140 0.09617  -0.22235 -0.05576 56  LEU B CD2 
1819 N N   . HIS B 57  ? 0.40995 0.28648 0.77615 -0.05811 -0.16290 -0.00958 57  HIS B N   
1820 C CA  . HIS B 57  ? 0.40694 0.29840 0.81838 -0.07478 -0.17841 0.01539  57  HIS B CA  
1821 C C   . HIS B 57  ? 0.43002 0.37094 0.87315 -0.07791 -0.13502 0.01520  57  HIS B C   
1822 O O   . HIS B 57  ? 0.42097 0.36140 0.88470 -0.07863 -0.13745 0.02596  57  HIS B O   
1823 C CB  . HIS B 57  ? 0.41544 0.33081 0.86699 -0.09812 -0.20592 0.04664  57  HIS B CB  
1824 C CG  . HIS B 57  ? 0.62752 0.57273 1.13544 -0.11143 -0.21846 0.08745  57  HIS B CG  
1825 N ND1 . HIS B 57  ? 0.72043 0.62081 1.23049 -0.10451 -0.26429 0.10181  57  HIS B ND1 
1826 C CD2 . HIS B 57  ? 0.58944 0.61101 1.14887 -0.12140 -0.18946 0.11822  57  HIS B CD2 
1827 C CE1 . HIS B 57  ? 0.69600 0.63863 1.26019 -0.11510 -0.26126 0.14362  57  HIS B CE1 
1828 N NE2 . HIS B 57  ? 0.64913 0.66810 1.24026 -0.12409 -0.21354 0.15620  57  HIS B NE2 
1829 N N   . GLN B 58  ? 0.39835 0.37717 0.84487 -0.07563 -0.10124 -0.00099 58  GLN B N   
1830 C CA  . GLN B 58  ? 0.34643 0.36080 0.81887 -0.06910 -0.07160 -0.01149 58  GLN B CA  
1831 C C   . GLN B 58  ? 0.32805 0.31034 0.80065 -0.05948 -0.06346 -0.02117 58  GLN B C   
1832 O O   . GLN B 58  ? 0.42411 0.41979 0.92160 -0.05813 -0.05475 -0.01819 58  GLN B O   
1833 C CB  . GLN B 58  ? 0.31279 0.35773 0.78661 -0.05974 -0.05211 -0.03670 58  GLN B CB  
1834 C CG  . GLN B 58  ? 0.35836 0.45700 0.83396 -0.05824 -0.05134 -0.02384 58  GLN B CG  
1835 C CD  . GLN B 58  ? 0.51568 0.66612 1.01929 -0.05635 -0.04895 0.01045  58  GLN B CD  
1836 O OE1 . GLN B 58  ? 0.74884 0.92128 1.26524 -0.04121 -0.03533 0.00169  58  GLN B OE1 
1837 N NE2 . GLN B 58  ? 0.52031 0.69203 1.04288 -0.07123 -0.06567 0.05519  58  GLN B NE2 
1838 N N   . SER B 59  ? 0.35382 0.30064 0.79968 -0.04831 -0.06500 -0.02692 59  SER B N   
1839 C CA  . SER B 59  ? 0.38505 0.31685 0.83715 -0.03231 -0.05204 -0.02387 59  SER B CA  
1840 C C   . SER B 59  ? 0.46318 0.37170 0.90107 -0.02585 -0.06951 -0.01091 59  SER B C   
1841 O O   . SER B 59  ? 0.46981 0.38444 0.93239 -0.02173 -0.05603 -0.00619 59  SER B O   
1842 C CB  . SER B 59  ? 0.36045 0.27824 0.78809 -0.01177 -0.04525 -0.02062 59  SER B CB  
1843 O OG  . SER B 59  ? 0.38131 0.28890 0.79709 0.01596  -0.03840 -0.00332 59  SER B OG  
1844 N N   . HIS B 60  ? 0.39747 0.27525 0.80167 -0.02432 -0.10640 -0.00599 60  HIS B N   
1845 C CA  . HIS B 60  ? 0.42688 0.27398 0.82330 -0.01694 -0.13695 0.00307  60  HIS B CA  
1846 C C   . HIS B 60  ? 0.40067 0.27873 0.85063 -0.04199 -0.13129 0.01748  60  HIS B C   
1847 O O   . HIS B 60  ? 0.47066 0.33882 0.92947 -0.03613 -0.13403 0.02314  60  HIS B O   
1848 C CB  . HIS B 60  ? 0.47350 0.27388 0.83880 -0.01073 -0.19404 0.00308  60  HIS B CB  
1849 C CG  . HIS B 60  ? 0.64279 0.40808 0.93956 0.02966  -0.20671 -0.01358 60  HIS B CG  
1850 N ND1 . HIS B 60  ? 0.82773 0.55243 1.09086 0.03961  -0.25635 -0.02275 60  HIS B ND1 
1851 C CD2 . HIS B 60  ? 0.74917 0.52145 1.00840 0.06799  -0.17619 -0.01703 60  HIS B CD2 
1852 C CE1 . HIS B 60  ? 0.85820 0.56485 1.05306 0.08751  -0.25499 -0.03731 60  HIS B CE1 
1853 N NE2 . HIS B 60  ? 0.74593 0.48712 0.93980 0.10612  -0.20351 -0.02889 60  HIS B NE2 
1854 N N   . GLU B 61  ? 0.37943 0.30203 0.86253 -0.06364 -0.12129 0.02600  61  GLU B N   
1855 C CA  . GLU B 61  ? 0.35373 0.32205 0.88363 -0.07653 -0.11120 0.04569  61  GLU B CA  
1856 C C   . GLU B 61  ? 0.37140 0.36141 0.91353 -0.06645 -0.07466 0.02780  61  GLU B C   
1857 O O   . GLU B 61  ? 0.35842 0.35989 0.92432 -0.06742 -0.07136 0.03845  61  GLU B O   
1858 C CB  . GLU B 61  ? 0.38657 0.40984 0.94137 -0.08809 -0.10835 0.06599  61  GLU B CB  
1859 C CG  . GLU B 61  ? 0.59808 0.69337 1.17683 -0.07891 -0.07391 0.06858  61  GLU B CG  
1860 C CD  . GLU B 61  ? 0.73144 0.89024 1.32091 -0.07595 -0.06689 0.08931  61  GLU B CD  
1861 O OE1 . GLU B 61  ? 0.65725 0.82865 1.27652 -0.09256 -0.09156 0.13339  61  GLU B OE1 
1862 O OE2 . GLU B 61  ? 0.83900 1.03482 1.41184 -0.05373 -0.04168 0.06290  61  GLU B OE2 
1863 N N   . GLU B 62  ? 0.32211 0.31435 0.85692 -0.05696 -0.05302 0.00223  62  GLU B N   
1864 C CA  . GLU B 62  ? 0.42083 0.42425 0.98373 -0.04787 -0.03166 -0.01401 62  GLU B CA  
1865 C C   . GLU B 62  ? 0.41861 0.39208 0.98424 -0.04183 -0.03060 -0.00475 62  GLU B C   
1866 O O   . GLU B 62  ? 0.34555 0.32999 0.94045 -0.04017 -0.02168 -0.00530 62  GLU B O   
1867 C CB  . GLU B 62  ? 0.30367 0.30789 0.87801 -0.04084 -0.02174 -0.03720 62  GLU B CB  
1868 C CG  . GLU B 62  ? 0.38038 0.42047 0.95687 -0.03524 -0.02153 -0.05723 62  GLU B CG  
1869 C CD  . GLU B 62  ? 0.48430 0.56484 1.07709 -0.02051 -0.01794 -0.06577 62  GLU B CD  
1870 O OE1 . GLU B 62  ? 0.59466 0.72164 1.17241 -0.01187 -0.01589 -0.05604 62  GLU B OE1 
1871 O OE2 . GLU B 62  ? 0.60796 0.68029 1.23055 -0.01284 -0.01718 -0.07822 62  GLU B OE2 
1872 N N   . ARG B 63  ? 0.33840 0.27693 0.86877 -0.03143 -0.04088 0.00366  63  ARG B N   
1873 C CA  . ARG B 63  ? 0.35455 0.27254 0.87817 -0.01420 -0.03964 0.01505  63  ARG B CA  
1874 C C   . ARG B 63  ? 0.38913 0.29549 0.91152 -0.02076 -0.06094 0.02395  63  ARG B C   
1875 O O   . ARG B 63  ? 0.41339 0.31841 0.95062 -0.01376 -0.05263 0.02977  63  ARG B O   
1876 C CB  . ARG B 63  ? 0.38767 0.28002 0.86176 0.01583  -0.04603 0.02153  63  ARG B CB  
1877 C CG  . ARG B 63  ? 0.68881 0.53963 1.10773 0.03273  -0.08611 0.02046  63  ARG B CG  
1878 C CD  . ARG B 63  ? 0.82555 0.65995 1.19236 0.08436  -0.08643 0.02753  63  ARG B CD  
1879 N NE  . ARG B 63  ? 0.83845 0.68914 1.22624 0.10066  -0.06295 0.04374  63  ARG B NE  
1880 C CZ  . ARG B 63  ? 0.79383 0.64970 1.14325 0.15391  -0.05328 0.06049  63  ARG B CZ  
1881 N NH1 . ARG B 63  ? 0.71130 0.58727 1.08692 0.16699  -0.03141 0.08026  63  ARG B NH1 
1882 N NH2 . ARG B 63  ? 0.97610 0.82272 1.25788 0.20090  -0.06506 0.06006  63  ARG B NH2 
1883 N N   . GLU B 64  ? 0.43094 0.33212 0.94835 -0.03560 -0.09031 0.03099  64  GLU B N   
1884 C CA  . GLU B 64  ? 0.53149 0.43113 1.07348 -0.04684 -0.11239 0.04922  64  GLU B CA  
1885 C C   . GLU B 64  ? 0.34904 0.29799 0.93546 -0.05683 -0.08185 0.05370  64  GLU B C   
1886 O O   . GLU B 64  ? 0.35117 0.29765 0.95495 -0.05688 -0.08433 0.06337  64  GLU B O   
1887 C CB  . GLU B 64  ? 0.47165 0.36921 1.02939 -0.06488 -0.15176 0.07013  64  GLU B CB  
1888 C CG  . GLU B 64  ? 0.54548 0.37816 1.06474 -0.05046 -0.20396 0.06389  64  GLU B CG  
1889 C CD  . GLU B 64  ? 0.64759 0.49105 1.19190 -0.06776 -0.24494 0.08806  64  GLU B CD  
1890 O OE1 . GLU B 64  ? 0.72012 0.59638 1.31320 -0.08106 -0.25725 0.12200  64  GLU B OE1 
1891 O OE2 . GLU B 64  ? 0.75460 0.57934 1.27311 -0.06419 -0.26199 0.07829  64  GLU B OE2 
1892 N N   . HIS B 65  ? 0.33516 0.32781 0.93587 -0.05927 -0.05736 0.04357  65  HIS B N   
1893 C CA  . HIS B 65  ? 0.37716 0.41256 1.00808 -0.05392 -0.03392 0.03682  65  HIS B CA  
1894 C C   . HIS B 65  ? 0.33845 0.35046 0.98037 -0.04487 -0.02131 0.02207  65  HIS B C   
1895 O O   . HIS B 65  ? 0.36886 0.39491 1.03397 -0.04246 -0.01482 0.02494  65  HIS B O   
1896 C CB  . HIS B 65  ? 0.42363 0.49874 1.05539 -0.04384 -0.01989 0.01687  65  HIS B CB  
1897 C CG  . HIS B 65  ? 0.60752 0.73285 1.24002 -0.04525 -0.02328 0.04144  65  HIS B CG  
1898 N ND1 . HIS B 65  ? 0.68668 0.84241 1.30536 -0.03351 -0.01654 0.02781  65  HIS B ND1 
1899 C CD2 . HIS B 65  ? 0.71483 0.87241 1.37096 -0.05524 -0.03361 0.08667  65  HIS B CD2 
1900 C CE1 . HIS B 65  ? 0.68485 0.89488 1.31432 -0.03399 -0.01798 0.06626  65  HIS B CE1 
1901 N NE2 . HIS B 65  ? 0.73053 0.94449 1.39045 -0.04905 -0.02912 0.10652  65  HIS B NE2 
1902 N N   . ALA B 66  ? 0.30929 0.29214 0.94117 -0.03794 -0.01700 0.01337  66  ALA B N   
1903 C CA  . ALA B 66  ? 0.48749 0.45887 1.14529 -0.02826 -0.00421 0.01474  66  ALA B CA  
1904 C C   . ALA B 66  ? 0.46369 0.41639 1.10855 -0.02382 -0.01088 0.03199  66  ALA B C   
1905 O O   . ALA B 66  ? 0.32235 0.28127 0.99802 -0.02175 -0.00113 0.03456  66  ALA B O   
1906 C CB  . ALA B 66  ? 0.31286 0.27165 0.96999 -0.01686 0.00377  0.02050  66  ALA B CB  
1907 N N   . GLU B 67  ? 0.35769 0.28268 0.95873 -0.01973 -0.03434 0.04120  67  GLU B N   
1908 C CA  . GLU B 67  ? 0.37028 0.26796 0.95451 -0.00798 -0.05107 0.05215  67  GLU B CA  
1909 C C   . GLU B 67  ? 0.41451 0.32869 1.03238 -0.02745 -0.05827 0.06084  67  GLU B C   
1910 O O   . GLU B 67  ? 0.36495 0.26909 0.99013 -0.02129 -0.05965 0.06732  67  GLU B O   
1911 C CB  . GLU B 67  ? 0.41553 0.26910 0.94504 0.00947  -0.09015 0.05221  67  GLU B CB  
1912 C CG  . GLU B 67  ? 0.55873 0.39893 1.04092 0.04623  -0.08276 0.04902  67  GLU B CG  
1913 C CD  . GLU B 67  ? 0.63251 0.42706 1.05368 0.06862  -0.13033 0.03922  67  GLU B CD  
1914 O OE1 . GLU B 67  ? 0.72403 0.48238 1.14179 0.06366  -0.17870 0.03700  67  GLU B OE1 
1915 O OE2 . GLU B 67  ? 0.64173 0.43532 1.02483 0.09268  -0.12464 0.03505  67  GLU B OE2 
1916 N N   . LYS B 68  ? 0.37803 0.32382 1.01659 -0.04672 -0.06262 0.06724  68  LYS B N   
1917 C CA  . LYS B 68  ? 0.33082 0.31393 1.00838 -0.05848 -0.06103 0.08576  68  LYS B CA  
1918 C C   . LYS B 68  ? 0.42530 0.43322 1.12445 -0.05000 -0.03039 0.07100  68  LYS B C   
1919 O O   . LYS B 68  ? 0.31025 0.32667 1.03012 -0.05110 -0.02958 0.08248  68  LYS B O   
1920 C CB  . LYS B 68  ? 0.32090 0.35491 1.01837 -0.06896 -0.06185 0.10433  68  LYS B CB  
1921 C CG  . LYS B 68  ? 0.39164 0.48525 1.13406 -0.07223 -0.05548 0.13796  68  LYS B CG  
1922 C CD  . LYS B 68  ? 0.43594 0.57405 1.19609 -0.07892 -0.06821 0.18231  68  LYS B CD  
1923 N N   . LEU B 69  ? 0.30154 0.31637 1.00283 -0.04100 -0.01150 0.04539  69  LEU B N   
1924 C CA  . LEU B 69  ? 0.29260 0.32105 1.02605 -0.03134 0.00399  0.02835  69  LEU B CA  
1925 C C   . LEU B 69  ? 0.33198 0.32910 1.07679 -0.02839 0.00787  0.03627  69  LEU B C   
1926 O O   . LEU B 69  ? 0.29086 0.29645 1.06366 -0.02545 0.01382  0.03469  69  LEU B O   
1927 C CB  . LEU B 69  ? 0.29026 0.32630 1.03827 -0.02213 0.00805  -0.00006 69  LEU B CB  
1928 C CG  . LEU B 69  ? 0.29488 0.37523 1.03259 -0.00989 0.00671  -0.01484 69  LEU B CG  
1929 C CD1 . LEU B 69  ? 0.29975 0.37200 1.04029 -0.00226 0.00095  -0.04276 69  LEU B CD1 
1930 C CD2 . LEU B 69  ? 0.39197 0.50726 1.14571 0.01194  0.00895  -0.02778 69  LEU B CD2 
1931 N N   . MET B 70  ? 0.33404 0.30015 1.05348 -0.02251 0.00476  0.04703  70  MET B N   
1932 C CA  . MET B 70  ? 0.31840 0.26744 1.03921 -0.00821 0.01084  0.06190  70  MET B CA  
1933 C C   . MET B 70  ? 0.34887 0.28706 1.05422 -0.00974 -0.00356 0.07078  70  MET B C   
1934 O O   . MET B 70  ? 0.35434 0.29935 1.07704 -0.00480 0.00535  0.07587  70  MET B O   
1935 C CB  . MET B 70  ? 0.34155 0.27077 1.02515 0.01407  0.01060  0.07430  70  MET B CB  
1936 C CG  . MET B 70  ? 0.32963 0.27522 1.04014 0.01550  0.02568  0.07514  70  MET B CG  
1937 S SD  . MET B 70  ? 0.36076 0.29905 1.01949 0.04976  0.02879  0.09508  70  MET B SD  
1938 C CE  . MET B 70  ? 0.38671 0.34145 1.03738 0.08655  0.04742  0.13051  70  MET B CE  
1939 N N   . LYS B 71  ? 0.34445 0.26875 1.02529 -0.01827 -0.03035 0.07550  71  LYS B N   
1940 C CA  . LYS B 71  ? 0.41909 0.33791 1.09917 -0.02326 -0.05300 0.08816  71  LYS B CA  
1941 C C   . LYS B 71  ? 0.35415 0.31480 1.07680 -0.03430 -0.03504 0.09291  71  LYS B C   
1942 O O   . LYS B 71  ? 0.41533 0.37452 1.14623 -0.03206 -0.03842 0.10101  71  LYS B O   
1943 C CB  . LYS B 71  ? 0.37877 0.28492 1.04508 -0.03314 -0.09253 0.09891  71  LYS B CB  
1944 C CG  . LYS B 71  ? 0.38729 0.30532 1.07816 -0.04406 -0.11875 0.12107  71  LYS B CG  
1945 C CD  . LYS B 71  ? 0.42115 0.32018 1.10736 -0.04996 -0.17272 0.13417  71  LYS B CD  
1946 C CE  . LYS B 71  ? 0.43277 0.34745 1.15933 -0.05871 -0.20305 0.16143  71  LYS B CE  
1947 N NZ  . LYS B 71  ? 0.64161 0.53253 1.37459 -0.06258 -0.26906 0.16864  71  LYS B NZ  
1948 N N   . LEU B 72  ? 0.31120 0.31094 1.05671 -0.04101 -0.01866 0.08669  72  LEU B N   
1949 C CA  . LEU B 72  ? 0.30844 0.35274 1.08791 -0.03914 -0.00248 0.08639  72  LEU B CA  
1950 C C   . LEU B 72  ? 0.39063 0.42039 1.18462 -0.02845 0.01156  0.06828  72  LEU B C   
1951 O O   . LEU B 72  ? 0.29248 0.33377 1.10240 -0.02574 0.01551  0.07374  72  LEU B O   
1952 C CB  . LEU B 72  ? 0.28947 0.38386 1.07365 -0.03026 0.00844  0.07441  72  LEU B CB  
1953 C CG  . LEU B 72  ? 0.29039 0.44452 1.09085 -0.00827 0.02198  0.06946  72  LEU B CG  
1954 C CD1 . LEU B 72  ? 0.29557 0.43672 1.10720 0.01124  0.02569  0.02637  72  LEU B CD1 
1955 C CD2 . LEU B 72  ? 0.28931 0.47085 1.11145 -0.01191 0.02279  0.10489  72  LEU B CD2 
1956 N N   . GLN B 73  ? 0.35378 0.36165 1.14766 -0.02131 0.01765  0.05315  73  GLN B N   
1957 C CA  . GLN B 73  ? 0.35366 0.35376 1.17406 -0.01033 0.02646  0.04802  73  GLN B CA  
1958 C C   . GLN B 73  ? 0.29713 0.28919 1.10701 -0.00774 0.02644  0.06709  73  GLN B C   
1959 O O   . GLN B 73  ? 0.32233 0.32073 1.15664 -0.00348 0.03158  0.06600  73  GLN B O   
1960 C CB  . GLN B 73  ? 0.29175 0.28803 1.12595 -0.00303 0.03099  0.04810  73  GLN B CB  
1961 C CG  . GLN B 73  ? 0.44783 0.45089 1.32025 0.00289  0.03544  0.05322  73  GLN B CG  
1962 C CD  . GLN B 73  ? 0.41794 0.41986 1.32397 0.00245  0.02153  0.02420  73  GLN B CD  
1963 O OE1 . GLN B 73  ? 0.31010 0.30722 1.22490 0.00182  0.01733  0.00951  73  GLN B OE1 
1964 N NE2 . GLN B 73  ? 0.31197 0.31602 1.24362 0.00220  0.01003  0.01460  73  GLN B NE2 
1965 N N   . ASN B 74  ? 0.40256 0.37436 1.17429 -0.00807 0.01528  0.08110  74  ASN B N   
1966 C CA  . ASN B 74  ? 0.38810 0.34388 1.14170 -0.00155 0.00780  0.09375  74  ASN B CA  
1967 C C   . ASN B 74  ? 0.33140 0.29580 1.09613 -0.01184 -0.00480 0.09938  74  ASN B C   
1968 O O   . ASN B 74  ? 0.34229 0.30874 1.11650 -0.00846 -0.00152 0.10401  74  ASN B O   
1969 C CB  . ASN B 74  ? 0.43959 0.35704 1.13564 0.01498  -0.01248 0.09941  74  ASN B CB  
1970 C CG  . ASN B 74  ? 0.38690 0.30497 1.06805 0.03954  0.00785  0.10750  74  ASN B CG  
1971 O OD1 . ASN B 74  ? 0.46852 0.41069 1.18394 0.04194  0.03266  0.11903  74  ASN B OD1 
1972 N ND2 . ASN B 74  ? 0.40877 0.30522 1.04081 0.06113  -0.00486 0.10721  74  ASN B ND2 
1973 N N   . GLN B 75  ? 0.34634 0.32238 1.11470 -0.02399 -0.01776 0.10605  75  GLN B N   
1974 C CA  . GLN B 75  ? 0.32598 0.32150 1.11407 -0.03190 -0.02793 0.12633  75  GLN B CA  
1975 C C   . GLN B 75  ? 0.52276 0.54309 1.33824 -0.02724 -0.00293 0.12075  75  GLN B C   
1976 O O   . GLN B 75  ? 0.37217 0.39796 1.19903 -0.02761 -0.00705 0.13545  75  GLN B O   
1977 C CB  . GLN B 75  ? 0.32782 0.35080 1.12567 -0.04337 -0.03891 0.14771  75  GLN B CB  
1978 C CG  . GLN B 75  ? 0.35193 0.34497 1.13202 -0.04868 -0.07930 0.15837  75  GLN B CG  
1979 C CD  . GLN B 75  ? 0.48300 0.50508 1.27775 -0.05900 -0.08894 0.18346  75  GLN B CD  
1980 O OE1 . GLN B 75  ? 0.40042 0.44458 1.19048 -0.05958 -0.06628 0.17280  75  GLN B OE1 
1981 N NE2 . GLN B 75  ? 0.41398 0.44205 1.23386 -0.06565 -0.12483 0.21995  75  GLN B NE2 
1982 N N   . ARG B 76  ? 0.32786 0.32387 1.12460 -0.03986 -0.09454 0.05209  76  ARG B N   
1983 C CA  . ARG B 76  ? 0.38009 0.37648 1.20647 -0.03512 -0.09120 0.04765  76  ARG B CA  
1984 C C   . ARG B 76  ? 0.47854 0.47414 1.32349 -0.03259 -0.09232 0.06013  76  ARG B C   
1985 O O   . ARG B 76  ? 0.33635 0.33245 1.20773 -0.02858 -0.08975 0.05929  76  ARG B O   
1986 C CB  . ARG B 76  ? 0.33186 0.32493 1.16403 -0.03281 -0.08770 0.02886  76  ARG B CB  
1987 C CG  . ARG B 76  ? 0.35589 0.34994 1.17302 -0.03476 -0.08599 0.01603  76  ARG B CG  
1988 C CD  . ARG B 76  ? 0.34507 0.34360 1.17402 -0.03405 -0.08314 0.01771  76  ARG B CD  
1989 N NE  . ARG B 76  ? 0.33352 0.33084 1.19368 -0.02954 -0.07978 0.01708  76  ARG B NE  
1990 C CZ  . ARG B 76  ? 0.33803 0.33131 1.21479 -0.02647 -0.07497 0.00228  76  ARG B CZ  
1991 N NH1 . ARG B 76  ? 0.34193 0.33168 1.19909 -0.02471 -0.07260 -0.01329 76  ARG B NH1 
1992 N NH2 . ARG B 76  ? 0.34253 0.33428 1.24783 -0.02246 -0.07185 0.00318  76  ARG B NH2 
1993 N N   . GLY B 77  ? 0.41543 0.40975 1.24767 -0.03483 -0.09571 0.07235  77  GLY B N   
1994 C CA  . GLY B 77  ? 0.33708 0.33119 1.18534 -0.03267 -0.09673 0.08585  77  GLY B CA  
1995 C C   . GLY B 77  ? 0.34966 0.34149 1.21163 -0.02928 -0.09385 0.08188  77  GLY B C   
1996 O O   . GLY B 77  ? 0.34068 0.33354 1.22072 -0.02664 -0.09363 0.09250  77  GLY B O   
1997 N N   . GLY B 78  ? 0.36867 0.35812 1.22413 -0.02918 -0.09201 0.06718  78  GLY B N   
1998 C CA  . GLY B 78  ? 0.33838 0.32596 1.20498 -0.02658 -0.09051 0.06418  78  GLY B CA  
1999 C C   . GLY B 78  ? 0.40599 0.39215 1.25611 -0.02885 -0.09132 0.07489  78  GLY B C   
2000 O O   . GLY B 78  ? 0.33700 0.32240 1.16514 -0.03271 -0.09328 0.08430  78  GLY B O   
2001 N N   . ARG B 79  ? 0.46342 0.44886 1.32529 -0.02640 -0.08967 0.07372  79  ARG B N   
2002 C CA  . ARG B 79  ? 0.44523 0.42968 1.29793 -0.02746 -0.08876 0.08567  79  ARG B CA  
2003 C C   . ARG B 79  ? 0.35692 0.33909 1.20014 -0.02812 -0.08819 0.07607  79  ARG B C   
2004 O O   . ARG B 79  ? 0.43177 0.41404 1.29009 -0.02565 -0.08844 0.06345  79  ARG B O   
2005 C CB  . ARG B 79  ? 0.38883 0.37657 1.26768 -0.02371 -0.08661 0.09800  79  ARG B CB  
2006 C CG  . ARG B 79  ? 0.54870 0.53881 1.43238 -0.02388 -0.08801 0.10970  79  ARG B CG  
2007 C CD  . ARG B 79  ? 0.59500 0.58214 1.45169 -0.02798 -0.08957 0.12341  79  ARG B CD  
2008 N NE  . ARG B 79  ? 0.65458 0.64263 1.50831 -0.02961 -0.09333 0.13310  79  ARG B NE  
2009 C CZ  . ARG B 79  ? 0.67750 0.66401 1.51340 -0.03320 -0.09732 0.12999  79  ARG B CZ  
2010 N NH1 . ARG B 79  ? 0.58616 0.57056 1.40386 -0.03569 -0.09736 0.11715  79  ARG B NH1 
2011 N NH2 . ARG B 79  ? 0.64634 0.63432 1.48357 -0.03443 -0.10155 0.14031  79  ARG B NH2 
2012 N N   . ILE B 80  ? 0.43080 0.41036 1.24842 -0.03164 -0.08787 0.08218  80  ILE B N   
2013 C CA  . ILE B 80  ? 0.35412 0.33173 1.16048 -0.03269 -0.08720 0.07564  80  ILE B CA  
2014 C C   . ILE B 80  ? 0.33745 0.31653 1.16589 -0.02906 -0.08463 0.08113  80  ILE B C   
2015 O O   . ILE B 80  ? 0.35615 0.33552 1.18661 -0.02835 -0.08130 0.09703  80  ILE B O   
2016 C CB  . ILE B 80  ? 0.33503 0.30883 1.10946 -0.03713 -0.08654 0.08327  80  ILE B CB  
2017 C CG1 . ILE B 80  ? 0.48993 0.46290 1.24390 -0.04100 -0.08929 0.08279  80  ILE B CG1 
2018 C CG2 . ILE B 80  ? 0.37179 0.34427 1.13449 -0.03840 -0.08609 0.07441  80  ILE B CG2 
2019 C CD1 . ILE B 80  ? 0.34658 0.32111 1.08844 -0.04309 -0.09119 0.06599  80  ILE B CD1 
2020 N N   . PHE B 81  ? 0.33788 0.31778 1.18205 -0.02683 -0.08614 0.06830  81  PHE B N   
2021 C CA  . PHE B 81  ? 0.33941 0.32118 1.20337 -0.02392 -0.08426 0.07323  81  PHE B CA  
2022 C C   . PHE B 81  ? 0.33870 0.31850 1.19108 -0.02547 -0.08592 0.06430  81  PHE B C   
2023 O O   . PHE B 81  ? 0.37917 0.35775 1.23209 -0.02562 -0.09024 0.04769  81  PHE B O   
2024 C CB  . PHE B 81  ? 0.35954 0.34423 1.25759 -0.01957 -0.08519 0.06902  81  PHE B CB  
2025 C CG  . PHE B 81  ? 0.34264 0.33102 1.25552 -0.01769 -0.08223 0.08294  81  PHE B CG  
2026 C CD1 . PHE B 81  ? 0.34311 0.33539 1.26501 -0.01650 -0.07765 0.09996  81  PHE B CD1 
2027 C CD2 . PHE B 81  ? 0.34299 0.33151 1.25948 -0.01739 -0.08355 0.07991  81  PHE B CD2 
2028 C CE1 . PHE B 81  ? 0.34435 0.34084 1.27860 -0.01526 -0.07502 0.11302  81  PHE B CE1 
2029 C CE2 . PHE B 81  ? 0.50007 0.49260 1.43042 -0.01585 -0.08137 0.09355  81  PHE B CE2 
2030 C CZ  . PHE B 81  ? 0.45484 0.45150 1.39348 -0.01497 -0.07741 0.10997  81  PHE B CZ  
2031 N N   . LEU B 82  ? 0.33767 0.31691 1.17801 -0.02675 -0.08235 0.07548  82  LEU B N   
2032 C CA  . LEU B 82  ? 0.33659 0.31423 1.16417 -0.02856 -0.08358 0.06882  82  LEU B CA  
2033 C C   . LEU B 82  ? 0.33870 0.31900 1.19260 -0.02521 -0.08372 0.06952  82  LEU B C   
2034 O O   . LEU B 82  ? 0.34012 0.32400 1.21753 -0.02193 -0.08035 0.08058  82  LEU B O   
2035 C CB  . LEU B 82  ? 0.33518 0.30984 1.13439 -0.03177 -0.07915 0.08021  82  LEU B CB  
2036 C CG  . LEU B 82  ? 0.33387 0.30504 1.10387 -0.03580 -0.07970 0.08019  82  LEU B CG  
2037 C CD1 . LEU B 82  ? 0.33607 0.30218 1.08214 -0.03774 -0.07448 0.09497  82  LEU B CD1 
2038 C CD2 . LEU B 82  ? 0.33084 0.30215 1.08656 -0.03856 -0.08446 0.06227  82  LEU B CD2 
2039 N N   . GLN B 83  ? 0.33932 0.31852 1.19024 -0.02609 -0.08797 0.05781  83  GLN B N   
2040 C CA  . GLN B 83  ? 0.41613 0.39754 1.29206 -0.02321 -0.08919 0.05890  83  GLN B CA  
2041 C C   . GLN B 83  ? 0.48116 0.46202 1.34298 -0.02518 -0.08815 0.06150  83  GLN B C   
2042 O O   . GLN B 83  ? 0.33721 0.31583 1.16957 -0.02877 -0.08598 0.06268  83  GLN B O   
2043 C CB  . GLN B 83  ? 0.43538 0.41582 1.33052 -0.02143 -0.09712 0.04182  83  GLN B CB  
2044 C CG  . GLN B 83  ? 0.61079 0.58780 1.48581 -0.02416 -0.10311 0.02280  83  GLN B CG  
2045 C CD  . GLN B 83  ? 0.63313 0.60884 1.52702 -0.02193 -0.10878 0.00833  83  GLN B CD  
2046 O OE1 . GLN B 83  ? 0.72335 0.70011 1.63132 -0.01989 -0.10638 0.01183  83  GLN B OE1 
2047 N NE2 . GLN B 83  ? 0.65595 0.62930 1.55029 -0.02230 -0.11643 -0.00774 83  GLN B NE2 
2048 N N   . ASP B 84  ? 0.45431 0.43740 1.33927 -0.02267 -0.08961 0.06321  84  ASP B N   
2049 C CA  . ASP B 84  ? 0.34218 0.32529 1.21906 -0.02402 -0.08929 0.06529  84  ASP B CA  
2050 C C   . ASP B 84  ? 0.34214 0.32188 1.19419 -0.02793 -0.09600 0.04823  84  ASP B C   
2051 O O   . ASP B 84  ? 0.34588 0.32393 1.19956 -0.02811 -0.10332 0.03193  84  ASP B O   
2052 C CB  . ASP B 84  ? 0.34632 0.33242 1.25689 -0.02042 -0.09202 0.06749  84  ASP B CB  
2053 C CG  . ASP B 84  ? 0.47036 0.46243 1.40758 -0.01632 -0.08416 0.08555  84  ASP B CG  
2054 O OD1 . ASP B 84  ? 0.34264 0.33624 1.26728 -0.01680 -0.07569 0.09804  84  ASP B OD1 
2055 O OD2 . ASP B 84  ? 0.46819 0.46373 1.43860 -0.01278 -0.08646 0.08751  84  ASP B OD2 
2056 N N   . ILE B 85  ? 0.33851 0.31767 1.16726 -0.03091 -0.09296 0.05200  85  ILE B N   
2057 C CA  . ILE B 85  ? 0.33842 0.31625 1.14654 -0.03432 -0.09920 0.03675  85  ILE B CA  
2058 C C   . ILE B 85  ? 0.34204 0.32117 1.16639 -0.03321 -0.10383 0.03504  85  ILE B C   
2059 O O   . ILE B 85  ? 0.34755 0.32844 1.17874 -0.03227 -0.09821 0.04927  85  ILE B O   
2060 C CB  . ILE B 85  ? 0.43439 0.41104 1.20885 -0.03836 -0.09400 0.04086  85  ILE B CB  
2061 C CG1 . ILE B 85  ? 0.33070 0.30557 1.09216 -0.03930 -0.09046 0.04373  85  ILE B CG1 
2062 C CG2 . ILE B 85  ? 0.33244 0.30937 1.08707 -0.04159 -0.10053 0.02455  85  ILE B CG2 
2063 C CD1 . ILE B 85  ? 0.49492 0.46694 1.22715 -0.04259 -0.08361 0.05410  85  ILE B CD1 
2064 N N   . GLN B 86  ? 0.34850 0.32653 1.18074 -0.03292 -0.11402 0.01832  86  GLN B N   
2065 C CA  . GLN B 86  ? 0.38120 0.35985 1.23310 -0.03159 -0.11986 0.01739  86  GLN B CA  
2066 C C   . GLN B 86  ? 0.35123 0.33093 1.18287 -0.03476 -0.12052 0.01649  86  GLN B C   
2067 O O   . GLN B 86  ? 0.35469 0.33415 1.15725 -0.03806 -0.12069 0.00843  86  GLN B O   
2068 C CB  . GLN B 86  ? 0.36443 0.34056 1.23140 -0.03024 -0.13151 -0.00000 86  GLN B CB  
2069 C CG  . GLN B 86  ? 0.37000 0.34560 1.26419 -0.02657 -0.13097 0.00226  86  GLN B CG  
2070 C CD  . GLN B 86  ? 0.57390 0.55158 1.50234 -0.02305 -0.12962 0.01582  86  GLN B CD  
2071 O OE1 . GLN B 86  ? 0.61057 0.59101 1.55434 -0.02034 -0.12140 0.03057  86  GLN B OE1 
2072 N NE2 . GLN B 86  ? 0.59738 0.57431 1.53784 -0.02298 -0.13747 0.01191  86  GLN B NE2 
2073 N N   . LYS B 87  ? 0.35264 0.33401 1.20121 -0.03352 -0.12042 0.02566  87  LYS B N   
2074 C CA  . LYS B 87  ? 0.38788 0.37058 1.22159 -0.03627 -0.12252 0.02382  87  LYS B CA  
2075 C C   . LYS B 87  ? 0.35920 0.34034 1.18508 -0.03789 -0.13598 0.00226  87  LYS B C   
2076 O O   . LYS B 87  ? 0.42536 0.40387 1.26648 -0.03603 -0.14425 -0.00864 87  LYS B O   
2077 C CB  . LYS B 87  ? 0.35222 0.33717 1.20959 -0.03405 -0.11973 0.03883  87  LYS B CB  
2078 C CG  . LYS B 87  ? 0.36220 0.34613 1.25229 -0.03124 -0.12952 0.03455  87  LYS B CG  
2079 C CD  . LYS B 87  ? 0.49116 0.47733 1.39768 -0.03031 -0.12951 0.04530  87  LYS B CD  
2080 C CE  . LYS B 87  ? 0.44665 0.43085 1.38689 -0.02786 -0.14103 0.04065  87  LYS B CE  
2081 N NZ  . LYS B 87  ? 0.37697 0.36340 1.33500 -0.02671 -0.14030 0.05307  87  LYS B NZ  
2082 N N   . PRO B 88  ? 0.38912 0.37178 1.19024 -0.04112 -0.13814 -0.00435 88  PRO B N   
2083 C CA  . PRO B 88  ? 0.43370 0.41511 1.22488 -0.04217 -0.15096 -0.02467 88  PRO B CA  
2084 C C   . PRO B 88  ? 0.45163 0.43170 1.26860 -0.04046 -0.16177 -0.02778 88  PRO B C   
2085 O O   . PRO B 88  ? 0.37668 0.35788 1.21801 -0.03892 -0.15892 -0.01328 88  PRO B O   
2086 C CB  . PRO B 88  ? 0.35925 0.34407 1.12141 -0.04561 -0.14881 -0.02599 88  PRO B CB  
2087 C CG  . PRO B 88  ? 0.46303 0.44916 1.21352 -0.04680 -0.13488 -0.01113 88  PRO B CG  
2088 C CD  . PRO B 88  ? 0.34660 0.33184 1.12440 -0.04387 -0.12836 0.00566  88  PRO B CD  
2089 N N   . ASP B 89  ? 0.38915 0.36627 1.20001 -0.04050 -0.17456 -0.04716 89  ASP B N   
2090 C CA  . ASP B 89  ? 0.45740 0.43198 1.28993 -0.03922 -0.18740 -0.05297 89  ASP B CA  
2091 C C   . ASP B 89  ? 0.45147 0.42949 1.28703 -0.04074 -0.18935 -0.04467 89  ASP B C   
2092 O O   . ASP B 89  ? 0.41000 0.38698 1.27291 -0.03946 -0.19563 -0.03966 89  ASP B O   
2093 C CB  . ASP B 89  ? 0.53305 0.50288 1.35132 -0.03896 -0.20042 -0.07626 89  ASP B CB  
2094 C CG  . ASP B 89  ? 0.79485 0.76018 1.62098 -0.03663 -0.20089 -0.08455 89  ASP B CG  
2095 O OD1 . ASP B 89  ? 0.88774 0.85382 1.73631 -0.03502 -0.19367 -0.07248 89  ASP B OD1 
2096 O OD2 . ASP B 89  ? 0.87574 0.83664 1.68543 -0.03606 -0.20808 -0.10295 89  ASP B OD2 
2097 N N   . GLU B 90  ? 0.39263 0.37487 1.20223 -0.04339 -0.18394 -0.04248 90  GLU B N   
2098 C CA  . GLU B 90  ? 0.42298 0.40897 1.23235 -0.04500 -0.18662 -0.03691 90  GLU B CA  
2099 C C   . GLU B 90  ? 0.52259 0.51369 1.32474 -0.04639 -0.17136 -0.01843 90  GLU B C   
2100 O O   . GLU B 90  ? 0.36638 0.35843 1.14778 -0.04752 -0.16167 -0.01679 90  GLU B O   
2101 C CB  . GLU B 90  ? 0.39944 0.38576 1.18188 -0.04669 -0.19758 -0.05523 90  GLU B CB  
2102 C CG  . GLU B 90  ? 0.50889 0.48870 1.29346 -0.04492 -0.21287 -0.07492 90  GLU B CG  
2103 C CD  . GLU B 90  ? 0.63326 0.61083 1.44304 -0.04417 -0.22581 -0.07496 90  GLU B CD  
2104 O OE1 . GLU B 90  ? 0.58985 0.57077 1.42066 -0.04456 -0.22171 -0.05820 90  GLU B OE1 
2105 O OE2 . GLU B 90  ? 0.72207 0.69383 1.53083 -0.04297 -0.23988 -0.09149 90  GLU B OE2 
2106 N N   . ASP B 91  ? 0.37519 0.36889 1.19561 -0.04609 -0.16923 -0.00401 91  ASP B N   
2107 C CA  . ASP B 91  ? 0.46934 0.46770 1.28190 -0.04724 -0.15558 0.01311  91  ASP B CA  
2108 C C   . ASP B 91  ? 0.51822 0.52153 1.30913 -0.05029 -0.15897 0.00800  91  ASP B C   
2109 O O   . ASP B 91  ? 0.37923 0.38613 1.15025 -0.05220 -0.14811 0.01542  91  ASP B O   
2110 C CB  . ASP B 91  ? 0.54263 0.54138 1.38781 -0.04434 -0.14933 0.03352  91  ASP B CB  
2111 C CG  . ASP B 91  ? 0.56183 0.55649 1.43480 -0.04051 -0.14855 0.03815  91  ASP B CG  
2112 O OD1 . ASP B 91  ? 0.41581 0.40995 1.28506 -0.03912 -0.13716 0.04626  91  ASP B OD1 
2113 O OD2 . ASP B 91  ? 0.58719 0.57935 1.48678 -0.03879 -0.15929 0.03482  91  ASP B OD2 
2114 N N   . ASP B 92  ? 0.54654 0.54977 1.34158 -0.05060 -0.17411 -0.00422 92  ASP B N   
2115 C CA  . ASP B 92  ? 0.49949 0.50775 1.27744 -0.05283 -0.18043 -0.01039 92  ASP B CA  
2116 C C   . ASP B 92  ? 0.38113 0.38710 1.13470 -0.05324 -0.19279 -0.03439 92  ASP B C   
2117 O O   . ASP B 92  ? 0.39583 0.39614 1.15932 -0.05162 -0.20528 -0.04654 92  ASP B O   
2118 C CB  . ASP B 92  ? 0.38126 0.39030 1.18593 -0.05213 -0.18882 -0.00379 92  ASP B CB  
2119 C CG  . ASP B 92  ? 0.38481 0.39896 1.17444 -0.05403 -0.19817 -0.01126 92  ASP B CG  
2120 O OD1 . ASP B 92  ? 0.47053 0.48749 1.22880 -0.05545 -0.19981 -0.02365 92  ASP B OD1 
2121 O OD2 . ASP B 92  ? 0.57872 0.59396 1.38935 -0.05378 -0.20456 -0.00458 92  ASP B OD2 
2122 N N   . TRP B 93  ? 0.37374 0.38346 1.09568 -0.05497 -0.18930 -0.04123 93  TRP B N   
2123 C CA  . TRP B 93  ? 0.38273 0.38917 1.08037 -0.05429 -0.19881 -0.06331 93  TRP B CA  
2124 C C   . TRP B 93  ? 0.40559 0.41395 1.08907 -0.05417 -0.21247 -0.07610 93  TRP B C   
2125 O O   . TRP B 93  ? 0.40257 0.40775 1.06181 -0.05286 -0.21976 -0.09452 93  TRP B O   
2126 C CB  . TRP B 93  ? 0.37097 0.37871 1.04264 -0.05539 -0.18796 -0.06535 93  TRP B CB  
2127 C CG  . TRP B 93  ? 0.36506 0.36903 1.04843 -0.05487 -0.17798 -0.05682 93  TRP B CG  
2128 C CD1 . TRP B 93  ? 0.57074 0.57665 1.26035 -0.05602 -0.16343 -0.03795 93  TRP B CD1 
2129 C CD2 . TRP B 93  ? 0.37328 0.37046 1.06336 -0.05265 -0.18174 -0.06637 93  TRP B CD2 
2130 N NE1 . TRP B 93  ? 0.40268 0.40372 1.10184 -0.05459 -0.15844 -0.03517 93  TRP B NE1 
2131 C CE2 . TRP B 93  ? 0.36353 0.35982 1.06426 -0.05262 -0.16929 -0.05224 93  TRP B CE2 
2132 C CE3 . TRP B 93  ? 0.38908 0.38037 1.07681 -0.05039 -0.19420 -0.08525 93  TRP B CE3 
2133 C CZ2 . TRP B 93  ? 0.36749 0.35859 1.07785 -0.05058 -0.16906 -0.05616 93  TRP B CZ2 
2134 C CZ3 . TRP B 93  ? 0.39314 0.37877 1.09119 -0.04841 -0.19326 -0.08911 93  TRP B CZ3 
2135 C CH2 . TRP B 93  ? 0.38165 0.36787 1.09176 -0.04861 -0.18087 -0.07442 93  TRP B CH2 
2136 N N   . GLU B 94  ? 0.44931 0.46211 1.14777 -0.05497 -0.21620 -0.06654 94  GLU B N   
2137 C CA  . GLU B 94  ? 0.44879 0.46253 1.14097 -0.05448 -0.23170 -0.07687 94  GLU B CA  
2138 C C   . GLU B 94  ? 0.52107 0.54122 1.18023 -0.05500 -0.23168 -0.08421 94  GLU B C   
2139 O O   . GLU B 94  ? 0.40426 0.43082 1.06401 -0.05567 -0.23587 -0.07948 94  GLU B O   
2140 C CB  . GLU B 94  ? 0.45909 0.46311 1.15034 -0.05200 -0.24811 -0.09610 94  GLU B CB  
2141 C CG  . GLU B 94  ? 0.61524 0.61288 1.34147 -0.05111 -0.25339 -0.09154 94  GLU B CG  
2142 C CD  . GLU B 94  ? 0.73741 0.72491 1.45849 -0.04855 -0.26858 -0.11194 94  GLU B CD  
2143 O OE1 . GLU B 94  ? 0.67323 0.65843 1.36832 -0.04731 -0.27969 -0.12792 94  GLU B OE1 
2144 O OE2 . GLU B 94  ? 0.78958 0.77107 1.53095 -0.04732 -0.26878 -0.11208 94  GLU B OE2 
2145 N N   . SER B 95  ? 0.40091 0.41940 1.03229 -0.05431 -0.22754 -0.09577 95  SER B N   
2146 C CA  . SER B 95  ? 0.40324 0.42453 0.99228 -0.05109 -0.22488 -0.10311 95  SER B CA  
2147 C C   . SER B 95  ? 0.46507 0.48205 1.02043 -0.04776 -0.21263 -0.10957 95  SER B C   
2148 O O   . SER B 95  ? 0.51379 0.52581 1.08103 -0.04871 -0.20987 -0.11134 95  SER B O   
2149 C CB  . SER B 95  ? 0.42370 0.44213 1.00275 -0.04921 -0.24450 -0.12093 95  SER B CB  
2150 O OG  . SER B 95  ? 0.46828 0.47648 1.03858 -0.04718 -0.25360 -0.14050 95  SER B OG  
2151 N N   . GLY B 96  ? 0.48226 0.50153 0.99665 -0.04375 -0.20525 -0.11247 96  GLY B N   
2152 C CA  . GLY B 96  ? 0.40037 0.41627 0.88258 -0.04034 -0.19387 -0.11826 96  GLY B CA  
2153 C C   . GLY B 96  ? 0.43370 0.44074 0.90771 -0.03734 -0.20413 -0.13889 96  GLY B C   
2154 O O   . GLY B 96  ? 0.46005 0.46262 0.92984 -0.03641 -0.19744 -0.14227 96  GLY B O   
2155 N N   . LEU B 97  ? 0.43553 0.43906 0.90734 -0.03557 -0.22074 -0.15279 97  LEU B N   
2156 C CA  . LEU B 97  ? 0.48541 0.47806 0.94783 -0.03203 -0.23099 -0.17321 97  LEU B CA  
2157 C C   . LEU B 97  ? 0.54124 0.52790 1.04134 -0.03588 -0.23779 -0.17536 97  LEU B C   
2158 O O   . LEU B 97  ? 0.50651 0.48545 1.00093 -0.03359 -0.23563 -0.18510 97  LEU B O   
2159 C CB  . LEU B 97  ? 0.47796 0.46665 0.92659 -0.02893 -0.24815 -0.18751 97  LEU B CB  
2160 C CG  . LEU B 97  ? 0.53822 0.51293 0.98379 -0.02586 -0.26329 -0.20914 97  LEU B CG  
2161 C CD1 . LEU B 97  ? 0.51239 0.47993 0.92061 -0.01882 -0.25306 -0.22045 97  LEU B CD1 
2162 C CD2 . LEU B 97  ? 0.52580 0.49676 0.96650 -0.02453 -0.28348 -0.22010 97  LEU B CD2 
2163 N N   . ASN B 98  ? 0.54635 0.53648 1.08657 -0.04149 -0.24553 -0.16578 98  ASN B N   
2164 C CA  . ASN B 98  ? 0.49973 0.48432 1.07177 -0.04291 -0.24756 -0.16330 98  ASN B CA  
2165 C C   . ASN B 98  ? 0.50891 0.49502 1.08820 -0.04470 -0.23202 -0.15395 98  ASN B C   
2166 O O   . ASN B 98  ? 0.43970 0.41879 1.02690 -0.04309 -0.23124 -0.15902 98  ASN B O   
2167 C CB  . ASN B 98  ? 0.52215 0.51021 1.12751 -0.04528 -0.25221 -0.14912 98  ASN B CB  
2168 C CG  . ASN B 98  ? 0.56501 0.54647 1.20004 -0.04477 -0.25403 -0.14669 98  ASN B CG  
2169 O OD1 . ASN B 98  ? 0.55553 0.52787 1.19031 -0.04199 -0.26580 -0.16092 98  ASN B OD1 
2170 N ND2 . ASN B 98  ? 0.50906 0.49454 1.16837 -0.04697 -0.24215 -0.12883 98  ASN B ND2 
2171 N N   . ALA B 99  ? 0.47321 0.46789 1.04608 -0.04663 -0.21794 -0.13855 99  ALA B N   
2172 C CA  . ALA B 99  ? 0.40063 0.39586 0.97173 -0.04697 -0.20205 -0.12868 99  ALA B CA  
2173 C C   . ALA B 99  ? 0.44913 0.43858 0.99072 -0.04249 -0.19802 -0.14229 99  ALA B C   
2174 O O   . ALA B 99  ? 0.49449 0.48007 1.04665 -0.04283 -0.19365 -0.14252 99  ALA B O   
2175 C CB  . ALA B 99  ? 0.38435 0.38754 0.94229 -0.04768 -0.18659 -0.10994 99  ALA B CB  
2176 N N   . MET B 100 ? 0.51065 0.49950 1.01592 -0.03788 -0.19880 -0.15294 100 MET B N   
2177 C CA  . MET B 100 ? 0.42543 0.40895 0.90239 -0.03282 -0.19316 -0.16451 100 MET B CA  
2178 C C   . MET B 100 ? 0.44226 0.41494 0.93234 -0.03128 -0.20420 -0.18094 100 MET B C   
2179 O O   . MET B 100 ? 0.44284 0.41101 0.92938 -0.02920 -0.19766 -0.18488 100 MET B O   
2180 C CB  . MET B 100 ? 0.43411 0.41892 0.87009 -0.02750 -0.19117 -0.17176 100 MET B CB  
2181 C CG  . MET B 100 ? 0.41811 0.41213 0.83339 -0.02781 -0.17651 -0.15700 100 MET B CG  
2182 S SD  . MET B 100 ? 0.47383 0.46889 0.87830 -0.02758 -0.15875 -0.14861 100 MET B SD  
2183 C CE  . MET B 100 ? 0.39071 0.39447 0.76867 -0.02783 -0.14520 -0.13403 100 MET B CE  
2184 N N   . GLU B 101 ? 0.47545 0.44338 0.98173 -0.03234 -0.22129 -0.19040 101 GLU B N   
2185 C CA  . GLU B 101 ? 0.54593 0.50190 1.06776 -0.03146 -0.23343 -0.20610 101 GLU B CA  
2186 C C   . GLU B 101 ? 0.51010 0.46625 1.06448 -0.03410 -0.22749 -0.19553 101 GLU B C   
2187 O O   . GLU B 101 ? 0.61050 0.55876 1.16629 -0.03134 -0.22635 -0.20397 101 GLU B O   
2188 C CB  . GLU B 101 ? 0.49407 0.44643 1.02248 -0.03053 -0.25003 -0.21218 101 GLU B CB  
2189 C CG  . GLU B 101 ? 0.51205 0.46060 1.00635 -0.02640 -0.25908 -0.22676 101 GLU B CG  
2190 C CD  . GLU B 101 ? 0.67195 0.61879 1.17448 -0.02622 -0.27515 -0.22871 101 GLU B CD  
2191 O OE1 . GLU B 101 ? 0.89312 0.84120 1.42946 -0.02921 -0.27917 -0.21934 101 GLU B OE1 
2192 O OE2 . GLU B 101 ? 0.62217 0.56604 1.09724 -0.02269 -0.28378 -0.23939 101 GLU B OE2 
2193 N N   . ALA B 102 ? 0.49479 0.45928 1.07479 -0.03841 -0.22313 -0.17651 102 ALA B N   
2194 C CA  . ALA B 102 ? 0.43905 0.40376 1.04705 -0.03969 -0.21606 -0.16492 102 ALA B CA  
2195 C C   . ALA B 102 ? 0.49824 0.46352 1.09667 -0.04006 -0.20322 -0.16272 102 ALA B C   
2196 O O   . ALA B 102 ? 0.47117 0.43221 1.08249 -0.03876 -0.20021 -0.16338 102 ALA B O   
2197 C CB  . ALA B 102 ? 0.42530 0.39761 1.05872 -0.04311 -0.21210 -0.14427 102 ALA B CB  
2198 N N   . ALA B 103 ? 0.41569 0.38643 0.98934 -0.04079 -0.19481 -0.15913 103 ALA B N   
2199 C CA  . ALA B 103 ? 0.48584 0.45771 1.04233 -0.03881 -0.18054 -0.15445 103 ALA B CA  
2200 C C   . ALA B 103 ? 0.42237 0.38560 0.96413 -0.03370 -0.18208 -0.17178 103 ALA B C   
2201 O O   . ALA B 103 ? 0.45725 0.41837 1.00562 -0.03310 -0.17524 -0.17010 103 ALA B O   
2202 C CB  . ALA B 103 ? 0.39728 0.37664 0.92126 -0.03770 -0.16931 -0.14536 103 ALA B CB  
2203 N N   . LEU B 104 ? 0.44084 0.39850 0.96168 -0.02947 -0.19059 -0.18802 104 LEU B N   
2204 C CA  . LEU B 104 ? 0.45922 0.40657 0.96378 -0.02343 -0.19173 -0.20518 104 LEU B CA  
2205 C C   . LEU B 104 ? 0.49979 0.43806 1.03616 -0.02470 -0.19911 -0.21218 104 LEU B C   
2206 O O   . LEU B 104 ? 0.47056 0.40372 1.00669 -0.02180 -0.19265 -0.21614 104 LEU B O   
2207 C CB  . LEU B 104 ? 0.48027 0.42203 0.95601 -0.01841 -0.20073 -0.22067 104 LEU B CB  
2208 C CG  . LEU B 104 ? 0.66400 0.59190 1.12250 -0.01126 -0.20371 -0.24014 104 LEU B CG  
2209 C CD1 . LEU B 104 ? 0.50032 0.43000 0.93413 -0.00617 -0.18678 -0.23770 104 LEU B CD1 
2210 C CD2 . LEU B 104 ? 0.52932 0.44969 0.96361 -0.00682 -0.21619 -0.25555 104 LEU B CD2 
2211 N N   . HIS B 105 ? 0.47158 0.40932 1.03371 -0.02772 -0.21039 -0.21064 105 HIS B N   
2212 C CA  . HIS B 105 ? 0.48047 0.41299 1.06839 -0.02657 -0.21395 -0.21150 105 HIS B CA  
2213 C C   . HIS B 105 ? 0.46157 0.39925 1.07170 -0.02912 -0.20219 -0.19667 105 HIS B C   
2214 O O   . HIS B 105 ? 0.46703 0.39908 1.08545 -0.02682 -0.19940 -0.20135 105 HIS B O   
2215 C CB  . HIS B 105 ? 0.48750 0.42150 1.09567 -0.02796 -0.22534 -0.20746 105 HIS B CB  
2216 C CG  . HIS B 105 ? 0.61540 0.54338 1.24940 -0.02642 -0.23098 -0.21026 105 HIS B CG  
2217 N ND1 . HIS B 105 ? 0.61555 0.53249 1.24339 -0.02266 -0.24335 -0.22725 105 HIS B ND1 
2218 C CD2 . HIS B 105 ? 0.61603 0.54708 1.28131 -0.02782 -0.22585 -0.19829 105 HIS B CD2 
2219 C CE1 . HIS B 105 ? 0.53261 0.44654 1.18834 -0.02232 -0.24577 -0.22577 105 HIS B CE1 
2220 N NE2 . HIS B 105 ? 0.50998 0.43273 1.18933 -0.02523 -0.23518 -0.20825 105 HIS B NE2 
2221 N N   . LEU B 106 ? 0.44042 0.38831 1.05875 -0.03350 -0.19486 -0.17843 106 LEU B N   
2222 C CA  . LEU B 106 ? 0.43784 0.39041 1.07398 -0.03560 -0.18380 -0.16272 106 LEU B CA  
2223 C C   . LEU B 106 ? 0.51550 0.46548 1.13829 -0.03451 -0.17542 -0.16746 106 LEU B C   
2224 O O   . LEU B 106 ? 0.50054 0.44914 1.13962 -0.03380 -0.17048 -0.16338 106 LEU B O   
2225 C CB  . LEU B 106 ? 0.43640 0.39845 1.07550 -0.03980 -0.17721 -0.14354 106 LEU B CB  
2226 C CG  . LEU B 106 ? 0.41767 0.38437 1.06156 -0.04208 -0.16448 -0.12721 106 LEU B CG  
2227 C CD1 . LEU B 106 ? 0.38543 0.35225 1.05970 -0.04148 -0.16231 -0.11495 106 LEU B CD1 
2228 C CD2 . LEU B 106 ? 0.37311 0.34689 1.00327 -0.04582 -0.15796 -0.11453 106 LEU B CD2 
2229 N N   . GLU B 107 ? 0.50800 0.45835 1.09846 -0.03266 -0.17210 -0.17409 107 GLU B N   
2230 C CA  . GLU B 107 ? 0.42076 0.37064 0.99238 -0.02867 -0.16110 -0.17507 107 GLU B CA  
2231 C C   . GLU B 107 ? 0.53786 0.47622 1.11093 -0.02371 -0.16467 -0.19226 107 GLU B C   
2232 O O   . GLU B 107 ? 0.43781 0.37482 1.01461 -0.02175 -0.15670 -0.19058 107 GLU B O   
2233 C CB  . GLU B 107 ? 0.41917 0.37397 0.95175 -0.02558 -0.15406 -0.17473 107 GLU B CB  
2234 C CG  . GLU B 107 ? 0.52952 0.49459 1.05795 -0.02998 -0.14789 -0.15682 107 GLU B CG  
2235 C CD  . GLU B 107 ? 0.56851 0.53815 1.10163 -0.03201 -0.13689 -0.14203 107 GLU B CD  
2236 O OE1 . GLU B 107 ? 0.65994 0.63596 1.18848 -0.03536 -0.13163 -0.12725 107 GLU B OE1 
2237 O OE2 . GLU B 107 ? 0.64981 0.61610 1.19000 -0.03003 -0.13356 -0.14500 107 GLU B OE2 
2238 N N   . LYS B 108 ? 0.50805 0.43725 1.07788 -0.02140 -0.17669 -0.20876 108 LYS B N   
2239 C CA  . LYS B 108 ? 0.54977 0.46546 1.12154 -0.01646 -0.18036 -0.22544 108 LYS B CA  
2240 C C   . LYS B 108 ? 0.52223 0.43753 1.13024 -0.01868 -0.18029 -0.21879 108 LYS B C   
2241 O O   . LYS B 108 ? 0.53484 0.44323 1.14805 -0.01533 -0.17583 -0.22445 108 LYS B O   
2242 C CB  . LYS B 108 ? 0.50548 0.41088 1.06371 -0.01324 -0.19419 -0.24334 108 LYS B CB  
2243 C CG  . LYS B 108 ? 0.51909 0.42445 1.03484 -0.00803 -0.19199 -0.25037 108 LYS B CG  
2244 C CD  . LYS B 108 ? 0.57754 0.47020 1.07740 -0.00413 -0.20667 -0.26970 108 LYS B CD  
2245 C CE  . LYS B 108 ? 0.74539 0.62167 1.22797 0.00426  -0.20536 -0.28727 108 LYS B CE  
2246 N NZ  . LYS B 108 ? 0.81705 0.68160 1.27933 0.00910  -0.21892 -0.30337 108 LYS B NZ  
2247 N N   . ASN B 109 ? 0.48809 0.41211 1.11977 -0.02298 -0.18296 -0.20429 109 ASN B N   
2248 C CA  A ASN B 109 ? 0.46070 0.38664 1.12444 -0.02368 -0.18085 -0.19488 109 ASN B CA  
2249 C CA  B ASN B 109 ? 0.46044 0.38655 1.12434 -0.02375 -0.18085 -0.19463 109 ASN B CA  
2250 C C   . ASN B 109 ? 0.44289 0.37391 1.11394 -0.02531 -0.16821 -0.18228 109 ASN B C   
2251 O O   . ASN B 109 ? 0.60701 0.53474 1.29307 -0.02337 -0.16464 -0.18307 109 ASN B O   
2252 C CB  A ASN B 109 ? 0.49328 0.42596 1.17913 -0.02652 -0.18594 -0.18235 109 ASN B CB  
2253 C CB  B ASN B 109 ? 0.49035 0.42344 1.17542 -0.02670 -0.18579 -0.18185 109 ASN B CB  
2254 C CG  A ASN B 109 ? 0.57345 0.49937 1.27022 -0.02426 -0.19895 -0.19352 109 ASN B CG  
2255 C CG  B ASN B 109 ? 0.48576 0.42436 1.20139 -0.02799 -0.17947 -0.16509 109 ASN B CG  
2256 O OD1 A ASN B 109 ? 0.89131 0.80695 1.57424 -0.02062 -0.20496 -0.21145 109 ASN B OD1 
2257 O OD1 B ASN B 109 ? 0.46748 0.40259 1.20522 -0.02598 -0.18242 -0.16764 109 ASN B OD1 
2258 N ND2 A ASN B 109 ? 0.50188 0.43264 1.22279 -0.02607 -0.20313 -0.18261 109 ASN B ND2 
2259 N ND2 B ASN B 109 ? 0.46417 0.41097 1.18048 -0.03107 -0.17098 -0.14764 109 ASN B ND2 
2260 N N   . VAL B 110 ? 0.47877 0.41766 1.13878 -0.02891 -0.16172 -0.17047 110 VAL B N   
2261 C CA  . VAL B 110 ? 0.41024 0.35351 1.07366 -0.03067 -0.15081 -0.15858 110 VAL B CA  
2262 C C   . VAL B 110 ? 0.41952 0.35578 1.07205 -0.02635 -0.14633 -0.17040 110 VAL B C   
2263 O O   . VAL B 110 ? 0.58493 0.52096 1.25316 -0.02588 -0.14045 -0.16508 110 VAL B O   
2264 C CB  . VAL B 110 ? 0.45458 0.40650 1.09992 -0.03430 -0.14502 -0.14599 110 VAL B CB  
2265 C CG1 . VAL B 110 ? 0.40079 0.35728 1.03506 -0.03323 -0.13341 -0.13624 110 VAL B CG1 
2266 C CG2 . VAL B 110 ? 0.38342 0.34182 1.04359 -0.03788 -0.14529 -0.12929 110 VAL B CG2 
2267 N N   . ASN B 111 ? 0.43419 0.36546 1.05702 -0.02129 -0.14786 -0.18510 111 ASN B N   
2268 C CA  . ASN B 111 ? 0.44650 0.37158 1.05269 -0.01449 -0.14126 -0.19514 111 ASN B CA  
2269 C C   . ASN B 111 ? 0.46152 0.37474 1.09059 -0.01197 -0.14492 -0.20611 111 ASN B C   
2270 O O   . ASN B 111 ? 0.46352 0.37438 1.09657 -0.00848 -0.13669 -0.20577 111 ASN B O   
2271 C CB  . ASN B 111 ? 0.46260 0.38379 1.03114 -0.00900 -0.14233 -0.20829 111 ASN B CB  
2272 C CG  . ASN B 111 ? 0.50835 0.42407 1.05616 -0.00109 -0.13275 -0.21618 111 ASN B CG  
2273 O OD1 . ASN B 111 ? 0.46342 0.38379 1.01827 -0.00071 -0.12262 -0.20661 111 ASN B OD1 
2274 N ND2 . ASN B 111 ? 0.49638 0.40169 1.01860 0.00567  -0.13590 -0.23329 111 ASN B ND2 
2275 N N   . GLN B 112 ? 0.52237 0.42846 1.16624 -0.01330 -0.15698 -0.21523 112 GLN B N   
2276 C CA  . GLN B 112 ? 0.48912 0.38733 1.14968 -0.00966 -0.15923 -0.22273 112 GLN B CA  
2277 C C   . GLN B 112 ? 0.58576 0.49120 1.27804 -0.01227 -0.15256 -0.20712 112 GLN B C   
2278 O O   . GLN B 112 ? 0.48125 0.38078 1.18359 -0.00885 -0.14762 -0.21097 112 GLN B O   
2279 C CB  . GLN B 112 ? 0.50465 0.39980 1.17003 -0.00951 -0.17233 -0.23009 112 GLN B CB  
2280 N N   . SER B 113 ? 0.52169 0.43950 1.22848 -0.01760 -0.15135 -0.18873 113 SER B N   
2281 C CA  . SER B 113 ? 0.44149 0.36519 1.17589 -0.01884 -0.14501 -0.17413 113 SER B CA  
2282 C C   . SER B 113 ? 0.52863 0.45394 1.25776 -0.01914 -0.13447 -0.16782 113 SER B C   
2283 O O   . SER B 113 ? 0.52938 0.45538 1.27793 -0.01813 -0.12905 -0.16179 113 SER B O   
2284 C CB  . SER B 113 ? 0.44155 0.37558 1.19287 -0.02257 -0.14625 -0.15626 113 SER B CB  
2285 O OG  . SER B 113 ? 0.56702 0.50912 1.31203 -0.02596 -0.13910 -0.14019 113 SER B OG  
2286 N N   . LEU B 114 ? 0.54231 0.46795 1.24612 -0.02021 -0.13164 -0.16956 114 LEU B N   
2287 C CA  . LEU B 114 ? 0.54811 0.47904 1.23981 -0.01767 -0.12043 -0.16200 114 LEU B CA  
2288 C C   . LEU B 114 ? 0.52042 0.44172 1.20990 -0.01060 -0.11607 -0.17510 114 LEU B C   
2289 O O   . LEU B 114 ? 0.43194 0.35537 1.13260 -0.00907 -0.10818 -0.16797 114 LEU B O   
2290 C CB  . LEU B 114 ? 0.41271 0.35102 1.06979 -0.01752 -0.11658 -0.15830 114 LEU B CB  
2291 C CG  . LEU B 114 ? 0.56783 0.51666 1.22633 -0.02390 -0.11598 -0.14011 114 LEU B CG  
2292 C CD1 . LEU B 114 ? 0.47563 0.42950 1.09947 -0.02386 -0.11457 -0.13986 114 LEU B CD1 
2293 C CD2 . LEU B 114 ? 0.38109 0.33596 1.05226 -0.02577 -0.10892 -0.12403 114 LEU B CD2 
2294 N N   . LEU B 115 ? 0.46110 0.37105 1.13562 -0.00587 -0.12110 -0.19403 115 LEU B N   
2295 C CA  . LEU B 115 ? 0.47716 0.37494 1.14806 0.00180  -0.11681 -0.20771 115 LEU B CA  
2296 C C   . LEU B 115 ? 0.55601 0.44766 1.26395 0.00093  -0.11812 -0.20749 115 LEU B C   
2297 O O   . LEU B 115 ? 0.53633 0.42377 1.25145 0.00564  -0.10984 -0.20837 115 LEU B O   
2298 C CB  . LEU B 115 ? 0.55989 0.44462 1.20548 0.00701  -0.12368 -0.22842 115 LEU B CB  
2299 C CG  . LEU B 115 ? 0.53955 0.42786 1.14576 0.00963  -0.12226 -0.23163 115 LEU B CG  
2300 C CD1 . LEU B 115 ? 0.53716 0.41003 1.12215 0.01526  -0.13046 -0.25284 115 LEU B CD1 
2301 C CD2 . LEU B 115 ? 0.57094 0.46457 1.15859 0.01461  -0.10792 -0.22557 115 LEU B CD2 
2302 N N   . GLU B 116 ? 0.47654 0.37209 1.20485 -0.00383 -0.12693 -0.20343 116 GLU B N   
2303 C CA  . GLU B 116 ? 0.49516 0.39240 1.25457 -0.00381 -0.12633 -0.19808 116 GLU B CA  
2304 C C   . GLU B 116 ? 0.48984 0.39661 1.26917 -0.00634 -0.11737 -0.17963 116 GLU B C   
2305 O O   . GLU B 116 ? 0.46110 0.36626 1.26028 -0.00396 -0.11232 -0.17764 116 GLU B O   
2306 C CB  . GLU B 116 ? 0.55570 0.45815 1.33123 -0.00710 -0.13631 -0.19480 116 GLU B CB  
2307 N N   . LEU B 117 ? 0.43818 0.35466 1.21134 -0.01112 -0.11543 -0.16575 117 LEU B N   
2308 C CA  . LEU B 117 ? 0.42164 0.34655 1.21030 -0.01350 -0.10806 -0.14796 117 LEU B CA  
2309 C C   . LEU B 117 ? 0.42674 0.34743 1.20869 -0.00877 -0.09903 -0.15144 117 LEU B C   
2310 O O   . LEU B 117 ? 0.42975 0.35266 1.23317 -0.00820 -0.09347 -0.14247 117 LEU B O   
2311 C CB  . LEU B 117 ? 0.40308 0.33848 1.18124 -0.01920 -0.10803 -0.13269 117 LEU B CB  
2312 C CG  . LEU B 117 ? 0.55192 0.49725 1.34661 -0.02188 -0.10337 -0.11161 117 LEU B CG  
2313 C CD1 . LEU B 117 ? 0.58568 0.53923 1.37298 -0.02588 -0.10596 -0.09754 117 LEU B CD1 
2314 C CD2 . LEU B 117 ? 0.77245 0.72088 1.55845 -0.02143 -0.09610 -0.10571 117 LEU B CD2 
2315 N N   . HIS B 118 ? 0.43729 0.35456 1.18694 -0.00390 -0.09648 -0.16282 118 HIS B N   
2316 C CA  . HIS B 118 ? 0.45339 0.36921 1.19304 0.00262  -0.08599 -0.16475 118 HIS B CA  
2317 C C   . HIS B 118 ? 0.57622 0.47906 1.33413 0.00836  -0.08334 -0.17578 118 HIS B C   
2318 O O   . HIS B 118 ? 0.56486 0.46887 1.33566 0.01159  -0.07443 -0.16973 118 HIS B O   
2319 C CB  . HIS B 118 ? 0.45324 0.36732 1.15401 0.00734  -0.08317 -0.17449 118 HIS B CB  
2320 C CG  . HIS B 118 ? 0.46189 0.37608 1.15276 0.01403  -0.07111 -0.17373 118 HIS B CG  
2321 N ND1 . HIS B 118 ? 0.49974 0.40134 1.19262 0.02226  -0.06517 -0.18577 118 HIS B ND1 
2322 C CD2 . HIS B 118 ? 0.50511 0.43007 1.18579 0.01383  -0.06360 -0.16168 118 HIS B CD2 
2323 C CE1 . HIS B 118 ? 0.47928 0.38447 1.16429 0.02718  -0.05370 -0.18058 118 HIS B CE1 
2324 N NE2 . HIS B 118 ? 0.52487 0.44458 1.20345 0.02189  -0.05306 -0.16597 118 HIS B NE2 
2325 N N   . LYS B 119 ? 0.49720 0.38693 1.25617 0.00990  -0.09111 -0.19214 119 LYS B N   
2326 C CA  . LYS B 119 ? 0.59341 0.47046 1.36867 0.01506  -0.08918 -0.20247 119 LYS B CA  
2327 C C   . LYS B 119 ? 0.48545 0.37213 1.29715 0.01128  -0.08697 -0.18684 119 LYS B C   
2328 O O   . LYS B 119 ? 0.49123 0.37498 1.31658 0.01554  -0.07859 -0.18538 119 LYS B O   
2329 C CB  . LYS B 119 ? 0.58163 0.44991 1.34632 0.01611  -0.09949 -0.21860 119 LYS B CB  
2330 C CG  . LYS B 119 ? 0.54458 0.39996 1.31314 0.02259  -0.09661 -0.23073 119 LYS B CG  
2331 C CD  . LYS B 119 ? 0.63839 0.48266 1.39032 0.02405  -0.10789 -0.24806 119 LYS B CD  
2332 N N   . LEU B 120 ? 0.46851 0.36719 1.29567 0.00402  -0.09362 -0.17417 120 LEU B N   
2333 C CA  . LEU B 120 ? 0.45553 0.36455 1.31530 0.00111  -0.09116 -0.15761 120 LEU B CA  
2334 C C   . LEU B 120 ? 0.60924 0.52240 1.47618 0.00187  -0.08147 -0.14529 120 LEU B C   
2335 O O   . LEU B 120 ? 0.55847 0.47206 1.44706 0.00438  -0.07547 -0.14092 120 LEU B O   
2336 C CB  . LEU B 120 ? 0.49383 0.41509 1.36192 -0.00508 -0.09778 -0.14390 120 LEU B CB  
2337 C CG  . LEU B 120 ? 0.52776 0.46034 1.42559 -0.00714 -0.09516 -0.12480 120 LEU B CG  
2338 C CD1 . LEU B 120 ? 0.50929 0.43883 1.43362 -0.00388 -0.09275 -0.12874 120 LEU B CD1 
2339 C CD2 . LEU B 120 ? 0.41376 0.35515 1.31546 -0.01066 -0.10088 -0.11327 120 LEU B CD2 
2340 N N   . ALA B 121 ? 0.56049 0.47676 1.40976 -0.00040 -0.08003 -0.13940 121 ALA B N   
2341 C CA  . ALA B 121 ? 0.52487 0.45106 1.37698 -0.00032 -0.07215 -0.12407 121 ALA B CA  
2342 C C   . ALA B 121 ? 0.54700 0.46697 1.40033 0.00764  -0.06221 -0.13063 121 ALA B C   
2343 O O   . ALA B 121 ? 0.42930 0.35419 1.30416 0.00838  -0.05623 -0.11886 121 ALA B O   
2344 C CB  . ALA B 121 ? 0.40981 0.34615 1.23177 -0.00320 -0.07232 -0.11693 121 ALA B CB  
2345 N N   . THR B 122 ? 0.45366 0.36251 1.28353 0.01413  -0.05993 -0.14867 122 THR B N   
2346 C CA  . THR B 122 ? 0.47865 0.38013 1.30888 0.02280  -0.04883 -0.15446 122 THR B CA  
2347 C C   . THR B 122 ? 0.48629 0.37553 1.34501 0.02611  -0.04763 -0.16143 122 THR B C   
2348 O O   . THR B 122 ? 0.51674 0.40440 1.38893 0.03136  -0.03760 -0.15818 122 THR B O   
2349 C CB  . THR B 122 ? 0.60926 0.50206 1.40173 0.02983  -0.04522 -0.17032 122 THR B CB  
2350 O OG1 . THR B 122 ? 0.68048 0.55789 1.46360 0.03193  -0.05265 -0.18960 122 THR B OG1 
2351 C CG2 . THR B 122 ? 0.52287 0.42759 1.28844 0.02592  -0.04731 -0.16367 122 THR B CG2 
2352 N N   . ASP B 123 ? 0.48725 0.37485 1.35106 0.02214  -0.05719 -0.16758 123 ASP B N   
2353 C CA  . ASP B 123 ? 0.62551 0.51141 1.51339 0.02277  -0.05649 -0.16852 123 ASP B CA  
2354 C C   . ASP B 123 ? 0.53831 0.43796 1.45979 0.01880  -0.05293 -0.14788 123 ASP B C   
2355 O O   . ASP B 123 ? 0.48623 0.38453 1.42768 0.02154  -0.04679 -0.14623 123 ASP B O   
2356 C CB  . ASP B 123 ? 0.64892 0.53248 1.53695 0.01913  -0.06832 -0.17748 123 ASP B CB  
2357 C CG  . ASP B 123 ? 0.72784 0.59437 1.58700 0.02476  -0.07131 -0.20001 123 ASP B CG  
2358 O OD1 . ASP B 123 ? 0.84028 0.69529 1.68514 0.03273  -0.06211 -0.20894 123 ASP B OD1 
2359 O OD2 . ASP B 123 ? 0.67417 0.53878 1.52397 0.02180  -0.08256 -0.20806 123 ASP B OD2 
2360 N N   . LYS B 124 ? 0.45544 0.36775 1.38211 0.01259  -0.05658 -0.13183 124 LYS B N   
2361 C CA  . LYS B 124 ? 0.43945 0.36454 1.39463 0.00922  -0.05413 -0.11169 124 LYS B CA  
2362 C C   . LYS B 124 ? 0.46727 0.39548 1.42362 0.01149  -0.04586 -0.10130 124 LYS B C   
2363 O O   . LYS B 124 ? 0.44403 0.38355 1.41970 0.00799  -0.04546 -0.08291 124 LYS B O   
2364 C CB  . LYS B 124 ? 0.42145 0.35824 1.38116 0.00215  -0.06259 -0.09844 124 LYS B CB  
2365 C CG  . LYS B 124 ? 0.53936 0.47509 1.50174 0.00063  -0.07056 -0.10626 124 LYS B CG  
2366 C CD  . LYS B 124 ? 0.43864 0.37241 1.42695 0.00293  -0.06886 -0.11024 124 LYS B CD  
2367 C CE  . LYS B 124 ? 0.48558 0.41322 1.47096 0.00287  -0.07678 -0.12431 124 LYS B CE  
2368 N NZ  . LYS B 124 ? 0.48675 0.40347 1.48137 0.00692  -0.07435 -0.13833 124 LYS B NZ  
2369 N N   . ASN B 125 ? 0.44398 0.36280 1.38027 0.01806  -0.03926 -0.11223 125 ASN B N   
2370 C CA  . ASN B 125 ? 0.43848 0.36381 1.37165 0.02098  -0.03082 -0.10226 125 ASN B CA  
2371 C C   . ASN B 125 ? 0.47924 0.42094 1.40873 0.01309  -0.03625 -0.08366 125 ASN B C   
2372 O O   . ASN B 125 ? 0.40604 0.35756 1.35448 0.01126  -0.03404 -0.06675 125 ASN B O   
2373 C CB  . ASN B 125 ? 0.45394 0.37896 1.41634 0.02562  -0.02135 -0.09586 125 ASN B CB  
2374 C CG  . ASN B 125 ? 0.48156 0.39353 1.44030 0.03219  -0.01549 -0.11293 125 ASN B CG  
2375 O OD1 . ASN B 125 ? 0.54700 0.44699 1.47965 0.03888  -0.01143 -0.12870 125 ASN B OD1 
2376 N ND2 . ASN B 125 ? 0.56083 0.47423 1.54416 0.03043  -0.01539 -0.11014 125 ASN B ND2 
2377 N N   . ASP B 126 ? 0.41070 0.35446 1.31531 0.00842  -0.04400 -0.08689 126 ASP B N   
2378 C CA  . ASP B 126 ? 0.39309 0.34973 1.28734 0.00152  -0.04899 -0.07146 126 ASP B CA  
2379 C C   . ASP B 126 ? 0.43974 0.39861 1.29839 0.00312  -0.04655 -0.07678 126 ASP B C   
2380 O O   . ASP B 126 ? 0.41055 0.36817 1.24467 0.00075  -0.05183 -0.08374 126 ASP B O   
2381 C CB  . ASP B 126 ? 0.44836 0.40594 1.34498 -0.00510 -0.05871 -0.06812 126 ASP B CB  
2382 C CG  . ASP B 126 ? 0.38535 0.35441 1.27585 -0.01178 -0.06326 -0.04980 126 ASP B CG  
2383 O OD1 . ASP B 126 ? 0.39724 0.37294 1.27014 -0.01219 -0.06109 -0.04393 126 ASP B OD1 
2384 O OD2 . ASP B 126 ? 0.44912 0.41976 1.35244 -0.01640 -0.06891 -0.04098 126 ASP B OD2 
2385 N N   . PRO B 127 ? 0.39623 0.35852 1.25279 0.00737  -0.03819 -0.07315 127 PRO B N   
2386 C CA  . PRO B 127 ? 0.39985 0.36283 1.22391 0.01031  -0.03419 -0.07960 127 PRO B CA  
2387 C C   . PRO B 127 ? 0.44708 0.42033 1.25140 0.00319  -0.04043 -0.06933 127 PRO B C   
2388 O O   . PRO B 127 ? 0.38838 0.36065 1.16237 0.00400  -0.04044 -0.07735 127 PRO B O   
2389 C CB  . PRO B 127 ? 0.46018 0.42452 1.29531 0.01675  -0.02284 -0.07555 127 PRO B CB  
2390 C CG  . PRO B 127 ? 0.39642 0.36731 1.26704 0.01348  -0.02405 -0.05953 127 PRO B CG  
2391 C CD  . PRO B 127 ? 0.41027 0.37633 1.29591 0.00981  -0.03175 -0.06204 127 PRO B CD  
2392 N N   . HIS B 128 ? 0.37121 0.35309 1.19056 -0.00354 -0.04603 -0.05218 128 HIS B N   
2393 C CA  . HIS B 128 ? 0.35970 0.34834 1.15862 -0.01040 -0.05293 -0.04355 128 HIS B CA  
2394 C C   . HIS B 128 ? 0.37181 0.35528 1.15283 -0.01257 -0.05870 -0.05345 128 HIS B C   
2395 O O   . HIS B 128 ? 0.38348 0.36847 1.13581 -0.01412 -0.06022 -0.05649 128 HIS B O   
2396 C CB  . HIS B 128 ? 0.34861 0.34446 1.16577 -0.01664 -0.05874 -0.02424 128 HIS B CB  
2397 C CG  . HIS B 128 ? 0.42795 0.42810 1.22241 -0.02323 -0.06576 -0.01572 128 HIS B CG  
2398 N ND1 . HIS B 128 ? 0.38326 0.38099 1.17391 -0.02736 -0.07208 -0.01382 128 HIS B ND1 
2399 C CD2 . HIS B 128 ? 0.33508 0.34069 1.10846 -0.02596 -0.06678 -0.00919 128 HIS B CD2 
2400 C CE1 . HIS B 128 ? 0.33056 0.33158 1.09775 -0.03202 -0.07619 -0.00622 128 HIS B CE1 
2401 N NE2 . HIS B 128 ? 0.32975 0.33538 1.08587 -0.03153 -0.07358 -0.00362 128 HIS B NE2 
2402 N N   . LEU B 129 ? 0.36384 0.34145 1.16331 -0.01291 -0.06212 -0.05775 129 LEU B N   
2403 C CA  . LEU B 129 ? 0.36433 0.33771 1.15141 -0.01545 -0.06834 -0.06546 129 LEU B CA  
2404 C C   . LEU B 129 ? 0.41933 0.38626 1.18104 -0.01070 -0.06634 -0.08378 129 LEU B C   
2405 O O   . LEU B 129 ? 0.37330 0.34118 1.11053 -0.01298 -0.06994 -0.08699 129 LEU B O   
2406 C CB  . LEU B 129 ? 0.46757 0.43570 1.28332 -0.01645 -0.07218 -0.06642 129 LEU B CB  
2407 C CG  . LEU B 129 ? 0.45781 0.42160 1.26794 -0.01927 -0.07913 -0.07322 129 LEU B CG  
2408 C CD1 . LEU B 129 ? 0.35587 0.32625 1.14616 -0.02481 -0.08288 -0.06241 129 LEU B CD1 
2409 C CD2 . LEU B 129 ? 0.36862 0.32791 1.21223 -0.02044 -0.08248 -0.07189 129 LEU B CD2 
2410 N N   . ALA B 130 ? 0.38952 0.34917 1.15586 -0.00362 -0.06025 -0.09553 130 ALA B N   
2411 C CA  . ALA B 130 ? 0.42919 0.38142 1.16882 0.00240  -0.05720 -0.11269 130 ALA B CA  
2412 C C   . ALA B 130 ? 0.39796 0.35723 1.10704 0.00177  -0.05488 -0.10937 130 ALA B C   
2413 O O   . ALA B 130 ? 0.40032 0.35785 1.08447 0.00128  -0.05851 -0.11740 130 ALA B O   
2414 C CB  . ALA B 130 ? 0.43681 0.38085 1.18446 0.01100  -0.04817 -0.12153 130 ALA B CB  
2415 N N   . ASP B 131 ? 0.39137 0.35834 1.10313 0.00209  -0.04879 -0.09778 131 ASP B N   
2416 C CA  . ASP B 131 ? 0.47272 0.44550 1.15732 0.00235  -0.04542 -0.09535 131 ASP B CA  
2417 C C   . ASP B 131 ? 0.37485 0.35377 1.04392 -0.00538 -0.05312 -0.08783 131 ASP B C   
2418 O O   . ASP B 131 ? 0.40745 0.38753 1.04847 -0.00498 -0.05252 -0.09208 131 ASP B O   
2419 C CB  . ASP B 131 ? 0.41640 0.39636 1.11222 0.00362  -0.03828 -0.08314 131 ASP B CB  
2420 C CG  . ASP B 131 ? 0.52036 0.50579 1.19015 0.00445  -0.03397 -0.08100 131 ASP B CG  
2421 O OD1 . ASP B 131 ? 0.51289 0.49279 1.16047 0.01094  -0.02845 -0.09392 131 ASP B OD1 
2422 O OD2 . ASP B 131 ? 0.39063 0.38519 1.06170 -0.00130 -0.03647 -0.06640 131 ASP B OD2 
2423 N N   . PHE B 132 ? 0.41756 0.39975 1.10392 -0.01188 -0.05968 -0.07638 132 PHE B N   
2424 C CA  . PHE B 132 ? 0.41625 0.40196 1.08780 -0.01840 -0.06626 -0.06965 132 PHE B CA  
2425 C C   . PHE B 132 ? 0.37755 0.35755 1.03261 -0.01743 -0.06973 -0.08333 132 PHE B C   
2426 O O   . PHE B 132 ? 0.37991 0.36204 1.00885 -0.01895 -0.07072 -0.08437 132 PHE B O   
2427 C CB  . PHE B 132 ? 0.34639 0.33434 1.04064 -0.02402 -0.07168 -0.05564 132 PHE B CB  
2428 C CG  . PHE B 132 ? 0.48084 0.47019 1.16125 -0.02972 -0.07741 -0.04872 132 PHE B CG  
2429 C CD1 . PHE B 132 ? 0.57343 0.56786 1.23711 -0.03390 -0.07842 -0.03639 132 PHE B CD1 
2430 C CD2 . PHE B 132 ? 0.46247 0.44730 1.14672 -0.03072 -0.08166 -0.05443 132 PHE B CD2 
2431 C CE1 . PHE B 132 ? 0.39979 0.39394 1.04878 -0.03840 -0.08249 -0.02993 132 PHE B CE1 
2432 C CE2 . PHE B 132 ? 0.49891 0.48477 1.17113 -0.03529 -0.08552 -0.04713 132 PHE B CE2 
2433 C CZ  . PHE B 132 ? 0.39992 0.39008 1.05348 -0.03883 -0.08535 -0.03485 132 PHE B CZ  
2434 N N   . ILE B 133 ? 0.45349 0.42593 1.12441 -0.01497 -0.07205 -0.09383 133 ILE B N   
2435 C CA  . ILE B 133 ? 0.41734 0.38374 1.07572 -0.01419 -0.07704 -0.10721 133 ILE B CA  
2436 C C   . ILE B 133 ? 0.44372 0.40814 1.07090 -0.00901 -0.07308 -0.11885 133 ILE B C   
2437 O O   . ILE B 133 ? 0.51319 0.47892 1.11792 -0.01058 -0.07612 -0.12162 133 ILE B O   
2438 C CB  . ILE B 133 ? 0.41329 0.37050 1.09539 -0.01193 -0.08045 -0.11760 133 ILE B CB  
2439 C CG1 . ILE B 133 ? 0.37820 0.33752 1.08956 -0.01762 -0.08542 -0.10586 133 ILE B CG1 
2440 C CG2 . ILE B 133 ? 0.40209 0.35105 1.06885 -0.00936 -0.08566 -0.13504 133 ILE B CG2 
2441 C CD1 . ILE B 133 ? 0.38363 0.34584 1.08949 -0.02321 -0.09172 -0.10008 133 ILE B CD1 
2442 N N   . GLU B 134 ? 0.39577 0.35739 1.02122 -0.00249 -0.06531 -0.12425 134 GLU B N   
2443 C CA  . GLU B 134 ? 0.50439 0.46355 1.10099 0.00386  -0.05948 -0.13424 134 GLU B CA  
2444 C C   . GLU B 134 ? 0.60241 0.57059 1.17558 0.00033  -0.05856 -0.12567 134 GLU B C   
2445 O O   . GLU B 134 ? 0.77588 0.74340 1.32699 -0.00036 -0.06226 -0.13153 134 GLU B O   
2446 C CB  . GLU B 134 ? 0.50915 0.46574 1.11219 0.01106  -0.04909 -0.13574 134 GLU B CB  
2447 C CG  . GLU B 134 ? 0.55673 0.50121 1.17539 0.01693  -0.04800 -0.14801 134 GLU B CG  
2448 C CD  . GLU B 134 ? 0.72994 0.67219 1.35815 0.02418  -0.03621 -0.14684 134 GLU B CD  
2449 O OE1 . GLU B 134 ? 0.63117 0.58340 1.27022 0.02194  -0.03146 -0.13199 134 GLU B OE1 
2450 O OE2 . GLU B 134 ? 0.83832 0.76803 1.46378 0.03233  -0.03182 -0.16066 134 GLU B OE2 
2451 N N   . THR B 135 ? 0.41823 0.39469 0.99803 -0.00267 -0.05484 -0.11098 135 THR B N   
2452 C CA  . THR B 135 ? 0.53016 0.51364 1.08697 -0.00455 -0.05220 -0.10425 135 THR B CA  
2453 C C   . THR B 135 ? 0.55423 0.54154 1.10047 -0.01202 -0.05941 -0.09714 135 THR B C   
2454 O O   . THR B 135 ? 0.57751 0.56827 1.09941 -0.01295 -0.05801 -0.09564 135 THR B O   
2455 C CB  . THR B 135 ? 0.52043 0.51051 1.08867 -0.00512 -0.04659 -0.09144 135 THR B CB  
2456 O OG1 . THR B 135 ? 0.54807 0.54017 1.14475 -0.00976 -0.05075 -0.08063 135 THR B OG1 
2457 C CG2 . THR B 135 ? 0.52143 0.50777 1.09210 0.00391  -0.03668 -0.09914 135 THR B CG2 
2458 N N   . HIS B 136 ? 0.61760 0.60389 1.18105 -0.01690 -0.06628 -0.09249 136 HIS B N   
2459 C CA  . HIS B 136 ? 0.48798 0.47687 1.04035 -0.02296 -0.07151 -0.08526 136 HIS B CA  
2460 C C   . HIS B 136 ? 0.51200 0.49607 1.06208 -0.02286 -0.07712 -0.09519 136 HIS B C   
2461 O O   . HIS B 136 ? 0.47173 0.45752 1.01321 -0.02721 -0.08074 -0.08960 136 HIS B O   
2462 C CB  . HIS B 136 ? 0.48411 0.47591 1.05452 -0.02897 -0.07472 -0.06899 136 HIS B CB  
2463 C CG  . HIS B 136 ? 0.51408 0.51106 1.08352 -0.03059 -0.07161 -0.05731 136 HIS B CG  
2464 N ND1 . HIS B 136 ? 0.54333 0.54185 1.13718 -0.03200 -0.07227 -0.04763 136 HIS B ND1 
2465 C CD2 . HIS B 136 ? 0.51909 0.52001 1.06749 -0.03126 -0.06855 -0.05337 136 HIS B CD2 
2466 C CE1 . HIS B 136 ? 0.61141 0.61459 1.19967 -0.03358 -0.07047 -0.03842 136 HIS B CE1 
2467 N NE2 . HIS B 136 ? 0.57709 0.58164 1.13818 -0.03328 -0.06815 -0.04178 136 HIS B NE2 
2468 N N   . TYR B 137 ? 0.47925 0.45663 1.03663 -0.01794 -0.07818 -0.10961 137 TYR B N   
2469 C CA  . TYR B 137 ? 0.42630 0.39923 0.98499 -0.01893 -0.08552 -0.11769 137 TYR B CA  
2470 C C   . TYR B 137 ? 0.51297 0.47896 1.05548 -0.01248 -0.08615 -0.13611 137 TYR B C   
2471 O O   . TYR B 137 ? 0.66325 0.62799 1.19188 -0.01301 -0.09129 -0.14219 137 TYR B O   
2472 C CB  . TYR B 137 ? 0.49733 0.46718 1.08952 -0.02175 -0.09063 -0.11458 137 TYR B CB  
2473 C CG  . TYR B 137 ? 0.56634 0.54193 1.16809 -0.02831 -0.09174 -0.09642 137 TYR B CG  
2474 C CD1 . TYR B 137 ? 0.55253 0.53245 1.16131 -0.03001 -0.08769 -0.08330 137 TYR B CD1 
2475 C CD2 . TYR B 137 ? 0.40620 0.38230 1.00843 -0.03238 -0.09665 -0.09183 137 TYR B CD2 
2476 C CE1 . TYR B 137 ? 0.49062 0.47399 1.10349 -0.03528 -0.08886 -0.06699 137 TYR B CE1 
2477 C CE2 . TYR B 137 ? 0.39658 0.37623 1.00394 -0.03727 -0.09630 -0.07485 137 TYR B CE2 
2478 C CZ  . TYR B 137 ? 0.53919 0.52186 1.15022 -0.03857 -0.09259 -0.06285 137 TYR B CZ  
2479 O OH  . TYR B 137 ? 0.56999 0.55435 1.18286 -0.04280 -0.09261 -0.04619 137 TYR B OH  
2480 N N   . LEU B 138 ? 0.52913 0.49001 1.07172 -0.00595 -0.08086 -0.14484 138 LEU B N   
2481 C CA  . LEU B 138 ? 0.54708 0.49766 1.07831 0.00043  -0.08342 -0.16353 138 LEU B CA  
2482 C C   . LEU B 138 ? 0.59931 0.55039 1.09493 0.00469  -0.08037 -0.17009 138 LEU B C   
2483 O O   . LEU B 138 ? 0.47264 0.41845 0.95400 0.00637  -0.08688 -0.18147 138 LEU B O   
2484 C CB  . LEU B 138 ? 0.57309 0.51528 1.11755 0.00670  -0.07869 -0.17135 138 LEU B CB  
2485 C CG  . LEU B 138 ? 0.61575 0.55735 1.19686 0.00245  -0.08216 -0.16493 138 LEU B CG  
2486 C CD1 . LEU B 138 ? 0.59966 0.53002 1.19396 0.00884  -0.07954 -0.17613 138 LEU B CD1 
2487 C CD2 . LEU B 138 ? 0.69914 0.64059 1.29305 -0.00384 -0.09323 -0.16419 138 LEU B CD2 
2488 N N   . ASN B 139 ? 0.47738 0.43503 0.95894 0.00616  -0.07120 -0.16244 139 ASN B N   
2489 C CA  . ASN B 139 ? 0.60028 0.55895 1.04887 0.00995  -0.06815 -0.16753 139 ASN B CA  
2490 C C   . ASN B 139 ? 0.54704 0.51219 0.98532 0.00351  -0.07408 -0.16129 139 ASN B C   
2491 O O   . ASN B 139 ? 0.55663 0.52046 0.97098 0.00615  -0.07581 -0.16881 139 ASN B O   
2492 C CB  . ASN B 139 ? 0.65100 0.61455 1.08856 0.01371  -0.05633 -0.16128 139 ASN B CB  
2493 C CG  . ASN B 139 ? 0.73154 0.69335 1.13577 0.02030  -0.05162 -0.16953 139 ASN B CG  
2494 O OD1 . ASN B 139 ? 0.79732 0.74907 1.18849 0.02794  -0.05170 -0.18440 139 ASN B OD1 
2495 N ND2 . ASN B 139 ? 0.63471 0.60533 1.02400 0.01770  -0.04762 -0.16006 139 ASN B ND2 
2496 N N   . GLU B 140 ? 0.47098 0.44240 0.92635 -0.00441 -0.07695 -0.14741 140 GLU B N   
2497 C CA  . GLU B 140 ? 0.38787 0.36397 0.83458 -0.00992 -0.08166 -0.14112 140 GLU B CA  
2498 C C   . GLU B 140 ? 0.45975 0.43030 0.91131 -0.01007 -0.09149 -0.15140 140 GLU B C   
2499 O O   . GLU B 140 ? 0.56763 0.53950 1.00210 -0.01048 -0.09480 -0.15395 140 GLU B O   
2500 C CB  . GLU B 140 ? 0.40610 0.38804 0.86864 -0.01736 -0.08180 -0.12380 140 GLU B CB  
2501 C CG  . GLU B 140 ? 0.54314 0.53192 0.98606 -0.01988 -0.07595 -0.11222 140 GLU B CG  
2502 C CD  . GLU B 140 ? 0.85065 0.84165 1.27057 -0.02137 -0.07737 -0.11197 140 GLU B CD  
2503 O OE1 . GLU B 140 ? 0.86390 0.85599 1.28917 -0.02652 -0.08133 -0.10390 140 GLU B OE1 
2504 O OE2 . GLU B 140 ? 0.95560 0.94706 1.35224 -0.01687 -0.07380 -0.11933 140 GLU B OE2 
2505 N N   . GLN B 141 ? 0.43322 0.39720 0.90862 -0.00954 -0.09655 -0.15772 141 GLN B N   
2506 C CA  . GLN B 141 ? 0.43623 0.39373 0.91754 -0.00943 -0.10704 -0.16895 141 GLN B CA  
2507 C C   . GLN B 141 ? 0.43560 0.38643 0.88957 -0.00228 -0.10844 -0.18541 141 GLN B C   
2508 O O   . GLN B 141 ? 0.43948 0.38894 0.88417 -0.00282 -0.11638 -0.19137 141 GLN B O   
2509 C CB  . GLN B 141 ? 0.47456 0.42531 0.98773 -0.01011 -0.11193 -0.17282 141 GLN B CB  
2510 C CG  . GLN B 141 ? 0.61193 0.56803 1.15355 -0.01747 -0.11404 -0.15767 141 GLN B CG  
2511 C CD  . GLN B 141 ? 0.63799 0.59646 1.18380 -0.02221 -0.12186 -0.15427 141 GLN B CD  
2512 O OE1 . GLN B 141 ? 0.74091 0.69363 1.28792 -0.02103 -0.13074 -0.16631 141 GLN B OE1 
2513 N NE2 . GLN B 141 ? 0.61785 0.58405 1.16613 -0.02739 -0.11879 -0.13761 141 GLN B NE2 
2514 N N   . VAL B 142 ? 0.44540 0.39149 0.88671 0.00488  -0.10083 -0.19262 142 VAL B N   
2515 C CA  . VAL B 142 ? 0.48845 0.42637 0.90136 0.01295  -0.10133 -0.20836 142 VAL B CA  
2516 C C   . VAL B 142 ? 0.51023 0.45527 0.89532 0.01278  -0.09975 -0.20490 142 VAL B C   
2517 O O   . VAL B 142 ? 0.49967 0.44023 0.86689 0.01553  -0.10659 -0.21526 142 VAL B O   
2518 C CB  . VAL B 142 ? 0.53417 0.46550 0.93889 0.02152  -0.09086 -0.21458 142 VAL B CB  
2519 C CG1 . VAL B 142 ? 0.49751 0.42466 0.86539 0.03017  -0.08580 -0.22406 142 VAL B CG1 
2520 C CG2 . VAL B 142 ? 0.62625 0.54462 1.04944 0.02463  -0.09521 -0.22614 142 VAL B CG2 
2521 N N   . LYS B 143 ? 0.44340 0.39926 0.82505 0.00925  -0.09152 -0.19006 143 LYS B N   
2522 C CA  . LYS B 143 ? 0.43726 0.40011 0.79433 0.00845  -0.08943 -0.18536 143 LYS B CA  
2523 C C   . LYS B 143 ? 0.45174 0.41749 0.81499 0.00226  -0.09953 -0.18238 143 LYS B C   
2524 O O   . LYS B 143 ? 0.49036 0.45696 0.83320 0.00385  -0.10250 -0.18650 143 LYS B O   
2525 C CB  . LYS B 143 ? 0.41971 0.39208 0.77408 0.00538  -0.07930 -0.16999 143 LYS B CB  
2526 C CG  . LYS B 143 ? 0.48033 0.45160 0.82584 0.01200  -0.06811 -0.17151 143 LYS B CG  
2527 N N   . ALA B 144 ? 0.41903 0.38656 0.81112 -0.00453 -0.10428 -0.17418 144 ALA B N   
2528 C CA  . ALA B 144 ? 0.52952 0.49973 0.93165 -0.01019 -0.11286 -0.16973 144 ALA B CA  
2529 C C   . ALA B 144 ? 0.49093 0.45367 0.89103 -0.00728 -0.12432 -0.18512 144 ALA B C   
2530 O O   . ALA B 144 ? 0.46069 0.42599 0.85156 -0.00856 -0.12981 -0.18532 144 ALA B O   
2531 C CB  . ALA B 144 ? 0.41081 0.38277 0.84596 -0.01671 -0.11491 -0.15845 144 ALA B CB  
2532 N N   . ILE B 145 ? 0.44684 0.39961 0.85475 -0.00314 -0.12825 -0.19822 145 ILE B N   
2533 C CA  . ILE B 145 ? 0.50438 0.44770 0.90970 -0.00027 -0.14069 -0.21415 145 ILE B CA  
2534 C C   . ILE B 145 ? 0.48309 0.42415 0.85089 0.00647  -0.13984 -0.22367 145 ILE B C   
2535 O O   . ILE B 145 ? 0.49132 0.43077 0.85110 0.00640  -0.15008 -0.22979 145 ILE B O   
2536 C CB  . ILE B 145 ? 0.48339 0.41460 0.90445 0.00295  -0.14440 -0.22619 145 ILE B CB  
2537 C CG1 . ILE B 145 ? 0.46916 0.40277 0.92950 -0.00387 -0.14636 -0.21647 145 ILE B CG1 
2538 C CG2 . ILE B 145 ? 0.50928 0.42817 0.92221 0.00679  -0.15784 -0.24459 145 ILE B CG2 
2539 C CD1 . ILE B 145 ? 0.48188 0.40471 0.95871 -0.00052 -0.14627 -0.22563 145 ILE B CD1 
2540 N N   . LYS B 146 ? 0.48611 0.42681 0.83144 0.01270  -0.12780 -0.22481 146 LYS B N   
2541 C CA  . LYS B 146 ? 0.66849 0.60801 0.97733 0.01956  -0.12485 -0.23161 146 LYS B CA  
2542 C C   . LYS B 146 ? 0.59240 0.54265 0.89197 0.01504  -0.12631 -0.22191 146 LYS B C   
2543 O O   . LYS B 146 ? 0.49813 0.44619 0.77839 0.01803  -0.13300 -0.22947 146 LYS B O   
2544 C CB  . LYS B 146 ? 0.65163 0.59156 0.94345 0.02597  -0.10933 -0.22983 146 LYS B CB  
2545 C CG  . LYS B 146 ? 0.55259 0.49083 0.80659 0.03438  -0.10364 -0.23604 146 LYS B CG  
2546 C CD  . LYS B 146 ? 0.55202 0.47577 0.78875 0.04186  -0.11309 -0.25496 146 LYS B CD  
2547 C CE  . LYS B 146 ? 0.56216 0.48314 0.75987 0.05138  -0.10655 -0.26085 146 LYS B CE  
2548 N NZ  . LYS B 146 ? 0.54648 0.48014 0.73264 0.04764  -0.10514 -0.25048 146 LYS B NZ  
2549 N N   . GLU B 147 ? 0.52359 0.48464 0.83648 0.00802  -0.12042 -0.20507 147 GLU B N   
2550 C CA  . GLU B 147 ? 0.44826 0.41869 0.75119 0.00422  -0.11955 -0.19485 147 GLU B CA  
2551 C C   . GLU B 147 ? 0.54880 0.51903 0.86538 0.00006  -0.13314 -0.19637 147 GLU B C   
2552 O O   . GLU B 147 ? 0.53427 0.50731 0.83431 0.00104  -0.13663 -0.19737 147 GLU B O   
2553 C CB  . GLU B 147 ? 0.47029 0.44964 0.78359 -0.00198 -0.11031 -0.17694 147 GLU B CB  
2554 C CG  . GLU B 147 ? 0.42562 0.41317 0.73150 -0.00641 -0.10901 -0.16527 147 GLU B CG  
2555 C CD  . GLU B 147 ? 0.52500 0.51871 0.83637 -0.01170 -0.09976 -0.14859 147 GLU B CD  
2556 O OE1 . GLU B 147 ? 0.67525 0.67156 0.96960 -0.00967 -0.08986 -0.14497 147 GLU B OE1 
2557 O OE2 . GLU B 147 ? 0.66678 0.66202 0.99988 -0.01775 -0.10255 -0.13884 147 GLU B OE2 
2558 N N   . LEU B 148 ? 0.44740 0.41479 0.79599 -0.00467 -0.14077 -0.19565 148 LEU B N   
2559 C CA  . LEU B 148 ? 0.53269 0.49963 0.89897 -0.00868 -0.15427 -0.19691 148 LEU B CA  
2560 C C   . LEU B 148 ? 0.53393 0.49220 0.88395 -0.00311 -0.16589 -0.21474 148 LEU B C   
2561 O O   . LEU B 148 ? 0.58984 0.55048 0.93730 -0.00446 -0.17470 -0.21518 148 LEU B O   
2562 C CB  . LEU B 148 ? 0.56452 0.52909 0.96968 -0.01405 -0.15962 -0.19330 148 LEU B CB  
2563 C CG  . LEU B 148 ? 0.42024 0.39349 0.84092 -0.02003 -0.15013 -0.17368 148 LEU B CG  
2564 C CD1 . LEU B 148 ? 0.41543 0.38572 0.87127 -0.02376 -0.15244 -0.17004 148 LEU B CD1 
2565 C CD2 . LEU B 148 ? 0.40959 0.39045 0.83162 -0.02423 -0.15116 -0.16199 148 LEU B CD2 
2566 N N   . GLY B 149 ? 0.55718 0.50457 0.89589 0.00346  -0.16623 -0.22933 149 GLY B N   
2567 C CA  . GLY B 149 ? 0.52225 0.45920 0.83876 0.01007  -0.17641 -0.24690 149 GLY B CA  
2568 C C   . GLY B 149 ? 0.63001 0.57186 0.91233 0.01425  -0.17291 -0.24628 149 GLY B C   
2569 O O   . GLY B 149 ? 0.53903 0.47859 0.81236 0.01525  -0.18488 -0.25298 149 GLY B O   
2570 N N   . ASP B 150 ? 0.52954 0.47789 0.79303 0.01690  -0.15688 -0.23830 150 ASP B N   
2571 C CA  . ASP B 150 ? 0.54206 0.49619 0.77494 0.02056  -0.15171 -0.23567 150 ASP B CA  
2572 C C   . ASP B 150 ? 0.50310 0.46653 0.74602 0.01397  -0.15870 -0.22599 150 ASP B C   
2573 O O   . ASP B 150 ? 0.51409 0.47786 0.73816 0.01689  -0.16479 -0.23029 150 ASP B O   
2574 C CB  . ASP B 150 ? 0.50057 0.46197 0.72095 0.02200  -0.13322 -0.22499 150 ASP B CB  
2575 C CG  . ASP B 150 ? 0.57169 0.52462 0.77940 0.02995  -0.12442 -0.23363 150 ASP B CG  
2576 O OD1 . ASP B 150 ? 0.68312 0.62333 0.88528 0.03577  -0.13107 -0.24884 150 ASP B OD1 
2577 O OD2 . ASP B 150 ? 0.74233 0.70084 0.94665 0.03039  -0.11041 -0.22461 150 ASP B OD2 
2578 N N   . HIS B 151 ? 0.48075 0.45152 0.75306 0.00551  -0.15723 -0.21210 151 HIS B N   
2579 C CA  . HIS B 151 ? 0.46782 0.44733 0.75163 -0.00048 -0.16137 -0.20070 151 HIS B CA  
2580 C C   . HIS B 151 ? 0.63735 0.61227 0.93386 -0.00148 -0.17983 -0.20969 151 HIS B C   
2581 O O   . HIS B 151 ? 0.50105 0.48033 0.78921 -0.00155 -0.18533 -0.20788 151 HIS B O   
2582 C CB  . HIS B 151 ? 0.45978 0.44551 0.77243 -0.00828 -0.15555 -0.18448 151 HIS B CB  
2583 C CG  . HIS B 151 ? 0.48972 0.48122 0.78966 -0.00867 -0.13910 -0.17288 151 HIS B CG  
2584 N ND1 . HIS B 151 ? 0.43177 0.42522 0.69916 -0.00336 -0.12982 -0.17445 151 HIS B ND1 
2585 C CD2 . HIS B 151 ? 0.41082 0.40592 0.72629 -0.01371 -0.13088 -0.15942 151 HIS B CD2 
2586 C CE1 . HIS B 151 ? 0.45892 0.45701 0.72382 -0.00561 -0.11718 -0.16272 151 HIS B CE1 
2587 N NE2 . HIS B 151 ? 0.40396 0.40279 0.69648 -0.01184 -0.11798 -0.15365 151 HIS B NE2 
2588 N N   . VAL B 152 ? 0.49239 0.45862 0.81154 -0.00271 -0.18991 -0.21864 152 VAL B N   
2589 C CA  . VAL B 152 ? 0.50947 0.46939 0.84227 -0.00375 -0.20923 -0.22890 152 VAL B CA  
2590 C C   . VAL B 152 ? 0.59315 0.54692 0.89077 0.00376  -0.21642 -0.24294 152 VAL B C   
2591 O O   . VAL B 152 ? 0.60589 0.56138 0.90417 0.00260  -0.22886 -0.24421 152 VAL B O   
2592 C CB  . VAL B 152 ? 0.51942 0.46850 0.87733 -0.00493 -0.21758 -0.23866 152 VAL B CB  
2593 C CG1 . VAL B 152 ? 0.56152 0.50221 0.93084 -0.00562 -0.23908 -0.25123 152 VAL B CG1 
2594 C CG2 . VAL B 152 ? 0.49608 0.45129 0.89114 -0.01236 -0.21203 -0.22404 152 VAL B CG2 
2595 N N   . THR B 153 ? 0.54907 0.49504 0.81620 0.01193  -0.20891 -0.25342 153 THR B N   
2596 C CA  . THR B 153 ? 0.57518 0.51386 0.80471 0.02057  -0.21376 -0.26660 153 THR B CA  
2597 C C   . THR B 153 ? 0.61385 0.56409 0.82660 0.02051  -0.21053 -0.25685 153 THR B C   
2598 O O   . THR B 153 ? 0.65169 0.59912 0.85088 0.02313  -0.22313 -0.26398 153 THR B O   
2599 C CB  . THR B 153 ? 0.58786 0.51834 0.78819 0.02973  -0.20075 -0.27489 153 THR B CB  
2600 O OG1 . THR B 153 ? 0.59924 0.51757 0.81435 0.03051  -0.20449 -0.28503 153 THR B OG1 
2601 C CG2 . THR B 153 ? 0.61612 0.53857 0.77417 0.03994  -0.20347 -0.28730 153 THR B CG2 
2602 N N   . ASN B 154 ? 0.54028 0.50299 0.75371 0.01751  -0.19428 -0.24050 154 ASN B N   
2603 C CA  . ASN B 154 ? 0.53201 0.50517 0.72943 0.01762  -0.18994 -0.23087 154 ASN B CA  
2604 C C   . ASN B 154 ? 0.52484 0.50445 0.74784 0.01057  -0.20265 -0.22347 154 ASN B C   
2605 O O   . ASN B 154 ? 0.53480 0.51653 0.74441 0.01268  -0.21045 -0.22518 154 ASN B O   
2606 C CB  . ASN B 154 ? 0.55419 0.53729 0.74602 0.01601  -0.16985 -0.21572 154 ASN B CB  
2607 C CG  . ASN B 154 ? 0.61510 0.59454 0.77387 0.02458  -0.15695 -0.22144 154 ASN B CG  
2608 O OD1 . ASN B 154 ? 0.60556 0.58571 0.73464 0.03086  -0.15435 -0.22434 154 ASN B OD1 
2609 N ND2 . ASN B 154 ? 0.51349 0.48894 0.67837 0.02524  -0.14869 -0.22266 154 ASN B ND2 
2610 N N   . LEU B 155 ? 0.50774 0.49082 0.76828 0.00248  -0.20426 -0.21412 155 LEU B N   
2611 C CA  . LEU B 155 ? 0.61333 0.60170 0.90230 -0.00382 -0.21640 -0.20692 155 LEU B CA  
2612 C C   . LEU B 155 ? 0.62017 0.60038 0.90665 -0.00127 -0.23757 -0.22226 155 LEU B C   
2613 O O   . LEU B 155 ? 0.69272 0.67807 0.98002 -0.00224 -0.24644 -0.21897 155 LEU B O   
2614 C CB  . LEU B 155 ? 0.56062 0.55043 0.89156 -0.01151 -0.21680 -0.19785 155 LEU B CB  
2615 C CG  . LEU B 155 ? 0.56562 0.56579 0.90812 -0.01645 -0.20083 -0.17726 155 LEU B CG  
2616 C CD1 . LEU B 155 ? 0.45001 0.46015 0.78745 -0.01780 -0.19799 -0.16466 155 LEU B CD1 
2617 C CD2 . LEU B 155 ? 0.62090 0.62073 0.94099 -0.01345 -0.18438 -0.17591 155 LEU B CD2 
2618 N N   . ARG B 156 ? 0.63318 0.59984 0.91474 0.00245  -0.24592 -0.23932 156 ARG B N   
2619 C CA  . ARG B 156 ? 0.68422 0.64034 0.96278 0.00480  -0.26770 -0.25530 156 ARG B CA  
2620 C C   . ARG B 156 ? 0.65946 0.61407 0.89621 0.01266  -0.26984 -0.26232 156 ARG B C   
2621 O O   . ARG B 156 ? 0.67852 0.63424 0.91690 0.01186  -0.28531 -0.26408 156 ARG B O   
2622 C CB  . ARG B 156 ? 0.62420 0.56410 0.90433 0.00760  -0.27455 -0.27225 156 ARG B CB  
2623 C CG  . ARG B 156 ? 0.77775 0.71470 1.10416 -0.00027 -0.28759 -0.27208 156 ARG B CG  
2624 C CD  . ARG B 156 ? 0.81810 0.73902 1.14606 0.00264  -0.29076 -0.28759 156 ARG B CD  
2625 N NE  . ARG B 156 ? 0.82501 0.74823 1.19817 -0.00516 -0.29077 -0.27983 156 ARG B NE  
2626 C CZ  . ARG B 156 ? 0.85537 0.76857 1.23789 -0.00358 -0.28921 -0.28603 156 ARG B CZ  
2627 N NH1 . ARG B 156 ? 0.90916 0.80758 1.26124 0.00462  -0.28966 -0.30309 156 ARG B NH1 
2628 N NH2 . ARG B 156 ? 0.81150 0.72931 1.23328 -0.00958 -0.28614 -0.27442 156 ARG B NH2 
2629 N N   . CYS B 157 ? 0.60328 0.55528 0.80329 0.02053  -0.25464 -0.26598 157 CYS B N   
2630 C CA  . CYS B 157 ? 0.76382 0.71397 0.92233 0.02905  -0.25478 -0.27209 157 CYS B CA  
2631 C C   . CYS B 157 ? 0.63042 0.59552 0.79068 0.02585  -0.25327 -0.25741 157 CYS B C   
2632 O O   . CYS B 157 ? 0.70853 0.67233 0.84925 0.02995  -0.26388 -0.26256 157 CYS B O   
2633 C CB  . CYS B 157 ? 0.86818 0.81509 0.99205 0.03760  -0.23530 -0.27485 157 CYS B CB  
2634 S SG  . CYS B 157 ? 1.16844 1.09357 1.27284 0.04643  -0.23893 -0.29671 157 CYS B SG  
2635 N N   . MET B 158 ? 0.70353 0.61235 0.95545 -0.07213 -0.25599 -0.19552 158 MET B N   
2636 C CA  . MET B 158 ? 0.66481 0.65201 0.94821 -0.06237 -0.27286 -0.17749 158 MET B CA  
2637 C C   . MET B 158 ? 0.73398 0.78162 1.03070 -0.09760 -0.29109 -0.19437 158 MET B C   
2638 O O   . MET B 158 ? 0.64901 0.76788 0.97003 -0.08981 -0.30290 -0.17570 158 MET B O   
2639 C CB  . MET B 158 ? 0.57142 0.54312 0.89105 -0.04879 -0.26361 -0.15124 158 MET B CB  
2640 C CG  . MET B 158 ? 0.62099 0.55530 0.94066 -0.01355 -0.25084 -0.13162 158 MET B CG  
2641 S SD  . MET B 158 ? 0.59547 0.51117 0.94934 -0.00700 -0.24202 -0.11180 158 MET B SD  
2642 C CE  . MET B 158 ? 0.50884 0.49765 0.89629 0.00547  -0.25040 -0.10143 158 MET B CE  
2643 N N   . GLY B 159 ? 0.68551 0.70626 0.97457 -0.13624 -0.28978 -0.22667 159 GLY B N   
2644 C CA  . GLY B 159 ? 0.70115 0.77954 1.01207 -0.17287 -0.30774 -0.24420 159 GLY B CA  
2645 C C   . GLY B 159 ? 0.67833 0.74572 1.03961 -0.18928 -0.29965 -0.23188 159 GLY B C   
2646 O O   . GLY B 159 ? 0.67777 0.80153 1.06615 -0.21102 -0.31301 -0.23182 159 GLY B O   
2647 N N   . ALA B 160 ? 0.69012 0.69368 1.06375 -0.17545 -0.27531 -0.21488 160 ALA B N   
2648 C CA  . ALA B 160 ? 0.64983 0.64233 1.07008 -0.18839 -0.26211 -0.20352 160 ALA B CA  
2649 C C   . ALA B 160 ? 0.70909 0.67334 1.14255 -0.22803 -0.24687 -0.23548 160 ALA B C   
2650 O O   . ALA B 160 ? 0.76275 0.69531 1.15964 -0.24319 -0.23981 -0.26685 160 ALA B O   
2651 C CB  . ALA B 160 ? 0.62193 0.56712 1.04822 -0.16077 -0.23831 -0.17510 160 ALA B CB  
2652 N N   . PRO B 161 ? 0.81390 0.78989 1.29576 -0.24286 -0.23609 -0.22590 161 PRO B N   
2653 C CA  . PRO B 161 ? 0.75394 0.77285 1.27705 -0.22640 -0.24615 -0.19053 161 PRO B CA  
2654 C C   . PRO B 161 ? 0.81554 0.91351 1.33819 -0.23340 -0.27358 -0.18402 161 PRO B C   
2655 O O   . PRO B 161 ? 0.81777 0.94837 1.36720 -0.21538 -0.27954 -0.15122 161 PRO B O   
2656 C CB  . PRO B 161 ? 0.73320 0.72497 1.31586 -0.23833 -0.21714 -0.18302 161 PRO B CB  
2657 C CG  . PRO B 161 ? 0.81846 0.78473 1.39131 -0.27413 -0.20125 -0.22128 161 PRO B CG  
2658 C CD  . PRO B 161 ? 0.83917 0.77765 1.34469 -0.27375 -0.20656 -0.24697 161 PRO B CD  
2659 N N   . GLU B 162 ? 0.74879 0.87994 1.24162 -0.25825 -0.28814 -0.21182 162 GLU B N   
2660 C CA  . GLU B 162 ? 0.82195 1.03934 1.32207 -0.26905 -0.31130 -0.20110 162 GLU B CA  
2661 C C   . GLU B 162 ? 0.74578 1.00910 1.24569 -0.23282 -0.32248 -0.16254 162 GLU B C   
2662 O O   . GLU B 162 ? 0.83635 1.15229 1.36637 -0.22963 -0.32724 -0.13263 162 GLU B O   
2663 C CB  . GLU B 162 ? 0.96562 1.22186 1.42523 -0.29822 -0.32929 -0.23591 162 GLU B CB  
2664 C CG  . GLU B 162 ? 1.10189 1.30289 1.54995 -0.33603 -0.31563 -0.27979 162 GLU B CG  
2665 C CD  . GLU B 162 ? 1.19998 1.31544 1.61546 -0.32275 -0.29382 -0.29959 162 GLU B CD  
2666 O OE1 . GLU B 162 ? 1.15109 1.27230 1.51796 -0.30972 -0.30629 -0.31264 162 GLU B OE1 
2667 O OE2 . GLU B 162 ? 1.23964 1.28557 1.68295 -0.32269 -0.26192 -0.29806 162 GLU B OE2 
2668 N N   . SER B 163 ? 0.61218 0.85376 1.08281 -0.20480 -0.32294 -0.16139 163 SER B N   
2669 C CA  . SER B 163 ? 0.54694 0.82139 1.02145 -0.16865 -0.32583 -0.12806 163 SER B CA  
2670 C C   . SER B 163 ? 0.60337 0.83049 1.09755 -0.14666 -0.30834 -0.10672 163 SER B C   
2671 O O   . SER B 163 ? 0.56194 0.72880 1.03654 -0.13327 -0.29506 -0.11451 163 SER B O   
2672 C CB  . SER B 163 ? 0.54927 0.82300 0.98673 -0.14773 -0.33030 -0.13842 163 SER B CB  
2673 O OG  . SER B 163 ? 0.50509 0.77834 0.94573 -0.10795 -0.31614 -0.10864 163 SER B OG  
2674 N N   . GLY B 164 ? 0.53224 0.78906 1.05929 -0.14104 -0.30458 -0.07686 164 GLY B N   
2675 C CA  . GLY B 164 ? 0.50430 0.72576 1.03699 -0.11646 -0.28563 -0.05763 164 GLY B CA  
2676 C C   . GLY B 164 ? 0.50053 0.71269 1.01113 -0.08553 -0.27675 -0.05235 164 GLY B C   
2677 O O   . GLY B 164 ? 0.42610 0.59926 0.92840 -0.06890 -0.26450 -0.05221 164 GLY B O   
2678 N N   . LEU B 165 ? 0.42852 0.68243 0.93439 -0.07701 -0.28138 -0.04750 165 LEU B N   
2679 C CA  . LEU B 165 ? 0.48302 0.72781 0.97995 -0.04718 -0.26863 -0.04380 165 LEU B CA  
2680 C C   . LEU B 165 ? 0.46188 0.64746 0.93124 -0.04265 -0.26902 -0.06730 165 LEU B C   
2681 O O   . LEU B 165 ? 0.45604 0.61116 0.92492 -0.02249 -0.25711 -0.06676 165 LEU B O   
2682 C CB  . LEU B 165 ? 0.52142 0.83225 1.02700 -0.03581 -0.26886 -0.02774 165 LEU B CB  
2683 C CG  . LEU B 165 ? 0.50152 0.81570 1.01508 -0.00070 -0.24865 -0.01707 165 LEU B CG  
2684 C CD1 . LEU B 165 ? 0.42832 0.73247 0.97007 0.01513  -0.22294 -0.00063 165 LEU B CD1 
2685 C CD2 . LEU B 165 ? 0.37606 0.77033 0.90092 0.01185  -0.24750 0.00478  165 LEU B CD2 
2686 N N   . ALA B 166 ? 0.46207 0.63078 0.91040 -0.06231 -0.28057 -0.08827 166 ALA B N   
2687 C CA  . ALA B 166 ? 0.46776 0.57566 0.89060 -0.05659 -0.27525 -0.10393 166 ALA B CA  
2688 C C   . ALA B 166 ? 0.57499 0.63778 1.00417 -0.05271 -0.26335 -0.09919 166 ALA B C   
2689 O O   . ALA B 166 ? 0.44638 0.48076 0.87007 -0.03288 -0.25551 -0.09575 166 ALA B O   
2690 C CB  . ALA B 166 ? 0.62425 0.71465 1.02394 -0.08265 -0.28290 -0.12968 166 ALA B CB  
2691 N N   . GLU B 167 ? 0.47654 0.54056 0.92206 -0.06940 -0.26121 -0.09582 167 GLU B N   
2692 C CA  . GLU B 167 ? 0.46017 0.49818 0.91235 -0.06107 -0.24824 -0.08570 167 GLU B CA  
2693 C C   . GLU B 167 ? 0.42845 0.48583 0.88510 -0.03830 -0.24573 -0.07424 167 GLU B C   
2694 O O   . GLU B 167 ? 0.42362 0.46437 0.87477 -0.02595 -0.23920 -0.07158 167 GLU B O   
2695 C CB  . GLU B 167 ? 0.47141 0.51347 0.94842 -0.07777 -0.24154 -0.07931 167 GLU B CB  
2696 C CG  . GLU B 167 ? 0.54702 0.56268 1.02876 -0.10467 -0.23694 -0.09705 167 GLU B CG  
2697 C CD  . GLU B 167 ? 0.66304 0.66569 1.18114 -0.11354 -0.21629 -0.08661 167 GLU B CD  
2698 O OE1 . GLU B 167 ? 0.65041 0.68077 1.19254 -0.10226 -0.21309 -0.06456 167 GLU B OE1 
2699 O OE2 . GLU B 167 ? 0.73682 0.70024 1.26278 -0.12998 -0.19848 -0.09903 167 GLU B OE2 
2700 N N   . TYR B 168 ? 0.41280 0.50813 0.88122 -0.03355 -0.24817 -0.06739 168 TYR B N   
2701 C CA  . TYR B 168 ? 0.39325 0.49985 0.86778 -0.01411 -0.23894 -0.06276 168 TYR B CA  
2702 C C   . TYR B 168 ? 0.38444 0.47159 0.85467 0.00116  -0.23594 -0.07364 168 TYR B C   
2703 O O   . TYR B 168 ? 0.38012 0.45661 0.85020 0.01080  -0.23101 -0.08028 168 TYR B O   
2704 C CB  . TYR B 168 ? 0.38210 0.52973 0.87623 -0.01132 -0.23299 -0.04768 168 TYR B CB  
2705 C CG  . TYR B 168 ? 0.36956 0.52315 0.87482 0.00702  -0.21435 -0.04592 168 TYR B CG  
2706 C CD1 . TYR B 168 ? 0.35680 0.51234 0.87666 0.02207  -0.20240 -0.05040 168 TYR B CD1 
2707 C CD2 . TYR B 168 ? 0.37541 0.53091 0.87965 0.01062  -0.20432 -0.04106 168 TYR B CD2 
2708 C CE1 . TYR B 168 ? 0.35155 0.50738 0.89038 0.03546  -0.17898 -0.05418 168 TYR B CE1 
2709 C CE2 . TYR B 168 ? 0.37462 0.53052 0.88657 0.02372  -0.18356 -0.04698 168 TYR B CE2 
2710 C CZ  . TYR B 168 ? 0.41914 0.57354 0.95151 0.03390  -0.16962 -0.05563 168 TYR B CZ  
2711 O OH  . TYR B 168 ? 0.40355 0.55365 0.95299 0.04403  -0.14217 -0.06664 168 TYR B OH  
2712 N N   . LEU B 169 ? 0.42263 0.50909 0.89113 0.00424  -0.23911 -0.07546 169 LEU B N   
2713 C CA  . LEU B 169 ? 0.37508 0.44390 0.84943 0.02393  -0.23265 -0.07970 169 LEU B CA  
2714 C C   . LEU B 169 ? 0.42646 0.45110 0.88468 0.02325  -0.23620 -0.08581 169 LEU B C   
2715 O O   . LEU B 169 ? 0.41779 0.42876 0.88818 0.03684  -0.23124 -0.08867 169 LEU B O   
2716 C CB  . LEU B 169 ? 0.37601 0.46218 0.85117 0.03366  -0.23263 -0.07412 169 LEU B CB  
2717 C CG  . LEU B 169 ? 0.53345 0.67608 1.03620 0.04261  -0.22164 -0.05785 169 LEU B CG  
2718 C CD1 . LEU B 169 ? 0.36237 0.54231 0.86512 0.05570  -0.22185 -0.04685 169 LEU B CD1 
2719 C CD2 . LEU B 169 ? 0.33868 0.48047 0.87698 0.06098  -0.19814 -0.05541 169 LEU B CD2 
2720 N N   . PHE B 170 ? 0.46373 0.46740 0.90100 0.00684  -0.24133 -0.08607 170 PHE B N   
2721 C CA  . PHE B 170 ? 0.48700 0.45232 0.91334 0.00657  -0.23718 -0.08256 170 PHE B CA  
2722 C C   . PHE B 170 ? 0.41038 0.39107 0.84522 0.01004  -0.23543 -0.07772 170 PHE B C   
2723 O O   . PHE B 170 ? 0.40754 0.37765 0.84462 0.01926  -0.23392 -0.07354 170 PHE B O   
2724 C CB  . PHE B 170 ? 0.45072 0.39139 0.86244 -0.01299 -0.23296 -0.08316 170 PHE B CB  
2725 C CG  . PHE B 170 ? 0.46764 0.36461 0.87133 -0.01058 -0.21924 -0.07236 170 PHE B CG  
2726 C CD1 . PHE B 170 ? 0.52903 0.38464 0.91666 -0.00282 -0.21374 -0.07208 170 PHE B CD1 
2727 C CD2 . PHE B 170 ? 0.49233 0.39374 0.90631 -0.01177 -0.20805 -0.05635 170 PHE B CD2 
2728 C CE1 . PHE B 170 ? 0.50133 0.31399 0.88410 0.00085  -0.19574 -0.05487 170 PHE B CE1 
2729 C CE2 . PHE B 170 ? 0.53513 0.40373 0.94741 -0.00713 -0.18982 -0.03733 170 PHE B CE2 
2730 C CZ  . PHE B 170 ? 0.50031 0.32128 0.89735 -0.00207 -0.18310 -0.03616 170 PHE B CZ  
2731 N N   . ASP B 171 ? 0.52581 0.53660 0.96520 0.00377  -0.23589 -0.07656 171 ASP B N   
2732 C CA  . ASP B 171 ? 0.48535 0.52031 0.92620 0.01053  -0.23452 -0.07442 171 ASP B CA  
2733 C C   . ASP B 171 ? 0.45528 0.49941 0.90511 0.02119  -0.23673 -0.08967 171 ASP B C   
2734 O O   . ASP B 171 ? 0.46344 0.52001 0.91174 0.02551  -0.23946 -0.09302 171 ASP B O   
2735 C CB  . ASP B 171 ? 0.40692 0.47019 0.85110 0.00711  -0.23188 -0.06924 171 ASP B CB  
2736 C CG  . ASP B 171 ? 0.51766 0.61111 0.95586 0.01763  -0.22982 -0.07071 171 ASP B CG  
2737 O OD1 . ASP B 171 ? 0.40483 0.50906 0.84470 0.02240  -0.22949 -0.08785 171 ASP B OD1 
2738 O OD2 . ASP B 171 ? 0.41900 0.52779 0.85279 0.02229  -0.22509 -0.05495 171 ASP B OD2 
2739 N N   . LYS B 172 ? 0.38092 0.42484 0.84612 0.02555  -0.23304 -0.09821 172 LYS B N   
2740 C CA  . LYS B 172 ? 0.37271 0.42358 0.85993 0.03474  -0.22678 -0.11499 172 LYS B CA  
2741 C C   . LYS B 172 ? 0.40575 0.43251 0.90749 0.04334  -0.22873 -0.11648 172 LYS B C   
2742 O O   . LYS B 172 ? 0.40470 0.43817 0.92340 0.04528  -0.22926 -0.13120 172 LYS B O   
2743 C CB  . LYS B 172 ? 0.36203 0.42545 0.87318 0.04091  -0.21116 -0.11633 172 LYS B CB  
2744 C CG  . LYS B 172 ? 0.55725 0.64456 1.06161 0.03518  -0.20431 -0.11168 172 LYS B CG  
2745 C CD  . LYS B 172 ? 0.55547 0.65387 1.04940 0.03330  -0.20168 -0.12927 172 LYS B CD  
2746 C CE  . LYS B 172 ? 0.50031 0.61583 0.98974 0.03337  -0.18774 -0.12176 172 LYS B CE  
2747 N NZ  . LYS B 172 ? 0.63395 0.76176 1.10318 0.03379  -0.18563 -0.14246 172 LYS B NZ  
2748 N N   . HIS B 173 ? 0.43608 0.43564 0.93198 0.04818  -0.22954 -0.10230 173 HIS B N   
2749 C CA  . HIS B 173 ? 0.36175 0.33393 0.87562 0.06266  -0.22670 -0.09751 173 HIS B CA  
2750 C C   . HIS B 173 ? 0.37434 0.32305 0.87087 0.05944  -0.23289 -0.08312 173 HIS B C   
2751 O O   . HIS B 173 ? 0.37088 0.31833 0.88768 0.06495  -0.23493 -0.08203 173 HIS B O   
2752 C CB  . HIS B 173 ? 0.42748 0.38551 0.94365 0.07681  -0.21931 -0.08739 173 HIS B CB  
2753 C CG  . HIS B 173 ? 0.39793 0.38294 0.93464 0.08468  -0.20072 -0.08982 173 HIS B CG  
2754 N ND1 . HIS B 173 ? 0.39049 0.37513 0.94181 0.08892  -0.17466 -0.09069 173 HIS B ND1 
2755 C CD2 . HIS B 173 ? 0.40428 0.42347 0.95044 0.08704  -0.19976 -0.08569 173 HIS B CD2 
2756 C CE1 . HIS B 173 ? 0.34832 0.35851 0.91588 0.09678  -0.15385 -0.08525 173 HIS B CE1 
2757 N NE2 . HIS B 173 ? 0.38524 0.41876 0.94982 0.09697  -0.16865 -0.08052 173 HIS B NE2 
2758 N N   . THR B 174 ? 0.43567 0.36696 0.90134 0.05006  -0.23236 -0.07013 174 THR B N   
2759 C CA  . THR B 174 ? 0.47217 0.38067 0.92800 0.04944  -0.22812 -0.04902 174 THR B CA  
2760 C C   . THR B 174 ? 0.40479 0.35478 0.86270 0.04337  -0.23257 -0.04449 174 THR B C   
2761 O O   . THR B 174 ? 0.40559 0.36346 0.87320 0.04829  -0.23340 -0.02956 174 THR B O   
2762 C CB  . THR B 174 ? 0.43069 0.30306 0.86028 0.04046  -0.21678 -0.03804 174 THR B CB  
2763 O OG1 . THR B 174 ? 0.55557 0.39469 0.97526 0.04798  -0.21406 -0.04311 174 THR B OG1 
2764 C CG2 . THR B 174 ? 0.46379 0.31230 0.89047 0.04190  -0.20158 -0.00875 174 THR B CG2 
2765 N N   . LEU B 175 ? 0.44285 0.42546 0.89192 0.03476  -0.23482 -0.05316 175 LEU B N   
2766 C CA  . LEU B 175 ? 0.41148 0.43859 0.85651 0.03419  -0.23560 -0.04291 175 LEU B CA  
2767 C C   . LEU B 175 ? 0.40672 0.48089 0.85783 0.03516  -0.24858 -0.06716 175 LEU B C   
2768 O O   . LEU B 175 ? 0.41595 0.53894 0.85895 0.03697  -0.25205 -0.06120 175 LEU B O   
2769 C CB  . LEU B 175 ? 0.42080 0.45696 0.85620 0.02871  -0.22568 -0.03289 175 LEU B CB  
2770 C CG  . LEU B 175 ? 0.48426 0.47796 0.91897 0.02281  -0.20687 -0.01284 175 LEU B CG  
2771 C CD1 . LEU B 175 ? 0.44554 0.45365 0.88641 0.01710  -0.19448 -0.00445 175 LEU B CD1 
2772 C CD2 . LEU B 175 ? 0.44606 0.42831 0.88553 0.03033  -0.19133 0.01840  175 LEU B CD2 
2773 N N   . GLY B 176 ? 0.41836 0.48270 0.88525 0.03502  -0.25185 -0.09419 176 GLY B N   
2774 C CA  . GLY B 176 ? 0.40100 0.50098 0.87729 0.03221  -0.25721 -0.12499 176 GLY B CA  
2775 C C   . GLY B 176 ? 0.46045 0.56122 0.96808 0.03266  -0.26309 -0.13970 176 GLY B C   
2776 O O   . GLY B 176 ? 0.62075 0.73520 1.13027 0.03327  -0.27165 -0.12273 176 GLY B O   
2777 N N   . THR C 5   ? 1.06687 0.98747 1.22390 0.06843  -0.19911 0.34385  5   THR C N   
2778 C CA  . THR C 5   ? 1.08715 1.00037 1.22701 0.06715  -0.19601 0.34387  5   THR C CA  
2779 C C   . THR C 5   ? 0.99175 0.90416 1.13409 0.06211  -0.19060 0.33221  5   THR C C   
2780 O O   . THR C 5   ? 1.08029 0.98434 1.21756 0.06168  -0.18484 0.33147  5   THR C O   
2781 C CB  . THR C 5   ? 1.08282 0.99942 1.20322 0.06723  -0.20281 0.34659  5   THR C CB  
2782 O OG1 . THR C 5   ? 1.13179 1.04904 1.24917 0.07283  -0.20893 0.35693  5   THR C OG1 
2783 C CG2 . THR C 5   ? 1.04616 0.95388 1.14819 0.06652  -0.19909 0.34792  5   THR C CG2 
2784 N N   . SER C 6   ? 0.77424 0.69427 0.92399 0.05876  -0.19255 0.32330  6   SER C N   
2785 C CA  . SER C 6   ? 0.75218 0.67106 0.90303 0.05481  -0.18878 0.31162  6   SER C CA  
2786 C C   . SER C 6   ? 0.70271 0.61947 0.87125 0.05505  -0.18368 0.30734  6   SER C C   
2787 O O   . SER C 6   ? 0.75402 0.67510 0.93521 0.05609  -0.18513 0.30899  6   SER C O   
2788 C CB  . SER C 6   ? 0.72859 0.65463 0.87345 0.05118  -0.19389 0.30415  6   SER C CB  
2789 O OG  . SER C 6   ? 0.60526 0.52889 0.75138 0.04830  -0.19066 0.29284  6   SER C OG  
2790 N N   . GLN C 7   ? 0.67489 0.58498 0.84412 0.05426  -0.17788 0.30138  7   GLN C N   
2791 C CA  . GLN C 7   ? 0.70912 0.61622 0.89339 0.05468  -0.17284 0.29633  7   GLN C CA  
2792 C C   . GLN C 7   ? 0.68471 0.59612 0.87394 0.05249  -0.17456 0.28751  7   GLN C C   
2793 O O   . GLN C 7   ? 0.75645 0.66635 0.95858 0.05332  -0.17124 0.28460  7   GLN C O   
2794 C CB  . GLN C 7   ? 0.58560 0.48456 0.76744 0.05445  -0.16723 0.29092  7   GLN C CB  
2795 C CG  . GLN C 7   ? 0.66289 0.56213 0.83361 0.05168  -0.16896 0.28015  7   GLN C CG  
2796 C CD  . GLN C 7   ? 0.69245 0.58428 0.85816 0.05191  -0.16487 0.27583  7   GLN C CD  
2797 O OE1 . GLN C 7   ? 0.73346 0.61915 0.90796 0.05367  -0.15949 0.27741  7   GLN C OE1 
2798 N NE2 . GLN C 7   ? 0.57264 0.46485 0.72471 0.05026  -0.16742 0.27028  7   GLN C NE2 
2799 N N   . VAL C 8   ? 0.62765 0.54325 0.80620 0.04980  -0.17927 0.28300  8   VAL C N   
2800 C CA  . VAL C 8   ? 0.63926 0.55654 0.82075 0.04785  -0.18028 0.27480  8   VAL C CA  
2801 C C   . VAL C 8   ? 0.64981 0.57475 0.83718 0.04756  -0.18492 0.27937  8   VAL C C   
2802 O O   . VAL C 8   ? 0.81337 0.73907 1.00593 0.04641  -0.18495 0.27417  8   VAL C O   
2803 C CB  . VAL C 8   ? 0.63780 0.55302 0.80442 0.04513  -0.18204 0.26508  8   VAL C CB  
2804 C CG1 . VAL C 8   ? 0.55917 0.46663 0.72162 0.04594  -0.17772 0.25896  8   VAL C CG1 
2805 C CG2 . VAL C 8   ? 0.62086 0.54132 0.77456 0.04348  -0.18765 0.26851  8   VAL C CG2 
2806 N N   . ARG C 9   ? 0.60572 0.53567 0.79190 0.04897  -0.18896 0.28886  9   ARG C N   
2807 C CA  . ARG C 9   ? 0.63532 0.57322 0.82617 0.04894  -0.19459 0.29271  9   ARG C CA  
2808 C C   . ARG C 9   ? 0.64164 0.58096 0.85127 0.05087  -0.19252 0.29442  9   ARG C C   
2809 O O   . ARG C 9   ? 0.58265 0.51918 0.80223 0.05403  -0.18894 0.29932  9   ARG C O   
2810 C CB  . ARG C 9   ? 0.59728 0.53924 0.78212 0.05132  -0.19978 0.30275  9   ARG C CB  
2811 C CG  . ARG C 9   ? 0.65005 0.60066 0.83912 0.05171  -0.20660 0.30615  9   ARG C CG  
2812 C CD  . ARG C 9   ? 0.65724 0.61122 0.83497 0.05399  -0.21282 0.31407  9   ARG C CD  
2813 N NE  . ARG C 9   ? 0.62902 0.59188 0.80796 0.05383  -0.22040 0.31534  9   ARG C NE  
2814 C CZ  . ARG C 9   ? 0.66994 0.63683 0.83573 0.05449  -0.22698 0.31876  9   ARG C CZ  
2815 N NH1 . ARG C 9   ? 0.64590 0.60813 0.79588 0.05531  -0.22640 0.32153  9   ARG C NH1 
2816 N NH2 . ARG C 9   ? 0.63870 0.61411 0.80701 0.05455  -0.23413 0.31940  9   ARG C NH2 
2817 N N   . GLN C 10  ? 0.73974 0.68285 0.95418 0.04907  -0.19454 0.29041  10  GLN C N   
2818 C CA  . GLN C 10  ? 0.71845 0.66307 0.95084 0.05085  -0.19247 0.29154  10  GLN C CA  
2819 C C   . GLN C 10  ? 0.59457 0.54608 0.83033 0.04935  -0.19753 0.29095  10  GLN C C   
2820 O O   . GLN C 10  ? 0.55514 0.50545 0.78157 0.04581  -0.19848 0.28381  10  GLN C O   
2821 C CB  . GLN C 10  ? 0.62462 0.56140 0.86072 0.05034  -0.18536 0.28351  10  GLN C CB  
2822 C CG  . GLN C 10  ? 0.64319 0.58012 0.89814 0.05295  -0.18178 0.28540  10  GLN C CG  
2823 C CD  . GLN C 10  ? 0.68770 0.61613 0.94427 0.05296  -0.17496 0.27729  10  GLN C CD  
2824 O OE1 . GLN C 10  ? 0.72550 0.64894 0.97075 0.05074  -0.17409 0.26862  10  GLN C OE1 
2825 N NE2 . GLN C 10  ? 0.80588 0.73203 1.07601 0.05594  -0.17035 0.28000  10  GLN C NE2 
2826 N N   . ASN C 11  ? 0.63632 0.59466 0.88513 0.05237  -0.20107 0.29846  11  ASN C N   
2827 C CA  . ASN C 11  ? 0.57297 0.53848 0.82889 0.05160  -0.20576 0.29833  11  ASN C CA  
2828 C C   . ASN C 11  ? 0.57232 0.54195 0.81339 0.04860  -0.21219 0.29684  11  ASN C C   
2829 O O   . ASN C 11  ? 0.56428 0.53528 0.80353 0.04544  -0.21373 0.29158  11  ASN C O   
2830 C CB  . ASN C 11  ? 0.55690 0.51851 0.82028 0.04977  -0.20069 0.29103  11  ASN C CB  
2831 C CG  . ASN C 11  ? 0.55591 0.52465 0.83161 0.04999  -0.20436 0.29226  11  ASN C CG  
2832 O OD1 . ASN C 11  ? 0.60609 0.58286 0.89332 0.05340  -0.20914 0.29956  11  ASN C OD1 
2833 N ND2 . ASN C 11  ? 0.54536 0.51082 0.81826 0.04688  -0.20252 0.28517  11  ASN C ND2 
2834 N N   . TYR C 12  ? 0.58398 0.55505 0.81384 0.04980  -0.21593 0.30169  12  TYR C N   
2835 C CA  . TYR C 12  ? 0.68566 0.65909 0.89867 0.04683  -0.22102 0.29942  12  TYR C CA  
2836 C C   . TYR C 12  ? 0.60364 0.58433 0.81384 0.05040  -0.22883 0.30811  12  TYR C C   
2837 O O   . TYR C 12  ? 0.68482 0.66292 0.88503 0.05266  -0.22924 0.31289  12  TYR C O   
2838 C CB  . TYR C 12  ? 0.58087 0.54646 0.77760 0.04432  -0.21691 0.29414  12  TYR C CB  
2839 C CG  . TYR C 12  ? 0.58004 0.54735 0.76039 0.04078  -0.22134 0.28998  12  TYR C CG  
2840 C CD1 . TYR C 12  ? 0.63448 0.60310 0.81395 0.03726  -0.22313 0.28371  12  TYR C CD1 
2841 C CD2 . TYR C 12  ? 0.58975 0.55699 0.75526 0.04120  -0.22376 0.29267  12  TYR C CD2 
2842 C CE1 . TYR C 12  ? 0.62598 0.59579 0.79048 0.03403  -0.22723 0.27976  12  TYR C CE1 
2843 C CE2 . TYR C 12  ? 0.65239 0.62142 0.80308 0.03809  -0.22782 0.28871  12  TYR C CE2 
2844 C CZ  . TYR C 12  ? 0.65655 0.62697 0.80705 0.03445  -0.22962 0.28213  12  TYR C CZ  
2845 O OH  . TYR C 12  ? 0.62169 0.59337 0.75745 0.03136  -0.23360 0.27800  12  TYR C OH  
2846 N N   . HIS C 13  ? 0.60665 0.59602 0.82470 0.05122  -0.23525 0.30983  13  HIS C N   
2847 C CA  . HIS C 13  ? 0.69521 0.69219 0.91386 0.05628  -0.24359 0.31817  13  HIS C CA  
2848 C C   . HIS C 13  ? 0.73570 0.73306 0.93325 0.05562  -0.24822 0.31920  13  HIS C C   
2849 O O   . HIS C 13  ? 0.65877 0.65419 0.84401 0.05047  -0.24724 0.31250  13  HIS C O   
2850 C CB  . HIS C 13  ? 0.62430 0.63130 0.85677 0.05712  -0.24974 0.31807  13  HIS C CB  
2851 C CG  . HIS C 13  ? 0.66609 0.68091 0.90668 0.06447  -0.25764 0.32664  13  HIS C CG  
2852 N ND1 . HIS C 13  ? 0.66997 0.68956 0.89773 0.06769  -0.26617 0.33109  13  HIS C ND1 
2853 C CD2 . HIS C 13  ? 0.64833 0.66695 0.90813 0.06992  -0.25886 0.33121  13  HIS C CD2 
2854 C CE1 . HIS C 13  ? 0.70290 0.72859 0.94084 0.07526  -0.27272 0.33805  13  HIS C CE1 
2855 N NE2 . HIS C 13  ? 0.70332 0.72874 0.96132 0.07673  -0.26847 0.33821  13  HIS C NE2 
2856 N N   . GLN C 14  ? 0.70937 0.70853 0.90186 0.06143  -0.25341 0.32776  14  GLN C N   
2857 C CA  . GLN C 14  ? 0.78684 0.78582 0.95823 0.06152  -0.25775 0.32936  14  GLN C CA  
2858 C C   . GLN C 14  ? 0.77271 0.78082 0.93938 0.05921  -0.26557 0.32572  14  GLN C C   
2859 O O   . GLN C 14  ? 0.66999 0.67750 0.81906 0.05652  -0.26736 0.32308  14  GLN C O   
2860 C CB  . GLN C 14  ? 0.77278 0.76989 0.93817 0.06923  -0.26163 0.33990  14  GLN C CB  
2861 N N   . ASP C 15  ? 0.66515 0.68187 0.84782 0.06033  -0.27025 0.32535  15  ASP C N   
2862 C CA  . ASP C 15  ? 0.66145 0.68664 0.84222 0.05723  -0.27669 0.32055  15  ASP C CA  
2863 C C   . ASP C 15  ? 0.64271 0.66269 0.81751 0.04913  -0.27079 0.31098  15  ASP C C   
2864 O O   . ASP C 15  ? 0.66832 0.69060 0.83059 0.04571  -0.27440 0.30683  15  ASP C O   
2865 C CB  . ASP C 15  ? 0.68202 0.71732 0.88366 0.06012  -0.28200 0.32158  15  ASP C CB  
2866 C CG  . ASP C 15  ? 0.79406 0.83607 1.00040 0.06922  -0.29032 0.33027  15  ASP C CG  
2867 O OD1 . ASP C 15  ? 0.82505 0.86381 1.01527 0.07306  -0.29300 0.33558  15  ASP C OD1 
2868 O OD2 . ASP C 15  ? 0.78819 0.83813 1.01408 0.07308  -0.29413 0.33175  15  ASP C OD2 
2869 N N   . SER C 16  ? 0.66413 0.67675 0.84733 0.04650  -0.26206 0.30721  16  SER C N   
2870 C CA  . SER C 16  ? 0.70103 0.70677 0.87676 0.04001  -0.25650 0.29803  16  SER C CA  
2871 C C   . SER C 16  ? 0.61129 0.61104 0.76629 0.03799  -0.25466 0.29563  16  SER C C   
2872 O O   . SER C 16  ? 0.60513 0.60332 0.74857 0.03359  -0.25528 0.28910  16  SER C O   
2873 C CB  . SER C 16  ? 0.62924 0.62766 0.81673 0.03910  -0.24784 0.29491  16  SER C CB  
2874 O OG  . SER C 16  ? 0.59351 0.59750 0.80081 0.04115  -0.24915 0.29711  16  SER C OG  
2875 N N   . GLU C 17  ? 0.72913 0.72531 0.87913 0.04145  -0.25255 0.30100  17  GLU C N   
2876 C CA  . GLU C 17  ? 0.68146 0.67220 0.81268 0.04002  -0.25058 0.29913  17  GLU C CA  
2877 C C   . GLU C 17  ? 0.72168 0.71837 0.83827 0.03973  -0.25831 0.29989  17  GLU C C   
2878 O O   . GLU C 17  ? 0.68796 0.68213 0.79057 0.03590  -0.25778 0.29379  17  GLU C O   
2879 C CB  . GLU C 17  ? 0.63328 0.61879 0.76342 0.04429  -0.24677 0.30582  17  GLU C CB  
2880 C CG  . GLU C 17  ? 0.78165 0.76132 0.89344 0.04355  -0.24429 0.30493  17  GLU C CG  
2881 C CD  . GLU C 17  ? 0.87564 0.85027 0.98577 0.04845  -0.24164 0.31339  17  GLU C CD  
2882 O OE1 . GLU C 17  ? 0.92753 0.90152 1.05218 0.05163  -0.23988 0.31800  17  GLU C OE1 
2883 O OE2 . GLU C 17  ? 0.89324 0.86414 0.98741 0.04936  -0.24132 0.31574  17  GLU C OE2 
2884 N N   . ALA C 18  ? 0.65117 0.65581 0.77050 0.04426  -0.26597 0.30703  18  ALA C N   
2885 C CA  . ALA C 18  ? 0.72454 0.73571 0.83041 0.04441  -0.27410 0.30730  18  ALA C CA  
2886 C C   . ALA C 18  ? 0.70907 0.72435 0.81590 0.03889  -0.27653 0.29911  18  ALA C C   
2887 O O   . ALA C 18  ? 0.70956 0.72578 0.80155 0.03612  -0.27931 0.29513  18  ALA C O   
2888 C CB  . ALA C 18  ? 0.68373 0.70287 0.79313 0.05141  -0.28276 0.31604  18  ALA C CB  
2889 N N   . ALA C 19  ? 0.71677 0.73412 0.84065 0.03740  -0.27550 0.29668  19  ALA C N   
2890 C CA  . ALA C 19  ? 0.77064 0.79065 0.89553 0.03236  -0.27758 0.28947  19  ALA C CA  
2891 C C   . ALA C 19  ? 0.61510 0.62509 0.72754 0.02677  -0.27126 0.28099  19  ALA C C   
2892 O O   . ALA C 19  ? 0.61281 0.62342 0.71541 0.02294  -0.27405 0.27540  19  ALA C O   
2893 C CB  . ALA C 19  ? 0.61954 0.64286 0.76559 0.03256  -0.27709 0.28937  19  ALA C CB  
2894 N N   . ILE C 20  ? 0.75152 0.75226 0.86390 0.02675  -0.26318 0.27974  20  ILE C N   
2895 C CA  . ILE C 20  ? 0.65990 0.65112 0.75999 0.02283  -0.25778 0.27158  20  ILE C CA  
2896 C C   . ILE C 20  ? 0.67009 0.66162 0.75128 0.02242  -0.26037 0.27089  20  ILE C C   
2897 O O   . ILE C 20  ? 0.67755 0.66573 0.74702 0.01872  -0.26049 0.26367  20  ILE C O   
2898 C CB  . ILE C 20  ? 0.68163 0.66422 0.78723 0.02399  -0.24937 0.27067  20  ILE C CB  
2899 C CG1 . ILE C 20  ? 0.59869 0.57961 0.72066 0.02359  -0.24629 0.26913  20  ILE C CG1 
2900 C CG2 . ILE C 20  ? 0.60686 0.58015 0.69808 0.02154  -0.24468 0.26275  20  ILE C CG2 
2901 C CD1 . ILE C 20  ? 0.59339 0.57006 0.71170 0.01925  -0.24604 0.26087  20  ILE C CD1 
2902 N N   . ASN C 21  ? 0.61988 0.61465 0.69701 0.02654  -0.26243 0.27842  21  ASN C N   
2903 C CA  . ASN C 21  ? 0.65783 0.65330 0.71640 0.02660  -0.26518 0.27839  21  ASN C CA  
2904 C C   . ASN C 21  ? 0.67938 0.68189 0.73116 0.02434  -0.27269 0.27554  21  ASN C C   
2905 O O   . ASN C 21  ? 0.78800 0.78846 0.82552 0.02138  -0.27310 0.26975  21  ASN C O   
2906 C CB  . ASN C 21  ? 0.65218 0.64941 0.70693 0.03215  -0.26682 0.28811  21  ASN C CB  
2907 C CG  . ASN C 21  ? 0.67554 0.66412 0.72967 0.03351  -0.25897 0.28945  21  ASN C CG  
2908 O OD1 . ASN C 21  ? 0.70093 0.68322 0.74925 0.03054  -0.25383 0.28256  21  ASN C OD1 
2909 N ND2 . ASN C 21  ? 0.65493 0.64285 0.71582 0.03828  -0.25814 0.29801  21  ASN C ND2 
2910 N N   . ARG C 22  ? 0.64028 0.65137 0.70275 0.02589  -0.27886 0.27919  22  ARG C N   
2911 C CA  . ARG C 22  ? 0.66201 0.68079 0.71966 0.02395  -0.28654 0.27640  22  ARG C CA  
2912 C C   . ARG C 22  ? 0.62958 0.64346 0.68576 0.01779  -0.28404 0.26685  22  ARG C C   
2913 O O   . ARG C 22  ? 0.70995 0.72513 0.75399 0.01493  -0.28750 0.26206  22  ARG C O   
2914 C CB  . ARG C 22  ? 0.66641 0.69607 0.73832 0.02752  -0.29389 0.28188  22  ARG C CB  
2915 C CG  . ARG C 22  ? 0.70335 0.73774 0.77326 0.03466  -0.29841 0.29133  22  ARG C CG  
2916 C CD  . ARG C 22  ? 0.82124 0.86842 0.90168 0.03891  -0.30844 0.29525  22  ARG C CD  
2917 N NE  . ARG C 22  ? 0.84393 0.89363 0.94630 0.03826  -0.30706 0.29448  22  ARG C NE  
2918 C CZ  . ARG C 22  ? 0.84854 0.89733 0.96514 0.04252  -0.30464 0.30010  22  ARG C CZ  
2919 N NH1 . ARG C 22  ? 0.76868 0.81344 0.87945 0.04775  -0.30342 0.30717  22  ARG C NH1 
2920 N NH2 . ARG C 22  ? 0.78683 0.83821 0.92322 0.04166  -0.30326 0.29869  22  ARG C NH2 
2921 N N   . GLN C 23  ? 0.61501 0.62240 0.68238 0.01601  -0.27804 0.26396  23  GLN C N   
2922 C CA  . GLN C 23  ? 0.65576 0.65614 0.71985 0.01091  -0.27545 0.25519  23  GLN C CA  
2923 C C   . GLN C 23  ? 0.72661 0.71816 0.77329 0.00883  -0.27165 0.24881  23  GLN C C   
2924 O O   . GLN C 23  ? 0.70563 0.69368 0.74269 0.00509  -0.27289 0.24191  23  GLN C O   
2925 C CB  . GLN C 23  ? 0.58940 0.58373 0.66757 0.01041  -0.26971 0.25382  23  GLN C CB  
2926 C CG  . GLN C 23  ? 0.57924 0.56623 0.65397 0.00580  -0.26829 0.24573  23  GLN C CG  
2927 C CD  . GLN C 23  ? 0.60083 0.59608 0.67776 0.00355  -0.27575 0.24543  23  GLN C CD  
2928 O OE1 . GLN C 23  ? 0.63676 0.64377 0.72521 0.00597  -0.28128 0.25134  23  GLN C OE1 
2929 N NE2 . GLN C 23  ? 0.66509 0.65418 0.73125 -0.00075 -0.27627 0.23829  23  GLN C NE2 
2930 N N   . ILE C 24  ? 0.60001 0.58765 0.64293 0.01141  -0.26708 0.25087  24  ILE C N   
2931 C CA  . ILE C 24  ? 0.64831 0.62916 0.67550 0.01029  -0.26408 0.24519  24  ILE C CA  
2932 C C   . ILE C 24  ? 0.68299 0.66940 0.69602 0.00923  -0.27012 0.24428  24  ILE C C   
2933 O O   . ILE C 24  ? 0.60534 0.58720 0.60678 0.00628  -0.27011 0.23675  24  ILE C O   
2934 C CB  . ILE C 24  ? 0.67699 0.65492 0.70364 0.01380  -0.25916 0.24908  24  ILE C CB  
2935 C CG1 . ILE C 24  ? 0.60726 0.57791 0.64556 0.01449  -0.25238 0.24754  24  ILE C CG1 
2936 C CG2 . ILE C 24  ? 0.72538 0.69978 0.73525 0.01341  -0.25799 0.24479  24  ILE C CG2 
2937 C CD1 . ILE C 24  ? 0.59180 0.56211 0.63532 0.01850  -0.24863 0.25428  24  ILE C CD1 
2938 N N   . ASN C 25  ? 0.75726 0.75316 0.77027 0.01219  -0.27553 0.25192  25  ASN C N   
2939 C CA  . ASN C 25  ? 0.77319 0.77545 0.77285 0.01173  -0.28206 0.25139  25  ASN C CA  
2940 C C   . ASN C 25  ? 0.74884 0.75250 0.74799 0.00732  -0.28597 0.24490  25  ASN C C   
2941 O O   . ASN C 25  ? 0.66541 0.66828 0.65102 0.00492  -0.28797 0.23941  25  ASN C O   
2942 C CB  . ASN C 25  ? 0.65281 0.66506 0.65406 0.01641  -0.28837 0.26070  25  ASN C CB  
2943 C CG  . ASN C 25  ? 0.69111 0.71000 0.67698 0.01680  -0.29530 0.26039  25  ASN C CG  
2944 O OD1 . ASN C 25  ? 0.70427 0.72124 0.67578 0.01838  -0.29421 0.26138  25  ASN C OD1 
2945 N ND2 . ASN C 25  ? 0.67137 0.69829 0.66009 0.01547  -0.30251 0.25879  25  ASN C ND2 
2946 N N   . LEU C 26  ? 0.76476 0.77044 0.77860 0.00629  -0.28713 0.24555  26  LEU C N   
2947 C CA  . LEU C 26  ? 0.76222 0.76907 0.77595 0.00210  -0.29100 0.24001  26  LEU C CA  
2948 C C   . LEU C 26  ? 0.70646 0.70073 0.71041 -0.00198 -0.28607 0.23080  26  LEU C C   
2949 O O   . LEU C 26  ? 0.72774 0.72124 0.72157 -0.00519 -0.28930 0.22525  26  LEU C O   
2950 C CB  . LEU C 26  ? 0.77732 0.78850 0.80963 0.00212  -0.29263 0.24277  26  LEU C CB  
2951 C CG  . LEU C 26  ? 0.75061 0.76661 0.78525 -0.00146 -0.29847 0.23902  26  LEU C CG  
2952 C CD1 . LEU C 26  ? 0.73057 0.75929 0.75923 -0.00009 -0.30754 0.24088  26  LEU C CD1 
2953 C CD2 . LEU C 26  ? 0.80898 0.82870 0.86352 -0.00100 -0.29886 0.24183  26  LEU C CD2 
2954 N N   . GLU C 27  ? 0.60029 0.58437 0.60680 -0.00152 -0.27865 0.22877  27  GLU C N   
2955 C CA  . GLU C 27  ? 0.68245 0.65380 0.67900 -0.00432 -0.27458 0.21969  27  GLU C CA  
2956 C C   . GLU C 27  ? 0.65925 0.62899 0.63878 -0.00445 -0.27512 0.21554  27  GLU C C   
2957 O O   . GLU C 27  ? 0.77939 0.74290 0.74800 -0.00734 -0.27600 0.20815  27  GLU C O   
2958 C CB  . GLU C 27  ? 0.66457 0.62610 0.66717 -0.00285 -0.26718 0.21812  27  GLU C CB  
2959 C CG  . GLU C 27  ? 0.69609 0.65886 0.71566 -0.00230 -0.26587 0.22216  27  GLU C CG  
2960 C CD  . GLU C 27  ? 0.84292 0.80027 0.86371 -0.00577 -0.26687 0.21771  27  GLU C CD  
2961 O OE1 . GLU C 27  ? 0.85233 0.80158 0.85969 -0.00858 -0.26744 0.21048  27  GLU C OE1 
2962 O OE2 . GLU C 27  ? 0.87488 0.83566 0.91017 -0.00543 -0.26703 0.22164  27  GLU C OE2 
2963 N N   . LEU C 28  ? 0.60337 0.57827 0.58003 -0.00118 -0.27470 0.22032  28  LEU C N   
2964 C CA  . LEU C 28  ? 0.64092 0.61577 0.60162 -0.00101 -0.27554 0.21698  28  LEU C CA  
2965 C C   . LEU C 28  ? 0.64558 0.62748 0.59809 -0.00315 -0.28264 0.21576  28  LEU C C   
2966 O O   . LEU C 28  ? 0.68551 0.66410 0.62483 -0.00492 -0.28343 0.20923  28  LEU C O   
2967 C CB  . LEU C 28  ? 0.64199 0.62098 0.60090 0.00313  -0.27378 0.22343  28  LEU C CB  
2968 C CG  . LEU C 28  ? 0.65147 0.62282 0.61566 0.00523  -0.26646 0.22313  28  LEU C CG  
2969 C CD1 . LEU C 28  ? 0.67324 0.64917 0.64186 0.00934  -0.26503 0.23251  28  LEU C CD1 
2970 C CD2 . LEU C 28  ? 0.59983 0.56270 0.55307 0.00479  -0.26282 0.21447  28  LEU C CD2 
2971 N N   . TYR C 29  ? 0.62665 0.61852 0.58715 -0.00278 -0.28819 0.22153  29  TYR C N   
2972 C CA  . TYR C 29  ? 0.68810 0.68774 0.64161 -0.00456 -0.29562 0.22006  29  TYR C CA  
2973 C C   . TYR C 29  ? 0.66829 0.66120 0.61948 -0.00945 -0.29616 0.21201  29  TYR C C   
2974 O O   . TYR C 29  ? 0.89683 0.88992 0.83594 -0.01167 -0.29938 0.20680  29  TYR C O   
2975 C CB  . TYR C 29  ? 0.70680 0.71934 0.67056 -0.00227 -0.30225 0.22766  29  TYR C CB  
2976 C CG  . TYR C 29  ? 0.76697 0.78837 0.72708 -0.00433 -0.31063 0.22529  29  TYR C CG  
2977 C CD1 . TYR C 29  ? 0.75767 0.78494 0.70317 -0.00341 -0.31531 0.22436  29  TYR C CD1 
2978 C CD2 . TYR C 29  ? 0.80938 0.83361 0.78080 -0.00711 -0.31392 0.22373  29  TYR C CD2 
2979 C CE1 . TYR C 29  ? 0.76889 0.80484 0.71124 -0.00516 -0.32324 0.22159  29  TYR C CE1 
2980 C CE2 . TYR C 29  ? 0.79458 0.82771 0.76351 -0.00907 -0.32186 0.22102  29  TYR C CE2 
2981 C CZ  . TYR C 29  ? 0.79710 0.83613 0.75153 -0.00808 -0.32655 0.21977  29  TYR C CZ  
2982 O OH  . TYR C 29  ? 0.83568 0.88411 0.78774 -0.00992 -0.33466 0.21645  29  TYR C OH  
2983 N N   . ALA C 30  ? 0.61912 0.60547 0.58107 -0.01105 -0.29307 0.21100  30  ALA C N   
2984 C CA  . ALA C 30  ? 0.61355 0.59061 0.57144 -0.01544 -0.29293 0.20356  30  ALA C CA  
2985 C C   . ALA C 30  ? 0.70070 0.66599 0.64293 -0.01632 -0.28938 0.19563  30  ALA C C   
2986 O O   . ALA C 30  ? 0.72398 0.68501 0.65569 -0.01942 -0.29196 0.18944  30  ALA C O   
2987 C CB  . ALA C 30  ? 0.63891 0.60921 0.60949 -0.01618 -0.28919 0.20417  30  ALA C CB  
2988 N N   . SER C 31  ? 0.67965 0.63959 0.62070 -0.01341 -0.28369 0.19547  31  SER C N   
2989 C CA  . SER C 31  ? 0.68098 0.63101 0.60849 -0.01326 -0.28070 0.18785  31  SER C CA  
2990 C C   . SER C 31  ? 0.73024 0.68653 0.64472 -0.01369 -0.28495 0.18588  31  SER C C   
2991 O O   . SER C 31  ? 0.68378 0.63249 0.58650 -0.01557 -0.28550 0.17814  31  SER C O   
2992 C CB  . SER C 31  ? 0.69692 0.64395 0.62742 -0.00946 -0.27483 0.18920  31  SER C CB  
2993 O OG  . SER C 31  ? 0.85157 0.79186 0.76990 -0.00846 -0.27271 0.18237  31  SER C OG  
2994 N N   . TYR C 32  ? 0.80129 0.77094 0.71706 -0.01167 -0.28825 0.19279  32  TYR C N   
2995 C CA  . TYR C 32  ? 0.81247 0.78929 0.71544 -0.01167 -0.29272 0.19146  32  TYR C CA  
2996 C C   . TYR C 32  ? 0.76578 0.74337 0.66440 -0.01572 -0.29819 0.18693  32  TYR C C   
2997 O O   . TYR C 32  ? 0.72798 0.70310 0.61371 -0.01716 -0.29971 0.18061  32  TYR C O   
2998 C CB  . TYR C 32  ? 0.74152 0.73161 0.64642 -0.00828 -0.29596 0.20039  32  TYR C CB  
2999 C CG  . TYR C 32  ? 0.71450 0.70998 0.60454 -0.00637 -0.29782 0.19999  32  TYR C CG  
3000 C CD1 . TYR C 32  ? 0.68352 0.67237 0.56176 -0.00698 -0.29500 0.19244  32  TYR C CD1 
3001 C CD2 . TYR C 32  ? 0.73958 0.74662 0.62688 -0.00348 -0.30270 0.20714  32  TYR C CD2 
3002 C CE1 . TYR C 32  ? 0.66600 0.66026 0.53074 -0.00513 -0.29647 0.19201  32  TYR C CE1 
3003 C CE2 . TYR C 32  ? 0.85037 0.86181 0.72255 -0.00150 -0.30431 0.20696  32  TYR C CE2 
3004 C CZ  . TYR C 32  ? 0.79904 0.80434 0.66031 -0.00254 -0.30089 0.19935  32  TYR C CZ  
3005 O OH  . TYR C 32  ? 0.78808 0.79815 0.63438 -0.00057 -0.30229 0.19898  32  TYR C OH  
3006 N N   . VAL C 33  ? 0.73111 0.71259 0.64078 -0.01751 -0.30136 0.19003  33  VAL C N   
3007 C CA  . VAL C 33  ? 0.73488 0.71796 0.64158 -0.02153 -0.30692 0.18603  33  VAL C CA  
3008 C C   . VAL C 33  ? 0.79601 0.76316 0.69352 -0.02480 -0.30399 0.17704  33  VAL C C   
3009 O O   . VAL C 33  ? 0.84604 0.81157 0.73217 -0.02722 -0.30716 0.17128  33  VAL C O   
3010 C CB  . VAL C 33  ? 0.71452 0.70447 0.63671 -0.02266 -0.31044 0.19078  33  VAL C CB  
3011 C CG1 . VAL C 33  ? 0.64654 0.63751 0.56611 -0.02725 -0.31595 0.18596  33  VAL C CG1 
3012 C CG2 . VAL C 33  ? 0.65094 0.65647 0.58097 -0.01863 -0.31454 0.19928  33  VAL C CG2 
3013 N N   . TYR C 34  ? 0.74846 0.70306 0.65021 -0.02456 -0.29816 0.17556  34  TYR C N   
3014 C CA  . TYR C 34  ? 0.69400 0.63131 0.58632 -0.02689 -0.29569 0.16715  34  TYR C CA  
3015 C C   . TYR C 34  ? 0.80656 0.73885 0.68405 -0.02557 -0.29460 0.16081  34  TYR C C   
3016 O O   . TYR C 34  ? 0.69613 0.61819 0.56217 -0.02787 -0.29582 0.15346  34  TYR C O   
3017 C CB  . TYR C 34  ? 0.72920 0.65481 0.62838 -0.02571 -0.28986 0.16705  34  TYR C CB  
3018 C CG  . TYR C 34  ? 0.79370 0.71857 0.70396 -0.02804 -0.29064 0.17024  34  TYR C CG  
3019 C CD1 . TYR C 34  ? 0.84250 0.76186 0.74815 -0.03242 -0.29412 0.16674  34  TYR C CD1 
3020 C CD2 . TYR C 34  ? 0.71742 0.64675 0.64277 -0.02583 -0.28778 0.17665  34  TYR C CD2 
3021 C CE1 . TYR C 34  ? 0.79060 0.70960 0.70649 -0.03455 -0.29481 0.16970  34  TYR C CE1 
3022 C CE2 . TYR C 34  ? 0.70334 0.63242 0.63944 -0.02767 -0.28836 0.17947  34  TYR C CE2 
3023 C CZ  . TYR C 34  ? 0.77653 0.70069 0.70787 -0.03203 -0.29190 0.17602  34  TYR C CZ  
3024 O OH  . TYR C 34  ? 0.93177 0.85611 0.87384 -0.03386 -0.29252 0.17890  34  TYR C OH  
3025 N N   . LEU C 35  ? 0.83148 0.77045 0.70897 -0.02170 -0.29231 0.16359  35  LEU C N   
3026 C CA  . LEU C 35  ? 0.78915 0.72607 0.65372 -0.02002 -0.29153 0.15811  35  LEU C CA  
3027 C C   . LEU C 35  ? 0.76151 0.70568 0.61607 -0.02206 -0.29718 0.15581  35  LEU C C   
3028 O O   . LEU C 35  ? 0.83524 0.77190 0.67776 -0.02288 -0.29765 0.14811  35  LEU C O   
3029 C CB  . LEU C 35  ? 0.68806 0.63297 0.55553 -0.01569 -0.28848 0.16302  35  LEU C CB  
3030 C CG  . LEU C 35  ? 0.72949 0.67702 0.58434 -0.01378 -0.28856 0.15892  35  LEU C CG  
3031 C CD1 . LEU C 35  ? 0.62903 0.56167 0.47781 -0.01302 -0.28508 0.14981  35  LEU C CD1 
3032 C CD2 . LEU C 35  ? 0.63772 0.59603 0.49418 -0.01003 -0.28700 0.16557  35  LEU C CD2 
3033 N N   . SER C 36  ? 0.72189 0.68067 0.58118 -0.02251 -0.30188 0.16213  36  SER C N   
3034 C CA  . SER C 36  ? 0.73548 0.70249 0.58559 -0.02420 -0.30784 0.15988  36  SER C CA  
3035 C C   . SER C 36  ? 0.78393 0.74204 0.62990 -0.02888 -0.31048 0.15344  36  SER C C   
3036 O O   . SER C 36  ? 0.92315 0.87924 0.75706 -0.03031 -0.31279 0.14720  36  SER C O   
3037 C CB  . SER C 36  ? 0.75719 0.74123 0.61371 -0.02316 -0.31320 0.16771  36  SER C CB  
3038 O OG  . SER C 36  ? 0.81041 0.80118 0.66106 -0.02585 -0.31988 0.16470  36  SER C OG  
3039 N N   . MET C 37  ? 0.76541 0.71825 0.62101 -0.03133 -0.31029 0.15504  37  MET C N   
3040 C CA  . MET C 37  ? 0.75880 0.70014 0.60966 -0.03591 -0.31204 0.14911  37  MET C CA  
3041 C C   . MET C 37  ? 0.78661 0.70973 0.62394 -0.03579 -0.30855 0.14055  37  MET C C   
3042 O O   . MET C 37  ? 0.84878 0.76666 0.67459 -0.03816 -0.31137 0.13427  37  MET C O   
3043 C CB  . MET C 37  ? 0.77202 0.70838 0.63499 -0.03776 -0.31079 0.15241  37  MET C CB  
3044 C CG  . MET C 37  ? 0.82993 0.78329 0.70693 -0.03846 -0.31560 0.15948  37  MET C CG  
3045 S SD  . MET C 37  ? 0.71501 0.66189 0.60600 -0.04080 -0.31393 0.16241  37  MET C SD  
3046 C CE  . MET C 37  ? 0.71569 0.68687 0.62352 -0.04031 -0.32107 0.17007  37  MET C CE  
3047 N N   . SER C 38  ? 0.73484 0.64775 0.57366 -0.03280 -0.30276 0.13982  38  SER C N   
3048 C CA  . SER C 38  ? 0.72722 0.62232 0.55422 -0.03162 -0.29988 0.13140  38  SER C CA  
3049 C C   . SER C 38  ? 0.76596 0.66477 0.58073 -0.03088 -0.30217 0.12638  38  SER C C   
3050 O O   . SER C 38  ? 0.81631 0.70437 0.61981 -0.03296 -0.30428 0.11952  38  SER C O   
3051 C CB  . SER C 38  ? 0.84212 0.73196 0.67403 -0.02736 -0.29415 0.13197  38  SER C CB  
3052 O OG  . SER C 38  ? 0.87325 0.75293 0.69454 -0.02451 -0.29229 0.12436  38  SER C OG  
3053 N N   . TYR C 39  ? 0.92411 0.83812 0.74037 -0.02790 -0.30195 0.12990  39  TYR C N   
3054 C CA  . TYR C 39  ? 0.86650 0.78343 0.67047 -0.02689 -0.30365 0.12447  39  TYR C CA  
3055 C C   . TYR C 39  ? 0.82738 0.75233 0.62578 -0.03041 -0.30965 0.12353  39  TYR C C   
3056 O O   . TYR C 39  ? 0.85863 0.78240 0.64549 -0.03044 -0.31138 0.11734  39  TYR C O   
3057 C CB  . TYR C 39  ? 0.75573 0.68527 0.56066 -0.02261 -0.30149 0.12788  39  TYR C CB  
3058 C CG  . TYR C 39  ? 0.65712 0.57563 0.46196 -0.01915 -0.29626 0.12399  39  TYR C CG  
3059 C CD1 . TYR C 39  ? 0.82589 0.73380 0.62000 -0.01775 -0.29576 0.11475  39  TYR C CD1 
3060 C CD2 . TYR C 39  ? 0.71789 0.63568 0.53373 -0.01715 -0.29225 0.12894  39  TYR C CD2 
3061 C CE1 . TYR C 39  ? 0.66712 0.56464 0.46160 -0.01415 -0.29182 0.11039  39  TYR C CE1 
3062 C CE2 . TYR C 39  ? 0.78552 0.69351 0.60172 -0.01388 -0.28801 0.12483  39  TYR C CE2 
3063 C CZ  . TYR C 39  ? 0.74256 0.64052 0.54817 -0.01232 -0.28804 0.11544  39  TYR C CZ  
3064 O OH  . TYR C 39  ? 0.78948 0.67827 0.59623 -0.00864 -0.28460 0.11108  39  TYR C OH  
3065 N N   . TYR C 40  ? 0.81429 0.74725 0.62083 -0.03330 -0.31315 0.12882  40  TYR C N   
3066 C CA  . TYR C 40  ? 0.78954 0.72704 0.59095 -0.03725 -0.31917 0.12619  40  TYR C CA  
3067 C C   . TYR C 40  ? 0.82604 0.74405 0.61769 -0.04032 -0.31907 0.11794  40  TYR C C   
3068 O O   . TYR C 40  ? 0.70303 0.62037 0.48408 -0.04211 -0.32241 0.11224  40  TYR C O   
3069 C CB  . TYR C 40  ? 0.81836 0.76687 0.63197 -0.03968 -0.32313 0.13263  40  TYR C CB  
3070 C CG  . TYR C 40  ? 0.79031 0.74106 0.60042 -0.04457 -0.32932 0.12891  40  TYR C CG  
3071 C CD1 . TYR C 40  ? 0.81356 0.78000 0.61927 -0.04481 -0.33524 0.12814  40  TYR C CD1 
3072 C CD2 . TYR C 40  ? 0.77796 0.71511 0.58854 -0.04892 -0.32944 0.12597  40  TYR C CD2 
3073 C CE1 . TYR C 40  ? 0.87023 0.83976 0.67336 -0.04937 -0.34117 0.12403  40  TYR C CE1 
3074 C CE2 . TYR C 40  ? 0.78765 0.72714 0.59509 -0.05377 -0.33514 0.12225  40  TYR C CE2 
3075 C CZ  . TYR C 40  ? 0.86738 0.82356 0.67174 -0.05406 -0.34104 0.12103  40  TYR C CZ  
3076 O OH  . TYR C 40  ? 0.89420 0.85383 0.69616 -0.05905 -0.34701 0.11654  40  TYR C OH  
3077 N N   . PHE C 41  ? 0.87039 0.77156 0.66463 -0.04080 -0.31546 0.11716  41  PHE C N   
3078 C CA  . PHE C 41  ? 0.76830 0.64796 0.55121 -0.04320 -0.31552 0.10955  41  PHE C CA  
3079 C C   . PHE C 41  ? 0.76697 0.63413 0.53759 -0.03960 -0.31315 0.10197  41  PHE C C   
3080 O O   . PHE C 41  ? 0.82581 0.67425 0.58467 -0.04075 -0.31388 0.09495  41  PHE C O   
3081 C CB  . PHE C 41  ? 0.77996 0.64483 0.56794 -0.04469 -0.31292 0.11114  41  PHE C CB  
3082 C CG  . PHE C 41  ? 0.83384 0.70826 0.63171 -0.04919 -0.31633 0.11651  41  PHE C CG  
3083 C CD1 . PHE C 41  ? 0.89011 0.75856 0.68142 -0.05443 -0.32047 0.11301  41  PHE C CD1 
3084 C CD2 . PHE C 41  ? 0.76990 0.66003 0.58387 -0.04808 -0.31585 0.12481  41  PHE C CD2 
3085 C CE1 . PHE C 41  ? 0.74809 0.62752 0.54978 -0.05867 -0.32426 0.11738  41  PHE C CE1 
3086 C CE2 . PHE C 41  ? 0.77372 0.67408 0.59809 -0.05172 -0.31970 0.12930  41  PHE C CE2 
3087 C CZ  . PHE C 41  ? 0.73703 0.63275 0.55569 -0.05709 -0.32403 0.12537  41  PHE C CZ  
3088 N N   . ASP C 42  ? 0.84975 0.72669 0.62246 -0.03511 -0.31069 0.10311  42  ASP C N   
3089 C CA  . ASP C 42  ? 0.86029 0.72946 0.62265 -0.03141 -0.30918 0.09580  42  ASP C CA  
3090 C C   . ASP C 42  ? 0.90291 0.78189 0.65599 -0.03223 -0.31302 0.09210  42  ASP C C   
3091 O O   . ASP C 42  ? 0.90424 0.77517 0.64735 -0.02976 -0.31265 0.08477  42  ASP C O   
3092 C CB  . ASP C 42  ? 0.70444 0.58106 0.47328 -0.02651 -0.30492 0.09843  42  ASP C CB  
3093 C CG  . ASP C 42  ? 0.70880 0.57514 0.46887 -0.02226 -0.30312 0.09022  42  ASP C CG  
3094 O OD1 . ASP C 42  ? 0.82533 0.67008 0.58053 -0.02088 -0.30197 0.08427  42  ASP C OD1 
3095 O OD2 . ASP C 42  ? 0.85980 0.73925 0.61731 -0.01997 -0.30317 0.08941  42  ASP C OD2 
3096 N N   . ARG C 43  ? 0.75118 0.73466 0.48842 0.03528  -0.22058 -0.02886 43  ARG C N   
3097 C CA  . ARG C 43  ? 0.75448 0.71422 0.44448 0.04454  -0.21760 -0.03607 43  ARG C CA  
3098 C C   . ARG C 43  ? 0.80264 0.75762 0.49743 0.03787  -0.21995 -0.05025 43  ARG C C   
3099 O O   . ARG C 43  ? 0.69701 0.66628 0.42203 0.02611  -0.23263 -0.05798 43  ARG C O   
3100 C CB  . ARG C 43  ? 0.78283 0.73429 0.43487 0.04984  -0.23974 -0.04134 43  ARG C CB  
3101 C CG  . ARG C 43  ? 0.85424 0.80422 0.49098 0.05899  -0.23744 -0.02730 43  ARG C CG  
3102 C CD  . ARG C 43  ? 0.92994 0.86760 0.52887 0.06464  -0.26513 -0.03341 43  ARG C CD  
3103 N NE  . ARG C 43  ? 1.14472 1.04980 0.68970 0.07173  -0.27337 -0.04623 43  ARG C NE  
3104 C CZ  . ARG C 43  ? 1.19841 1.06437 0.67785 0.08741  -0.26092 -0.04279 43  ARG C CZ  
3105 N NH1 . ARG C 43  ? 1.20514 1.06120 0.66813 0.09796  -0.23748 -0.02606 43  ARG C NH1 
3106 N NH2 . ARG C 43  ? 1.16859 1.00090 0.59625 0.09322  -0.27035 -0.05608 43  ARG C NH2 
3107 N N   . ASP C 44  ? 0.78585 0.71721 0.44925 0.04616  -0.20465 -0.05301 44  ASP C N   
3108 C CA  . ASP C 44  ? 0.78957 0.71493 0.45683 0.04072  -0.20469 -0.06592 44  ASP C CA  
3109 C C   . ASP C 44  ? 0.85635 0.77978 0.50583 0.03590  -0.23147 -0.08286 44  ASP C C   
3110 O O   . ASP C 44  ? 0.81791 0.74196 0.48007 0.02863  -0.23513 -0.09430 44  ASP C O   
3111 C CB  . ASP C 44  ? 0.87206 0.76897 0.50847 0.05186  -0.17921 -0.06436 44  ASP C CB  
3112 C CG  . ASP C 44  ? 1.02616 0.89093 0.59238 0.06454  -0.18263 -0.06903 44  ASP C CG  
3113 O OD1 . ASP C 44  ? 1.08984 0.94434 0.62934 0.07452  -0.17734 -0.05821 44  ASP C OD1 
3114 O OD2 . ASP C 44  ? 1.16791 1.01439 0.70289 0.06488  -0.19218 -0.08380 44  ASP C OD2 
3115 N N   . ASP C 45  ? 0.93916 0.85920 0.56331 0.03997  -0.25141 -0.08464 45  ASP C N   
3116 C CA  . ASP C 45  ? 0.91426 0.83176 0.53009 0.03577  -0.28080 -0.10061 45  ASP C CA  
3117 C C   . ASP C 45  ? 0.86753 0.81424 0.53586 0.02360  -0.29806 -0.10174 45  ASP C C   
3118 O O   . ASP C 45  ? 0.86436 0.81534 0.54802 0.01799  -0.31540 -0.11150 45  ASP C O   
3119 C CB  . ASP C 45  ? 0.99701 0.88564 0.55233 0.04861  -0.29693 -0.10345 45  ASP C CB  
3120 C CG  . ASP C 45  ? 1.13839 1.02759 0.68125 0.05696  -0.29260 -0.08745 45  ASP C CG  
3121 O OD1 . ASP C 45  ? 1.13855 1.05740 0.72903 0.05007  -0.28782 -0.07708 45  ASP C OD1 
3122 O OD2 . ASP C 45  ? 1.21079 1.06642 0.69161 0.07122  -0.29330 -0.08512 45  ASP C OD2 
3123 N N   . VAL C 46  ? 0.85631 0.82277 0.56078 0.01876  -0.28527 -0.08921 46  VAL C N   
3124 C CA  . VAL C 46  ? 0.81542 0.80315 0.56863 0.00701  -0.29248 -0.08938 46  VAL C CA  
3125 C C   . VAL C 46  ? 0.83966 0.83157 0.62010 -0.00097 -0.27601 -0.08745 46  VAL C C   
3126 O O   . VAL C 46  ? 0.96789 0.96093 0.76888 -0.00971 -0.27981 -0.09696 46  VAL C O   
3127 C CB  . VAL C 46  ? 0.82783 0.82842 0.59412 0.00880  -0.29511 -0.07647 46  VAL C CB  
3128 C CG1 . VAL C 46  ? 0.74155 0.75767 0.55295 -0.00159 -0.30506 -0.07895 46  VAL C CG1 
3129 C CG2 . VAL C 46  ? 0.79415 0.78302 0.52062 0.02051  -0.30790 -0.07473 46  VAL C CG2 
3130 N N   . ALA C 47  ? 0.74066 0.73187 0.52262 0.00234  -0.25870 -0.07520 47  ALA C N   
3131 C CA  . ALA C 47  ? 0.74481 0.73384 0.54883 -0.00326 -0.24702 -0.07287 47  ALA C CA  
3132 C C   . ALA C 47  ? 0.73691 0.73007 0.56865 -0.01393 -0.25248 -0.07468 47  ALA C C   
3133 O O   . ALA C 47  ? 0.81108 0.79678 0.65132 -0.02042 -0.25261 -0.08275 47  ALA C O   
3134 C CB  . ALA C 47  ? 0.72910 0.70578 0.52184 -0.00253 -0.24148 -0.08242 47  ALA C CB  
3135 N N   . LEU C 48  ? 0.75111 0.75234 0.59450 -0.01498 -0.25466 -0.06636 48  LEU C N   
3136 C CA  . LEU C 48  ? 0.70963 0.70726 0.57377 -0.02329 -0.25421 -0.06533 48  LEU C CA  
3137 C C   . LEU C 48  ? 0.66285 0.65647 0.53220 -0.02194 -0.24740 -0.05186 48  LEU C C   
3138 O O   . LEU C 48  ? 0.62891 0.63020 0.50362 -0.02031 -0.24736 -0.04331 48  LEU C O   
3139 C CB  . LEU C 48  ? 0.56966 0.57648 0.44780 -0.02608 -0.26180 -0.06801 48  LEU C CB  
3140 C CG  . LEU C 48  ? 0.61819 0.62456 0.50284 -0.02995 -0.27024 -0.08268 48  LEU C CG  
3141 C CD1 . LEU C 48  ? 0.66994 0.68669 0.57879 -0.03181 -0.28010 -0.08456 48  LEU C CD1 
3142 C CD2 . LEU C 48  ? 0.77114 0.76200 0.66364 -0.03729 -0.26187 -0.08843 48  LEU C CD2 
3143 N N   . LYS C 49  ? 0.58391 0.56422 0.45462 -0.02270 -0.24367 -0.05041 49  LYS C N   
3144 C CA  . LYS C 49  ? 0.58970 0.56538 0.46917 -0.01987 -0.24076 -0.03830 49  LYS C CA  
3145 C C   . LYS C 49  ? 0.58847 0.55333 0.47154 -0.02390 -0.24287 -0.03234 49  LYS C C   
3146 O O   . LYS C 49  ? 0.66342 0.63030 0.55356 -0.02083 -0.24202 -0.02160 49  LYS C O   
3147 C CB  . LYS C 49  ? 0.54496 0.50637 0.43257 -0.02011 -0.24067 -0.03921 49  LYS C CB  
3148 N N   . ASN C 50  ? 0.62603 0.57586 0.50350 -0.03018 -0.24346 -0.03871 50  ASN C N   
3149 C CA  . ASN C 50  ? 0.58738 0.51927 0.46156 -0.03276 -0.24154 -0.03259 50  ASN C CA  
3150 C C   . ASN C 50  ? 0.54080 0.49132 0.42394 -0.03170 -0.23741 -0.02791 50  ASN C C   
3151 O O   . ASN C 50  ? 0.78928 0.73227 0.67256 -0.03114 -0.23484 -0.01916 50  ASN C O   
3152 C CB  . ASN C 50  ? 0.57949 0.47944 0.44005 -0.03843 -0.23877 -0.03944 50  ASN C CB  
3153 C CG  . ASN C 50  ? 0.63301 0.50686 0.48213 -0.03893 -0.24641 -0.04176 50  ASN C CG  
3154 O OD1 . ASN C 50  ? 0.57445 0.43430 0.42220 -0.03671 -0.25450 -0.03484 50  ASN C OD1 
3155 N ND2 . ASN C 50  ? 0.63678 0.50304 0.48117 -0.04180 -0.24572 -0.05156 50  ASN C ND2 
3156 N N   . PHE C 51  ? 0.53497 0.50726 0.42630 -0.03119 -0.23880 -0.03370 51  PHE C N   
3157 C CA  . PHE C 51  ? 0.60934 0.60165 0.51253 -0.02856 -0.23968 -0.02822 51  PHE C CA  
3158 C C   . PHE C 51  ? 0.62363 0.62743 0.52322 -0.02170 -0.24027 -0.01697 51  PHE C C   
3159 O O   . PHE C 51  ? 0.68346 0.69244 0.59049 -0.02023 -0.23791 -0.00780 51  PHE C O   
3160 C CB  . PHE C 51  ? 0.58488 0.59521 0.49458 -0.02754 -0.24820 -0.03714 51  PHE C CB  
3161 C CG  . PHE C 51  ? 0.53566 0.54179 0.46565 -0.03392 -0.24727 -0.04537 51  PHE C CG  
3162 C CD1 . PHE C 51  ? 0.54101 0.53438 0.46917 -0.03848 -0.24541 -0.05604 51  PHE C CD1 
3163 C CD2 . PHE C 51  ? 0.56961 0.58492 0.52597 -0.03501 -0.24757 -0.04226 51  PHE C CD2 
3164 C CE1 . PHE C 51  ? 0.54398 0.53268 0.49647 -0.04400 -0.24192 -0.06325 51  PHE C CE1 
3165 C CE2 . PHE C 51  ? 0.56175 0.57303 0.54790 -0.04072 -0.24433 -0.04938 51  PHE C CE2 
3166 C CZ  . PHE C 51  ? 0.56666 0.56427 0.55093 -0.04515 -0.24065 -0.05983 51  PHE C CZ  
3167 N N   . ALA C 52  ? 0.63620 0.64329 0.52691 -0.01702 -0.24110 -0.01718 52  ALA C N   
3168 C CA  . ALA C 52  ? 0.64902 0.66365 0.54027 -0.00982 -0.23728 -0.00582 52  ALA C CA  
3169 C C   . ALA C 52  ? 0.67036 0.67270 0.57201 -0.01177 -0.23531 0.00331  52  ALA C C   
3170 O O   . ALA C 52  ? 0.77439 0.78454 0.68263 -0.00833 -0.23272 0.01362  52  ALA C O   
3171 C CB  . ALA C 52  ? 0.58103 0.59448 0.46575 -0.00480 -0.23339 -0.00775 52  ALA C CB  
3172 N N   . LYS C 53  ? 0.69099 0.67032 0.59148 -0.01688 -0.23831 -0.00064 53  LYS C N   
3173 C CA  . LYS C 53  ? 0.62046 0.57912 0.52418 -0.01831 -0.24131 0.00652  53  LYS C CA  
3174 C C   . LYS C 53  ? 0.60206 0.55549 0.50108 -0.02056 -0.23762 0.01050  53  LYS C C   
3175 O O   . LYS C 53  ? 0.57152 0.52151 0.47574 -0.01861 -0.23758 0.01991  53  LYS C O   
3176 C CB  . LYS C 53  ? 0.58870 0.51533 0.48296 -0.02276 -0.24889 0.00013  53  LYS C CB  
3177 C CG  . LYS C 53  ? 0.71641 0.64561 0.62177 -0.02092 -0.25262 -0.00311 53  LYS C CG  
3178 N N   . TYR C 54  ? 0.53270 0.48322 0.42565 -0.02471 -0.23329 0.00353  54  TYR C N   
3179 C CA  . TYR C 54  ? 0.52978 0.47226 0.42351 -0.02686 -0.22568 0.00740  54  TYR C CA  
3180 C C   . TYR C 54  ? 0.51668 0.48781 0.42654 -0.02234 -0.22444 0.01663  54  TYR C C   
3181 O O   . TYR C 54  ? 0.54007 0.50371 0.45162 -0.02159 -0.22053 0.02528  54  TYR C O   
3182 C CB  . TYR C 54  ? 0.55384 0.49260 0.45074 -0.03148 -0.21906 -0.00149 54  TYR C CB  
3183 C CG  . TYR C 54  ? 0.60311 0.53519 0.51070 -0.03339 -0.20696 0.00272  54  TYR C CG  
3184 C CD1 . TYR C 54  ? 0.61272 0.50300 0.50107 -0.03563 -0.19531 0.00499  54  TYR C CD1 
3185 C CD2 . TYR C 54  ? 0.52722 0.48999 0.46281 -0.03223 -0.20722 0.00459  54  TYR C CD2 
3186 C CE1 . TYR C 54  ? 0.66521 0.54614 0.56497 -0.03674 -0.17944 0.00963  54  TYR C CE1 
3187 C CE2 . TYR C 54  ? 0.55030 0.50793 0.50449 -0.03392 -0.19512 0.00910  54  TYR C CE2 
3188 C CZ  . TYR C 54  ? 0.62222 0.53993 0.56031 -0.03624 -0.17881 0.01189  54  TYR C CZ  
3189 O OH  . TYR C 54  ? 0.62427 0.53423 0.58322 -0.03736 -0.16204 0.01716  54  TYR C OH  
3190 N N   . PHE C 55  ? 0.50979 0.50978 0.42719 -0.01852 -0.22850 0.01493  55  PHE C N   
3191 C CA  . PHE C 55  ? 0.61318 0.63658 0.54027 -0.01301 -0.22896 0.02359  55  PHE C CA  
3192 C C   . PHE C 55  ? 0.63888 0.66442 0.56610 -0.00752 -0.22692 0.03477  55  PHE C C   
3193 O O   . PHE C 55  ? 0.63592 0.67006 0.57138 -0.00454 -0.22402 0.04462  55  PHE C O   
3194 C CB  . PHE C 55  ? 0.54619 0.58925 0.47079 -0.00913 -0.23654 0.01789  55  PHE C CB  
3195 C CG  . PHE C 55  ? 0.61592 0.66308 0.55480 -0.01357 -0.24114 0.01006  55  PHE C CG  
3196 C CD1 . PHE C 55  ? 0.60984 0.65590 0.57022 -0.01690 -0.23573 0.01463  55  PHE C CD1 
3197 C CD2 . PHE C 55  ? 0.56420 0.61439 0.49971 -0.01445 -0.24982 -0.00178 55  PHE C CD2 
3198 C CE1 . PHE C 55  ? 0.51247 0.56192 0.49793 -0.02106 -0.23792 0.00826  55  PHE C CE1 
3199 C CE2 . PHE C 55  ? 0.65738 0.71123 0.61593 -0.01884 -0.25519 -0.00900 55  PHE C CE2 
3200 C CZ  . PHE C 55  ? 0.60649 0.66078 0.59383 -0.02216 -0.24874 -0.00357 55  PHE C CZ  
3201 N N   . LEU C 56  ? 0.50141 0.51866 0.42528 -0.00622 -0.22788 0.03385  56  LEU C N   
3202 C CA  . LEU C 56  ? 0.53006 0.54863 0.46505 -0.00113 -0.22514 0.04477  56  LEU C CA  
3203 C C   . LEU C 56  ? 0.50376 0.50329 0.44425 -0.00455 -0.22715 0.05033  56  LEU C C   
3204 O O   . LEU C 56  ? 0.54297 0.54909 0.49550 -0.00083 -0.22418 0.06096  56  LEU C O   
3205 C CB  . LEU C 56  ? 0.53639 0.54949 0.47698 0.00100  -0.22527 0.04269  56  LEU C CB  
3206 C CG  . LEU C 56  ? 0.58176 0.59860 0.54519 0.00723  -0.21972 0.05505  56  LEU C CG  
3207 C CD1 . LEU C 56  ? 0.56417 0.60111 0.52209 0.01612  -0.20820 0.06242  56  LEU C CD1 
3208 C CD2 . LEU C 56  ? 0.49960 0.50619 0.48288 0.00811  -0.22053 0.05420  56  LEU C CD2 
3209 N N   . HIS C 57  ? 0.50598 0.47717 0.43370 -0.01092 -0.23193 0.04324  57  HIS C N   
3210 C CA  . HIS C 57  ? 0.52357 0.46657 0.44369 -0.01354 -0.23372 0.04713  57  HIS C CA  
3211 C C   . HIS C 57  ? 0.64413 0.59887 0.56808 -0.01290 -0.22423 0.05356  57  HIS C C   
3212 O O   . HIS C 57  ? 0.68653 0.63896 0.61765 -0.01068 -0.22356 0.06270  57  HIS C O   
3213 C CB  . HIS C 57  ? 0.60279 0.50620 0.49670 -0.01909 -0.23712 0.03797  57  HIS C CB  
3214 C CG  . HIS C 57  ? 0.90125 0.76442 0.77408 -0.02065 -0.23723 0.04110  57  HIS C CG  
3215 N ND1 . HIS C 57  ? 1.01404 0.85025 0.88271 -0.01921 -0.25099 0.04505  57  HIS C ND1 
3216 C CD2 . HIS C 57  ? 0.91836 0.75970 0.77291 -0.02289 -0.22460 0.04101  57  HIS C CD2 
3217 C CE1 . HIS C 57  ? 0.92417 0.72037 0.76444 -0.02023 -0.24836 0.04649  57  HIS C CE1 
3218 N NE2 . HIS C 57  ? 1.02663 0.82487 0.85757 -0.02227 -0.22970 0.04459  57  HIS C NE2 
3219 N N   . GLN C 58  ? 0.66304 0.63034 0.58742 -0.01483 -0.21771 0.04902  58  GLN C N   
3220 C CA  . GLN C 58  ? 0.64338 0.62245 0.57968 -0.01410 -0.20968 0.05576  58  GLN C CA  
3221 C C   . GLN C 58  ? 0.60499 0.61301 0.55641 -0.00745 -0.21105 0.06628  58  GLN C C   
3222 O O   . GLN C 58  ? 0.68599 0.69683 0.64648 -0.00608 -0.20591 0.07505  58  GLN C O   
3223 C CB  . GLN C 58  ? 0.57295 0.56366 0.51969 -0.01686 -0.20547 0.04942  58  GLN C CB  
3224 C CG  . GLN C 58  ? 0.73029 0.69037 0.66432 -0.02289 -0.19937 0.03981  58  GLN C CG  
3225 C CD  . GLN C 58  ? 0.91043 0.83706 0.83780 -0.02558 -0.18395 0.04344  58  GLN C CD  
3226 O OE1 . GLN C 58  ? 1.01068 0.94754 0.95721 -0.02453 -0.17593 0.05083  58  GLN C OE1 
3227 N NE2 . GLN C 58  ? 0.86815 0.74974 0.76446 -0.02819 -0.17927 0.03882  58  GLN C NE2 
3228 N N   . SER C 59  ? 0.52970 0.55505 0.48213 -0.00261 -0.21549 0.06633  59  SER C N   
3229 C CA  . SER C 59  ? 0.57109 0.61779 0.53285 0.00516  -0.21294 0.07725  59  SER C CA  
3230 C C   . SER C 59  ? 0.57473 0.61117 0.54745 0.00652  -0.21073 0.08674  59  SER C C   
3231 O O   . SER C 59  ? 0.56877 0.61524 0.55201 0.01022  -0.20607 0.09720  59  SER C O   
3232 C CB  . SER C 59  ? 0.58254 0.64152 0.53674 0.01123  -0.21355 0.07514  59  SER C CB  
3233 O OG  . SER C 59  ? 0.49993 0.56723 0.46108 0.01942  -0.20645 0.08671  59  SER C OG  
3234 N N   . HIS C 60  ? 0.57592 0.59055 0.54831 0.00357  -0.21626 0.08299  60  HIS C N   
3235 C CA  . HIS C 60  ? 0.57854 0.57807 0.56458 0.00417  -0.21960 0.09039  60  HIS C CA  
3236 C C   . HIS C 60  ? 0.62027 0.60092 0.59695 0.00060  -0.21877 0.09273  60  HIS C C   
3237 O O   . HIS C 60  ? 0.70872 0.68740 0.69809 0.00286  -0.21810 0.10179  60  HIS C O   
3238 C CB  . HIS C 60  ? 0.53642 0.51156 0.52510 0.00159  -0.23136 0.08460  60  HIS C CB  
3239 C CG  . HIS C 60  ? 0.62705 0.61835 0.63159 0.00568  -0.22883 0.08392  60  HIS C CG  
3240 N ND1 . HIS C 60  ? 0.65591 0.63069 0.66459 0.00324  -0.23837 0.07682  60  HIS C ND1 
3241 C CD2 . HIS C 60  ? 0.64383 0.66168 0.65794 0.01285  -0.21617 0.08976  60  HIS C CD2 
3242 C CE1 . HIS C 60  ? 0.62581 0.61864 0.65056 0.00832  -0.22965 0.07846  60  HIS C CE1 
3243 N NE2 . HIS C 60  ? 0.60918 0.62565 0.63364 0.01461  -0.21526 0.08624  60  HIS C NE2 
3244 N N   . GLU C 61  ? 0.58141 0.54576 0.53709 -0.00456 -0.21637 0.08504  61  GLU C N   
3245 C CA  . GLU C 61  ? 0.63587 0.57526 0.57963 -0.00724 -0.21052 0.08749  61  GLU C CA  
3246 C C   . GLU C 61  ? 0.58961 0.55722 0.55207 -0.00425 -0.20007 0.09685  61  GLU C C   
3247 O O   . GLU C 61  ? 0.73770 0.69359 0.70199 -0.00365 -0.19589 0.10405  61  GLU C O   
3248 C CB  . GLU C 61  ? 0.66236 0.57256 0.58093 -0.01255 -0.20523 0.07784  61  GLU C CB  
3249 N N   . GLU C 62  ? 0.51150 0.51337 0.48655 -0.00190 -0.19774 0.09678  62  GLU C N   
3250 C CA  . GLU C 62  ? 0.63849 0.66625 0.63178 0.00216  -0.19219 0.10644  62  GLU C CA  
3251 C C   . GLU C 62  ? 0.71160 0.75017 0.71612 0.00823  -0.19235 0.11785  62  GLU C C   
3252 O O   . GLU C 62  ? 0.60696 0.64876 0.62249 0.00994  -0.18664 0.12712  62  GLU C O   
3253 C CB  . GLU C 62  ? 0.69337 0.74950 0.69323 0.00471  -0.19579 0.10342  62  GLU C CB  
3254 C CG  . GLU C 62  ? 0.68670 0.73727 0.69026 -0.00113 -0.19449 0.09398  62  GLU C CG  
3255 C CD  . GLU C 62  ? 0.77412 0.81466 0.79361 -0.00430 -0.18286 0.09832  62  GLU C CD  
3256 O OE1 . GLU C 62  ? 0.94775 0.95856 0.95904 -0.00980 -0.17311 0.09293  62  GLU C OE1 
3257 O OE2 . GLU C 62  ? 0.78318 0.84221 0.82220 -0.00073 -0.18170 0.10752  62  GLU C OE2 
3258 N N   . ARG C 63  ? 0.58265 0.62619 0.58866 0.01178  -0.19668 0.11793  63  ARG C N   
3259 C CA  . ARG C 63  ? 0.60328 0.65392 0.62723 0.01762  -0.19377 0.12928  63  ARG C CA  
3260 C C   . ARG C 63  ? 0.68487 0.71061 0.71477 0.01424  -0.19649 0.13253  63  ARG C C   
3261 O O   . ARG C 63  ? 0.59046 0.62317 0.63682 0.01782  -0.19168 0.14323  63  ARG C O   
3262 C CB  . ARG C 63  ? 0.68159 0.73501 0.71246 0.02132  -0.19501 0.12824  63  ARG C CB  
3263 C CG  . ARG C 63  ? 0.75130 0.81480 0.80775 0.02896  -0.18687 0.14113  63  ARG C CG  
3264 N N   . GLU C 64  ? 0.57097 0.56308 0.58336 0.00792  -0.20487 0.12320  64  GLU C N   
3265 C CA  . GLU C 64  ? 0.58091 0.53822 0.58692 0.00531  -0.21039 0.12462  64  GLU C CA  
3266 C C   . GLU C 64  ? 0.61321 0.56819 0.61405 0.00475  -0.19859 0.13004  64  GLU C C   
3267 O O   . GLU C 64  ? 0.57865 0.52150 0.58601 0.00594  -0.19874 0.13692  64  GLU C O   
3268 C CB  . GLU C 64  ? 0.53257 0.44573 0.50844 -0.00002 -0.22196 0.11311  64  GLU C CB  
3269 N N   . HIS C 65  ? 0.58499 0.55009 0.57852 0.00288  -0.18849 0.12700  65  HIS C N   
3270 C CA  . HIS C 65  ? 0.64923 0.61222 0.64610 0.00241  -0.17545 0.13280  65  HIS C CA  
3271 C C   . HIS C 65  ? 0.56311 0.56262 0.58869 0.00820  -0.17138 0.14540  65  HIS C C   
3272 O O   . HIS C 65  ? 0.66444 0.65750 0.69690 0.00891  -0.16405 0.15300  65  HIS C O   
3273 C CB  . HIS C 65  ? 0.66979 0.63302 0.66265 -0.00113 -0.16589 0.12666  65  HIS C CB  
3274 C CG  . HIS C 65  ? 0.89169 0.80727 0.85177 -0.00612 -0.16285 0.11697  65  HIS C CG  
3275 N ND1 . HIS C 65  ? 0.97837 0.87075 0.93135 -0.00912 -0.14533 0.11498  65  HIS C ND1 
3276 C CD2 . HIS C 65  ? 0.97315 0.85482 0.90453 -0.00780 -0.17426 0.10951  65  HIS C CD2 
3277 C CE1 . HIS C 65  ? 1.06560 0.90913 0.98027 -0.01188 -0.14399 0.10680  65  HIS C CE1 
3278 N NE2 . HIS C 65  ? 1.06942 0.90561 0.96899 -0.01122 -0.16380 0.10303  65  HIS C NE2 
3279 N N   . ALA C 66  ? 0.48976 0.52266 0.52816 0.01320  -0.17522 0.14813  66  ALA C N   
3280 C CA  . ALA C 66  ? 0.56531 0.62574 0.62406 0.02042  -0.17094 0.16100  66  ALA C CA  
3281 C C   . ALA C 66  ? 0.56698 0.61594 0.63816 0.02227  -0.17129 0.16834  66  ALA C C   
3282 O O   . ALA C 66  ? 0.54584 0.60141 0.63149 0.02510  -0.16473 0.17861  66  ALA C O   
3283 C CB  . ALA C 66  ? 0.47083 0.55735 0.52932 0.02691  -0.17319 0.16198  66  ALA C CB  
3284 N N   . GLU C 67  ? 0.53194 0.56340 0.60210 0.02072  -0.18036 0.16321  67  GLU C N   
3285 C CA  . GLU C 67  ? 0.56517 0.58358 0.65530 0.02215  -0.18504 0.16913  67  GLU C CA  
3286 C C   . GLU C 67  ? 0.56982 0.55728 0.64898 0.01814  -0.18671 0.16924  67  GLU C C   
3287 O O   . GLU C 67  ? 0.61198 0.59818 0.71076 0.02062  -0.18567 0.17790  67  GLU C O   
3288 C CB  . GLU C 67  ? 0.46367 0.46560 0.55973 0.02063  -0.19859 0.16222  67  GLU C CB  
3289 C CG  . GLU C 67  ? 0.53420 0.56426 0.65634 0.02738  -0.19188 0.16770  67  GLU C CG  
3290 C CD  . GLU C 67  ? 0.65448 0.67259 0.78320 0.02556  -0.20254 0.15940  67  GLU C CD  
3291 O OE1 . GLU C 67  ? 0.84318 0.82965 0.97102 0.02037  -0.22038 0.15242  67  GLU C OE1 
3292 O OE2 . GLU C 67  ? 0.69588 0.73317 0.82849 0.03000  -0.19351 0.15995  67  GLU C OE2 
3293 N N   . LYS C 68  ? 0.52235 0.48196 0.56899 0.01259  -0.18663 0.16014  68  LYS C N   
3294 C CA  . LYS C 68  ? 0.51226 0.43430 0.53959 0.00988  -0.18358 0.16027  68  LYS C CA  
3295 C C   . LYS C 68  ? 0.61012 0.55511 0.65346 0.01223  -0.16631 0.17066  68  LYS C C   
3296 O O   . LYS C 68  ? 0.54996 0.47521 0.59262 0.01250  -0.16257 0.17578  68  LYS C O   
3297 C CB  . LYS C 68  ? 0.54134 0.42127 0.52645 0.00471  -0.18294 0.14871  68  LYS C CB  
3298 C CG  . LYS C 68  ? 0.65655 0.48083 0.60797 0.00300  -0.17963 0.14739  68  LYS C CG  
3299 C CD  . LYS C 68  ? 0.72189 0.51241 0.63611 -0.00031 -0.16492 0.13999  68  LYS C CD  
3300 C CE  . LYS C 68  ? 0.90944 0.66233 0.78743 -0.00264 -0.17929 0.12815  68  LYS C CE  
3301 N NZ  . LYS C 68  ? 1.03704 0.71815 0.86707 -0.00232 -0.19170 0.12376  68  LYS C NZ  
3302 N N   . LEU C 69  ? 0.47957 0.46368 0.53755 0.01429  -0.15772 0.17376  69  LEU C N   
3303 C CA  . LEU C 69  ? 0.51598 0.52297 0.59458 0.01733  -0.14530 0.18455  69  LEU C CA  
3304 C C   . LEU C 69  ? 0.50944 0.53656 0.61298 0.02339  -0.14601 0.19657  69  LEU C C   
3305 O O   . LEU C 69  ? 0.45652 0.48397 0.57250 0.02494  -0.13780 0.20537  69  LEU C O   
3306 C CB  . LEU C 69  ? 0.60148 0.64152 0.69050 0.01878  -0.14214 0.18452  69  LEU C CB  
3307 C CG  . LEU C 69  ? 0.56842 0.59305 0.64791 0.01308  -0.13591 0.17567  69  LEU C CG  
3308 C CD1 . LEU C 69  ? 0.46302 0.52111 0.55563 0.01487  -0.14165 0.17338  69  LEU C CD1 
3309 C CD2 . LEU C 69  ? 0.55769 0.56639 0.64612 0.01131  -0.11961 0.18086  69  LEU C CD2 
3310 N N   . MET C 70  ? 0.55803 0.60052 0.67144 0.02724  -0.15315 0.19765  70  MET C N   
3311 C CA  . MET C 70  ? 0.58172 0.63890 0.72272 0.03348  -0.15027 0.20964  70  MET C CA  
3312 C C   . MET C 70  ? 0.66141 0.68734 0.80889 0.03059  -0.15609 0.21005  70  MET C C   
3313 O O   . MET C 70  ? 0.74295 0.77469 0.91097 0.03376  -0.14968 0.22050  70  MET C O   
3314 C CB  . MET C 70  ? 0.58927 0.66213 0.74157 0.03848  -0.15243 0.21064  70  MET C CB  
3315 C CG  . MET C 70  ? 0.50647 0.60571 0.64709 0.04363  -0.14724 0.21150  70  MET C CG  
3316 S SD  . MET C 70  ? 0.54978 0.65405 0.69372 0.04861  -0.14703 0.20946  70  MET C SD  
3317 C CE  . MET C 70  ? 0.48394 0.60112 0.66054 0.05951  -0.13087 0.22750  70  MET C CE  
3318 N N   . LYS C 71  ? 0.55182 0.54078 0.67932 0.02496  -0.17003 0.19848  71  LYS C N   
3319 C CA  . LYS C 71  ? 0.56613 0.51376 0.68805 0.02221  -0.18054 0.19650  71  LYS C CA  
3320 C C   . LYS C 71  ? 0.54345 0.47625 0.65049 0.02108  -0.16789 0.20028  71  LYS C C   
3321 O O   . LYS C 71  ? 0.69619 0.61807 0.81652 0.02251  -0.16836 0.20655  71  LYS C O   
3322 C CB  . LYS C 71  ? 0.51763 0.41983 0.60684 0.01705  -0.19917 0.18236  71  LYS C CB  
3323 C CG  . LYS C 71  ? 0.55100 0.40096 0.62781 0.01527  -0.21716 0.17886  71  LYS C CG  
3324 C CD  . LYS C 71  ? 0.60204 0.39702 0.63283 0.01113  -0.23658 0.16464  71  LYS C CD  
3325 N N   . LEU C 72  ? 0.52728 0.45959 0.61188 0.01869  -0.15533 0.19695  72  LEU C N   
3326 C CA  . LEU C 72  ? 0.53262 0.44870 0.60732 0.01767  -0.13938 0.20075  72  LEU C CA  
3327 C C   . LEU C 72  ? 0.59002 0.54524 0.70249 0.02262  -0.12831 0.21529  72  LEU C C   
3328 O O   . LEU C 72  ? 0.51594 0.45436 0.63015 0.02290  -0.12023 0.22076  72  LEU C O   
3329 C CB  . LEU C 72  ? 0.52290 0.43536 0.57936 0.01447  -0.12651 0.19497  72  LEU C CB  
3330 C CG  . LEU C 72  ? 0.62541 0.51496 0.67270 0.01283  -0.10487 0.19729  72  LEU C CG  
3331 C CD1 . LEU C 72  ? 0.56668 0.50553 0.65687 0.01596  -0.09268 0.20892  72  LEU C CD1 
3332 C CD2 . LEU C 72  ? 0.64083 0.47749 0.66161 0.01259  -0.10280 0.19758  72  LEU C CD2 
3333 N N   . GLN C 73  ? 0.55765 0.56088 0.69584 0.02721  -0.12721 0.22171  73  GLN C N   
3334 C CA  . GLN C 73  ? 0.47825 0.51547 0.64752 0.03340  -0.11798 0.23625  73  GLN C CA  
3335 C C   . GLN C 73  ? 0.53230 0.56027 0.72023 0.03576  -0.12118 0.24282  73  GLN C C   
3336 O O   . GLN C 73  ? 0.55900 0.58712 0.76086 0.03745  -0.11224 0.25166  73  GLN C O   
3337 C CB  . GLN C 73  ? 0.45965 0.53786 0.64048 0.03950  -0.11861 0.24096  73  GLN C CB  
3338 C CG  . GLN C 73  ? 0.46593 0.57480 0.66974 0.04733  -0.10948 0.25620  73  GLN C CG  
3339 C CD  . GLN C 73  ? 0.51521 0.63794 0.72182 0.04725  -0.10460 0.25872  73  GLN C CD  
3340 O OE1 . GLN C 73  ? 0.51145 0.61793 0.72099 0.04242  -0.09739 0.25766  73  GLN C OE1 
3341 N NE2 . GLN C 73  ? 0.44564 0.59459 0.65206 0.05320  -0.10888 0.26217  73  GLN C NE2 
3342 N N   . ASN C 74  ? 0.45659 0.47470 0.64957 0.03564  -0.13460 0.23835  74  ASN C N   
3343 C CA  . ASN C 74  ? 0.51430 0.52130 0.73390 0.03743  -0.14016 0.24394  74  ASN C CA  
3344 C C   . ASN C 74  ? 0.56329 0.52278 0.76135 0.03249  -0.14628 0.23846  74  ASN C C   
3345 O O   . ASN C 74  ? 0.51709 0.47104 0.73516 0.03431  -0.14441 0.24580  74  ASN C O   
3346 C CB  . ASN C 74  ? 0.53270 0.53721 0.77185 0.03819  -0.15451 0.24023  74  ASN C CB  
3347 C CG  . ASN C 74  ? 0.53397 0.57990 0.80472 0.04609  -0.14217 0.25115  74  ASN C CG  
3348 O OD1 . ASN C 74  ? 0.62966 0.70266 0.90879 0.05194  -0.12567 0.26299  74  ASN C OD1 
3349 N ND2 . ASN C 74  ? 0.45194 0.49941 0.73779 0.04715  -0.14895 0.24770  74  ASN C ND2 
3350 N N   . GLN C 75  ? 0.57953 0.50032 0.73317 0.02695  -0.15205 0.22583  75  GLN C N   
3351 C CA  . GLN C 75  ? 0.54552 0.40914 0.66474 0.02359  -0.15598 0.22001  75  GLN C CA  
3352 C C   . GLN C 75  ? 0.68149 0.54884 0.80347 0.02486  -0.13396 0.22896  75  GLN C C   
3353 O O   . GLN C 75  ? 0.64904 0.47552 0.75544 0.02425  -0.13506 0.22853  75  GLN C O   
3354 C CB  . GLN C 75  ? 0.60268 0.42152 0.66779 0.01901  -0.16037 0.20618  75  GLN C CB  
3355 C CG  . GLN C 75  ? 0.74959 0.53018 0.79575 0.01705  -0.18882 0.19498  75  GLN C CG  
3356 C CD  . GLN C 75  ? 0.92490 0.65628 0.91070 0.01352  -0.19017 0.18233  75  GLN C CD  
3357 O OE1 . GLN C 75  ? 0.98870 0.74050 0.96698 0.01223  -0.17360 0.18100  75  GLN C OE1 
3358 N NE2 . GLN C 75  ? 1.03025 0.69260 0.97155 0.01249  -0.21084 0.17295  75  GLN C NE2 
3359 N N   . ARG C 76  ? 0.55336 0.54317 0.70868 0.00848  -0.19991 0.30458  76  ARG C N   
3360 C CA  . ARG C 76  ? 0.55795 0.54380 0.74525 0.01023  -0.20490 0.30937  76  ARG C CA  
3361 C C   . ARG C 76  ? 0.64151 0.62918 0.81941 0.01044  -0.21044 0.31688  76  ARG C C   
3362 O O   . ARG C 76  ? 0.60374 0.58919 0.80720 0.01189  -0.21597 0.32163  76  ARG C O   
3363 C CB  . ARG C 76  ? 0.55790 0.54834 0.77095 0.01375  -0.21700 0.30617  76  ARG C CB  
3364 C CG  . ARG C 76  ? 0.59513 0.58163 0.82592 0.01409  -0.21087 0.29881  76  ARG C CG  
3365 C CD  . ARG C 76  ? 0.53080 0.50260 0.78492 0.01235  -0.19616 0.29936  76  ARG C CD  
3366 N NE  . ARG C 76  ? 0.59454 0.56227 0.88090 0.01407  -0.19846 0.30440  76  ARG C NE  
3367 C CZ  . ARG C 76  ? 0.64621 0.61228 0.97197 0.01711  -0.20179 0.30202  76  ARG C CZ  
3368 N NH1 . ARG C 76  ? 0.61322 0.58102 0.95056 0.01891  -0.20339 0.29436  76  ARG C NH1 
3369 N NH2 . ARG C 76  ? 0.59270 0.55555 0.94783 0.01836  -0.20297 0.30683  76  ARG C NH2 
3370 N N   . GLY C 77  ? 0.59922 0.59012 0.74270 0.00906  -0.20828 0.31797  77  GLY C N   
3371 C CA  . GLY C 77  ? 0.60018 0.59196 0.73238 0.00944  -0.21357 0.32465  77  GLY C CA  
3372 C C   . GLY C 77  ? 0.73665 0.73438 0.86238 0.01200  -0.22951 0.32599  77  GLY C C   
3373 O O   . GLY C 77  ? 0.73870 0.73599 0.85447 0.01232  -0.23526 0.33190  77  GLY C O   
3374 N N   . GLY C 78  ? 0.61549 0.61771 0.74632 0.01359  -0.23710 0.32058  78  GLY C N   
3375 C CA  . GLY C 78  ? 0.63426 0.64100 0.75337 0.01528  -0.25219 0.32058  78  GLY C CA  
3376 C C   . GLY C 78  ? 0.71674 0.72504 0.79293 0.01469  -0.25039 0.32002  78  GLY C C   
3377 O O   . GLY C 78  ? 0.81140 0.81878 0.86913 0.01314  -0.23743 0.31895  78  GLY C O   
3378 N N   . ARG C 79  ? 0.66913 0.67881 0.72934 0.01574  -0.26344 0.32079  79  ARG C N   
3379 C CA  . ARG C 79  ? 0.78865 0.79782 0.80775 0.01544  -0.26164 0.32066  79  ARG C CA  
3380 C C   . ARG C 79  ? 0.78789 0.79973 0.79094 0.01623  -0.27099 0.31511  79  ARG C C   
3381 O O   . ARG C 79  ? 0.73712 0.74889 0.74984 0.01685  -0.28606 0.31571  79  ARG C O   
3382 C CB  . ARG C 79  ? 0.77003 0.77446 0.77535 0.01528  -0.26597 0.32878  79  ARG C CB  
3383 C CG  . ARG C 79  ? 0.75943 0.76108 0.77349 0.01414  -0.25385 0.33330  79  ARG C CG  
3384 C CD  . ARG C 79  ? 0.76121 0.76236 0.74846 0.01294  -0.23858 0.33126  79  ARG C CD  
3385 N NE  . ARG C 79  ? 0.81416 0.81266 0.81194 0.01123  -0.22661 0.33403  79  ARG C NE  
3386 C CZ  . ARG C 79  ? 0.80219 0.80088 0.81781 0.00966  -0.21643 0.33064  79  ARG C CZ  
3387 N NH1 . ARG C 79  ? 0.80042 0.80236 0.82552 0.00986  -0.21631 0.32433  79  ARG C NH1 
3388 N NH2 . ARG C 79  ? 0.70907 0.70388 0.73120 0.00763  -0.20627 0.33316  79  ARG C NH2 
3389 N N   . ILE C 80  ? 0.69094 0.70466 0.66961 0.01589  -0.26195 0.30980  80  ILE C N   
3390 C CA  . ILE C 80  ? 0.69750 0.71371 0.66076 0.01640  -0.26821 0.30338  80  ILE C CA  
3391 C C   . ILE C 80  ? 0.73197 0.74355 0.66674 0.01643  -0.27945 0.30643  80  ILE C C   
3392 O O   . ILE C 80  ? 0.87950 0.88625 0.79014 0.01606  -0.27539 0.31157  80  ILE C O   
3393 C CB  . ILE C 80  ? 0.78454 0.80343 0.72962 0.01581  -0.25398 0.29779  80  ILE C CB  
3394 C CG1 . ILE C 80  ? 0.65275 0.67460 0.62556 0.01512  -0.24363 0.29488  80  ILE C CG1 
3395 C CG2 . ILE C 80  ? 0.69280 0.71363 0.61827 0.01621  -0.25974 0.29123  80  ILE C CG2 
3396 C CD1 . ILE C 80  ? 0.63976 0.66270 0.59700 0.01368  -0.22764 0.29223  80  ILE C CD1 
3397 N N   . PHE C 81  ? 0.79430 0.80635 0.73121 0.01657  -0.29374 0.30323  81  PHE C N   
3398 C CA  . PHE C 81  ? 0.89325 0.89916 0.80269 0.01582  -0.30615 0.30591  81  PHE C CA  
3399 C C   . PHE C 81  ? 0.78321 0.79002 0.67785 0.01537  -0.31276 0.29825  81  PHE C C   
3400 O O   . PHE C 81  ? 0.84194 0.85194 0.76021 0.01541  -0.32354 0.29434  81  PHE C O   
3401 C CB  . PHE C 81  ? 0.82896 0.83197 0.75930 0.01541  -0.32136 0.31233  81  PHE C CB  
3402 C CG  . PHE C 81  ? 0.81286 0.81220 0.74358 0.01540  -0.31667 0.32088  81  PHE C CG  
3403 C CD1 . PHE C 81  ? 0.81634 0.80937 0.71035 0.01491  -0.31176 0.32496  81  PHE C CD1 
3404 C CD2 . PHE C 81  ? 0.82602 0.82763 0.79361 0.01588  -0.31583 0.32467  81  PHE C CD2 
3405 C CE1 . PHE C 81  ? 0.87157 0.86118 0.76608 0.01492  -0.30722 0.33253  81  PHE C CE1 
3406 C CE2 . PHE C 81  ? 0.91323 0.91128 0.88056 0.01570  -0.31135 0.33229  81  PHE C CE2 
3407 C CZ  . PHE C 81  ? 0.90431 0.89668 0.83503 0.01525  -0.30726 0.33604  81  PHE C CZ  
3408 N N   . LEU C 82  ? 0.79731 0.80052 0.65320 0.01483  -0.30634 0.29628  82  LEU C N   
3409 C CA  . LEU C 82  ? 0.87356 0.87741 0.71169 0.01425  -0.30856 0.28832  82  LEU C CA  
3410 C C   . LEU C 82  ? 0.83862 0.83409 0.65248 0.01231  -0.32431 0.28935  82  LEU C C   
3411 O O   . LEU C 82  ? 1.03325 1.02053 0.82698 0.01129  -0.32804 0.29636  82  LEU C O   
3412 C CB  . LEU C 82  ? 0.83661 0.84041 0.64642 0.01438  -0.29142 0.28564  82  LEU C CB  
3413 C CG  . LEU C 82  ? 0.82338 0.83349 0.65096 0.01533  -0.27464 0.28564  82  LEU C CG  
3414 C CD1 . LEU C 82  ? 0.76690 0.77560 0.56482 0.01497  -0.25886 0.28451  82  LEU C CD1 
3415 C CD2 . LEU C 82  ? 0.85583 0.87434 0.71727 0.01590  -0.27505 0.27913  82  LEU C CD2 
3416 N N   . GLN C 83  ? 0.88229 0.87905 0.69751 0.01143  -0.33359 0.28226  83  GLN C N   
3417 C CA  . GLN C 83  ? 0.96335 0.95123 0.75454 0.00870  -0.34890 0.28206  83  GLN C CA  
3418 C C   . GLN C 83  ? 1.09164 1.07630 0.84714 0.00756  -0.34313 0.27481  83  GLN C C   
3419 O O   . GLN C 83  ? 1.11639 1.10694 0.87020 0.00909  -0.32841 0.26998  83  GLN C O   
3420 C CB  . GLN C 83  ? 0.91917 0.90978 0.74401 0.00791  -0.36684 0.28020  83  GLN C CB  
3421 C CG  . GLN C 83  ? 0.95989 0.95355 0.82342 0.00898  -0.37191 0.28733  83  GLN C CG  
3422 C CD  . GLN C 83  ? 1.05221 1.03745 0.89881 0.00784  -0.37505 0.29752  83  GLN C CD  
3423 O OE1 . GLN C 83  ? 1.02156 0.99679 0.82830 0.00555  -0.37843 0.29969  83  GLN C OE1 
3424 N NE2 . GLN C 83  ? 0.99280 0.98120 0.86932 0.00924  -0.37351 0.30382  83  GLN C NE2 
3425 N N   . ASP C 84  ? 1.15145 1.12569 0.87754 0.00438  -0.35474 0.27429  84  ASP C N   
3426 C CA  . ASP C 84  ? 1.20861 1.17901 0.90366 0.00279  -0.35119 0.26636  84  ASP C CA  
3427 C C   . ASP C 84  ? 1.14052 1.12162 0.86350 0.00405  -0.35215 0.25678  84  ASP C C   
3428 O O   . ASP C 84  ? 1.17992 1.16754 0.94173 0.00481  -0.36258 0.25597  84  ASP C O   
3429 C CB  . ASP C 84  ? 1.25324 1.20938 0.91586 -0.00170 -0.36592 0.26700  84  ASP C CB  
3430 C CG  . ASP C 84  ? 1.32435 1.26895 0.96133 -0.00334 -0.36677 0.27684  84  ASP C CG  
3431 O OD1 . ASP C 84  ? 1.36359 1.31039 1.02486 -0.00243 -0.37309 0.28417  84  ASP C OD1 
3432 O OD2 . ASP C 84  ? 1.38904 1.32202 0.98195 -0.00558 -0.36038 0.27714  84  ASP C OD2 
3433 N N   . ILE C 85  ? 1.08630 1.06913 0.79076 0.00434  -0.34009 0.24971  85  ILE C N   
3434 C CA  . ILE C 85  ? 0.97469 0.96588 0.69848 0.00500  -0.34109 0.23965  85  ILE C CA  
3435 C C   . ILE C 85  ? 0.94994 0.93191 0.64648 0.00146  -0.35264 0.23369  85  ILE C C   
3436 O O   . ILE C 85  ? 0.92558 0.89845 0.57997 -0.00052 -0.34563 0.23187  85  ILE C O   
3437 C CB  . ILE C 85  ? 0.94462 0.94310 0.66613 0.00695  -0.32174 0.23531  85  ILE C CB  
3438 C CG1 . ILE C 85  ? 0.86292 0.86903 0.61101 0.00964  -0.31061 0.24159  85  ILE C CG1 
3439 C CG2 . ILE C 85  ? 0.82340 0.82939 0.56181 0.00725  -0.32358 0.22428  85  ILE C CG2 
3440 C CD1 . ILE C 85  ? 0.84428 0.85303 0.57773 0.01040  -0.29045 0.24146  85  ILE C CD1 
3441 N N   . GLN C 86  ? 0.93673 0.91967 0.65687 0.00025  -0.37017 0.23114  86  GLN C N   
3442 C CA  . GLN C 86  ? 0.98638 0.95945 0.68238 -0.00382 -0.38292 0.22582  86  GLN C CA  
3443 C C   . GLN C 86  ? 1.00421 0.97917 0.68415 -0.00394 -0.37405 0.21464  86  GLN C C   
3444 O O   . GLN C 86  ? 0.92922 0.91623 0.63478 -0.00093 -0.36575 0.20914  86  GLN C O   
3445 C CB  . GLN C 86  ? 0.94864 0.92360 0.67930 -0.00504 -0.40315 0.22549  86  GLN C CB  
3446 N N   . LYS C 87  ? 1.03555 0.99737 0.67222 -0.00783 -0.37593 0.21118  87  LYS C N   
3447 C CA  . LYS C 87  ? 0.98108 0.94308 0.60235 -0.00857 -0.36980 0.19984  87  LYS C CA  
3448 C C   . LYS C 87  ? 0.96720 0.93778 0.62509 -0.00818 -0.38226 0.19188  87  LYS C C   
3449 O O   . LYS C 87  ? 0.98280 0.95359 0.66608 -0.00916 -0.39901 0.19506  87  LYS C O   
3450 C CB  . LYS C 87  ? 1.11044 1.05429 0.67894 -0.01356 -0.37105 0.19748  87  LYS C CB  
3451 C CG  . LYS C 87  ? 1.07904 1.01294 0.64355 -0.01830 -0.39254 0.19518  87  LYS C CG  
3452 C CD  . LYS C 87  ? 1.11353 1.02918 0.62524 -0.02351 -0.39099 0.18996  87  LYS C CD  
3453 N N   . PRO C 88  ? 0.92247 0.89993 0.58474 -0.00686 -0.37409 0.18159  88  PRO C N   
3454 C CA  . PRO C 88  ? 0.90174 0.88583 0.59491 -0.00685 -0.38531 0.17285  88  PRO C CA  
3455 C C   . PRO C 88  ? 0.98419 0.95579 0.65873 -0.01185 -0.40260 0.17028  88  PRO C C   
3456 O O   . PRO C 88  ? 0.98830 0.94481 0.61761 -0.01575 -0.40289 0.17185  88  PRO C O   
3457 C CB  . PRO C 88  ? 0.94537 0.93567 0.63334 -0.00524 -0.37093 0.16221  88  PRO C CB  
3458 C CG  . PRO C 88  ? 0.95892 0.94174 0.60294 -0.00581 -0.35397 0.16494  88  PRO C CG  
3459 C CD  . PRO C 88  ? 0.96637 0.94664 0.60953 -0.00517 -0.35359 0.17797  88  PRO C CD  
3460 N N   . ASP C 89  ? 1.04457 1.02174 0.75546 -0.01205 -0.41690 0.16639  89  ASP C N   
3461 C CA  . ASP C 89  ? 1.08489 1.05064 0.78464 -0.01718 -0.43543 0.16485  89  ASP C CA  
3462 C C   . ASP C 89  ? 1.00781 0.96518 0.67188 -0.02036 -0.43280 0.15380  89  ASP C C   
3463 O O   . ASP C 89  ? 1.01988 0.96269 0.65772 -0.02576 -0.44515 0.15332  89  ASP C O   
3464 C CB  . ASP C 89  ? 1.08040 1.05489 0.83298 -0.01638 -0.45050 0.16431  89  ASP C CB  
3465 C CG  . ASP C 89  ? 1.12941 1.10609 0.91090 -0.01529 -0.45836 0.17643  89  ASP C CG  
3466 O OD1 . ASP C 89  ? 1.11161 1.07599 0.86856 -0.01874 -0.46665 0.18514  89  ASP C OD1 
3467 O OD2 . ASP C 89  ? 1.15210 1.14207 0.98087 -0.01111 -0.45559 0.17704  89  ASP C OD2 
3468 N N   . GLU C 90  ? 1.06644 1.03154 0.72838 -0.01751 -0.41711 0.14500  90  GLU C N   
3469 C CA  . GLU C 90  ? 1.07849 1.03592 0.70720 -0.02018 -0.41239 0.13384  90  GLU C CA  
3470 C C   . GLU C 90  ? 1.03191 0.98813 0.62870 -0.01846 -0.39032 0.13202  90  GLU C C   
3471 O O   . GLU C 90  ? 1.12763 1.09501 0.74278 -0.01413 -0.37843 0.13564  90  GLU C O   
3472 C CB  . GLU C 90  ? 1.03491 1.00275 0.69693 -0.01891 -0.41676 0.12245  90  GLU C CB  
3473 C CG  . GLU C 90  ? 1.12595 1.08491 0.78752 -0.02380 -0.43610 0.11918  90  GLU C CG  
3474 C CD  . GLU C 90  ? 1.23983 1.17805 0.84410 -0.02972 -0.43780 0.11874  90  GLU C CD  
3475 O OE1 . GLU C 90  ? 1.32860 1.25466 0.91927 -0.03370 -0.45085 0.12759  90  GLU C OE1 
3476 O OE2 . GLU C 90  ? 1.25744 1.19057 0.83013 -0.03053 -0.42544 0.10953  90  GLU C OE2 
3477 N N   . ASP C 91  ? 1.08388 1.02522 0.63260 -0.02224 -0.38462 0.12694  91  ASP C N   
3478 C CA  . ASP C 91  ? 1.16545 1.10346 0.68136 -0.02121 -0.36276 0.12409  91  ASP C CA  
3479 C C   . ASP C 91  ? 1.19250 1.13354 0.70503 -0.02072 -0.35432 0.11004  91  ASP C C   
3480 O O   . ASP C 91  ? 1.08043 1.02430 0.58140 -0.01849 -0.33550 0.10702  91  ASP C O   
3481 C CB  . ASP C 91  ? 1.21666 1.13384 0.67853 -0.02577 -0.35848 0.12832  91  ASP C CB  
3482 N N   . ASP C 92  ? 1.27995 1.22006 0.80297 -0.02293 -0.36785 0.10174  92  ASP C N   
3483 C CA  . ASP C 92  ? 1.23303 1.17673 0.75836 -0.02250 -0.36253 0.08764  92  ASP C CA  
3484 C C   . ASP C 92  ? 1.11790 1.07842 0.69869 -0.01955 -0.37360 0.08408  92  ASP C C   
3485 O O   . ASP C 92  ? 1.28435 1.24493 0.88678 -0.02134 -0.39190 0.08686  92  ASP C O   
3486 C CB  . ASP C 92  ? 1.34224 1.26860 0.83043 -0.02817 -0.36810 0.08039  92  ASP C CB  
3487 C CG  . ASP C 92  ? 1.42457 1.35511 0.92029 -0.02791 -0.36557 0.06555  92  ASP C CG  
3488 O OD1 . ASP C 92  ? 1.46076 1.40352 0.99876 -0.02639 -0.37717 0.06175  92  ASP C OD1 
3489 O OD2 . ASP C 92  ? 1.46405 1.38500 0.92383 -0.02929 -0.35132 0.05755  92  ASP C OD2 
3490 N N   . TRP C 93  ? 0.98229 0.95594 0.58622 -0.01530 -0.36222 0.07801  93  TRP C N   
3491 C CA  . TRP C 93  ? 0.95656 0.94626 0.61524 -0.01193 -0.36915 0.07530  93  TRP C CA  
3492 C C   . TRP C 93  ? 0.96623 0.95866 0.63726 -0.01249 -0.37268 0.06096  93  TRP C C   
3493 O O   . TRP C 93  ? 0.93390 0.93942 0.64762 -0.00925 -0.37324 0.05590  93  TRP C O   
3494 C CB  . TRP C 93  ? 0.88809 0.88972 0.56785 -0.00720 -0.35530 0.07829  93  TRP C CB  
3495 C CG  . TRP C 93  ? 0.86124 0.86183 0.53719 -0.00659 -0.35377 0.09276  93  TRP C CG  
3496 C CD1 . TRP C 93  ? 0.86005 0.85369 0.50004 -0.00703 -0.34048 0.09921  93  TRP C CD1 
3497 C CD2 . TRP C 93  ? 0.90349 0.90916 0.61244 -0.00560 -0.36562 0.10282  93  TRP C CD2 
3498 N NE1 . TRP C 93  ? 0.86293 0.85757 0.51174 -0.00627 -0.34366 0.11257  93  TRP C NE1 
3499 C CE2 . TRP C 93  ? 0.89278 0.89463 0.58349 -0.00532 -0.35900 0.11485  93  TRP C CE2 
3500 C CE3 . TRP C 93  ? 0.81021 0.82301 0.56380 -0.00484 -0.38017 0.10280  93  TRP C CE3 
3501 C CZ2 . TRP C 93  ? 0.85785 0.86271 0.57242 -0.00425 -0.36682 0.12627  93  TRP C CZ2 
3502 C CZ3 . TRP C 93  ? 0.80885 0.82421 0.58633 -0.00384 -0.38748 0.11440  93  TRP C CZ3 
3503 C CH2 . TRP C 93  ? 0.90977 0.92111 0.66722 -0.00354 -0.38106 0.12582  93  TRP C CH2 
3504 N N   . GLU C 94  ? 0.94768 0.92719 0.58175 -0.01665 -0.37401 0.05415  94  GLU C N   
3505 C CA  . GLU C 94  ? 0.96727 0.94690 0.60989 -0.01833 -0.38025 0.04159  94  GLU C CA  
3506 C C   . GLU C 94  ? 0.91568 0.90503 0.57306 -0.01469 -0.36693 0.02903  94  GLU C C   
3507 O O   . GLU C 94  ? 0.92254 0.90487 0.55131 -0.01611 -0.35818 0.01855  94  GLU C O   
3508 C CB  . GLU C 94  ? 1.05889 1.04437 0.74396 -0.01910 -0.40022 0.04462  94  GLU C CB  
3509 N N   . SER C 95  ? 0.93759 0.94186 0.63911 -0.01010 -0.36485 0.02955  95  SER C N   
3510 C CA  . SER C 95  ? 0.82753 0.84265 0.55188 -0.00640 -0.34849 0.01672  95  SER C CA  
3511 C C   . SER C 95  ? 0.85796 0.88783 0.62277 -0.00140 -0.33469 0.02086  95  SER C C   
3512 O O   . SER C 95  ? 0.93059 0.96221 0.70691 -0.00076 -0.34079 0.03334  95  SER C O   
3513 C CB  . SER C 95  ? 0.76722 0.78512 0.51660 -0.00751 -0.36164 0.00617  95  SER C CB  
3514 O OG  . SER C 95  ? 0.79187 0.82019 0.59212 -0.00564 -0.37309 0.01071  95  SER C OG  
3515 N N   . GLY C 96  ? 0.78590 0.82508 0.57098 0.00178  -0.31602 0.01019  96  GLY C N   
3516 C CA  . GLY C 96  ? 0.75053 0.80142 0.57325 0.00568  -0.30297 0.01274  96  GLY C CA  
3517 C C   . GLY C 96  ? 0.81791 0.87556 0.68859 0.00658  -0.31630 0.01416  96  GLY C C   
3518 O O   . GLY C 96  ? 0.75486 0.81770 0.65159 0.00853  -0.31432 0.02266  96  GLY C O   
3519 N N   . LEU C 97  ? 0.79069 0.84780 0.67444 0.00506  -0.32968 0.00597  97  LEU C N   
3520 C CA  . LEU C 97  ? 0.80674 0.86909 0.73636 0.00552  -0.34472 0.00828  97  LEU C CA  
3521 C C   . LEU C 97  ? 0.75986 0.81821 0.68838 0.00398  -0.36430 0.02370  97  LEU C C   
3522 O O   . LEU C 97  ? 0.77551 0.83957 0.74200 0.00588  -0.36814 0.03095  97  LEU C O   
3523 C CB  . LEU C 97  ? 0.77289 0.83440 0.71314 0.00358  -0.35700 -0.00267 97  LEU C CB  
3524 C CG  . LEU C 97  ? 0.69779 0.76395 0.68611 0.00361  -0.37501 0.00040  97  LEU C CG  
3525 C CD1 . LEU C 97  ? 0.63331 0.70903 0.66817 0.00754  -0.35891 -0.00276 97  LEU C CD1 
3526 C CD2 . LEU C 97  ? 0.68287 0.74634 0.67406 0.00070  -0.38913 -0.00890 97  LEU C CD2 
3527 N N   . ASN C 98  ? 0.71806 0.76526 0.60227 0.00032  -0.37626 0.02907  98  ASN C N   
3528 C CA  . ASN C 98  ? 0.75770 0.80015 0.64052 -0.00166 -0.39175 0.04322  98  ASN C CA  
3529 C C   . ASN C 98  ? 0.76668 0.81082 0.64610 0.00056  -0.38437 0.05532  98  ASN C C   
3530 O O   . ASN C 98  ? 0.84736 0.89372 0.75097 0.00122  -0.39159 0.06606  98  ASN C O   
3531 C CB  . ASN C 98  ? 0.76592 0.79455 0.60282 -0.00675 -0.40027 0.04439  98  ASN C CB  
3532 C CG  . ASN C 98  ? 0.87477 0.89782 0.71286 -0.00905 -0.41466 0.05760  98  ASN C CG  
3533 O OD1 . ASN C 98  ? 0.91971 0.93718 0.73196 -0.00947 -0.41188 0.06757  98  ASN C OD1 
3534 N ND2 . ASN C 98  ? 0.93919 0.96357 0.80955 -0.01047 -0.42989 0.05815  98  ASN C ND2 
3535 N N   . ALA C 99  ? 0.70906 0.75267 0.56121 0.00187  -0.36392 0.05319  99  ALA C N   
3536 C CA  . ALA C 99  ? 0.74393 0.79111 0.59922 0.00431  -0.35123 0.06320  99  ALA C CA  
3537 C C   . ALA C 99  ? 0.70699 0.76539 0.61567 0.00786  -0.34550 0.06349  99  ALA C C   
3538 O O   . ALA C 99  ? 0.68302 0.74309 0.60878 0.00889  -0.34959 0.07511  99  ALA C O   
3539 C CB  . ALA C 99  ? 0.74202 0.78835 0.56628 0.00528  -0.32721 0.05918  99  ALA C CB  
3540 N N   . MET C 100 ? 0.71525 0.78004 0.64975 0.00952  -0.33545 0.05067  100 MET C N   
3541 C CA  . MET C 100 ? 0.60241 0.67513 0.58530 0.01237  -0.32772 0.04970  100 MET C CA  
3542 C C   . MET C 100 ? 0.67767 0.75170 0.69683 0.01232  -0.34783 0.05685  100 MET C C   
3543 O O   . MET C 100 ? 0.60465 0.68222 0.65612 0.01435  -0.34418 0.06328  100 MET C O   
3544 C CB  . MET C 100 ? 0.57920 0.65607 0.57865 0.01339  -0.31435 0.03400  100 MET C CB  
3545 C CG  . MET C 100 ? 0.77340 0.85470 0.80003 0.01574  -0.29435 0.03189  100 MET C CG  
3546 S SD  . MET C 100 ? 0.70297 0.78323 0.69787 0.01623  -0.27287 0.03614  100 MET C SD  
3547 C CE  . MET C 100 ? 0.83634 0.91611 0.80560 0.01563  -0.26078 0.02100  100 MET C CE  
3548 N N   . GLU C 101 ? 0.66100 0.73135 0.67560 0.00973  -0.36960 0.05631  101 GLU C N   
3549 C CA  . GLU C 101 ? 0.63445 0.70605 0.68574 0.00944  -0.38965 0.06379  101 GLU C CA  
3550 C C   . GLU C 101 ? 0.68332 0.75053 0.72327 0.00879  -0.39516 0.07949  101 GLU C C   
3551 O O   . GLU C 101 ? 0.64482 0.71497 0.72172 0.01036  -0.39831 0.08715  101 GLU C O   
3552 C CB  . GLU C 101 ? 0.74765 0.81530 0.79634 0.00621  -0.40303 0.05757  101 GLU C CB  
3553 C CG  . GLU C 101 ? 0.71327 0.78659 0.79026 0.00719  -0.39926 0.04280  101 GLU C CG  
3554 C CD  . GLU C 101 ? 0.93117 0.99966 1.00078 0.00351  -0.41201 0.03680  101 GLU C CD  
3555 O OE1 . GLU C 101 ? 1.00259 1.06196 1.02688 -0.00011 -0.41878 0.03899  101 GLU C OE1 
3556 O OE2 . GLU C 101 ? 0.94616 1.01903 1.05461 0.00400  -0.41438 0.02970  101 GLU C OE2 
3557 N N   . ALA C 102 ? 0.67978 0.73909 0.66916 0.00643  -0.39551 0.08426  102 ALA C N   
3558 C CA  . ALA C 102 ? 0.73124 0.78613 0.70818 0.00596  -0.39861 0.09874  102 ALA C CA  
3559 C C   . ALA C 102 ? 0.69431 0.75545 0.69112 0.00953  -0.38607 0.10515  102 ALA C C   
3560 O O   . ALA C 102 ? 0.74455 0.80585 0.75999 0.01038  -0.38941 0.11593  102 ALA C O   
3561 C CB  . ALA C 102 ? 0.76414 0.80840 0.68194 0.00277  -0.39831 0.10155  102 ALA C CB  
3562 N N   . ALA C 103 ? 0.64487 0.71041 0.63884 0.01142  -0.36856 0.09786  103 ALA C N   
3563 C CA  . ALA C 103 ? 0.61994 0.68996 0.63314 0.01421  -0.35104 0.10228  103 ALA C CA  
3564 C C   . ALA C 103 ? 0.59762 0.67297 0.66672 0.01642  -0.35265 0.10197  103 ALA C C   
3565 O O   . ALA C 103 ? 0.70808 0.78419 0.79731 0.01788  -0.35044 0.11166  103 ALA C O   
3566 C CB  . ALA C 103 ? 0.60112 0.67325 0.59866 0.01516  -0.32607 0.09283  103 ALA C CB  
3567 N N   . LEU C 104 ? 0.58770 0.66607 0.68271 0.01665  -0.35533 0.09078  104 LEU C N   
3568 C CA  . LEU C 104 ? 0.61803 0.70025 0.76798 0.01852  -0.35819 0.09055  104 LEU C CA  
3569 C C   . LEU C 104 ? 0.58671 0.66754 0.75450 0.01836  -0.37764 0.10495  104 LEU C C   
3570 O O   . LEU C 104 ? 0.59874 0.68097 0.79991 0.02042  -0.37350 0.11174  104 LEU C O   
3571 C CB  . LEU C 104 ? 0.59209 0.67685 0.76277 0.01811  -0.36284 0.07754  104 LEU C CB  
3572 C CG  . LEU C 104 ? 0.66888 0.75717 0.89882 0.02006  -0.36367 0.07616  104 LEU C CG  
3573 C CD1 . LEU C 104 ? 0.57120 0.65921 0.82099 0.02225  -0.33994 0.07540  104 LEU C CD1 
3574 C CD2 . LEU C 104 ? 0.69396 0.78475 0.94328 0.01953  -0.36648 0.06259  104 LEU C CD2 
3575 N N   . HIS C 105 ? 0.61826 0.69371 0.76018 0.01532  -0.39174 0.10802  105 HIS C N   
3576 C CA  . HIS C 105 ? 0.64809 0.71958 0.80175 0.01427  -0.40387 0.11967  105 HIS C CA  
3577 C C   . HIS C 105 ? 0.72539 0.79492 0.86558 0.01524  -0.39798 0.13201  105 HIS C C   
3578 O O   . HIS C 105 ? 0.71000 0.77934 0.87954 0.01628  -0.40048 0.14080  105 HIS C O   
3579 C CB  . HIS C 105 ? 0.72203 0.78618 0.84514 0.01009  -0.42016 0.12035  105 HIS C CB  
3580 C CG  . HIS C 105 ? 0.83416 0.89375 0.97508 0.00840  -0.43522 0.13071  105 HIS C CG  
3581 N ND1 . HIS C 105 ? 0.88597 0.94761 1.07469 0.00855  -0.44345 0.12975  105 HIS C ND1 
3582 C CD2 . HIS C 105 ? 0.87952 0.93191 0.99731 0.00630  -0.44348 0.14229  105 HIS C CD2 
3583 C CE1 . HIS C 105 ? 0.89410 0.95013 1.08871 0.00651  -0.45679 0.14062  105 HIS C CE1 
3584 N NE2 . HIS C 105 ? 0.89130 0.94163 1.04300 0.00509  -0.45728 0.14819  105 HIS C NE2 
3585 N N   . LEU C 106 ? 0.64354 0.71120 0.74013 0.01479  -0.38944 0.13280  106 LEU C N   
3586 C CA  . LEU C 106 ? 0.68237 0.74775 0.76256 0.01540  -0.38294 0.14438  106 LEU C CA  
3587 C C   . LEU C 106 ? 0.65362 0.72406 0.77242 0.01862  -0.37131 0.14733  106 LEU C C   
3588 O O   . LEU C 106 ? 0.61803 0.68681 0.74929 0.01935  -0.37123 0.15791  106 LEU C O   
3589 C CB  . LEU C 106 ? 0.73683 0.79922 0.76508 0.01420  -0.37412 0.14343  106 LEU C CB  
3590 C CG  . LEU C 106 ? 0.73361 0.79400 0.74017 0.01471  -0.36380 0.15402  106 LEU C CG  
3591 C CD1 . LEU C 106 ? 0.74834 0.80140 0.73660 0.01293  -0.37369 0.16500  106 LEU C CD1 
3592 C CD2 . LEU C 106 ? 0.65488 0.71440 0.62134 0.01398  -0.35127 0.15032  106 LEU C CD2 
3593 N N   . GLU C 107 ? 0.58834 0.66385 0.72609 0.02032  -0.36104 0.13774  107 GLU C N   
3594 C CA  . GLU C 107 ? 0.56191 0.63891 0.73420 0.02259  -0.34386 0.13752  107 GLU C CA  
3595 C C   . GLU C 107 ? 0.66848 0.74690 0.89338 0.02422  -0.35455 0.14154  107 GLU C C   
3596 O O   . GLU C 107 ? 0.71811 0.79523 0.96813 0.02577  -0.34732 0.14836  107 GLU C O   
3597 C CB  . GLU C 107 ? 0.53812 0.61638 0.71288 0.02291  -0.32202 0.12252  107 GLU C CB  
3598 C CG  . GLU C 107 ? 0.58988 0.66700 0.71917 0.02171  -0.30723 0.11930  107 GLU C CG  
3599 C CD  . GLU C 107 ? 0.68773 0.76241 0.80539 0.02179  -0.29516 0.12922  107 GLU C CD  
3600 O OE1 . GLU C 107 ? 0.80671 0.88081 0.89384 0.02088  -0.28164 0.12694  107 GLU C OE1 
3601 O OE2 . GLU C 107 ? 0.77355 0.84680 0.91330 0.02269  -0.29906 0.13949  107 GLU C OE2 
3602 N N   . LYS C 108 ? 0.58906 0.66840 0.82962 0.02337  -0.36716 0.13615  108 LYS C N   
3603 C CA  . LYS C 108 ? 0.56579 0.64484 0.85486 0.02427  -0.37257 0.13914  108 LYS C CA  
3604 C C   . LYS C 108 ? 0.67728 0.75190 0.96250 0.02344  -0.38038 0.15334  108 LYS C C   
3605 O O   . LYS C 108 ? 0.64967 0.72342 0.97107 0.02506  -0.37657 0.15947  108 LYS C O   
3606 C CB  . LYS C 108 ? 0.57508 0.65508 0.87840 0.02280  -0.38421 0.13093  108 LYS C CB  
3607 C CG  . LYS C 108 ? 0.58589 0.67033 0.89969 0.02381  -0.37546 0.11620  108 LYS C CG  
3608 C CD  . LYS C 108 ? 0.62431 0.71063 0.99435 0.02647  -0.36507 0.11220  108 LYS C CD  
3609 C CE  . LYS C 108 ? 0.70367 0.78945 1.10923 0.02552  -0.37609 0.11025  108 LYS C CE  
3610 N NZ  . LYS C 108 ? 0.70023 0.78722 1.08527 0.02319  -0.38553 0.10076  108 LYS C NZ  
3611 N N   . ASN C 109 ? 0.68864 0.75947 0.92934 0.02080  -0.39021 0.15850  109 ASN C N   
3612 C CA  . ASN C 109 ? 0.69040 0.75635 0.92322 0.01974  -0.39734 0.17168  109 ASN C CA  
3613 C C   . ASN C 109 ? 0.66187 0.72785 0.89523 0.02179  -0.38333 0.17908  109 ASN C C   
3614 O O   . ASN C 109 ? 0.73188 0.79609 0.99193 0.02261  -0.38372 0.18757  109 ASN C O   
3615 C CB  . ASN C 109 ? 0.77321 0.83358 0.95391 0.01636  -0.40810 0.17459  109 ASN C CB  
3616 C CG  . ASN C 109 ? 0.95189 1.00858 1.13655 0.01331  -0.42672 0.17300  109 ASN C CG  
3617 O OD1 . ASN C 109 ? 0.94715 1.00570 1.17601 0.01367  -0.43286 0.17157  109 ASN C OD1 
3618 N ND2 . ASN C 109 ? 1.06695 1.11730 1.20506 0.00996  -0.43533 0.17335  109 ASN C ND2 
3619 N N   . VAL C 110 ? 0.67060 0.73797 0.87434 0.02231  -0.37088 0.17631  110 VAL C N   
3620 C CA  . VAL C 110 ? 0.66322 0.72984 0.86515 0.02371  -0.35718 0.18349  110 VAL C CA  
3621 C C   . VAL C 110 ? 0.63916 0.70689 0.89306 0.02625  -0.34879 0.18336  110 VAL C C   
3622 O O   . VAL C 110 ? 0.68572 0.75052 0.95363 0.02701  -0.34433 0.19253  110 VAL C O   
3623 C CB  . VAL C 110 ? 0.64773 0.71569 0.81360 0.02343  -0.34498 0.17957  110 VAL C CB  
3624 C CG1 . VAL C 110 ? 0.60774 0.67460 0.77794 0.02452  -0.32999 0.18647  110 VAL C CG1 
3625 C CG2 . VAL C 110 ? 0.65671 0.72161 0.76990 0.02099  -0.35035 0.18136  110 VAL C CG2 
3626 N N   . ASN C 111 ? 0.68765 0.75866 0.97075 0.02752  -0.34553 0.17262  111 ASN C N   
3627 C CA  . ASN C 111 ? 0.62300 0.69335 0.95760 0.02995  -0.33632 0.17133  111 ASN C CA  
3628 C C   . ASN C 111 ? 0.63941 0.70713 1.00725 0.03006  -0.34470 0.17895  111 ASN C C   
3629 O O   . ASN C 111 ? 0.53252 0.59674 0.92811 0.03153  -0.33627 0.18498  111 ASN C O   
3630 C CB  . ASN C 111 ? 0.58157 0.65401 0.93746 0.03031  -0.32911 0.15573  111 ASN C CB  
3631 C CG  . ASN C 111 ? 0.59802 0.66540 0.99430 0.03154  -0.30866 0.15005  111 ASN C CG  
3632 O OD1 . ASN C 111 ? 0.52721 0.58840 0.91693 0.03114  -0.29163 0.15256  111 ASN C OD1 
3633 N ND2 . ASN C 111 ? 0.48513 0.55378 0.92214 0.03260  -0.30968 0.14213  111 ASN C ND2 
3634 N N   . GLN C 112 ? 0.66318 0.73162 1.03011 0.02826  -0.36113 0.17863  112 GLN C N   
3635 C CA  . GLN C 112 ? 0.67443 0.74025 1.07510 0.02783  -0.37055 0.18587  112 GLN C CA  
3636 C C   . GLN C 112 ? 0.76131 0.82313 1.14902 0.02741  -0.37089 0.19914  112 GLN C C   
3637 O O   . GLN C 112 ? 0.78531 0.84445 1.20878 0.02831  -0.36838 0.20557  112 GLN C O   
3638 C CB  . GLN C 112 ? 0.61501 0.68096 1.00894 0.02512  -0.38971 0.18413  112 GLN C CB  
3639 C CG  . GLN C 112 ? 0.67728 0.73927 1.08943 0.02338  -0.40368 0.19455  112 GLN C CG  
3640 C CD  . GLN C 112 ? 0.77304 0.83282 1.16403 0.01973  -0.42403 0.19475  112 GLN C CD  
3641 O OE1 . GLN C 112 ? 0.82134 0.88290 1.19504 0.01873  -0.42748 0.18555  112 GLN C OE1 
3642 N NE2 . GLN C 112 ? 0.82985 0.88479 1.22199 0.01741  -0.43776 0.20533  112 GLN C NE2 
3643 N N   . SER C 113 ? 0.62741 0.68833 0.96428 0.02598  -0.37268 0.20307  113 SER C N   
3644 C CA  . SER C 113 ? 0.61023 0.66724 0.93195 0.02548  -0.37186 0.21507  113 SER C CA  
3645 C C   . SER C 113 ? 0.72698 0.78281 1.06481 0.02772  -0.35363 0.21769  113 SER C C   
3646 O O   . SER C 113 ? 0.69853 0.75084 1.05264 0.02803  -0.35160 0.22675  113 SER C O   
3647 C CB  . SER C 113 ? 0.63095 0.68638 0.89433 0.02330  -0.37670 0.21763  113 SER C CB  
3648 O OG  . SER C 113 ? 0.63457 0.68691 0.87779 0.02326  -0.36982 0.22704  113 SER C OG  
3649 N N   . LEU C 114 ? 0.64583 0.70362 0.98120 0.02903  -0.34051 0.20980  114 LEU C N   
3650 C CA  . LEU C 114 ? 0.58112 0.63566 0.93420 0.03078  -0.32309 0.21162  114 LEU C CA  
3651 C C   . LEU C 114 ? 0.53168 0.58309 0.94159 0.03267  -0.31861 0.21171  114 LEU C C   
3652 O O   . LEU C 114 ? 0.52429 0.56999 0.95098 0.03357  -0.30783 0.21795  114 LEU C O   
3653 C CB  . LEU C 114 ? 0.52208 0.57839 0.86182 0.03130  -0.31165 0.20233  114 LEU C CB  
3654 C CG  . LEU C 114 ? 0.58894 0.64605 0.87327 0.02912  -0.30819 0.20328  114 LEU C CG  
3655 C CD1 . LEU C 114 ? 0.61779 0.67501 0.88430 0.02769  -0.29153 0.18831  114 LEU C CD1 
3656 C CD2 . LEU C 114 ? 0.55977 0.61204 0.83115 0.02857  -0.29978 0.21444  114 LEU C CD2 
3657 N N   . LEU C 115 ? 0.62354 0.67768 1.06372 0.03307  -0.32572 0.20470  115 LEU C N   
3658 C CA  . LEU C 115 ? 0.52394 0.57468 1.02006 0.03466  -0.31997 0.20405  115 LEU C CA  
3659 C C   . LEU C 115 ? 0.54189 0.58999 1.05281 0.03364  -0.32873 0.21556  115 LEU C C   
3660 O O   . LEU C 115 ? 0.53540 0.57830 1.08312 0.03479  -0.31917 0.21940  115 LEU C O   
3661 C CB  . LEU C 115 ? 0.52018 0.57460 1.04411 0.03493  -0.32445 0.19296  115 LEU C CB  
3662 C CG  . LEU C 115 ? 0.58773 0.64380 1.10884 0.03632  -0.31263 0.18040  115 LEU C CG  
3663 C CD1 . LEU C 115 ? 0.61294 0.67492 1.13420 0.03531  -0.32354 0.17050  115 LEU C CD1 
3664 C CD2 . LEU C 115 ? 0.54374 0.59279 1.10767 0.03867  -0.29232 0.17590  115 LEU C CD2 
3665 N N   . GLU C 116 ? 0.56856 0.61904 1.05054 0.03130  -0.34636 0.22100  116 GLU C N   
3666 C CA  . GLU C 116 ? 0.58489 0.63235 1.07371 0.03000  -0.35530 0.23282  116 GLU C CA  
3667 C C   . GLU C 116 ? 0.66891 0.71230 1.14218 0.03054  -0.34387 0.24116  116 GLU C C   
3668 O O   . GLU C 116 ? 0.63572 0.67518 1.13547 0.03075  -0.34133 0.24886  116 GLU C O   
3669 C CB  . GLU C 116 ? 0.61348 0.66223 1.06806 0.02710  -0.37560 0.23647  116 GLU C CB  
3670 C CG  . GLU C 116 ? 0.70610 0.75692 1.17771 0.02570  -0.38990 0.23080  116 GLU C CG  
3671 C CD  . GLU C 116 ? 0.85838 0.90732 1.29682 0.02228  -0.41020 0.23623  116 GLU C CD  
3672 O OE1 . GLU C 116 ? 0.91155 0.95722 1.32427 0.02121  -0.41315 0.24562  116 GLU C OE1 
3673 O OE2 . GLU C 116 ? 0.87173 0.92144 1.30946 0.02045  -0.42285 0.23108  116 GLU C OE2 
3674 N N   . LEU C 117 ? 0.57451 0.61846 1.00485 0.03045  -0.33674 0.23993  117 LEU C N   
3675 C CA  . LEU C 117 ? 0.68498 0.72448 1.09953 0.03053  -0.32517 0.24765  117 LEU C CA  
3676 C C   . LEU C 117 ? 0.62666 0.66041 1.08089 0.03253  -0.30777 0.24680  117 LEU C C   
3677 O O   . LEU C 117 ? 0.54995 0.57814 1.01398 0.03250  -0.30112 0.25494  117 LEU C O   
3678 C CB  . LEU C 117 ? 0.61455 0.65552 0.97818 0.02965  -0.31979 0.24578  117 LEU C CB  
3679 C CG  . LEU C 117 ? 0.64551 0.68344 0.97519 0.02819  -0.31676 0.25561  117 LEU C CG  
3680 C CD1 . LEU C 117 ? 0.72320 0.76372 1.00132 0.02683  -0.31518 0.25290  117 LEU C CD1 
3681 C CD2 . LEU C 117 ? 0.66388 0.69547 1.01131 0.02888  -0.30048 0.26033  117 LEU C CD2 
3682 N N   . HIS C 118 ? 0.53116 0.56489 1.00837 0.03419  -0.29950 0.23663  118 HIS C N   
3683 C CA  . HIS C 118 ? 0.56023 0.58553 1.07692 0.03608  -0.28157 0.23475  118 HIS C CA  
3684 C C   . HIS C 118 ? 0.55745 0.57996 1.12020 0.03635  -0.28350 0.23931  118 HIS C C   
3685 O O   . HIS C 118 ? 0.58275 0.59688 1.16366 0.03671  -0.27131 0.24468  118 HIS C O   
3686 C CB  . HIS C 118 ? 0.49593 0.52075 1.02928 0.03779  -0.27238 0.22186  118 HIS C CB  
3687 C CG  . HIS C 118 ? 0.49839 0.50957 1.05306 0.03760  -0.24688 0.21636  118 HIS C CG  
3688 N ND1 . HIS C 118 ? 0.47850 0.48285 1.08615 0.03962  -0.23918 0.21585  118 HIS C ND1 
3689 C CD2 . HIS C 118 ? 0.47381 0.47467 1.00002 0.03425  -0.22551 0.21018  118 HIS C CD2 
3690 C CE1 . HIS C 118 ? 0.47009 0.45919 1.07854 0.03735  -0.21338 0.20904  118 HIS C CE1 
3691 N NE2 . HIS C 118 ? 0.46727 0.45384 1.02632 0.03385  -0.20555 0.20566  118 HIS C NE2 
3692 N N   . LYS C 119 ? 0.53244 0.56093 1.11513 0.03579  -0.29824 0.23726  119 LYS C N   
3693 C CA  . LYS C 119 ? 0.54740 0.57319 1.17698 0.03560  -0.29967 0.24186  119 LYS C CA  
3694 C C   . LYS C 119 ? 0.61186 0.63580 1.22993 0.03427  -0.30560 0.25497  119 LYS C C   
3695 O O   . LYS C 119 ? 0.55531 0.57389 1.20760 0.03449  -0.29792 0.25998  119 LYS C O   
3696 C CB  . LYS C 119 ? 0.55080 0.58237 1.20312 0.03451  -0.31564 0.23820  119 LYS C CB  
3697 C CG  . LYS C 119 ? 0.55917 0.58807 1.26316 0.03378  -0.31739 0.24327  119 LYS C CG  
3698 N N   . LEU C 120 ? 0.56876 0.59630 1.13851 0.03276  -0.31750 0.26021  120 LEU C N   
3699 C CA  . LEU C 120 ? 0.58258 0.60756 1.13782 0.03153  -0.32094 0.27201  120 LEU C CA  
3700 C C   . LEU C 120 ? 0.66962 0.68715 1.22481 0.03249  -0.30090 0.27496  120 LEU C C   
3701 O O   . LEU C 120 ? 0.57254 0.58537 1.14776 0.03229  -0.29669 0.28253  120 LEU C O   
3702 C CB  . LEU C 120 ? 0.60040 0.62921 1.10100 0.02960  -0.33477 0.27554  120 LEU C CB  
3703 C CG  . LEU C 120 ? 0.72991 0.75541 1.20777 0.02844  -0.33478 0.28663  120 LEU C CG  
3704 C CD1 . LEU C 120 ? 0.63130 0.65564 1.13676 0.02729  -0.34730 0.29520  120 LEU C CD1 
3705 C CD2 . LEU C 120 ? 0.62458 0.65214 1.04370 0.02692  -0.34051 0.28768  120 LEU C CD2 
3706 N N   . ALA C 121 ? 0.62448 0.63990 1.15713 0.03321  -0.28836 0.26912  121 ALA C N   
3707 C CA  . ALA C 121 ? 0.54051 0.54624 1.07047 0.03342  -0.26912 0.27170  121 ALA C CA  
3708 C C   . ALA C 121 ? 0.53794 0.53466 1.11969 0.03468  -0.25467 0.27010  121 ALA C C   
3709 O O   . ALA C 121 ? 0.54456 0.53276 1.13339 0.03411  -0.24370 0.27617  121 ALA C O   
3710 C CB  . ALA C 121 ? 0.57709 0.58084 1.07781 0.03352  -0.25896 0.26490  121 ALA C CB  
3711 N N   . THR C 122 ? 0.53540 0.53328 1.15296 0.03604  -0.25331 0.26131  122 THR C N   
3712 C CA  . THR C 122 ? 0.51869 0.50719 1.18609 0.03686  -0.23666 0.25760  122 THR C CA  
3713 C C   . THR C 122 ? 0.59570 0.58608 1.29650 0.03612  -0.24352 0.26575  122 THR C C   
3714 O O   . THR C 122 ? 0.53118 0.51231 1.25770 0.03592  -0.22813 0.26799  122 THR C O   
3715 C CB  . THR C 122 ? 0.51253 0.50233 1.20730 0.03810  -0.23287 0.24506  122 THR C CB  
3716 O OG1 . THR C 122 ? 0.67556 0.67724 1.38580 0.03762  -0.25341 0.24555  122 THR C OG1 
3717 C CG2 . THR C 122 ? 0.49635 0.48579 1.15715 0.03884  -0.22900 0.23724  122 THR C CG2 
3718 N N   . ASP C 123 ? 0.56771 0.56870 1.26889 0.03525  -0.26598 0.26982  123 ASP C N   
3719 C CA  . ASP C 123 ? 0.56141 0.56330 1.29448 0.03415  -0.27349 0.27823  123 ASP C CA  
3720 C C   . ASP C 123 ? 0.63648 0.63566 1.34535 0.03328  -0.27445 0.28962  123 ASP C C   
3721 O O   . ASP C 123 ? 0.58398 0.58151 1.32163 0.03261  -0.27519 0.29671  123 ASP C O   
3722 C CB  . ASP C 123 ? 0.64583 0.65676 1.38627 0.03273  -0.29736 0.27960  123 ASP C CB  
3723 C CG  . ASP C 123 ? 0.80264 0.81669 1.56436 0.03324  -0.29772 0.26812  123 ASP C CG  
3724 O OD1 . ASP C 123 ? 0.79368 0.80306 1.56694 0.03488  -0.27870 0.25863  123 ASP C OD1 
3725 O OD2 . ASP C 123 ? 0.78404 0.80396 1.55202 0.03169  -0.31678 0.26860  123 ASP C OD2 
3726 N N   . LYS C 124 ? 0.56891 0.56761 1.22693 0.03305  -0.27375 0.29141  124 LYS C N   
3727 C CA  . LYS C 124 ? 0.57453 0.56877 1.20917 0.03210  -0.26949 0.30070  124 LYS C CA  
3728 C C   . LYS C 124 ? 0.60102 0.58319 1.23738 0.03250  -0.24483 0.29820  124 LYS C C   
3729 O O   . LYS C 124 ? 0.65358 0.63087 1.26669 0.03134  -0.23926 0.30487  124 LYS C O   
3730 C CB  . LYS C 124 ? 0.58381 0.58338 1.16061 0.03077  -0.28152 0.30440  124 LYS C CB  
3731 C CG  . LYS C 124 ? 0.61223 0.62033 1.17635 0.02956  -0.30537 0.30728  124 LYS C CG  
3732 C CD  . LYS C 124 ? 0.62162 0.62953 1.21254 0.02856  -0.31579 0.31659  124 LYS C CD  
3733 C CE  . LYS C 124 ? 0.69330 0.70650 1.26199 0.02659  -0.33949 0.32045  124 LYS C CE  
3734 N NZ  . LYS C 124 ? 0.75954 0.77304 1.36790 0.02538  -0.35278 0.32679  124 LYS C NZ  
3735 N N   . ASN C 125 ? 0.54531 0.52112 1.20654 0.03361  -0.22948 0.28828  125 ASN C N   
3736 C CA  . ASN C 125 ? 0.53435 0.49462 1.19680 0.03311  -0.20406 0.28391  125 ASN C CA  
3737 C C   . ASN C 125 ? 0.65058 0.60617 1.26024 0.03137  -0.20001 0.28694  125 ASN C C   
3738 O O   . ASN C 125 ? 0.53458 0.48070 1.13162 0.02950  -0.18885 0.29176  125 ASN C O   
3739 C CB  . ASN C 125 ? 0.56378 0.51602 1.26165 0.03261  -0.19141 0.28736  125 ASN C CB  
3740 C CG  . ASN C 125 ? 0.71360 0.66657 1.46687 0.03359  -0.18593 0.28065  125 ASN C CG  
3741 O OD1 . ASN C 125 ? 0.84230 0.80360 1.60872 0.03456  -0.19613 0.27526  125 ASN C OD1 
3742 N ND2 . ASN C 125 ? 0.69375 0.63850 1.47900 0.03299  -0.16938 0.28060  125 ASN C ND2 
3743 N N   . ASP C 126 ? 0.70345 0.66605 1.28222 0.03161  -0.20884 0.28348  126 ASP C N   
3744 C CA  . ASP C 126 ? 0.52392 0.48315 1.05409 0.02951  -0.20438 0.28495  126 ASP C CA  
3745 C C   . ASP C 126 ? 0.51794 0.46992 1.04416 0.02954  -0.19288 0.27421  126 ASP C C   
3746 O O   . ASP C 126 ? 0.50583 0.46789 1.01636 0.03066  -0.20349 0.26991  126 ASP C O   
3747 C CB  . ASP C 126 ? 0.53394 0.50782 1.02608 0.02905  -0.22419 0.29052  126 ASP C CB  
3748 C CG  . ASP C 126 ? 0.58637 0.55805 1.02955 0.02638  -0.21876 0.29275  126 ASP C CG  
3749 O OD1 . ASP C 126 ? 0.59488 0.55373 1.03168 0.02450  -0.20131 0.29000  126 ASP C OD1 
3750 O OD2 . ASP C 126 ? 0.66579 0.64752 1.07568 0.02556  -0.23137 0.29657  126 ASP C OD2 
3751 N N   . PRO C 127 ? 0.50389 0.43722 1.04303 0.02769  -0.17039 0.26851  127 PRO C N   
3752 C CA  . PRO C 127 ? 0.49314 0.41776 1.02768 0.02612  -0.15711 0.25520  127 PRO C CA  
3753 C C   . PRO C 127 ? 0.57962 0.50688 1.06070 0.02191  -0.15542 0.25141  127 PRO C C   
3754 O O   . PRO C 127 ? 0.48153 0.41110 0.95025 0.02038  -0.15139 0.23896  127 PRO C O   
3755 C CB  . PRO C 127 ? 0.49357 0.39497 1.04891 0.02324  -0.13173 0.24981  127 PRO C CB  
3756 C CG  . PRO C 127 ? 0.50316 0.40208 1.05090 0.02152  -0.12979 0.25971  127 PRO C CG  
3757 C CD  . PRO C 127 ? 0.50940 0.42884 1.06238 0.02538  -0.15422 0.27095  127 PRO C CD  
3758 N N   . HIS C 128 ? 0.51981 0.44738 0.97001 0.02011  -0.15884 0.26217  128 HIS C N   
3759 C CA  . HIS C 128 ? 0.56582 0.49824 0.96827 0.01661  -0.15902 0.25968  128 HIS C CA  
3760 C C   . HIS C 128 ? 0.49110 0.44366 0.88083 0.01948  -0.17742 0.25767  128 HIS C C   
3761 O O   . HIS C 128 ? 0.48410 0.43998 0.85164 0.01751  -0.17387 0.24740  128 HIS C O   
3762 C CB  . HIS C 128 ? 0.53865 0.46839 0.91300 0.01432  -0.15979 0.27244  128 HIS C CB  
3763 C CG  . HIS C 128 ? 0.57906 0.51597 0.90823 0.01135  -0.16166 0.27142  128 HIS C CG  
3764 N ND1 . HIS C 128 ? 0.59649 0.55109 0.90526 0.01383  -0.17908 0.27673  128 HIS C ND1 
3765 C CD2 . HIS C 128 ? 0.53291 0.46091 0.83452 0.00593  -0.14810 0.26544  128 HIS C CD2 
3766 C CE1 . HIS C 128 ? 0.55636 0.51327 0.82861 0.01050  -0.17494 0.27409  128 HIS C CE1 
3767 N NE2 . HIS C 128 ? 0.59413 0.53580 0.86246 0.00574  -0.15702 0.26756  128 HIS C NE2 
3768 N N   . LEU C 129 ? 0.49989 0.46478 0.90279 0.02379  -0.19746 0.26744  129 LEU C N   
3769 C CA  . LEU C 129 ? 0.50304 0.48450 0.89153 0.02585  -0.21569 0.26589  129 LEU C CA  
3770 C C   . LEU C 129 ? 0.56176 0.54603 0.97190 0.02699  -0.21426 0.25175  129 LEU C C   
3771 O O   . LEU C 129 ? 0.53363 0.52572 0.92024 0.02622  -0.21753 0.24353  129 LEU C O   
3772 C CB  . LEU C 129 ? 0.51886 0.51027 0.91200 0.02765  -0.23447 0.27536  129 LEU C CB  
3773 C CG  . LEU C 129 ? 0.52865 0.53398 0.90051 0.02808  -0.25231 0.27260  129 LEU C CG  
3774 C CD1 . LEU C 129 ? 0.56447 0.57383 0.88893 0.02622  -0.25057 0.26998  129 LEU C CD1 
3775 C CD2 . LEU C 129 ? 0.54893 0.55891 0.91578 0.02759  -0.26584 0.28044  129 LEU C CD2 
3776 N N   . ALA C 130 ? 0.58331 0.56082 1.03901 0.02881  -0.20853 0.24871  130 ALA C N   
3777 C CA  . ALA C 130 ? 0.59289 0.57196 1.07277 0.02978  -0.20553 0.23516  130 ALA C CA  
3778 C C   . ALA C 130 ? 0.54756 0.51979 1.00134 0.02573  -0.18778 0.22100  130 ALA C C   
3779 O O   . ALA C 130 ? 0.52282 0.50302 0.96754 0.02581  -0.19178 0.21115  130 ALA C O   
3780 C CB  . ALA C 130 ? 0.48203 0.45188 1.01575 0.03190  -0.19756 0.23455  130 ALA C CB  
3781 N N   . ASP C 131 ? 0.56530 0.52182 1.00586 0.02177  -0.16871 0.22021  131 ASP C N   
3782 C CA  . ASP C 131 ? 0.55466 0.50175 0.97267 0.01721  -0.15176 0.20744  131 ASP C CA  
3783 C C   . ASP C 131 ? 0.64123 0.59877 1.01324 0.01544  -0.15828 0.20714  131 ASP C C   
3784 O O   . ASP C 131 ? 0.58991 0.54738 0.94643 0.01330  -0.15194 0.19542  131 ASP C O   
3785 C CB  . ASP C 131 ? 0.59073 0.51558 1.00737 0.01268  -0.13090 0.20770  131 ASP C CB  
3786 C CG  . ASP C 131 ? 0.61316 0.52545 1.00347 0.00686  -0.11418 0.19565  131 ASP C CG  
3787 O OD1 . ASP C 131 ? 0.56435 0.47340 0.96611 0.00639  -0.10708 0.18244  131 ASP C OD1 
3788 O OD2 . ASP C 131 ? 0.75647 0.66160 1.11479 0.00248  -0.10860 0.19998  131 ASP C OD2 
3789 N N   . PHE C 132 ? 0.54785 0.51398 0.89852 0.01634  -0.17042 0.21985  132 PHE C N   
3790 C CA  . PHE C 132 ? 0.53643 0.51373 0.84670 0.01539  -0.17755 0.22010  132 PHE C CA  
3791 C C   . PHE C 132 ? 0.52177 0.51292 0.83347 0.01822  -0.19031 0.21259  132 PHE C C   
3792 O O   . PHE C 132 ? 0.53524 0.52995 0.82423 0.01660  -0.18681 0.20326  132 PHE C O   
3793 C CB  . PHE C 132 ? 0.55444 0.53754 0.84517 0.01614  -0.18846 0.23576  132 PHE C CB  
3794 C CG  . PHE C 132 ? 0.55709 0.55173 0.80886 0.01571  -0.19639 0.23713  132 PHE C CG  
3795 C CD1 . PHE C 132 ? 0.68140 0.67246 0.90197 0.01176  -0.18532 0.23618  132 PHE C CD1 
3796 C CD2 . PHE C 132 ? 0.63690 0.64469 0.88328 0.01887  -0.21463 0.23935  132 PHE C CD2 
3797 C CE1 . PHE C 132 ? 0.69081 0.69211 0.87758 0.01153  -0.19093 0.23741  132 PHE C CE1 
3798 C CE2 . PHE C 132 ? 0.68713 0.70346 0.89634 0.01825  -0.22011 0.24008  132 PHE C CE2 
3799 C CZ  . PHE C 132 ? 0.68926 0.70280 0.86973 0.01487  -0.20757 0.23907  132 PHE C CZ  
3800 N N   . ILE C 133 ? 0.51441 0.51309 0.85257 0.02223  -0.20603 0.21712  133 ILE C N   
3801 C CA  . ILE C 133 ? 0.54148 0.55178 0.88354 0.02448  -0.21947 0.21032  133 ILE C CA  
3802 C C   . ILE C 133 ? 0.55530 0.56111 0.91009 0.02331  -0.20636 0.19392  133 ILE C C   
3803 O O   . ILE C 133 ? 0.52433 0.53628 0.85870 0.02261  -0.20761 0.18490  133 ILE C O   
3804 C CB  . ILE C 133 ? 0.62697 0.64325 1.00250 0.02829  -0.23803 0.21812  133 ILE C CB  
3805 C CG1 . ILE C 133 ? 0.67470 0.69484 1.03488 0.02917  -0.25279 0.23480  133 ILE C CG1 
3806 C CG2 . ILE C 133 ? 0.48793 0.51438 0.86925 0.02987  -0.25183 0.21037  133 ILE C CG2 
3807 C CD1 . ILE C 133 ? 0.66919 0.69868 0.98607 0.02850  -0.26611 0.23759  133 ILE C CD1 
3808 N N   . GLU C 134 ? 0.56380 0.55740 0.95090 0.02280  -0.19227 0.18964  134 GLU C N   
3809 C CA  . GLU C 134 ? 0.52314 0.50976 0.92300 0.02126  -0.17812 0.17410  134 GLU C CA  
3810 C C   . GLU C 134 ? 0.59808 0.58175 0.95837 0.01724  -0.16731 0.16610  134 GLU C C   
3811 O O   . GLU C 134 ? 0.63263 0.62485 0.97944 0.01748  -0.17179 0.15745  134 GLU C O   
3812 C CB  . GLU C 134 ? 0.51193 0.48094 0.94465 0.02007  -0.16022 0.17168  134 GLU C CB  
3813 C CG  . GLU C 134 ? 0.62578 0.59682 1.10678 0.02424  -0.16801 0.17692  134 GLU C CG  
3814 C CD  . GLU C 134 ? 0.69932 0.65158 1.20728 0.02301  -0.14988 0.17856  134 GLU C CD  
3815 O OE1 . GLU C 134 ? 0.76222 0.71518 1.30797 0.02640  -0.15571 0.18652  134 GLU C OE1 
3816 O OE2 . GLU C 134 ? 0.75994 0.69558 1.25089 0.01835  -0.12987 0.17208  134 GLU C OE2 
3817 N N   . THR C 135 ? 0.51872 0.49109 0.85957 0.01358  -0.15523 0.17068  135 THR C N   
3818 C CA  . THR C 135 ? 0.49883 0.46374 0.80806 0.00874  -0.14210 0.16382  135 THR C CA  
3819 C C   . THR C 135 ? 0.52829 0.50781 0.80274 0.00911  -0.15176 0.16357  135 THR C C   
3820 O O   . THR C 135 ? 0.60700 0.58490 0.86342 0.00648  -0.14422 0.15381  135 THR C O   
3821 C CB  . THR C 135 ? 0.65543 0.60583 0.95231 0.00469  -0.13096 0.17187  135 THR C CB  
3822 O OG1 . THR C 135 ? 0.77262 0.70717 1.10105 0.00410  -0.12021 0.17156  135 THR C OG1 
3823 C CG2 . THR C 135 ? 0.56438 0.50546 0.83022 -0.00108 -0.11845 0.16582  135 THR C CG2 
3824 N N   . HIS C 136 ? 0.51262 0.50518 0.77631 0.01208  -0.16778 0.17422  136 HIS C N   
3825 C CA  . HIS C 136 ? 0.44405 0.44753 0.67175 0.01186  -0.17398 0.17468  136 HIS C CA  
3826 C C   . HIS C 136 ? 0.52288 0.54017 0.75017 0.01535  -0.18979 0.17126  136 HIS C C   
3827 O O   . HIS C 136 ? 0.57262 0.59733 0.77135 0.01500  -0.19246 0.16809  136 HIS C O   
3828 C CB  . HIS C 136 ? 0.48384 0.48926 0.68860 0.01126  -0.17781 0.18919  136 HIS C CB  
3829 C CG  . HIS C 136 ? 0.61213 0.60412 0.80953 0.00683  -0.16259 0.19223  136 HIS C CG  
3830 N ND1 . HIS C 136 ? 0.47292 0.45653 0.68176 0.00625  -0.16050 0.20270  136 HIS C ND1 
3831 C CD2 . HIS C 136 ? 0.50760 0.49174 0.68793 0.00231  -0.14920 0.18609  136 HIS C CD2 
3832 C CE1 . HIS C 136 ? 0.56270 0.53339 0.76026 0.00132  -0.14648 0.20274  136 HIS C CE1 
3833 N NE2 . HIS C 136 ? 0.60408 0.57470 0.78451 -0.00129 -0.13993 0.19296  136 HIS C NE2 
3834 N N   . TYR C 137 ? 0.45312 0.47323 0.71157 0.01840  -0.20008 0.17153  137 TYR C N   
3835 C CA  . TYR C 137 ? 0.57932 0.61137 0.83462 0.02099  -0.21745 0.16987  137 TYR C CA  
3836 C C   . TYR C 137 ? 0.62476 0.65734 0.91244 0.02236  -0.21845 0.15833  137 TYR C C   
3837 O O   . TYR C 137 ? 0.75367 0.79362 1.03138 0.02289  -0.22560 0.15061  137 TYR C O   
3838 C CB  . TYR C 137 ? 0.69857 0.73582 0.95578 0.02324  -0.23570 0.18452  137 TYR C CB  
3839 C CG  . TYR C 137 ? 0.64905 0.68827 0.86682 0.02196  -0.23710 0.19420  137 TYR C CG  
3840 C CD1 . TYR C 137 ? 0.72946 0.76160 0.94126 0.02022  -0.22612 0.20199  137 TYR C CD1 
3841 C CD2 . TYR C 137 ? 0.73700 0.78396 0.92261 0.02213  -0.24820 0.19512  137 TYR C CD2 
3842 C CE1 . TYR C 137 ? 0.70679 0.74088 0.88393 0.01894  -0.22636 0.21071  137 TYR C CE1 
3843 C CE2 . TYR C 137 ? 0.76504 0.81295 0.91498 0.02088  -0.24741 0.20358  137 TYR C CE2 
3844 C CZ  . TYR C 137 ? 0.75626 0.79841 0.90336 0.01942  -0.23654 0.21148  137 TYR C CZ  
3845 O OH  . TYR C 137 ? 0.82235 0.86563 0.93625 0.01814  -0.23525 0.22020  137 TYR C OH  
3846 N N   . LEU C 138 ? 0.50934 0.53371 0.83576 0.02284  -0.21089 0.15687  138 LEU C N   
3847 C CA  . LEU C 138 ? 0.55615 0.58295 0.91887 0.02489  -0.21592 0.14894  138 LEU C CA  
3848 C C   . LEU C 138 ? 0.59623 0.62151 0.95295 0.02322  -0.20506 0.13269  138 LEU C C   
3849 O O   . LEU C 138 ? 0.43633 0.47015 0.79572 0.02449  -0.21551 0.12599  138 LEU C O   
3850 C CB  . LEU C 138 ? 0.44311 0.46078 0.85108 0.02599  -0.20903 0.15179  138 LEU C CB  
3851 C CG  . LEU C 138 ? 0.46114 0.48300 0.88788 0.02876  -0.22503 0.16702  138 LEU C CG  
3852 C CD1 . LEU C 138 ? 0.45699 0.47201 0.93756 0.03073  -0.22046 0.16832  138 LEU C CD1 
3853 C CD2 . LEU C 138 ? 0.46751 0.50340 0.88410 0.03063  -0.25021 0.17140  138 LEU C CD2 
3854 N N   . ASN C 139 ? 0.61042 0.62393 0.95771 0.01993  -0.18468 0.12630  139 ASN C N   
3855 C CA  . ASN C 139 ? 0.64918 0.66042 0.99063 0.01813  -0.17488 0.11108  139 ASN C CA  
3856 C C   . ASN C 139 ? 0.52910 0.55054 0.83107 0.01769  -0.18156 0.10845  139 ASN C C   
3857 O O   . ASN C 139 ? 0.57967 0.60501 0.87954 0.01774  -0.18194 0.09710  139 ASN C O   
3858 C CB  . ASN C 139 ? 0.59120 0.58489 0.93157 0.01394  -0.15215 0.10466  139 ASN C CB  
3859 C CG  . ASN C 139 ? 0.69001 0.67957 1.03153 0.01213  -0.14225 0.08864  139 ASN C CG  
3860 O OD1 . ASN C 139 ? 0.68960 0.67412 1.00299 0.00866  -0.13264 0.08293  139 ASN C OD1 
3861 N ND2 . ASN C 139 ? 0.53995 0.53224 0.91482 0.01449  -0.14565 0.08163  139 ASN C ND2 
3862 N N   . GLU C 140 ? 0.48991 0.51551 0.76135 0.01736  -0.18658 0.11878  140 GLU C N   
3863 C CA  . GLU C 140 ? 0.54845 0.58344 0.78397 0.01727  -0.19275 0.11681  140 GLU C CA  
3864 C C   . GLU C 140 ? 0.60237 0.64836 0.84219 0.02011  -0.21163 0.11572  140 GLU C C   
3865 O O   . GLU C 140 ? 0.48811 0.53935 0.71129 0.01998  -0.21393 0.10696  140 GLU C O   
3866 C CB  . GLU C 140 ? 0.56629 0.60272 0.77026 0.01632  -0.19348 0.12881  140 GLU C CB  
3867 N N   . GLN C 141 ? 0.65005 0.69873 0.91248 0.02238  -0.22580 0.12464  141 GLN C N   
3868 C CA  . GLN C 141 ? 0.66642 0.72373 0.93467 0.02427  -0.24548 0.12392  141 GLN C CA  
3869 C C   . GLN C 141 ? 0.55567 0.61321 0.85104 0.02465  -0.24287 0.11011  141 GLN C C   
3870 O O   . GLN C 141 ? 0.64660 0.71035 0.93222 0.02486  -0.25282 0.10367  141 GLN C O   
3871 C CB  . GLN C 141 ? 0.57719 0.63652 0.86616 0.02620  -0.26254 0.13729  141 GLN C CB  
3872 C CG  . GLN C 141 ? 0.72116 0.78228 0.97710 0.02586  -0.27147 0.15081  141 GLN C CG  
3873 C CD  . GLN C 141 ? 0.72816 0.79497 0.94657 0.02517  -0.28450 0.15002  141 GLN C CD  
3874 O OE1 . GLN C 141 ? 0.80355 0.87031 0.98310 0.02385  -0.27903 0.15217  141 GLN C OE1 
3875 N NE2 . GLN C 141 ? 0.62045 0.69116 0.85036 0.02577  -0.30162 0.14728  141 GLN C NE2 
3876 N N   . VAL C 142 ? 0.43695 0.48654 0.76517 0.02444  -0.22879 0.10520  142 VAL C N   
3877 C CA  . VAL C 142 ? 0.50564 0.55447 0.86101 0.02468  -0.22476 0.09193  142 VAL C CA  
3878 C C   . VAL C 142 ? 0.53688 0.58557 0.86375 0.02264  -0.21468 0.07906  142 VAL C C   
3879 O O   . VAL C 142 ? 0.42067 0.47477 0.74995 0.02309  -0.22099 0.06984  142 VAL C O   
3880 C CB  . VAL C 142 ? 0.41843 0.45635 0.81486 0.02464  -0.21010 0.08992  142 VAL C CB  
3881 C CG1 . VAL C 142 ? 0.40720 0.44030 0.82138 0.02364  -0.19781 0.07423  142 VAL C CG1 
3882 C CG2 . VAL C 142 ? 0.42634 0.46745 0.86297 0.02757  -0.22425 0.10019  142 VAL C CG2 
3883 N N   . LYS C 143 ? 0.43784 0.48058 0.73676 0.02025  -0.20020 0.07888  143 LYS C N   
3884 C CA  . LYS C 143 ? 0.47294 0.51582 0.74492 0.01833  -0.19153 0.06780  143 LYS C CA  
3885 C C   . LYS C 143 ? 0.48235 0.53660 0.72537 0.01946  -0.20617 0.06819  143 LYS C C   
3886 O O   . LYS C 143 ? 0.45278 0.51026 0.68880 0.01925  -0.20640 0.05708  143 LYS C O   
3887 C CB  . LYS C 143 ? 0.48757 0.52171 0.73635 0.01520  -0.17514 0.06951  143 LYS C CB  
3888 C CG  . LYS C 143 ? 0.49379 0.51258 0.76525 0.01275  -0.15817 0.06650  143 LYS C CG  
3889 C CD  . LYS C 143 ? 0.50364 0.51261 0.75024 0.00888  -0.14471 0.07009  143 LYS C CD  
3890 N N   . ALA C 144 ? 0.43329 0.49239 0.65827 0.02040  -0.21815 0.08081  144 ALA C N   
3891 C CA  . ALA C 144 ? 0.44805 0.51502 0.64254 0.02092  -0.23160 0.08182  144 ALA C CA  
3892 C C   . ALA C 144 ? 0.49147 0.56336 0.70313 0.02211  -0.24719 0.07625  144 ALA C C   
3893 O O   . ALA C 144 ? 0.59045 0.66583 0.78279 0.02167  -0.25084 0.06811  144 ALA C O   
3894 C CB  . ALA C 144 ? 0.46386 0.53261 0.63810 0.02132  -0.24142 0.09708  144 ALA C CB  
3895 N N   . ILE C 145 ? 0.45696 0.52886 0.70587 0.02350  -0.25672 0.08083  145 ILE C N   
3896 C CA  . ILE C 145 ? 0.46471 0.54130 0.73425 0.02435  -0.27356 0.07705  145 ILE C CA  
3897 C C   . ILE C 145 ? 0.45075 0.52680 0.73502 0.02393  -0.26376 0.06092  145 ILE C C   
3898 O O   . ILE C 145 ? 0.45763 0.53798 0.73596 0.02365  -0.27419 0.05402  145 ILE C O   
3899 C CB  . ILE C 145 ? 0.48401 0.56061 0.79480 0.02598  -0.28499 0.08673  145 ILE C CB  
3900 C CG1 . ILE C 145 ? 0.54897 0.62689 0.84047 0.02613  -0.30018 0.10260  145 ILE C CG1 
3901 C CG2 . ILE C 145 ? 0.47170 0.55228 0.81516 0.02666  -0.29905 0.08144  145 ILE C CG2 
3902 C CD1 . ILE C 145 ? 0.48849 0.56489 0.81855 0.02777  -0.30622 0.11385  145 ILE C CD1 
3903 N N   . LYS C 146 ? 0.43260 0.50195 0.73330 0.02339  -0.24334 0.05459  146 LYS C N   
3904 C CA  . LYS C 146 ? 0.51493 0.58205 0.82715 0.02259  -0.23237 0.03915  146 LYS C CA  
3905 C C   . LYS C 146 ? 0.42090 0.49073 0.69292 0.02130  -0.22936 0.03105  146 LYS C C   
3906 O O   . LYS C 146 ? 0.48784 0.56072 0.76181 0.02118  -0.23300 0.02052  146 LYS C O   
3907 C CB  . LYS C 146 ? 0.40394 0.46003 0.73555 0.02137  -0.21035 0.03474  146 LYS C CB  
3908 C CG  . LYS C 146 ? 0.39159 0.44288 0.72842 0.01979  -0.19639 0.01847  146 LYS C CG  
3909 C CD  . LYS C 146 ? 0.44201 0.49725 0.81530 0.02120  -0.20499 0.01120  146 LYS C CD  
3910 C CE  . LYS C 146 ? 0.48794 0.53623 0.87271 0.01954  -0.18898 -0.00453 146 LYS C CE  
3911 N NZ  . LYS C 146 ? 0.37577 0.42503 0.72196 0.01779  -0.18332 -0.01381 146 LYS C NZ  
3912 N N   . GLU C 147 ? 0.42301 0.49192 0.65942 0.02037  -0.22317 0.03628  147 GLU C N   
3913 C CA  . GLU C 147 ? 0.42368 0.49464 0.62356 0.01928  -0.21823 0.02918  147 GLU C CA  
3914 C C   . GLU C 147 ? 0.50986 0.58775 0.68894 0.01992  -0.23601 0.02954  147 GLU C C   
3915 O O   . GLU C 147 ? 0.44269 0.52241 0.60659 0.01937  -0.23508 0.01911  147 GLU C O   
3916 C CB  . GLU C 147 ? 0.49124 0.55942 0.66261 0.01814  -0.20734 0.03615  147 GLU C CB  
3917 C CG  . GLU C 147 ? 0.53364 0.60593 0.66451 0.01773  -0.20748 0.03431  147 GLU C CG  
3918 C CD  . GLU C 147 ? 0.57233 0.64196 0.68043 0.01648  -0.19542 0.04087  147 GLU C CD  
3919 O OE1 . GLU C 147 ? 0.62326 0.68635 0.74119 0.01474  -0.18094 0.03783  147 GLU C OE1 
3920 O OE2 . GLU C 147 ? 0.70250 0.77540 0.78333 0.01686  -0.20061 0.04946  147 GLU C OE2 
3921 N N   . LEU C 148 ? 0.48616 0.56648 0.66281 0.02067  -0.25245 0.04154  148 LEU C N   
3922 C CA  . LEU C 148 ? 0.51093 0.59478 0.66752 0.02038  -0.27107 0.04242  148 LEU C CA  
3923 C C   . LEU C 148 ? 0.57500 0.66103 0.75779 0.02042  -0.28090 0.03285  148 LEU C C   
3924 O O   . LEU C 148 ? 0.51560 0.60290 0.67794 0.01941  -0.28745 0.02561  148 LEU C O   
3925 C CB  . LEU C 148 ? 0.49948 0.58345 0.65056 0.02059  -0.28754 0.05783  148 LEU C CB  
3926 C CG  . LEU C 148 ? 0.52203 0.60417 0.63612 0.02011  -0.28026 0.06656  148 LEU C CG  
3927 C CD1 . LEU C 148 ? 0.54928 0.63042 0.66386 0.02037  -0.29394 0.08251  148 LEU C CD1 
3928 C CD2 . LEU C 148 ? 0.55096 0.63289 0.62147 0.01884  -0.27994 0.06147  148 LEU C CD2 
3929 N N   . GLY C 149 ? 0.50509 0.59099 0.73368 0.02146  -0.28184 0.03295  149 GLY C N   
3930 C CA  . GLY C 149 ? 0.49132 0.57940 0.74996 0.02151  -0.28932 0.02367  149 GLY C CA  
3931 C C   . GLY C 149 ? 0.57074 0.65797 0.82221 0.02076  -0.27496 0.00777  149 GLY C C   
3932 O O   . GLY C 149 ? 0.48736 0.57707 0.73780 0.02006  -0.28398 -0.00042 149 GLY C O   
3933 N N   . ASP C 150 ? 0.43653 0.51939 0.68249 0.02051  -0.25310 0.00348  150 ASP C N   
3934 C CA  . ASP C 150 ? 0.51292 0.59405 0.74657 0.01947  -0.23911 -0.01063 150 ASP C CA  
3935 C C   . ASP C 150 ? 0.49825 0.58279 0.69082 0.01879  -0.24598 -0.01379 150 ASP C C   
3936 O O   . ASP C 150 ? 0.52595 0.61190 0.71681 0.01825  -0.24818 -0.02488 150 ASP C O   
3937 C CB  . ASP C 150 ? 0.46001 0.53461 0.68563 0.01853  -0.21717 -0.01173 150 ASP C CB  
3938 C CG  . ASP C 150 ? 0.56682 0.63413 0.83087 0.01820  -0.20491 -0.01471 150 ASP C CG  
3939 O OD1 . ASP C 150 ? 0.50384 0.57216 0.80399 0.01940  -0.21325 -0.01254 150 ASP C OD1 
3940 O OD2 . ASP C 150 ? 0.63228 0.69166 0.89014 0.01641  -0.18667 -0.01897 150 ASP C OD2 
3941 N N   . HIS C 151 ? 0.46823 0.55312 0.62676 0.01868  -0.24783 -0.00440 151 HIS C N   
3942 C CA  . HIS C 151 ? 0.46666 0.55279 0.58419 0.01789  -0.25216 -0.00704 151 HIS C CA  
3943 C C   . HIS C 151 ? 0.57126 0.65911 0.68880 0.01719  -0.27295 -0.00906 151 HIS C C   
3944 O O   . HIS C 151 ? 0.62718 0.71484 0.72488 0.01621  -0.27432 -0.01841 151 HIS C O   
3945 C CB  . HIS C 151 ? 0.47985 0.56509 0.56422 0.01782  -0.25146 0.00500  151 HIS C CB  
3946 C CG  . HIS C 151 ? 0.52868 0.61201 0.60759 0.01787  -0.23171 0.00667  151 HIS C CG  
3947 N ND1 . HIS C 151 ? 0.51254 0.59364 0.60734 0.01745  -0.21571 -0.00300 151 HIS C ND1 
3948 C CD2 . HIS C 151 ? 0.46636 0.54871 0.52504 0.01782  -0.22595 0.01711  151 HIS C CD2 
3949 C CE1 . HIS C 151 ? 0.49686 0.57528 0.58135 0.01684  -0.20199 0.00177  151 HIS C CE1 
3950 N NE2 . HIS C 151 ? 0.48047 0.56032 0.54384 0.01721  -0.20767 0.01384  151 HIS C NE2 
3951 N N   . VAL C 152 ? 0.52866 0.61744 0.66823 0.01739  -0.28990 -0.00002 152 VAL C N   
3952 C CA  . VAL C 152 ? 0.54578 0.63499 0.68500 0.01596  -0.31236 -0.00021 152 VAL C CA  
3953 C C   . VAL C 152 ? 0.55459 0.64561 0.71768 0.01570  -0.31150 -0.01435 152 VAL C C   
3954 O O   . VAL C 152 ? 0.62285 0.71294 0.76626 0.01398  -0.31965 -0.02156 152 VAL C O   
3955 C CB  . VAL C 152 ? 0.54035 0.63021 0.70461 0.01618  -0.33078 0.01308  152 VAL C CB  
3956 C CG1 . VAL C 152 ? 0.54432 0.63457 0.72149 0.01434  -0.35476 0.01178  152 VAL C CG1 
3957 C CG2 . VAL C 152 ? 0.54440 0.63134 0.67621 0.01570  -0.33569 0.02680  152 VAL C CG2 
3958 N N   . THR C 153 ? 0.58039 0.67274 0.78484 0.01714  -0.30022 -0.01876 153 THR C N   
3959 C CA  . THR C 153 ? 0.47006 0.56344 0.70011 0.01696  -0.29612 -0.03244 153 THR C CA  
3960 C C   . THR C 153 ? 0.54016 0.63222 0.73781 0.01608  -0.28419 -0.04483 153 THR C C   
3961 O O   . THR C 153 ? 0.67540 0.76820 0.86958 0.01489  -0.29173 -0.05385 153 THR C O   
3962 C CB  . THR C 153 ? 0.44670 0.53873 0.72008 0.01839  -0.28101 -0.03438 153 THR C CB  
3963 O OG1 . THR C 153 ? 0.45123 0.54477 0.75907 0.01936  -0.29372 -0.02336 153 THR C OG1 
3964 C CG2 . THR C 153 ? 0.43292 0.52447 0.73137 0.01805  -0.27288 -0.04930 153 THR C CG2 
3965 N N   . ASN C 154 ? 0.47151 0.56139 0.64571 0.01648  -0.26605 -0.04508 154 ASN C N   
3966 C CA  . ASN C 154 ? 0.45334 0.54200 0.60025 0.01581  -0.25383 -0.05639 154 ASN C CA  
3967 C C   . ASN C 154 ? 0.52394 0.61254 0.63268 0.01457  -0.26629 -0.05723 154 ASN C C   
3968 O O   . ASN C 154 ? 0.49196 0.58021 0.59265 0.01366  -0.26663 -0.06861 154 ASN C O   
3969 C CB  . ASN C 154 ? 0.44068 0.52684 0.57087 0.01618  -0.23417 -0.05416 154 ASN C CB  
3970 C CG  . ASN C 154 ? 0.43568 0.51835 0.59529 0.01614  -0.21785 -0.05993 154 ASN C CG  
3971 O OD1 . ASN C 154 ? 0.51571 0.59680 0.68443 0.01551  -0.21028 -0.07240 154 ASN C OD1 
3972 N ND2 . ASN C 154 ? 0.52537 0.60531 0.69851 0.01643  -0.21181 -0.05103 154 ASN C ND2 
3973 N N   . LEU C 155 ? 0.58026 0.66775 0.66400 0.01419  -0.27641 -0.04538 155 LEU C N   
3974 C CA  . LEU C 155 ? 0.52470 0.60898 0.56928 0.01231  -0.28788 -0.04588 155 LEU C CA  
3975 C C   . LEU C 155 ? 0.65298 0.73694 0.71098 0.01051  -0.30647 -0.05160 155 LEU C C   
3976 O O   . LEU C 155 ? 0.73054 0.81138 0.76402 0.00879  -0.30936 -0.06013 155 LEU C O   
3977 C CB  . LEU C 155 ? 0.54643 0.62772 0.56511 0.01170  -0.29714 -0.03131 155 LEU C CB  
3978 C CG  . LEU C 155 ? 0.54891 0.62975 0.54415 0.01294  -0.27834 -0.02690 155 LEU C CG  
3979 C CD1 . LEU C 155 ? 0.58144 0.66024 0.56334 0.01276  -0.28611 -0.01124 155 LEU C CD1 
3980 C CD2 . LEU C 155 ? 0.54834 0.62594 0.50450 0.01220  -0.26829 -0.03491 155 LEU C CD2 
3981 N N   . ARG C 156 ? 0.70785 0.79466 0.80621 0.01077  -0.31909 -0.04697 156 ARG C N   
3982 C CA  . ARG C 156 ? 0.69667 0.78341 0.81132 0.00872  -0.33912 -0.05082 156 ARG C CA  
3983 C C   . ARG C 156 ? 0.57504 0.66375 0.70674 0.00885  -0.32989 -0.06672 156 ARG C C   
3984 O O   . ARG C 156 ? 0.69477 0.78113 0.81302 0.00653  -0.34026 -0.07399 156 ARG C O   
3985 C CB  . ARG C 156 ? 0.54488 0.63467 0.70277 0.00919  -0.35439 -0.04091 156 ARG C CB  
3986 C CG  . ARG C 156 ? 0.66831 0.75395 0.80726 0.00659  -0.37932 -0.02866 156 ARG C CG  
3987 C CD  . ARG C 156 ? 0.71901 0.80677 0.90109 0.00707  -0.39029 -0.01753 156 ARG C CD  
3988 N NE  . ARG C 156 ? 0.80163 0.88396 0.95932 0.00535  -0.40203 -0.00250 156 ARG C NE  
3989 C CZ  . ARG C 156 ? 0.92895 1.00319 1.05401 0.00122  -0.41604 0.00147  156 ARG C CZ  
3990 N NH1 . ARG C 156 ? 0.94969 1.02044 1.06268 -0.00165 -0.42072 -0.00800 156 ARG C NH1 
3991 N NH2 . ARG C 156 ? 0.89057 0.95921 0.99445 -0.00037 -0.42520 0.01492  156 ARG C NH2 
3992 N N   . CYS C 157 ? 0.55503 0.64660 0.71463 0.01111  -0.31048 -0.07229 157 CYS C N   
3993 C CA  . CYS C 157 ? 0.71929 0.81156 0.89351 0.01105  -0.30019 -0.08745 157 CYS C CA  
3994 C C   . CYS C 157 ? 0.66992 0.75926 0.80064 0.01007  -0.29226 -0.09655 157 CYS C C   
3995 O O   . CYS C 157 ? 0.65118 0.73994 0.78141 0.00871  -0.29614 -0.10734 157 CYS C O   
3996 C CB  . CYS C 157 ? 0.71319 0.80594 0.91962 0.01297  -0.27955 -0.09094 157 CYS C CB  
3997 S SG  . CYS C 157 ? 0.93812 1.03315 1.20391 0.01409  -0.28709 -0.08348 157 CYS C SG  
3998 N N   . MET C 158 ? 0.59119 0.65686 0.90981 -0.06641 -0.35870 0.03836  158 MET C N   
3999 C CA  . MET C 158 ? 0.61033 0.63013 0.87230 -0.07241 -0.36037 0.01431  158 MET C CA  
4000 C C   . MET C 158 ? 0.76361 0.81364 1.01326 -0.08279 -0.39760 -0.01625 158 MET C C   
4001 O O   . MET C 158 ? 0.89432 0.90486 1.10091 -0.09031 -0.39683 -0.03928 158 MET C O   
4002 C CB  . MET C 158 ? 0.59790 0.58665 0.79165 -0.04864 -0.34768 0.02607  158 MET C CB  
4003 C CG  . MET C 158 ? 0.71513 0.66940 0.90790 -0.03930 -0.31299 0.04658  158 MET C CG  
4004 S SD  . MET C 158 ? 0.63429 0.58809 0.77379 -0.01363 -0.29937 0.05691  158 MET C SD  
4005 C CE  . MET C 158 ? 0.53783 0.45097 0.62491 -0.00744 -0.30255 0.02570  158 MET C CE  
4006 N N   . GLY C 159 ? 0.61668 0.73108 0.89101 -0.07843 -0.41986 -0.01794 159 GLY C N   
4007 C CA  . GLY C 159 ? 0.66548 0.80752 0.90938 -0.08344 -0.44134 -0.04693 159 GLY C CA  
4008 C C   . GLY C 159 ? 0.76459 0.90632 0.92496 -0.05743 -0.44781 -0.03753 159 GLY C C   
4009 O O   . GLY C 159 ? 0.80647 0.95986 0.92984 -0.06352 -0.46419 -0.06184 159 GLY C O   
4010 N N   . ALA C 160 ? 0.75738 0.88284 0.88658 -0.03206 -0.43243 -0.00534 160 ALA C N   
4011 C CA  . ALA C 160 ? 0.81256 0.93335 0.86509 -0.00943 -0.43556 0.00353  160 ALA C CA  
4012 C C   . ALA C 160 ? 0.84316 1.02174 0.89719 0.00725  -0.46103 0.00918  160 ALA C C   
4013 O O   . ALA C 160 ? 0.76693 0.99358 0.88987 0.00787  -0.46978 0.01368  160 ALA C O   
4014 C CB  . ALA C 160 ? 0.73545 0.82259 0.75996 0.00969  -0.40877 0.03318  160 ALA C CB  
4015 N N   . PRO C 161 ? 1.03600 1.21074 1.01290 0.02239  -0.47435 0.00803  161 PRO C N   
4016 C CA  . PRO C 161 ? 1.11873 1.23746 1.01259 0.01981  -0.46493 -0.00285 161 PRO C CA  
4017 C C   . PRO C 161 ? 1.15302 1.27170 1.03689 -0.00694 -0.47852 -0.04276 161 PRO C C   
4018 O O   . PRO C 161 ? 1.13580 1.20575 0.96524 -0.01409 -0.46627 -0.05789 161 PRO C O   
4019 C CB  . PRO C 161 ? 1.14965 1.26080 0.96418 0.05076  -0.47249 0.01918  161 PRO C CB  
4020 C CG  . PRO C 161 ? 1.14540 1.32782 0.99850 0.06247  -0.50296 0.02419  161 PRO C CG  
4021 C CD  . PRO C 161 ? 1.11298 1.33762 1.07583 0.04786  -0.49993 0.02107  161 PRO C CD  
4022 N N   . GLU C 162 ? 1.07619 1.24964 1.01432 -0.02288 -0.50136 -0.06250 162 GLU C N   
4023 C CA  . GLU C 162 ? 1.05434 1.22774 0.98866 -0.05311 -0.51059 -0.10315 162 GLU C CA  
4024 C C   . GLU C 162 ? 0.98419 1.09579 0.92204 -0.07197 -0.48401 -0.11735 162 GLU C C   
4025 O O   . GLU C 162 ? 1.03204 1.11542 0.93396 -0.08890 -0.48106 -0.14572 162 GLU C O   
4026 C CB  . GLU C 162 ? 0.95278 1.19508 0.96216 -0.07374 -0.53297 -0.12560 162 GLU C CB  
4027 N N   . SER C 163 ? 0.82318 0.91184 0.80059 -0.06757 -0.46471 -0.09802 163 SER C N   
4028 C CA  . SER C 163 ? 0.82970 0.85836 0.80403 -0.07653 -0.44258 -0.10673 163 SER C CA  
4029 C C   . SER C 163 ? 0.84663 0.83984 0.76675 -0.05430 -0.42454 -0.09060 163 SER C C   
4030 O O   . SER C 163 ? 0.85743 0.85250 0.79022 -0.03798 -0.41360 -0.06293 163 SER C O   
4031 C CB  . SER C 163 ? 0.77783 0.79806 0.82096 -0.08563 -0.43426 -0.09819 163 SER C CB  
4032 O OG  . SER C 163 ? 0.78094 0.73854 0.81278 -0.09239 -0.41944 -0.11114 163 SER C OG  
4033 N N   . GLY C 164 ? 0.91334 0.87461 0.77587 -0.05653 -0.41865 -0.11213 164 GLY C N   
4034 C CA  . GLY C 164 ? 0.87754 0.80360 0.69793 -0.04118 -0.39800 -0.10936 164 GLY C CA  
4035 C C   . GLY C 164 ? 0.84334 0.74314 0.69593 -0.03678 -0.38125 -0.11187 164 GLY C C   
4036 O O   . GLY C 164 ? 0.74660 0.63774 0.59051 -0.02139 -0.36545 -0.10542 164 GLY C O   
4037 N N   . LEU C 165 ? 0.76582 0.64967 0.65134 -0.04936 -0.38561 -0.12441 165 LEU C N   
4038 C CA  . LEU C 165 ? 0.85541 0.70851 0.76501 -0.03912 -0.37362 -0.12170 165 LEU C CA  
4039 C C   . LEU C 165 ? 0.75754 0.63421 0.70421 -0.02858 -0.36490 -0.08769 165 LEU C C   
4040 O O   . LEU C 165 ? 0.66152 0.52763 0.61141 -0.01039 -0.34481 -0.07966 165 LEU C O   
4041 C CB  . LEU C 165 ? 0.76900 0.58592 0.69729 -0.05512 -0.37255 -0.13738 165 LEU C CB  
4042 C CG  . LEU C 165 ? 0.77639 0.55017 0.71709 -0.03761 -0.34914 -0.12658 165 LEU C CG  
4043 C CD1 . LEU C 165 ? 0.83099 0.57599 0.73710 -0.01048 -0.33702 -0.14229 165 LEU C CD1 
4044 C CD2 . LEU C 165 ? 0.80103 0.53048 0.75859 -0.05715 -0.34013 -0.13480 165 LEU C CD2 
4045 N N   . ALA C 166 ? 0.83520 0.74784 0.81222 -0.03884 -0.38069 -0.07045 166 ALA C N   
4046 C CA  . ALA C 166 ? 0.74269 0.67658 0.75635 -0.02997 -0.36941 -0.03815 166 ALA C CA  
4047 C C   . ALA C 166 ? 0.69041 0.63054 0.67454 -0.01054 -0.35132 -0.02494 166 ALA C C   
4048 O O   . ALA C 166 ? 0.70045 0.63609 0.70007 -0.00049 -0.32805 -0.01123 166 ALA C O   
4049 C CB  . ALA C 166 ? 0.63366 0.61298 0.68766 -0.04005 -0.39033 -0.02633 166 ALA C CB  
4050 N N   . GLU C 167 ? 0.72615 0.67232 0.66315 -0.00686 -0.35811 -0.03135 167 GLU C N   
4051 C CA  . GLU C 167 ? 0.66738 0.61017 0.57223 0.00709  -0.33124 -0.02228 167 GLU C CA  
4052 C C   . GLU C 167 ? 0.80071 0.72547 0.69992 0.01210  -0.30498 -0.04553 167 GLU C C   
4053 O O   . GLU C 167 ? 0.71657 0.64732 0.62596 0.01996  -0.27682 -0.03989 167 GLU C O   
4054 C CB  . GLU C 167 ? 0.69258 0.62911 0.53310 0.01039  -0.33931 -0.02503 167 GLU C CB  
4055 C CG  . GLU C 167 ? 0.78450 0.74863 0.62770 0.01464  -0.37240 -0.00340 167 GLU C CG  
4056 C CD  . GLU C 167 ? 0.96377 0.91311 0.73503 0.03349  -0.36614 0.01397  167 GLU C CD  
4057 O OE1 . GLU C 167 ? 1.02226 0.93294 0.72565 0.03374  -0.34442 -0.00228 167 GLU C OE1 
4058 O OE2 . GLU C 167 ? 0.95251 0.92345 0.73245 0.05006  -0.37925 0.04383  167 GLU C OE2 
4059 N N   . TYR C 168 ? 0.76006 0.66619 0.64718 0.00845  -0.31388 -0.07498 168 TYR C N   
4060 C CA  . TYR C 168 ? 0.64634 0.54296 0.53604 0.01968  -0.29526 -0.10097 168 TYR C CA  
4061 C C   . TYR C 168 ? 0.73051 0.63256 0.65994 0.03195  -0.28878 -0.08886 168 TYR C C   
4062 O O   . TYR C 168 ? 0.86754 0.78611 0.80732 0.04352  -0.26844 -0.09717 168 TYR C O   
4063 C CB  . TYR C 168 ? 0.71299 0.58322 0.58533 0.01698  -0.30745 -0.13059 168 TYR C CB  
4064 C CG  . TYR C 168 ? 0.66537 0.52838 0.54639 0.03616  -0.29441 -0.15875 168 TYR C CG  
4065 C CD1 . TYR C 168 ? 0.65667 0.50589 0.56038 0.05369  -0.29970 -0.15435 168 TYR C CD1 
4066 C CD2 . TYR C 168 ? 0.73282 0.60052 0.59696 0.03942  -0.27611 -0.19158 168 TYR C CD2 
4067 C CE1 . TYR C 168 ? 0.68109 0.52828 0.59041 0.08052  -0.29421 -0.18029 168 TYR C CE1 
4068 C CE2 . TYR C 168 ? 0.71314 0.58677 0.59699 0.06116  -0.26762 -0.22243 168 TYR C CE2 
4069 C CZ  . TYR C 168 ? 0.68887 0.55525 0.59505 0.08481  -0.28057 -0.21589 168 TYR C CZ  
4070 O OH  . TYR C 168 ? 0.76385 0.63999 0.68709 0.11546  -0.27865 -0.24618 168 TYR C OH  
4071 N N   . LEU C 169 ? 0.73169 0.61812 0.68143 0.02802  -0.30326 -0.07262 169 LEU C N   
4072 C CA  . LEU C 169 ? 0.61550 0.49283 0.58714 0.04102  -0.29470 -0.05989 169 LEU C CA  
4073 C C   . LEU C 169 ? 0.57014 0.47521 0.56213 0.04028  -0.27780 -0.03635 169 LEU C C   
4074 O O   . LEU C 169 ? 0.58942 0.49916 0.58801 0.05406  -0.26463 -0.03830 169 LEU C O   
4075 C CB  . LEU C 169 ? 0.61421 0.45466 0.59623 0.03290  -0.30347 -0.04854 169 LEU C CB  
4076 C CG  . LEU C 169 ? 0.77429 0.57282 0.73224 0.03548  -0.31125 -0.07299 169 LEU C CG  
4077 C CD1 . LEU C 169 ? 0.68584 0.44027 0.65317 0.01969  -0.30997 -0.06536 169 LEU C CD1 
4078 C CD2 . LEU C 169 ? 0.65729 0.43778 0.59413 0.06864  -0.30580 -0.09062 169 LEU C CD2 
4079 N N   . PHE C 170 ? 0.55671 0.48008 0.55658 0.02705  -0.27824 -0.01540 170 PHE C N   
4080 C CA  . PHE C 170 ? 0.49173 0.43431 0.50745 0.02793  -0.25593 0.00717  170 PHE C CA  
4081 C C   . PHE C 170 ? 0.61376 0.56880 0.61218 0.03469  -0.22928 -0.01267 170 PHE C C   
4082 O O   . PHE C 170 ? 0.60647 0.57219 0.62067 0.03838  -0.20699 -0.01164 170 PHE C O   
4083 C CB  . PHE C 170 ? 0.55702 0.51425 0.57701 0.02089  -0.26348 0.03158  170 PHE C CB  
4084 C CG  . PHE C 170 ? 0.52700 0.49573 0.56379 0.02408  -0.23721 0.05910  170 PHE C CG  
4085 C CD1 . PHE C 170 ? 0.48774 0.45910 0.56857 0.02038  -0.23159 0.08170  170 PHE C CD1 
4086 C CD2 . PHE C 170 ? 0.51028 0.47843 0.51544 0.02939  -0.21150 0.06144  170 PHE C CD2 
4087 C CE1 . PHE C 170 ? 0.43792 0.41627 0.53518 0.02292  -0.20427 0.10623  170 PHE C CE1 
4088 C CE2 . PHE C 170 ? 0.47950 0.44919 0.49676 0.03240  -0.18126 0.08662  170 PHE C CE2 
4089 C CZ  . PHE C 170 ? 0.55756 0.53498 0.62290 0.02972  -0.17933 0.10919  170 PHE C CZ  
4090 N N   . ASP C 171 ? 0.61742 0.57059 0.58381 0.03329  -0.22785 -0.03498 171 ASP C N   
4091 C CA  . ASP C 171 ? 0.60162 0.56520 0.55664 0.03505  -0.19717 -0.06496 171 ASP C CA  
4092 C C   . ASP C 171 ? 0.68358 0.66599 0.66627 0.04755  -0.19583 -0.09266 171 ASP C C   
4093 O O   . ASP C 171 ? 0.59022 0.59762 0.58966 0.04781  -0.16859 -0.10949 171 ASP C O   
4094 C CB  . ASP C 171 ? 0.62497 0.57307 0.53911 0.03063  -0.19859 -0.08843 171 ASP C CB  
4095 C CG  . ASP C 171 ? 0.72340 0.67954 0.63014 0.02809  -0.16070 -0.12717 171 ASP C CG  
4096 O OD1 . ASP C 171 ? 0.75876 0.73196 0.68720 0.03592  -0.16396 -0.16442 171 ASP C OD1 
4097 O OD2 . ASP C 171 ? 0.70893 0.65222 0.58864 0.01947  -0.12493 -0.12219 171 ASP C OD2 
4098 N N   . LYS C 172 ? 0.56504 0.53413 0.55034 0.05981  -0.22477 -0.09834 172 LYS C N   
4099 C CA  . LYS C 172 ? 0.59251 0.57485 0.59256 0.08227  -0.23027 -0.12294 172 LYS C CA  
4100 C C   . LYS C 172 ? 0.53467 0.52049 0.54923 0.08848  -0.22670 -0.10151 172 LYS C C   
4101 O O   . LYS C 172 ? 0.52820 0.54605 0.55690 0.10039  -0.21772 -0.12415 172 LYS C O   
4102 C CB  . LYS C 172 ? 0.52419 0.47473 0.50912 0.09855  -0.25737 -0.13210 172 LYS C CB  
4103 C CG  . LYS C 172 ? 0.56994 0.51823 0.54074 0.09470  -0.25770 -0.16289 172 LYS C CG  
4104 C CD  . LYS C 172 ? 0.64189 0.63520 0.63231 0.10173  -0.23653 -0.20673 172 LYS C CD  
4105 C CE  . LYS C 172 ? 0.65417 0.64337 0.63547 0.10212  -0.23255 -0.24451 172 LYS C CE  
4106 N NZ  . LYS C 172 ? 0.72742 0.76728 0.74269 0.10885  -0.20872 -0.29548 172 LYS C NZ  
4107 N N   . HIS C 173 ? 0.56713 0.52366 0.58080 0.07885  -0.23195 -0.06221 173 HIS C N   
4108 C CA  . HIS C 173 ? 0.56954 0.51090 0.58792 0.08497  -0.22890 -0.04047 173 HIS C CA  
4109 C C   . HIS C 173 ? 0.47593 0.43714 0.51389 0.06904  -0.20105 -0.02175 173 HIS C C   
4110 O O   . HIS C 173 ? 0.51606 0.48427 0.55656 0.07556  -0.18976 -0.02363 173 HIS C O   
4111 C CB  . HIS C 173 ? 0.63508 0.52702 0.64710 0.07973  -0.24165 -0.01275 173 HIS C CB  
4112 C CG  . HIS C 173 ? 0.65760 0.50928 0.64160 0.09996  -0.26004 -0.02639 173 HIS C CG  
4113 N ND1 . HIS C 173 ? 0.71135 0.53935 0.66860 0.13053  -0.26459 -0.03274 173 HIS C ND1 
4114 C CD2 . HIS C 173 ? 0.66856 0.49436 0.64126 0.09657  -0.27343 -0.03519 173 HIS C CD2 
4115 C CE1 . HIS C 173 ? 0.79086 0.57426 0.71969 0.14838  -0.27804 -0.04168 173 HIS C CE1 
4116 N NE2 . HIS C 173 ? 0.70296 0.48431 0.64354 0.12515  -0.28121 -0.04465 173 HIS C NE2 
4117 N N   . THR C 174 ? 0.42236 0.38815 0.46935 0.05083  -0.19017 -0.00238 174 THR C N   
4118 C CA  . THR C 174 ? 0.56395 0.54057 0.62701 0.03956  -0.15890 0.01728  174 THR C CA  
4119 C C   . THR C 174 ? 0.45653 0.45938 0.51516 0.03474  -0.12790 -0.00873 174 THR C C   
4120 O O   . THR C 174 ? 0.48227 0.50024 0.55240 0.03028  -0.09986 -0.01741 174 THR C O   
4121 C CB  . THR C 174 ? 0.59005 0.55724 0.66567 0.02921  -0.16035 0.05385  174 THR C CB  
4122 O OG1 . THR C 174 ? 0.47827 0.42480 0.57021 0.02724  -0.18056 0.07113  174 THR C OG1 
4123 C CG2 . THR C 174 ? 0.49945 0.47232 0.58939 0.02228  -0.12306 0.07561  174 THR C CG2 
4124 N N   . LEU C 175 ? 0.49355 0.49792 0.53332 0.03278  -0.12803 -0.02479 175 LEU C N   
4125 C CA  . LEU C 175 ? 0.56690 0.58455 0.59814 0.02411  -0.08931 -0.05276 175 LEU C CA  
4126 C C   . LEU C 175 ? 0.62076 0.67388 0.66760 0.02959  -0.08735 -0.10696 175 LEU C C   
4127 O O   . LEU C 175 ? 0.55601 0.62648 0.60658 0.01813  -0.04980 -0.14141 175 LEU C O   
4128 C CB  . LEU C 175 ? 0.50920 0.50265 0.50255 0.02044  -0.08641 -0.04660 175 LEU C CB  
4129 C CG  . LEU C 175 ? 0.55016 0.51905 0.52784 0.02210  -0.09472 0.00248  175 LEU C CG  
4130 C CD1 . LEU C 175 ? 0.60366 0.54488 0.52731 0.02281  -0.08370 0.00508  175 LEU C CD1 
4131 C CD2 . LEU C 175 ? 0.57563 0.54247 0.57357 0.01897  -0.06369 0.03070  175 LEU C CD2 
4132 N N   . GLY C 176 ? 0.65530 0.71787 0.71116 0.04849  -0.12441 -0.11740 176 GLY C N   
4133 C CA  . GLY C 176 ? 0.54291 0.64685 0.61760 0.06352  -0.13133 -0.16864 176 GLY C CA  
4134 C C   . GLY C 176 ? 0.66067 0.80310 0.75974 0.06445  -0.11611 -0.18846 176 GLY C C   
4135 O O   . GLY C 176 ? 0.74746 0.94161 0.87172 0.07540  -0.11819 -0.24035 176 GLY C O   
4136 N N   . THR D 5   ? 1.34798 1.37818 0.79722 0.00495  0.23153  -0.31642 5   THR D N   
4137 C CA  . THR D 5   ? 1.32884 1.35671 0.77913 -0.00065 0.23085  -0.30747 5   THR D CA  
4138 C C   . THR D 5   ? 1.34146 1.38248 0.82508 -0.01092 0.23240  -0.30246 5   THR D C   
4139 O O   . THR D 5   ? 1.39196 1.44761 0.89378 -0.01602 0.23918  -0.30435 5   THR D O   
4140 C CB  . THR D 5   ? 1.36192 1.39054 0.79262 -0.00267 0.24036  -0.30376 5   THR D CB  
4141 O OG1 . THR D 5   ? 1.38820 1.43264 0.83123 -0.00919 0.25195  -0.30431 5   THR D OG1 
4142 C CG2 . THR D 5   ? 1.34407 1.35997 0.74063 0.00783  0.23878  -0.30867 5   THR D CG2 
4143 N N   . SER D 6   ? 1.19492 1.23067 0.68612 -0.01364 0.22589  -0.29634 6   SER D N   
4144 C CA  . SER D 6   ? 1.16470 1.21117 0.68553 -0.02310 0.22692  -0.29115 6   SER D CA  
4145 C C   . SER D 6   ? 1.13835 1.19389 0.66329 -0.03238 0.23792  -0.28594 6   SER D C   
4146 O O   . SER D 6   ? 1.21659 1.26757 0.72048 -0.03207 0.24329  -0.28378 6   SER D O   
4147 C CB  . SER D 6   ? 1.17222 1.20986 0.69755 -0.02332 0.21784  -0.28558 6   SER D CB  
4148 O OG  . SER D 6   ? 1.22743 1.25798 0.75459 -0.01658 0.20725  -0.28986 6   SER D OG  
4149 N N   . GLN D 7   ? 1.01773 1.08589 0.56994 -0.04093 0.24096  -0.28397 7   GLN D N   
4150 C CA  . GLN D 7   ? 1.00713 1.08187 0.56524 -0.05084 0.24983  -0.27835 7   GLN D CA  
4151 C C   . GLN D 7   ? 1.04676 1.11287 0.60339 -0.05477 0.24706  -0.26991 7   GLN D C   
4152 O O   . GLN D 7   ? 1.05889 1.12626 0.61413 -0.06221 0.25401  -0.26471 7   GLN D O   
4153 C CB  . GLN D 7   ? 0.93911 1.02949 0.52633 -0.05857 0.25323  -0.27958 7   GLN D CB  
4154 C CG  . GLN D 7   ? 0.88778 0.97933 0.49701 -0.05888 0.24426  -0.27883 7   GLN D CG  
4155 C CD  . GLN D 7   ? 0.88356 0.99020 0.52134 -0.06635 0.24659  -0.27987 7   GLN D CD  
4156 O OE1 . GLN D 7   ? 0.92876 1.04447 0.57120 -0.07284 0.25497  -0.28003 7   GLN D OE1 
4157 N NE2 . GLN D 7   ? 0.83908 0.94864 0.49611 -0.06548 0.23895  -0.28076 7   GLN D NE2 
4158 N N   . VAL D 8   ? 0.97959 1.03690 0.53683 -0.05011 0.23710  -0.26851 8   VAL D N   
4159 C CA  . VAL D 8   ? 0.96749 1.01660 0.52356 -0.05296 0.23391  -0.26073 8   VAL D CA  
4160 C C   . VAL D 8   ? 0.97627 1.01068 0.50491 -0.04508 0.22879  -0.25971 8   VAL D C   
4161 O O   . VAL D 8   ? 1.08448 1.11159 0.60806 -0.04698 0.22695  -0.25318 8   VAL D O   
4162 C CB  . VAL D 8   ? 0.89327 0.94461 0.47373 -0.05502 0.22665  -0.25856 8   VAL D CB  
4163 C CG1 . VAL D 8   ? 0.86608 0.93162 0.47357 -0.06396 0.23157  -0.25839 8   VAL D CG1 
4164 C CG2 . VAL D 8   ? 0.91494 0.96243 0.49554 -0.04625 0.21701  -0.26397 8   VAL D CG2 
4165 N N   . ARG D 9   ? 0.97074 1.00023 0.48119 -0.03619 0.22609  -0.26606 9   ARG D N   
4166 C CA  . ARG D 9   ? 1.03740 1.05261 0.52148 -0.02822 0.21985  -0.26576 9   ARG D CA  
4167 C C   . ARG D 9   ? 1.11941 1.13138 0.58420 -0.03107 0.22685  -0.26084 9   ARG D C   
4168 O O   . ARG D 9   ? 1.13280 1.15143 0.59327 -0.03471 0.23669  -0.26165 9   ARG D O   
4169 C CB  . ARG D 9   ? 0.99754 1.00747 0.46545 -0.01816 0.21553  -0.27430 9   ARG D CB  
4170 C CG  . ARG D 9   ? 1.01417 1.00851 0.45860 -0.00917 0.20559  -0.27511 9   ARG D CG  
4171 C CD  . ARG D 9   ? 1.04480 1.03243 0.48042 0.00015  0.19839  -0.28394 9   ARG D CD  
4172 N NE  . ARG D 9   ? 1.04862 1.02028 0.45941 0.00907  0.18825  -0.28564 9   ARG D NE  
4173 C CZ  . ARG D 9   ? 1.05381 1.01471 0.45695 0.01703  0.17815  -0.29213 9   ARG D CZ  
4174 N NH1 . ARG D 9   ? 1.04313 1.00777 0.46181 0.01708  0.17725  -0.29732 9   ARG D NH1 
4175 N NH2 . ARG D 9   ? 1.10305 1.04922 0.48297 0.02465  0.16852  -0.29355 9   ARG D NH2 
4176 N N   . GLN D 10  ? 1.09688 1.09888 0.55029 -0.02953 0.22168  -0.25570 10  GLN D N   
4177 C CA  . GLN D 10  ? 1.01909 1.01676 0.45323 -0.03199 0.22711  -0.25051 10  GLN D CA  
4178 C C   . GLN D 10  ? 1.11635 1.10175 0.53410 -0.02601 0.21765  -0.24788 10  GLN D C   
4179 O O   . GLN D 10  ? 1.20613 1.18883 0.63636 -0.02762 0.21183  -0.24370 10  GLN D O   
4180 C CB  . GLN D 10  ? 1.03588 1.03961 0.48577 -0.04365 0.23539  -0.24350 10  GLN D CB  
4181 C CG  . GLN D 10  ? 1.05604 1.05431 0.48683 -0.04707 0.24100  -0.23757 10  GLN D CG  
4182 C CD  . GLN D 10  ? 1.10054 1.10540 0.54341 -0.05859 0.25154  -0.23288 10  GLN D CD  
4183 O OE1 . GLN D 10  ? 1.05709 1.06704 0.52414 -0.06508 0.25193  -0.23069 10  GLN D OE1 
4184 N NE2 . GLN D 10  ? 1.12839 1.13303 0.55410 -0.06128 0.26003  -0.23148 10  GLN D NE2 
4185 N N   . ASN D 11  ? 1.18829 1.16688 0.57824 -0.01895 0.21591  -0.25057 11  ASN D N   
4186 C CA  . ASN D 11  ? 1.12561 1.09352 0.49690 -0.01325 0.20709  -0.24851 11  ASN D CA  
4187 C C   . ASN D 11  ? 1.13300 1.09482 0.50955 -0.00588 0.19364  -0.25232 11  ASN D C   
4188 O O   . ASN D 11  ? 1.18825 1.14399 0.56321 -0.00428 0.18574  -0.24879 11  ASN D O   
4189 C CB  . ASN D 11  ? 1.15888 1.12510 0.53221 -0.02074 0.21023  -0.23904 11  ASN D CB  
4190 C CG  . ASN D 11  ? 1.22580 1.18257 0.57678 -0.01553 0.20285  -0.23680 11  ASN D CG  
4191 O OD1 . ASN D 11  ? 1.17644 1.12881 0.50724 -0.00685 0.19682  -0.24238 11  ASN D OD1 
4192 N ND2 . ASN D 11  ? 1.20306 1.15677 0.55763 -0.02076 0.20288  -0.22886 11  ASN D ND2 
4193 N N   . TYR D 12  ? 1.13734 1.10026 0.51928 -0.00128 0.19083  -0.25974 12  TYR D N   
4194 C CA  . TYR D 12  ? 1.13344 1.08962 0.52066 0.00526  0.17829  -0.26400 12  TYR D CA  
4195 C C   . TYR D 12  ? 1.13390 1.08162 0.49767 0.01575  0.17218  -0.27272 12  TYR D C   
4196 O O   . TYR D 12  ? 1.19964 1.14897 0.56601 0.01797  0.17413  -0.27900 12  TYR D O   
4197 C CB  . TYR D 12  ? 1.01230 0.97630 0.42922 0.00047  0.17970  -0.26476 12  TYR D CB  
4198 C CG  . TYR D 12  ? 1.05047 1.00834 0.47795 0.00442  0.16763  -0.26666 12  TYR D CG  
4199 C CD1 . TYR D 12  ? 1.13437 1.08582 0.56142 0.00548  0.15955  -0.26206 12  TYR D CD1 
4200 C CD2 . TYR D 12  ? 1.05001 1.00867 0.48833 0.00674  0.16443  -0.27300 12  TYR D CD2 
4201 C CE1 . TYR D 12  ? 1.10008 1.04588 0.53714 0.00867  0.14861  -0.26368 12  TYR D CE1 
4202 C CE2 . TYR D 12  ? 1.00337 0.95587 0.45138 0.00955  0.15357  -0.27452 12  TYR D CE2 
4203 C CZ  . TYR D 12  ? 1.03124 0.97721 0.47856 0.01044  0.14573  -0.26981 12  TYR D CZ  
4204 O OH  . TYR D 12  ? 0.99929 0.93895 0.45619 0.01285  0.13500  -0.27125 12  TYR D OH  
4205 N N   . HIS D 13  ? 1.14172 1.08053 0.48255 0.02222  0.16440  -0.27332 13  HIS D N   
4206 C CA  . HIS D 13  ? 1.15007 1.07988 0.46628 0.03260  0.15748  -0.28166 13  HIS D CA  
4207 C C   . HIS D 13  ? 1.20745 1.12857 0.53046 0.03795  0.14734  -0.28825 13  HIS D C   
4208 O O   . HIS D 13  ? 1.19010 1.11131 0.53445 0.03458  0.14297  -0.28578 13  HIS D O   
4209 C CB  . HIS D 13  ? 1.19423 1.11833 0.48840 0.03776  0.14921  -0.28088 13  HIS D CB  
4210 C CG  . HIS D 13  ? 1.24610 1.16451 0.51194 0.04730  0.14501  -0.28875 13  HIS D CG  
4211 N ND1 . HIS D 13  ? 1.24990 1.15760 0.50744 0.05570  0.13047  -0.29545 13  HIS D ND1 
4212 C CD2 . HIS D 13  ? 1.23642 1.15860 0.48286 0.04860  0.15314  -0.29026 13  HIS D CD2 
4213 C CE1 . HIS D 13  ? 1.27059 1.17654 0.50694 0.06131  0.12954  -0.30046 13  HIS D CE1 
4214 N NE2 . HIS D 13  ? 1.31110 1.22578 0.53781 0.05820  0.14351  -0.29811 13  HIS D NE2 
4215 N N   . GLN D 14  ? 1.26218 1.17467 0.56578 0.04616  0.14367  -0.29668 14  GLN D N   
4216 C CA  . GLN D 14  ? 1.29570 1.19707 0.60320 0.05037  0.13496  -0.30325 14  GLN D CA  
4217 C C   . GLN D 14  ? 1.30417 1.19214 0.60838 0.05455  0.11831  -0.30357 14  GLN D C   
4218 O O   . GLN D 14  ? 1.29926 1.17942 0.61634 0.05377  0.11101  -0.30531 14  GLN D O   
4219 C CB  . GLN D 14  ? 1.39651 1.29058 0.68336 0.05709  0.13670  -0.31184 14  GLN D CB  
4220 C CG  . GLN D 14  ? 1.40525 1.31150 0.70643 0.05200  0.15020  -0.31324 14  GLN D CG  
4221 C CD  . GLN D 14  ? 1.40465 1.30609 0.71995 0.05184  0.14654  -0.31876 14  GLN D CD  
4222 O OE1 . GLN D 14  ? 1.34852 1.24911 0.68375 0.04837  0.14005  -0.31665 14  GLN D OE1 
4223 N NE2 . GLN D 14  ? 1.43208 1.33063 0.73679 0.05549  0.15075  -0.32596 14  GLN D NE2 
4224 N N   . ASP D 15  ? 1.31736 1.20452 0.60813 0.05742  0.11195  -0.30125 15  ASP D N   
4225 C CA  . ASP D 15  ? 1.30779 1.18591 0.60030 0.06005  0.09568  -0.30053 15  ASP D CA  
4226 C C   . ASP D 15  ? 1.32171 1.20265 0.63751 0.05441  0.09415  -0.29476 15  ASP D C   
4227 O O   . ASP D 15  ? 1.39577 1.26637 0.72059 0.05487  0.08295  -0.29554 15  ASP D O   
4228 C CB  . ASP D 15  ? 1.29179 1.17521 0.56890 0.06328  0.09049  -0.29948 15  ASP D CB  
4229 C CG  . ASP D 15  ? 1.44478 1.32828 0.69876 0.06885  0.09245  -0.30519 15  ASP D CG  
4230 O OD1 . ASP D 15  ? 1.46639 1.34185 0.71430 0.07151  0.09569  -0.31030 15  ASP D OD1 
4231 O OD2 . ASP D 15  ? 1.48019 1.37259 0.72192 0.06996  0.09107  -0.30472 15  ASP D OD2 
4232 N N   . SER D 16  ? 1.20408 1.09779 0.52906 0.04867  0.10539  -0.28869 16  SER D N   
4233 C CA  . SER D 16  ? 1.25144 1.14842 0.59846 0.04345  0.10455  -0.28300 16  SER D CA  
4234 C C   . SER D 16  ? 1.23473 1.13328 0.60500 0.03882  0.10781  -0.28389 16  SER D C   
4235 O O   . SER D 16  ? 1.25841 1.15470 0.64557 0.03664  0.10158  -0.28174 16  SER D O   
4236 C CB  . SER D 16  ? 1.20852 1.11837 0.56383 0.03581  0.11539  -0.27404 16  SER D CB  
4237 O OG  . SER D 16  ? 1.21812 1.13609 0.56983 0.03204  0.12912  -0.27350 16  SER D OG  
4238 N N   . GLU D 17  ? 1.19048 1.09432 0.56273 0.03720  0.11725  -0.28731 17  GLU D N   
4239 C CA  . GLU D 17  ? 1.13446 1.04119 0.52802 0.03372  0.11867  -0.28990 17  GLU D CA  
4240 C C   . GLU D 17  ? 1.21898 1.10830 0.60625 0.03888  0.10451  -0.29569 17  GLU D C   
4241 O O   . GLU D 17  ? 1.31401 1.20365 0.72186 0.03528  0.09997  -0.29444 17  GLU D O   
4242 C CB  . GLU D 17  ? 1.10177 1.01680 0.49489 0.03250  0.12997  -0.29392 17  GLU D CB  
4243 C CG  . GLU D 17  ? 1.11004 1.02989 0.52415 0.02970  0.13105  -0.29789 17  GLU D CG  
4244 C CD  . GLU D 17  ? 1.21531 1.14294 0.62676 0.02966  0.14126  -0.30277 17  GLU D CD  
4245 O OE1 . GLU D 17  ? 1.25905 1.19007 0.65530 0.03031  0.14906  -0.30176 17  GLU D OE1 
4246 O OE2 . GLU D 17  ? 1.26298 1.19381 0.68750 0.02897  0.14145  -0.30772 17  GLU D OE2 
4247 N N   . ALA D 18  ? 1.14181 1.01542 0.50128 0.04642  0.09700  -0.30151 18  ALA D N   
4248 C CA  . ALA D 18  ? 1.14163 0.99716 0.49785 0.04808  0.08307  -0.30524 18  ALA D CA  
4249 C C   . ALA D 18  ? 1.14812 0.99757 0.51201 0.04679  0.07110  -0.30010 18  ALA D C   
4250 O O   . ALA D 18  ? 1.21782 1.05735 0.59131 0.04394  0.06255  -0.30101 18  ALA D O   
4251 C CB  . ALA D 18  ? 1.24206 1.08329 0.57119 0.05404  0.07773  -0.31036 18  ALA D CB  
4252 N N   . ALA D 19  ? 1.10569 0.96178 0.46582 0.04823  0.07053  -0.29482 19  ALA D N   
4253 C CA  . ALA D 19  ? 1.16594 1.01901 0.53343 0.04638  0.06016  -0.29103 19  ALA D CA  
4254 C C   . ALA D 19  ? 1.14769 1.00874 0.54091 0.04038  0.06424  -0.28670 19  ALA D C   
4255 O O   . ALA D 19  ? 1.14038 0.99626 0.54217 0.03628  0.05558  -0.28720 19  ALA D O   
4256 C CB  . ALA D 19  ? 1.17733 1.03984 0.53451 0.04752  0.06048  -0.28851 19  ALA D CB  
4257 N N   . ILE D 20  ? 1.20677 1.08215 0.61150 0.03772  0.07827  -0.28456 20  ILE D N   
4258 C CA  . ILE D 20  ? 1.11764 1.00460 0.55323 0.03041  0.08280  -0.27991 20  ILE D CA  
4259 C C   . ILE D 20  ? 1.04213 0.92329 0.48900 0.02899  0.07740  -0.28490 20  ILE D C   
4260 O O   . ILE D 20  ? 1.11436 0.99593 0.57947 0.02561  0.07208  -0.28248 20  ILE D O   
4261 C CB  . ILE D 20  ? 1.08758 0.99434 0.53888 0.02413  0.09904  -0.27570 20  ILE D CB  
4262 C CG1 . ILE D 20  ? 1.05566 0.96819 0.50224 0.02248  0.10389  -0.26861 20  ILE D CG1 
4263 C CG2 . ILE D 20  ? 1.08576 1.00511 0.56952 0.01707  0.10332  -0.27294 20  ILE D CG2 
4264 C CD1 . ILE D 20  ? 1.06148 0.97282 0.51846 0.02113  0.09759  -0.26284 20  ILE D CD1 
4265 N N   . ASN D 21  ? 1.05082 0.92743 0.48774 0.03115  0.07901  -0.29191 21  ASN D N   
4266 C CA  . ASN D 21  ? 1.03605 0.90683 0.48275 0.02939  0.07332  -0.29713 21  ASN D CA  
4267 C C   . ASN D 21  ? 1.05408 0.90347 0.49019 0.03021  0.05747  -0.29824 21  ASN D C   
4268 O O   . ASN D 21  ? 1.10898 0.95897 0.56418 0.02567  0.05209  -0.29815 21  ASN D O   
4269 C CB  . ASN D 21  ? 1.05087 0.91802 0.48445 0.03211  0.07722  -0.30494 21  ASN D CB  
4270 C CG  . ASN D 21  ? 1.08691 0.97701 0.54259 0.02840  0.09114  -0.30487 21  ASN D CG  
4271 O OD1 . ASN D 21  ? 1.13429 1.03836 0.61901 0.02331  0.09344  -0.30296 21  ASN D OD1 
4272 N ND2 . ASN D 21  ? 1.03475 0.92865 0.47644 0.03082  0.10005  -0.30708 21  ASN D ND2 
4273 N N   . ARG D 22  ? 1.04656 0.88368 0.46087 0.03282  0.05013  -0.29804 22  ARG D N   
4274 C CA  . ARG D 22  ? 1.04765 0.87135 0.45611 0.02832  0.03623  -0.30070 22  ARG D CA  
4275 C C   . ARG D 22  ? 1.16125 0.99413 0.58790 0.02365  0.03359  -0.29667 22  ARG D C   
4276 O O   . ARG D 22  ? 1.22722 1.05527 0.66289 0.01761  0.02445  -0.29902 22  ARG D O   
4277 C CB  . ARG D 22  ? 1.11366 0.92504 0.49450 0.03191  0.02989  -0.30184 22  ARG D CB  
4278 C CG  . ARG D 22  ? 1.15012 0.94357 0.50959 0.03304  0.02703  -0.30758 22  ARG D CG  
4279 C CD  . ARG D 22  ? 1.20711 0.98768 0.53868 0.03653  0.01994  -0.30841 22  ARG D CD  
4280 N NE  . ARG D 22  ? 1.26235 1.05400 0.58334 0.04681  0.02829  -0.30755 22  ARG D NE  
4281 C CZ  . ARG D 22  ? 1.31872 1.12634 0.63757 0.05214  0.02918  -0.30503 22  ARG D CZ  
4282 N NH1 . ARG D 22  ? 1.32145 1.13452 0.64732 0.04948  0.02183  -0.30305 22  ARG D NH1 
4283 N NH2 . ARG D 22  ? 1.29565 1.11615 0.60642 0.05860  0.03815  -0.30490 22  ARG D NH2 
4284 N N   . GLN D 23  ? 1.08251 0.92923 0.51491 0.02548  0.04191  -0.29075 23  GLN D N   
4285 C CA  . GLN D 23  ? 1.04540 0.90072 0.49402 0.02096  0.04097  -0.28657 23  GLN D CA  
4286 C C   . GLN D 23  ? 1.07825 0.94587 0.55937 0.01547  0.04445  -0.28444 23  GLN D C   
4287 O O   . GLN D 23  ? 1.15051 1.02195 0.64755 0.01022  0.03899  -0.28329 23  GLN D O   
4288 C CB  . GLN D 23  ? 0.99020 0.85856 0.43927 0.02231  0.05063  -0.27969 23  GLN D CB  
4289 C CG  . GLN D 23  ? 0.96388 0.83819 0.42323 0.01755  0.04814  -0.27507 23  GLN D CG  
4290 C CD  . GLN D 23  ? 0.99174 0.85411 0.43130 0.01850  0.03489  -0.27887 23  GLN D CD  
4291 O OE1 . GLN D 23  ? 1.00571 0.86060 0.42536 0.02271  0.03011  -0.28209 23  GLN D OE1 
4292 N NE2 . GLN D 23  ? 1.08204 0.94566 0.53144 0.01351  0.02887  -0.27726 23  GLN D NE2 
4293 N N   . ILE D 24  ? 1.02529 0.90076 0.51720 0.01681  0.05337  -0.28393 24  ILE D N   
4294 C CA  . ILE D 24  ? 0.95333 0.84049 0.47507 0.01258  0.05532  -0.28315 24  ILE D CA  
4295 C C   . ILE D 24  ? 0.98430 0.86214 0.50831 0.00958  0.04285  -0.28983 24  ILE D C   
4296 O O   . ILE D 24  ? 0.98893 0.87520 0.53558 0.00464  0.03871  -0.28889 24  ILE D O   
4297 C CB  . ILE D 24  ? 0.90693 0.80368 0.43644 0.01430  0.06589  -0.28347 24  ILE D CB  
4298 C CG1 . ILE D 24  ? 0.93632 0.84917 0.47210 0.01243  0.07910  -0.27773 24  ILE D CG1 
4299 C CG2 . ILE D 24  ? 0.83514 0.74408 0.39376 0.01011  0.06611  -0.28511 24  ILE D CG2 
4300 C CD1 . ILE D 24  ? 0.96542 0.88965 0.50316 0.01158  0.09036  -0.28099 24  ILE D CD1 
4301 N N   . ASN D 25  ? 1.02604 0.88668 0.52688 0.01198  0.03664  -0.29672 25  ASN D N   
4302 C CA  . ASN D 25  ? 1.01022 0.86190 0.51331 0.00748  0.02435  -0.30318 25  ASN D CA  
4303 C C   . ASN D 25  ? 0.99622 0.84424 0.49920 0.00249  0.01355  -0.30277 25  ASN D C   
4304 O O   . ASN D 25  ? 1.00468 0.85747 0.52650 -0.00285 0.00520  -0.30507 25  ASN D O   
4305 C CB  . ASN D 25  ? 1.02862 0.86071 0.50436 0.00927  0.02001  -0.31048 25  ASN D CB  
4306 C CG  . ASN D 25  ? 1.06291 0.88835 0.54408 0.00287  0.00769  -0.31738 25  ASN D CG  
4307 O OD1 . ASN D 25  ? 1.03556 0.84923 0.50350 -0.00222 -0.00317 -0.32035 25  ASN D OD1 
4308 N ND2 . ASN D 25  ? 1.06985 0.90518 0.57267 0.00255  0.00915  -0.31988 25  ASN D ND2 
4309 N N   . LEU D 26  ? 1.00714 0.84858 0.49056 0.00444  0.01324  -0.29990 26  LEU D N   
4310 C CA  . LEU D 26  ? 0.98988 0.82800 0.47222 -0.00047 0.00279  -0.29943 26  LEU D CA  
4311 C C   . LEU D 26  ? 1.03204 0.89010 0.54722 -0.00407 0.00532  -0.29452 26  LEU D C   
4312 O O   . LEU