data_6WZ5
# 
_entry.id   6WZ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WZ5         
WWPDB D_1000249262 
EMDB  EMD-21970    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin' 
_pdbx_database_related.db_id          EMD-21970 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WZ5 
_pdbx_database_status.recvd_initial_deposition_date   2020-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Halic, M.'     1 ? 
'Bilokapic, S.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            585 
_citation.language                  ? 
_citation.page_first                609 
_citation.page_last                 613 
_citation.title                     'Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-020-2725-7 
_citation.pdbx_database_id_PubMed   32939087 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bilokapic, S.'    1 ? 
primary 'Suskiewicz, M.J.' 2 ? 
primary 'Ahel, I.'         3 ? 
primary 'Halic, M.'        4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WZ5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WZ5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3.2'    15303.930 2 ? ? ? ? 
2 polymer man 'Histone H4'      11263.231 2 ? ? ? ? 
3 polymer man 'Histone H2A'     13978.241 2 ? ? ? ? 
4 polymer man 'Histone H2B 1.1' 13524.752 2 ? ? ? ? 
5 polymer man 'DNA (153-MER)'   51776.004 1 ? ? ? ? 
6 polymer man 'DNA (153-MER)'   51330.684 1 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DT)(DA)(DC)(DA)(DT)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)
(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)
(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)
(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)
(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)
(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)
(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)
(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DC)
(DA)(DT)(DC)(DA)(DT)(DA)(DG)
;
;CAATACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGG
ACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGC
ATCATAG
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DT)(DG)(DA)(DT)(DG)(DC)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)
(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)
(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)
(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)
(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)
(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)
(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)
(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)
(DT)(DG)(DT)(DA)(DT)(DT)(DG)
;
;CTATGATGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTAC
GCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCA
TGTATTG
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DC  n 
5 2   DA  n 
5 3   DA  n 
5 4   DT  n 
5 5   DA  n 
5 6   DC  n 
5 7   DA  n 
5 8   DT  n 
5 9   DG  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DA  n 
5 14  DG  n 
5 15  DG  n 
5 16  DA  n 
5 17  DT  n 
5 18  DG  n 
5 19  DT  n 
5 20  DA  n 
5 21  DT  n 
5 22  DA  n 
5 23  DT  n 
5 24  DA  n 
5 25  DT  n 
5 26  DC  n 
5 27  DT  n 
5 28  DG  n 
5 29  DA  n 
5 30  DC  n 
5 31  DA  n 
5 32  DC  n 
5 33  DG  n 
5 34  DT  n 
5 35  DG  n 
5 36  DC  n 
5 37  DC  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DG  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DA  n 
5 47  DG  n 
5 48  DG  n 
5 49  DG  n 
5 50  DA  n 
5 51  DG  n 
5 52  DT  n 
5 53  DA  n 
5 54  DA  n 
5 55  DT  n 
5 56  DC  n 
5 57  DC  n 
5 58  DC  n 
5 59  DC  n 
5 60  DT  n 
5 61  DT  n 
5 62  DG  n 
5 63  DG  n 
5 64  DC  n 
5 65  DG  n 
5 66  DG  n 
5 67  DT  n 
5 68  DT  n 
5 69  DA  n 
5 70  DA  n 
5 71  DA  n 
5 72  DA  n 
5 73  DC  n 
5 74  DG  n 
5 75  DC  n 
5 76  DG  n 
5 77  DG  n 
5 78  DG  n 
5 79  DG  n 
5 80  DG  n 
5 81  DA  n 
5 82  DC  n 
5 83  DA  n 
5 84  DG  n 
5 85  DC  n 
5 86  DG  n 
5 87  DC  n 
5 88  DG  n 
5 89  DT  n 
5 90  DA  n 
5 91  DC  n 
5 92  DG  n 
5 93  DT  n 
5 94  DG  n 
5 95  DC  n 
5 96  DG  n 
5 97  DT  n 
5 98  DT  n 
5 99  DT  n 
5 100 DA  n 
5 101 DA  n 
5 102 DG  n 
5 103 DC  n 
5 104 DG  n 
5 105 DG  n 
5 106 DT  n 
5 107 DG  n 
5 108 DC  n 
5 109 DT  n 
5 110 DA  n 
5 111 DG  n 
5 112 DA  n 
5 113 DG  n 
5 114 DC  n 
5 115 DT  n 
5 116 DG  n 
5 117 DT  n 
5 118 DC  n 
5 119 DT  n 
5 120 DA  n 
5 121 DC  n 
5 122 DG  n 
5 123 DA  n 
5 124 DC  n 
5 125 DC  n 
5 126 DA  n 
5 127 DA  n 
5 128 DT  n 
5 129 DT  n 
5 130 DG  n 
5 131 DA  n 
5 132 DG  n 
5 133 DC  n 
5 134 DG  n 
5 135 DG  n 
5 136 DC  n 
5 137 DC  n 
5 138 DT  n 
5 139 DC  n 
5 140 DG  n 
5 141 DG  n 
5 142 DC  n 
5 143 DA  n 
5 144 DC  n 
5 145 DC  n 
5 146 DG  n 
5 147 DG  n 
5 148 DG  n 
5 149 DA  n 
5 150 DT  n 
5 151 DT  n 
5 152 DC  n 
5 153 DT  n 
5 154 DC  n 
5 155 DC  n 
5 156 DA  n 
5 157 DG  n 
5 158 DG  n 
5 159 DG  n 
5 160 DC  n 
5 161 DA  n 
5 162 DT  n 
5 163 DC  n 
5 164 DA  n 
5 165 DT  n 
5 166 DA  n 
5 167 DG  n 
6 1   DC  n 
6 2   DT  n 
6 3   DA  n 
6 4   DT  n 
6 5   DG  n 
6 6   DA  n 
6 7   DT  n 
6 8   DG  n 
6 9   DC  n 
6 10  DC  n 
6 11  DC  n 
6 12  DT  n 
6 13  DG  n 
6 14  DG  n 
6 15  DA  n 
6 16  DG  n 
6 17  DA  n 
6 18  DA  n 
6 19  DT  n 
6 20  DC  n 
6 21  DC  n 
6 22  DC  n 
6 23  DG  n 
6 24  DG  n 
6 25  DT  n 
6 26  DG  n 
6 27  DC  n 
6 28  DC  n 
6 29  DG  n 
6 30  DA  n 
6 31  DG  n 
6 32  DG  n 
6 33  DC  n 
6 34  DC  n 
6 35  DG  n 
6 36  DC  n 
6 37  DT  n 
6 38  DC  n 
6 39  DA  n 
6 40  DA  n 
6 41  DT  n 
6 42  DT  n 
6 43  DG  n 
6 44  DG  n 
6 45  DT  n 
6 46  DC  n 
6 47  DG  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DA  n 
6 52  DC  n 
6 53  DA  n 
6 54  DG  n 
6 55  DC  n 
6 56  DT  n 
6 57  DC  n 
6 58  DT  n 
6 59  DA  n 
6 60  DG  n 
6 61  DC  n 
6 62  DA  n 
6 63  DC  n 
6 64  DC  n 
6 65  DG  n 
6 66  DC  n 
6 67  DT  n 
6 68  DT  n 
6 69  DA  n 
6 70  DA  n 
6 71  DA  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DA  n 
6 76  DC  n 
6 77  DG  n 
6 78  DT  n 
6 79  DA  n 
6 80  DC  n 
6 81  DG  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DT  n 
6 86  DG  n 
6 87  DT  n 
6 88  DC  n 
6 89  DC  n 
6 90  DC  n 
6 91  DC  n 
6 92  DC  n 
6 93  DG  n 
6 94  DC  n 
6 95  DG  n 
6 96  DT  n 
6 97  DT  n 
6 98  DT  n 
6 99  DT  n 
6 100 DA  n 
6 101 DA  n 
6 102 DC  n 
6 103 DC  n 
6 104 DG  n 
6 105 DC  n 
6 106 DC  n 
6 107 DA  n 
6 108 DA  n 
6 109 DG  n 
6 110 DG  n 
6 111 DG  n 
6 112 DG  n 
6 113 DA  n 
6 114 DT  n 
6 115 DT  n 
6 116 DA  n 
6 117 DC  n 
6 118 DT  n 
6 119 DC  n 
6 120 DC  n 
6 121 DC  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DC  n 
6 127 DT  n 
6 128 DC  n 
6 129 DC  n 
6 130 DA  n 
6 131 DG  n 
6 132 DG  n 
6 133 DC  n 
6 134 DA  n 
6 135 DC  n 
6 136 DG  n 
6 137 DT  n 
6 138 DG  n 
6 139 DT  n 
6 140 DC  n 
6 141 DA  n 
6 142 DG  n 
6 143 DA  n 
6 144 DT  n 
6 145 DA  n 
6 146 DT  n 
6 147 DA  n 
6 148 DT  n 
6 149 DA  n 
6 150 DC  n 
6 151 DA  n 
6 152 DT  n 
6 153 DC  n 
6 154 DC  n 
6 155 DT  n 
6 156 DG  n 
6 157 DT  n 
6 158 DG  n 
6 159 DC  n 
6 160 DA  n 
6 161 DT  n 
6 162 DG  n 
6 163 DT  n 
6 164 DA  n 
6 165 DT  n 
6 166 DT  n 
6 167 DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                                                 ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                                                 ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, h2ac14, LOC494591, XELAEV_18003602mg' ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ?                                                 ? ? ? ? ? ? 
'Xenopus laevis'      8355  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 167 ?                     ? ?                                                 ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 167 ?                     ? ?                                                 ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 
5 PDB 6WZ5         6WZ5   ? 5 ? 1 
6 PDB 6WZ5         6WZ5   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6WZ5 A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 6WZ5 B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 6WZ5 C 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
4  4 6WZ5 D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 6WZ5 E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 6WZ5 F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 6WZ5 G 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
8  4 6WZ5 H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 6WZ5 I 1 ? 167 ? 6WZ5   -83 ? 83  ? -83 83  
10 6 6WZ5 J 1 ? 167 ? 6WZ5   -83 ? 83  ? -83 83  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WZ5 ALA A 102 ? UNP P84233 GLY 103 variant 102 1 
4 6WZ5 THR D 29  ? UNP P02281 SER 33  variant 29  2 
5 6WZ5 ALA E 102 ? UNP P84233 GLY 103 variant 102 3 
8 6WZ5 THR H 29  ? UNP P02281 SER 33  variant 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WZ5 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6WZ5 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.008  ? 13286 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.677  ? 19249 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 29.430 ? 5500  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.043  ? 2192  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.005  ? 1372  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6WZ5 
_struct.title                        'Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WZ5 
_struct_keywords.text            
'DNA repair, PARP1, PARP2, HPF1, ADP-ribosylation, chromatin, histone modifications, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 120 ? GLY A 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? ALA C 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 26  ? LYS C 36  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P11 AB2 ALA C 45  ? ASP C 72  ? ALA C 45  ASP C 72  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 52  ? ASN D 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 GLY D 101 ? LYS D 122 ? GLY D 101 LYS D 122 1 ? 22 
HELX_P HELX_P19 AC1 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 AC3 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 120 ? GLY E 132 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P23 AC5 ASN F 25  ? ILE F 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 AC6 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 ALA G 45  ? ASN G 73  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 AD3 ILE G 79  ? ASP G 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 AD4 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 GLY H 101 ? LYS H 122 ? GLY H 101 LYS H 122 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1   hydrog ? ? I DT 8   N3 ? ? ? 1_555 J DA 160 N1 ? ? I DT -76 J DA 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2   hydrog ? ? I DT 8   O4 ? ? ? 1_555 J DA 160 N6 ? ? I DT -76 J DA 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3   hydrog ? ? I DG 9   N1 ? ? ? 1_555 J DC 159 N3 ? ? I DG -75 J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4   hydrog ? ? I DG 9   N2 ? ? ? 1_555 J DC 159 O2 ? ? I DG -75 J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5   hydrog ? ? I DG 9   O6 ? ? ? 1_555 J DC 159 N4 ? ? I DG -75 J DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6   hydrog ? ? I DC 10  N3 ? ? ? 1_555 J DG 158 N1 ? ? I DC -74 J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7   hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 158 O6 ? ? I DC -74 J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8   hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 158 N2 ? ? I DC -74 J DG 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9   hydrog ? ? I DA 11  N1 ? ? ? 1_555 J DT 157 N3 ? ? I DA -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10  hydrog ? ? I DA 11  N6 ? ? ? 1_555 J DT 157 O4 ? ? I DA -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11  hydrog ? ? I DC 12  N3 ? ? ? 1_555 J DG 156 N1 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12  hydrog ? ? I DC 12  N4 ? ? ? 1_555 J DG 156 O6 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13  hydrog ? ? I DC 12  O2 ? ? ? 1_555 J DG 156 N2 ? ? I DC -72 J DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14  hydrog ? ? I DA 13  N1 ? ? ? 1_555 J DT 155 N3 ? ? I DA -71 J DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15  hydrog ? ? I DA 13  N6 ? ? ? 1_555 J DT 155 O4 ? ? I DA -71 J DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16  hydrog ? ? I DG 14  N1 ? ? ? 1_555 J DC 154 N3 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 154 O2 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18  hydrog ? ? I DG 14  O6 ? ? ? 1_555 J DC 154 N4 ? ? I DG -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19  hydrog ? ? I DG 15  N1 ? ? ? 1_555 J DC 153 N3 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20  hydrog ? ? I DG 15  N2 ? ? ? 1_555 J DC 153 O2 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21  hydrog ? ? I DG 15  O6 ? ? ? 1_555 J DC 153 N4 ? ? I DG -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22  hydrog ? ? I DA 16  N1 ? ? ? 1_555 J DT 152 N3 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23  hydrog ? ? I DA 16  N6 ? ? ? 1_555 J DT 152 O4 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24  hydrog ? ? I DT 17  N3 ? ? ? 1_555 J DA 151 N1 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25  hydrog ? ? I DT 17  O4 ? ? ? 1_555 J DA 151 N6 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26  hydrog ? ? I DG 18  N1 ? ? ? 1_555 J DC 150 N3 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27  hydrog ? ? I DG 18  N2 ? ? ? 1_555 J DC 150 O2 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28  hydrog ? ? I DG 18  O6 ? ? ? 1_555 J DC 150 N4 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29  hydrog ? ? I DT 19  N3 ? ? ? 1_555 J DA 149 N1 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30  hydrog ? ? I DT 19  O4 ? ? ? 1_555 J DA 149 N6 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31  hydrog ? ? I DA 20  N1 ? ? ? 1_555 J DT 148 N3 ? ? I DA -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32  hydrog ? ? I DA 20  N6 ? ? ? 1_555 J DT 148 O4 ? ? I DA -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33  hydrog ? ? I DT 21  N3 ? ? ? 1_555 J DA 147 N1 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34  hydrog ? ? I DT 21  O4 ? ? ? 1_555 J DA 147 N6 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35  hydrog ? ? I DA 22  N1 ? ? ? 1_555 J DT 146 N3 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36  hydrog ? ? I DA 22  N6 ? ? ? 1_555 J DT 146 O4 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37  hydrog ? ? I DT 23  N3 ? ? ? 1_555 J DA 145 N1 ? ? I DT -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38  hydrog ? ? I DT 23  O4 ? ? ? 1_555 J DA 145 N6 ? ? I DT -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39  hydrog ? ? I DA 24  N1 ? ? ? 1_555 J DT 144 N3 ? ? I DA -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40  hydrog ? ? I DA 24  N6 ? ? ? 1_555 J DT 144 O4 ? ? I DA -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41  hydrog ? ? I DT 25  N3 ? ? ? 1_555 J DA 143 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42  hydrog ? ? I DT 25  O4 ? ? ? 1_555 J DA 143 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 142 N1 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 142 O6 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 142 N2 ? ? I DC -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46  hydrog ? ? I DT 27  N3 ? ? ? 1_555 J DA 141 N1 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47  hydrog ? ? I DT 27  O4 ? ? ? 1_555 J DA 141 N6 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48  hydrog ? ? I DG 28  N1 ? ? ? 1_555 J DC 140 N3 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49  hydrog ? ? I DG 28  N2 ? ? ? 1_555 J DC 140 O2 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50  hydrog ? ? I DG 28  O6 ? ? ? 1_555 J DC 140 N4 ? ? I DG -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 139 N3 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 139 O4 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog53  hydrog ? ? I DC 30  N3 ? ? ? 1_555 J DG 138 N1 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54  hydrog ? ? I DC 30  N4 ? ? ? 1_555 J DG 138 O6 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55  hydrog ? ? I DC 30  O2 ? ? ? 1_555 J DG 138 N2 ? ? I DC -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog56  hydrog ? ? I DA 31  N1 ? ? ? 1_555 J DT 137 N3 ? ? I DA -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog57  hydrog ? ? I DA 31  N6 ? ? ? 1_555 J DT 137 O4 ? ? I DA -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58  hydrog ? ? I DC 32  N3 ? ? ? 1_555 J DG 136 N1 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59  hydrog ? ? I DC 32  N4 ? ? ? 1_555 J DG 136 O6 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60  hydrog ? ? I DC 32  O2 ? ? ? 1_555 J DG 136 N2 ? ? I DC -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 135 N3 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 135 O2 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog63  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 135 N4 ? ? I DG -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64  hydrog ? ? I DT 34  N3 ? ? ? 1_555 J DA 134 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65  hydrog ? ? I DT 34  O4 ? ? ? 1_555 J DA 134 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66  hydrog ? ? I DG 35  N1 ? ? ? 1_555 J DC 133 N3 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67  hydrog ? ? I DG 35  N2 ? ? ? 1_555 J DC 133 O2 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog68  hydrog ? ? I DG 35  O6 ? ? ? 1_555 J DC 133 N4 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog69  hydrog ? ? I DC 36  N3 ? ? ? 1_555 J DG 132 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog70  hydrog ? ? I DC 36  N4 ? ? ? 1_555 J DG 132 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog71  hydrog ? ? I DC 36  O2 ? ? ? 1_555 J DG 132 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog72  hydrog ? ? I DC 37  N3 ? ? ? 1_555 J DG 131 N1 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog73  hydrog ? ? I DC 37  N4 ? ? ? 1_555 J DG 131 O6 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog74  hydrog ? ? I DC 37  O2 ? ? ? 1_555 J DG 131 N2 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog75  hydrog ? ? I DT 38  N3 ? ? ? 1_555 J DA 130 N1 ? ? I DT -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog76  hydrog ? ? I DT 38  O4 ? ? ? 1_555 J DA 130 N6 ? ? I DT -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog77  hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DC 129 N3 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog78  hydrog ? ? I DG 39  N2 ? ? ? 1_555 J DC 129 O2 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog79  hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DC 129 N4 ? ? I DG -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog80  hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 128 N3 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog81  hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 128 O2 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog82  hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 128 N4 ? ? I DG -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog83  hydrog ? ? I DA 41  N1 ? ? ? 1_555 J DT 127 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog84  hydrog ? ? I DA 41  N6 ? ? ? 1_555 J DT 127 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog85  hydrog ? ? I DG 42  N1 ? ? ? 1_555 J DC 126 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog86  hydrog ? ? I DG 42  N2 ? ? ? 1_555 J DC 126 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog87  hydrog ? ? I DG 42  O6 ? ? ? 1_555 J DC 126 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog88  hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 125 N3 ? ? I DA -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog89  hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 125 O4 ? ? I DA -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog90  hydrog ? ? I DC 44  N3 ? ? ? 1_555 J DG 124 N1 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog91  hydrog ? ? I DC 44  N4 ? ? ? 1_555 J DG 124 O6 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog92  hydrog ? ? I DC 44  O2 ? ? ? 1_555 J DG 124 N2 ? ? I DC -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog93  hydrog ? ? I DT 45  N3 ? ? ? 1_555 J DA 123 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog94  hydrog ? ? I DT 45  O4 ? ? ? 1_555 J DA 123 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog95  hydrog ? ? I DA 46  N1 ? ? ? 1_555 J DT 122 N3 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog96  hydrog ? ? I DA 46  N6 ? ? ? 1_555 J DT 122 O4 ? ? I DA -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog97  hydrog ? ? I DG 47  N1 ? ? ? 1_555 J DC 121 N3 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog98  hydrog ? ? I DG 47  N2 ? ? ? 1_555 J DC 121 O2 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog99  hydrog ? ? I DG 47  O6 ? ? ? 1_555 J DC 121 N4 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog100 hydrog ? ? I DG 48  N1 ? ? ? 1_555 J DC 120 N3 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog101 hydrog ? ? I DG 48  N2 ? ? ? 1_555 J DC 120 O2 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog102 hydrog ? ? I DG 48  O6 ? ? ? 1_555 J DC 120 N4 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog103 hydrog ? ? I DG 49  N1 ? ? ? 1_555 J DC 119 N3 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog104 hydrog ? ? I DG 49  N2 ? ? ? 1_555 J DC 119 O2 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog105 hydrog ? ? I DG 49  O6 ? ? ? 1_555 J DC 119 N4 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog106 hydrog ? ? I DA 50  N1 ? ? ? 1_555 J DT 118 N3 ? ? I DA -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog107 hydrog ? ? I DA 50  N6 ? ? ? 1_555 J DT 118 O4 ? ? I DA -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog108 hydrog ? ? I DG 51  N1 ? ? ? 1_555 J DC 117 N3 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog109 hydrog ? ? I DG 51  N2 ? ? ? 1_555 J DC 117 O2 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog110 hydrog ? ? I DG 51  O6 ? ? ? 1_555 J DC 117 N4 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog111 hydrog ? ? I DT 52  N3 ? ? ? 1_555 J DA 116 N1 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog112 hydrog ? ? I DT 52  O4 ? ? ? 1_555 J DA 116 N6 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog113 hydrog ? ? I DA 53  N1 ? ? ? 1_555 J DT 115 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog114 hydrog ? ? I DA 53  N6 ? ? ? 1_555 J DT 115 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog115 hydrog ? ? I DA 54  N1 ? ? ? 1_555 J DT 114 N3 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog116 hydrog ? ? I DA 54  N6 ? ? ? 1_555 J DT 114 O4 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog117 hydrog ? ? I DT 55  N3 ? ? ? 1_555 J DA 113 N1 ? ? I DT -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog118 hydrog ? ? I DT 55  O4 ? ? ? 1_555 J DA 113 N6 ? ? I DT -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog119 hydrog ? ? I DC 56  N3 ? ? ? 1_555 J DG 112 N1 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog120 hydrog ? ? I DC 56  N4 ? ? ? 1_555 J DG 112 O6 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog121 hydrog ? ? I DC 56  O2 ? ? ? 1_555 J DG 112 N2 ? ? I DC -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog122 hydrog ? ? I DC 57  N3 ? ? ? 1_555 J DG 111 N1 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog123 hydrog ? ? I DC 57  N4 ? ? ? 1_555 J DG 111 O6 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog124 hydrog ? ? I DC 57  O2 ? ? ? 1_555 J DG 111 N2 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog125 hydrog ? ? I DC 58  N3 ? ? ? 1_555 J DG 110 N1 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog126 hydrog ? ? I DC 58  N4 ? ? ? 1_555 J DG 110 O6 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog127 hydrog ? ? I DC 58  O2 ? ? ? 1_555 J DG 110 N2 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog128 hydrog ? ? I DC 59  N3 ? ? ? 1_555 J DG 109 N1 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog129 hydrog ? ? I DC 59  N4 ? ? ? 1_555 J DG 109 O6 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog130 hydrog ? ? I DC 59  O2 ? ? ? 1_555 J DG 109 N2 ? ? I DC -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog131 hydrog ? ? I DT 60  N3 ? ? ? 1_555 J DA 108 N1 ? ? I DT -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog132 hydrog ? ? I DT 60  O4 ? ? ? 1_555 J DA 108 N6 ? ? I DT -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog133 hydrog ? ? I DT 61  N3 ? ? ? 1_555 J DA 107 N1 ? ? I DT -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog134 hydrog ? ? I DT 61  O4 ? ? ? 1_555 J DA 107 N6 ? ? I DT -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog135 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 106 N3 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog136 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 106 O2 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog137 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 106 N4 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog138 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 105 N3 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog139 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 105 O2 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog140 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 105 N4 ? ? I DG -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog141 hydrog ? ? I DC 64  N3 ? ? ? 1_555 J DG 104 N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog142 hydrog ? ? I DC 64  N4 ? ? ? 1_555 J DG 104 O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog143 hydrog ? ? I DC 64  O2 ? ? ? 1_555 J DG 104 N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog144 hydrog ? ? I DG 65  N1 ? ? ? 1_555 J DC 103 N3 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog145 hydrog ? ? I DG 65  N2 ? ? ? 1_555 J DC 103 O2 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog146 hydrog ? ? I DG 65  O6 ? ? ? 1_555 J DC 103 N4 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog147 hydrog ? ? I DG 66  N1 ? ? ? 1_555 J DC 102 N3 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog148 hydrog ? ? I DG 66  N2 ? ? ? 1_555 J DC 102 O2 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog149 hydrog ? ? I DG 66  O6 ? ? ? 1_555 J DC 102 N4 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog150 hydrog ? ? I DT 67  N3 ? ? ? 1_555 J DA 101 N1 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog151 hydrog ? ? I DT 67  O4 ? ? ? 1_555 J DA 101 N6 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog152 hydrog ? ? I DT 68  N3 ? ? ? 1_555 J DA 100 N1 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog153 hydrog ? ? I DT 68  O4 ? ? ? 1_555 J DA 100 N6 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog154 hydrog ? ? I DA 69  N1 ? ? ? 1_555 J DT 99  N3 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog155 hydrog ? ? I DA 69  N6 ? ? ? 1_555 J DT 99  O4 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog156 hydrog ? ? I DA 70  N1 ? ? ? 1_555 J DT 98  N3 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog157 hydrog ? ? I DA 70  N6 ? ? ? 1_555 J DT 98  O4 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog158 hydrog ? ? I DA 71  N1 ? ? ? 1_555 J DT 97  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog159 hydrog ? ? I DA 71  N6 ? ? ? 1_555 J DT 97  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog160 hydrog ? ? I DA 72  N1 ? ? ? 1_555 J DT 96  N3 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog161 hydrog ? ? I DA 72  N6 ? ? ? 1_555 J DT 96  O4 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog162 hydrog ? ? I DC 73  N3 ? ? ? 1_555 J DG 95  N1 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog163 hydrog ? ? I DC 73  N4 ? ? ? 1_555 J DG 95  O6 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog164 hydrog ? ? I DC 73  O2 ? ? ? 1_555 J DG 95  N2 ? ? I DC -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog165 hydrog ? ? I DG 74  N1 ? ? ? 1_555 J DC 94  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog166 hydrog ? ? I DG 74  N2 ? ? ? 1_555 J DC 94  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog167 hydrog ? ? I DG 74  O6 ? ? ? 1_555 J DC 94  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog168 hydrog ? ? I DC 75  N3 ? ? ? 1_555 J DG 93  N1 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog169 hydrog ? ? I DC 75  N4 ? ? ? 1_555 J DG 93  O6 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog170 hydrog ? ? I DC 75  O2 ? ? ? 1_555 J DG 93  N2 ? ? I DC -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog171 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 92  N3 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog172 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 92  O2 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog173 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 92  N4 ? ? I DG -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog174 hydrog ? ? I DG 77  N1 ? ? ? 1_555 J DC 91  N3 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog175 hydrog ? ? I DG 77  N2 ? ? ? 1_555 J DC 91  O2 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog176 hydrog ? ? I DG 77  O6 ? ? ? 1_555 J DC 91  N4 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog177 hydrog ? ? I DG 78  N1 ? ? ? 1_555 J DC 90  N3 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog178 hydrog ? ? I DG 78  N2 ? ? ? 1_555 J DC 90  O2 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog179 hydrog ? ? I DG 78  O6 ? ? ? 1_555 J DC 90  N4 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog180 hydrog ? ? I DG 79  N1 ? ? ? 1_555 J DC 89  N3 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog181 hydrog ? ? I DG 79  N2 ? ? ? 1_555 J DC 89  O2 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog182 hydrog ? ? I DG 79  O6 ? ? ? 1_555 J DC 89  N4 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog183 hydrog ? ? I DG 80  N1 ? ? ? 1_555 J DC 88  N3 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog184 hydrog ? ? I DG 80  N2 ? ? ? 1_555 J DC 88  O2 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog185 hydrog ? ? I DG 80  O6 ? ? ? 1_555 J DC 88  N4 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog186 hydrog ? ? I DA 81  N1 ? ? ? 1_555 J DT 87  N3 ? ? I DA -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog187 hydrog ? ? I DA 81  N6 ? ? ? 1_555 J DT 87  O4 ? ? I DA -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog188 hydrog ? ? I DC 82  N3 ? ? ? 1_555 J DG 86  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog189 hydrog ? ? I DC 82  N4 ? ? ? 1_555 J DG 86  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog190 hydrog ? ? I DC 82  O2 ? ? ? 1_555 J DG 86  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog191 hydrog ? ? I DA 83  N1 ? ? ? 1_555 J DT 85  N3 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog192 hydrog ? ? I DA 83  N6 ? ? ? 1_555 J DT 85  O4 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog193 hydrog ? ? I DG 84  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog194 hydrog ? ? I DG 84  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog195 hydrog ? ? I DG 84  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog196 hydrog ? ? I DC 85  N3 ? ? ? 1_555 J DG 83  N1 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog197 hydrog ? ? I DC 85  N4 ? ? ? 1_555 J DG 83  O6 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog198 hydrog ? ? I DC 85  O2 ? ? ? 1_555 J DG 83  N2 ? ? I DC 1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog199 hydrog ? ? I DG 86  N1 ? ? ? 1_555 J DC 82  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog200 hydrog ? ? I DG 86  N2 ? ? ? 1_555 J DC 82  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog201 hydrog ? ? I DG 86  O6 ? ? ? 1_555 J DC 82  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog202 hydrog ? ? I DC 87  N3 ? ? ? 1_555 J DG 81  N1 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog203 hydrog ? ? I DC 87  N4 ? ? ? 1_555 J DG 81  O6 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog204 hydrog ? ? I DC 87  O2 ? ? ? 1_555 J DG 81  N2 ? ? I DC 3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog205 hydrog ? ? I DG 88  N1 ? ? ? 1_555 J DC 80  N3 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog206 hydrog ? ? I DG 88  N2 ? ? ? 1_555 J DC 80  O2 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog207 hydrog ? ? I DG 88  O6 ? ? ? 1_555 J DC 80  N4 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog208 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 79  N1 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog209 hydrog ? ? I DT 89  O4 ? ? ? 1_555 J DA 79  N6 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog210 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 78  N3 ? ? I DA 6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog211 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 78  O4 ? ? I DA 6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog212 hydrog ? ? I DC 91  N3 ? ? ? 1_555 J DG 77  N1 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog213 hydrog ? ? I DC 91  N4 ? ? ? 1_555 J DG 77  O6 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog214 hydrog ? ? I DC 91  O2 ? ? ? 1_555 J DG 77  N2 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog215 hydrog ? ? I DG 92  N1 ? ? ? 1_555 J DC 76  N3 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog216 hydrog ? ? I DG 92  N2 ? ? ? 1_555 J DC 76  O2 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog217 hydrog ? ? I DG 92  O6 ? ? ? 1_555 J DC 76  N4 ? ? I DG 8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog218 hydrog ? ? I DT 93  N3 ? ? ? 1_555 J DA 75  N1 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog219 hydrog ? ? I DT 93  O4 ? ? ? 1_555 J DA 75  N6 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog220 hydrog ? ? I DG 94  N1 ? ? ? 1_555 J DC 74  N3 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog221 hydrog ? ? I DG 94  N2 ? ? ? 1_555 J DC 74  O2 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog222 hydrog ? ? I DG 94  O6 ? ? ? 1_555 J DC 74  N4 ? ? I DG 10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog223 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 73  N1 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog224 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 73  O6 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog225 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 73  N2 ? ? I DC 11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog226 hydrog ? ? I DG 96  N1 ? ? ? 1_555 J DC 72  N3 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog227 hydrog ? ? I DG 96  N2 ? ? ? 1_555 J DC 72  O2 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog228 hydrog ? ? I DG 96  O6 ? ? ? 1_555 J DC 72  N4 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog229 hydrog ? ? I DT 97  N3 ? ? ? 1_555 J DA 71  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog230 hydrog ? ? I DT 97  O4 ? ? ? 1_555 J DA 71  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog231 hydrog ? ? I DT 98  N3 ? ? ? 1_555 J DA 70  N1 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog232 hydrog ? ? I DT 98  O4 ? ? ? 1_555 J DA 70  N6 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog233 hydrog ? ? I DT 99  N3 ? ? ? 1_555 J DA 69  N1 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog234 hydrog ? ? I DT 99  O4 ? ? ? 1_555 J DA 69  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog235 hydrog ? ? I DA 100 N1 ? ? ? 1_555 J DT 68  N3 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog236 hydrog ? ? I DA 100 N6 ? ? ? 1_555 J DT 68  O4 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog237 hydrog ? ? I DA 101 N1 ? ? ? 1_555 J DT 67  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog238 hydrog ? ? I DA 101 N6 ? ? ? 1_555 J DT 67  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog239 hydrog ? ? I DG 102 N1 ? ? ? 1_555 J DC 66  N3 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog240 hydrog ? ? I DG 102 N2 ? ? ? 1_555 J DC 66  O2 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog241 hydrog ? ? I DG 102 O6 ? ? ? 1_555 J DC 66  N4 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog242 hydrog ? ? I DC 103 N3 ? ? ? 1_555 J DG 65  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog243 hydrog ? ? I DC 103 N4 ? ? ? 1_555 J DG 65  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog244 hydrog ? ? I DC 103 O2 ? ? ? 1_555 J DG 65  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog245 hydrog ? ? I DG 104 N1 ? ? ? 1_555 J DC 64  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog246 hydrog ? ? I DG 104 N2 ? ? ? 1_555 J DC 64  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog247 hydrog ? ? I DG 104 O6 ? ? ? 1_555 J DC 64  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog248 hydrog ? ? I DG 105 N1 ? ? ? 1_555 J DC 63  N3 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog249 hydrog ? ? I DG 105 N2 ? ? ? 1_555 J DC 63  O2 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog250 hydrog ? ? I DG 105 O6 ? ? ? 1_555 J DC 63  N4 ? ? I DG 21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog251 hydrog ? ? I DT 106 N3 ? ? ? 1_555 J DA 62  N1 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog252 hydrog ? ? I DT 106 O4 ? ? ? 1_555 J DA 62  N6 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog253 hydrog ? ? I DG 107 N1 ? ? ? 1_555 J DC 61  N3 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog254 hydrog ? ? I DG 107 N2 ? ? ? 1_555 J DC 61  O2 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog255 hydrog ? ? I DG 107 O6 ? ? ? 1_555 J DC 61  N4 ? ? I DG 23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog256 hydrog ? ? I DC 108 N3 ? ? ? 1_555 J DG 60  N1 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog257 hydrog ? ? I DC 108 N4 ? ? ? 1_555 J DG 60  O6 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog258 hydrog ? ? I DC 108 O2 ? ? ? 1_555 J DG 60  N2 ? ? I DC 24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog259 hydrog ? ? I DT 109 N3 ? ? ? 1_555 J DA 59  N1 ? ? I DT 25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog260 hydrog ? ? I DT 109 O4 ? ? ? 1_555 J DA 59  N6 ? ? I DT 25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog261 hydrog ? ? I DA 110 N1 ? ? ? 1_555 J DT 58  N3 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog262 hydrog ? ? I DA 110 N6 ? ? ? 1_555 J DT 58  O4 ? ? I DA 26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog263 hydrog ? ? I DG 111 N1 ? ? ? 1_555 J DC 57  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog264 hydrog ? ? I DG 111 N2 ? ? ? 1_555 J DC 57  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog265 hydrog ? ? I DG 111 O6 ? ? ? 1_555 J DC 57  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog266 hydrog ? ? I DA 112 N1 ? ? ? 1_555 J DT 56  N3 ? ? I DA 28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog267 hydrog ? ? I DA 112 N6 ? ? ? 1_555 J DT 56  O4 ? ? I DA 28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog268 hydrog ? ? I DG 113 N1 ? ? ? 1_555 J DC 55  N3 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog269 hydrog ? ? I DG 113 N2 ? ? ? 1_555 J DC 55  O2 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog270 hydrog ? ? I DG 113 O6 ? ? ? 1_555 J DC 55  N4 ? ? I DG 29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog271 hydrog ? ? I DC 114 N3 ? ? ? 1_555 J DG 54  N1 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog272 hydrog ? ? I DC 114 N4 ? ? ? 1_555 J DG 54  O6 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog273 hydrog ? ? I DC 114 O2 ? ? ? 1_555 J DG 54  N2 ? ? I DC 30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog274 hydrog ? ? I DT 115 N3 ? ? ? 1_555 J DA 53  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog275 hydrog ? ? I DT 115 O4 ? ? ? 1_555 J DA 53  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog276 hydrog ? ? I DG 116 N1 ? ? ? 1_555 J DC 52  N3 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog277 hydrog ? ? I DG 116 N2 ? ? ? 1_555 J DC 52  O2 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog278 hydrog ? ? I DG 116 O6 ? ? ? 1_555 J DC 52  N4 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog279 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DA 51  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog280 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DA 51  N6 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog281 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 50  N1 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog282 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 50  O6 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog283 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 50  N2 ? ? I DC 34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog284 hydrog ? ? I DT 119 N3 ? ? ? 1_555 J DA 49  N1 ? ? I DT 35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog285 hydrog ? ? I DT 119 O4 ? ? ? 1_555 J DA 49  N6 ? ? I DT 35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog286 hydrog ? ? I DA 120 N1 ? ? ? 1_555 J DT 48  N3 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog287 hydrog ? ? I DA 120 N6 ? ? ? 1_555 J DT 48  O4 ? ? I DA 36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog288 hydrog ? ? I DC 121 N3 ? ? ? 1_555 J DG 47  N1 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog289 hydrog ? ? I DC 121 N4 ? ? ? 1_555 J DG 47  O6 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog290 hydrog ? ? I DC 121 O2 ? ? ? 1_555 J DG 47  N2 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog291 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 46  N3 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog292 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 46  O2 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog293 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 46  N4 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog294 hydrog ? ? I DA 123 N1 ? ? ? 1_555 J DT 45  N3 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog295 hydrog ? ? I DA 123 N6 ? ? ? 1_555 J DT 45  O4 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog296 hydrog ? ? I DC 124 N3 ? ? ? 1_555 J DG 44  N1 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog297 hydrog ? ? I DC 124 N4 ? ? ? 1_555 J DG 44  O6 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog298 hydrog ? ? I DC 124 O2 ? ? ? 1_555 J DG 44  N2 ? ? I DC 40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog299 hydrog ? ? I DC 125 N3 ? ? ? 1_555 J DG 43  N1 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog300 hydrog ? ? I DC 125 N4 ? ? ? 1_555 J DG 43  O6 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog301 hydrog ? ? I DC 125 O2 ? ? ? 1_555 J DG 43  N2 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog302 hydrog ? ? I DA 126 N1 ? ? ? 1_555 J DT 42  N3 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog303 hydrog ? ? I DA 126 N6 ? ? ? 1_555 J DT 42  O4 ? ? I DA 42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog304 hydrog ? ? I DA 127 N1 ? ? ? 1_555 J DT 41  N3 ? ? I DA 43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog305 hydrog ? ? I DA 127 N6 ? ? ? 1_555 J DT 41  O4 ? ? I DA 43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog306 hydrog ? ? I DT 128 N3 ? ? ? 1_555 J DA 40  N1 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog307 hydrog ? ? I DT 128 O4 ? ? ? 1_555 J DA 40  N6 ? ? I DT 44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog308 hydrog ? ? I DT 129 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog309 hydrog ? ? I DT 129 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog310 hydrog ? ? I DG 130 N1 ? ? ? 1_555 J DC 38  N3 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog311 hydrog ? ? I DG 130 N2 ? ? ? 1_555 J DC 38  O2 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog312 hydrog ? ? I DG 130 O6 ? ? ? 1_555 J DC 38  N4 ? ? I DG 46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog313 hydrog ? ? I DA 131 N1 ? ? ? 1_555 J DT 37  N3 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog314 hydrog ? ? I DA 131 N6 ? ? ? 1_555 J DT 37  O4 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog315 hydrog ? ? I DG 132 N1 ? ? ? 1_555 J DC 36  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog316 hydrog ? ? I DG 132 N2 ? ? ? 1_555 J DC 36  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog317 hydrog ? ? I DG 132 O6 ? ? ? 1_555 J DC 36  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog318 hydrog ? ? I DC 133 N3 ? ? ? 1_555 J DG 35  N1 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog319 hydrog ? ? I DC 133 N4 ? ? ? 1_555 J DG 35  O6 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog320 hydrog ? ? I DC 133 O2 ? ? ? 1_555 J DG 35  N2 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog321 hydrog ? ? I DG 134 N1 ? ? ? 1_555 J DC 34  N3 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog322 hydrog ? ? I DG 134 N2 ? ? ? 1_555 J DC 34  O2 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog323 hydrog ? ? I DG 134 O6 ? ? ? 1_555 J DC 34  N4 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog324 hydrog ? ? I DG 135 N1 ? ? ? 1_555 J DC 33  N3 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog325 hydrog ? ? I DG 135 N2 ? ? ? 1_555 J DC 33  O2 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog326 hydrog ? ? I DG 135 O6 ? ? ? 1_555 J DC 33  N4 ? ? I DG 51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog327 hydrog ? ? I DC 136 N3 ? ? ? 1_555 J DG 32  N1 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog328 hydrog ? ? I DC 136 N4 ? ? ? 1_555 J DG 32  O6 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog329 hydrog ? ? I DC 136 O2 ? ? ? 1_555 J DG 32  N2 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog330 hydrog ? ? I DC 137 N3 ? ? ? 1_555 J DG 31  N1 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog331 hydrog ? ? I DC 137 N4 ? ? ? 1_555 J DG 31  O6 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog332 hydrog ? ? I DC 137 O2 ? ? ? 1_555 J DG 31  N2 ? ? I DC 53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog333 hydrog ? ? I DT 138 N3 ? ? ? 1_555 J DA 30  N1 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog334 hydrog ? ? I DT 138 O4 ? ? ? 1_555 J DA 30  N6 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog335 hydrog ? ? I DC 139 N3 ? ? ? 1_555 J DG 29  N1 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog336 hydrog ? ? I DC 139 N4 ? ? ? 1_555 J DG 29  O6 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog337 hydrog ? ? I DC 139 O2 ? ? ? 1_555 J DG 29  N2 ? ? I DC 55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog338 hydrog ? ? I DG 140 N1 ? ? ? 1_555 J DC 28  N3 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog339 hydrog ? ? I DG 140 N2 ? ? ? 1_555 J DC 28  O2 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog340 hydrog ? ? I DG 140 O6 ? ? ? 1_555 J DC 28  N4 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog341 hydrog ? ? I DG 141 N1 ? ? ? 1_555 J DC 27  N3 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog342 hydrog ? ? I DG 141 N2 ? ? ? 1_555 J DC 27  O2 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog343 hydrog ? ? I DG 141 O6 ? ? ? 1_555 J DC 27  N4 ? ? I DG 57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog344 hydrog ? ? I DC 142 N3 ? ? ? 1_555 J DG 26  N1 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog345 hydrog ? ? I DC 142 N4 ? ? ? 1_555 J DG 26  O6 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog346 hydrog ? ? I DC 142 O2 ? ? ? 1_555 J DG 26  N2 ? ? I DC 58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog347 hydrog ? ? I DA 143 N1 ? ? ? 1_555 J DT 25  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog348 hydrog ? ? I DA 143 N6 ? ? ? 1_555 J DT 25  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog349 hydrog ? ? I DC 144 N3 ? ? ? 1_555 J DG 24  N1 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog350 hydrog ? ? I DC 144 N4 ? ? ? 1_555 J DG 24  O6 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog351 hydrog ? ? I DC 144 O2 ? ? ? 1_555 J DG 24  N2 ? ? I DC 60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog352 hydrog ? ? I DC 145 N3 ? ? ? 1_555 J DG 23  N1 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog353 hydrog ? ? I DC 145 N4 ? ? ? 1_555 J DG 23  O6 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog354 hydrog ? ? I DC 145 O2 ? ? ? 1_555 J DG 23  N2 ? ? I DC 61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog355 hydrog ? ? I DG 146 N1 ? ? ? 1_555 J DC 22  N3 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog356 hydrog ? ? I DG 146 N2 ? ? ? 1_555 J DC 22  O2 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog357 hydrog ? ? I DG 146 O6 ? ? ? 1_555 J DC 22  N4 ? ? I DG 62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog358 hydrog ? ? I DG 147 N1 ? ? ? 1_555 J DC 21  N3 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog359 hydrog ? ? I DG 147 N2 ? ? ? 1_555 J DC 21  O2 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog360 hydrog ? ? I DG 147 O6 ? ? ? 1_555 J DC 21  N4 ? ? I DG 63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog361 hydrog ? ? I DG 148 N1 ? ? ? 1_555 J DC 20  N3 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog362 hydrog ? ? I DG 148 N2 ? ? ? 1_555 J DC 20  O2 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog363 hydrog ? ? I DG 148 O6 ? ? ? 1_555 J DC 20  N4 ? ? I DG 64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog364 hydrog ? ? I DA 149 N1 ? ? ? 1_555 J DT 19  N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog365 hydrog ? ? I DA 149 N6 ? ? ? 1_555 J DT 19  O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog366 hydrog ? ? I DT 150 N3 ? ? ? 1_555 J DA 18  N1 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog367 hydrog ? ? I DT 150 O4 ? ? ? 1_555 J DA 18  N6 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog368 hydrog ? ? I DT 151 N3 ? ? ? 1_555 J DA 17  N1 ? ? I DT 67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog369 hydrog ? ? I DT 151 O4 ? ? ? 1_555 J DA 17  N6 ? ? I DT 67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog370 hydrog ? ? I DC 152 N3 ? ? ? 1_555 J DG 16  N1 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog371 hydrog ? ? I DC 152 N4 ? ? ? 1_555 J DG 16  O6 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog372 hydrog ? ? I DC 152 O2 ? ? ? 1_555 J DG 16  N2 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog373 hydrog ? ? I DT 153 N3 ? ? ? 1_555 J DA 15  N1 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog374 hydrog ? ? I DT 153 O4 ? ? ? 1_555 J DA 15  N6 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog375 hydrog ? ? I DC 154 N3 ? ? ? 1_555 J DG 14  N1 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog376 hydrog ? ? I DC 154 N4 ? ? ? 1_555 J DG 14  O6 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog377 hydrog ? ? I DC 154 O2 ? ? ? 1_555 J DG 14  N2 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog378 hydrog ? ? I DC 155 N3 ? ? ? 1_555 J DG 13  N1 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog379 hydrog ? ? I DC 155 N4 ? ? ? 1_555 J DG 13  O6 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog380 hydrog ? ? I DC 155 O2 ? ? ? 1_555 J DG 13  N2 ? ? I DC 71  J DG -71 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog381 hydrog ? ? I DA 156 N1 ? ? ? 1_555 J DT 12  N3 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog382 hydrog ? ? I DA 156 N6 ? ? ? 1_555 J DT 12  O4 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog383 hydrog ? ? I DG 157 N1 ? ? ? 1_555 J DC 11  N3 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog384 hydrog ? ? I DG 157 N2 ? ? ? 1_555 J DC 11  O2 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog385 hydrog ? ? I DG 157 O6 ? ? ? 1_555 J DC 11  N4 ? ? I DG 73  J DC -73 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog386 hydrog ? ? I DG 158 N1 ? ? ? 1_555 J DC 10  N3 ? ? I DG 74  J DC -74 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog387 hydrog ? ? I DG 158 N2 ? ? ? 1_555 J DC 10  O2 ? ? I DG 74  J DC -74 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog388 hydrog ? ? I DG 158 O6 ? ? ? 1_555 J DC 10  N4 ? ? I DG 74  J DC -74 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog389 hydrog ? ? I DG 159 N1 ? ? ? 1_555 J DC 9   N3 ? ? I DG 75  J DC -75 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog390 hydrog ? ? I DG 159 N2 ? ? ? 1_555 J DC 9   O2 ? ? I DG 75  J DC -75 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog391 hydrog ? ? I DG 159 O6 ? ? ? 1_555 J DC 9   N4 ? ? I DG 75  J DC -75 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog392 hydrog ? ? I DC 160 N3 ? ? ? 1_555 J DG 8   N1 ? ? I DC 76  J DG -76 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog393 hydrog ? ? I DC 160 N4 ? ? ? 1_555 J DG 8   O6 ? ? I DC 76  J DG -76 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog394 hydrog ? ? I DC 160 O2 ? ? ? 1_555 J DG 8   N2 ? ? I DC 76  J DG -76 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
AA1 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
AA2 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA2 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA3 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 50  ? ILE D 51  ? GLY D 50  ILE D 51  
AA6 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
AA6 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
AA7 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA7 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA8 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA8 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
AA2 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA3 1 2 N THR B 96  ? N THR B 96  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 50  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
AA7 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA8 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
_atom_sites.entry_id                    6WZ5 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . LYS A 1 37  ? 250.426 220.522 208.827 1.00 61.83  ? 37  LYS A N     1 
ATOM 2     C CA    . LYS A 1 37  ? 249.558 219.462 209.336 1.00 61.83  ? 37  LYS A CA    1 
ATOM 3     C C     . LYS A 1 37  ? 249.454 219.443 210.870 1.00 61.83  ? 37  LYS A C     1 
ATOM 4     O O     . LYS A 1 37  ? 248.344 219.384 211.396 1.00 61.83  ? 37  LYS A O     1 
ATOM 5     C CB    . LYS A 1 37  ? 250.023 218.093 208.827 1.00 61.83  ? 37  LYS A CB    1 
ATOM 6     C CG    . LYS A 1 37  ? 250.158 217.998 207.319 1.00 61.83  ? 37  LYS A CG    1 
ATOM 7     C CD    . LYS A 1 37  ? 250.824 216.695 206.919 1.00 61.83  ? 37  LYS A CD    1 
ATOM 8     C CE    . LYS A 1 37  ? 251.224 216.700 205.455 1.00 61.83  ? 37  LYS A CE    1 
ATOM 9     N NZ    . LYS A 1 37  ? 252.067 215.517 205.115 1.00 61.83  ? 37  LYS A NZ    1 
ATOM 10    N N     . PRO A 1 38  ? 250.578 219.484 211.594 1.00 59.47  ? 38  PRO A N     1 
ATOM 11    C CA    . PRO A 1 38  ? 250.481 219.518 213.057 1.00 59.47  ? 38  PRO A CA    1 
ATOM 12    C C     . PRO A 1 38  ? 249.754 220.768 213.525 1.00 59.47  ? 38  PRO A C     1 
ATOM 13    O O     . PRO A 1 38  ? 249.945 221.859 212.987 1.00 59.47  ? 38  PRO A O     1 
ATOM 14    C CB    . PRO A 1 38  ? 251.945 219.512 213.513 1.00 59.47  ? 38  PRO A CB    1 
ATOM 15    C CG    . PRO A 1 38  ? 252.689 218.934 212.380 1.00 59.47  ? 38  PRO A CG    1 
ATOM 16    C CD    . PRO A 1 38  ? 251.989 219.441 211.166 1.00 59.47  ? 38  PRO A CD    1 
ATOM 17    N N     . HIS A 1 39  ? 248.907 220.594 214.533 1.00 56.14  ? 39  HIS A N     1 
ATOM 18    C CA    . HIS A 1 39  ? 248.116 221.703 215.042 1.00 56.14  ? 39  HIS A CA    1 
ATOM 19    C C     . HIS A 1 39  ? 249.005 222.714 215.753 1.00 56.14  ? 39  HIS A C     1 
ATOM 20    O O     . HIS A 1 39  ? 249.883 222.351 216.537 1.00 56.14  ? 39  HIS A O     1 
ATOM 21    C CB    . HIS A 1 39  ? 247.040 221.190 215.995 1.00 56.14  ? 39  HIS A CB    1 
ATOM 22    C CG    . HIS A 1 39  ? 246.264 222.275 216.668 1.00 56.14  ? 39  HIS A CG    1 
ATOM 23    N ND1   . HIS A 1 39  ? 246.672 222.858 217.848 1.00 56.14  ? 39  HIS A ND1   1 
ATOM 24    C CD2   . HIS A 1 39  ? 245.105 222.885 216.328 1.00 56.14  ? 39  HIS A CD2   1 
ATOM 25    C CE1   . HIS A 1 39  ? 245.799 223.781 218.204 1.00 56.14  ? 39  HIS A CE1   1 
ATOM 26    N NE2   . HIS A 1 39  ? 244.837 223.817 217.300 1.00 56.14  ? 39  HIS A NE2   1 
ATOM 27    N N     . ARG A 1 40  ? 248.775 223.992 215.466 1.00 50.22  ? 40  ARG A N     1 
ATOM 28    C CA    . ARG A 1 40  ? 249.476 225.075 216.139 1.00 50.22  ? 40  ARG A CA    1 
ATOM 29    C C     . ARG A 1 40  ? 248.481 226.145 216.539 1.00 50.22  ? 40  ARG A C     1 
ATOM 30    O O     . ARG A 1 40  ? 247.653 226.560 215.726 1.00 50.22  ? 40  ARG A O     1 
ATOM 31    C CB    . ARG A 1 40  ? 250.547 225.702 215.248 1.00 50.22  ? 40  ARG A CB    1 
ATOM 32    C CG    . ARG A 1 40  ? 251.800 224.894 215.116 1.00 50.22  ? 40  ARG A CG    1 
ATOM 33    C CD    . ARG A 1 40  ? 252.881 225.723 214.475 1.00 50.22  ? 40  ARG A CD    1 
ATOM 34    N NE    . ARG A 1 40  ? 253.381 226.746 215.380 1.00 50.22  ? 40  ARG A NE    1 
ATOM 35    C CZ    . ARG A 1 40  ? 254.385 226.553 216.225 1.00 50.22  ? 40  ARG A CZ    1 
ATOM 36    N NH1   . ARG A 1 40  ? 254.987 225.375 216.271 1.00 50.22  ? 40  ARG A NH1   1 
ATOM 37    N NH2   . ARG A 1 40  ? 254.786 227.532 217.017 1.00 50.22  ? 40  ARG A NH2   1 
ATOM 38    N N     . TYR A 1 41  ? 248.566 226.590 217.783 1.00 52.78  ? 41  TYR A N     1 
ATOM 39    C CA    . TYR A 1 41  ? 247.873 227.801 218.176 1.00 52.78  ? 41  TYR A CA    1 
ATOM 40    C C     . TYR A 1 41  ? 248.641 229.013 217.672 1.00 52.78  ? 41  TYR A C     1 
ATOM 41    O O     . TYR A 1 41  ? 249.850 228.960 217.445 1.00 52.78  ? 41  TYR A O     1 
ATOM 42    C CB    . TYR A 1 41  ? 247.697 227.861 219.691 1.00 52.78  ? 41  TYR A CB    1 
ATOM 43    C CG    . TYR A 1 41  ? 246.652 226.898 220.197 1.00 52.78  ? 41  TYR A CG    1 
ATOM 44    C CD1   . TYR A 1 41  ? 245.312 227.129 219.967 1.00 52.78  ? 41  TYR A CD1   1 
ATOM 45    C CD2   . TYR A 1 41  ? 247.006 225.756 220.889 1.00 52.78  ? 41  TYR A CD2   1 
ATOM 46    C CE1   . TYR A 1 41  ? 244.356 226.259 220.415 1.00 52.78  ? 41  TYR A CE1   1 
ATOM 47    C CE2   . TYR A 1 41  ? 246.052 224.878 221.346 1.00 52.78  ? 41  TYR A CE2   1 
ATOM 48    C CZ    . TYR A 1 41  ? 244.729 225.134 221.100 1.00 52.78  ? 41  TYR A CZ    1 
ATOM 49    O OH    . TYR A 1 41  ? 243.762 224.271 221.543 1.00 52.78  ? 41  TYR A OH    1 
ATOM 50    N N     . ARG A 1 42  ? 247.915 230.101 217.464 1.00 53.12  ? 42  ARG A N     1 
ATOM 51    C CA    . ARG A 1 42  ? 248.516 231.322 216.979 1.00 53.12  ? 42  ARG A CA    1 
ATOM 52    C C     . ARG A 1 42  ? 249.272 232.030 218.102 1.00 53.12  ? 42  ARG A C     1 
ATOM 53    O O     . ARG A 1 42  ? 249.039 231.768 219.281 1.00 53.12  ? 42  ARG A O     1 
ATOM 54    C CB    . ARG A 1 42  ? 247.437 232.217 216.386 1.00 53.12  ? 42  ARG A CB    1 
ATOM 55    C CG    . ARG A 1 42  ? 246.943 231.709 215.055 1.00 53.12  ? 42  ARG A CG    1 
ATOM 56    C CD    . ARG A 1 42  ? 245.524 232.139 214.773 1.00 53.12  ? 42  ARG A CD    1 
ATOM 57    N NE    . ARG A 1 42  ? 245.332 233.574 214.929 1.00 53.12  ? 42  ARG A NE    1 
ATOM 58    C CZ    . ARG A 1 42  ? 245.755 234.480 214.058 1.00 53.12  ? 42  ARG A CZ    1 
ATOM 59    N NH1   . ARG A 1 42  ? 246.410 234.103 212.969 1.00 53.12  ? 42  ARG A NH1   1 
ATOM 60    N NH2   . ARG A 1 42  ? 245.530 235.766 214.278 1.00 53.12  ? 42  ARG A NH2   1 
ATOM 61    N N     . PRO A 1 43  ? 250.180 232.938 217.757 1.00 46.96  ? 43  PRO A N     1 
ATOM 62    C CA    . PRO A 1 43  ? 251.050 233.537 218.775 1.00 46.96  ? 43  PRO A CA    1 
ATOM 63    C C     . PRO A 1 43  ? 250.338 234.504 219.704 1.00 46.96  ? 43  PRO A C     1 
ATOM 64    O O     . PRO A 1 43  ? 250.247 235.699 219.420 1.00 46.96  ? 43  PRO A O     1 
ATOM 65    C CB    . PRO A 1 43  ? 252.115 234.259 217.943 1.00 46.96  ? 43  PRO A CB    1 
ATOM 66    C CG    . PRO A 1 43  ? 252.096 233.583 216.643 1.00 46.96  ? 43  PRO A CG    1 
ATOM 67    C CD    . PRO A 1 43  ? 250.684 233.200 216.401 1.00 46.96  ? 43  PRO A CD    1 
ATOM 68    N N     . GLY A 1 44  ? 249.813 233.991 220.807 1.00 44.47  ? 44  GLY A N     1 
ATOM 69    C CA    . GLY A 1 44  ? 249.191 234.817 221.819 1.00 44.47  ? 44  GLY A CA    1 
ATOM 70    C C     . GLY A 1 44  ? 248.035 234.096 222.469 1.00 44.47  ? 44  GLY A C     1 
ATOM 71    O O     . GLY A 1 44  ? 247.621 234.431 223.579 1.00 44.47  ? 44  GLY A O     1 
ATOM 72    N N     . THR A 1 45  ? 247.525 233.079 221.778 1.00 46.93  ? 45  THR A N     1 
ATOM 73    C CA    . THR A 1 45  ? 246.457 232.253 222.326 1.00 46.93  ? 45  THR A CA    1 
ATOM 74    C C     . THR A 1 45  ? 246.909 231.554 223.598 1.00 46.93  ? 45  THR A C     1 
ATOM 75    O O     . THR A 1 45  ? 246.217 231.580 224.623 1.00 46.93  ? 45  THR A O     1 
ATOM 76    C CB    . THR A 1 45  ? 246.019 231.239 221.273 1.00 46.93  ? 45  THR A CB    1 
ATOM 77    O OG1   . THR A 1 45  ? 245.639 231.940 220.088 1.00 46.93  ? 45  THR A OG1   1 
ATOM 78    C CG2   . THR A 1 45  ? 244.856 230.422 221.755 1.00 46.93  ? 45  THR A CG2   1 
ATOM 79    N N     . VAL A 1 46  ? 248.093 230.950 223.559 1.00 42.39  ? 46  VAL A N     1 
ATOM 80    C CA    . VAL A 1 46  ? 248.597 230.236 224.720 1.00 42.39  ? 46  VAL A CA    1 
ATOM 81    C C     . VAL A 1 46  ? 249.063 231.210 225.791 1.00 42.39  ? 46  VAL A C     1 
ATOM 82    O O     . VAL A 1 46  ? 248.983 230.910 226.983 1.00 42.39  ? 46  VAL A O     1 
ATOM 83    C CB    . VAL A 1 46  ? 249.709 229.266 224.291 1.00 42.39  ? 46  VAL A CB    1 
ATOM 84    C CG1   . VAL A 1 46  ? 250.160 228.435 225.454 1.00 42.39  ? 46  VAL A CG1   1 
ATOM 85    C CG2   . VAL A 1 46  ? 249.209 228.380 223.173 1.00 42.39  ? 46  VAL A CG2   1 
ATOM 86    N N     . ALA A 1 47  ? 249.520 232.398 225.402 1.00 40.21  ? 47  ALA A N     1 
ATOM 87    C CA    . ALA A 1 47  ? 249.874 233.402 226.397 1.00 40.21  ? 47  ALA A CA    1 
ATOM 88    C C     . ALA A 1 47  ? 248.648 233.871 227.169 1.00 40.21  ? 47  ALA A C     1 
ATOM 89    O O     . ALA A 1 47  ? 248.698 234.016 228.393 1.00 40.21  ? 47  ALA A O     1 
ATOM 90    C CB    . ALA A 1 47  ? 250.568 234.582 225.729 1.00 40.21  ? 47  ALA A CB    1 
ATOM 91    N N     . LEU A 1 48  ? 247.534 234.102 226.473 1.00 40.95  ? 48  LEU A N     1 
ATOM 92    C CA    . LEU A 1 48  ? 246.302 234.476 227.159 1.00 40.95  ? 48  LEU A CA    1 
ATOM 93    C C     . LEU A 1 48  ? 245.777 233.332 228.011 1.00 40.95  ? 48  LEU A C     1 
ATOM 94    O O     . LEU A 1 48  ? 245.245 233.553 229.109 1.00 40.95  ? 48  LEU A O     1 
ATOM 95    C CB    . LEU A 1 48  ? 245.253 234.912 226.145 1.00 40.95  ? 48  LEU A CB    1 
ATOM 96    C CG    . LEU A 1 48  ? 245.525 236.265 225.505 1.00 40.95  ? 48  LEU A CG    1 
ATOM 97    C CD1   . LEU A 1 48  ? 244.730 236.403 224.233 1.00 40.95  ? 48  LEU A CD1   1 
ATOM 98    C CD2   . LEU A 1 48  ? 245.182 237.372 226.473 1.00 40.95  ? 48  LEU A CD2   1 
ATOM 99    N N     . ARG A 1 49  ? 245.918 232.102 227.525 1.00 45.92  ? 49  ARG A N     1 
ATOM 100   C CA    . ARG A 1 49  ? 245.532 230.948 228.322 1.00 45.92  ? 49  ARG A CA    1 
ATOM 101   C C     . ARG A 1 49  ? 246.321 230.892 229.622 1.00 45.92  ? 49  ARG A C     1 
ATOM 102   O O     . ARG A 1 49  ? 245.758 230.667 230.698 1.00 45.92  ? 49  ARG A O     1 
ATOM 103   C CB    . ARG A 1 49  ? 245.744 229.681 227.506 1.00 45.92  ? 49  ARG A CB    1 
ATOM 104   C CG    . ARG A 1 49  ? 244.860 228.548 227.900 1.00 45.92  ? 49  ARG A CG    1 
ATOM 105   C CD    . ARG A 1 49  ? 244.631 227.643 226.720 1.00 45.92  ? 49  ARG A CD    1 
ATOM 106   N NE    . ARG A 1 49  ? 245.824 226.892 226.357 1.00 45.92  ? 49  ARG A NE    1 
ATOM 107   C CZ    . ARG A 1 49  ? 246.067 226.456 225.131 1.00 45.92  ? 49  ARG A CZ    1 
ATOM 108   N NH1   . ARG A 1 49  ? 245.208 226.714 224.157 1.00 45.92  ? 49  ARG A NH1   1 
ATOM 109   N NH2   . ARG A 1 49  ? 247.172 225.778 224.876 1.00 45.92  ? 49  ARG A NH2   1 
ATOM 110   N N     . GLU A 1 50  ? 247.636 231.080 229.535 1.00 39.74  ? 50  GLU A N     1 
ATOM 111   C CA    . GLU A 1 50  ? 248.467 231.080 230.729 1.00 39.74  ? 50  GLU A CA    1 
ATOM 112   C C     . GLU A 1 50  ? 248.110 232.234 231.655 1.00 39.74  ? 50  GLU A C     1 
ATOM 113   O O     . GLU A 1 50  ? 248.141 232.081 232.878 1.00 39.74  ? 50  GLU A O     1 
ATOM 114   C CB    . GLU A 1 50  ? 249.940 231.137 230.339 1.00 39.74  ? 50  GLU A CB    1 
ATOM 115   C CG    . GLU A 1 50  ? 250.437 229.896 229.638 1.00 39.74  ? 50  GLU A CG    1 
ATOM 116   C CD    . GLU A 1 50  ? 251.798 230.091 229.005 1.00 39.74  ? 50  GLU A CD    1 
ATOM 117   O OE1   . GLU A 1 50  ? 252.475 231.081 229.342 1.00 39.74  ? 50  GLU A OE1   1 
ATOM 118   O OE2   . GLU A 1 50  ? 252.197 229.258 228.168 1.00 39.74  ? 50  GLU A OE2   1 
ATOM 119   N N     . ILE A 1 51  ? 247.783 233.400 231.100 1.00 37.06  ? 51  ILE A N     1 
ATOM 120   C CA    . ILE A 1 51  ? 247.341 234.505 231.948 1.00 37.06  ? 51  ILE A CA    1 
ATOM 121   C C     . ILE A 1 51  ? 246.135 234.084 232.770 1.00 37.06  ? 51  ILE A C     1 
ATOM 122   O O     . ILE A 1 51  ? 246.100 234.260 233.993 1.00 37.06  ? 51  ILE A O     1 
ATOM 123   C CB    . ILE A 1 51  ? 247.025 235.753 231.112 1.00 37.06  ? 51  ILE A CB    1 
ATOM 124   C CG1   . ILE A 1 51  ? 248.297 236.369 230.556 1.00 37.06  ? 51  ILE A CG1   1 
ATOM 125   C CG2   . ILE A 1 51  ? 246.295 236.764 231.965 1.00 37.06  ? 51  ILE A CG2   1 
ATOM 126   C CD1   . ILE A 1 51  ? 248.040 237.441 229.551 1.00 37.06  ? 51  ILE A CD1   1 
ATOM 127   N N     . ARG A 1 52  ? 245.129 233.513 232.110 1.00 39.02  ? 52  ARG A N     1 
ATOM 128   C CA    . ARG A 1 52  ? 243.926 233.106 232.826 1.00 39.02  ? 52  ARG A CA    1 
ATOM 129   C C     . ARG A 1 52  ? 244.242 232.052 233.876 1.00 39.02  ? 52  ARG A C     1 
ATOM 130   O O     . ARG A 1 52  ? 243.761 232.125 235.012 1.00 39.02  ? 52  ARG A O     1 
ATOM 131   C CB    . ARG A 1 52  ? 242.879 232.599 231.846 1.00 39.02  ? 52  ARG A CB    1 
ATOM 132   C CG    . ARG A 1 52  ? 242.387 233.678 230.943 1.00 39.02  ? 52  ARG A CG    1 
ATOM 133   C CD    . ARG A 1 52  ? 241.314 233.193 230.023 1.00 39.02  ? 52  ARG A CD    1 
ATOM 134   N NE    . ARG A 1 52  ? 240.882 234.264 229.139 1.00 39.02  ? 52  ARG A NE    1 
ATOM 135   C CZ    . ARG A 1 52  ? 241.185 234.334 227.851 1.00 39.02  ? 52  ARG A CZ    1 
ATOM 136   N NH1   . ARG A 1 52  ? 241.906 233.381 227.285 1.00 39.02  ? 52  ARG A NH1   1 
ATOM 137   N NH2   . ARG A 1 52  ? 240.750 235.352 227.125 1.00 39.02  ? 52  ARG A NH2   1 
ATOM 138   N N     . ARG A 1 53  ? 245.078 231.080 233.521 1.00 38.46  ? 53  ARG A N     1 
ATOM 139   C CA    . ARG A 1 53  ? 245.407 230.004 234.449 1.00 38.46  ? 53  ARG A CA    1 
ATOM 140   C C     . ARG A 1 53  ? 246.124 230.528 235.689 1.00 38.46  ? 53  ARG A C     1 
ATOM 141   O O     . ARG A 1 53  ? 245.748 230.210 236.825 1.00 38.46  ? 53  ARG A O     1 
ATOM 142   C CB    . ARG A 1 53  ? 246.259 228.962 233.738 1.00 38.46  ? 53  ARG A CB    1 
ATOM 143   C CG    . ARG A 1 53  ? 246.907 227.981 234.664 1.00 38.46  ? 53  ARG A CG    1 
ATOM 144   C CD    . ARG A 1 53  ? 247.922 227.142 233.940 1.00 38.46  ? 53  ARG A CD    1 
ATOM 145   N NE    . ARG A 1 53  ? 248.668 226.311 234.868 1.00 38.46  ? 53  ARG A NE    1 
ATOM 146   C CZ    . ARG A 1 53  ? 249.663 225.510 234.512 1.00 38.46  ? 53  ARG A CZ    1 
ATOM 147   N NH1   . ARG A 1 53  ? 250.027 225.435 233.241 1.00 38.46  ? 53  ARG A NH1   1 
ATOM 148   N NH2   . ARG A 1 53  ? 250.292 224.787 235.425 1.00 38.46  ? 53  ARG A NH2   1 
ATOM 149   N N     . TYR A 1 54  ? 247.162 231.333 235.493 1.00 37.07  ? 54  TYR A N     1 
ATOM 150   C CA    . TYR A 1 54  ? 247.953 231.806 236.618 1.00 37.07  ? 54  TYR A CA    1 
ATOM 151   C C     . TYR A 1 54  ? 247.273 232.916 237.395 1.00 37.07  ? 54  TYR A C     1 
ATOM 152   O O     . TYR A 1 54  ? 247.690 233.200 238.519 1.00 37.07  ? 54  TYR A O     1 
ATOM 153   C CB    . TYR A 1 54  ? 249.331 232.261 236.147 1.00 37.07  ? 54  TYR A CB    1 
ATOM 154   C CG    . TYR A 1 54  ? 250.160 231.111 235.659 1.00 37.07  ? 54  TYR A CG    1 
ATOM 155   C CD1   . TYR A 1 54  ? 250.485 230.071 236.505 1.00 37.07  ? 54  TYR A CD1   1 
ATOM 156   C CD2   . TYR A 1 54  ? 250.599 231.053 234.353 1.00 37.07  ? 54  TYR A CD2   1 
ATOM 157   C CE1   . TYR A 1 54  ? 251.220 229.012 236.069 1.00 37.07  ? 54  TYR A CE1   1 
ATOM 158   C CE2   . TYR A 1 54  ? 251.338 229.997 233.910 1.00 37.07  ? 54  TYR A CE2   1 
ATOM 159   C CZ    . TYR A 1 54  ? 251.646 228.978 234.772 1.00 37.07  ? 54  TYR A CZ    1 
ATOM 160   O OH    . TYR A 1 54  ? 252.390 227.915 234.333 1.00 37.07  ? 54  TYR A OH    1 
ATOM 161   N N     . GLN A 1 55  ? 246.242 233.545 236.840 1.00 37.49  ? 55  GLN A N     1 
ATOM 162   C CA    . GLN A 1 55  ? 245.437 234.440 237.653 1.00 37.49  ? 55  GLN A CA    1 
ATOM 163   C C     . GLN A 1 55  ? 244.329 233.710 238.393 1.00 37.49  ? 55  GLN A C     1 
ATOM 164   O O     . GLN A 1 55  ? 243.835 234.219 239.401 1.00 37.49  ? 55  GLN A O     1 
ATOM 165   C CB    . GLN A 1 55  ? 244.863 235.554 236.789 1.00 37.49  ? 55  GLN A CB    1 
ATOM 166   C CG    . GLN A 1 55  ? 245.918 236.519 236.320 1.00 37.49  ? 55  GLN A CG    1 
ATOM 167   C CD    . GLN A 1 55  ? 245.344 237.642 235.506 1.00 37.49  ? 55  GLN A CD    1 
ATOM 168   O OE1   . GLN A 1 55  ? 244.209 237.572 235.059 1.00 37.49  ? 55  GLN A OE1   1 
ATOM 169   N NE2   . GLN A 1 55  ? 246.119 238.692 235.320 1.00 37.49  ? 55  GLN A NE2   1 
ATOM 170   N N     . LYS A 1 56  ? 243.924 232.536 237.917 1.00 39.99  ? 56  LYS A N     1 
ATOM 171   C CA    . LYS A 1 56  ? 243.090 231.672 238.737 1.00 39.99  ? 56  LYS A CA    1 
ATOM 172   C C     . LYS A 1 56  ? 243.859 231.106 239.916 1.00 39.99  ? 56  LYS A C     1 
ATOM 173   O O     . LYS A 1 56  ? 243.323 231.035 241.023 1.00 39.99  ? 56  LYS A O     1 
ATOM 174   C CB    . LYS A 1 56  ? 242.535 230.518 237.910 1.00 39.99  ? 56  LYS A CB    1 
ATOM 175   C CG    . LYS A 1 56  ? 241.130 230.714 237.427 1.00 39.99  ? 56  LYS A CG    1 
ATOM 176   C CD    . LYS A 1 56  ? 240.571 229.405 236.908 1.00 39.99  ? 56  LYS A CD    1 
ATOM 177   C CE    . LYS A 1 56  ? 239.131 229.557 236.457 1.00 39.99  ? 56  LYS A CE    1 
ATOM 178   N NZ    . LYS A 1 56  ? 238.476 228.235 236.233 1.00 39.99  ? 56  LYS A NZ    1 
ATOM 179   N N     . SER A 1 57  ? 245.111 230.725 239.709 1.00 39.24  ? 57  SER A N     1 
ATOM 180   C CA    . SER A 1 57  ? 245.846 229.994 240.727 1.00 39.24  ? 57  SER A CA    1 
ATOM 181   C C     . SER A 1 57  ? 246.416 230.933 241.789 1.00 39.24  ? 57  SER A C     1 
ATOM 182   O O     . SER A 1 57  ? 246.391 232.157 241.661 1.00 39.24  ? 57  SER A O     1 
ATOM 183   C CB    . SER A 1 57  ? 246.960 229.180 240.081 1.00 39.24  ? 57  SER A CB    1 
ATOM 184   O OG    . SER A 1 57  ? 247.988 230.020 239.604 1.00 39.24  ? 57  SER A OG    1 
ATOM 185   N N     . THR A 1 58  ? 246.916 230.337 242.869 1.00 38.94  ? 58  THR A N     1 
ATOM 186   C CA    . THR A 1 58  ? 247.538 231.083 243.953 1.00 38.94  ? 58  THR A CA    1 
ATOM 187   C C     . THR A 1 58  ? 248.870 230.506 244.398 1.00 38.94  ? 58  THR A C     1 
ATOM 188   O O     . THR A 1 58  ? 249.502 231.080 245.288 1.00 38.94  ? 58  THR A O     1 
ATOM 189   C CB    . THR A 1 58  ? 246.614 231.162 245.177 1.00 38.94  ? 58  THR A CB    1 
ATOM 190   O OG1   . THR A 1 58  ? 246.285 229.843 245.626 1.00 38.94  ? 58  THR A OG1   1 
ATOM 191   C CG2   . THR A 1 58  ? 245.344 231.924 244.860 1.00 38.94  ? 58  THR A CG2   1 
ATOM 192   N N     . GLU A 1 59  ? 249.311 229.393 243.828 1.00 39.48  ? 59  GLU A N     1 
ATOM 193   C CA    . GLU A 1 59  ? 250.542 228.790 244.302 1.00 39.48  ? 59  GLU A CA    1 
ATOM 194   C C     . GLU A 1 59  ? 251.745 229.609 243.852 1.00 39.48  ? 59  GLU A C     1 
ATOM 195   O O     . GLU A 1 59  ? 251.691 230.366 242.882 1.00 39.48  ? 59  GLU A O     1 
ATOM 196   C CB    . GLU A 1 59  ? 250.669 227.351 243.807 1.00 39.48  ? 59  GLU A CB    1 
ATOM 197   C CG    . GLU A 1 59  ? 251.253 227.209 242.422 1.00 39.48  ? 59  GLU A CG    1 
ATOM 198   C CD    . GLU A 1 59  ? 250.267 227.563 241.342 1.00 39.48  ? 59  GLU A CD    1 
ATOM 199   O OE1   . GLU A 1 59  ? 249.100 227.819 241.682 1.00 39.48  ? 59  GLU A OE1   1 
ATOM 200   O OE2   . GLU A 1 59  ? 250.652 227.581 240.154 1.00 39.48  ? 59  GLU A OE2   1 
ATOM 201   N N     . LEU A 1 60  ? 252.837 229.459 244.587 1.00 37.38  ? 60  LEU A N     1 
ATOM 202   C CA    . LEU A 1 60  ? 254.065 230.154 244.244 1.00 37.38  ? 60  LEU A CA    1 
ATOM 203   C C     . LEU A 1 60  ? 254.586 229.674 242.896 1.00 37.38  ? 60  LEU A C     1 
ATOM 204   O O     . LEU A 1 60  ? 254.400 228.521 242.506 1.00 37.38  ? 60  LEU A O     1 
ATOM 205   C CB    . LEU A 1 60  ? 255.112 229.941 245.331 1.00 37.38  ? 60  LEU A CB    1 
ATOM 206   C CG    . LEU A 1 60  ? 254.747 230.527 246.692 1.00 37.38  ? 60  LEU A CG    1 
ATOM 207   C CD1   . LEU A 1 60  ? 255.692 230.020 247.745 1.00 37.38  ? 60  LEU A CD1   1 
ATOM 208   C CD2   . LEU A 1 60  ? 254.787 232.037 246.650 1.00 37.38  ? 60  LEU A CD2   1 
ATOM 209   N N     . LEU A 1 61  ? 255.243 230.582 242.179 1.00 35.91  ? 61  LEU A N     1 
ATOM 210   C CA    . LEU A 1 61  ? 255.641 230.332 240.805 1.00 35.91  ? 61  LEU A CA    1 
ATOM 211   C C     . LEU A 1 61  ? 257.139 230.185 240.620 1.00 35.91  ? 61  LEU A C     1 
ATOM 212   O O     . LEU A 1 61  ? 257.571 229.791 239.537 1.00 35.91  ? 61  LEU A O     1 
ATOM 213   C CB    . LEU A 1 61  ? 255.130 231.459 239.900 1.00 35.91  ? 61  LEU A CB    1 
ATOM 214   C CG    . LEU A 1 61  ? 253.625 231.685 240.016 1.00 35.91  ? 61  LEU A CG    1 
ATOM 215   C CD1   . LEU A 1 61  ? 253.199 232.898 239.234 1.00 35.91  ? 61  LEU A CD1   1 
ATOM 216   C CD2   . LEU A 1 61  ? 252.872 230.462 239.558 1.00 35.91  ? 61  LEU A CD2   1 
ATOM 217   N N     . ILE A 1 62  ? 257.922 230.507 241.614 1.00 36.33  ? 62  ILE A N     1 
ATOM 218   C CA    . ILE A 1 62  ? 259.356 230.265 241.602 1.00 36.33  ? 62  ILE A CA    1 
ATOM 219   C C     . ILE A 1 62  ? 259.611 228.932 242.283 1.00 36.33  ? 62  ILE A C     1 
ATOM 220   O O     . ILE A 1 62  ? 258.858 228.521 243.168 1.00 36.33  ? 62  ILE A O     1 
ATOM 221   C CB    . ILE A 1 62  ? 260.107 231.418 242.295 1.00 36.33  ? 62  ILE A CB    1 
ATOM 222   C CG1   . ILE A 1 62  ? 259.700 232.750 241.679 1.00 36.33  ? 62  ILE A CG1   1 
ATOM 223   C CG2   . ILE A 1 62  ? 261.599 231.236 242.181 1.00 36.33  ? 62  ILE A CG2   1 
ATOM 224   C CD1   . ILE A 1 62  ? 260.427 233.935 242.253 1.00 36.33  ? 62  ILE A CD1   1 
ATOM 225   N N     . ARG A 1 63  ? 260.661 228.236 241.860 1.00 38.51  ? 63  ARG A N     1 
ATOM 226   C CA    . ARG A 1 63  ? 261.037 226.996 242.522 1.00 38.51  ? 63  ARG A CA    1 
ATOM 227   C C     . ARG A 1 63  ? 261.611 227.282 243.905 1.00 38.51  ? 63  ARG A C     1 
ATOM 228   O O     . ARG A 1 63  ? 262.470 228.157 244.078 1.00 38.51  ? 63  ARG A O     1 
ATOM 229   C CB    . ARG A 1 63  ? 262.053 226.224 241.683 1.00 38.51  ? 63  ARG A CB    1 
ATOM 230   C CG    . ARG A 1 63  ? 261.605 225.801 240.298 1.00 38.51  ? 63  ARG A CG    1 
ATOM 231   C CD    . ARG A 1 63  ? 260.551 224.720 240.338 1.00 38.51  ? 63  ARG A CD    1 
ATOM 232   N NE    . ARG A 1 63  ? 259.221 225.299 240.409 1.00 38.51  ? 63  ARG A NE    1 
ATOM 233   C CZ    . ARG A 1 63  ? 258.107 224.601 240.566 1.00 38.51  ? 63  ARG A CZ    1 
ATOM 234   N NH1   . ARG A 1 63  ? 258.156 223.283 240.669 1.00 38.51  ? 63  ARG A NH1   1 
ATOM 235   N NH2   . ARG A 1 63  ? 256.943 225.225 240.621 1.00 38.51  ? 63  ARG A NH2   1 
ATOM 236   N N     . LYS A 1 64  ? 261.138 226.513 244.889 1.00 37.63  ? 64  LYS A N     1 
ATOM 237   C CA    . LYS A 1 64  ? 261.484 226.760 246.284 1.00 37.63  ? 64  LYS A CA    1 
ATOM 238   C C     . LYS A 1 64  ? 262.980 226.652 246.524 1.00 37.63  ? 64  LYS A C     1 
ATOM 239   O O     . LYS A 1 64  ? 263.569 227.523 247.164 1.00 37.63  ? 64  LYS A O     1 
ATOM 240   C CB    . LYS A 1 64  ? 260.757 225.780 247.197 1.00 37.63  ? 64  LYS A CB    1 
ATOM 241   C CG    . LYS A 1 64  ? 259.295 225.634 246.937 1.00 37.63  ? 64  LYS A CG    1 
ATOM 242   C CD    . LYS A 1 64  ? 258.584 226.945 247.045 1.00 37.63  ? 64  LYS A CD    1 
ATOM 243   C CE    . LYS A 1 64  ? 257.097 226.725 246.978 1.00 37.63  ? 64  LYS A CE    1 
ATOM 244   N NZ    . LYS A 1 64  ? 256.710 225.675 247.947 1.00 37.63  ? 64  LYS A NZ    1 
ATOM 245   N N     . LEU A 1 65  ? 263.602 225.567 246.068 1.00 38.45  ? 65  LEU A N     1 
ATOM 246   C CA    . LEU A 1 65  ? 265.018 225.363 246.362 1.00 38.45  ? 65  LEU A CA    1 
ATOM 247   C C     . LEU A 1 65  ? 265.917 226.407 245.720 1.00 38.45  ? 65  LEU A C     1 
ATOM 248   O O     . LEU A 1 65  ? 266.830 226.900 246.407 1.00 38.45  ? 65  LEU A O     1 
ATOM 249   C CB    . LEU A 1 65  ? 265.448 223.952 245.944 1.00 38.45  ? 65  LEU A CB    1 
ATOM 250   C CG    . LEU A 1 65  ? 265.037 222.802 246.851 1.00 38.45  ? 65  LEU A CG    1 
ATOM 251   C CD1   . LEU A 1 65  ? 265.713 221.532 246.398 1.00 38.45  ? 65  LEU A CD1   1 
ATOM 252   C CD2   . LEU A 1 65  ? 265.404 223.114 248.278 1.00 38.45  ? 65  LEU A CD2   1 
ATOM 253   N N     . PRO A 1 66  ? 265.753 226.767 244.445 1.00 37.83  ? 66  PRO A N     1 
ATOM 254   C CA    . PRO A 1 66  ? 266.523 227.896 243.922 1.00 37.83  ? 66  PRO A CA    1 
ATOM 255   C C     . PRO A 1 66  ? 266.268 229.187 244.669 1.00 37.83  ? 66  PRO A C     1 
ATOM 256   O O     . PRO A 1 66  ? 267.218 229.940 244.916 1.00 37.83  ? 66  PRO A O     1 
ATOM 257   C CB    . PRO A 1 66  ? 266.060 227.974 242.465 1.00 37.83  ? 66  PRO A CB    1 
ATOM 258   C CG    . PRO A 1 66  ? 265.678 226.615 242.140 1.00 37.83  ? 66  PRO A CG    1 
ATOM 259   C CD    . PRO A 1 66  ? 265.043 226.067 243.365 1.00 37.83  ? 66  PRO A CD    1 
ATOM 260   N N     . PHE A 1 67  ? 265.018 229.478 245.036 1.00 35.91  ? 67  PHE A N     1 
ATOM 261   C CA    . PHE A 1 67  ? 264.783 230.709 245.777 1.00 35.91  ? 67  PHE A CA    1 
ATOM 262   C C     . PHE A 1 67  ? 265.487 230.682 247.128 1.00 35.91  ? 67  PHE A C     1 
ATOM 263   O O     . PHE A 1 67  ? 266.052 231.689 247.564 1.00 35.91  ? 67  PHE A O     1 
ATOM 264   C CB    . PHE A 1 67  ? 263.291 230.957 245.958 1.00 35.91  ? 67  PHE A CB    1 
ATOM 265   C CG    . PHE A 1 67  ? 262.991 232.285 246.556 1.00 35.91  ? 67  PHE A CG    1 
ATOM 266   C CD1   . PHE A 1 67  ? 262.881 233.400 245.758 1.00 35.91  ? 67  PHE A CD1   1 
ATOM 267   C CD2   . PHE A 1 67  ? 262.878 232.431 247.919 1.00 35.91  ? 67  PHE A CD2   1 
ATOM 268   C CE1   . PHE A 1 67  ? 262.635 234.624 246.304 1.00 35.91  ? 67  PHE A CE1   1 
ATOM 269   C CE2   . PHE A 1 67  ? 262.626 233.655 248.465 1.00 35.91  ? 67  PHE A CE2   1 
ATOM 270   C CZ    . PHE A 1 67  ? 262.505 234.753 247.658 1.00 35.91  ? 67  PHE A CZ    1 
ATOM 271   N N     . GLN A 1 68  ? 265.474 229.534 247.796 1.00 37.31  ? 68  GLN A N     1 
ATOM 272   C CA    . GLN A 1 68  ? 266.098 229.425 249.106 1.00 37.31  ? 68  GLN A CA    1 
ATOM 273   C C     . GLN A 1 68  ? 267.609 229.577 249.017 1.00 37.31  ? 68  GLN A C     1 
ATOM 274   O O     . GLN A 1 68  ? 268.219 230.249 249.857 1.00 37.31  ? 68  GLN A O     1 
ATOM 275   C CB    . GLN A 1 68  ? 265.727 228.095 249.743 1.00 37.31  ? 68  GLN A CB    1 
ATOM 276   C CG    . GLN A 1 68  ? 266.306 227.903 251.110 1.00 37.31  ? 68  GLN A CG    1 
ATOM 277   C CD    . GLN A 1 68  ? 265.760 226.688 251.792 1.00 37.31  ? 68  GLN A CD    1 
ATOM 278   O OE1   . GLN A 1 68  ? 265.052 225.893 251.188 1.00 37.31  ? 68  GLN A OE1   1 
ATOM 279   N NE2   . GLN A 1 68  ? 266.077 226.535 253.065 1.00 37.31  ? 68  GLN A NE2   1 
ATOM 280   N N     . ARG A 1 69  ? 268.231 228.960 248.012 1.00 38.34  ? 69  ARG A N     1 
ATOM 281   C CA    . ARG A 1 69  ? 269.658 229.175 247.809 1.00 38.34  ? 69  ARG A CA    1 
ATOM 282   C C     . ARG A 1 69  ? 269.955 230.641 247.539 1.00 38.34  ? 69  ARG A C     1 
ATOM 283   O O     . ARG A 1 69  ? 270.945 231.180 248.040 1.00 38.34  ? 69  ARG A O     1 
ATOM 284   C CB    . ARG A 1 69  ? 270.181 228.315 246.663 1.00 38.34  ? 69  ARG A CB    1 
ATOM 285   C CG    . ARG A 1 69  ? 270.300 226.855 246.980 1.00 38.34  ? 69  ARG A CG    1 
ATOM 286   C CD    . ARG A 1 69  ? 271.107 226.142 245.927 1.00 38.34  ? 69  ARG A CD    1 
ATOM 287   N NE    . ARG A 1 69  ? 270.561 226.336 244.592 1.00 38.34  ? 69  ARG A NE    1 
ATOM 288   C CZ    . ARG A 1 69  ? 269.680 225.526 244.023 1.00 38.34  ? 69  ARG A CZ    1 
ATOM 289   N NH1   . ARG A 1 69  ? 269.240 224.467 244.675 1.00 38.34  ? 69  ARG A NH1   1 
ATOM 290   N NH2   . ARG A 1 69  ? 269.240 225.780 242.803 1.00 38.34  ? 69  ARG A NH2   1 
ATOM 291   N N     . LEU A 1 70  ? 269.111 231.300 246.747 1.00 37.37  ? 70  LEU A N     1 
ATOM 292   C CA    . LEU A 1 70  ? 269.291 232.727 246.508 1.00 37.37  ? 70  LEU A CA    1 
ATOM 293   C C     . LEU A 1 70  ? 269.240 233.519 247.806 1.00 37.37  ? 70  LEU A C     1 
ATOM 294   O O     . LEU A 1 70  ? 270.077 234.398 248.040 1.00 37.37  ? 70  LEU A O     1 
ATOM 295   C CB    . LEU A 1 70  ? 268.231 233.233 245.536 1.00 37.37  ? 70  LEU A CB    1 
ATOM 296   C CG    . LEU A 1 70  ? 268.190 234.751 245.399 1.00 37.37  ? 70  LEU A CG    1 
ATOM 297   C CD1   . LEU A 1 70  ? 269.473 235.282 244.802 1.00 37.37  ? 70  LEU A CD1   1 
ATOM 298   C CD2   . LEU A 1 70  ? 267.009 235.187 244.587 1.00 37.37  ? 70  LEU A CD2   1 
ATOM 299   N N     . VAL A 1 71  ? 268.261 233.225 248.659 1.00 37.52  ? 71  VAL A N     1 
ATOM 300   C CA    . VAL A 1 71  ? 268.117 233.957 249.915 1.00 37.52  ? 71  VAL A CA    1 
ATOM 301   C C     . VAL A 1 71  ? 269.351 233.765 250.786 1.00 37.52  ? 71  VAL A C     1 
ATOM 302   O O     . VAL A 1 71  ? 269.889 234.725 251.348 1.00 37.52  ? 71  VAL A O     1 
ATOM 303   C CB    . VAL A 1 71  ? 266.836 233.522 250.645 1.00 37.52  ? 71  VAL A CB    1 
ATOM 304   C CG1   . VAL A 1 71  ? 266.955 233.793 252.118 1.00 37.52  ? 71  VAL A CG1   1 
ATOM 305   C CG2   . VAL A 1 71  ? 265.650 234.259 250.088 1.00 37.52  ? 71  VAL A CG2   1 
ATOM 306   N N     . ARG A 1 72  ? 269.824 232.524 250.904 1.00 38.71  ? 72  ARG A N     1 
ATOM 307   C CA    . ARG A 1 72  ? 270.993 232.270 251.741 1.00 38.71  ? 72  ARG A CA    1 
ATOM 308   C C     . ARG A 1 72  ? 272.236 232.946 251.179 1.00 38.71  ? 72  ARG A C     1 
ATOM 309   O O     . ARG A 1 72  ? 273.074 233.454 251.934 1.00 38.71  ? 72  ARG A O     1 
ATOM 310   C CB    . ARG A 1 72  ? 271.215 230.772 251.894 1.00 38.71  ? 72  ARG A CB    1 
ATOM 311   C CG    . ARG A 1 72  ? 270.046 230.071 252.519 1.00 38.71  ? 72  ARG A CG    1 
ATOM 312   C CD    . ARG A 1 72  ? 270.300 228.602 252.699 1.00 38.71  ? 72  ARG A CD    1 
ATOM 313   N NE    . ARG A 1 72  ? 269.167 227.958 253.346 1.00 38.71  ? 72  ARG A NE    1 
ATOM 314   C CZ    . ARG A 1 72  ? 268.996 227.900 254.658 1.00 38.71  ? 72  ARG A CZ    1 
ATOM 315   N NH1   . ARG A 1 72  ? 269.888 228.445 255.466 1.00 38.71  ? 72  ARG A NH1   1 
ATOM 316   N NH2   . ARG A 1 72  ? 267.931 227.306 255.162 1.00 38.71  ? 72  ARG A NH2   1 
ATOM 317   N N     . GLU A 1 73  ? 272.370 232.971 249.855 1.00 41.76  ? 73  GLU A N     1 
ATOM 318   C CA    . GLU A 1 73  ? 273.506 233.647 249.247 1.00 41.76  ? 73  GLU A CA    1 
ATOM 319   C C     . GLU A 1 73  ? 273.472 235.136 249.543 1.00 41.76  ? 73  GLU A C     1 
ATOM 320   O O     . GLU A 1 73  ? 274.495 235.741 249.873 1.00 41.76  ? 73  GLU A O     1 
ATOM 321   C CB    . GLU A 1 73  ? 273.513 233.405 247.744 1.00 41.76  ? 73  GLU A CB    1 
ATOM 322   C CG    . GLU A 1 73  ? 274.633 234.115 247.039 1.00 41.76  ? 73  GLU A CG    1 
ATOM 323   C CD    . GLU A 1 73  ? 274.405 234.232 245.553 1.00 41.76  ? 73  GLU A CD    1 
ATOM 324   O OE1   . GLU A 1 73  ? 274.144 235.355 245.077 1.00 41.76  ? 73  GLU A OE1   1 
ATOM 325   O OE2   . GLU A 1 73  ? 274.474 233.200 244.860 1.00 41.76  ? 73  GLU A OE2   1 
ATOM 326   N N     . ILE A 1 74  ? 272.296 235.747 249.422 1.00 38.82  ? 74  ILE A N     1 
ATOM 327   C CA    . ILE A 1 74  ? 272.165 237.168 249.717 1.00 38.82  ? 74  ILE A CA    1 
ATOM 328   C C     . ILE A 1 74  ? 272.473 237.441 251.183 1.00 38.82  ? 74  ILE A C     1 
ATOM 329   O O     . ILE A 1 74  ? 273.114 238.442 251.517 1.00 38.82  ? 74  ILE A O     1 
ATOM 330   C CB    . ILE A 1 74  ? 270.762 237.662 249.323 1.00 38.82  ? 74  ILE A CB    1 
ATOM 331   C CG1   . ILE A 1 74  ? 270.614 237.647 247.805 1.00 38.82  ? 74  ILE A CG1   1 
ATOM 332   C CG2   . ILE A 1 74  ? 270.496 239.048 249.872 1.00 38.82  ? 74  ILE A CG2   1 
ATOM 333   C CD1   . ILE A 1 74  ? 269.281 238.105 247.322 1.00 38.82  ? 74  ILE A CD1   1 
ATOM 334   N N     . ALA A 1 75  ? 272.049 236.549 252.078 1.00 39.70  ? 75  ALA A N     1 
ATOM 335   C CA    . ALA A 1 75  ? 272.269 236.783 253.500 1.00 39.70  ? 75  ALA A CA    1 
ATOM 336   C C     . ALA A 1 75  ? 273.716 236.559 253.919 1.00 39.70  ? 75  ALA A C     1 
ATOM 337   O O     . ALA A 1 75  ? 274.138 237.114 254.941 1.00 39.70  ? 75  ALA A O     1 
ATOM 338   C CB    . ALA A 1 75  ? 271.349 235.900 254.333 1.00 39.70  ? 75  ALA A CB    1 
ATOM 339   N N     . GLN A 1 76  ? 274.468 235.743 253.175 1.00 42.92  ? 76  GLN A N     1 
ATOM 340   C CA    . GLN A 1 76  ? 275.894 235.580 253.447 1.00 42.92  ? 76  GLN A CA    1 
ATOM 341   C C     . GLN A 1 76  ? 276.606 236.920 253.554 1.00 42.92  ? 76  GLN A C     1 
ATOM 342   O O     . GLN A 1 76  ? 277.506 237.088 254.382 1.00 42.92  ? 76  GLN A O     1 
ATOM 343   C CB    . GLN A 1 76  ? 276.551 234.743 252.352 1.00 42.92  ? 76  GLN A CB    1 
ATOM 344   C CG    . GLN A 1 76  ? 276.578 233.263 252.618 1.00 42.92  ? 76  GLN A CG    1 
ATOM 345   C CD    . GLN A 1 76  ? 276.660 232.462 251.339 1.00 42.92  ? 76  GLN A CD    1 
ATOM 346   O OE1   . GLN A 1 76  ? 277.342 232.853 250.392 1.00 42.92  ? 76  GLN A OE1   1 
ATOM 347   N NE2   . GLN A 1 76  ? 275.947 231.342 251.295 1.00 42.92  ? 76  GLN A NE2   1 
ATOM 348   N N     . ASP A 1 77  ? 276.217 237.886 252.725 1.00 43.50  ? 77  ASP A N     1 
ATOM 349   C CA    . ASP A 1 77  ? 276.896 239.174 252.707 1.00 43.50  ? 77  ASP A CA    1 
ATOM 350   C C     . ASP A 1 77  ? 276.564 240.027 253.917 1.00 43.50  ? 77  ASP A C     1 
ATOM 351   O O     . ASP A 1 77  ? 277.292 240.979 254.206 1.00 43.50  ? 77  ASP A O     1 
ATOM 352   C CB    . ASP A 1 77  ? 276.545 239.925 251.428 1.00 43.50  ? 77  ASP A CB    1 
ATOM 353   C CG    . ASP A 1 77  ? 276.864 239.126 250.188 1.00 43.50  ? 77  ASP A CG    1 
ATOM 354   O OD1   . ASP A 1 77  ? 277.946 238.507 250.149 1.00 43.50  ? 77  ASP A OD1   1 
ATOM 355   O OD2   . ASP A 1 77  ? 276.030 239.103 249.258 1.00 43.50  ? 77  ASP A OD2   1 
ATOM 356   N N     . PHE A 1 78  ? 275.489 239.716 254.628 1.00 39.95  ? 78  PHE A N     1 
ATOM 357   C CA    . PHE A 1 78  ? 275.123 240.457 255.824 1.00 39.95  ? 78  PHE A CA    1 
ATOM 358   C C     . PHE A 1 78  ? 275.600 239.789 257.098 1.00 39.95  ? 78  PHE A C     1 
ATOM 359   O O     . PHE A 1 78  ? 275.992 240.485 258.037 1.00 39.95  ? 78  PHE A O     1 
ATOM 360   C CB    . PHE A 1 78  ? 273.605 240.637 255.888 1.00 39.95  ? 78  PHE A CB    1 
ATOM 361   C CG    . PHE A 1 78  ? 273.036 241.326 254.693 1.00 39.95  ? 78  PHE A CG    1 
ATOM 362   C CD1   . PHE A 1 78  ? 273.651 242.444 254.173 1.00 39.95  ? 78  PHE A CD1   1 
ATOM 363   C CD2   . PHE A 1 78  ? 271.903 240.846 254.075 1.00 39.95  ? 78  PHE A CD2   1 
ATOM 364   C CE1   . PHE A 1 78  ? 273.143 243.074 253.072 1.00 39.95  ? 78  PHE A CE1   1 
ATOM 365   C CE2   . PHE A 1 78  ? 271.389 241.476 252.972 1.00 39.95  ? 78  PHE A CE2   1 
ATOM 366   C CZ    . PHE A 1 78  ? 272.011 242.589 252.469 1.00 39.95  ? 78  PHE A CZ    1 
ATOM 367   N N     . LYS A 1 79  ? 275.583 238.463 257.152 1.00 42.57  ? 79  LYS A N     1 
ATOM 368   C CA    . LYS A 1 79  ? 276.026 237.762 258.344 1.00 42.57  ? 79  LYS A CA    1 
ATOM 369   C C     . LYS A 1 79  ? 276.296 236.316 257.978 1.00 42.57  ? 79  LYS A C     1 
ATOM 370   O O     . LYS A 1 79  ? 275.509 235.699 257.261 1.00 42.57  ? 79  LYS A O     1 
ATOM 371   C CB    . LYS A 1 79  ? 274.983 237.843 259.460 1.00 42.57  ? 79  LYS A CB    1 
ATOM 372   C CG    . LYS A 1 79  ? 275.473 237.330 260.789 1.00 42.57  ? 79  LYS A CG    1 
ATOM 373   C CD    . LYS A 1 79  ? 274.396 237.440 261.842 1.00 42.57  ? 79  LYS A CD    1 
ATOM 374   C CE    . LYS A 1 79  ? 274.883 236.937 263.189 1.00 42.57  ? 79  LYS A CE    1 
ATOM 375   N NZ    . LYS A 1 79  ? 275.351 235.529 263.118 1.00 42.57  ? 79  LYS A NZ    1 
ATOM 376   N N     . THR A 1 80  ? 277.399 235.781 258.476 1.00 44.63  ? 80  THR A N     1 
ATOM 377   C CA    . THR A 1 80  ? 277.791 234.425 258.141 1.00 44.63  ? 80  THR A CA    1 
ATOM 378   C C     . THR A 1 80  ? 277.115 233.431 259.073 1.00 44.63  ? 80  THR A C     1 
ATOM 379   O O     . THR A 1 80  ? 276.663 233.782 260.164 1.00 44.63  ? 80  THR A O     1 
ATOM 380   C CB    . THR A 1 80  ? 279.308 234.263 258.214 1.00 44.63  ? 80  THR A CB    1 
ATOM 381   O OG1   . THR A 1 80  ? 279.752 234.499 259.553 1.00 44.63  ? 80  THR A OG1   1 
ATOM 382   C CG2   . THR A 1 80  ? 279.981 235.253 257.287 1.00 44.63  ? 80  THR A CG2   1 
ATOM 383   N N     . ASP A 1 81  ? 277.030 232.185 258.615 1.00 46.55  ? 81  ASP A N     1 
ATOM 384   C CA    . ASP A 1 81  ? 276.492 231.083 259.408 1.00 46.55  ? 81  ASP A CA    1 
ATOM 385   C C     . ASP A 1 81  ? 275.052 231.337 259.841 1.00 46.55  ? 81  ASP A C     1 
ATOM 386   O O     . ASP A 1 81  ? 274.604 230.832 260.870 1.00 46.55  ? 81  ASP A O     1 
ATOM 387   C CB    . ASP A 1 81  ? 277.376 230.806 260.625 1.00 46.55  ? 81  ASP A CB    1 
ATOM 388   C CG    . ASP A 1 81  ? 278.788 230.421 260.239 1.00 46.55  ? 81  ASP A CG    1 
ATOM 389   O OD1   . ASP A 1 81  ? 279.062 230.285 259.028 1.00 46.55  ? 81  ASP A OD1   1 
ATOM 390   O OD2   . ASP A 1 81  ? 279.626 230.252 261.146 1.00 46.55  ? 81  ASP A OD2   1 
ATOM 391   N N     . LEU A 1 82  ? 274.315 232.120 259.063 1.00 41.75  ? 82  LEU A N     1 
ATOM 392   C CA    . LEU A 1 82  ? 272.922 232.375 259.383 1.00 41.75  ? 82  LEU A CA    1 
ATOM 393   C C     . LEU A 1 82  ? 272.082 231.135 259.138 1.00 41.75  ? 82  LEU A C     1 
ATOM 394   O O     . LEU A 1 82  ? 272.347 230.353 258.225 1.00 41.75  ? 82  LEU A O     1 
ATOM 395   C CB    . LEU A 1 82  ? 272.380 233.522 258.543 1.00 41.75  ? 82  LEU A CB    1 
ATOM 396   C CG    . LEU A 1 82  ? 272.455 234.933 259.101 1.00 41.75  ? 82  LEU A CG    1 
ATOM 397   C CD1   . LEU A 1 82  ? 271.664 235.842 258.203 1.00 41.75  ? 82  LEU A CD1   1 
ATOM 398   C CD2   . LEU A 1 82  ? 271.932 234.985 260.515 1.00 41.75  ? 82  LEU A CD2   1 
ATOM 399   N N     . ARG A 1 83  ? 271.070 230.956 259.966 1.00 40.85  ? 83  ARG A N     1 
ATOM 400   C CA    . ARG A 1 83  ? 270.046 229.953 259.746 1.00 40.85  ? 83  ARG A CA    1 
ATOM 401   C C     . ARG A 1 83  ? 268.722 230.630 259.440 1.00 40.85  ? 83  ARG A C     1 
ATOM 402   O O     . ARG A 1 83  ? 268.492 231.786 259.792 1.00 40.85  ? 83  ARG A O     1 
ATOM 403   C CB    . ARG A 1 83  ? 269.908 229.046 260.964 1.00 40.85  ? 83  ARG A CB    1 
ATOM 404   C CG    . ARG A 1 83  ? 271.072 228.125 261.147 1.00 40.85  ? 83  ARG A CG    1 
ATOM 405   C CD    . ARG A 1 83  ? 271.037 227.450 262.485 1.00 40.85  ? 83  ARG A CD    1 
ATOM 406   N NE    . ARG A 1 83  ? 272.018 226.379 262.532 1.00 40.85  ? 83  ARG A NE    1 
ATOM 407   C CZ    . ARG A 1 83  ? 271.718 225.098 262.692 1.00 40.85  ? 83  ARG A CZ    1 
ATOM 408   N NH1   . ARG A 1 83  ? 270.459 224.720 262.852 1.00 40.85  ? 83  ARG A NH1   1 
ATOM 409   N NH2   . ARG A 1 83  ? 272.685 224.197 262.709 1.00 40.85  ? 83  ARG A NH2   1 
ATOM 410   N N     . PHE A 1 84  ? 267.849 229.900 258.762 1.00 38.02  ? 84  PHE A N     1 
ATOM 411   C CA    . PHE A 1 84  ? 266.548 230.423 258.386 1.00 38.02  ? 84  PHE A CA    1 
ATOM 412   C C     . PHE A 1 84  ? 265.468 229.459 258.829 1.00 38.02  ? 84  PHE A C     1 
ATOM 413   O O     . PHE A 1 84  ? 265.598 228.249 258.640 1.00 38.02  ? 84  PHE A O     1 
ATOM 414   C CB    . PHE A 1 84  ? 266.449 230.641 256.879 1.00 38.02  ? 84  PHE A CB    1 
ATOM 415   C CG    . PHE A 1 84  ? 267.158 231.856 256.396 1.00 38.02  ? 84  PHE A CG    1 
ATOM 416   C CD1   . PHE A 1 84  ? 268.516 231.832 256.162 1.00 38.02  ? 84  PHE A CD1   1 
ATOM 417   C CD2   . PHE A 1 84  ? 266.465 233.022 256.149 1.00 38.02  ? 84  PHE A CD2   1 
ATOM 418   C CE1   . PHE A 1 84  ? 269.165 232.943 255.705 1.00 38.02  ? 84  PHE A CE1   1 
ATOM 419   C CE2   . PHE A 1 84  ? 267.116 234.139 255.689 1.00 38.02  ? 84  PHE A CE2   1 
ATOM 420   C CZ    . PHE A 1 84  ? 268.464 234.097 255.470 1.00 38.02  ? 84  PHE A CZ    1 
ATOM 421   N N     . GLN A 1 85  ? 264.410 229.993 259.419 1.00 37.69  ? 85  GLN A N     1 
ATOM 422   C CA    . GLN A 1 85  ? 263.196 229.212 259.561 1.00 37.69  ? 85  GLN A CA    1 
ATOM 423   C C     . GLN A 1 85  ? 262.573 228.989 258.191 1.00 37.69  ? 85  GLN A C     1 
ATOM 424   O O     . GLN A 1 85  ? 262.628 229.859 257.310 1.00 37.69  ? 85  GLN A O     1 
ATOM 425   C CB    . GLN A 1 85  ? 262.211 229.914 260.490 1.00 37.69  ? 85  GLN A CB    1 
ATOM 426   C CG    . GLN A 1 85  ? 262.691 230.020 261.911 1.00 37.69  ? 85  GLN A CG    1 
ATOM 427   C CD    . GLN A 1 85  ? 261.618 230.501 262.856 1.00 37.69  ? 85  GLN A CD    1 
ATOM 428   O OE1   . GLN A 1 85  ? 260.618 231.077 262.438 1.00 37.69  ? 85  GLN A OE1   1 
ATOM 429   N NE2   . GLN A 1 85  ? 261.818 230.264 264.141 1.00 37.69  ? 85  GLN A NE2   1 
ATOM 430   N N     . SER A 1 86  ? 261.994 227.802 258.007 1.00 37.27  ? 86  SER A N     1 
ATOM 431   C CA    . SER A 1 86  ? 261.291 227.505 256.768 1.00 37.27  ? 86  SER A CA    1 
ATOM 432   C C     . SER A 1 86  ? 260.211 228.539 256.504 1.00 37.27  ? 86  SER A C     1 
ATOM 433   O O     . SER A 1 86  ? 260.013 228.972 255.365 1.00 37.27  ? 86  SER A O     1 
ATOM 434   C CB    . SER A 1 86  ? 260.689 226.105 256.832 1.00 37.27  ? 86  SER A CB    1 
ATOM 435   O OG    . SER A 1 86  ? 261.656 225.163 257.241 1.00 37.27  ? 86  SER A OG    1 
ATOM 436   N N     . SER A 1 87  ? 259.513 228.958 257.555 1.00 36.47  ? 87  SER A N     1 
ATOM 437   C CA    . SER A 1 87  ? 258.480 229.965 257.391 1.00 36.47  ? 87  SER A CA    1 
ATOM 438   C C     . SER A 1 87  ? 259.073 231.319 257.032 1.00 36.47  ? 87  SER A C     1 
ATOM 439   O O     . SER A 1 87  ? 258.432 232.097 256.328 1.00 36.47  ? 87  SER A O     1 
ATOM 440   C CB    . SER A 1 87  ? 257.636 230.054 258.655 1.00 36.47  ? 87  SER A CB    1 
ATOM 441   O OG    . SER A 1 87  ? 258.459 230.186 259.794 1.00 36.47  ? 87  SER A OG    1 
ATOM 442   N N     . ALA A 1 88  ? 260.294 231.614 257.475 1.00 35.58  ? 88  ALA A N     1 
ATOM 443   C CA    . ALA A 1 88  ? 260.945 232.845 257.040 1.00 35.58  ? 88  ALA A CA    1 
ATOM 444   C C     . ALA A 1 88  ? 261.227 232.810 255.546 1.00 35.58  ? 88  ALA A C     1 
ATOM 445   O O     . ALA A 1 88  ? 260.948 233.775 254.824 1.00 35.58  ? 88  ALA A O     1 
ATOM 446   C CB    . ALA A 1 88  ? 262.235 233.072 257.819 1.00 35.58  ? 88  ALA A CB    1 
ATOM 447   N N     . VAL A 1 89  ? 261.786 231.699 255.064 1.00 35.83  ? 89  VAL A N     1 
ATOM 448   C CA    . VAL A 1 89  ? 262.041 231.572 253.632 1.00 35.83  ? 89  VAL A CA    1 
ATOM 449   C C     . VAL A 1 89  ? 260.742 231.682 252.839 1.00 35.83  ? 89  VAL A C     1 
ATOM 450   O O     . VAL A 1 89  ? 260.692 232.331 251.788 1.00 35.83  ? 89  VAL A O     1 
ATOM 451   C CB    . VAL A 1 89  ? 262.777 230.254 253.337 1.00 35.83  ? 89  VAL A CB    1 
ATOM 452   C CG1   . VAL A 1 89  ? 262.925 230.056 251.848 1.00 35.83  ? 89  VAL A CG1   1 
ATOM 453   C CG2   . VAL A 1 89  ? 264.128 230.246 254.003 1.00 35.83  ? 89  VAL A CG2   1 
ATOM 454   N N     . MET A 1 90  ? 259.666 231.080 253.341 1.00 36.52  ? 90  MET A N     1 
ATOM 455   C CA    . MET A 1 90  ? 258.395 231.141 252.626 1.00 36.52  ? 90  MET A CA    1 
ATOM 456   C C     . MET A 1 90  ? 257.803 232.546 252.639 1.00 36.52  ? 90  MET A C     1 
ATOM 457   O O     . MET A 1 90  ? 257.221 232.986 251.642 1.00 36.52  ? 90  MET A O     1 
ATOM 458   C CB    . MET A 1 90  ? 257.407 230.141 253.217 1.00 36.52  ? 90  MET A CB    1 
ATOM 459   C CG    . MET A 1 90  ? 257.848 228.696 253.122 1.00 36.52  ? 90  MET A CG    1 
ATOM 460   S SD    . MET A 1 90  ? 258.779 228.299 251.630 1.00 36.52  ? 90  MET A SD    1 
ATOM 461   C CE    . MET A 1 90  ? 257.547 228.539 250.363 1.00 36.52  ? 90  MET A CE    1 
ATOM 462   N N     . ALA A 1 91  ? 257.920 233.260 253.757 1.00 34.53  ? 91  ALA A N     1 
ATOM 463   C CA    . ALA A 1 91  ? 257.450 234.637 253.803 1.00 34.53  ? 91  ALA A CA    1 
ATOM 464   C C     . ALA A 1 91  ? 258.212 235.504 252.818 1.00 34.53  ? 91  ALA A C     1 
ATOM 465   O O     . ALA A 1 91  ? 257.621 236.349 252.137 1.00 34.53  ? 91  ALA A O     1 
ATOM 466   C CB    . ALA A 1 91  ? 257.580 235.194 255.218 1.00 34.53  ? 91  ALA A CB    1 
ATOM 467   N N     . LEU A 1 92  ? 259.526 235.309 252.734 1.00 34.42  ? 92  LEU A N     1 
ATOM 468   C CA    . LEU A 1 92  ? 260.315 236.023 251.742 1.00 34.42  ? 92  LEU A CA    1 
ATOM 469   C C     . LEU A 1 92  ? 259.839 235.714 250.332 1.00 34.42  ? 92  LEU A C     1 
ATOM 470   O O     . LEU A 1 92  ? 259.730 236.617 249.500 1.00 34.42  ? 92  LEU A O     1 
ATOM 471   C CB    . LEU A 1 92  ? 261.790 235.676 251.896 1.00 34.42  ? 92  LEU A CB    1 
ATOM 472   C CG    . LEU A 1 92  ? 262.526 236.442 252.987 1.00 34.42  ? 92  LEU A CG    1 
ATOM 473   C CD1   . LEU A 1 92  ? 263.904 235.869 253.199 1.00 34.42  ? 92  LEU A CD1   1 
ATOM 474   C CD2   . LEU A 1 92  ? 262.608 237.896 252.606 1.00 34.42  ? 92  LEU A CD2   1 
ATOM 475   N N     . GLN A 1 93  ? 259.552 234.448 250.041 1.00 35.58  ? 93  GLN A N     1 
ATOM 476   C CA    . GLN A 1 93  ? 259.121 234.113 248.688 1.00 35.58  ? 93  GLN A CA    1 
ATOM 477   C C     . GLN A 1 93  ? 257.762 234.723 248.364 1.00 35.58  ? 93  GLN A C     1 
ATOM 478   O O     . GLN A 1 93  ? 257.559 235.236 247.260 1.00 35.58  ? 93  GLN A O     1 
ATOM 479   C CB    . GLN A 1 93  ? 259.097 232.601 248.494 1.00 35.58  ? 93  GLN A CB    1 
ATOM 480   C CG    . GLN A 1 93  ? 259.183 232.195 247.040 1.00 35.58  ? 93  GLN A CG    1 
ATOM 481   C CD    . GLN A 1 93  ? 259.369 230.715 246.854 1.00 35.58  ? 93  GLN A CD    1 
ATOM 482   O OE1   . GLN A 1 93  ? 259.699 229.999 247.791 1.00 35.58  ? 93  GLN A OE1   1 
ATOM 483   N NE2   . GLN A 1 93  ? 259.152 230.244 245.639 1.00 35.58  ? 93  GLN A NE2   1 
ATOM 484   N N     . GLU A 1 94  ? 256.824 234.684 249.311 1.00 35.69  ? 94  GLU A N     1 
ATOM 485   C CA    . GLU A 1 94  ? 255.524 235.319 249.100 1.00 35.69  ? 94  GLU A CA    1 
ATOM 486   C C     . GLU A 1 94  ? 255.675 236.810 248.842 1.00 35.69  ? 94  GLU A C     1 
ATOM 487   O O     . GLU A 1 94  ? 255.075 237.353 247.907 1.00 35.69  ? 94  GLU A O     1 
ATOM 488   C CB    . GLU A 1 94  ? 254.614 235.085 250.301 1.00 35.69  ? 94  GLU A CB    1 
ATOM 489   C CG    . GLU A 1 94  ? 254.209 233.653 250.511 1.00 35.69  ? 94  GLU A CG    1 
ATOM 490   C CD    . GLU A 1 94  ? 252.973 233.267 249.732 1.00 35.69  ? 94  GLU A CD    1 
ATOM 491   O OE1   . GLU A 1 94  ? 252.539 232.103 249.849 1.00 35.69  ? 94  GLU A OE1   1 
ATOM 492   O OE2   . GLU A 1 94  ? 252.427 234.123 249.005 1.00 35.69  ? 94  GLU A OE2   1 
ATOM 493   N N     . ALA A 1 95  ? 256.477 237.491 249.662 1.00 33.91  ? 95  ALA A N     1 
ATOM 494   C CA    . ALA A 1 95  ? 256.694 238.916 249.454 1.00 33.91  ? 95  ALA A CA    1 
ATOM 495   C C     . ALA A 1 95  ? 257.321 239.189 248.096 1.00 33.91  ? 95  ALA A C     1 
ATOM 496   O O     . ALA A 1 95  ? 256.882 240.088 247.374 1.00 33.91  ? 95  ALA A O     1 
ATOM 497   C CB    . ALA A 1 95  ? 257.570 239.484 250.565 1.00 33.91  ? 95  ALA A CB    1 
ATOM 498   N N     . SER A 1 96  ? 258.344 238.417 247.729 1.00 34.37  ? 96  SER A N     1 
ATOM 499   C CA    . SER A 1 96  ? 259.047 238.640 246.472 1.00 34.37  ? 96  SER A CA    1 
ATOM 500   C C     . SER A 1 96  ? 258.128 238.447 245.278 1.00 34.37  ? 96  SER A C     1 
ATOM 501   O O     . SER A 1 96  ? 258.138 239.252 244.344 1.00 34.37  ? 96  SER A O     1 
ATOM 502   C CB    . SER A 1 96  ? 260.237 237.696 246.369 1.00 34.37  ? 96  SER A CB    1 
ATOM 503   O OG    . SER A 1 96  ? 260.888 237.576 247.611 1.00 34.37  ? 96  SER A OG    1 
ATOM 504   N N     . GLU A 1 97  ? 257.336 237.380 245.287 1.00 35.89  ? 97  GLU A N     1 
ATOM 505   C CA    . GLU A 1 97  ? 256.464 237.117 244.153 1.00 35.89  ? 97  GLU A CA    1 
ATOM 506   C C     . GLU A 1 97  ? 255.339 238.134 244.071 1.00 35.89  ? 97  GLU A C     1 
ATOM 507   O O     . GLU A 1 97  ? 254.976 238.564 242.974 1.00 35.89  ? 97  GLU A O     1 
ATOM 508   C CB    . GLU A 1 97  ? 255.919 235.699 244.228 1.00 35.89  ? 97  GLU A CB    1 
ATOM 509   C CG    . GLU A 1 97  ? 256.990 234.661 243.989 1.00 35.89  ? 97  GLU A CG    1 
ATOM 510   C CD    . GLU A 1 97  ? 256.431 233.281 243.774 1.00 35.89  ? 97  GLU A CD    1 
ATOM 511   O OE1   . GLU A 1 97  ? 255.203 233.165 243.576 1.00 35.89  ? 97  GLU A OE1   1 
ATOM 512   O OE2   . GLU A 1 97  ? 257.216 232.313 243.799 1.00 35.89  ? 97  GLU A OE2   1 
ATOM 513   N N     . ALA A 1 98  ? 254.779 238.543 245.211 1.00 33.62  ? 98  ALA A N     1 
ATOM 514   C CA    . ALA A 1 98  ? 253.787 239.610 245.187 1.00 33.62  ? 98  ALA A CA    1 
ATOM 515   C C     . ALA A 1 98  ? 254.375 240.895 244.620 1.00 33.62  ? 98  ALA A C     1 
ATOM 516   O O     . ALA A 1 98  ? 253.742 241.575 243.800 1.00 33.62  ? 98  ALA A O     1 
ATOM 517   C CB    . ALA A 1 98  ? 253.244 239.842 246.592 1.00 33.62  ? 98  ALA A CB    1 
ATOM 518   N N     . TYR A 1 99  ? 255.596 241.231 245.035 1.00 33.57  ? 99  TYR A N     1 
ATOM 519   C CA    . TYR A 1 99  ? 256.262 242.425 244.538 1.00 33.57  ? 99  TYR A CA    1 
ATOM 520   C C     . TYR A 1 99  ? 256.470 242.351 243.033 1.00 33.57  ? 99  TYR A C     1 
ATOM 521   O O     . TYR A 1 99  ? 256.178 243.307 242.308 1.00 33.57  ? 99  TYR A O     1 
ATOM 522   C CB    . TYR A 1 99  ? 257.592 242.604 245.263 1.00 33.57  ? 99  TYR A CB    1 
ATOM 523   C CG    . TYR A 1 99  ? 258.429 243.731 244.738 1.00 33.57  ? 99  TYR A CG    1 
ATOM 524   C CD1   . TYR A 1 99  ? 258.115 245.039 245.036 1.00 33.57  ? 99  TYR A CD1   1 
ATOM 525   C CD2   . TYR A 1 99  ? 259.533 243.487 243.941 1.00 33.57  ? 99  TYR A CD2   1 
ATOM 526   C CE1   . TYR A 1 99  ? 258.869 246.068 244.563 1.00 33.57  ? 99  TYR A CE1   1 
ATOM 527   C CE2   . TYR A 1 99  ? 260.294 244.513 243.463 1.00 33.57  ? 99  TYR A CE2   1 
ATOM 528   C CZ    . TYR A 1 99  ? 259.958 245.803 243.777 1.00 33.57  ? 99  TYR A CZ    1 
ATOM 529   O OH    . TYR A 1 99  ? 260.719 246.838 243.298 1.00 33.57  ? 99  TYR A OH    1 
ATOM 530   N N     . LEU A 1 100 ? 256.952 241.213 242.542 1.00 32.48  ? 100 LEU A N     1 
ATOM 531   C CA    . LEU A 1 100 ? 257.216 241.090 241.114 1.00 32.48  ? 100 LEU A CA    1 
ATOM 532   C C     . LEU A 1 100 ? 255.929 241.105 240.303 1.00 32.48  ? 100 LEU A C     1 
ATOM 533   O O     . LEU A 1 100 ? 255.892 241.680 239.215 1.00 32.48  ? 100 LEU A O     1 
ATOM 534   C CB    . LEU A 1 100 ? 258.019 239.828 240.827 1.00 32.48  ? 100 LEU A CB    1 
ATOM 535   C CG    . LEU A 1 100 ? 259.488 239.906 241.235 1.00 32.48  ? 100 LEU A CG    1 
ATOM 536   C CD1   . LEU A 1 100 ? 260.229 238.650 240.844 1.00 32.48  ? 100 LEU A CD1   1 
ATOM 537   C CD2   . LEU A 1 100 ? 260.139 241.122 240.620 1.00 32.48  ? 100 LEU A CD2   1 
ATOM 538   N N     . VAL A 1 101 ? 254.859 240.499 240.814 1.00 32.68  ? 101 VAL A N     1 
ATOM 539   C CA    . VAL A 1 101 ? 253.603 240.484 240.074 1.00 32.68  ? 101 VAL A CA    1 
ATOM 540   C C     . VAL A 1 101 ? 253.022 241.887 239.980 1.00 32.68  ? 101 VAL A C     1 
ATOM 541   O O     . VAL A 1 101 ? 252.549 242.307 238.915 1.00 32.68  ? 101 VAL A O     1 
ATOM 542   C CB    . VAL A 1 101 ? 252.615 239.492 240.712 1.00 32.68  ? 101 VAL A CB    1 
ATOM 543   C CG1   . VAL A 1 101 ? 251.246 239.622 240.094 1.00 32.68  ? 101 VAL A CG1   1 
ATOM 544   C CG2   . VAL A 1 101 ? 253.115 238.083 240.544 1.00 32.68  ? 101 VAL A CG2   1 
ATOM 545   N N     . ALA A 1 102 ? 253.055 242.645 241.077 1.00 33.18  ? 102 ALA A N     1 
ATOM 546   C CA    . ALA A 1 102 ? 252.574 244.021 241.008 1.00 33.18  ? 102 ALA A CA    1 
ATOM 547   C C     . ALA A 1 102 ? 253.449 244.861 240.085 1.00 33.18  ? 102 ALA A C     1 
ATOM 548   O O     . ALA A 1 102 ? 252.949 245.720 239.344 1.00 33.18  ? 102 ALA A O     1 
ATOM 549   C CB    . ALA A 1 102 ? 252.517 244.631 242.404 1.00 33.18  ? 102 ALA A CB    1 
ATOM 550   N N     . LEU A 1 103 ? 254.759 244.620 240.110 1.00 33.06  ? 103 LEU A N     1 
ATOM 551   C CA    . LEU A 1 103 ? 255.657 245.340 239.222 1.00 33.06  ? 103 LEU A CA    1 
ATOM 552   C C     . LEU A 1 103 ? 255.367 245.028 237.762 1.00 33.06  ? 103 LEU A C     1 
ATOM 553   O O     . LEU A 1 103 ? 255.447 245.911 236.907 1.00 33.06  ? 103 LEU A O     1 
ATOM 554   C CB    . LEU A 1 103 ? 257.104 245.003 239.560 1.00 33.06  ? 103 LEU A CB    1 
ATOM 555   C CG    . LEU A 1 103 ? 258.123 245.745 238.706 1.00 33.06  ? 103 LEU A CG    1 
ATOM 556   C CD1   . LEU A 1 103 ? 257.866 247.232 238.765 1.00 33.06  ? 103 LEU A CD1   1 
ATOM 557   C CD2   . LEU A 1 103 ? 259.510 245.431 239.179 1.00 33.06  ? 103 LEU A CD2   1 
ATOM 558   N N     . PHE A 1 104 ? 255.021 243.779 237.456 1.00 33.04  ? 104 PHE A N     1 
ATOM 559   C CA    . PHE A 1 104 ? 254.688 243.427 236.083 1.00 33.04  ? 104 PHE A CA    1 
ATOM 560   C C     . PHE A 1 104 ? 253.355 244.012 235.657 1.00 33.04  ? 104 PHE A C     1 
ATOM 561   O O     . PHE A 1 104 ? 253.191 244.360 234.490 1.00 33.04  ? 104 PHE A O     1 
ATOM 562   C CB    . PHE A 1 104 ? 254.684 241.914 235.901 1.00 33.04  ? 104 PHE A CB    1 
ATOM 563   C CG    . PHE A 1 104 ? 256.040 241.338 235.670 1.00 33.04  ? 104 PHE A CG    1 
ATOM 564   C CD1   . PHE A 1 104 ? 256.859 241.840 234.685 1.00 33.04  ? 104 PHE A CD1   1 
ATOM 565   C CD2   . PHE A 1 104 ? 256.506 240.308 236.456 1.00 33.04  ? 104 PHE A CD2   1 
ATOM 566   C CE1   . PHE A 1 104 ? 258.107 241.317 234.482 1.00 33.04  ? 104 PHE A CE1   1 
ATOM 567   C CE2   . PHE A 1 104 ? 257.749 239.782 236.257 1.00 33.04  ? 104 PHE A CE2   1 
ATOM 568   C CZ    . PHE A 1 104 ? 258.553 240.286 235.269 1.00 33.04  ? 104 PHE A CZ    1 
ATOM 569   N N     . GLU A 1 105 ? 252.402 244.146 236.578 1.00 34.84  ? 105 GLU A N     1 
ATOM 570   C CA    . GLU A 1 105 ? 251.175 244.873 236.257 1.00 34.84  ? 105 GLU A CA    1 
ATOM 571   C C     . GLU A 1 105 ? 251.472 246.318 235.866 1.00 34.84  ? 105 GLU A C     1 
ATOM 572   O O     . GLU A 1 105 ? 250.989 246.816 234.838 1.00 34.84  ? 105 GLU A O     1 
ATOM 573   C CB    . GLU A 1 105 ? 250.212 244.821 237.438 1.00 34.84  ? 105 GLU A CB    1 
ATOM 574   C CG    . GLU A 1 105 ? 249.367 243.579 237.460 1.00 34.84  ? 105 GLU A CG    1 
ATOM 575   C CD    . GLU A 1 105 ? 248.691 243.354 238.794 1.00 34.84  ? 105 GLU A CD    1 
ATOM 576   O OE1   . GLU A 1 105 ? 248.882 242.271 239.384 1.00 34.84  ? 105 GLU A OE1   1 
ATOM 577   O OE2   . GLU A 1 105 ? 247.972 244.263 239.258 1.00 34.84  ? 105 GLU A OE2   1 
ATOM 578   N N     . ASP A 1 106 ? 252.280 247.008 236.673 1.00 35.64  ? 106 ASP A N     1 
ATOM 579   C CA    . ASP A 1 106 ? 252.616 248.392 236.344 1.00 35.64  ? 106 ASP A CA    1 
ATOM 580   C C     . ASP A 1 106 ? 253.418 248.480 235.049 1.00 35.64  ? 106 ASP A C     1 
ATOM 581   O O     . ASP A 1 106 ? 253.244 249.415 234.258 1.00 35.64  ? 106 ASP A O     1 
ATOM 582   C CB    . ASP A 1 106 ? 253.381 249.035 237.495 1.00 35.64  ? 106 ASP A CB    1 
ATOM 583   C CG    . ASP A 1 106 ? 252.523 249.229 238.723 1.00 35.64  ? 106 ASP A CG    1 
ATOM 584   O OD1   . ASP A 1 106 ? 251.288 249.100 238.607 1.00 35.64  ? 106 ASP A OD1   1 
ATOM 585   O OD2   . ASP A 1 106 ? 253.077 249.512 239.804 1.00 35.64  ? 106 ASP A OD2   1 
ATOM 586   N N     . THR A 1 107 ? 254.300 247.512 234.814 1.00 34.30  ? 107 THR A N     1 
ATOM 587   C CA    . THR A 1 107 ? 255.080 247.480 233.586 1.00 34.30  ? 107 THR A CA    1 
ATOM 588   C C     . THR A 1 107 ? 254.192 247.259 232.369 1.00 34.30  ? 107 THR A C     1 
ATOM 589   O O     . THR A 1 107 ? 254.407 247.863 231.315 1.00 34.30  ? 107 THR A O     1 
ATOM 590   C CB    . THR A 1 107 ? 256.136 246.384 233.700 1.00 34.30  ? 107 THR A CB    1 
ATOM 591   O OG1   . THR A 1 107 ? 257.041 246.717 234.754 1.00 34.30  ? 107 THR A OG1   1 
ATOM 592   C CG2   . THR A 1 107 ? 256.900 246.221 232.415 1.00 34.30  ? 107 THR A CG2   1 
ATOM 593   N N     . ASN A 1 108 ? 253.184 246.401 232.502 1.00 33.64  ? 108 ASN A N     1 
ATOM 594   C CA    . ASN A 1 108 ? 252.232 246.180 231.424 1.00 33.64  ? 108 ASN A CA    1 
ATOM 595   C C     . ASN A 1 108 ? 251.464 247.454 231.108 1.00 33.64  ? 108 ASN A C     1 
ATOM 596   O O     . ASN A 1 108 ? 251.220 247.770 229.939 1.00 33.64  ? 108 ASN A O     1 
ATOM 597   C CB    . ASN A 1 108 ? 251.281 245.054 231.818 1.00 33.64  ? 108 ASN A CB    1 
ATOM 598   C CG    . ASN A 1 108 ? 250.655 244.373 230.633 1.00 33.64  ? 108 ASN A CG    1 
ATOM 599   O OD1   . ASN A 1 108 ? 251.220 244.339 229.550 1.00 33.64  ? 108 ASN A OD1   1 
ATOM 600   N ND2   . ASN A 1 108 ? 249.480 243.808 230.841 1.00 33.64  ? 108 ASN A ND2   1 
ATOM 601   N N     . LEU A 1 109 ? 251.084 248.208 232.140 1.00 33.76  ? 109 LEU A N     1 
ATOM 602   C CA    . LEU A 1 109 ? 250.430 249.489 231.887 1.00 33.76  ? 109 LEU A CA    1 
ATOM 603   C C     . LEU A 1 109 ? 251.361 250.451 231.162 1.00 33.76  ? 109 LEU A C     1 
ATOM 604   O O     . LEU A 1 109 ? 250.937 251.173 230.253 1.00 33.76  ? 109 LEU A O     1 
ATOM 605   C CB    . LEU A 1 109 ? 249.940 250.106 233.191 1.00 33.76  ? 109 LEU A CB    1 
ATOM 606   C CG    . LEU A 1 109 ? 248.774 249.364 233.825 1.00 33.76  ? 109 LEU A CG    1 
ATOM 607   C CD1   . LEU A 1 109 ? 248.222 250.160 234.971 1.00 33.76  ? 109 LEU A CD1   1 
ATOM 608   C CD2   . LEU A 1 109 ? 247.705 249.101 232.796 1.00 33.76  ? 109 LEU A CD2   1 
ATOM 609   N N     . CYS A 1 110 ? 252.633 250.481 231.554 1.00 35.18  ? 110 CYS A N     1 
ATOM 610   C CA    . CYS A 1 110 ? 253.590 251.345 230.871 1.00 35.18  ? 110 CYS A CA    1 
ATOM 611   C C     . CYS A 1 110 ? 253.752 250.950 229.411 1.00 35.18  ? 110 CYS A C     1 
ATOM 612   O O     . CYS A 1 110 ? 253.870 251.812 228.537 1.00 35.18  ? 110 CYS A O     1 
ATOM 613   C CB    . CYS A 1 110 ? 254.941 251.305 231.578 1.00 35.18  ? 110 CYS A CB    1 
ATOM 614   S SG    . CYS A 1 110 ? 254.944 252.061 233.199 1.00 35.18  ? 110 CYS A SG    1 
ATOM 615   N N     . ALA A 1 111 ? 253.783 249.649 229.131 1.00 34.71  ? 111 ALA A N     1 
ATOM 616   C CA    . ALA A 1 111 ? 253.967 249.196 227.758 1.00 34.71  ? 111 ALA A CA    1 
ATOM 617   C C     . ALA A 1 111 ? 252.749 249.519 226.907 1.00 34.71  ? 111 ALA A C     1 
ATOM 618   O O     . ALA A 1 111 ? 252.885 250.001 225.780 1.00 34.71  ? 111 ALA A O     1 
ATOM 619   C CB    . ALA A 1 111 ? 254.266 247.701 227.733 1.00 34.71  ? 111 ALA A CB    1 
ATOM 620   N N     . ILE A 1 112 ? 251.550 249.286 227.441 1.00 34.89  ? 112 ILE A N     1 
ATOM 621   C CA    . ILE A 1 112 ? 250.333 249.630 226.714 1.00 34.89  ? 112 ILE A CA    1 
ATOM 622   C C     . ILE A 1 112 ? 250.250 251.133 226.479 1.00 34.89  ? 112 ILE A C     1 
ATOM 623   O O     . ILE A 1 112 ? 249.765 251.586 225.437 1.00 34.89  ? 112 ILE A O     1 
ATOM 624   C CB    . ILE A 1 112 ? 249.102 249.099 227.464 1.00 34.89  ? 112 ILE A CB    1 
ATOM 625   C CG1   . ILE A 1 112 ? 249.103 247.575 227.455 1.00 34.89  ? 112 ILE A CG1   1 
ATOM 626   C CG2   . ILE A 1 112 ? 247.837 249.613 226.840 1.00 34.89  ? 112 ILE A CG2   1 
ATOM 627   C CD1   . ILE A 1 112 ? 248.080 246.980 228.355 1.00 34.89  ? 112 ILE A CD1   1 
ATOM 628   N N     . HIS A 1 113 ? 250.739 251.930 227.431 1.00 34.89  ? 113 HIS A N     1 
ATOM 629   C CA    . HIS A 1 113 ? 250.767 253.378 227.247 1.00 34.89  ? 113 HIS A CA    1 
ATOM 630   C C     . HIS A 1 113 ? 251.588 253.777 226.029 1.00 34.89  ? 113 HIS A C     1 
ATOM 631   O O     . HIS A 1 113 ? 251.218 254.709 225.313 1.00 34.89  ? 113 HIS A O     1 
ATOM 632   C CB    . HIS A 1 113 ? 251.327 254.049 228.500 1.00 34.89  ? 113 HIS A CB    1 
ATOM 633   C CG    . HIS A 1 113 ? 251.220 255.540 228.492 1.00 34.89  ? 113 HIS A CG    1 
ATOM 634   N ND1   . HIS A 1 113 ? 250.068 256.203 228.852 1.00 34.89  ? 113 HIS A ND1   1 
ATOM 635   C CD2   . HIS A 1 113 ? 252.122 256.497 228.180 1.00 34.89  ? 113 HIS A CD2   1 
ATOM 636   C CE1   . HIS A 1 113 ? 250.263 257.504 228.757 1.00 34.89  ? 113 HIS A CE1   1 
ATOM 637   N NE2   . HIS A 1 113 ? 251.501 257.709 228.351 1.00 34.89  ? 113 HIS A NE2   1 
ATOM 638   N N     . ALA A 1 114 ? 252.699 253.091 225.780 1.00 35.42  ? 114 ALA A N     1 
ATOM 639   C CA    . ALA A 1 114 ? 253.530 253.341 224.614 1.00 35.42  ? 114 ALA A CA    1 
ATOM 640   C C     . ALA A 1 114 ? 253.070 252.566 223.388 1.00 35.42  ? 114 ALA A C     1 
ATOM 641   O O     . ALA A 1 114 ? 253.874 252.332 222.482 1.00 35.42  ? 114 ALA A O     1 
ATOM 642   C CB    . ALA A 1 114 ? 254.987 253.008 224.924 1.00 35.42  ? 114 ALA A CB    1 
ATOM 643   N N     . LYS A 1 115 ? 251.805 252.154 223.350 1.00 36.55  ? 115 LYS A N     1 
ATOM 644   C CA    . LYS A 1 115 ? 251.196 251.512 222.183 1.00 36.55  ? 115 LYS A CA    1 
ATOM 645   C C     . LYS A 1 115 ? 251.839 250.173 221.836 1.00 36.55  ? 115 LYS A C     1 
ATOM 646   O O     . LYS A 1 115 ? 251.846 249.765 220.677 1.00 36.55  ? 115 LYS A O     1 
ATOM 647   C CB    . LYS A 1 115 ? 251.230 252.426 220.958 1.00 36.55  ? 115 LYS A CB    1 
ATOM 648   C CG    . LYS A 1 115 ? 250.045 253.347 220.827 1.00 36.55  ? 115 LYS A CG    1 
ATOM 649   C CD    . LYS A 1 115 ? 250.091 254.456 221.848 1.00 36.55  ? 115 LYS A CD    1 
ATOM 650   C CE    . LYS A 1 115 ? 248.971 255.450 221.626 1.00 36.55  ? 115 LYS A CE    1 
ATOM 651   N NZ    . LYS A 1 115 ? 249.100 256.141 220.317 1.00 36.55  ? 115 LYS A NZ    1 
ATOM 652   N N     . ARG A 1 116 ? 252.366 249.464 222.822 1.00 35.89  ? 116 ARG A N     1 
ATOM 653   C CA    . ARG A 1 116 ? 252.929 248.146 222.600 1.00 35.89  ? 116 ARG A CA    1 
ATOM 654   C C     . ARG A 1 116 ? 252.134 247.114 223.382 1.00 35.89  ? 116 ARG A C     1 
ATOM 655   O O     . ARG A 1 116 ? 251.346 247.446 224.267 1.00 35.89  ? 116 ARG A O     1 
ATOM 656   C CB    . ARG A 1 116 ? 254.400 248.084 223.012 1.00 35.89  ? 116 ARG A CB    1 
ATOM 657   C CG    . ARG A 1 116 ? 255.310 248.972 222.205 1.00 35.89  ? 116 ARG A CG    1 
ATOM 658   C CD    . ARG A 1 116 ? 256.752 248.779 222.600 1.00 35.89  ? 116 ARG A CD    1 
ATOM 659   N NE    . ARG A 1 116 ? 257.178 249.698 223.648 1.00 35.89  ? 116 ARG A NE    1 
ATOM 660   C CZ    . ARG A 1 116 ? 257.168 249.422 224.947 1.00 35.89  ? 116 ARG A CZ    1 
ATOM 661   N NH1   . ARG A 1 116 ? 256.746 248.247 225.382 1.00 35.89  ? 116 ARG A NH1   1 
ATOM 662   N NH2   . ARG A 1 116 ? 257.580 250.326 225.812 1.00 35.89  ? 116 ARG A NH2   1 
ATOM 663   N N     . VAL A 1 117 ? 252.328 245.851 223.022 1.00 36.44  ? 117 VAL A N     1 
ATOM 664   C CA    . VAL A 1 117 ? 251.849 244.737 223.824 1.00 36.44  ? 117 VAL A CA    1 
ATOM 665   C C     . VAL A 1 117 ? 252.987 243.963 224.450 1.00 36.44  ? 117 VAL A C     1 
ATOM 666   O O     . VAL A 1 117 ? 252.747 242.942 225.100 1.00 36.44  ? 117 VAL A O     1 
ATOM 667   C CB    . VAL A 1 117 ? 250.945 243.800 223.003 1.00 36.44  ? 117 VAL A CB    1 
ATOM 668   C CG1   . VAL A 1 117 ? 249.684 244.526 222.599 1.00 36.44  ? 117 VAL A CG1   1 
ATOM 669   C CG2   . VAL A 1 117 ? 251.666 243.299 221.784 1.00 36.44  ? 117 VAL A CG2   1 
ATOM 670   N N     . THR A 1 118 ? 254.217 244.428 224.286 1.00 35.88  ? 118 THR A N     1 
ATOM 671   C CA    . THR A 1 118 ? 255.417 243.733 224.725 1.00 35.88  ? 118 THR A CA    1 
ATOM 672   C C     . THR A 1 118 ? 256.086 244.559 225.810 1.00 35.88  ? 118 THR A C     1 
ATOM 673   O O     . THR A 1 118 ? 256.440 245.716 225.575 1.00 35.88  ? 118 THR A O     1 
ATOM 674   C CB    . THR A 1 118 ? 256.374 243.524 223.554 1.00 35.88  ? 118 THR A CB    1 
ATOM 675   O OG1   . THR A 1 118 ? 255.701 242.827 222.505 1.00 35.88  ? 118 THR A OG1   1 
ATOM 676   C CG2   . THR A 1 118 ? 257.580 242.729 223.981 1.00 35.88  ? 118 THR A CG2   1 
ATOM 677   N N     . ILE A 1 119 ? 256.266 243.972 226.990 1.00 34.42  ? 119 ILE A N     1 
ATOM 678   C CA    . ILE A 1 119 ? 256.932 244.709 228.056 1.00 34.42  ? 119 ILE A CA    1 
ATOM 679   C C     . ILE A 1 119 ? 258.432 244.703 227.808 1.00 34.42  ? 119 ILE A C     1 
ATOM 680   O O     . ILE A 1 119 ? 258.995 243.719 227.318 1.00 34.42  ? 119 ILE A O     1 
ATOM 681   C CB    . ILE A 1 119 ? 256.588 244.134 229.440 1.00 34.42  ? 119 ILE A CB    1 
ATOM 682   C CG1   . ILE A 1 119 ? 257.048 242.684 229.560 1.00 34.42  ? 119 ILE A CG1   1 
ATOM 683   C CG2   . ILE A 1 119 ? 255.108 244.282 229.717 1.00 34.42  ? 119 ILE A CG2   1 
ATOM 684   C CD1   . ILE A 1 119 ? 257.114 242.185 230.967 1.00 34.42  ? 119 ILE A CD1   1 
ATOM 685   N N     . MET A 1 120 ? 259.081 245.811 228.116 1.00 36.60  ? 120 MET A N     1 
ATOM 686   C CA    . MET A 1 120 ? 260.500 245.991 227.870 1.00 36.60  ? 120 MET A CA    1 
ATOM 687   C C     . MET A 1 120 ? 261.187 246.521 229.118 1.00 36.60  ? 120 MET A C     1 
ATOM 688   O O     . MET A 1 120 ? 260.531 247.028 230.040 1.00 36.60  ? 120 MET A O     1 
ATOM 689   C CB    . MET A 1 120 ? 260.724 246.945 226.686 1.00 36.60  ? 120 MET A CB    1 
ATOM 690   C CG    . MET A 1 120 ? 260.108 246.444 225.393 1.00 36.60  ? 120 MET A CG    1 
ATOM 691   S SD    . MET A 1 120 ? 260.326 247.517 223.969 1.00 36.60  ? 120 MET A SD    1 
ATOM 692   C CE    . MET A 1 120 ? 262.073 247.313 223.660 1.00 36.60  ? 120 MET A CE    1 
ATOM 693   N N     . PRO A 1 121 ? 262.513 246.388 229.193 1.00 35.79  ? 121 PRO A N     1 
ATOM 694   C CA    . PRO A 1 121 ? 263.228 246.931 230.352 1.00 35.79  ? 121 PRO A CA    1 
ATOM 695   C C     . PRO A 1 121 ? 262.925 248.385 230.615 1.00 35.79  ? 121 PRO A C     1 
ATOM 696   O O     . PRO A 1 121 ? 262.880 248.788 231.778 1.00 35.79  ? 121 PRO A O     1 
ATOM 697   C CB    . PRO A 1 121 ? 264.698 246.721 229.979 1.00 35.79  ? 121 PRO A CB    1 
ATOM 698   C CG    . PRO A 1 121 ? 264.679 245.570 229.077 1.00 35.79  ? 121 PRO A CG    1 
ATOM 699   C CD    . PRO A 1 121 ? 263.423 245.672 228.285 1.00 35.79  ? 121 PRO A CD    1 
ATOM 700   N N     . LYS A 1 122 ? 262.714 249.188 229.576 1.00 36.01  ? 122 LYS A N     1 
ATOM 701   C CA    . LYS A 1 122 ? 262.383 250.586 229.805 1.00 36.01  ? 122 LYS A CA    1 
ATOM 702   C C     . LYS A 1 122 ? 261.002 250.743 230.429 1.00 36.01  ? 122 LYS A C     1 
ATOM 703   O O     . LYS A 1 122 ? 260.786 251.674 231.203 1.00 36.01  ? 122 LYS A O     1 
ATOM 704   C CB    . LYS A 1 122 ? 262.495 251.372 228.503 1.00 36.01  ? 122 LYS A CB    1 
ATOM 705   C CG    . LYS A 1 122 ? 261.416 251.099 227.490 1.00 36.01  ? 122 LYS A CG    1 
ATOM 706   C CD    . LYS A 1 122 ? 261.911 251.427 226.099 1.00 36.01  ? 122 LYS A CD    1 
ATOM 707   C CE    . LYS A 1 122 ? 260.778 251.775 225.166 1.00 36.01  ? 122 LYS A CE    1 
ATOM 708   N NZ    . LYS A 1 122 ? 260.219 253.116 225.487 1.00 36.01  ? 122 LYS A NZ    1 
ATOM 709   N N     . ASP A 1 123 ? 260.070 249.833 230.145 1.00 36.05  ? 123 ASP A N     1 
ATOM 710   C CA    . ASP A 1 123 ? 258.795 249.850 230.854 1.00 36.05  ? 123 ASP A CA    1 
ATOM 711   C C     . ASP A 1 123 ? 258.992 249.545 232.332 1.00 36.05  ? 123 ASP A C     1 
ATOM 712   O O     . ASP A 1 123 ? 258.415 250.212 233.200 1.00 36.05  ? 123 ASP A O     1 
ATOM 713   C CB    . ASP A 1 123 ? 257.824 248.850 230.235 1.00 36.05  ? 123 ASP A CB    1 
ATOM 714   C CG    . ASP A 1 123 ? 257.645 249.048 228.760 1.00 36.05  ? 123 ASP A CG    1 
ATOM 715   O OD1   . ASP A 1 123 ? 257.580 250.206 228.319 1.00 36.05  ? 123 ASP A OD1   1 
ATOM 716   O OD2   . ASP A 1 123 ? 257.580 248.041 228.033 1.00 36.05  ? 123 ASP A OD2   1 
ATOM 717   N N     . ILE A 1 124 ? 259.808 248.535 232.640 1.00 35.86  ? 124 ILE A N     1 
ATOM 718   C CA    . ILE A 1 124 ? 260.084 248.242 234.047 1.00 35.86  ? 124 ILE A CA    1 
ATOM 719   C C     . ILE A 1 124 ? 260.739 249.436 234.729 1.00 35.86  ? 124 ILE A C     1 
ATOM 720   O O     . ILE A 1 124 ? 260.376 249.811 235.852 1.00 35.86  ? 124 ILE A O     1 
ATOM 721   C CB    . ILE A 1 124 ? 260.949 246.978 234.183 1.00 35.86  ? 124 ILE A CB    1 
ATOM 722   C CG1   . ILE A 1 124 ? 260.087 245.730 234.076 1.00 35.86  ? 124 ILE A CG1   1 
ATOM 723   C CG2   . ILE A 1 124 ? 261.686 246.980 235.503 1.00 35.86  ? 124 ILE A CG2   1 
ATOM 724   C CD1   . ILE A 1 124 ? 260.846 244.460 234.260 1.00 35.86  ? 124 ILE A CD1   1 
ATOM 725   N N     . GLN A 1 125 ? 261.715 250.048 234.064 1.00 36.70  ? 125 GLN A N     1 
ATOM 726   C CA    . GLN A 1 125 ? 262.429 251.171 234.649 1.00 36.70  ? 125 GLN A CA    1 
ATOM 727   C C     . GLN A 1 125 ? 261.503 252.353 234.872 1.00 36.70  ? 125 GLN A C     1 
ATOM 728   O O     . GLN A 1 125 ? 261.593 253.028 235.901 1.00 36.70  ? 125 GLN A O     1 
ATOM 729   C CB    . GLN A 1 125 ? 263.600 251.564 233.759 1.00 36.70  ? 125 GLN A CB    1 
ATOM 730   C CG    . GLN A 1 125 ? 264.710 250.545 233.732 1.00 36.70  ? 125 GLN A CG    1 
ATOM 731   C CD    . GLN A 1 125 ? 265.512 250.605 232.455 1.00 36.70  ? 125 GLN A CD    1 
ATOM 732   O OE1   . GLN A 1 125 ? 265.401 251.555 231.685 1.00 36.70  ? 125 GLN A OE1   1 
ATOM 733   N NE2   . GLN A 1 125 ? 266.319 249.584 232.216 1.00 36.70  ? 125 GLN A NE2   1 
ATOM 734   N N     . LEU A 1 126 ? 260.592 252.610 233.933 1.00 35.85  ? 126 LEU A N     1 
ATOM 735   C CA    . LEU A 1 126 ? 259.647 253.699 234.120 1.00 35.85  ? 126 LEU A CA    1 
ATOM 736   C C     . LEU A 1 126 ? 258.724 253.429 235.293 1.00 35.85  ? 126 LEU A C     1 
ATOM 737   O O     . LEU A 1 126 ? 258.470 254.324 236.105 1.00 35.85  ? 126 LEU A O     1 
ATOM 738   C CB    . LEU A 1 126 ? 258.824 253.927 232.858 1.00 35.85  ? 126 LEU A CB    1 
ATOM 739   C CG    . LEU A 1 126 ? 257.746 254.991 233.068 1.00 35.85  ? 126 LEU A CG    1 
ATOM 740   C CD1   . LEU A 1 126 ? 258.376 256.363 233.200 1.00 35.85  ? 126 LEU A CD1   1 
ATOM 741   C CD2   . LEU A 1 126 ? 256.717 254.972 231.969 1.00 35.85  ? 126 LEU A CD2   1 
ATOM 742   N N     . ALA A 1 127 ? 258.191 252.213 235.388 1.00 36.30  ? 127 ALA A N     1 
ATOM 743   C CA    . ALA A 1 127 ? 257.315 251.894 236.508 1.00 36.30  ? 127 ALA A CA    1 
ATOM 744   C C     . ALA A 1 127 ? 258.035 252.088 237.836 1.00 36.30  ? 127 ALA A C     1 
ATOM 745   O O     . ALA A 1 127 ? 257.490 252.685 238.769 1.00 36.30  ? 127 ALA A O     1 
ATOM 746   C CB    . ALA A 1 127 ? 256.789 250.468 236.380 1.00 36.30  ? 127 ALA A CB    1 
ATOM 747   N N     . ARG A 1 128 ? 259.274 251.608 237.935 1.00 37.18  ? 128 ARG A N     1 
ATOM 748   C CA    . ARG A 1 128 ? 259.984 251.731 239.202 1.00 37.18  ? 128 ARG A CA    1 
ATOM 749   C C     . ARG A 1 128 ? 260.373 253.171 239.499 1.00 37.18  ? 128 ARG A C     1 
ATOM 750   O O     . ARG A 1 128 ? 260.458 253.552 240.667 1.00 37.18  ? 128 ARG A O     1 
ATOM 751   C CB    . ARG A 1 128 ? 261.211 250.830 239.215 1.00 37.18  ? 128 ARG A CB    1 
ATOM 752   C CG    . ARG A 1 128 ? 260.855 249.371 239.333 1.00 37.18  ? 128 ARG A CG    1 
ATOM 753   C CD    . ARG A 1 128 ? 262.074 248.494 239.387 1.00 37.18  ? 128 ARG A CD    1 
ATOM 754   N NE    . ARG A 1 128 ? 262.793 248.618 240.648 1.00 37.18  ? 128 ARG A NE    1 
ATOM 755   C CZ    . ARG A 1 128 ? 264.048 249.031 240.752 1.00 37.18  ? 128 ARG A CZ    1 
ATOM 756   N NH1   . ARG A 1 128 ? 264.734 249.354 239.668 1.00 37.18  ? 128 ARG A NH1   1 
ATOM 757   N NH2   . ARG A 1 128 ? 264.622 249.104 241.941 1.00 37.18  ? 128 ARG A NH2   1 
ATOM 758   N N     . ARG A 1 129 ? 260.601 253.984 238.469 1.00 37.61  ? 129 ARG A N     1 
ATOM 759   C CA    . ARG A 1 129 ? 260.875 255.397 238.697 1.00 37.61  ? 129 ARG A CA    1 
ATOM 760   C C     . ARG A 1 129 ? 259.628 256.137 239.161 1.00 37.61  ? 129 ARG A C     1 
ATOM 761   O O     . ARG A 1 129 ? 259.700 256.968 240.069 1.00 37.61  ? 129 ARG A O     1 
ATOM 762   C CB    . ARG A 1 129 ? 261.447 256.025 237.430 1.00 37.61  ? 129 ARG A CB    1 
ATOM 763   C CG    . ARG A 1 129 ? 261.354 257.534 237.361 1.00 37.61  ? 129 ARG A CG    1 
ATOM 764   C CD    . ARG A 1 129 ? 262.129 258.237 238.463 1.00 37.61  ? 129 ARG A CD    1 
ATOM 765   N NE    . ARG A 1 129 ? 261.955 259.684 238.390 1.00 37.61  ? 129 ARG A NE    1 
ATOM 766   C CZ    . ARG A 1 129 ? 260.925 260.347 238.910 1.00 37.61  ? 129 ARG A CZ    1 
ATOM 767   N NH1   . ARG A 1 129 ? 259.963 259.700 239.554 1.00 37.61  ? 129 ARG A NH1   1 
ATOM 768   N NH2   . ARG A 1 129 ? 260.854 261.663 238.782 1.00 37.61  ? 129 ARG A NH2   1 
ATOM 769   N N     . ILE A 1 130 ? 258.477 255.850 238.558 1.00 36.70  ? 130 ILE A N     1 
ATOM 770   C CA    . ILE A 1 130 ? 257.253 256.520 238.981 1.00 36.70  ? 130 ILE A CA    1 
ATOM 771   C C     . ILE A 1 130 ? 256.897 256.123 240.406 1.00 36.70  ? 130 ILE A C     1 
ATOM 772   O O     . ILE A 1 130 ? 256.478 256.961 241.210 1.00 36.70  ? 130 ILE A O     1 
ATOM 773   C CB    . ILE A 1 130 ? 256.097 256.219 238.013 1.00 36.70  ? 130 ILE A CB    1 
ATOM 774   C CG1   . ILE A 1 130 ? 256.449 256.652 236.595 1.00 36.70  ? 130 ILE A CG1   1 
ATOM 775   C CG2   . ILE A 1 130 ? 254.840 256.911 238.477 1.00 36.70  ? 130 ILE A CG2   1 
ATOM 776   C CD1   . ILE A 1 130 ? 256.761 258.099 236.463 1.00 36.70  ? 130 ILE A CD1   1 
ATOM 777   N N     . ARG A 1 131 ? 257.064 254.843 240.745 1.00 36.73  ? 131 ARG A N     1 
ATOM 778   C CA    . ARG A 1 131 ? 256.809 254.419 242.118 1.00 36.73  ? 131 ARG A CA    1 
ATOM 779   C C     . ARG A 1 131 ? 257.708 255.138 243.110 1.00 36.73  ? 131 ARG A C     1 
ATOM 780   O O     . ARG A 1 131 ? 257.298 255.395 244.244 1.00 36.73  ? 131 ARG A O     1 
ATOM 781   C CB    . ARG A 1 131 ? 257.011 252.918 242.258 1.00 36.73  ? 131 ARG A CB    1 
ATOM 782   C CG    . ARG A 1 131 ? 255.926 252.080 241.677 1.00 36.73  ? 131 ARG A CG    1 
ATOM 783   C CD    . ARG A 1 131 ? 256.379 250.653 241.680 1.00 36.73  ? 131 ARG A CD    1 
ATOM 784   N NE    . ARG A 1 131 ? 255.278 249.726 241.505 1.00 36.73  ? 131 ARG A NE    1 
ATOM 785   C CZ    . ARG A 1 131 ? 255.329 248.450 241.853 1.00 36.73  ? 131 ARG A CZ    1 
ATOM 786   N NH1   . ARG A 1 131 ? 256.425 247.958 242.408 1.00 36.73  ? 131 ARG A NH1   1 
ATOM 787   N NH2   . ARG A 1 131 ? 254.279 247.672 241.661 1.00 36.73  ? 131 ARG A NH2   1 
ATOM 788   N N     . GLY A 1 132 ? 258.929 255.460 242.715 1.00 38.98  ? 132 GLY A N     1 
ATOM 789   C CA    . GLY A 1 132 ? 259.856 256.076 243.635 1.00 38.98  ? 132 GLY A CA    1 
ATOM 790   C C     . GLY A 1 132 ? 260.794 255.053 244.231 1.00 38.98  ? 132 GLY A C     1 
ATOM 791   O O     . GLY A 1 132 ? 260.951 254.977 245.451 1.00 38.98  ? 132 GLY A O     1 
ATOM 792   N N     . GLU A 1 133 ? 261.404 254.240 243.373 1.00 40.74  ? 133 GLU A N     1 
ATOM 793   C CA    . GLU A 1 133 ? 262.333 253.208 243.800 1.00 40.74  ? 133 GLU A CA    1 
ATOM 794   C C     . GLU A 1 133 ? 263.709 253.337 243.167 1.00 40.74  ? 133 GLU A C     1 
ATOM 795   O O     . GLU A 1 133 ? 264.658 252.725 243.666 1.00 40.74  ? 133 GLU A O     1 
ATOM 796   C CB    . GLU A 1 133 ? 261.760 251.820 243.486 1.00 40.74  ? 133 GLU A CB    1 
ATOM 797   C CG    . GLU A 1 133 ? 260.369 251.602 244.046 1.00 40.74  ? 133 GLU A CG    1 
ATOM 798   C CD    . GLU A 1 133 ? 259.773 250.273 243.643 1.00 40.74  ? 133 GLU A CD    1 
ATOM 799   O OE1   . GLU A 1 133 ? 260.391 249.569 242.823 1.00 40.74  ? 133 GLU A OE1   1 
ATOM 800   O OE2   . GLU A 1 133 ? 258.684 249.935 244.146 1.00 40.74  ? 133 GLU A OE2   1 
ATOM 801   N N     . ARG A 1 134 ? 263.846 254.108 242.097 1.00 42.46  ? 134 ARG A N     1 
ATOM 802   C CA    . ARG A 1 134 ? 265.132 254.255 241.428 1.00 42.46  ? 134 ARG A CA    1 
ATOM 803   C C     . ARG A 1 134 ? 265.461 255.727 241.195 1.00 42.46  ? 134 ARG A C     1 
ATOM 804   O O     . ARG A 1 134 ? 264.573 256.539 240.939 1.00 42.46  ? 134 ARG A O     1 
ATOM 805   C CB    . ARG A 1 134 ? 265.132 253.494 240.103 1.00 42.46  ? 134 ARG A CB    1 
ATOM 806   C CG    . ARG A 1 134 ? 264.058 253.957 239.144 1.00 42.46  ? 134 ARG A CG    1 
ATOM 807   C CD    . ARG A 1 134 ? 263.958 253.070 237.920 1.00 42.46  ? 134 ARG A CD    1 
ATOM 808   N NE    . ARG A 1 134 ? 265.206 253.018 237.169 1.00 42.46  ? 134 ARG A NE    1 
ATOM 809   C CZ    . ARG A 1 134 ? 265.535 253.866 236.200 1.00 42.46  ? 134 ARG A CZ    1 
ATOM 810   N NH1   . ARG A 1 134 ? 264.710 254.844 235.859 1.00 42.46  ? 134 ARG A NH1   1 
ATOM 811   N NH2   . ARG A 1 134 ? 266.694 253.734 235.571 1.00 42.46  ? 134 ARG A NH2   1 
ATOM 812   N N     . VAL B 2 21  ? 279.819 228.208 250.731 1.00 50.98  ? 21  VAL B N     1 
ATOM 813   C CA    . VAL B 2 21  ? 279.579 229.525 250.156 1.00 50.98  ? 21  VAL B CA    1 
ATOM 814   C C     . VAL B 2 21  ? 278.858 229.398 248.823 1.00 50.98  ? 21  VAL B C     1 
ATOM 815   O O     . VAL B 2 21  ? 279.364 228.774 247.892 1.00 50.98  ? 21  VAL B O     1 
ATOM 816   C CB    . VAL B 2 21  ? 280.892 230.306 249.986 1.00 50.98  ? 21  VAL B CB    1 
ATOM 817   C CG1   . VAL B 2 21  ? 280.634 231.627 249.275 1.00 50.98  ? 21  VAL B CG1   1 
ATOM 818   C CG2   . VAL B 2 21  ? 281.543 230.545 251.335 1.00 50.98  ? 21  VAL B CG2   1 
ATOM 819   N N     . LEU B 2 22  ? 277.682 230.008 248.733 1.00 48.16  ? 22  LEU B N     1 
ATOM 820   C CA    . LEU B 2 22  ? 276.851 229.952 247.541 1.00 48.16  ? 22  LEU B CA    1 
ATOM 821   C C     . LEU B 2 22  ? 277.273 231.024 246.545 1.00 48.16  ? 22  LEU B C     1 
ATOM 822   O O     . LEU B 2 22  ? 277.885 232.030 246.910 1.00 48.16  ? 22  LEU B O     1 
ATOM 823   C CB    . LEU B 2 22  ? 275.377 230.129 247.905 1.00 48.16  ? 22  LEU B CB    1 
ATOM 824   C CG    . LEU B 2 22  ? 274.692 228.929 248.555 1.00 48.16  ? 22  LEU B CG    1 
ATOM 825   C CD1   . LEU B 2 22  ? 273.342 229.326 249.115 1.00 48.16  ? 22  LEU B CD1   1 
ATOM 826   C CD2   . LEU B 2 22  ? 274.540 227.802 247.546 1.00 48.16  ? 22  LEU B CD2   1 
ATOM 827   N N     . ARG B 2 23  ? 276.953 230.790 245.274 1.00 49.07  ? 23  ARG B N     1 
ATOM 828   C CA    . ARG B 2 23  ? 277.245 231.752 244.223 1.00 49.07  ? 23  ARG B CA    1 
ATOM 829   C C     . ARG B 2 23  ? 276.329 231.503 243.033 1.00 49.07  ? 23  ARG B C     1 
ATOM 830   O O     . ARG B 2 23  ? 275.879 230.377 242.804 1.00 49.07  ? 23  ARG B O     1 
ATOM 831   C CB    . ARG B 2 23  ? 278.720 231.690 243.797 1.00 49.07  ? 23  ARG B CB    1 
ATOM 832   C CG    . ARG B 2 23  ? 279.337 230.293 243.813 1.00 49.07  ? 23  ARG B CG    1 
ATOM 833   C CD    . ARG B 2 23  ? 278.879 229.459 242.630 1.00 49.07  ? 23  ARG B CD    1 
ATOM 834   N NE    . ARG B 2 23  ? 279.101 228.033 242.840 1.00 49.07  ? 23  ARG B NE    1 
ATOM 835   C CZ    . ARG B 2 23  ? 278.583 227.079 242.075 1.00 49.07  ? 23  ARG B CZ    1 
ATOM 836   N NH1   . ARG B 2 23  ? 277.806 227.398 241.050 1.00 49.07  ? 23  ARG B NH1   1 
ATOM 837   N NH2   . ARG B 2 23  ? 278.837 225.805 242.338 1.00 49.07  ? 23  ARG B NH2   1 
ATOM 838   N N     . ASP B 2 24  ? 276.043 232.575 242.292 1.00 46.63  ? 24  ASP B N     1 
ATOM 839   C CA    . ASP B 2 24  ? 275.330 232.496 241.015 1.00 46.63  ? 24  ASP B CA    1 
ATOM 840   C C     . ASP B 2 24  ? 273.959 231.839 241.168 1.00 46.63  ? 24  ASP B C     1 
ATOM 841   O O     . ASP B 2 24  ? 273.511 231.076 240.312 1.00 46.63  ? 24  ASP B O     1 
ATOM 842   C CB    . ASP B 2 24  ? 276.172 231.762 239.971 1.00 46.63  ? 24  ASP B CB    1 
ATOM 843   C CG    . ASP B 2 24  ? 275.600 231.873 238.579 1.00 46.63  ? 24  ASP B CG    1 
ATOM 844   O OD1   . ASP B 2 24  ? 275.473 233.009 238.081 1.00 46.63  ? 24  ASP B OD1   1 
ATOM 845   O OD2   . ASP B 2 24  ? 275.278 230.821 237.989 1.00 46.63  ? 24  ASP B OD2   1 
ATOM 846   N N     . ASN B 2 25  ? 273.279 232.140 242.262 1.00 43.07  ? 25  ASN B N     1 
ATOM 847   C CA    . ASN B 2 25  ? 271.979 231.539 242.493 1.00 43.07  ? 25  ASN B CA    1 
ATOM 848   C C     . ASN B 2 25  ? 270.843 232.355 241.905 1.00 43.07  ? 25  ASN B C     1 
ATOM 849   O O     . ASN B 2 25  ? 269.714 231.861 241.849 1.00 43.07  ? 25  ASN B O     1 
ATOM 850   C CB    . ASN B 2 25  ? 271.758 231.335 243.989 1.00 43.07  ? 25  ASN B CB    1 
ATOM 851   C CG    . ASN B 2 25  ? 272.774 230.406 244.597 1.00 43.07  ? 25  ASN B CG    1 
ATOM 852   O OD1   . ASN B 2 25  ? 272.558 229.204 244.681 1.00 43.07  ? 25  ASN B OD1   1 
ATOM 853   N ND2   . ASN B 2 25  ? 273.899 230.958 245.014 1.00 43.07  ? 25  ASN B ND2   1 
ATOM 854   N N     . ILE B 2 26  ? 271.111 233.581 241.459 1.00 40.03  ? 26  ILE B N     1 
ATOM 855   C CA    . ILE B 2 26  ? 270.057 234.379 240.846 1.00 40.03  ? 26  ILE B CA    1 
ATOM 856   C C     . ILE B 2 26  ? 269.599 233.741 239.544 1.00 40.03  ? 26  ILE B C     1 
ATOM 857   O O     . ILE B 2 26  ? 268.424 233.839 239.175 1.00 40.03  ? 26  ILE B O     1 
ATOM 858   C CB    . ILE B 2 26  ? 270.530 235.832 240.649 1.00 40.03  ? 26  ILE B CB    1 
ATOM 859   C CG1   . ILE B 2 26  ? 269.349 236.744 240.336 1.00 40.03  ? 26  ILE B CG1   1 
ATOM 860   C CG2   . ILE B 2 26  ? 271.567 235.922 239.560 1.00 40.03  ? 26  ILE B CG2   1 
ATOM 861   C CD1   . ILE B 2 26  ? 268.323 236.801 241.423 1.00 40.03  ? 26  ILE B CD1   1 
ATOM 862   N N     . GLN B 2 27  ? 270.498 233.041 238.849 1.00 40.58  ? 27  GLN B N     1 
ATOM 863   C CA    . GLN B 2 27  ? 270.109 232.310 237.652 1.00 40.58  ? 27  GLN B CA    1 
ATOM 864   C C     . GLN B 2 27  ? 269.152 231.171 237.961 1.00 40.58  ? 27  GLN B C     1 
ATOM 865   O O     . GLN B 2 27  ? 268.548 230.621 237.039 1.00 40.58  ? 27  GLN B O     1 
ATOM 866   C CB    . GLN B 2 27  ? 271.345 231.774 236.933 1.00 40.58  ? 27  GLN B CB    1 
ATOM 867   C CG    . GLN B 2 27  ? 272.216 232.854 236.325 1.00 40.58  ? 27  GLN B CG    1 
ATOM 868   C CD    . GLN B 2 27  ? 271.463 233.729 235.342 1.00 40.58  ? 27  GLN B CD    1 
ATOM 869   O OE1   . GLN B 2 27  ? 271.634 234.944 235.321 1.00 40.58  ? 27  GLN B OE1   1 
ATOM 870   N NE2   . GLN B 2 27  ? 270.631 233.111 234.517 1.00 40.58  ? 27  GLN B NE2   1 
ATOM 871   N N     . GLY B 2 28  ? 269.004 230.804 239.232 1.00 39.41  ? 28  GLY B N     1 
ATOM 872   C CA    . GLY B 2 28  ? 267.983 229.849 239.611 1.00 39.41  ? 28  GLY B CA    1 
ATOM 873   C C     . GLY B 2 28  ? 266.575 230.387 239.496 1.00 39.41  ? 28  GLY B C     1 
ATOM 874   O O     . GLY B 2 28  ? 265.617 229.613 239.560 1.00 39.41  ? 28  GLY B O     1 
ATOM 875   N N     . ILE B 2 29  ? 266.423 231.698 239.336 1.00 37.73  ? 29  ILE B N     1 
ATOM 876   C CA    . ILE B 2 29  ? 265.126 232.284 239.010 1.00 37.73  ? 29  ILE B CA    1 
ATOM 877   C C     . ILE B 2 29  ? 265.027 232.249 237.489 1.00 37.73  ? 29  ILE B C     1 
ATOM 878   O O     . ILE B 2 29  ? 265.529 233.132 236.796 1.00 37.73  ? 29  ILE B O     1 
ATOM 879   C CB    . ILE B 2 29  ? 264.968 233.698 239.571 1.00 37.73  ? 29  ILE B CB    1 
ATOM 880   C CG1   . ILE B 2 29  ? 264.732 233.654 241.080 1.00 37.73  ? 29  ILE B CG1   1 
ATOM 881   C CG2   . ILE B 2 29  ? 263.770 234.383 238.961 1.00 37.73  ? 29  ILE B CG2   1 
ATOM 882   C CD1   . ILE B 2 29  ? 265.899 233.201 241.900 1.00 37.73  ? 29  ILE B CD1   1 
ATOM 883   N N     . THR B 2 30  ? 264.408 231.202 236.966 1.00 36.64  ? 30  THR B N     1 
ATOM 884   C CA    . THR B 2 30  ? 264.559 230.879 235.563 1.00 36.64  ? 30  THR B CA    1 
ATOM 885   C C     . THR B 2 30  ? 263.662 231.753 234.696 1.00 36.64  ? 30  THR B C     1 
ATOM 886   O O     . THR B 2 30  ? 262.745 232.428 235.167 1.00 36.64  ? 30  THR B O     1 
ATOM 887   C CB    . THR B 2 30  ? 264.252 229.405 235.320 1.00 36.64  ? 30  THR B CB    1 
ATOM 888   O OG1   . THR B 2 30  ? 262.867 229.156 235.565 1.00 36.64  ? 30  THR B OG1   1 
ATOM 889   C CG2   . THR B 2 30  ? 265.068 228.545 236.242 1.00 36.64  ? 30  THR B CG2   1 
ATOM 890   N N     . LYS B 2 31  ? 263.962 231.730 233.403 1.00 35.31  ? 31  LYS B N     1 
ATOM 891   C CA    . LYS B 2 31  ? 263.127 232.408 232.422 1.00 35.31  ? 31  LYS B CA    1 
ATOM 892   C C     . LYS B 2 31  ? 261.676 231.945 232.454 1.00 35.31  ? 31  LYS B C     1 
ATOM 893   O O     . LYS B 2 31  ? 260.786 232.810 232.415 1.00 35.31  ? 31  LYS B O     1 
ATOM 894   C CB    . LYS B 2 31  ? 263.757 232.229 231.038 1.00 35.31  ? 31  LYS B CB    1 
ATOM 895   C CG    . LYS B 2 31  ? 262.880 232.591 229.875 1.00 35.31  ? 31  LYS B CG    1 
ATOM 896   C CD    . LYS B 2 31  ? 263.612 232.329 228.577 1.00 35.31  ? 31  LYS B CD    1 
ATOM 897   C CE    . LYS B 2 31  ? 262.880 232.914 227.388 1.00 35.31  ? 31  LYS B CE    1 
ATOM 898   N NZ    . LYS B 2 31  ? 261.681 232.126 227.032 1.00 35.31  ? 31  LYS B NZ    1 
ATOM 899   N N     . PRO B 2 32  ? 261.357 230.647 232.527 1.00 34.64  ? 32  PRO B N     1 
ATOM 900   C CA    . PRO B 2 32  ? 259.945 230.274 232.697 1.00 34.64  ? 32  PRO B CA    1 
ATOM 901   C C     . PRO B 2 32  ? 259.332 230.760 233.998 1.00 34.64  ? 32  PRO B C     1 
ATOM 902   O O     . PRO B 2 32  ? 258.141 231.080 234.025 1.00 34.64  ? 32  PRO B O     1 
ATOM 903   C CB    . PRO B 2 32  ? 259.977 228.743 232.616 1.00 34.64  ? 32  PRO B CB    1 
ATOM 904   C CG    . PRO B 2 32  ? 261.389 228.366 232.786 1.00 34.64  ? 32  PRO B CG    1 
ATOM 905   C CD    . PRO B 2 32  ? 262.176 229.469 232.208 1.00 34.64  ? 32  PRO B CD    1 
ATOM 906   N N     . ALA B 2 33  ? 260.100 230.830 235.081 1.00 34.29  ? 33  ALA B N     1 
ATOM 907   C CA    . ALA B 2 33  ? 259.549 231.343 236.329 1.00 34.29  ? 33  ALA B CA    1 
ATOM 908   C C     . ALA B 2 33  ? 259.187 232.815 236.193 1.00 34.29  ? 33  ALA B C     1 
ATOM 909   O O     . ALA B 2 33  ? 258.113 233.249 236.627 1.00 34.29  ? 33  ALA B O     1 
ATOM 910   C CB    . ALA B 2 33  ? 260.540 231.124 237.466 1.00 34.29  ? 33  ALA B CB    1 
ATOM 911   N N     . ILE B 2 34  ? 260.065 233.591 235.561 1.00 33.71  ? 34  ILE B N     1 
ATOM 912   C CA    . ILE B 2 34  ? 259.780 234.999 235.320 1.00 33.71  ? 34  ILE B CA    1 
ATOM 913   C C     . ILE B 2 34  ? 258.584 235.148 234.395 1.00 33.71  ? 34  ILE B C     1 
ATOM 914   O O     . ILE B 2 34  ? 257.746 236.039 234.574 1.00 33.71  ? 34  ILE B O     1 
ATOM 915   C CB    . ILE B 2 34  ? 261.032 235.698 234.762 1.00 33.71  ? 34  ILE B CB    1 
ATOM 916   C CG1   . ILE B 2 34  ? 262.153 235.636 235.795 1.00 33.71  ? 34  ILE B CG1   1 
ATOM 917   C CG2   . ILE B 2 34  ? 260.729 237.126 234.366 1.00 33.71  ? 34  ILE B CG2   1 
ATOM 918   C CD1   . ILE B 2 34  ? 263.459 236.179 235.320 1.00 33.71  ? 34  ILE B CD1   1 
ATOM 919   N N     . ARG B 2 35  ? 258.466 234.260 233.407 1.00 34.99  ? 35  ARG B N     1 
ATOM 920   C CA    . ARG B 2 35  ? 257.310 234.304 232.525 1.00 34.99  ? 35  ARG B CA    1 
ATOM 921   C C     . ARG B 2 35  ? 256.025 234.008 233.280 1.00 34.99  ? 35  ARG B C     1 
ATOM 922   O O     . ARG B 2 35  ? 255.003 234.645 233.032 1.00 34.99  ? 35  ARG B O     1 
ATOM 923   C CB    . ARG B 2 35  ? 257.494 233.334 231.362 1.00 34.99  ? 35  ARG B CB    1 
ATOM 924   C CG    . ARG B 2 35  ? 258.529 233.796 230.374 1.00 34.99  ? 35  ARG B CG    1 
ATOM 925   C CD    . ARG B 2 35  ? 258.806 232.758 229.323 1.00 34.99  ? 35  ARG B CD    1 
ATOM 926   N NE    . ARG B 2 35  ? 257.667 232.556 228.445 1.00 34.99  ? 35  ARG B NE    1 
ATOM 927   C CZ    . ARG B 2 35  ? 257.411 233.307 227.383 1.00 34.99  ? 35  ARG B CZ    1 
ATOM 928   N NH1   . ARG B 2 35  ? 258.209 234.315 227.072 1.00 34.99  ? 35  ARG B NH1   1 
ATOM 929   N NH2   . ARG B 2 35  ? 256.356 233.052 226.631 1.00 34.99  ? 35  ARG B NH2   1 
ATOM 930   N N     . ARG B 2 36  ? 256.055 233.058 234.215 1.00 33.91  ? 36  ARG B N     1 
ATOM 931   C CA    . ARG B 2 36  ? 254.862 232.763 235.004 1.00 33.91  ? 36  ARG B CA    1 
ATOM 932   C C     . ARG B 2 36  ? 254.471 233.950 235.870 1.00 33.91  ? 36  ARG B C     1 
ATOM 933   O O     . ARG B 2 36  ? 253.283 234.263 236.018 1.00 33.91  ? 36  ARG B O     1 
ATOM 934   C CB    . ARG B 2 36  ? 255.088 231.532 235.877 1.00 33.91  ? 36  ARG B CB    1 
ATOM 935   C CG    . ARG B 2 36  ? 255.178 230.236 235.128 1.00 33.91  ? 36  ARG B CG    1 
ATOM 936   C CD    . ARG B 2 36  ? 255.109 229.050 236.062 1.00 33.91  ? 36  ARG B CD    1 
ATOM 937   N NE    . ARG B 2 36  ? 256.292 228.909 236.899 1.00 33.91  ? 36  ARG B NE    1 
ATOM 938   C CZ    . ARG B 2 36  ? 257.411 228.306 236.519 1.00 33.91  ? 36  ARG B CZ    1 
ATOM 939   N NH1   . ARG B 2 36  ? 257.515 227.806 235.303 1.00 33.91  ? 36  ARG B NH1   1 
ATOM 940   N NH2   . ARG B 2 36  ? 258.431 228.219 237.353 1.00 33.91  ? 36  ARG B NH2   1 
ATOM 941   N N     . LEU B 2 37  ? 255.460 234.616 236.463 1.00 33.23  ? 37  LEU B N     1 
ATOM 942   C CA    . LEU B 2 37  ? 255.158 235.805 237.249 1.00 33.23  ? 37  LEU B CA    1 
ATOM 943   C C     . LEU B 2 37  ? 254.533 236.886 236.381 1.00 33.23  ? 37  LEU B C     1 
ATOM 944   O O     . LEU B 2 37  ? 253.549 237.517 236.777 1.00 33.23  ? 37  LEU B O     1 
ATOM 945   C CB    . LEU B 2 37  ? 256.418 236.322 237.939 1.00 33.23  ? 37  LEU B CB    1 
ATOM 946   C CG    . LEU B 2 37  ? 256.945 235.423 239.057 1.00 33.23  ? 37  LEU B CG    1 
ATOM 947   C CD1   . LEU B 2 37  ? 258.328 235.852 239.477 1.00 33.23  ? 37  LEU B CD1   1 
ATOM 948   C CD2   . LEU B 2 37  ? 256.010 235.433 240.245 1.00 33.23  ? 37  LEU B CD2   1 
ATOM 949   N N     . ALA B 2 38  ? 255.075 237.101 235.184 1.00 33.09  ? 38  ALA B N     1 
ATOM 950   C CA    . ALA B 2 38  ? 254.516 238.122 234.307 1.00 33.09  ? 38  ALA B CA    1 
ATOM 951   C C     . ALA B 2 38  ? 253.123 237.738 233.819 1.00 33.09  ? 38  ALA B C     1 
ATOM 952   O O     . ALA B 2 38  ? 252.280 238.608 233.593 1.00 33.09  ? 38  ALA B O     1 
ATOM 953   C CB    . ALA B 2 38  ? 255.458 238.379 233.136 1.00 33.09  ? 38  ALA B CB    1 
ATOM 954   N N     . ARG B 2 39  ? 252.860 236.442 233.645 1.00 34.16  ? 39  ARG B N     1 
ATOM 955   C CA    . ARG B 2 39  ? 251.508 236.008 233.302 1.00 34.16  ? 39  ARG B CA    1 
ATOM 956   C C     . ARG B 2 39  ? 250.536 236.314 234.428 1.00 34.16  ? 39  ARG B C     1 
ATOM 957   O O     . ARG B 2 39  ? 249.409 236.747 234.182 1.00 34.16  ? 39  ARG B O     1 
ATOM 958   C CB    . ARG B 2 39  ? 251.480 234.515 232.995 1.00 34.16  ? 39  ARG B CB    1 
ATOM 959   C CG    . ARG B 2 39  ? 252.273 234.107 231.790 1.00 34.16  ? 39  ARG B CG    1 
ATOM 960   C CD    . ARG B 2 39  ? 251.595 234.508 230.515 1.00 34.16  ? 39  ARG B CD    1 
ATOM 961   N NE    . ARG B 2 39  ? 252.344 234.032 229.365 1.00 34.16  ? 39  ARG B NE    1 
ATOM 962   C CZ    . ARG B 2 39  ? 253.169 234.781 228.654 1.00 34.16  ? 39  ARG B CZ    1 
ATOM 963   N NH1   . ARG B 2 39  ? 253.340 236.052 228.960 1.00 34.16  ? 39  ARG B NH1   1 
ATOM 964   N NH2   . ARG B 2 39  ? 253.810 234.260 227.627 1.00 34.16  ? 39  ARG B NH2   1 
ATOM 965   N N     . ARG B 2 40  ? 250.939 236.059 235.671 1.00 34.56  ? 40  ARG B N     1 
ATOM 966   C CA    . ARG B 2 40  ? 250.083 236.450 236.781 1.00 34.56  ? 40  ARG B CA    1 
ATOM 967   C C     . ARG B 2 40  ? 249.919 237.961 236.834 1.00 34.56  ? 40  ARG B C     1 
ATOM 968   O O     . ARG B 2 40  ? 248.881 238.459 237.277 1.00 34.56  ? 40  ARG B O     1 
ATOM 969   C CB    . ARG B 2 40  ? 250.628 235.916 238.101 1.00 34.56  ? 40  ARG B CB    1 
ATOM 970   C CG    . ARG B 2 40  ? 249.762 236.254 239.292 1.00 34.56  ? 40  ARG B CG    1 
ATOM 971   C CD    . ARG B 2 40  ? 250.151 235.468 240.517 1.00 34.56  ? 40  ARG B CD    1 
ATOM 972   N NE    . ARG B 2 40  ? 249.836 234.058 240.363 1.00 34.56  ? 40  ARG B NE    1 
ATOM 973   C CZ    . ARG B 2 40  ? 250.160 233.119 241.238 1.00 34.56  ? 40  ARG B CZ    1 
ATOM 974   N NH1   . ARG B 2 40  ? 250.815 233.433 242.340 1.00 34.56  ? 40  ARG B NH1   1 
ATOM 975   N NH2   . ARG B 2 40  ? 249.831 231.863 241.004 1.00 34.56  ? 40  ARG B NH2   1 
ATOM 976   N N     . GLY B 2 41  ? 250.915 238.702 236.380 1.00 33.13  ? 41  GLY B N     1 
ATOM 977   C CA    . GLY B 2 41  ? 250.774 240.130 236.239 1.00 33.13  ? 41  GLY B CA    1 
ATOM 978   C C     . GLY B 2 41  ? 250.015 240.578 235.014 1.00 33.13  ? 41  GLY B C     1 
ATOM 979   O O     . GLY B 2 41  ? 249.940 241.776 234.747 1.00 33.13  ? 41  GLY B O     1 
ATOM 980   N N     . GLY B 2 42  ? 249.452 239.646 234.250 1.00 33.50  ? 42  GLY B N     1 
ATOM 981   C CA    . GLY B 2 42  ? 248.671 239.973 233.078 1.00 33.50  ? 42  GLY B CA    1 
ATOM 982   C C     . GLY B 2 42  ? 249.453 240.263 231.820 1.00 33.50  ? 42  GLY B C     1 
ATOM 983   O O     . GLY B 2 42  ? 248.849 240.639 230.817 1.00 33.50  ? 42  GLY B O     1 
ATOM 984   N N     . VAL B 2 43  ? 250.765 240.088 231.829 1.00 33.61  ? 43  VAL B N     1 
ATOM 985   C CA    . VAL B 2 43  ? 251.594 240.403 230.671 1.00 33.61  ? 43  VAL B CA    1 
ATOM 986   C C     . VAL B 2 43  ? 251.393 239.334 229.605 1.00 33.61  ? 43  VAL B C     1 
ATOM 987   O O     . VAL B 2 43  ? 251.370 238.138 229.906 1.00 33.61  ? 43  VAL B O     1 
ATOM 988   C CB    . VAL B 2 43  ? 253.070 240.511 231.080 1.00 33.61  ? 43  VAL B CB    1 
ATOM 989   C CG1   . VAL B 2 43  ? 253.960 240.622 229.871 1.00 33.61  ? 43  VAL B CG1   1 
ATOM 990   C CG2   . VAL B 2 43  ? 253.279 241.680 232.015 1.00 33.61  ? 43  VAL B CG2   1 
ATOM 991   N N     . LYS B 2 44  ? 251.255 239.763 228.354 1.00 36.32  ? 44  LYS B N     1 
ATOM 992   C CA    . LYS B 2 44  ? 251.035 238.861 227.232 1.00 36.32  ? 44  LYS B CA    1 
ATOM 993   C C     . LYS B 2 44  ? 252.280 238.594 226.400 1.00 36.32  ? 44  LYS B C     1 
ATOM 994   O O     . LYS B 2 44  ? 252.415 237.501 225.848 1.00 36.32  ? 44  LYS B O     1 
ATOM 995   C CB    . LYS B 2 44  ? 249.947 239.425 226.317 1.00 36.32  ? 44  LYS B CB    1 
ATOM 996   C CG    . LYS B 2 44  ? 249.527 238.501 225.201 1.00 36.32  ? 44  LYS B CG    1 
ATOM 997   C CD    . LYS B 2 44  ? 248.523 239.179 224.305 1.00 36.32  ? 44  LYS B CD    1 
ATOM 998   C CE    . LYS B 2 44  ? 248.040 238.255 223.216 1.00 36.32  ? 44  LYS B CE    1 
ATOM 999   N NZ    . LYS B 2 44  ? 246.980 238.898 222.404 1.00 36.32  ? 44  LYS B NZ    1 
ATOM 1000  N N     . ARG B 2 45  ? 253.185 239.561 226.278 1.00 36.19  ? 45  ARG B N     1 
ATOM 1001  C CA    . ARG B 2 45  ? 254.356 239.420 225.427 1.00 36.19  ? 45  ARG B CA    1 
ATOM 1002  C C     . ARG B 2 45  ? 255.557 240.024 226.134 1.00 36.19  ? 45  ARG B C     1 
ATOM 1003  O O     . ARG B 2 45  ? 255.473 241.130 226.678 1.00 36.19  ? 45  ARG B O     1 
ATOM 1004  C CB    . ARG B 2 45  ? 254.125 240.085 224.070 1.00 36.19  ? 45  ARG B CB    1 
ATOM 1005  C CG    . ARG B 2 45  ? 254.984 239.559 222.960 1.00 36.19  ? 45  ARG B CG    1 
ATOM 1006  C CD    . ARG B 2 45  ? 254.479 240.029 221.621 1.00 36.19  ? 45  ARG B CD    1 
ATOM 1007  N NE    . ARG B 2 45  ? 255.210 239.419 220.520 1.00 36.19  ? 45  ARG B NE    1 
ATOM 1008  C CZ    . ARG B 2 45  ? 256.325 239.910 220.001 1.00 36.19  ? 45  ARG B CZ    1 
ATOM 1009  N NH1   . ARG B 2 45  ? 256.847 241.025 220.480 1.00 36.19  ? 45  ARG B NH1   1 
ATOM 1010  N NH2   . ARG B 2 45  ? 256.915 239.287 218.999 1.00 36.19  ? 45  ARG B NH2   1 
ATOM 1011  N N     . ILE B 2 46  ? 256.670 239.300 226.122 1.00 34.96  ? 46  ILE B N     1 
ATOM 1012  C CA    . ILE B 2 46  ? 257.800 239.579 226.997 1.00 34.96  ? 46  ILE B CA    1 
ATOM 1013  C C     . ILE B 2 46  ? 259.062 239.681 226.159 1.00 34.96  ? 46  ILE B C     1 
ATOM 1014  O O     . ILE B 2 46  ? 259.460 238.710 225.508 1.00 34.96  ? 46  ILE B O     1 
ATOM 1015  C CB    . ILE B 2 46  ? 257.965 238.500 228.079 1.00 34.96  ? 46  ILE B CB    1 
ATOM 1016  C CG1   . ILE B 2 46  ? 256.710 238.403 228.933 1.00 34.96  ? 46  ILE B CG1   1 
ATOM 1017  C CG2   . ILE B 2 46  ? 259.144 238.810 228.960 1.00 34.96  ? 46  ILE B CG2   1 
ATOM 1018  C CD1   . ILE B 2 46  ? 256.722 237.241 229.873 1.00 34.96  ? 46  ILE B CD1   1 
ATOM 1019  N N     . SER B 2 47  ? 259.700 240.844 226.195 1.00 35.63  ? 47  SER B N     1 
ATOM 1020  C CA    . SER B 2 47  ? 261.004 241.016 225.578 1.00 35.63  ? 47  SER B CA    1 
ATOM 1021  C C     . SER B 2 47  ? 262.006 240.036 226.171 1.00 35.63  ? 47  SER B C     1 
ATOM 1022  O O     . SER B 2 47  ? 261.903 239.633 227.329 1.00 35.63  ? 47  SER B O     1 
ATOM 1023  C CB    . SER B 2 47  ? 261.491 242.449 225.779 1.00 35.63  ? 47  SER B CB    1 
ATOM 1024  O OG    . SER B 2 47  ? 262.781 242.642 225.247 1.00 35.63  ? 47  SER B OG    1 
ATOM 1025  N N     . GLY B 2 48  ? 262.985 239.642 225.358 1.00 35.43  ? 48  GLY B N     1 
ATOM 1026  C CA    . GLY B 2 48  ? 264.038 238.775 225.842 1.00 35.43  ? 48  GLY B CA    1 
ATOM 1027  C C     . GLY B 2 48  ? 264.962 239.435 226.839 1.00 35.43  ? 48  GLY B C     1 
ATOM 1028  O O     . GLY B 2 48  ? 265.638 238.737 227.598 1.00 35.43  ? 48  GLY B O     1 
ATOM 1029  N N     . LEU B 2 49  ? 265.000 240.759 226.861 1.00 35.38  ? 49  LEU B N     1 
ATOM 1030  C CA    . LEU B 2 49  ? 265.833 241.499 227.795 1.00 35.38  ? 49  LEU B CA    1 
ATOM 1031  C C     . LEU B 2 49  ? 265.180 241.682 229.153 1.00 35.38  ? 49  LEU B C     1 
ATOM 1032  O O     . LEU B 2 49  ? 265.822 242.202 230.065 1.00 35.38  ? 49  LEU B O     1 
ATOM 1033  C CB    . LEU B 2 49  ? 266.181 242.861 227.205 1.00 35.38  ? 49  LEU B CB    1 
ATOM 1034  C CG    . LEU B 2 49  ? 267.037 242.791 225.949 1.00 35.38  ? 49  LEU B CG    1 
ATOM 1035  C CD1   . LEU B 2 49  ? 267.256 244.176 225.393 1.00 35.38  ? 49  LEU B CD1   1 
ATOM 1036  C CD2   . LEU B 2 49  ? 268.351 242.127 226.279 1.00 35.38  ? 49  LEU B CD2   1 
ATOM 1037  N N     . ILE B 2 50  ? 263.926 241.264 229.305 1.00 35.00  ? 50  ILE B N     1 
ATOM 1038  C CA    . ILE B 2 50  ? 263.201 241.469 230.550 1.00 35.00  ? 50  ILE B CA    1 
ATOM 1039  C C     . ILE B 2 50  ? 263.780 240.620 231.673 1.00 35.00  ? 50  ILE B C     1 
ATOM 1040  O O     . ILE B 2 50  ? 263.706 241.003 232.841 1.00 35.00  ? 50  ILE B O     1 
ATOM 1041  C CB    . ILE B 2 50  ? 261.703 241.181 230.314 1.00 35.00  ? 50  ILE B CB    1 
ATOM 1042  C CG1   . ILE B 2 50  ? 260.985 242.429 229.802 1.00 35.00  ? 50  ILE B CG1   1 
ATOM 1043  C CG2   . ILE B 2 50  ? 261.015 240.639 231.556 1.00 35.00  ? 50  ILE B CG2   1 
ATOM 1044  C CD1   . ILE B 2 50  ? 260.889 243.530 230.806 1.00 35.00  ? 50  ILE B CD1   1 
ATOM 1045  N N     . TYR B 2 51  ? 264.380 239.475 231.352 1.00 35.27  ? 51  TYR B N     1 
ATOM 1046  C CA    . TYR B 2 51  ? 264.727 238.510 232.392 1.00 35.27  ? 51  TYR B CA    1 
ATOM 1047  C C     . TYR B 2 51  ? 265.898 238.980 233.247 1.00 35.27  ? 51  TYR B C     1 
ATOM 1048  O O     . TYR B 2 51  ? 265.862 238.844 234.475 1.00 35.27  ? 51  TYR B O     1 
ATOM 1049  C CB    . TYR B 2 51  ? 265.004 237.155 231.754 1.00 35.27  ? 51  TYR B CB    1 
ATOM 1050  C CG    . TYR B 2 51  ? 263.868 236.730 230.869 1.00 35.27  ? 51  TYR B CG    1 
ATOM 1051  C CD1   . TYR B 2 51  ? 262.650 236.379 231.407 1.00 35.27  ? 51  TYR B CD1   1 
ATOM 1052  C CD2   . TYR B 2 51  ? 263.999 236.723 229.496 1.00 35.27  ? 51  TYR B CD2   1 
ATOM 1053  C CE1   . TYR B 2 51  ? 261.604 236.012 230.610 1.00 35.27  ? 51  TYR B CE1   1 
ATOM 1054  C CE2   . TYR B 2 51  ? 262.956 236.359 228.691 1.00 35.27  ? 51  TYR B CE2   1 
ATOM 1055  C CZ    . TYR B 2 51  ? 261.761 236.004 229.252 1.00 35.27  ? 51  TYR B CZ    1 
ATOM 1056  O OH    . TYR B 2 51  ? 260.714 235.631 228.452 1.00 35.27  ? 51  TYR B OH    1 
ATOM 1057  N N     . GLU B 2 52  ? 266.932 239.555 232.634 1.00 37.37  ? 52  GLU B N     1 
ATOM 1058  C CA    . GLU B 2 52  ? 268.038 240.083 233.426 1.00 37.37  ? 52  GLU B CA    1 
ATOM 1059  C C     . GLU B 2 52  ? 267.598 241.275 234.261 1.00 37.37  ? 52  GLU B C     1 
ATOM 1060  O O     . GLU B 2 52  ? 268.010 241.419 235.419 1.00 37.37  ? 52  GLU B O     1 
ATOM 1061  C CB    . GLU B 2 52  ? 269.200 240.466 232.517 1.00 37.37  ? 52  GLU B CB    1 
ATOM 1062  C CG    . GLU B 2 52  ? 269.994 239.280 232.049 1.00 37.37  ? 52  GLU B CG    1 
ATOM 1063  C CD    . GLU B 2 52  ? 270.553 238.472 233.202 1.00 37.37  ? 52  GLU B CD    1 
ATOM 1064  O OE1   . GLU B 2 52  ? 271.133 239.073 234.128 1.00 37.37  ? 52  GLU B OE1   1 
ATOM 1065  O OE2   . GLU B 2 52  ? 270.404 237.235 233.190 1.00 37.37  ? 52  GLU B OE2   1 
ATOM 1066  N N     . GLU B 2 53  ? 266.766 242.140 233.686 1.00 37.23  ? 53  GLU B N     1 
ATOM 1067  C CA    . GLU B 2 53  ? 266.225 243.264 234.436 1.00 37.23  ? 53  GLU B CA    1 
ATOM 1068  C C     . GLU B 2 53  ? 265.421 242.786 235.635 1.00 37.23  ? 53  GLU B C     1 
ATOM 1069  O O     . GLU B 2 53  ? 265.546 243.332 236.736 1.00 37.23  ? 53  GLU B O     1 
ATOM 1070  C CB    . GLU B 2 53  ? 265.365 244.127 233.519 1.00 37.23  ? 53  GLU B CB    1 
ATOM 1071  C CG    . GLU B 2 53  ? 264.993 245.468 234.098 1.00 37.23  ? 53  GLU B CG    1 
ATOM 1072  C CD    . GLU B 2 53  ? 266.123 246.466 234.011 1.00 37.23  ? 53  GLU B CD    1 
ATOM 1073  O OE1   . GLU B 2 53  ? 267.080 246.209 233.252 1.00 37.23  ? 53  GLU B OE1   1 
ATOM 1074  O OE2   . GLU B 2 53  ? 266.059 247.506 234.701 1.00 37.23  ? 53  GLU B OE2   1 
ATOM 1075  N N     . THR B 2 54  ? 264.595 241.760 235.441 1.00 35.22  ? 54  THR B N     1 
ATOM 1076  C CA    . THR B 2 54  ? 263.785 241.237 236.531 1.00 35.22  ? 54  THR B CA    1 
ATOM 1077  C C     . THR B 2 54  ? 264.655 240.620 237.610 1.00 35.22  ? 54  THR B C     1 
ATOM 1078  O O     . THR B 2 54  ? 264.363 240.756 238.801 1.00 35.22  ? 54  THR B O     1 
ATOM 1079  C CB    . THR B 2 54  ? 262.796 240.207 236.001 1.00 35.22  ? 54  THR B CB    1 
ATOM 1080  O OG1   . THR B 2 54  ? 262.027 240.784 234.945 1.00 35.22  ? 54  THR B OG1   1 
ATOM 1081  C CG2   . THR B 2 54  ? 261.863 239.752 237.100 1.00 35.22  ? 54  THR B CG2   1 
ATOM 1082  N N     . ARG B 2 55  ? 265.716 239.923 237.215 1.00 35.65  ? 55  ARG B N     1 
ATOM 1083  C CA    . ARG B 2 55  ? 266.630 239.381 238.208 1.00 35.65  ? 55  ARG B CA    1 
ATOM 1084  C C     . ARG B 2 55  ? 267.272 240.491 239.023 1.00 35.65  ? 55  ARG B C     1 
ATOM 1085  O O     . ARG B 2 55  ? 267.356 240.393 240.249 1.00 35.65  ? 55  ARG B O     1 
ATOM 1086  C CB    . ARG B 2 55  ? 267.684 238.516 237.530 1.00 35.65  ? 55  ARG B CB    1 
ATOM 1087  C CG    . ARG B 2 55  ? 267.120 237.237 237.000 1.00 35.65  ? 55  ARG B CG    1 
ATOM 1088  C CD    . ARG B 2 55  ? 268.183 236.378 236.380 1.00 35.65  ? 55  ARG B CD    1 
ATOM 1089  N NE    . ARG B 2 55  ? 267.594 235.201 235.766 1.00 35.65  ? 55  ARG B NE    1 
ATOM 1090  C CZ    . ARG B 2 55  ? 267.393 235.064 234.465 1.00 35.65  ? 55  ARG B CZ    1 
ATOM 1091  N NH1   . ARG B 2 55  ? 267.756 236.021 233.632 1.00 35.65  ? 55  ARG B NH1   1 
ATOM 1092  N NH2   . ARG B 2 55  ? 266.846 233.961 233.999 1.00 35.65  ? 55  ARG B NH2   1 
ATOM 1093  N N     . GLY B 2 56  ? 267.726 241.555 238.365 1.00 34.73  ? 56  GLY B N     1 
ATOM 1094  C CA    . GLY B 2 56  ? 268.292 242.674 239.102 1.00 34.73  ? 56  GLY B CA    1 
ATOM 1095  C C     . GLY B 2 56  ? 267.304 243.297 240.067 1.00 34.73  ? 56  GLY B C     1 
ATOM 1096  O O     . GLY B 2 56  ? 267.649 243.624 241.207 1.00 34.73  ? 56  GLY B O     1 
ATOM 1097  N N     . VAL B 2 57  ? 266.055 243.451 239.630 1.00 34.19  ? 57  VAL B N     1 
ATOM 1098  C CA    . VAL B 2 57  ? 265.027 244.026 240.492 1.00 34.19  ? 57  VAL B CA    1 
ATOM 1099  C C     . VAL B 2 57  ? 264.780 243.138 241.705 1.00 34.19  ? 57  VAL B C     1 
ATOM 1100  O O     . VAL B 2 57  ? 264.715 243.617 242.843 1.00 34.19  ? 57  VAL B O     1 
ATOM 1101  C CB    . VAL B 2 57  ? 263.737 244.264 239.692 1.00 34.19  ? 57  VAL B CB    1 
ATOM 1102  C CG1   . VAL B 2 57  ? 262.611 244.591 240.620 1.00 34.19  ? 57  VAL B CG1   1 
ATOM 1103  C CG2   . VAL B 2 57  ? 263.940 245.379 238.697 1.00 34.19  ? 57  VAL B CG2   1 
ATOM 1104  N N     . LEU B 2 58  ? 264.627 241.833 241.477 1.00 33.88  ? 58  LEU B N     1 
ATOM 1105  C CA    . LEU B 2 58  ? 264.366 240.911 242.575 1.00 33.88  ? 58  LEU B CA    1 
ATOM 1106  C C     . LEU B 2 58  ? 265.535 240.866 243.543 1.00 33.88  ? 58  LEU B C     1 
ATOM 1107  O O     . LEU B 2 58  ? 265.340 240.776 244.759 1.00 33.88  ? 58  LEU B O     1 
ATOM 1108  C CB    . LEU B 2 58  ? 264.074 239.515 242.034 1.00 33.88  ? 58  LEU B CB    1 
ATOM 1109  C CG    . LEU B 2 58  ? 263.979 238.422 243.097 1.00 33.88  ? 58  LEU B CG    1 
ATOM 1110  C CD1   . LEU B 2 58  ? 262.773 238.638 243.976 1.00 33.88  ? 58  LEU B CD1   1 
ATOM 1111  C CD2   . LEU B 2 58  ? 263.940 237.048 242.475 1.00 33.88  ? 58  LEU B CD2   1 
ATOM 1112  N N     . LYS B 2 59  ? 266.758 240.948 243.026 1.00 35.03  ? 59  LYS B N     1 
ATOM 1113  C CA    . LYS B 2 59  ? 267.920 240.945 243.901 1.00 35.03  ? 59  LYS B CA    1 
ATOM 1114  C C     . LYS B 2 59  ? 267.963 242.198 244.763 1.00 35.03  ? 59  LYS B C     1 
ATOM 1115  O O     . LYS B 2 59  ? 268.262 242.117 245.954 1.00 35.03  ? 59  LYS B O     1 
ATOM 1116  C CB    . LYS B 2 59  ? 269.198 240.810 243.083 1.00 35.03  ? 59  LYS B CB    1 
ATOM 1117  C CG    . LYS B 2 59  ? 270.307 240.124 243.834 1.00 35.03  ? 59  LYS B CG    1 
ATOM 1118  C CD    . LYS B 2 59  ? 271.619 240.185 243.091 1.00 35.03  ? 59  LYS B CD    1 
ATOM 1119  C CE    . LYS B 2 59  ? 272.163 241.600 243.074 1.00 35.03  ? 59  LYS B CE    1 
ATOM 1120  N NZ    . LYS B 2 59  ? 273.578 241.654 242.608 1.00 35.03  ? 59  LYS B NZ    1 
ATOM 1121  N N     . VAL B 2 60  ? 267.643 243.359 244.191 1.00 34.21  ? 60  VAL B N     1 
ATOM 1122  C CA    . VAL B 2 60  ? 267.613 244.588 244.982 1.00 34.21  ? 60  VAL B CA    1 
ATOM 1123  C C     . VAL B 2 60  ? 266.552 244.499 246.076 1.00 34.21  ? 60  VAL B C     1 
ATOM 1124  O O     . VAL B 2 60  ? 266.790 244.860 247.239 1.00 34.21  ? 60  VAL B O     1 
ATOM 1125  C CB    . VAL B 2 60  ? 267.376 245.801 244.068 1.00 34.21  ? 60  VAL B CB    1 
ATOM 1126  C CG1   . VAL B 2 60  ? 267.082 247.025 244.888 1.00 34.21  ? 60  VAL B CG1   1 
ATOM 1127  C CG2   . VAL B 2 60  ? 268.581 246.030 243.191 1.00 34.21  ? 60  VAL B CG2   1 
ATOM 1128  N N     . PHE B 2 61  ? 265.364 244.015 245.714 1.00 33.34  ? 61  PHE B N     1 
ATOM 1129  C CA    . PHE B 2 61  ? 264.281 243.882 246.681 1.00 33.34  ? 61  PHE B CA    1 
ATOM 1130  C C     . PHE B 2 61  ? 264.676 242.955 247.823 1.00 33.34  ? 61  PHE B C     1 
ATOM 1131  O O     . PHE B 2 61  ? 264.500 243.285 249.005 1.00 33.34  ? 61  PHE B O     1 
ATOM 1132  C CB    . PHE B 2 61  ? 263.029 243.377 245.966 1.00 33.34  ? 61  PHE B CB    1 
ATOM 1133  C CG    . PHE B 2 61  ? 261.885 243.078 246.879 1.00 33.34  ? 61  PHE B CG    1 
ATOM 1134  C CD1   . PHE B 2 61  ? 261.024 244.076 247.277 1.00 33.34  ? 61  PHE B CD1   1 
ATOM 1135  C CD2   . PHE B 2 61  ? 261.660 241.796 247.325 1.00 33.34  ? 61  PHE B CD2   1 
ATOM 1136  C CE1   . PHE B 2 61  ? 259.971 243.800 248.108 1.00 33.34  ? 61  PHE B CE1   1 
ATOM 1137  C CE2   . PHE B 2 61  ? 260.612 241.521 248.156 1.00 33.34  ? 61  PHE B CE2   1 
ATOM 1138  C CZ    . PHE B 2 61  ? 259.766 242.523 248.549 1.00 33.34  ? 61  PHE B CZ    1 
ATOM 1139  N N     . LEU B 2 62  ? 265.214 241.785 247.484 1.00 34.22  ? 62  LEU B N     1 
ATOM 1140  C CA    . LEU B 2 62  ? 265.614 240.831 248.504 1.00 34.22  ? 62  LEU B CA    1 
ATOM 1141  C C     . LEU B 2 62  ? 266.747 241.372 249.356 1.00 34.22  ? 62  LEU B C     1 
ATOM 1142  O O     . LEU B 2 62  ? 266.785 241.123 250.559 1.00 34.22  ? 62  LEU B O     1 
ATOM 1143  C CB    . LEU B 2 62  ? 266.016 239.511 247.865 1.00 34.22  ? 62  LEU B CB    1 
ATOM 1144  C CG    . LEU B 2 62  ? 264.844 238.620 247.487 1.00 34.22  ? 62  LEU B CG    1 
ATOM 1145  C CD1   . LEU B 2 62  ? 265.349 237.304 246.978 1.00 34.22  ? 62  LEU B CD1   1 
ATOM 1146  C CD2   . LEU B 2 62  ? 263.940 238.426 248.676 1.00 34.22  ? 62  LEU B CD2   1 
ATOM 1147  N N     . GLU B 2 63  ? 267.680 242.107 248.760 1.00 35.93  ? 63  GLU B N     1 
ATOM 1148  C CA    . GLU B 2 63  ? 268.755 242.681 249.555 1.00 35.93  ? 63  GLU B CA    1 
ATOM 1149  C C     . GLU B 2 63  ? 268.208 243.631 250.603 1.00 35.93  ? 63  GLU B C     1 
ATOM 1150  O O     . GLU B 2 63  ? 268.595 243.556 251.771 1.00 35.93  ? 63  GLU B O     1 
ATOM 1151  C CB    . GLU B 2 63  ? 269.768 243.385 248.658 1.00 35.93  ? 63  GLU B CB    1 
ATOM 1152  C CG    . GLU B 2 63  ? 270.737 242.428 248.014 1.00 35.93  ? 63  GLU B CG    1 
ATOM 1153  C CD    . GLU B 2 63  ? 271.708 243.098 247.067 1.00 35.93  ? 63  GLU B CD    1 
ATOM 1154  O OE1   . GLU B 2 63  ? 271.334 244.095 246.415 1.00 35.93  ? 63  GLU B OE1   1 
ATOM 1155  O OE2   . GLU B 2 63  ? 272.857 242.622 246.974 1.00 35.93  ? 63  GLU B OE2   1 
ATOM 1156  N N     . ASN B 2 64  ? 267.279 244.505 250.222 1.00 35.42  ? 64  ASN B N     1 
ATOM 1157  C CA    . ASN B 2 64  ? 266.718 245.418 251.214 1.00 35.42  ? 64  ASN B CA    1 
ATOM 1158  C C     . ASN B 2 64  ? 265.990 244.657 252.320 1.00 35.42  ? 64  ASN B C     1 
ATOM 1159  O O     . ASN B 2 64  ? 266.252 244.864 253.517 1.00 35.42  ? 64  ASN B O     1 
ATOM 1160  C CB    . ASN B 2 64  ? 265.787 246.415 250.538 1.00 35.42  ? 64  ASN B CB    1 
ATOM 1161  C CG    . ASN B 2 64  ? 266.506 247.289 249.555 1.00 35.42  ? 64  ASN B CG    1 
ATOM 1162  O OD1   . ASN B 2 64  ? 267.729 247.353 249.554 1.00 35.42  ? 64  ASN B OD1   1 
ATOM 1163  N ND2   . ASN B 2 64  ? 265.755 247.975 248.712 1.00 35.42  ? 64  ASN B ND2   1 
ATOM 1164  N N     . VAL B 2 65  ? 265.081 243.757 251.937 1.00 34.33  ? 65  VAL B N     1 
ATOM 1165  C CA    . VAL B 2 65  ? 264.287 243.056 252.941 1.00 34.33  ? 65  VAL B CA    1 
ATOM 1166  C C     . VAL B 2 65  ? 265.176 242.233 253.859 1.00 34.33  ? 65  VAL B C     1 
ATOM 1167  O O     . VAL B 2 65  ? 265.000 242.238 255.080 1.00 34.33  ? 65  VAL B O     1 
ATOM 1168  C CB    . VAL B 2 65  ? 263.211 242.180 252.279 1.00 34.33  ? 65  VAL B CB    1 
ATOM 1169  C CG1   . VAL B 2 65  ? 262.357 241.540 253.339 1.00 34.33  ? 65  VAL B CG1   1 
ATOM 1170  C CG2   . VAL B 2 65  ? 262.359 243.001 251.356 1.00 34.33  ? 65  VAL B CG2   1 
ATOM 1171  N N     . ILE B 2 66  ? 266.153 241.524 253.295 1.00 35.14  ? 66  ILE B N     1 
ATOM 1172  C CA    . ILE B 2 66  ? 266.976 240.620 254.084 1.00 35.14  ? 66  ILE B CA    1 
ATOM 1173  C C     . ILE B 2 66  ? 267.939 241.400 254.962 1.00 35.14  ? 66  ILE B C     1 
ATOM 1174  O O     . ILE B 2 66  ? 268.235 240.981 256.081 1.00 35.14  ? 66  ILE B O     1 
ATOM 1175  C CB    . ILE B 2 66  ? 267.709 239.624 253.168 1.00 35.14  ? 66  ILE B CB    1 
ATOM 1176  C CG1   . ILE B 2 66  ? 266.724 238.615 252.584 1.00 35.14  ? 66  ILE B CG1   1 
ATOM 1177  C CG2   . ILE B 2 66  ? 268.797 238.888 253.915 1.00 35.14  ? 66  ILE B CG2   1 
ATOM 1178  C CD1   . ILE B 2 66  ? 267.329 237.701 251.557 1.00 35.14  ? 66  ILE B CD1   1 
ATOM 1179  N N     . ARG B 2 67  ? 268.422 242.551 254.497 1.00 36.60  ? 67  ARG B N     1 
ATOM 1180  C CA    . ARG B 2 67  ? 269.233 243.390 255.368 1.00 36.60  ? 67  ARG B CA    1 
ATOM 1181  C C     . ARG B 2 67  ? 268.446 243.800 256.603 1.00 36.60  ? 67  ARG B C     1 
ATOM 1182  O O     . ARG B 2 67  ? 268.941 243.694 257.730 1.00 36.60  ? 67  ARG B O     1 
ATOM 1183  C CB    . ARG B 2 67  ? 269.733 244.619 254.613 1.00 36.60  ? 67  ARG B CB    1 
ATOM 1184  C CG    . ARG B 2 67  ? 270.605 245.530 255.453 1.00 36.60  ? 67  ARG B CG    1 
ATOM 1185  C CD    . ARG B 2 67  ? 270.788 246.896 254.812 1.00 36.60  ? 67  ARG B CD    1 
ATOM 1186  N NE    . ARG B 2 67  ? 271.410 246.806 253.497 1.00 36.60  ? 67  ARG B NE    1 
ATOM 1187  C CZ    . ARG B 2 67  ? 270.756 246.952 252.350 1.00 36.60  ? 67  ARG B CZ    1 
ATOM 1188  N NH1   . ARG B 2 67  ? 269.458 247.206 252.352 1.00 36.60  ? 67  ARG B NH1   1 
ATOM 1189  N NH2   . ARG B 2 67  ? 271.403 246.846 251.201 1.00 36.60  ? 67  ARG B NH2   1 
ATOM 1190  N N     . ASP B 2 68  ? 267.199 244.245 256.415 1.00 36.09  ? 68  ASP B N     1 
ATOM 1191  C CA    . ASP B 2 68  ? 266.394 244.615 257.580 1.00 36.09  ? 68  ASP B CA    1 
ATOM 1192  C C     . ASP B 2 68  ? 266.106 243.411 258.473 1.00 36.09  ? 68  ASP B C     1 
ATOM 1193  O O     . ASP B 2 68  ? 266.160 243.512 259.707 1.00 36.09  ? 68  ASP B O     1 
ATOM 1194  C CB    . ASP B 2 68  ? 265.093 245.271 257.140 1.00 36.09  ? 68  ASP B CB    1 
ATOM 1195  C CG    . ASP B 2 68  ? 265.304 246.643 256.556 1.00 36.09  ? 68  ASP B CG    1 
ATOM 1196  O OD1   . ASP B 2 68  ? 266.451 247.136 256.583 1.00 36.09  ? 68  ASP B OD1   1 
ATOM 1197  O OD2   . ASP B 2 68  ? 264.317 247.233 256.070 1.00 36.09  ? 68  ASP B OD2   1 
ATOM 1198  N N     . ALA B 2 69  ? 265.813 242.261 257.869 1.00 34.67  ? 69  ALA B N     1 
ATOM 1199  C CA    . ALA B 2 69  ? 265.480 241.076 258.651 1.00 34.67  ? 69  ALA B CA    1 
ATOM 1200  C C     . ALA B 2 69  ? 266.666 240.611 259.480 1.00 34.67  ? 69  ALA B C     1 
ATOM 1201  O O     . ALA B 2 69  ? 266.512 240.251 260.650 1.00 34.67  ? 69  ALA B O     1 
ATOM 1202  C CB    . ALA B 2 69  ? 265.000 239.959 257.729 1.00 34.67  ? 69  ALA B CB    1 
ATOM 1203  N N     . VAL B 2 70  ? 267.861 240.620 258.896 1.00 34.72  ? 70  VAL B N     1 
ATOM 1204  C CA    . VAL B 2 70  ? 269.046 240.197 259.624 1.00 34.72  ? 70  VAL B CA    1 
ATOM 1205  C C     . VAL B 2 70  ? 269.423 241.222 260.679 1.00 34.72  ? 70  VAL B C     1 
ATOM 1206  O O     . VAL B 2 70  ? 269.986 240.867 261.714 1.00 34.72  ? 70  VAL B O     1 
ATOM 1207  C CB    . VAL B 2 70  ? 270.197 239.925 258.640 1.00 34.72  ? 70  VAL B CB    1 
ATOM 1208  C CG1   . VAL B 2 70  ? 271.459 239.560 259.371 1.00 34.72  ? 70  VAL B CG1   1 
ATOM 1209  C CG2   . VAL B 2 70  ? 269.811 238.815 257.698 1.00 34.72  ? 70  VAL B CG2   1 
ATOM 1210  N N     . THR B 2 71  ? 269.123 242.500 260.454 1.00 34.34  ? 71  THR B N     1 
ATOM 1211  C CA    . THR B 2 71  ? 269.308 243.480 261.517 1.00 34.34  ? 71  THR B CA    1 
ATOM 1212  C C     . THR B 2 71  ? 268.426 243.152 262.717 1.00 34.34  ? 71  THR B C     1 
ATOM 1213  O O     . THR B 2 71  ? 268.878 243.195 263.866 1.00 34.34  ? 71  THR B O     1 
ATOM 1214  C CB    . THR B 2 71  ? 269.025 244.883 260.990 1.00 34.34  ? 71  THR B CB    1 
ATOM 1215  O OG1   . THR B 2 71  ? 269.910 245.166 259.904 1.00 34.34  ? 71  THR B OG1   1 
ATOM 1216  C CG2   . THR B 2 71  ? 269.239 245.913 262.068 1.00 34.34  ? 71  THR B CG2   1 
ATOM 1217  N N     . TYR B 2 72  ? 267.166 242.798 262.465 1.00 34.19  ? 72  TYR B N     1 
ATOM 1218  C CA    . TYR B 2 72  ? 266.300 242.368 263.560 1.00 34.19  ? 72  TYR B CA    1 
ATOM 1219  C C     . TYR B 2 72  ? 266.852 241.122 264.246 1.00 34.19  ? 72  TYR B C     1 
ATOM 1220  O O     . TYR B 2 72  ? 266.848 241.024 265.478 1.00 34.19  ? 72  TYR B O     1 
ATOM 1221  C CB    . TYR B 2 72  ? 264.884 242.113 263.049 1.00 34.19  ? 72  TYR B CB    1 
ATOM 1222  C CG    . TYR B 2 72  ? 264.069 243.358 262.803 1.00 34.19  ? 72  TYR B CG    1 
ATOM 1223  C CD1   . TYR B 2 72  ? 263.663 244.162 263.848 1.00 34.19  ? 72  TYR B CD1   1 
ATOM 1224  C CD2   . TYR B 2 72  ? 263.696 243.720 261.524 1.00 34.19  ? 72  TYR B CD2   1 
ATOM 1225  C CE1   . TYR B 2 72  ? 262.914 245.292 263.623 1.00 34.19  ? 72  TYR B CE1   1 
ATOM 1226  C CE2   . TYR B 2 72  ? 262.952 244.847 261.291 1.00 34.19  ? 72  TYR B CE2   1 
ATOM 1227  C CZ    . TYR B 2 72  ? 262.568 245.631 262.341 1.00 34.19  ? 72  TYR B CZ    1 
ATOM 1228  O OH    . TYR B 2 72  ? 261.820 246.755 262.101 1.00 34.19  ? 72  TYR B OH    1 
ATOM 1229  N N     . THR B 2 73  ? 267.330 240.161 263.459 1.00 35.46  ? 73  THR B N     1 
ATOM 1230  C CA    . THR B 2 73  ? 267.887 238.932 264.019 1.00 35.46  ? 73  THR B CA    1 
ATOM 1231  C C     . THR B 2 73  ? 269.096 239.217 264.904 1.00 35.46  ? 73  THR B C     1 
ATOM 1232  O O     . THR B 2 73  ? 269.227 238.656 265.995 1.00 35.46  ? 73  THR B O     1 
ATOM 1233  C CB    . THR B 2 73  ? 268.264 237.974 262.890 1.00 35.46  ? 73  THR B CB    1 
ATOM 1234  O OG1   . THR B 2 73  ? 267.102 237.670 262.115 1.00 35.46  ? 73  THR B OG1   1 
ATOM 1235  C CG2   . THR B 2 73  ? 268.833 236.694 263.444 1.00 35.46  ? 73  THR B CG2   1 
ATOM 1236  N N     . GLU B 2 74  ? 270.001 240.077 264.438 1.00 36.75  ? 74  GLU B N     1 
ATOM 1237  C CA    . GLU B 2 74  ? 271.187 240.406 265.217 1.00 36.75  ? 74  GLU B CA    1 
ATOM 1238  C C     . GLU B 2 74  ? 270.818 241.138 266.492 1.00 36.75  ? 74  GLU B C     1 
ATOM 1239  O O     . GLU B 2 74  ? 271.398 240.880 267.550 1.00 36.75  ? 74  GLU B O     1 
ATOM 1240  C CB    . GLU B 2 74  ? 272.154 241.250 264.392 1.00 36.75  ? 74  GLU B CB    1 
ATOM 1241  C CG    . GLU B 2 74  ? 272.818 240.515 263.259 1.00 36.75  ? 74  GLU B CG    1 
ATOM 1242  C CD    . GLU B 2 74  ? 273.626 241.440 262.373 1.00 36.75  ? 74  GLU B CD    1 
ATOM 1243  O OE1   . GLU B 2 74  ? 273.326 242.651 262.348 1.00 36.75  ? 74  GLU B OE1   1 
ATOM 1244  O OE2   . GLU B 2 74  ? 274.563 240.961 261.704 1.00 36.75  ? 74  GLU B OE2   1 
ATOM 1245  N N     . HIS B 2 75  ? 269.859 242.062 266.416 1.00 34.94  ? 75  HIS B N     1 
ATOM 1246  C CA    . HIS B 2 75  ? 269.425 242.736 267.629 1.00 34.94  ? 75  HIS B CA    1 
ATOM 1247  C C     . HIS B 2 75  ? 268.860 241.750 268.637 1.00 34.94  ? 75  HIS B C     1 
ATOM 1248  O O     . HIS B 2 75  ? 269.159 241.847 269.830 1.00 34.94  ? 75  HIS B O     1 
ATOM 1249  C CB    . HIS B 2 75  ? 268.388 243.806 267.322 1.00 34.94  ? 75  HIS B CB    1 
ATOM 1250  C CG    . HIS B 2 75  ? 267.964 244.576 268.530 1.00 34.94  ? 75  HIS B CG    1 
ATOM 1251  N ND1   . HIS B 2 75  ? 268.755 245.541 269.109 1.00 34.94  ? 75  HIS B ND1   1 
ATOM 1252  C CD2   . HIS B 2 75  ? 266.852 244.496 269.291 1.00 34.94  ? 75  HIS B CD2   1 
ATOM 1253  C CE1   . HIS B 2 75  ? 268.140 246.034 270.166 1.00 34.94  ? 75  HIS B CE1   1 
ATOM 1254  N NE2   . HIS B 2 75  ? 266.983 245.415 270.300 1.00 34.94  ? 75  HIS B NE2   1 
ATOM 1255  N N     . ALA B 2 76  ? 268.063 240.788 268.181 1.00 35.63  ? 76  ALA B N     1 
ATOM 1256  C CA    . ALA B 2 76  ? 267.566 239.773 269.099 1.00 35.63  ? 76  ALA B CA    1 
ATOM 1257  C C     . ALA B 2 76  ? 268.655 238.830 269.588 1.00 35.63  ? 76  ALA B C     1 
ATOM 1258  O O     . ALA B 2 76  ? 268.349 237.922 270.361 1.00 35.63  ? 76  ALA B O     1 
ATOM 1259  C CB    . ALA B 2 76  ? 266.449 238.972 268.435 1.00 35.63  ? 76  ALA B CB    1 
ATOM 1260  N N     . LYS B 2 77  ? 269.905 239.030 269.166 1.00 36.68  ? 77  LYS B N     1 
ATOM 1261  C CA    . LYS B 2 77  ? 271.033 238.165 269.509 1.00 36.68  ? 77  LYS B CA    1 
ATOM 1262  C C     . LYS B 2 77  ? 270.805 236.729 269.053 1.00 36.68  ? 77  LYS B C     1 
ATOM 1263  O O     . LYS B 2 77  ? 271.402 235.795 269.585 1.00 36.68  ? 77  LYS B O     1 
ATOM 1264  C CB    . LYS B 2 77  ? 271.340 238.207 271.005 1.00 36.68  ? 77  LYS B CB    1 
ATOM 1265  C CG    . LYS B 2 77  ? 271.857 239.538 271.485 1.00 36.68  ? 77  LYS B CG    1 
ATOM 1266  C CD    . LYS B 2 77  ? 271.899 239.589 272.993 1.00 36.68  ? 77  LYS B CD    1 
ATOM 1267  C CE    . LYS B 2 77  ? 272.290 240.967 273.482 1.00 36.68  ? 77  LYS B CE    1 
ATOM 1268  N NZ    . LYS B 2 77  ? 272.133 241.096 274.956 1.00 36.68  ? 77  LYS B NZ    1 
ATOM 1269  N N     . ARG B 2 78  ? 269.957 236.548 268.054 1.00 37.67  ? 78  ARG B N     1 
ATOM 1270  C CA    . ARG B 2 78  ? 269.679 235.236 267.505 1.00 37.67  ? 78  ARG B CA    1 
ATOM 1271  C C     . ARG B 2 78  ? 270.639 234.920 266.369 1.00 37.67  ? 78  ARG B C     1 
ATOM 1272  O O     . ARG B 2 78  ? 271.352 235.784 265.863 1.00 37.67  ? 78  ARG B O     1 
ATOM 1273  C CB    . ARG B 2 78  ? 268.240 235.150 267.006 1.00 37.67  ? 78  ARG B CB    1 
ATOM 1274  C CG    . ARG B 2 78  ? 267.209 234.916 268.081 1.00 37.67  ? 78  ARG B CG    1 
ATOM 1275  C CD    . ARG B 2 78  ? 265.859 234.610 267.473 1.00 37.67  ? 78  ARG B CD    1 
ATOM 1276  N NE    . ARG B 2 78  ? 265.055 235.809 267.270 1.00 37.67  ? 78  ARG B NE    1 
ATOM 1277  C CZ    . ARG B 2 78  ? 265.000 236.496 266.137 1.00 37.67  ? 78  ARG B CZ    1 
ATOM 1278  N NH1   . ARG B 2 78  ? 265.700 236.111 265.084 1.00 37.67  ? 78  ARG B NH1   1 
ATOM 1279  N NH2   . ARG B 2 78  ? 264.242 237.576 266.060 1.00 37.67  ? 78  ARG B NH2   1 
ATOM 1280  N N     . LYS B 2 79  ? 270.667 233.650 265.992 1.00 40.49  ? 79  LYS B N     1 
ATOM 1281  C CA    . LYS B 2 79  ? 271.402 233.200 264.823 1.00 40.49  ? 79  LYS B CA    1 
ATOM 1282  C C     . LYS B 2 79  ? 270.484 232.660 263.746 1.00 40.49  ? 79  LYS B C     1 
ATOM 1283  O O     . LYS B 2 79  ? 270.969 232.163 262.728 1.00 40.49  ? 79  LYS B O     1 
ATOM 1284  C CB    . LYS B 2 79  ? 272.420 232.129 265.216 1.00 40.49  ? 79  LYS B CB    1 
ATOM 1285  C CG    . LYS B 2 79  ? 273.408 232.586 266.253 1.00 40.49  ? 79  LYS B CG    1 
ATOM 1286  C CD    . LYS B 2 79  ? 274.449 231.532 266.510 1.00 40.49  ? 79  LYS B CD    1 
ATOM 1287  C CE    . LYS B 2 79  ? 275.597 232.087 267.327 1.00 40.49  ? 79  LYS B CE    1 
ATOM 1288  N NZ    . LYS B 2 79  ? 276.693 231.094 267.461 1.00 40.49  ? 79  LYS B NZ    1 
ATOM 1289  N N     . THR B 2 80  ? 269.176 232.731 263.951 1.00 39.07  ? 80  THR B N     1 
ATOM 1290  C CA    . THR B 2 80  ? 268.186 232.179 263.043 1.00 39.07  ? 80  THR B CA    1 
ATOM 1291  C C     . THR B 2 80  ? 267.244 233.293 262.628 1.00 39.07  ? 80  THR B C     1 
ATOM 1292  O O     . THR B 2 80  ? 266.619 233.926 263.482 1.00 39.07  ? 80  THR B O     1 
ATOM 1293  C CB    . THR B 2 80  ? 267.409 231.048 263.711 1.00 39.07  ? 80  THR B CB    1 
ATOM 1294  O OG1   . THR B 2 80  ? 268.312 229.998 264.068 1.00 39.07  ? 80  THR B OG1   1 
ATOM 1295  C CG2   . THR B 2 80  ? 266.359 230.497 262.778 1.00 39.07  ? 80  THR B CG2   1 
ATOM 1296  N N     . VAL B 2 81  ? 267.158 233.545 261.326 1.00 36.74  ? 81  VAL B N     1 
ATOM 1297  C CA    . VAL B 2 81  ? 266.180 234.493 260.820 1.00 36.74  ? 81  VAL B CA    1 
ATOM 1298  C C     . VAL B 2 81  ? 264.800 233.868 260.923 1.00 36.74  ? 81  VAL B C     1 
ATOM 1299  O O     . VAL B 2 81  ? 264.560 232.771 260.410 1.00 36.74  ? 81  VAL B O     1 
ATOM 1300  C CB    . VAL B 2 81  ? 266.512 234.891 259.377 1.00 36.74  ? 81  VAL B CB    1 
ATOM 1301  C CG1   . VAL B 2 81  ? 265.588 235.987 258.908 1.00 36.74  ? 81  VAL B CG1   1 
ATOM 1302  C CG2   . VAL B 2 81  ? 267.953 235.321 259.279 1.00 36.74  ? 81  VAL B CG2   1 
ATOM 1303  N N     . THR B 2 82  ? 263.893 234.548 261.607 1.00 36.05  ? 82  THR B N     1 
ATOM 1304  C CA    . THR B 2 82  ? 262.553 234.035 261.819 1.00 36.05  ? 82  THR B CA    1 
ATOM 1305  C C     . THR B 2 82  ? 261.563 234.689 260.867 1.00 36.05  ? 82  THR B C     1 
ATOM 1306  O O     . THR B 2 82  ? 261.820 235.742 260.267 1.00 36.05  ? 82  THR B O     1 
ATOM 1307  C CB    . THR B 2 82  ? 262.096 234.248 263.265 1.00 36.05  ? 82  THR B CB    1 
ATOM 1308  O OG1   . THR B 2 82  ? 262.055 235.646 263.562 1.00 36.05  ? 82  THR B OG1   1 
ATOM 1309  C CG2   . THR B 2 82  ? 263.041 233.561 264.221 1.00 36.05  ? 82  THR B CG2   1 
ATOM 1310  N N     . ALA B 2 83  ? 260.411 234.033 260.740 1.00 35.10  ? 83  ALA B N     1 
ATOM 1311  C CA    . ALA B 2 83  ? 259.326 234.607 259.963 1.00 35.10  ? 83  ALA B CA    1 
ATOM 1312  C C     . ALA B 2 83  ? 258.931 235.963 260.512 1.00 35.10  ? 83  ALA B C     1 
ATOM 1313  O O     . ALA B 2 83  ? 258.569 236.855 259.747 1.00 35.10  ? 83  ALA B O     1 
ATOM 1314  C CB    . ALA B 2 83  ? 258.125 233.665 259.942 1.00 35.10  ? 83  ALA B CB    1 
ATOM 1315  N N     . MET B 2 84  ? 259.038 236.154 261.824 1.00 36.32  ? 84  MET B N     1 
ATOM 1316  C CA    . MET B 2 84  ? 258.743 237.457 262.401 1.00 36.32  ? 84  MET B CA    1 
ATOM 1317  C C     . MET B 2 84  ? 259.787 238.491 262.008 1.00 36.32  ? 84  MET B C     1 
ATOM 1318  O O     . MET B 2 84  ? 259.450 239.656 261.807 1.00 36.32  ? 84  MET B O     1 
ATOM 1319  C CB    . MET B 2 84  ? 258.640 237.356 263.915 1.00 36.32  ? 84  MET B CB    1 
ATOM 1320  C CG    . MET B 2 84  ? 257.410 236.629 264.387 1.00 36.32  ? 84  MET B CG    1 
ATOM 1321  S SD    . MET B 2 84  ? 255.892 237.479 263.940 1.00 36.32  ? 84  MET B SD    1 
ATOM 1322  C CE    . MET B 2 84  ? 254.737 236.606 264.989 1.00 36.32  ? 84  MET B CE    1 
ATOM 1323  N N     . ASP B 2 85  ? 261.059 238.100 261.919 1.00 35.67  ? 85  ASP B N     1 
ATOM 1324  C CA    . ASP B 2 85  ? 262.073 239.027 261.432 1.00 35.67  ? 85  ASP B CA    1 
ATOM 1325  C C     . ASP B 2 85  ? 261.744 239.480 260.019 1.00 35.67  ? 85  ASP B C     1 
ATOM 1326  O O     . ASP B 2 85  ? 261.816 240.672 259.700 1.00 35.67  ? 85  ASP B O     1 
ATOM 1327  C CB    . ASP B 2 85  ? 263.458 238.385 261.463 1.00 35.67  ? 85  ASP B CB    1 
ATOM 1328  C CG    . ASP B 2 85  ? 263.940 238.083 262.860 1.00 35.67  ? 85  ASP B CG    1 
ATOM 1329  O OD1   . ASP B 2 85  ? 263.482 238.737 263.815 1.00 35.67  ? 85  ASP B OD1   1 
ATOM 1330  O OD2   . ASP B 2 85  ? 264.797 237.189 263.001 1.00 35.67  ? 85  ASP B OD2   1 
ATOM 1331  N N     . VAL B 2 86  ? 261.350 238.533 259.165 1.00 33.82  ? 86  VAL B N     1 
ATOM 1332  C CA    . VAL B 2 86  ? 260.972 238.886 257.799 1.00 33.82  ? 86  VAL B CA    1 
ATOM 1333  C C     . VAL B 2 86  ? 259.737 239.779 257.791 1.00 33.82  ? 86  VAL B C     1 
ATOM 1334  O O     . VAL B 2 86  ? 259.668 240.752 257.036 1.00 33.82  ? 86  VAL B O     1 
ATOM 1335  C CB    . VAL B 2 86  ? 260.760 237.617 256.955 1.00 33.82  ? 86  VAL B CB    1 
ATOM 1336  C CG1   . VAL B 2 86  ? 260.163 237.973 255.614 1.00 33.82  ? 86  VAL B CG1   1 
ATOM 1337  C CG2   . VAL B 2 86  ? 262.064 236.896 256.768 1.00 33.82  ? 86  VAL B CG2   1 
ATOM 1338  N N     . VAL B 2 87  ? 258.752 239.473 258.635 1.00 33.91  ? 87  VAL B N     1 
ATOM 1339  C CA    . VAL B 2 87  ? 257.507 240.234 258.637 1.00 33.91  ? 87  VAL B CA    1 
ATOM 1340  C C     . VAL B 2 87  ? 257.744 241.649 259.142 1.00 33.91  ? 87  VAL B C     1 
ATOM 1341  O O     . VAL B 2 87  ? 257.184 242.612 258.614 1.00 33.91  ? 87  VAL B O     1 
ATOM 1342  C CB    . VAL B 2 87  ? 256.431 239.501 259.460 1.00 33.91  ? 87  VAL B CB    1 
ATOM 1343  C CG1   . VAL B 2 87  ? 255.266 240.408 259.736 1.00 33.91  ? 87  VAL B CG1   1 
ATOM 1344  C CG2   . VAL B 2 87  ? 255.949 238.277 258.714 1.00 33.91  ? 87  VAL B CG2   1 
ATOM 1345  N N     . TYR B 2 88  ? 258.598 241.804 260.152 1.00 34.67  ? 88  TYR B N     1 
ATOM 1346  C CA    . TYR B 2 88  ? 258.916 243.138 260.639 1.00 34.67  ? 88  TYR B CA    1 
ATOM 1347  C C     . TYR B 2 88  ? 259.700 243.924 259.606 1.00 34.67  ? 88  TYR B C     1 
ATOM 1348  O O     . TYR B 2 88  ? 259.463 245.120 259.426 1.00 34.67  ? 88  TYR B O     1 
ATOM 1349  C CB    . TYR B 2 88  ? 259.700 243.059 261.942 1.00 34.67  ? 88  TYR B CB    1 
ATOM 1350  C CG    . TYR B 2 88  ? 258.921 242.451 263.061 1.00 34.67  ? 88  TYR B CG    1 
ATOM 1351  C CD1   . TYR B 2 88  ? 257.553 242.606 263.135 1.00 34.67  ? 88  TYR B CD1   1 
ATOM 1352  C CD2   . TYR B 2 88  ? 259.552 241.701 264.036 1.00 34.67  ? 88  TYR B CD2   1 
ATOM 1353  C CE1   . TYR B 2 88  ? 256.834 242.038 264.154 1.00 34.67  ? 88  TYR B CE1   1 
ATOM 1354  C CE2   . TYR B 2 88  ? 258.845 241.134 265.055 1.00 34.67  ? 88  TYR B CE2   1 
ATOM 1355  C CZ    . TYR B 2 88  ? 257.487 241.304 265.112 1.00 34.67  ? 88  TYR B CZ    1 
ATOM 1356  O OH    . TYR B 2 88  ? 256.781 240.732 266.141 1.00 34.67  ? 88  TYR B OH    1 
ATOM 1357  N N     . ALA B 2 89  ? 260.635 243.275 258.912 1.00 34.73  ? 89  ALA B N     1 
ATOM 1358  C CA    . ALA B 2 89  ? 261.367 243.957 257.853 1.00 34.73  ? 89  ALA B CA    1 
ATOM 1359  C C     . ALA B 2 89  ? 260.419 244.449 256.768 1.00 34.73  ? 89  ALA B C     1 
ATOM 1360  O O     . ALA B 2 89  ? 260.477 245.613 256.345 1.00 34.73  ? 89  ALA B O     1 
ATOM 1361  C CB    . ALA B 2 89  ? 262.419 243.019 257.273 1.00 34.73  ? 89  ALA B CB    1 
ATOM 1362  N N     . LEU B 2 90  ? 259.515 243.576 256.327 1.00 34.34  ? 90  LEU B N     1 
ATOM 1363  C CA    . LEU B 2 90  ? 258.567 243.944 255.286 1.00 34.34  ? 90  LEU B CA    1 
ATOM 1364  C C     . LEU B 2 90  ? 257.657 245.070 255.740 1.00 34.34  ? 90  LEU B C     1 
ATOM 1365  O O     . LEU B 2 90  ? 257.441 246.034 255.002 1.00 34.34  ? 90  LEU B O     1 
ATOM 1366  C CB    . LEU B 2 90  ? 257.738 242.735 254.884 1.00 34.34  ? 90  LEU B CB    1 
ATOM 1367  C CG    . LEU B 2 90  ? 258.459 241.671 254.079 1.00 34.34  ? 90  LEU B CG    1 
ATOM 1368  C CD1   . LEU B 2 90  ? 257.624 240.420 254.083 1.00 34.34  ? 90  LEU B CD1   1 
ATOM 1369  C CD2   . LEU B 2 90  ? 258.668 242.174 252.679 1.00 34.34  ? 90  LEU B CD2   1 
ATOM 1370  N N     . LYS B 2 91  ? 257.123 244.970 256.954 1.00 35.63  ? 91  LYS B N     1 
ATOM 1371  C CA    . LYS B 2 91  ? 256.256 246.018 257.471 1.00 35.63  ? 91  LYS B CA    1 
ATOM 1372  C C     . LYS B 2 91  ? 256.996 247.338 257.580 1.00 35.63  ? 91  LYS B C     1 
ATOM 1373  O O     . LYS B 2 91  ? 256.417 248.402 257.350 1.00 35.63  ? 91  LYS B O     1 
ATOM 1374  C CB    . LYS B 2 91  ? 255.693 245.599 258.824 1.00 35.63  ? 91  LYS B CB    1 
ATOM 1375  C CG    . LYS B 2 91  ? 254.926 246.661 259.558 1.00 35.63  ? 91  LYS B CG    1 
ATOM 1376  C CD    . LYS B 2 91  ? 254.397 246.097 260.857 1.00 35.63  ? 91  LYS B CD    1 
ATOM 1377  C CE    . LYS B 2 91  ? 254.036 247.193 261.835 1.00 35.63  ? 91  LYS B CE    1 
ATOM 1378  N NZ    . LYS B 2 91  ? 253.823 246.644 263.203 1.00 35.63  ? 91  LYS B NZ    1 
ATOM 1379  N N     . ARG B 2 92  ? 258.279 247.292 257.931 1.00 36.15  ? 92  ARG B N     1 
ATOM 1380  C CA    . ARG B 2 92  ? 259.057 248.518 257.990 1.00 36.15  ? 92  ARG B CA    1 
ATOM 1381  C C     . ARG B 2 92  ? 259.206 249.141 256.615 1.00 36.15  ? 92  ARG B C     1 
ATOM 1382  O O     . ARG B 2 92  ? 259.153 250.367 256.484 1.00 36.15  ? 92  ARG B O     1 
ATOM 1383  C CB    . ARG B 2 92  ? 260.430 248.247 258.599 1.00 36.15  ? 92  ARG B CB    1 
ATOM 1384  C CG    . ARG B 2 92  ? 260.924 249.377 259.471 1.00 36.15  ? 92  ARG B CG    1 
ATOM 1385  C CD    . ARG B 2 92  ? 262.406 249.301 259.700 1.00 36.15  ? 92  ARG B CD    1 
ATOM 1386  N NE    . ARG B 2 92  ? 263.133 249.251 258.443 1.00 36.15  ? 92  ARG B NE    1 
ATOM 1387  C CZ    . ARG B 2 92  ? 263.346 250.301 257.662 1.00 36.15  ? 92  ARG B CZ    1 
ATOM 1388  N NH1   . ARG B 2 92  ? 262.880 251.492 258.004 1.00 36.15  ? 92  ARG B NH1   1 
ATOM 1389  N NH2   . ARG B 2 92  ? 264.024 250.158 256.535 1.00 36.15  ? 92  ARG B NH2   1 
ATOM 1390  N N     . GLN B 2 93  ? 259.377 248.326 255.581 1.00 36.72  ? 93  GLN B N     1 
ATOM 1391  C CA    . GLN B 2 93  ? 259.454 248.849 254.225 1.00 36.72  ? 93  GLN B CA    1 
ATOM 1392  C C     . GLN B 2 93  ? 258.090 249.100 253.602 1.00 36.72  ? 93  GLN B C     1 
ATOM 1393  O O     . GLN B 2 93  ? 258.003 249.242 252.381 1.00 36.72  ? 93  GLN B O     1 
ATOM 1394  C CB    . GLN B 2 93  ? 260.243 247.899 253.341 1.00 36.72  ? 93  GLN B CB    1 
ATOM 1395  C CG    . GLN B 2 93  ? 261.626 247.663 253.848 1.00 36.72  ? 93  GLN B CG    1 
ATOM 1396  C CD    . GLN B 2 93  ? 262.334 246.609 253.063 1.00 36.72  ? 93  GLN B CD    1 
ATOM 1397  O OE1   . GLN B 2 93  ? 261.820 246.118 252.062 1.00 36.72  ? 93  GLN B OE1   1 
ATOM 1398  N NE2   . GLN B 2 93  ? 263.519 246.241 253.513 1.00 36.72  ? 93  GLN B NE2   1 
ATOM 1399  N N     . GLY B 2 94  ? 257.029 249.140 254.400 1.00 35.32  ? 94  GLY B N     1 
ATOM 1400  C CA    . GLY B 2 94  ? 255.716 249.448 253.876 1.00 35.32  ? 94  GLY B CA    1 
ATOM 1401  C C     . GLY B 2 94  ? 255.114 248.372 253.007 1.00 35.32  ? 94  GLY B C     1 
ATOM 1402  O O     . GLY B 2 94  ? 254.355 248.684 252.090 1.00 35.32  ? 94  GLY B O     1 
ATOM 1403  N N     . ARG B 2 95  ? 255.439 247.112 253.263 1.00 35.85  ? 95  ARG B N     1 
ATOM 1404  C CA    . ARG B 2 95  ? 254.940 245.981 252.491 1.00 35.85  ? 95  ARG B CA    1 
ATOM 1405  C C     . ARG B 2 95  ? 254.400 244.910 253.417 1.00 35.85  ? 95  ARG B C     1 
ATOM 1406  O O     . ARG B 2 95  ? 254.779 243.743 253.340 1.00 35.85  ? 95  ARG B O     1 
ATOM 1407  C CB    . ARG B 2 95  ? 256.020 245.412 251.588 1.00 35.85  ? 95  ARG B CB    1 
ATOM 1408  C CG    . ARG B 2 95  ? 256.520 246.401 250.581 1.00 35.85  ? 95  ARG B CG    1 
ATOM 1409  C CD    . ARG B 2 95  ? 257.538 245.798 249.666 1.00 35.85  ? 95  ARG B CD    1 
ATOM 1410  N NE    . ARG B 2 95  ? 258.401 246.824 249.100 1.00 35.85  ? 95  ARG B NE    1 
ATOM 1411  C CZ    . ARG B 2 95  ? 258.091 247.556 248.040 1.00 35.85  ? 95  ARG B CZ    1 
ATOM 1412  N NH1   . ARG B 2 95  ? 256.932 247.377 247.426 1.00 35.85  ? 95  ARG B NH1   1 
ATOM 1413  N NH2   . ARG B 2 95  ? 258.941 248.470 247.601 1.00 35.85  ? 95  ARG B NH2   1 
ATOM 1414  N N     . THR B 2 96  ? 253.522 245.321 254.330 1.00 33.95  ? 96  THR B N     1 
ATOM 1415  C CA    . THR B 2 96  ? 252.888 244.435 255.298 1.00 33.95  ? 96  THR B CA    1 
ATOM 1416  C C     . THR B 2 96  ? 252.438 243.128 254.664 1.00 33.95  ? 96  THR B C     1 
ATOM 1417  O O     . THR B 2 96  ? 251.894 243.109 253.561 1.00 33.95  ? 96  THR B O     1 
ATOM 1418  C CB    . THR B 2 96  ? 251.694 245.145 255.931 1.00 33.95  ? 96  THR B CB    1 
ATOM 1419  O OG1   . THR B 2 96  ? 252.138 246.369 256.520 1.00 33.95  ? 96  THR B OG1   1 
ATOM 1420  C CG2   . THR B 2 96  ? 251.072 244.288 257.002 1.00 33.95  ? 96  THR B CG2   1 
ATOM 1421  N N     . LEU B 2 97  ? 252.686 242.033 255.368 1.00 32.88  ? 97  LEU B N     1 
ATOM 1422  C CA    . LEU B 2 97  ? 252.407 240.697 254.873 1.00 32.88  ? 97  LEU B CA    1 
ATOM 1423  C C     . LEU B 2 97  ? 251.614 239.934 255.920 1.00 32.88  ? 97  LEU B C     1 
ATOM 1424  O O     . LEU B 2 97  ? 252.123 239.669 257.012 1.00 32.88  ? 97  LEU B O     1 
ATOM 1425  C CB    . LEU B 2 97  ? 253.708 239.972 254.546 1.00 32.88  ? 97  LEU B CB    1 
ATOM 1426  C CG    . LEU B 2 97  ? 253.602 238.495 254.200 1.00 32.88  ? 97  LEU B CG    1 
ATOM 1427  C CD1   . LEU B 2 97  ? 253.126 238.325 252.781 1.00 32.88  ? 97  LEU B CD1   1 
ATOM 1428  C CD2   . LEU B 2 97  ? 254.935 237.826 254.400 1.00 32.88  ? 97  LEU B CD2   1 
ATOM 1429  N N     . TYR B 2 98  ? 250.382 239.575 255.585 1.00 32.53  ? 98  TYR B N     1 
ATOM 1430  C CA    . TYR B 2 98  ? 249.551 238.769 256.462 1.00 32.53  ? 98  TYR B CA    1 
ATOM 1431  C C     . TYR B 2 98  ? 249.809 237.293 256.203 1.00 32.53  ? 98  TYR B C     1 
ATOM 1432  O O     . TYR B 2 98  ? 250.159 236.893 255.094 1.00 32.53  ? 98  TYR B O     1 
ATOM 1433  C CB    . TYR B 2 98  ? 248.069 239.062 256.245 1.00 32.53  ? 98  TYR B CB    1 
ATOM 1434  C CG    . TYR B 2 98  ? 247.606 240.440 256.632 1.00 32.53  ? 98  TYR B CG    1 
ATOM 1435  C CD1   . TYR B 2 98  ? 248.438 241.324 257.296 1.00 32.53  ? 98  TYR B CD1   1 
ATOM 1436  C CD2   . TYR B 2 98  ? 246.317 240.843 256.358 1.00 32.53  ? 98  TYR B CD2   1 
ATOM 1437  C CE1   . TYR B 2 98  ? 248.003 242.572 257.643 1.00 32.53  ? 98  TYR B CE1   1 
ATOM 1438  C CE2   . TYR B 2 98  ? 245.877 242.084 256.700 1.00 32.53  ? 98  TYR B CE2   1 
ATOM 1439  C CZ    . TYR B 2 98  ? 246.719 242.943 257.351 1.00 32.53  ? 98  TYR B CZ    1 
ATOM 1440  O OH    . TYR B 2 98  ? 246.263 244.185 257.689 1.00 32.53  ? 98  TYR B OH    1 
ATOM 1441  N N     . GLY B 2 99  ? 249.634 236.484 257.240 1.00 34.04  ? 99  GLY B N     1 
ATOM 1442  C CA    . GLY B 2 99  ? 249.708 235.047 257.104 1.00 34.04  ? 99  GLY B CA    1 
ATOM 1443  C C     . GLY B 2 99  ? 250.964 234.388 257.621 1.00 34.04  ? 99  GLY B C     1 
ATOM 1444  O O     . GLY B 2 99  ? 251.173 233.203 257.348 1.00 34.04  ? 99  GLY B O     1 
ATOM 1445  N N     . PHE B 2 100 ? 251.807 235.106 258.355 1.00 34.70  ? 100 PHE B N     1 
ATOM 1446  C CA    . PHE B 2 100 ? 253.016 234.521 258.918 1.00 34.70  ? 100 PHE B CA    1 
ATOM 1447  C C     . PHE B 2 100 ? 253.241 234.977 260.351 1.00 34.70  ? 100 PHE B C     1 
ATOM 1448  O O     . PHE B 2 100 ? 254.381 234.996 260.817 1.00 34.70  ? 100 PHE B O     1 
ATOM 1449  C CB    . PHE B 2 100 ? 254.232 234.849 258.054 1.00 34.70  ? 100 PHE B CB    1 
ATOM 1450  C CG    . PHE B 2 100 ? 254.214 234.174 256.722 1.00 34.70  ? 100 PHE B CG    1 
ATOM 1451  C CD1   . PHE B 2 100 ? 254.716 232.900 256.576 1.00 34.70  ? 100 PHE B CD1   1 
ATOM 1452  C CD2   . PHE B 2 100 ? 253.672 234.802 255.621 1.00 34.70  ? 100 PHE B CD2   1 
ATOM 1453  C CE1   . PHE B 2 100 ? 254.691 232.274 255.358 1.00 34.70  ? 100 PHE B CE1   1 
ATOM 1454  C CE2   . PHE B 2 100 ? 253.648 234.179 254.403 1.00 34.70  ? 100 PHE B CE2   1 
ATOM 1455  C CZ    . PHE B 2 100 ? 254.161 232.917 254.271 1.00 34.70  ? 100 PHE B CZ    1 
ATOM 1456  N N     . GLY B 2 101 ? 252.179 235.345 261.053 1.00 35.36  ? 101 GLY B N     1 
ATOM 1457  C CA    . GLY B 2 101 ? 252.280 235.791 262.425 1.00 35.36  ? 101 GLY B CA    1 
ATOM 1458  C C     . GLY B 2 101 ? 252.280 237.296 262.572 1.00 35.36  ? 101 GLY B C     1 
ATOM 1459  O O     . GLY B 2 101 ? 252.280 238.019 261.582 1.00 35.36  ? 101 GLY B O     1 
ATOM 1460  N N     . THR C 3 10  ? 278.711 270.031 300.581 1.00 58.98  ? 10  THR C N     1 
ATOM 1461  C CA    . THR C 3 10  ? 278.167 270.702 299.407 1.00 58.98  ? 10  THR C CA    1 
ATOM 1462  C C     . THR C 3 10  ? 278.032 269.749 298.227 1.00 58.98  ? 10  THR C C     1 
ATOM 1463  O O     . THR C 3 10  ? 278.793 268.791 298.099 1.00 58.98  ? 10  THR C O     1 
ATOM 1464  C CB    . THR C 3 10  ? 279.045 271.889 298.983 1.00 58.98  ? 10  THR C CB    1 
ATOM 1465  O OG1   . THR C 3 10  ? 280.412 271.469 298.898 1.00 58.98  ? 10  THR C OG1   1 
ATOM 1466  C CG2   . THR C 3 10  ? 278.923 273.032 299.982 1.00 58.98  ? 10  THR C CG2   1 
ATOM 1467  N N     . ARG C 3 11  ? 277.056 270.012 297.364 1.00 54.94  ? 11  ARG C N     1 
ATOM 1468  C CA    . ARG C 3 11  ? 276.934 269.228 296.149 1.00 54.94  ? 11  ARG C CA    1 
ATOM 1469  C C     . ARG C 3 11  ? 277.940 269.713 295.114 1.00 54.94  ? 11  ARG C C     1 
ATOM 1470  O O     . ARG C 3 11  ? 278.474 270.821 295.198 1.00 54.94  ? 11  ARG C O     1 
ATOM 1471  C CB    . ARG C 3 11  ? 275.523 269.315 295.580 1.00 54.94  ? 11  ARG C CB    1 
ATOM 1472  C CG    . ARG C 3 11  ? 275.222 270.630 294.907 1.00 54.94  ? 11  ARG C CG    1 
ATOM 1473  C CD    . ARG C 3 11  ? 273.993 270.512 294.032 1.00 54.94  ? 11  ARG C CD    1 
ATOM 1474  N NE    . ARG C 3 11  ? 272.908 269.829 294.720 1.00 54.94  ? 11  ARG C NE    1 
ATOM 1475  C CZ    . ARG C 3 11  ? 271.662 269.782 294.268 1.00 54.94  ? 11  ARG C CZ    1 
ATOM 1476  N NH1   . ARG C 3 11  ? 271.353 270.384 293.132 1.00 54.94  ? 11  ARG C NH1   1 
ATOM 1477  N NH2   . ARG C 3 11  ? 270.727 269.142 294.952 1.00 54.94  ? 11  ARG C NH2   1 
ATOM 1478  N N     . ALA C 3 12  ? 278.199 268.862 294.130 1.00 54.04  ? 12  ALA C N     1 
ATOM 1479  C CA    . ALA C 3 12  ? 279.152 269.208 293.089 1.00 54.04  ? 12  ALA C CA    1 
ATOM 1480  C C     . ALA C 3 12  ? 278.572 270.274 292.170 1.00 54.04  ? 12  ALA C C     1 
ATOM 1481  O O     . ALA C 3 12  ? 277.356 270.438 292.062 1.00 54.04  ? 12  ALA C O     1 
ATOM 1482  C CB    . ALA C 3 12  ? 279.534 267.972 292.280 1.00 54.04  ? 12  ALA C CB    1 
ATOM 1483  N N     . LYS C 3 13  ? 279.462 271.013 291.515 1.00 53.56  ? 13  LYS C N     1 
ATOM 1484  C CA    . LYS C 3 13  ? 279.040 271.990 290.523 1.00 53.56  ? 13  LYS C CA    1 
ATOM 1485  C C     . LYS C 3 13  ? 278.368 271.277 289.357 1.00 53.56  ? 13  LYS C C     1 
ATOM 1486  O O     . LYS C 3 13  ? 278.904 270.300 288.826 1.00 53.56  ? 13  LYS C O     1 
ATOM 1487  C CB    . LYS C 3 13  ? 280.246 272.796 290.050 1.00 53.56  ? 13  LYS C CB    1 
ATOM 1488  C CG    . LYS C 3 13  ? 279.966 273.737 288.903 1.00 53.56  ? 13  LYS C CG    1 
ATOM 1489  C CD    . LYS C 3 13  ? 278.832 274.684 289.232 1.00 53.56  ? 13  LYS C CD    1 
ATOM 1490  C CE    . LYS C 3 13  ? 278.677 275.741 288.156 1.00 53.56  ? 13  LYS C CE    1 
ATOM 1491  N NZ    . LYS C 3 13  ? 279.879 276.615 288.083 1.00 53.56  ? 13  LYS C NZ    1 
ATOM 1492  N N     . ALA C 3 14  ? 277.190 271.758 288.969 1.00 50.93  ? 14  ALA C N     1 
ATOM 1493  C CA    . ALA C 3 14  ? 276.401 271.074 287.956 1.00 50.93  ? 14  ALA C CA    1 
ATOM 1494  C C     . ALA C 3 14  ? 277.111 271.082 286.611 1.00 50.93  ? 14  ALA C C     1 
ATOM 1495  O O     . ALA C 3 14  ? 277.713 272.078 286.207 1.00 50.93  ? 14  ALA C O     1 
ATOM 1496  C CB    . ALA C 3 14  ? 275.024 271.719 287.822 1.00 50.93  ? 14  ALA C CB    1 
ATOM 1497  N N     . LYS C 3 15  ? 277.036 269.952 285.919 1.00 47.69  ? 15  LYS C N     1 
ATOM 1498  C CA    . LYS C 3 15  ? 277.664 269.771 284.619 1.00 47.69  ? 15  LYS C CA    1 
ATOM 1499  C C     . LYS C 3 15  ? 276.669 269.052 283.723 1.00 47.69  ? 15  LYS C C     1 
ATOM 1500  O O     . LYS C 3 15  ? 276.181 267.978 284.080 1.00 47.69  ? 15  LYS C O     1 
ATOM 1501  C CB    . LYS C 3 15  ? 278.963 268.979 284.759 1.00 47.69  ? 15  LYS C CB    1 
ATOM 1502  C CG    . LYS C 3 15  ? 279.829 268.952 283.526 1.00 47.69  ? 15  LYS C CG    1 
ATOM 1503  C CD    . LYS C 3 15  ? 281.297 268.958 283.906 1.00 47.69  ? 15  LYS C CD    1 
ATOM 1504  C CE    . LYS C 3 15  ? 281.591 267.908 284.957 1.00 47.69  ? 15  LYS C CE    1 
ATOM 1505  N NZ    . LYS C 3 15  ? 281.343 266.542 284.436 1.00 47.69  ? 15  LYS C NZ    1 
ATOM 1506  N N     . THR C 3 16  ? 276.354 269.646 282.577 1.00 43.28  ? 16  THR C N     1 
ATOM 1507  C CA    . THR C 3 16  ? 275.334 269.072 281.716 1.00 43.28  ? 16  THR C CA    1 
ATOM 1508  C C     . THR C 3 16  ? 275.801 267.745 281.134 1.00 43.28  ? 16  THR C C     1 
ATOM 1509  O O     . THR C 3 16  ? 276.987 267.517 280.900 1.00 43.28  ? 16  THR C O     1 
ATOM 1510  C CB    . THR C 3 16  ? 274.974 270.022 280.578 1.00 43.28  ? 16  THR C CB    1 
ATOM 1511  O OG1   . THR C 3 16  ? 276.109 270.197 279.728 1.00 43.28  ? 16  THR C OG1   1 
ATOM 1512  C CG2   . THR C 3 16  ? 274.540 271.360 281.115 1.00 43.28  ? 16  THR C CG2   1 
ATOM 1513  N N     . ARG C 3 17  ? 274.839 266.858 280.900 1.00 40.54  ? 17  ARG C N     1 
ATOM 1514  C CA    . ARG C 3 17  ? 275.165 265.590 280.272 1.00 40.54  ? 17  ARG C CA    1 
ATOM 1515  C C     . ARG C 3 17  ? 275.647 265.764 278.842 1.00 40.54  ? 17  ARG C C     1 
ATOM 1516  O O     . ARG C 3 17  ? 276.389 264.913 278.348 1.00 40.54  ? 17  ARG C O     1 
ATOM 1517  C CB    . ARG C 3 17  ? 273.959 264.662 280.320 1.00 40.54  ? 17  ARG C CB    1 
ATOM 1518  C CG    . ARG C 3 17  ? 273.783 263.996 281.659 1.00 40.54  ? 17  ARG C CG    1 
ATOM 1519  C CD    . ARG C 3 17  ? 272.706 262.965 281.598 1.00 40.54  ? 17  ARG C CD    1 
ATOM 1520  N NE    . ARG C 3 17  ? 271.395 263.548 281.807 1.00 40.54  ? 17  ARG C NE    1 
ATOM 1521  C CZ    . ARG C 3 17  ? 270.264 262.917 281.537 1.00 40.54  ? 17  ARG C CZ    1 
ATOM 1522  N NH1   . ARG C 3 17  ? 270.300 261.700 281.031 1.00 40.54  ? 17  ARG C NH1   1 
ATOM 1523  N NH2   . ARG C 3 17  ? 269.103 263.508 281.761 1.00 40.54  ? 17  ARG C NH2   1 
ATOM 1524  N N     . SER C 3 18  ? 275.267 266.853 278.177 1.00 39.95  ? 18  SER C N     1 
ATOM 1525  C CA    . SER C 3 18  ? 275.778 267.108 276.838 1.00 39.95  ? 18  SER C CA    1 
ATOM 1526  C C     . SER C 3 18  ? 277.278 267.355 276.857 1.00 39.95  ? 18  SER C C     1 
ATOM 1527  O O     . SER C 3 18  ? 277.982 266.989 275.913 1.00 39.95  ? 18  SER C O     1 
ATOM 1528  C CB    . SER C 3 18  ? 275.048 268.292 276.213 1.00 39.95  ? 18  SER C CB    1 
ATOM 1529  O OG    . SER C 3 18  ? 273.789 267.903 275.712 1.00 39.95  ? 18  SER C OG    1 
ATOM 1530  N N     . SER C 3 19  ? 277.785 267.981 277.918 1.00 41.98  ? 19  SER C N     1 
ATOM 1531  C CA    . SER C 3 19  ? 279.219 268.222 278.002 1.00 41.98  ? 19  SER C CA    1 
ATOM 1532  C C     . SER C 3 19  ? 279.988 266.951 278.323 1.00 41.98  ? 19  SER C C     1 
ATOM 1533  O O     . SER C 3 19  ? 281.106 266.771 277.831 1.00 41.98  ? 19  SER C O     1 
ATOM 1534  C CB    . SER C 3 19  ? 279.518 269.289 279.047 1.00 41.98  ? 19  SER C CB    1 
ATOM 1535  O OG    . SER C 3 19  ? 279.290 268.791 280.348 1.00 41.98  ? 19  SER C OG    1 
ATOM 1536  N N     . ARG C 3 20  ? 279.420 266.064 279.141 1.00 43.33  ? 20  ARG C N     1 
ATOM 1537  C CA    . ARG C 3 20  ? 280.086 264.801 279.429 1.00 43.33  ? 20  ARG C CA    1 
ATOM 1538  C C     . ARG C 3 20  ? 280.211 263.940 278.185 1.00 43.33  ? 20  ARG C C     1 
ATOM 1539  O O     . ARG C 3 20  ? 281.232 263.276 277.994 1.00 43.33  ? 20  ARG C O     1 
ATOM 1540  C CB    . ARG C 3 20  ? 279.337 264.030 280.509 1.00 43.33  ? 20  ARG C CB    1 
ATOM 1541  C CG    . ARG C 3 20  ? 279.228 264.740 281.829 1.00 43.33  ? 20  ARG C CG    1 
ATOM 1542  C CD    . ARG C 3 20  ? 278.402 263.922 282.793 1.00 43.33  ? 20  ARG C CD    1 
ATOM 1543  N NE    . ARG C 3 20  ? 278.051 264.676 283.988 1.00 43.33  ? 20  ARG C NE    1 
ATOM 1544  C CZ    . ARG C 3 20  ? 278.792 264.712 285.087 1.00 43.33  ? 20  ARG C CZ    1 
ATOM 1545  N NH1   . ARG C 3 20  ? 279.928 264.038 285.140 1.00 43.33  ? 20  ARG C NH1   1 
ATOM 1546  N NH2   . ARG C 3 20  ? 278.400 265.423 286.131 1.00 43.33  ? 20  ARG C NH2   1 
ATOM 1547  N N     . ALA C 3 21  ? 279.196 263.939 277.335 1.00 40.12  ? 21  ALA C N     1 
ATOM 1548  C CA    . ALA C 3 21  ? 279.235 263.197 276.088 1.00 40.12  ? 21  ALA C CA    1 
ATOM 1549  C C     . ALA C 3 21  ? 279.960 263.949 274.989 1.00 40.12  ? 21  ALA C C     1 
ATOM 1550  O O     . ALA C 3 21  ? 280.142 263.398 273.902 1.00 40.12  ? 21  ALA C O     1 
ATOM 1551  C CB    . ALA C 3 21  ? 277.816 262.866 275.626 1.00 40.12  ? 21  ALA C CB    1 
ATOM 1552  N N     . GLY C 3 22  ? 280.379 265.182 275.245 1.00 39.59  ? 22  GLY C N     1 
ATOM 1553  C CA    . GLY C 3 22  ? 281.000 265.985 274.209 1.00 39.59  ? 22  GLY C CA    1 
ATOM 1554  C C     . GLY C 3 22  ? 280.071 266.311 273.063 1.00 39.59  ? 22  GLY C C     1 
ATOM 1555  O O     . GLY C 3 22  ? 280.424 266.086 271.901 1.00 39.59  ? 22  GLY C O     1 
ATOM 1556  N N     . LEU C 3 23  ? 278.885 266.829 273.361 1.00 38.26  ? 23  LEU C N     1 
ATOM 1557  C CA    . LEU C 3 23  ? 277.881 267.103 272.347 1.00 38.26  ? 23  LEU C CA    1 
ATOM 1558  C C     . LEU C 3 23  ? 277.421 268.549 272.420 1.00 38.26  ? 23  LEU C C     1 
ATOM 1559  O O     . LEU C 3 23  ? 277.662 269.249 273.405 1.00 38.26  ? 23  LEU C O     1 
ATOM 1560  C CB    . LEU C 3 23  ? 276.668 266.189 272.498 1.00 38.26  ? 23  LEU C CB    1 
ATOM 1561  C CG    . LEU C 3 23  ? 276.929 264.697 272.360 1.00 38.26  ? 23  LEU C CG    1 
ATOM 1562  C CD1   . LEU C 3 23  ? 275.635 263.935 272.465 1.00 38.26  ? 23  LEU C CD1   1 
ATOM 1563  C CD2   . LEU C 3 23  ? 277.608 264.411 271.045 1.00 38.26  ? 23  LEU C CD2   1 
ATOM 1564  N N     . GLN C 3 24  ? 276.759 268.988 271.355 1.00 38.69  ? 24  GLN C N     1 
ATOM 1565  C CA    . GLN C 3 24  ? 276.064 270.264 271.353 1.00 38.69  ? 24  GLN C CA    1 
ATOM 1566  C C     . GLN C 3 24  ? 274.562 270.107 271.505 1.00 38.69  ? 24  GLN C C     1 
ATOM 1567  O O     . GLN C 3 24  ? 273.889 271.074 271.865 1.00 38.69  ? 24  GLN C O     1 
ATOM 1568  C CB    . GLN C 3 24  ? 276.360 271.036 270.067 1.00 38.69  ? 24  GLN C CB    1 
ATOM 1569  C CG    . GLN C 3 24  ? 277.834 271.175 269.748 1.00 38.69  ? 24  GLN C CG    1 
ATOM 1570  C CD    . GLN C 3 24  ? 278.602 271.908 270.821 1.00 38.69  ? 24  GLN C CD    1 
ATOM 1571  O OE1   . GLN C 3 24  ? 278.171 272.949 271.304 1.00 38.69  ? 24  GLN C OE1   1 
ATOM 1572  N NE2   . GLN C 3 24  ? 279.744 271.360 271.209 1.00 38.69  ? 24  GLN C NE2   1 
ATOM 1573  N N     . PHE C 3 25  ? 274.030 268.929 271.246 1.00 36.88  ? 25  PHE C N     1 
ATOM 1574  C CA    . PHE C 3 25  ? 272.603 268.694 271.359 1.00 36.88  ? 25  PHE C CA    1 
ATOM 1575  C C     . PHE C 3 25  ? 272.233 268.290 272.783 1.00 36.88  ? 25  PHE C C     1 
ATOM 1576  O O     . PHE C 3 25  ? 273.030 267.665 273.484 1.00 36.88  ? 25  PHE C O     1 
ATOM 1577  C CB    . PHE C 3 25  ? 272.168 267.622 270.373 1.00 36.88  ? 25  PHE C CB    1 
ATOM 1578  C CG    . PHE C 3 25  ? 271.609 268.176 269.102 1.00 36.88  ? 25  PHE C CG    1 
ATOM 1579  C CD1   . PHE C 3 25  ? 272.326 269.091 268.360 1.00 36.88  ? 25  PHE C CD1   1 
ATOM 1580  C CD2   . PHE C 3 25  ? 270.370 267.788 268.651 1.00 36.88  ? 25  PHE C CD2   1 
ATOM 1581  C CE1   . PHE C 3 25  ? 271.817 269.603 267.199 1.00 36.88  ? 25  PHE C CE1   1 
ATOM 1582  C CE2   . PHE C 3 25  ? 269.861 268.300 267.487 1.00 36.88  ? 25  PHE C CE2   1 
ATOM 1583  C CZ    . PHE C 3 25  ? 270.586 269.210 266.763 1.00 36.88  ? 25  PHE C CZ    1 
ATOM 1584  N N     . PRO C 3 26  ? 271.026 268.639 273.234 1.00 37.04  ? 26  PRO C N     1 
ATOM 1585  C CA    . PRO C 3 26  ? 270.677 268.520 274.656 1.00 37.04  ? 26  PRO C CA    1 
ATOM 1586  C C     . PRO C 3 26  ? 270.371 267.086 275.057 1.00 37.04  ? 26  PRO C C     1 
ATOM 1587  O O     . PRO C 3 26  ? 269.285 266.564 274.789 1.00 37.04  ? 26  PRO C O     1 
ATOM 1588  C CB    . PRO C 3 26  ? 269.440 269.417 274.776 1.00 37.04  ? 26  PRO C CB    1 
ATOM 1589  C CG    . PRO C 3 26  ? 268.809 269.298 273.453 1.00 37.04  ? 26  PRO C CG    1 
ATOM 1590  C CD    . PRO C 3 26  ? 269.927 269.240 272.461 1.00 37.04  ? 26  PRO C CD    1 
ATOM 1591  N N     . VAL C 3 27  ? 271.317 266.460 275.753 1.00 36.77  ? 27  VAL C N     1 
ATOM 1592  C CA    . VAL C 3 27  ? 271.115 265.089 276.203 1.00 36.77  ? 27  VAL C CA    1 
ATOM 1593  C C     . VAL C 3 27  ? 269.994 265.022 277.230 1.00 36.77  ? 27  VAL C C     1 
ATOM 1594  O O     . VAL C 3 27  ? 269.162 264.112 277.194 1.00 36.77  ? 27  VAL C O     1 
ATOM 1595  C CB    . VAL C 3 27  ? 272.430 264.510 276.750 1.00 36.77  ? 27  VAL C CB    1 
ATOM 1596  C CG1   . VAL C 3 27  ? 272.193 263.162 277.389 1.00 36.77  ? 27  VAL C CG1   1 
ATOM 1597  C CG2   . VAL C 3 27  ? 273.449 264.394 275.641 1.00 36.77  ? 27  VAL C CG2   1 
ATOM 1598  N N     . GLY C 3 28  ? 269.935 265.990 278.145 1.00 38.11  ? 28  GLY C N     1 
ATOM 1599  C CA    . GLY C 3 28  ? 268.892 265.971 279.158 1.00 38.11  ? 28  GLY C CA    1 
ATOM 1600  C C     . GLY C 3 28  ? 267.505 266.174 278.583 1.00 38.11  ? 28  GLY C C     1 
ATOM 1601  O O     . GLY C 3 28  ? 266.556 265.481 278.961 1.00 38.11  ? 28  GLY C O     1 
ATOM 1602  N N     . ARG C 3 29  ? 267.366 267.120 277.658 1.00 38.49  ? 29  ARG C N     1 
ATOM 1603  C CA    . ARG C 3 29  ? 266.079 267.325 277.010 1.00 38.49  ? 29  ARG C CA    1 
ATOM 1604  C C     . ARG C 3 29  ? 265.672 266.112 276.187 1.00 38.49  ? 29  ARG C C     1 
ATOM 1605  O O     . ARG C 3 29  ? 264.494 265.745 276.164 1.00 38.49  ? 29  ARG C O     1 
ATOM 1606  C CB    . ARG C 3 29  ? 266.126 268.570 276.138 1.00 38.49  ? 29  ARG C CB    1 
ATOM 1607  C CG    . ARG C 3 29  ? 264.889 268.768 275.320 1.00 38.49  ? 29  ARG C CG    1 
ATOM 1608  C CD    . ARG C 3 29  ? 264.997 269.986 274.459 1.00 38.49  ? 29  ARG C CD    1 
ATOM 1609  N NE    . ARG C 3 29  ? 265.000 271.206 275.248 1.00 38.49  ? 29  ARG C NE    1 
ATOM 1610  C CZ    . ARG C 3 29  ? 265.000 272.420 274.723 1.00 38.49  ? 29  ARG C CZ    1 
ATOM 1611  N NH1   . ARG C 3 29  ? 265.000 272.570 273.411 1.00 38.49  ? 29  ARG C NH1   1 
ATOM 1612  N NH2   . ARG C 3 29  ? 265.001 273.480 275.510 1.00 38.49  ? 29  ARG C NH2   1 
ATOM 1613  N N     . VAL C 3 30  ? 266.623 265.483 275.497 1.00 35.93  ? 30  VAL C N     1 
ATOM 1614  C CA    . VAL C 3 30  ? 266.296 264.279 274.741 1.00 35.93  ? 30  VAL C CA    1 
ATOM 1615  C C     . VAL C 3 30  ? 265.852 263.167 275.678 1.00 35.93  ? 30  VAL C C     1 
ATOM 1616  O O     . VAL C 3 30  ? 264.918 262.418 275.378 1.00 35.93  ? 30  VAL C O     1 
ATOM 1617  C CB    . VAL C 3 30  ? 267.490 263.850 273.872 1.00 35.93  ? 30  VAL C CB    1 
ATOM 1618  C CG1   . VAL C 3 30  ? 267.321 262.426 273.415 1.00 35.93  ? 30  VAL C CG1   1 
ATOM 1619  C CG2   . VAL C 3 30  ? 267.626 264.769 272.683 1.00 35.93  ? 30  VAL C CG2   1 
ATOM 1620  N N     . HIS C 3 31  ? 266.500 263.052 276.834 1.00 37.03  ? 31  HIS C N     1 
ATOM 1621  C CA    . HIS C 3 31  ? 266.100 262.065 277.826 1.00 37.03  ? 31  HIS C CA    1 
ATOM 1622  C C     . HIS C 3 31  ? 264.674 262.311 278.297 1.00 37.03  ? 31  HIS C C     1 
ATOM 1623  O O     . HIS C 3 31  ? 263.883 261.374 278.440 1.00 37.03  ? 31  HIS C O     1 
ATOM 1624  C CB    . HIS C 3 31  ? 267.073 262.110 279.001 1.00 37.03  ? 31  HIS C CB    1 
ATOM 1625  C CG    . HIS C 3 31  ? 266.988 260.927 279.905 1.00 37.03  ? 31  HIS C CG    1 
ATOM 1626  N ND1   . HIS C 3 31  ? 266.321 259.773 279.562 1.00 37.03  ? 31  HIS C ND1   1 
ATOM 1627  C CD2   . HIS C 3 31  ? 267.487 260.718 281.143 1.00 37.03  ? 31  HIS C CD2   1 
ATOM 1628  C CE1   . HIS C 3 31  ? 266.419 258.902 280.547 1.00 37.03  ? 31  HIS C CE1   1 
ATOM 1629  N NE2   . HIS C 3 31  ? 267.122 259.450 281.519 1.00 37.03  ? 31  HIS C NE2   1 
ATOM 1630  N N     . ARG C 3 32  ? 264.330 263.572 278.547 1.00 38.52  ? 32  ARG C N     1 
ATOM 1631  C CA    . ARG C 3 32  ? 262.970 263.890 278.969 1.00 38.52  ? 32  ARG C CA    1 
ATOM 1632  C C     . ARG C 3 32  ? 261.958 263.572 277.876 1.00 38.52  ? 32  ARG C C     1 
ATOM 1633  O O     . ARG C 3 32  ? 260.902 262.993 278.150 1.00 38.52  ? 32  ARG C O     1 
ATOM 1634  C CB    . ARG C 3 32  ? 262.878 265.354 279.380 1.00 38.52  ? 32  ARG C CB    1 
ATOM 1635  C CG    . ARG C 3 32  ? 261.505 265.775 279.856 1.00 38.52  ? 32  ARG C CG    1 
ATOM 1636  C CD    . ARG C 3 32  ? 260.917 266.826 278.954 1.00 38.52  ? 32  ARG C CD    1 
ATOM 1637  N NE    . ARG C 3 32  ? 261.820 267.957 278.837 1.00 38.52  ? 32  ARG C NE    1 
ATOM 1638  C CZ    . ARG C 3 32  ? 261.688 268.927 277.945 1.00 38.52  ? 32  ARG C CZ    1 
ATOM 1639  N NH1   . ARG C 3 32  ? 260.684 268.902 277.087 1.00 38.52  ? 32  ARG C NH1   1 
ATOM 1640  N NH2   . ARG C 3 32  ? 262.564 269.916 277.912 1.00 38.52  ? 32  ARG C NH2   1 
ATOM 1641  N N     . LEU C 3 33  ? 262.264 263.933 276.632 1.00 36.35  ? 33  LEU C N     1 
ATOM 1642  C CA    . LEU C 3 33  ? 261.355 263.631 275.535 1.00 36.35  ? 33  LEU C CA    1 
ATOM 1643  C C     . LEU C 3 33  ? 261.199 262.134 275.323 1.00 36.35  ? 33  LEU C C     1 
ATOM 1644  O O     . LEU C 3 33  ? 260.136 261.682 274.894 1.00 36.35  ? 33  LEU C O     1 
ATOM 1645  C CB    . LEU C 3 33  ? 261.841 264.289 274.253 1.00 36.35  ? 33  LEU C CB    1 
ATOM 1646  C CG    . LEU C 3 33  ? 261.818 265.810 274.261 1.00 36.35  ? 33  LEU C CG    1 
ATOM 1647  C CD1   . LEU C 3 33  ? 262.540 266.335 273.052 1.00 36.35  ? 33  LEU C CD1   1 
ATOM 1648  C CD2   . LEU C 3 33  ? 260.393 266.287 274.278 1.00 36.35  ? 33  LEU C CD2   1 
ATOM 1649  N N     . LEU C 3 34  ? 262.242 261.354 275.599 1.00 36.10  ? 34  LEU C N     1 
ATOM 1650  C CA    . LEU C 3 34  ? 262.114 259.906 275.501 1.00 36.10  ? 34  LEU C CA    1 
ATOM 1651  C C     . LEU C 3 34  ? 261.241 259.361 276.615 1.00 36.10  ? 34  LEU C C     1 
ATOM 1652  O O     . LEU C 3 34  ? 260.391 258.499 276.378 1.00 36.10  ? 34  LEU C O     1 
ATOM 1653  C CB    . LEU C 3 34  ? 263.488 259.243 275.538 1.00 36.10  ? 34  LEU C CB    1 
ATOM 1654  C CG    . LEU C 3 34  ? 264.359 259.301 274.287 1.00 36.10  ? 34  LEU C CG    1 
ATOM 1655  C CD1   . LEU C 3 34  ? 265.696 258.641 274.540 1.00 36.10  ? 34  LEU C CD1   1 
ATOM 1656  C CD2   . LEU C 3 34  ? 263.658 258.640 273.131 1.00 36.10  ? 34  LEU C CD2   1 
ATOM 1657  N N     . ARG C 3 35  ? 261.444 259.841 277.840 1.00 38.37  ? 35  ARG C N     1 
ATOM 1658  C CA    . ARG C 3 35  ? 260.644 259.351 278.956 1.00 38.37  ? 35  ARG C CA    1 
ATOM 1659  C C     . ARG C 3 35  ? 259.174 259.702 278.781 1.00 38.37  ? 35  ARG C C     1 
ATOM 1660  O O     . ARG C 3 35  ? 258.296 258.908 279.130 1.00 38.37  ? 35  ARG C O     1 
ATOM 1661  C CB    . ARG C 3 35  ? 261.172 259.909 280.274 1.00 38.37  ? 35  ARG C CB    1 
ATOM 1662  C CG    . ARG C 3 35  ? 262.447 259.254 280.761 1.00 38.37  ? 35  ARG C CG    1 
ATOM 1663  C CD    . ARG C 3 35  ? 262.831 259.707 282.163 1.00 38.37  ? 35  ARG C CD    1 
ATOM 1664  N NE    . ARG C 3 35  ? 263.321 261.082 282.197 1.00 38.37  ? 35  ARG C NE    1 
ATOM 1665  C CZ    . ARG C 3 35  ? 262.569 262.143 282.472 1.00 38.37  ? 35  ARG C CZ    1 
ATOM 1666  N NH1   . ARG C 3 35  ? 261.279 261.998 282.744 1.00 38.37  ? 35  ARG C NH1   1 
ATOM 1667  N NH2   . ARG C 3 35  ? 263.107 263.351 282.477 1.00 38.37  ? 35  ARG C NH2   1 
ATOM 1668  N N     . LYS C 3 36  ? 258.882 260.880 278.236 1.00 37.64  ? 36  LYS C N     1 
ATOM 1669  C CA    . LYS C 3 36  ? 257.513 261.366 278.147 1.00 37.64  ? 36  LYS C CA    1 
ATOM 1670  C C     . LYS C 3 36  ? 256.924 261.208 276.756 1.00 37.64  ? 36  LYS C C     1 
ATOM 1671  O O     . LYS C 3 36  ? 255.896 261.814 276.448 1.00 37.64  ? 36  LYS C O     1 
ATOM 1672  C CB    . LYS C 3 36  ? 257.445 262.826 278.581 1.00 37.64  ? 36  LYS C CB    1 
ATOM 1673  C CG    . LYS C 3 36  ? 257.654 263.022 280.059 1.00 37.64  ? 36  LYS C CG    1 
ATOM 1674  C CD    . LYS C 3 36  ? 257.580 264.480 280.428 1.00 37.64  ? 36  LYS C CD    1 
ATOM 1675  C CE    . LYS C 3 36  ? 257.908 264.678 281.894 1.00 37.64  ? 36  LYS C CE    1 
ATOM 1676  N NZ    . LYS C 3 36  ? 258.039 266.118 282.235 1.00 37.64  ? 36  LYS C NZ    1 
ATOM 1677  N N     . GLY C 3 37  ? 257.543 260.399 275.911 1.00 36.60  ? 37  GLY C N     1 
ATOM 1678  C CA    . GLY C 3 37  ? 257.039 260.229 274.568 1.00 36.60  ? 37  GLY C CA    1 
ATOM 1679  C C     . GLY C 3 37  ? 256.276 258.939 274.394 1.00 36.60  ? 37  GLY C C     1 
ATOM 1680  O O     . GLY C 3 37  ? 255.810 258.640 273.294 1.00 36.60  ? 37  GLY C O     1 
ATOM 1681  N N     . ASN C 3 38  ? 256.135 258.175 275.476 1.00 37.04  ? 38  ASN C N     1 
ATOM 1682  C CA    . ASN C 3 38  ? 255.464 256.877 275.445 1.00 37.04  ? 38  ASN C CA    1 
ATOM 1683  C C     . ASN C 3 38  ? 256.133 255.942 274.442 1.00 37.04  ? 38  ASN C C     1 
ATOM 1684  O O     . ASN C 3 38  ? 255.508 255.452 273.504 1.00 37.04  ? 38  ASN C O     1 
ATOM 1685  C CB    . ASN C 3 38  ? 253.973 257.027 275.135 1.00 37.04  ? 38  ASN C CB    1 
ATOM 1686  C CG    . ASN C 3 38  ? 253.226 257.752 276.222 1.00 37.04  ? 38  ASN C CG    1 
ATOM 1687  O OD1   . ASN C 3 38  ? 253.341 257.421 277.398 1.00 37.04  ? 38  ASN C OD1   1 
ATOM 1688  N ND2   . ASN C 3 38  ? 252.452 258.750 275.834 1.00 37.04  ? 38  ASN C ND2   1 
ATOM 1689  N N     . TYR C 3 39  ? 257.426 255.715 274.635 1.00 35.44  ? 39  TYR C N     1 
ATOM 1690  C CA    . TYR C 3 39  ? 258.194 254.807 273.798 1.00 35.44  ? 39  TYR C CA    1 
ATOM 1691  C C     . TYR C 3 39  ? 258.505 253.498 274.496 1.00 35.44  ? 39  TYR C C     1 
ATOM 1692  O O     . TYR C 3 39  ? 258.561 252.452 273.850 1.00 35.44  ? 39  TYR C O     1 
ATOM 1693  C CB    . TYR C 3 39  ? 259.497 255.472 273.355 1.00 35.44  ? 39  TYR C CB    1 
ATOM 1694  C CG    . TYR C 3 39  ? 259.276 256.707 272.537 1.00 35.44  ? 39  TYR C CG    1 
ATOM 1695  C CD1   . TYR C 3 39  ? 258.651 256.638 271.305 1.00 35.44  ? 39  TYR C CD1   1 
ATOM 1696  C CD2   . TYR C 3 39  ? 259.680 257.944 272.998 1.00 35.44  ? 39  TYR C CD2   1 
ATOM 1697  C CE1   . TYR C 3 39  ? 258.444 257.762 270.558 1.00 35.44  ? 39  TYR C CE1   1 
ATOM 1698  C CE2   . TYR C 3 39  ? 259.472 259.070 272.261 1.00 35.44  ? 39  TYR C CE2   1 
ATOM 1699  C CZ    . TYR C 3 39  ? 258.848 258.976 271.045 1.00 35.44  ? 39  TYR C CZ    1 
ATOM 1700  O OH    . TYR C 3 39  ? 258.640 260.102 270.300 1.00 35.44  ? 39  TYR C OH    1 
ATOM 1701  N N     . ALA C 3 40  ? 258.710 253.539 275.803 1.00 38.24  ? 40  ALA C N     1 
ATOM 1702  C CA    . ALA C 3 40  ? 258.936 252.346 276.594 1.00 38.24  ? 40  ALA C CA    1 
ATOM 1703  C C     . ALA C 3 40  ? 258.640 252.690 278.037 1.00 38.24  ? 40  ALA C C     1 
ATOM 1704  O O     . ALA C 3 40  ? 258.425 253.848 278.389 1.00 38.24  ? 40  ALA C O     1 
ATOM 1705  C CB    . ALA C 3 40  ? 260.363 251.824 276.448 1.00 38.24  ? 40  ALA C CB    1 
ATOM 1706  N N     . GLU C 3 41  ? 258.638 251.664 278.876 1.00 42.39  ? 41  GLU C N     1 
ATOM 1707  C CA    . GLU C 3 41  ? 258.446 251.890 280.298 1.00 42.39  ? 41  GLU C CA    1 
ATOM 1708  C C     . GLU C 3 41  ? 259.646 252.605 280.900 1.00 42.39  ? 41  GLU C C     1 
ATOM 1709  O O     . GLU C 3 41  ? 259.492 253.463 281.774 1.00 42.39  ? 41  GLU C O     1 
ATOM 1710  C CB    . GLU C 3 41  ? 258.200 250.557 280.990 1.00 42.39  ? 41  GLU C CB    1 
ATOM 1711  C CG    . GLU C 3 41  ? 257.583 250.658 282.353 1.00 42.39  ? 41  GLU C CG    1 
ATOM 1712  C CD    . GLU C 3 41  ? 257.581 249.327 283.065 1.00 42.39  ? 41  GLU C CD    1 
ATOM 1713  O OE1   . GLU C 3 41  ? 258.640 248.943 283.606 1.00 42.39  ? 41  GLU C OE1   1 
ATOM 1714  O OE2   . GLU C 3 41  ? 256.529 248.654 283.065 1.00 42.39  ? 41  GLU C OE2   1 
ATOM 1715  N N     . ARG C 3 42  ? 260.846 252.280 280.430 1.00 42.07  ? 42  ARG C N     1 
ATOM 1716  C CA    . ARG C 3 42  ? 262.077 252.821 280.976 1.00 42.07  ? 42  ARG C CA    1 
ATOM 1717  C C     . ARG C 3 42  ? 262.990 253.243 279.840 1.00 42.07  ? 42  ARG C C     1 
ATOM 1718  O O     . ARG C 3 42  ? 262.883 252.740 278.722 1.00 42.07  ? 42  ARG C O     1 
ATOM 1719  C CB    . ARG C 3 42  ? 262.783 251.796 281.863 1.00 42.07  ? 42  ARG C CB    1 
ATOM 1720  C CG    . ARG C 3 42  ? 261.920 251.275 282.986 1.00 42.07  ? 42  ARG C CG    1 
ATOM 1721  C CD    . ARG C 3 42  ? 262.045 249.788 283.118 1.00 42.07  ? 42  ARG C CD    1 
ATOM 1722  N NE    . ARG C 3 42  ? 263.438 249.375 283.154 1.00 42.07  ? 42  ARG C NE    1 
ATOM 1723  C CZ    . ARG C 3 42  ? 264.204 249.436 284.233 1.00 42.07  ? 42  ARG C CZ    1 
ATOM 1724  N NH1   . ARG C 3 42  ? 263.712 249.902 285.372 1.00 42.07  ? 42  ARG C NH1   1 
ATOM 1725  N NH2   . ARG C 3 42  ? 265.465 249.037 284.171 1.00 42.07  ? 42  ARG C NH2   1 
ATOM 1726  N N     . VAL C 3 43  ? 263.894 254.169 280.137 1.00 38.92  ? 43  VAL C N     1 
ATOM 1727  C CA    . VAL C 3 43  ? 264.898 254.634 279.190 1.00 38.92  ? 43  VAL C CA    1 
ATOM 1728  C C     . VAL C 3 43  ? 266.260 254.478 279.844 1.00 38.92  ? 43  VAL C C     1 
ATOM 1729  O O     . VAL C 3 43  ? 266.489 255.002 280.938 1.00 38.92  ? 43  VAL C O     1 
ATOM 1730  C CB    . VAL C 3 43  ? 264.658 256.093 278.774 1.00 38.92  ? 43  VAL C CB    1 
ATOM 1731  C CG1   . VAL C 3 43  ? 265.682 256.520 277.753 1.00 38.92  ? 43  VAL C CG1   1 
ATOM 1732  C CG2   . VAL C 3 43  ? 263.265 256.263 278.222 1.00 38.92  ? 43  VAL C CG2   1 
ATOM 1733  N N     . GLY C 3 44  ? 267.164 253.768 279.177 1.00 37.91  ? 44  GLY C N     1 
ATOM 1734  C CA    . GLY C 3 44  ? 268.505 253.619 279.695 1.00 37.91  ? 44  GLY C CA    1 
ATOM 1735  C C     . GLY C 3 44  ? 269.290 254.914 279.651 1.00 37.91  ? 44  GLY C C     1 
ATOM 1736  O O     . GLY C 3 44  ? 268.943 255.862 278.956 1.00 37.91  ? 44  GLY C O     1 
ATOM 1737  N N     . ALA C 3 45  ? 270.387 254.944 280.408 1.00 37.68  ? 45  ALA C N     1 
ATOM 1738  C CA    . ALA C 3 45  ? 271.180 256.165 280.511 1.00 37.68  ? 45  ALA C CA    1 
ATOM 1739  C C     . ALA C 3 45  ? 271.917 256.481 279.216 1.00 37.68  ? 45  ALA C C     1 
ATOM 1740  O O     . ALA C 3 45  ? 272.166 257.652 278.917 1.00 37.68  ? 45  ALA C O     1 
ATOM 1741  C CB    . ALA C 3 45  ? 272.170 256.049 281.664 1.00 37.68  ? 45  ALA C CB    1 
ATOM 1742  N N     . GLY C 3 46  ? 272.272 255.459 278.438 1.00 35.83  ? 46  GLY C N     1 
ATOM 1743  C CA    . GLY C 3 46  ? 273.001 255.695 277.207 1.00 35.83  ? 46  GLY C CA    1 
ATOM 1744  C C     . GLY C 3 46  ? 272.125 256.004 276.017 1.00 35.83  ? 46  GLY C C     1 
ATOM 1745  O O     . GLY C 3 46  ? 272.614 256.520 275.011 1.00 35.83  ? 46  GLY C O     1 
ATOM 1746  N N     . ALA C 3 47  ? 270.839 255.676 276.094 1.00 34.73  ? 47  ALA C N     1 
ATOM 1747  C CA    . ALA C 3 47  ? 269.922 255.956 274.992 1.00 34.73  ? 47  ALA C CA    1 
ATOM 1748  C C     . ALA C 3 47  ? 269.863 257.429 274.611 1.00 34.73  ? 47  ALA C C     1 
ATOM 1749  O O     . ALA C 3 47  ? 270.021 257.735 273.420 1.00 34.73  ? 47  ALA C O     1 
ATOM 1750  C CB    . ALA C 3 47  ? 268.527 255.428 275.342 1.00 34.73  ? 47  ALA C CB    1 
ATOM 1751  N N     . PRO C 3 48  ? 269.644 258.377 275.532 1.00 34.57  ? 48  PRO C N     1 
ATOM 1752  C CA    . PRO C 3 48  ? 269.601 259.778 275.106 1.00 34.57  ? 48  PRO C CA    1 
ATOM 1753  C C     . PRO C 3 48  ? 270.930 260.263 274.587 1.00 34.57  ? 48  PRO C C     1 
ATOM 1754  O O     . PRO C 3 48  ? 270.966 261.108 273.694 1.00 34.57  ? 48  PRO C O     1 
ATOM 1755  C CB    . PRO C 3 48  ? 269.201 260.526 276.383 1.00 34.57  ? 48  PRO C CB    1 
ATOM 1756  C CG    . PRO C 3 48  ? 268.803 259.506 277.335 1.00 34.57  ? 48  PRO C CG    1 
ATOM 1757  C CD    . PRO C 3 48  ? 269.512 258.276 276.990 1.00 34.57  ? 48  PRO C CD    1 
ATOM 1758  N N     . VAL C 3 49  ? 272.031 259.751 275.127 1.00 34.84  ? 49  VAL C N     1 
ATOM 1759  C CA    . VAL C 3 49  ? 273.343 260.157 274.645 1.00 34.84  ? 49  VAL C CA    1 
ATOM 1760  C C     . VAL C 3 49  ? 273.524 259.728 273.198 1.00 34.84  ? 49  VAL C C     1 
ATOM 1761  O O     . VAL C 3 49  ? 273.900 260.529 272.336 1.00 34.84  ? 49  VAL C O     1 
ATOM 1762  C CB    . VAL C 3 49  ? 274.442 259.582 275.553 1.00 34.84  ? 49  VAL C CB    1 
ATOM 1763  C CG1   . VAL C 3 49  ? 275.785 259.788 274.927 1.00 34.84  ? 49  VAL C CG1   1 
ATOM 1764  C CG2   . VAL C 3 49  ? 274.382 260.223 276.915 1.00 34.84  ? 49  VAL C CG2   1 
ATOM 1765  N N     . TYR C 3 50  ? 273.249 258.457 272.915 1.00 34.71  ? 50  TYR C N     1 
ATOM 1766  C CA    . TYR C 3 50  ? 273.336 257.948 271.553 1.00 34.71  ? 50  TYR C CA    1 
ATOM 1767  C C     . TYR C 3 50  ? 272.421 258.720 270.612 1.00 34.71  ? 50  TYR C C     1 
ATOM 1768  O O     . TYR C 3 50  ? 272.822 259.086 269.500 1.00 34.71  ? 50  TYR C O     1 
ATOM 1769  C CB    . TYR C 3 50  ? 272.980 256.467 271.548 1.00 34.71  ? 50  TYR C CB    1 
ATOM 1770  C CG    . TYR C 3 50  ? 273.573 255.687 270.416 1.00 34.71  ? 50  TYR C CG    1 
ATOM 1771  C CD1   . TYR C 3 50  ? 273.118 255.853 269.125 1.00 34.71  ? 50  TYR C CD1   1 
ATOM 1772  C CD2   . TYR C 3 50  ? 274.579 254.772 270.641 1.00 34.71  ? 50  TYR C CD2   1 
ATOM 1773  C CE1   . TYR C 3 50  ? 273.648 255.146 268.097 1.00 34.71  ? 50  TYR C CE1   1 
ATOM 1774  C CE2   . TYR C 3 50  ? 275.119 254.061 269.616 1.00 34.71  ? 50  TYR C CE2   1 
ATOM 1775  C CZ    . TYR C 3 50  ? 274.650 254.250 268.345 1.00 34.71  ? 50  TYR C CZ    1 
ATOM 1776  O OH    . TYR C 3 50  ? 275.192 253.531 267.317 1.00 34.71  ? 50  TYR C OH    1 
ATOM 1777  N N     . LEU C 3 51  ? 271.195 259.001 271.050 1.00 33.69  ? 51  LEU C N     1 
ATOM 1778  C CA    . LEU C 3 51  ? 270.249 259.683 270.177 1.00 33.69  ? 51  LEU C CA    1 
ATOM 1779  C C     . LEU C 3 51  ? 270.655 261.130 269.927 1.00 33.69  ? 51  LEU C C     1 
ATOM 1780  O O     . LEU C 3 51  ? 270.509 261.631 268.809 1.00 33.69  ? 51  LEU C O     1 
ATOM 1781  C CB    . LEU C 3 51  ? 268.845 259.606 270.764 1.00 33.69  ? 51  LEU C CB    1 
ATOM 1782  C CG    . LEU C 3 51  ? 267.712 260.149 269.900 1.00 33.69  ? 51  LEU C CG    1 
ATOM 1783  C CD1   . LEU C 3 51  ? 267.863 259.700 268.469 1.00 33.69  ? 51  LEU C CD1   1 
ATOM 1784  C CD2   . LEU C 3 51  ? 266.384 259.699 270.446 1.00 33.69  ? 51  LEU C CD2   1 
ATOM 1785  N N     . ALA C 3 52  ? 271.165 261.820 270.946 1.00 34.26  ? 52  ALA C N     1 
ATOM 1786  C CA    . ALA C 3 52  ? 271.623 263.186 270.746 1.00 34.26  ? 52  ALA C CA    1 
ATOM 1787  C C     . ALA C 3 52  ? 272.826 263.222 269.820 1.00 34.26  ? 52  ALA C C     1 
ATOM 1788  O O     . ALA C 3 52  ? 272.931 264.106 268.967 1.00 34.26  ? 52  ALA C O     1 
ATOM 1789  C CB    . ALA C 3 52  ? 271.950 263.839 272.087 1.00 34.26  ? 52  ALA C CB    1 
ATOM 1790  N N     . ALA C 3 53  ? 273.733 262.253 269.953 1.00 34.61  ? 53  ALA C N     1 
ATOM 1791  C CA    . ALA C 3 53  ? 274.863 262.179 269.034 1.00 34.61  ? 53  ALA C CA    1 
ATOM 1792  C C     . ALA C 3 53  ? 274.399 261.982 267.599 1.00 34.61  ? 53  ALA C C     1 
ATOM 1793  O O     . ALA C 3 53  ? 274.909 262.629 266.680 1.00 34.61  ? 53  ALA C O     1 
ATOM 1794  C CB    . ALA C 3 53  ? 275.801 261.054 269.445 1.00 34.61  ? 53  ALA C CB    1 
ATOM 1795  N N     . VAL C 3 54  ? 273.419 261.107 267.386 1.00 34.11  ? 54  VAL C N     1 
ATOM 1796  C CA    . VAL C 3 54  ? 272.946 260.854 266.029 1.00 34.11  ? 54  VAL C CA    1 
ATOM 1797  C C     . VAL C 3 54  ? 272.242 262.078 265.454 1.00 34.11  ? 54  VAL C C     1 
ATOM 1798  O O     . VAL C 3 54  ? 272.460 262.447 264.294 1.00 34.11  ? 54  VAL C O     1 
ATOM 1799  C CB    . VAL C 3 54  ? 272.034 259.621 266.007 1.00 34.11  ? 54  VAL C CB    1 
ATOM 1800  C CG1   . VAL C 3 54  ? 271.264 259.576 264.712 1.00 34.11  ? 54  VAL C CG1   1 
ATOM 1801  C CG2   . VAL C 3 54  ? 272.861 258.376 266.170 1.00 34.11  ? 54  VAL C CG2   1 
ATOM 1802  N N     . LEU C 3 55  ? 271.364 262.704 266.238 1.00 34.60  ? 55  LEU C N     1 
ATOM 1803  C CA    . LEU C 3 55  ? 270.681 263.904 265.771 1.00 34.60  ? 55  LEU C CA    1 
ATOM 1804  C C     . LEU C 3 55  ? 271.681 264.994 265.427 1.00 34.60  ? 55  LEU C C     1 
ATOM 1805  O O     . LEU C 3 55  ? 271.541 265.687 264.414 1.00 34.60  ? 55  LEU C O     1 
ATOM 1806  C CB    . LEU C 3 55  ? 269.693 264.387 266.827 1.00 34.60  ? 55  LEU C CB    1 
ATOM 1807  C CG    . LEU C 3 55  ? 268.537 263.446 267.144 1.00 34.60  ? 55  LEU C CG    1 
ATOM 1808  C CD1   . LEU C 3 55  ? 267.703 264.006 268.265 1.00 34.60  ? 55  LEU C CD1   1 
ATOM 1809  C CD2   . LEU C 3 55  ? 267.692 263.204 265.923 1.00 34.60  ? 55  LEU C CD2   1 
ATOM 1810  N N     . GLU C 3 56  ? 272.725 265.131 266.243 1.00 36.96  ? 56  GLU C N     1 
ATOM 1811  C CA    . GLU C 3 56  ? 273.748 266.129 265.980 1.00 36.96  ? 56  GLU C CA    1 
ATOM 1812  C C     . GLU C 3 56  ? 274.525 265.812 264.712 1.00 36.96  ? 56  GLU C C     1 
ATOM 1813  O O     . GLU C 3 56  ? 274.845 266.716 263.937 1.00 36.96  ? 56  GLU C O     1 
ATOM 1814  C CB    . GLU C 3 56  ? 274.689 266.228 267.172 1.00 36.96  ? 56  GLU C CB    1 
ATOM 1815  C CG    . GLU C 3 56  ? 275.790 267.228 266.985 1.00 36.96  ? 56  GLU C CG    1 
ATOM 1816  C CD    . GLU C 3 56  ? 276.583 267.442 268.242 1.00 36.96  ? 56  GLU C CD    1 
ATOM 1817  O OE1   . GLU C 3 56  ? 276.144 266.957 269.298 1.00 36.96  ? 56  GLU C OE1   1 
ATOM 1818  O OE2   . GLU C 3 56  ? 277.641 268.095 268.181 1.00 36.96  ? 56  GLU C OE2   1 
ATOM 1819  N N     . TYR C 3 57  ? 274.819 264.534 264.472 1.00 37.18  ? 57  TYR C N     1 
ATOM 1820  C CA    . TYR C 3 57  ? 275.543 264.162 263.262 1.00 37.18  ? 57  TYR C CA    1 
ATOM 1821  C C     . TYR C 3 57  ? 274.721 264.456 262.012 1.00 37.18  ? 57  TYR C C     1 
ATOM 1822  O O     . TYR C 3 57  ? 275.237 265.000 261.030 1.00 37.18  ? 57  TYR C O     1 
ATOM 1823  C CB    . TYR C 3 57  ? 275.939 262.688 263.307 1.00 37.18  ? 57  TYR C CB    1 
ATOM 1824  C CG    . TYR C 3 57  ? 276.322 262.159 261.952 1.00 37.18  ? 57  TYR C CG    1 
ATOM 1825  C CD1   . TYR C 3 57  ? 277.570 262.419 261.415 1.00 37.18  ? 57  TYR C CD1   1 
ATOM 1826  C CD2   . TYR C 3 57  ? 275.426 261.428 261.197 1.00 37.18  ? 57  TYR C CD2   1 
ATOM 1827  C CE1   . TYR C 3 57  ? 277.912 261.954 260.172 1.00 37.18  ? 57  TYR C CE1   1 
ATOM 1828  C CE2   . TYR C 3 57  ? 275.759 260.961 259.957 1.00 37.18  ? 57  TYR C CE2   1 
ATOM 1829  C CZ    . TYR C 3 57  ? 277.003 261.228 259.447 1.00 37.18  ? 57  TYR C CZ    1 
ATOM 1830  O OH    . TYR C 3 57  ? 277.337 260.760 258.202 1.00 37.18  ? 57  TYR C OH    1 
ATOM 1831  N N     . LEU C 3 58  ? 273.441 264.085 262.020 1.00 36.00  ? 58  LEU C N     1 
ATOM 1832  C CA    . LEU C 3 58  ? 272.603 264.344 260.852 1.00 36.00  ? 58  LEU C CA    1 
ATOM 1833  C C     . LEU C 3 58  ? 272.420 265.838 260.624 1.00 36.00  ? 58  LEU C C     1 
ATOM 1834  O O     . LEU C 3 58  ? 272.420 266.308 259.476 1.00 36.00  ? 58  LEU C O     1 
ATOM 1835  C CB    . LEU C 3 58  ? 271.256 263.654 261.009 1.00 36.00  ? 58  LEU C CB    1 
ATOM 1836  C CG    . LEU C 3 58  ? 271.319 262.136 260.919 1.00 36.00  ? 58  LEU C CG    1 
ATOM 1837  C CD1   . LEU C 3 58  ? 270.019 261.550 261.371 1.00 36.00  ? 58  LEU C CD1   1 
ATOM 1838  C CD2   . LEU C 3 58  ? 271.627 261.718 259.507 1.00 36.00  ? 58  LEU C CD2   1 
ATOM 1839  N N     . THR C 3 59  ? 272.281 266.601 261.707 1.00 36.31  ? 59  THR C N     1 
ATOM 1840  C CA    . THR C 3 59  ? 272.195 268.047 261.585 1.00 36.31  ? 59  THR C CA    1 
ATOM 1841  C C     . THR C 3 59  ? 273.462 268.618 260.971 1.00 36.31  ? 59  THR C C     1 
ATOM 1842  O O     . THR C 3 59  ? 273.399 269.457 260.073 1.00 36.31  ? 59  THR C O     1 
ATOM 1843  C CB    . THR C 3 59  ? 271.929 268.660 262.954 1.00 36.31  ? 59  THR C CB    1 
ATOM 1844  O OG1   . THR C 3 59  ? 270.664 268.201 263.429 1.00 36.31  ? 59  THR C OG1   1 
ATOM 1845  C CG2   . THR C 3 59  ? 271.912 270.162 262.879 1.00 36.31  ? 59  THR C CG2   1 
ATOM 1846  N N     . ALA C 3 60  ? 274.624 268.169 261.439 1.00 37.77  ? 60  ALA C N     1 
ATOM 1847  C CA    . ALA C 3 60  ? 275.876 268.686 260.909 1.00 37.77  ? 60  ALA C CA    1 
ATOM 1848  C C     . ALA C 3 60  ? 276.048 268.325 259.442 1.00 37.77  ? 60  ALA C C     1 
ATOM 1849  O O     . ALA C 3 60  ? 276.571 269.124 258.663 1.00 37.77  ? 60  ALA C O     1 
ATOM 1850  C CB    . ALA C 3 60  ? 277.051 268.173 261.736 1.00 37.77  ? 60  ALA C CB    1 
ATOM 1851  N N     . GLU C 3 61  ? 275.600 267.137 259.040 1.00 39.31  ? 61  GLU C N     1 
ATOM 1852  C CA    . GLU C 3 61  ? 275.689 266.767 257.631 1.00 39.31  ? 61  GLU C CA    1 
ATOM 1853  C C     . GLU C 3 61  ? 274.857 267.704 256.769 1.00 39.31  ? 61  GLU C C     1 
ATOM 1854  O O     . GLU C 3 61  ? 275.351 268.279 255.783 1.00 39.31  ? 61  GLU C O     1 
ATOM 1855  C CB    . GLU C 3 61  ? 275.242 265.322 257.440 1.00 39.31  ? 61  GLU C CB    1 
ATOM 1856  C CG    . GLU C 3 61  ? 276.278 264.317 257.850 1.00 39.31  ? 61  GLU C CG    1 
ATOM 1857  C CD    . GLU C 3 61  ? 277.554 264.458 257.048 1.00 39.31  ? 61  GLU C CD    1 
ATOM 1858  O OE1   . GLU C 3 61  ? 277.459 264.671 255.821 1.00 39.31  ? 61  GLU C OE1   1 
ATOM 1859  O OE2   . GLU C 3 61  ? 278.648 264.367 257.639 1.00 39.31  ? 61  GLU C OE2   1 
ATOM 1860  N N     . ILE C 3 62  ? 273.586 267.877 257.137 1.00 37.55  ? 62  ILE C N     1 
ATOM 1861  C CA    . ILE C 3 62  ? 272.719 268.751 256.358 1.00 37.55  ? 62  ILE C CA    1 
ATOM 1862  C C     . ILE C 3 62  ? 273.256 270.175 256.351 1.00 37.55  ? 62  ILE C C     1 
ATOM 1863  O O     . ILE C 3 62  ? 273.270 270.836 255.312 1.00 37.55  ? 62  ILE C O     1 
ATOM 1864  C CB    . ILE C 3 62  ? 271.276 268.689 256.883 1.00 37.55  ? 62  ILE C CB    1 
ATOM 1865  C CG1   . ILE C 3 62  ? 270.652 267.350 256.521 1.00 37.55  ? 62  ILE C CG1   1 
ATOM 1866  C CG2   . ILE C 3 62  ? 270.451 269.797 256.290 1.00 37.55  ? 62  ILE C CG2   1 
ATOM 1867  C CD1   . ILE C 3 62  ? 269.177 267.316 256.706 1.00 37.55  ? 62  ILE C CD1   1 
ATOM 1868  N N     . LEU C 3 63  ? 273.713 270.667 257.500 1.00 38.43  ? 63  LEU C N     1 
ATOM 1869  C CA    . LEU C 3 63  ? 274.163 272.050 257.582 1.00 38.43  ? 63  LEU C CA    1 
ATOM 1870  C C     . LEU C 3 63  ? 275.444 272.269 256.797 1.00 38.43  ? 63  LEU C C     1 
ATOM 1871  O O     . LEU C 3 63  ? 275.639 273.335 256.216 1.00 38.43  ? 63  LEU C O     1 
ATOM 1872  C CB    . LEU C 3 63  ? 274.361 272.453 259.036 1.00 38.43  ? 63  LEU C CB    1 
ATOM 1873  C CG    . LEU C 3 63  ? 273.095 272.662 259.858 1.00 38.43  ? 63  LEU C CG    1 
ATOM 1874  C CD1   . LEU C 3 63  ? 273.468 273.142 261.236 1.00 38.43  ? 63  LEU C CD1   1 
ATOM 1875  C CD2   . LEU C 3 63  ? 272.187 273.648 259.175 1.00 38.43  ? 63  LEU C CD2   1 
ATOM 1876  N N     . GLU C 3 64  ? 276.327 271.276 256.768 1.00 41.19  ? 64  GLU C N     1 
ATOM 1877  C CA    . GLU C 3 64  ? 277.535 271.380 255.966 1.00 41.19  ? 64  GLU C CA    1 
ATOM 1878  C C     . GLU C 3 64  ? 277.188 271.508 254.491 1.00 41.19  ? 64  GLU C C     1 
ATOM 1879  O O     . GLU C 3 64  ? 277.664 272.419 253.797 1.00 41.19  ? 64  GLU C O     1 
ATOM 1880  C CB    . GLU C 3 64  ? 278.408 270.156 256.222 1.00 41.19  ? 64  GLU C CB    1 
ATOM 1881  C CG    . GLU C 3 64  ? 279.869 270.318 255.905 1.00 41.19  ? 64  GLU C CG    1 
ATOM 1882  C CD    . GLU C 3 64  ? 280.147 270.279 254.429 1.00 41.19  ? 64  GLU C CD    1 
ATOM 1883  O OE1   . GLU C 3 64  ? 280.376 271.355 253.843 1.00 41.19  ? 64  GLU C OE1   1 
ATOM 1884  O OE2   . GLU C 3 64  ? 280.131 269.173 253.850 1.00 41.19  ? 64  GLU C OE2   1 
ATOM 1885  N N     . LEU C 3 65  ? 276.337 270.608 253.999 1.00 39.76  ? 65  LEU C N     1 
ATOM 1886  C CA    . LEU C 3 65  ? 275.948 270.675 252.595 1.00 39.76  ? 65  LEU C CA    1 
ATOM 1887  C C     . LEU C 3 65  ? 275.205 271.969 252.280 1.00 39.76  ? 65  LEU C C     1 
ATOM 1888  O O     . LEU C 3 65  ? 275.420 272.579 251.227 1.00 39.76  ? 65  LEU C O     1 
ATOM 1889  C CB    . LEU C 3 65  ? 275.104 269.461 252.242 1.00 39.76  ? 65  LEU C CB    1 
ATOM 1890  C CG    . LEU C 3 65  ? 275.897 268.165 252.288 1.00 39.76  ? 65  LEU C CG    1 
ATOM 1891  C CD1   . LEU C 3 65  ? 274.978 266.992 252.121 1.00 39.76  ? 65  LEU C CD1   1 
ATOM 1892  C CD2   . LEU C 3 65  ? 276.955 268.180 251.218 1.00 39.76  ? 65  LEU C CD2   1 
ATOM 1893  N N     . ALA C 3 66  ? 274.346 272.418 253.194 1.00 39.72  ? 66  ALA C N     1 
ATOM 1894  C CA    . ALA C 3 66  ? 273.569 273.622 252.953 1.00 39.72  ? 66  ALA C CA    1 
ATOM 1895  C C     . ALA C 3 66  ? 274.434 274.868 253.002 1.00 39.72  ? 66  ALA C C     1 
ATOM 1896  O O     . ALA C 3 66  ? 274.164 275.825 252.280 1.00 39.72  ? 66  ALA C O     1 
ATOM 1897  C CB    . ALA C 3 66  ? 272.431 273.726 253.963 1.00 39.72  ? 66  ALA C CB    1 
ATOM 1898  N N     . GLY C 3 67  ? 275.473 274.880 253.833 1.00 41.49  ? 67  GLY C N     1 
ATOM 1899  C CA    . GLY C 3 67  ? 276.391 276.001 253.828 1.00 41.49  ? 67  GLY C CA    1 
ATOM 1900  C C     . GLY C 3 67  ? 277.221 276.052 252.564 1.00 41.49  ? 67  GLY C C     1 
ATOM 1901  O O     . GLY C 3 67  ? 277.496 277.131 252.037 1.00 41.49  ? 67  GLY C O     1 
ATOM 1902  N N     . ASN C 3 68  ? 277.625 274.887 252.055 1.00 42.97  ? 68  ASN C N     1 
ATOM 1903  C CA    . ASN C 3 68  ? 278.244 274.857 250.734 1.00 42.97  ? 68  ASN C CA    1 
ATOM 1904  C C     . ASN C 3 68  ? 277.310 275.442 249.684 1.00 42.97  ? 68  ASN C C     1 
ATOM 1905  O O     . ASN C 3 68  ? 277.720 276.265 248.860 1.00 42.97  ? 68  ASN C O     1 
ATOM 1906  C CB    . ASN C 3 68  ? 278.628 273.431 250.356 1.00 42.97  ? 68  ASN C CB    1 
ATOM 1907  C CG    . ASN C 3 68  ? 279.694 272.866 251.244 1.00 42.97  ? 68  ASN C CG    1 
ATOM 1908  O OD1   . ASN C 3 68  ? 280.389 273.597 251.942 1.00 42.97  ? 68  ASN C OD1   1 
ATOM 1909  N ND2   . ASN C 3 68  ? 279.840 271.550 251.220 1.00 42.97  ? 68  ASN C ND2   1 
ATOM 1910  N N     . ALA C 3 69  ? 276.043 275.025 249.703 1.00 42.62  ? 69  ALA C N     1 
ATOM 1911  C CA    . ALA C 3 69  ? 275.088 275.492 248.702 1.00 42.62  ? 69  ALA C CA    1 
ATOM 1912  C C     . ALA C 3 69  ? 274.793 276.979 248.842 1.00 42.62  ? 69  ALA C C     1 
ATOM 1913  O O     . ALA C 3 69  ? 274.542 277.657 247.842 1.00 42.62  ? 69  ALA C O     1 
ATOM 1914  C CB    . ALA C 3 69  ? 273.797 274.684 248.794 1.00 42.62  ? 69  ALA C CB    1 
ATOM 1915  N N     . ALA C 3 70  ? 274.800 277.500 250.066 1.00 43.41  ? 70  ALA C N     1 
ATOM 1916  C CA    . ALA C 3 70  ? 274.634 278.933 250.261 1.00 43.41  ? 70  ALA C CA    1 
ATOM 1917  C C     . ALA C 3 70  ? 275.837 279.696 249.735 1.00 43.41  ? 70  ALA C C     1 
ATOM 1918  O O     . ALA C 3 70  ? 275.686 280.744 249.100 1.00 43.41  ? 70  ALA C O     1 
ATOM 1919  C CB    . ALA C 3 70  ? 274.420 279.244 251.738 1.00 43.41  ? 70  ALA C CB    1 
ATOM 1920  N N     . ARG C 3 71  ? 277.040 279.188 249.996 1.00 45.85  ? 71  ARG C N     1 
ATOM 1921  C CA    . ARG C 3 71  ? 278.234 279.840 249.481 1.00 45.85  ? 71  ARG C CA    1 
ATOM 1922  C C     . ARG C 3 71  ? 278.275 279.818 247.960 1.00 45.85  ? 71  ARG C C     1 
ATOM 1923  O O     . ARG C 3 71  ? 278.775 280.761 247.340 1.00 45.85  ? 71  ARG C O     1 
ATOM 1924  C CB    . ARG C 3 71  ? 279.479 279.173 250.050 1.00 45.85  ? 71  ARG C CB    1 
ATOM 1925  C CG    . ARG C 3 71  ? 280.733 279.962 249.811 1.00 45.85  ? 71  ARG C CG    1 
ATOM 1926  C CD    . ARG C 3 71  ? 281.960 279.161 250.161 1.00 45.85  ? 71  ARG C CD    1 
ATOM 1927  N NE    . ARG C 3 71  ? 281.962 277.872 249.486 1.00 45.85  ? 71  ARG C NE    1 
ATOM 1928  C CZ    . ARG C 3 71  ? 281.959 276.703 250.112 1.00 45.85  ? 71  ARG C CZ    1 
ATOM 1929  N NH1   . ARG C 3 71  ? 281.961 276.660 251.435 1.00 45.85  ? 71  ARG C NH1   1 
ATOM 1930  N NH2   . ARG C 3 71  ? 281.959 275.578 249.414 1.00 45.85  ? 71  ARG C NH2   1 
ATOM 1931  N N     . ASP C 3 72  ? 277.755 278.759 247.341 1.00 46.65  ? 72  ASP C N     1 
ATOM 1932  C CA    . ASP C 3 72  ? 277.743 278.684 245.887 1.00 46.65  ? 72  ASP C CA    1 
ATOM 1933  C C     . ASP C 3 72  ? 276.736 279.630 245.249 1.00 46.65  ? 72  ASP C C     1 
ATOM 1934  O O     . ASP C 3 72  ? 276.695 279.721 244.021 1.00 46.65  ? 72  ASP C O     1 
ATOM 1935  C CB    . ASP C 3 72  ? 277.465 277.255 245.437 1.00 46.65  ? 72  ASP C CB    1 
ATOM 1936  C CG    . ASP C 3 72  ? 278.611 276.321 245.748 1.00 46.65  ? 72  ASP C CG    1 
ATOM 1937  O OD1   . ASP C 3 72  ? 279.743 276.815 245.920 1.00 46.65  ? 72  ASP C OD1   1 
ATOM 1938  O OD2   . ASP C 3 72  ? 278.382 275.097 245.820 1.00 46.65  ? 72  ASP C OD2   1 
ATOM 1939  N N     . ASN C 3 73  ? 275.916 280.315 246.040 1.00 47.21  ? 73  ASN C N     1 
ATOM 1940  C CA    . ASN C 3 73  ? 275.041 281.363 245.536 1.00 47.21  ? 73  ASN C CA    1 
ATOM 1941  C C     . ASN C 3 73  ? 275.461 282.736 246.035 1.00 47.21  ? 73  ASN C C     1 
ATOM 1942  O O     . ASN C 3 73  ? 274.683 283.688 245.947 1.00 47.21  ? 73  ASN C O     1 
ATOM 1943  C CB    . ASN C 3 73  ? 273.591 281.076 245.920 1.00 47.21  ? 73  ASN C CB    1 
ATOM 1944  C CG    . ASN C 3 73  ? 273.139 279.711 245.475 1.00 47.21  ? 73  ASN C CG    1 
ATOM 1945  O OD1   . ASN C 3 73  ? 272.406 279.027 246.181 1.00 47.21  ? 73  ASN C OD1   1 
ATOM 1946  N ND2   . ASN C 3 73  ? 273.585 279.298 244.297 1.00 47.21  ? 73  ASN C ND2   1 
ATOM 1947  N N     . LYS C 3 74  ? 276.677 282.846 246.570 1.00 48.61  ? 74  LYS C N     1 
ATOM 1948  C CA    . LYS C 3 74  ? 277.215 284.092 247.113 1.00 48.61  ? 74  LYS C CA    1 
ATOM 1949  C C     . LYS C 3 74  ? 276.390 284.612 248.283 1.00 48.61  ? 74  LYS C C     1 
ATOM 1950  O O     . LYS C 3 74  ? 276.420 285.803 248.593 1.00 48.61  ? 74  LYS C O     1 
ATOM 1951  C CB    . LYS C 3 74  ? 277.345 285.171 246.033 1.00 48.61  ? 74  LYS C CB    1 
ATOM 1952  C CG    . LYS C 3 74  ? 278.605 285.074 245.187 1.00 48.61  ? 74  LYS C CG    1 
ATOM 1953  C CD    . LYS C 3 74  ? 278.557 283.893 244.244 1.00 48.61  ? 74  LYS C CD    1 
ATOM 1954  C CE    . LYS C 3 74  ? 279.794 283.823 243.372 1.00 48.61  ? 74  LYS C CE    1 
ATOM 1955  N NZ    . LYS C 3 74  ? 279.839 282.560 242.585 1.00 48.61  ? 74  LYS C NZ    1 
ATOM 1956  N N     . LYS C 3 75  ? 275.655 283.732 248.949 1.00 49.51  ? 75  LYS C N     1 
ATOM 1957  C CA    . LYS C 3 75  ? 274.901 284.091 250.137 1.00 49.51  ? 75  LYS C CA    1 
ATOM 1958  C C     . LYS C 3 75  ? 275.687 283.701 251.378 1.00 49.51  ? 75  LYS C C     1 
ATOM 1959  O O     . LYS C 3 75  ? 276.504 282.781 251.352 1.00 49.51  ? 75  LYS C O     1 
ATOM 1960  C CB    . LYS C 3 75  ? 273.537 283.407 250.160 1.00 49.51  ? 75  LYS C CB    1 
ATOM 1961  C CG    . LYS C 3 75  ? 272.619 283.801 249.031 1.00 49.51  ? 75  LYS C CG    1 
ATOM 1962  C CD    . LYS C 3 75  ? 272.420 285.295 248.987 1.00 49.51  ? 75  LYS C CD    1 
ATOM 1963  C CE    . LYS C 3 75  ? 271.341 285.663 247.994 1.00 49.51  ? 75  LYS C CE    1 
ATOM 1964  N NZ    . LYS C 3 75  ? 271.622 285.104 246.649 1.00 49.51  ? 75  LYS C NZ    1 
ATOM 1965  N N     . THR C 3 76  ? 275.444 284.421 252.464 1.00 50.02  ? 76  THR C N     1 
ATOM 1966  C CA    . THR C 3 76  ? 276.051 284.083 253.739 1.00 50.02  ? 76  THR C CA    1 
ATOM 1967  C C     . THR C 3 76  ? 275.070 283.445 254.704 1.00 50.02  ? 76  THR C C     1 
ATOM 1968  O O     . THR C 3 76  ? 275.496 282.921 255.732 1.00 50.02  ? 76  THR C O     1 
ATOM 1969  C CB    . THR C 3 76  ? 276.662 285.321 254.400 1.00 50.02  ? 76  THR C CB    1 
ATOM 1970  O OG1   . THR C 3 76  ? 275.845 285.725 255.502 1.00 50.02  ? 76  THR C OG1   1 
ATOM 1971  C CG2   . THR C 3 76  ? 276.754 286.454 253.414 1.00 50.02  ? 76  THR C CG2   1 
ATOM 1972  N N     . ARG C 3 77  ? 273.779 283.484 254.407 1.00 47.23  ? 77  ARG C N     1 
ATOM 1973  C CA    . ARG C 3 77  ? 272.762 282.911 255.269 1.00 47.23  ? 77  ARG C CA    1 
ATOM 1974  C C     . ARG C 3 77  ? 272.060 281.777 254.549 1.00 47.23  ? 77  ARG C C     1 
ATOM 1975  O O     . ARG C 3 77  ? 271.608 281.935 253.413 1.00 47.23  ? 77  ARG C O     1 
ATOM 1976  C CB    . ARG C 3 77  ? 271.747 283.959 255.702 1.00 47.23  ? 77  ARG C CB    1 
ATOM 1977  C CG    . ARG C 3 77  ? 272.321 284.983 256.640 1.00 47.23  ? 77  ARG C CG    1 
ATOM 1978  C CD    . ARG C 3 77  ? 271.268 285.507 257.573 1.00 47.23  ? 77  ARG C CD    1 
ATOM 1979  N NE    . ARG C 3 77  ? 270.298 286.335 256.876 1.00 47.23  ? 77  ARG C NE    1 
ATOM 1980  C CZ    . ARG C 3 77  ? 270.301 287.660 256.900 1.00 47.23  ? 77  ARG C CZ    1 
ATOM 1981  N NH1   . ARG C 3 77  ? 271.223 288.308 257.591 1.00 47.23  ? 77  ARG C NH1   1 
ATOM 1982  N NH2   . ARG C 3 77  ? 269.378 288.332 256.236 1.00 47.23  ? 77  ARG C NH2   1 
ATOM 1983  N N     . ILE C 3 78  ? 271.968 280.643 255.221 1.00 39.68  ? 78  ILE C N     1 
ATOM 1984  C CA    . ILE C 3 78  ? 271.267 279.484 254.693 1.00 39.68  ? 78  ILE C CA    1 
ATOM 1985  C C     . ILE C 3 78  ? 269.784 279.803 254.604 1.00 39.68  ? 78  ILE C C     1 
ATOM 1986  O O     . ILE C 3 78  ? 269.209 280.400 255.515 1.00 39.68  ? 78  ILE C O     1 
ATOM 1987  C CB    . ILE C 3 78  ? 271.524 278.257 255.585 1.00 39.68  ? 78  ILE C CB    1 
ATOM 1988  C CG1   . ILE C 3 78  ? 272.968 277.782 255.443 1.00 39.68  ? 78  ILE C CG1   1 
ATOM 1989  C CG2   . ILE C 3 78  ? 270.539 277.142 255.283 1.00 39.68  ? 78  ILE C CG2   1 
ATOM 1990  C CD1   . ILE C 3 78  ? 273.390 276.794 256.487 1.00 39.68  ? 78  ILE C CD1   1 
ATOM 1991  N N     . ILE C 3 79  ? 269.161 279.411 253.500 1.00 37.07  ? 79  ILE C N     1 
ATOM 1992  C CA    . ILE C 3 79  ? 267.721 279.563 253.334 1.00 37.07  ? 79  ILE C CA    1 
ATOM 1993  C C     . ILE C 3 79  ? 267.120 278.219 252.929 1.00 37.07  ? 79  ILE C C     1 
ATOM 1994  O O     . ILE C 3 79  ? 267.865 277.272 252.617 1.00 37.07  ? 79  ILE C O     1 
ATOM 1995  C CB    . ILE C 3 79  ? 267.404 280.672 252.317 1.00 37.07  ? 79  ILE C CB    1 
ATOM 1996  C CG1   . ILE C 3 79  ? 267.977 280.328 250.950 1.00 37.07  ? 79  ILE C CG1   1 
ATOM 1997  C CG2   . ILE C 3 79  ? 267.936 281.998 252.801 1.00 37.07  ? 79  ILE C CG2   1 
ATOM 1998  C CD1   . ILE C 3 79  ? 267.369 281.123 249.851 1.00 37.07  ? 79  ILE C CD1   1 
ATOM 1999  N N     . PRO C 3 80  ? 265.790 278.078 252.941 1.00 35.27  ? 80  PRO C N     1 
ATOM 2000  C CA    . PRO C 3 80  ? 265.185 276.802 252.539 1.00 35.27  ? 80  PRO C CA    1 
ATOM 2001  C C     . PRO C 3 80  ? 265.648 276.302 251.198 1.00 35.27  ? 80  PRO C C     1 
ATOM 2002  O O     . PRO C 3 80  ? 265.749 275.089 251.004 1.00 35.27  ? 80  PRO C O     1 
ATOM 2003  C CB    . PRO C 3 80  ? 263.693 277.130 252.517 1.00 35.27  ? 80  PRO C CB    1 
ATOM 2004  C CG    . PRO C 3 80  ? 263.551 278.193 253.487 1.00 35.27  ? 80  PRO C CG    1 
ATOM 2005  C CD    . PRO C 3 80  ? 264.763 279.023 253.406 1.00 35.27  ? 80  PRO C CD    1 
ATOM 2006  N N     . ARG C 3 81  ? 265.925 277.201 250.258 1.00 36.37  ? 81  ARG C N     1 
ATOM 2007  C CA    . ARG C 3 81  ? 266.425 276.775 248.961 1.00 36.37  ? 81  ARG C CA    1 
ATOM 2008  C C     . ARG C 3 81  ? 267.756 276.056 249.100 1.00 36.37  ? 81  ARG C C     1 
ATOM 2009  O O     . ARG C 3 81  ? 267.987 275.035 248.448 1.00 36.37  ? 81  ARG C O     1 
ATOM 2010  C CB    . ARG C 3 81  ? 266.553 277.983 248.039 1.00 36.37  ? 81  ARG C CB    1 
ATOM 2011  C CG    . ARG C 3 81  ? 267.152 277.681 246.693 1.00 36.37  ? 81  ARG C CG    1 
ATOM 2012  C CD    . ARG C 3 81  ? 266.334 276.660 245.953 1.00 36.37  ? 81  ARG C CD    1 
ATOM 2013  N NE    . ARG C 3 81  ? 266.758 276.523 244.570 1.00 36.37  ? 81  ARG C NE    1 
ATOM 2014  C CZ    . ARG C 3 81  ? 266.220 275.665 243.715 1.00 36.37  ? 81  ARG C CZ    1 
ATOM 2015  N NH1   . ARG C 3 81  ? 265.240 274.870 244.103 1.00 36.37  ? 81  ARG C NH1   1 
ATOM 2016  N NH2   . ARG C 3 81  ? 266.669 275.600 242.475 1.00 36.37  ? 81  ARG C NH2   1 
ATOM 2017  N N     . HIS C 3 82  ? 268.647 276.572 249.945 1.00 38.29  ? 82  HIS C N     1 
ATOM 2018  C CA    . HIS C 3 82  ? 269.924 275.904 250.153 1.00 38.29  ? 82  HIS C CA    1 
ATOM 2019  C C     . HIS C 3 82  ? 269.729 274.559 250.827 1.00 38.29  ? 82  HIS C C     1 
ATOM 2020  O O     . HIS C 3 82  ? 270.395 273.580 250.474 1.00 38.29  ? 82  HIS C O     1 
ATOM 2021  C CB    . HIS C 3 82  ? 270.851 276.794 250.970 1.00 38.29  ? 82  HIS C CB    1 
ATOM 2022  C CG    . HIS C 3 82  ? 271.067 278.138 250.359 1.00 38.29  ? 82  HIS C CG    1 
ATOM 2023  N ND1   . HIS C 3 82  ? 271.193 279.285 251.107 1.00 38.29  ? 82  HIS C ND1   1 
ATOM 2024  C CD2   . HIS C 3 82  ? 271.161 278.519 249.066 1.00 38.29  ? 82  HIS C CD2   1 
ATOM 2025  C CE1   . HIS C 3 82  ? 271.360 280.316 250.301 1.00 38.29  ? 82  HIS C CE1   1 
ATOM 2026  N NE2   . HIS C 3 82  ? 271.349 279.878 249.057 1.00 38.29  ? 82  HIS C NE2   1 
ATOM 2027  N N     . LEU C 3 83  ? 268.805 274.483 251.783 1.00 36.08  ? 83  LEU C N     1 
ATOM 2028  C CA    . LEU C 3 83  ? 268.518 273.189 252.395 1.00 36.08  ? 83  LEU C CA    1 
ATOM 2029  C C     . LEU C 3 83  ? 268.016 272.186 251.362 1.00 36.08  ? 83  LEU C C     1 
ATOM 2030  O O     . LEU C 3 83  ? 268.436 271.024 251.352 1.00 36.08  ? 83  LEU C O     1 
ATOM 2031  C CB    . LEU C 3 83  ? 267.505 273.356 253.520 1.00 36.08  ? 83  LEU C CB    1 
ATOM 2032  C CG    . LEU C 3 83  ? 267.994 274.152 254.721 1.00 36.08  ? 83  LEU C CG    1 
ATOM 2033  C CD1   . LEU C 3 83  ? 266.848 274.434 255.644 1.00 36.08  ? 83  LEU C CD1   1 
ATOM 2034  C CD2   . LEU C 3 83  ? 269.080 273.406 255.444 1.00 36.08  ? 83  LEU C CD2   1 
ATOM 2035  N N     . GLN C 3 84  ? 267.120 272.619 250.480 1.00 36.87  ? 84  GLN C N     1 
ATOM 2036  C CA    . GLN C 3 84  ? 266.570 271.718 249.476 1.00 36.87  ? 84  GLN C CA    1 
ATOM 2037  C C     . GLN C 3 84  ? 267.633 271.281 248.481 1.00 36.87  ? 84  GLN C C     1 
ATOM 2038  O O     . GLN C 3 84  ? 267.691 270.107 248.100 1.00 36.87  ? 84  GLN C O     1 
ATOM 2039  C CB    . GLN C 3 84  ? 265.409 272.394 248.757 1.00 36.87  ? 84  GLN C CB    1 
ATOM 2040  C CG    . GLN C 3 84  ? 264.962 271.686 247.503 1.00 36.87  ? 84  GLN C CG    1 
ATOM 2041  C CD    . GLN C 3 84  ? 263.940 270.616 247.770 1.00 36.87  ? 84  GLN C CD    1 
ATOM 2042  O OE1   . GLN C 3 84  ? 263.858 270.081 248.867 1.00 36.87  ? 84  GLN C OE1   1 
ATOM 2043  N NE2   . GLN C 3 84  ? 263.146 270.299 246.759 1.00 36.87  ? 84  GLN C NE2   1 
ATOM 2044  N N     . LEU C 3 85  ? 268.479 272.210 248.040 1.00 37.49  ? 85  LEU C N     1 
ATOM 2045  C CA    . LEU C 3 85  ? 269.572 271.850 247.147 1.00 37.49  ? 85  LEU C CA    1 
ATOM 2046  C C     . LEU C 3 85  ? 270.481 270.817 247.795 1.00 37.49  ? 85  LEU C C     1 
ATOM 2047  O O     . LEU C 3 85  ? 270.812 269.798 247.182 1.00 37.49  ? 85  LEU C O     1 
ATOM 2048  C CB    . LEU C 3 85  ? 270.361 273.094 246.754 1.00 37.49  ? 85  LEU C CB    1 
ATOM 2049  C CG    . LEU C 3 85  ? 269.642 274.105 245.867 1.00 37.49  ? 85  LEU C CG    1 
ATOM 2050  C CD1   . LEU C 3 85  ? 270.522 275.312 245.630 1.00 37.49  ? 85  LEU C CD1   1 
ATOM 2051  C CD2   . LEU C 3 85  ? 269.240 273.479 244.557 1.00 37.49  ? 85  LEU C CD2   1 
ATOM 2052  N N     . ALA C 3 86  ? 270.875 271.057 249.047 1.00 37.82  ? 86  ALA C N     1 
ATOM 2053  C CA    . ALA C 3 86  ? 271.712 270.105 249.768 1.00 37.82  ? 86  ALA C CA    1 
ATOM 2054  C C     . ALA C 3 86  ? 271.075 268.725 249.810 1.00 37.82  ? 86  ALA C C     1 
ATOM 2055  O O     . ALA C 3 86  ? 271.699 267.723 249.437 1.00 37.82  ? 86  ALA C O     1 
ATOM 2056  C CB    . ALA C 3 86  ? 271.963 270.610 251.185 1.00 37.82  ? 86  ALA C CB    1 
ATOM 2057  N N     . VAL C 3 87  ? 269.821 268.659 250.251 1.00 37.92  ? 87  VAL C N     1 
ATOM 2058  C CA    . VAL C 3 87  ? 269.167 267.371 250.453 1.00 37.92  ? 87  VAL C CA    1 
ATOM 2059  C C     . VAL C 3 87  ? 269.016 266.630 249.133 1.00 37.92  ? 87  VAL C C     1 
ATOM 2060  O O     . VAL C 3 87  ? 269.369 265.453 249.024 1.00 37.92  ? 87  VAL C O     1 
ATOM 2061  C CB    . VAL C 3 87  ? 267.810 267.565 251.150 1.00 37.92  ? 87  VAL C CB    1 
ATOM 2062  C CG1   . VAL C 3 87  ? 267.054 266.268 251.179 1.00 37.92  ? 87  VAL C CG1   1 
ATOM 2063  C CG2   . VAL C 3 87  ? 268.017 268.092 252.555 1.00 37.92  ? 87  VAL C CG2   1 
ATOM 2064  N N     . ARG C 3 88  ? 268.478 267.299 248.113 1.00 38.27  ? 88  ARG C N     1 
ATOM 2065  C CA    . ARG C 3 88  ? 268.209 266.613 246.858 1.00 38.27  ? 88  ARG C CA    1 
ATOM 2066  C C     . ARG C 3 88  ? 269.473 266.333 246.062 1.00 38.27  ? 88  ARG C C     1 
ATOM 2067  O O     . ARG C 3 88  ? 269.435 265.508 245.148 1.00 38.27  ? 88  ARG C O     1 
ATOM 2068  C CB    . ARG C 3 88  ? 267.233 267.418 246.005 1.00 38.27  ? 88  ARG C CB    1 
ATOM 2069  C CG    . ARG C 3 88  ? 265.946 267.764 246.710 1.00 38.27  ? 88  ARG C CG    1 
ATOM 2070  C CD    . ARG C 3 88  ? 265.272 266.542 247.284 1.00 38.27  ? 88  ARG C CD    1 
ATOM 2071  N NE    . ARG C 3 88  ? 264.287 266.914 248.289 1.00 38.27  ? 88  ARG C NE    1 
ATOM 2072  C CZ    . ARG C 3 88  ? 263.675 266.060 249.100 1.00 38.27  ? 88  ARG C CZ    1 
ATOM 2073  N NH1   . ARG C 3 88  ? 263.942 264.767 249.039 1.00 38.27  ? 88  ARG C NH1   1 
ATOM 2074  N NH2   . ARG C 3 88  ? 262.797 266.506 249.979 1.00 38.27  ? 88  ARG C NH2   1 
ATOM 2075  N N     . ASN C 3 89  ? 270.586 266.992 246.378 1.00 39.65  ? 89  ASN C N     1 
ATOM 2076  C CA    . ASN C 3 89  ? 271.838 266.658 245.723 1.00 39.65  ? 89  ASN C CA    1 
ATOM 2077  C C     . ASN C 3 89  ? 272.594 265.542 246.425 1.00 39.65  ? 89  ASN C C     1 
ATOM 2078  O O     . ASN C 3 89  ? 273.357 264.827 245.772 1.00 39.65  ? 89  ASN C O     1 
ATOM 2079  C CB    . ASN C 3 89  ? 272.731 267.893 245.624 1.00 39.65  ? 89  ASN C CB    1 
ATOM 2080  C CG    . ASN C 3 89  ? 272.249 268.871 244.586 1.00 39.65  ? 89  ASN C CG    1 
ATOM 2081  O OD1   . ASN C 3 89  ? 271.723 268.480 243.551 1.00 39.65  ? 89  ASN C OD1   1 
ATOM 2082  N ND2   . ASN C 3 89  ? 272.420 270.152 244.859 1.00 39.65  ? 89  ASN C ND2   1 
ATOM 2083  N N     . ASP C 3 90  ? 272.420 265.376 247.734 1.00 42.71  ? 90  ASP C N     1 
ATOM 2084  C CA    . ASP C 3 90  ? 273.070 264.269 248.421 1.00 42.71  ? 90  ASP C CA    1 
ATOM 2085  C C     . ASP C 3 90  ? 272.190 263.029 248.344 1.00 42.71  ? 90  ASP C C     1 
ATOM 2086  O O     . ASP C 3 90  ? 270.995 263.090 248.630 1.00 42.71  ? 90  ASP C O     1 
ATOM 2087  C CB    . ASP C 3 90  ? 273.361 264.624 249.876 1.00 42.71  ? 90  ASP C CB    1 
ATOM 2088  C CG    . ASP C 3 90  ? 274.302 263.638 250.532 1.00 42.71  ? 90  ASP C CG    1 
ATOM 2089  O OD1   . ASP C 3 90  ? 274.831 262.760 249.825 1.00 42.71  ? 90  ASP C OD1   1 
ATOM 2090  O OD2   . ASP C 3 90  ? 274.516 263.732 251.756 1.00 42.71  ? 90  ASP C OD2   1 
ATOM 2091  N N     . GLU C 3 91  ? 272.791 261.900 247.979 1.00 44.57  ? 91  GLU C N     1 
ATOM 2092  C CA    . GLU C 3 91  ? 272.015 260.706 247.664 1.00 44.57  ? 91  GLU C CA    1 
ATOM 2093  C C     . GLU C 3 91  ? 271.360 260.116 248.910 1.00 44.57  ? 91  GLU C C     1 
ATOM 2094  O O     . GLU C 3 91  ? 270.161 259.812 248.914 1.00 44.57  ? 91  GLU C O     1 
ATOM 2095  C CB    . GLU C 3 91  ? 272.918 259.680 246.985 1.00 44.57  ? 91  GLU C CB    1 
ATOM 2096  C CG    . GLU C 3 91  ? 272.196 258.744 246.046 1.00 44.57  ? 91  GLU C CG    1 
ATOM 2097  C CD    . GLU C 3 91  ? 272.099 257.331 246.582 1.00 44.57  ? 91  GLU C CD    1 
ATOM 2098  O OE1   . GLU C 3 91  ? 272.645 257.062 247.673 1.00 44.57  ? 91  GLU C OE1   1 
ATOM 2099  O OE2   . GLU C 3 91  ? 271.473 256.487 245.908 1.00 44.57  ? 91  GLU C OE2   1 
ATOM 2100  N N     . GLU C 3 92  ? 272.122 259.973 249.989 1.00 42.63  ? 92  GLU C N     1 
ATOM 2101  C CA    . GLU C 3 92  ? 271.566 259.351 251.184 1.00 42.63  ? 92  GLU C CA    1 
ATOM 2102  C C     . GLU C 3 92  ? 270.615 260.284 251.920 1.00 42.63  ? 92  GLU C C     1 
ATOM 2103  O O     . GLU C 3 92  ? 269.604 259.833 252.463 1.00 42.63  ? 92  GLU C O     1 
ATOM 2104  C CB    . GLU C 3 92  ? 272.693 258.887 252.091 1.00 42.63  ? 92  GLU C CB    1 
ATOM 2105  C CG    . GLU C 3 92  ? 273.453 257.740 251.491 1.00 42.63  ? 92  GLU C CG    1 
ATOM 2106  C CD    . GLU C 3 92  ? 274.676 257.391 252.277 1.00 42.63  ? 92  GLU C CD    1 
ATOM 2107  O OE1   . GLU C 3 92  ? 275.331 258.319 252.793 1.00 42.63  ? 92  GLU C OE1   1 
ATOM 2108  O OE2   . GLU C 3 92  ? 274.985 256.188 252.379 1.00 42.63  ? 92  GLU C OE2   1 
ATOM 2109  N N     . LEU C 3 93  ? 270.910 261.584 251.950 1.00 40.31  ? 93  LEU C N     1 
ATOM 2110  C CA    . LEU C 3 93  ? 269.966 262.524 252.543 1.00 40.31  ? 93  LEU C CA    1 
ATOM 2111  C C     . LEU C 3 93  ? 268.688 262.602 251.726 1.00 40.31  ? 93  LEU C C     1 
ATOM 2112  O O     . LEU C 3 93  ? 267.596 262.746 252.280 1.00 40.31  ? 93  LEU C O     1 
ATOM 2113  C CB    . LEU C 3 93  ? 270.594 263.905 252.671 1.00 40.31  ? 93  LEU C CB    1 
ATOM 2114  C CG    . LEU C 3 93  ? 271.604 264.050 253.797 1.00 40.31  ? 93  LEU C CG    1 
ATOM 2115  C CD1   . LEU C 3 93  ? 272.183 265.440 253.777 1.00 40.31  ? 93  LEU C CD1   1 
ATOM 2116  C CD2   . LEU C 3 93  ? 270.954 263.763 255.132 1.00 40.31  ? 93  LEU C CD2   1 
ATOM 2117  N N     . ASN C 3 94  ? 268.808 262.512 250.403 1.00 40.33  ? 94  ASN C N     1 
ATOM 2118  C CA    . ASN C 3 94  ? 267.628 262.485 249.555 1.00 40.33  ? 94  ASN C CA    1 
ATOM 2119  C C     . ASN C 3 94  ? 266.821 261.218 249.781 1.00 40.33  ? 94  ASN C C     1 
ATOM 2120  O O     . ASN C 3 94  ? 265.598 261.225 249.626 1.00 40.33  ? 94  ASN C O     1 
ATOM 2121  C CB    . ASN C 3 94  ? 268.047 262.619 248.092 1.00 40.33  ? 94  ASN C CB    1 
ATOM 2122  C CG    . ASN C 3 94  ? 266.884 262.500 247.138 1.00 40.33  ? 94  ASN C CG    1 
ATOM 2123  O OD1   . ASN C 3 94  ? 266.060 263.398 247.031 1.00 40.33  ? 94  ASN C OD1   1 
ATOM 2124  N ND2   . ASN C 3 94  ? 266.817 261.387 246.431 1.00 40.33  ? 94  ASN C ND2   1 
ATOM 2125  N N     . LYS C 3 95  ? 267.484 260.124 250.143 1.00 40.88  ? 95  LYS C N     1 
ATOM 2126  C CA    . LYS C 3 95  ? 266.757 258.908 250.486 1.00 40.88  ? 95  LYS C CA    1 
ATOM 2127  C C     . LYS C 3 95  ? 266.074 259.036 251.842 1.00 40.88  ? 95  LYS C C     1 
ATOM 2128  O O     . LYS C 3 95  ? 264.930 258.604 252.013 1.00 40.88  ? 95  LYS C O     1 
ATOM 2129  C CB    . LYS C 3 95  ? 267.715 257.726 250.473 1.00 40.88  ? 95  LYS C CB    1 
ATOM 2130  C CG    . LYS C 3 95  ? 267.065 256.374 250.470 1.00 40.88  ? 95  LYS C CG    1 
ATOM 2131  C CD    . LYS C 3 95  ? 268.127 255.315 250.260 1.00 40.88  ? 95  LYS C CD    1 
ATOM 2132  C CE    . LYS C 3 95  ? 269.019 255.691 249.092 1.00 40.88  ? 95  LYS C CE    1 
ATOM 2133  N NZ    . LYS C 3 95  ? 270.351 255.037 249.154 1.00 40.88  ? 95  LYS C NZ    1 
ATOM 2134  N N     . LEU C 3 96  ? 266.761 259.634 252.815 1.00 38.10  ? 96  LEU C N     1 
ATOM 2135  C CA    . LEU C 3 96  ? 266.196 259.795 254.150 1.00 38.10  ? 96  LEU C CA    1 
ATOM 2136  C C     . LEU C 3 96  ? 265.000 260.736 254.135 1.00 38.10  ? 96  LEU C C     1 
ATOM 2137  O O     . LEU C 3 96  ? 264.014 260.512 254.841 1.00 38.10  ? 96  LEU C O     1 
ATOM 2138  C CB    . LEU C 3 96  ? 267.273 260.305 255.105 1.00 38.10  ? 96  LEU C CB    1 
ATOM 2139  C CG    . LEU C 3 96  ? 266.857 260.692 256.520 1.00 38.10  ? 96  LEU C CG    1 
ATOM 2140  C CD1   . LEU C 3 96  ? 266.329 259.488 257.268 1.00 38.10  ? 96  LEU C CD1   1 
ATOM 2141  C CD2   . LEU C 3 96  ? 268.011 261.316 257.266 1.00 38.10  ? 96  LEU C CD2   1 
ATOM 2142  N N     . LEU C 3 97  ? 265.065 261.792 253.330 1.00 37.18  ? 97  LEU C N     1 
ATOM 2143  C CA    . LEU C 3 97  ? 263.976 262.744 253.182 1.00 37.18  ? 97  LEU C CA    1 
ATOM 2144  C C     . LEU C 3 97  ? 263.231 262.553 251.868 1.00 37.18  ? 97  LEU C C     1 
ATOM 2145  O O     . LEU C 3 97  ? 262.850 263.531 251.222 1.00 37.18  ? 97  LEU C O     1 
ATOM 2146  C CB    . LEU C 3 97  ? 264.513 264.166 253.298 1.00 37.18  ? 97  LEU C CB    1 
ATOM 2147  C CG    . LEU C 3 97  ? 265.402 264.410 254.514 1.00 37.18  ? 97  LEU C CG    1 
ATOM 2148  C CD1   . LEU C 3 97  ? 265.829 265.853 254.588 1.00 37.18  ? 97  LEU C CD1   1 
ATOM 2149  C CD2   . LEU C 3 97  ? 264.687 264.003 255.776 1.00 37.18  ? 97  LEU C CD2   1 
ATOM 2150  N N     . GLY C 3 98  ? 263.035 261.302 251.453 1.00 38.01  ? 98  GLY C N     1 
ATOM 2151  C CA    . GLY C 3 98  ? 262.435 261.035 250.160 1.00 38.01  ? 98  GLY C CA    1 
ATOM 2152  C C     . GLY C 3 98  ? 261.006 261.513 250.040 1.00 38.01  ? 98  GLY C C     1 
ATOM 2153  O O     . GLY C 3 98  ? 260.614 262.038 248.997 1.00 38.01  ? 98  GLY C O     1 
ATOM 2154  N N     . ARG C 3 99  ? 260.212 261.345 251.088 1.00 38.18  ? 99  ARG C N     1 
ATOM 2155  C CA    . ARG C 3 99  ? 258.825 261.786 251.093 1.00 38.18  ? 99  ARG C CA    1 
ATOM 2156  C C     . ARG C 3 99  ? 258.629 262.977 252.022 1.00 38.18  ? 99  ARG C C     1 
ATOM 2157  O O     . ARG C 3 99  ? 257.604 263.106 252.687 1.00 38.18  ? 99  ARG C O     1 
ATOM 2158  C CB    . ARG C 3 99  ? 257.894 260.638 251.470 1.00 38.18  ? 99  ARG C CB    1 
ATOM 2159  C CG    . ARG C 3 99  ? 258.544 259.587 252.326 1.00 38.18  ? 99  ARG C CG    1 
ATOM 2160  C CD    . ARG C 3 99  ? 257.528 258.871 253.197 1.00 38.18  ? 99  ARG C CD    1 
ATOM 2161  N NE    . ARG C 3 99  ? 258.150 258.322 254.398 1.00 38.18  ? 99  ARG C NE    1 
ATOM 2162  C CZ    . ARG C 3 99  ? 258.471 259.043 255.470 1.00 38.18  ? 99  ARG C CZ    1 
ATOM 2163  N NH1   . ARG C 3 99  ? 258.224 260.347 255.493 1.00 38.18  ? 99  ARG C NH1   1 
ATOM 2164  N NH2   . ARG C 3 99  ? 259.040 258.463 256.518 1.00 38.18  ? 99  ARG C NH2   1 
ATOM 2165  N N     . VAL C 3 100 ? 259.617 263.862 252.067 1.00 35.03  ? 100 VAL C N     1 
ATOM 2166  C CA    . VAL C 3 100 ? 259.549 265.102 252.822 1.00 35.03  ? 100 VAL C CA    1 
ATOM 2167  C C     . VAL C 3 100 ? 259.470 266.247 251.827 1.00 35.03  ? 100 VAL C C     1 
ATOM 2168  O O     . VAL C 3 100 ? 260.133 266.215 250.787 1.00 35.03  ? 100 VAL C O     1 
ATOM 2169  C CB    . VAL C 3 100 ? 260.760 265.266 253.757 1.00 35.03  ? 100 VAL C CB    1 
ATOM 2170  C CG1   . VAL C 3 100 ? 260.759 266.635 254.398 1.00 35.03  ? 100 VAL C CG1   1 
ATOM 2171  C CG2   . VAL C 3 100 ? 260.760 264.187 254.813 1.00 35.03  ? 100 VAL C CG2   1 
ATOM 2172  N N     . THR C 3 101 ? 258.640 267.236 252.128 1.00 33.91  ? 101 THR C N     1 
ATOM 2173  C CA    . THR C 3 101 ? 258.546 268.458 251.349 1.00 33.91  ? 101 THR C CA    1 
ATOM 2174  C C     . THR C 3 101 ? 259.103 269.613 252.167 1.00 33.91  ? 101 THR C C     1 
ATOM 2175  O O     . THR C 3 101 ? 258.640 269.871 253.281 1.00 33.91  ? 101 THR C O     1 
ATOM 2176  C CB    . THR C 3 101 ? 257.099 268.750 250.954 1.00 33.91  ? 101 THR C CB    1 
ATOM 2177  O OG1   . THR C 3 101 ? 256.614 267.709 250.103 1.00 33.91  ? 101 THR C OG1   1 
ATOM 2178  C CG2   . THR C 3 101 ? 256.998 270.078 250.230 1.00 33.91  ? 101 THR C CG2   1 
ATOM 2179  N N     . ILE C 3 102 ? 260.089 270.300 251.614 1.00 34.82  ? 102 ILE C N     1 
ATOM 2180  C CA    . ILE C 3 102 ? 260.700 271.458 252.247 1.00 34.82  ? 102 ILE C CA    1 
ATOM 2181  C C     . ILE C 3 102 ? 259.996 272.696 251.715 1.00 34.82  ? 102 ILE C C     1 
ATOM 2182  O O     . ILE C 3 102 ? 260.020 272.961 250.509 1.00 34.82  ? 102 ILE C O     1 
ATOM 2183  C CB    . ILE C 3 102 ? 262.209 271.508 251.970 1.00 34.82  ? 102 ILE C CB    1 
ATOM 2184  C CG1   . ILE C 3 102 ? 262.907 270.333 252.644 1.00 34.82  ? 102 ILE C CG1   1 
ATOM 2185  C CG2   . ILE C 3 102 ? 262.798 272.812 252.420 1.00 34.82  ? 102 ILE C CG2   1 
ATOM 2186  C CD1   . ILE C 3 102 ? 264.363 270.255 252.332 1.00 34.82  ? 102 ILE C CD1   1 
ATOM 2187  N N     . ALA C 3 103 ? 259.360 273.449 252.604 1.00 35.67  ? 103 ALA C N     1 
ATOM 2188  C CA    . ALA C 3 103 ? 258.620 274.627 252.180 1.00 35.67  ? 103 ALA C CA    1 
ATOM 2189  C C     . ALA C 3 103 ? 259.574 275.675 251.631 1.00 35.67  ? 103 ALA C C     1 
ATOM 2190  O O     . ALA C 3 103 ? 260.627 275.934 252.220 1.00 35.67  ? 103 ALA C O     1 
ATOM 2191  C CB    . ALA C 3 103 ? 257.816 275.201 253.340 1.00 35.67  ? 103 ALA C CB    1 
ATOM 2192  N N     . GLN C 3 104 ? 259.202 276.270 250.496 1.00 37.89  ? 104 GLN C N     1 
ATOM 2193  C CA    . GLN C 3 104 ? 260.007 277.280 249.809 1.00 37.89  ? 104 GLN C CA    1 
ATOM 2194  C C     . GLN C 3 104 ? 261.326 276.711 249.306 1.00 37.89  ? 104 GLN C C     1 
ATOM 2195  O O     . GLN C 3 104 ? 262.288 277.446 249.100 1.00 37.89  ? 104 GLN C O     1 
ATOM 2196  C CB    . GLN C 3 104 ? 260.261 278.500 250.697 1.00 37.89  ? 104 GLN C CB    1 
ATOM 2197  C CG    . GLN C 3 104 ? 259.051 279.377 250.900 1.00 37.89  ? 104 GLN C CG    1 
ATOM 2198  C CD    . GLN C 3 104 ? 258.606 280.046 249.615 1.00 37.89  ? 104 GLN C CD    1 
ATOM 2199  O OE1   . GLN C 3 104 ? 257.525 279.770 249.100 1.00 37.89  ? 104 GLN C OE1   1 
ATOM 2200  N NE2   . GLN C 3 104 ? 259.438 280.939 249.094 1.00 37.89  ? 104 GLN C NE2   1 
ATOM 2201  N N     . GLY C 3 105 ? 261.384 275.403 249.100 1.00 36.81  ? 105 GLY C N     1 
ATOM 2202  C CA    . GLY C 3 105 ? 262.619 274.764 248.706 1.00 36.81  ? 105 GLY C CA    1 
ATOM 2203  C C     . GLY C 3 105 ? 262.816 274.725 247.209 1.00 36.81  ? 105 GLY C C     1 
ATOM 2204  O O     . GLY C 3 105 ? 263.944 274.611 246.732 1.00 36.81  ? 105 GLY C O     1 
ATOM 2205  N N     . GLY C 3 106 ? 261.728 274.823 246.459 1.00 36.50  ? 106 GLY C N     1 
ATOM 2206  C CA    . GLY C 3 106 ? 261.820 274.713 245.024 1.00 36.50  ? 106 GLY C CA    1 
ATOM 2207  C C     . GLY C 3 106 ? 262.112 273.281 244.614 1.00 36.50  ? 106 GLY C C     1 
ATOM 2208  O O     . GLY C 3 106 ? 261.820 272.324 245.324 1.00 36.50  ? 106 GLY C O     1 
ATOM 2209  N N     . VAL C 3 107 ? 262.711 273.147 243.433 1.00 36.46  ? 107 VAL C N     1 
ATOM 2210  C CA    . VAL C 3 107 ? 263.084 271.855 242.877 1.00 36.46  ? 107 VAL C CA    1 
ATOM 2211  C C     . VAL C 3 107 ? 264.500 271.958 242.335 1.00 36.46  ? 107 VAL C C     1 
ATOM 2212  O O     . VAL C 3 107 ? 265.134 273.010 242.383 1.00 36.46  ? 107 VAL C O     1 
ATOM 2213  C CB    . VAL C 3 107 ? 262.115 271.381 241.774 1.00 36.46  ? 107 VAL C CB    1 
ATOM 2214  C CG1   . VAL C 3 107 ? 260.719 271.240 242.319 1.00 36.46  ? 107 VAL C CG1   1 
ATOM 2215  C CG2   . VAL C 3 107 ? 262.131 272.348 240.615 1.00 36.46  ? 107 VAL C CG2   1 
ATOM 2216  N N     . LEU C 3 108 ? 265.000 270.837 241.834 1.00 37.72  ? 108 LEU C N     1 
ATOM 2217  C CA    . LEU C 3 108 ? 266.291 270.828 241.178 1.00 37.72  ? 108 LEU C CA    1 
ATOM 2218  C C     . LEU C 3 108 ? 266.140 271.209 239.707 1.00 37.72  ? 108 LEU C C     1 
ATOM 2219  O O     . LEU C 3 108 ? 265.142 270.874 239.069 1.00 37.72  ? 108 LEU C O     1 
ATOM 2220  C CB    . LEU C 3 108 ? 266.939 269.453 241.295 1.00 37.72  ? 108 LEU C CB    1 
ATOM 2221  C CG    . LEU C 3 108 ? 268.136 269.314 242.233 1.00 37.72  ? 108 LEU C CG    1 
ATOM 2222  C CD1   . LEU C 3 108 ? 267.908 270.064 243.521 1.00 37.72  ? 108 LEU C CD1   1 
ATOM 2223  C CD2   . LEU C 3 108 ? 268.392 267.853 242.514 1.00 37.72  ? 108 LEU C CD2   1 
ATOM 2224  N N     . PRO C 3 109 ? 267.120 271.900 239.149 1.00 39.01  ? 109 PRO C N     1 
ATOM 2225  C CA    . PRO C 3 109 ? 267.058 272.275 237.732 1.00 39.01  ? 109 PRO C CA    1 
ATOM 2226  C C     . PRO C 3 109 ? 267.298 271.104 236.795 1.00 39.01  ? 109 PRO C C     1 
ATOM 2227  O O     . PRO C 3 109 ? 268.440 270.859 236.404 1.00 39.01  ? 109 PRO C O     1 
ATOM 2228  C CB    . PRO C 3 109 ? 268.172 273.322 237.604 1.00 39.01  ? 109 PRO C CB    1 
ATOM 2229  C CG    . PRO C 3 109 ? 268.398 273.804 238.985 1.00 39.01  ? 109 PRO C CG    1 
ATOM 2230  C CD    . PRO C 3 109 ? 268.181 272.624 239.858 1.00 39.01  ? 109 PRO C CD    1 
ATOM 2231  N N     . ASN C 3 110 ? 266.250 270.366 236.437 1.00 40.35  ? 110 ASN C N     1 
ATOM 2232  C CA    . ASN C 3 110 ? 266.381 269.162 235.624 1.00 40.35  ? 110 ASN C CA    1 
ATOM 2233  C C     . ASN C 3 110 ? 265.467 269.240 234.408 1.00 40.35  ? 110 ASN C C     1 
ATOM 2234  O O     . ASN C 3 110 ? 264.241 269.241 234.547 1.00 40.35  ? 110 ASN C O     1 
ATOM 2235  C CB    . ASN C 3 110 ? 266.064 267.921 236.452 1.00 40.35  ? 110 ASN C CB    1 
ATOM 2236  C CG    . ASN C 3 110 ? 266.233 266.646 235.665 1.00 40.35  ? 110 ASN C CG    1 
ATOM 2237  O OD1   . ASN C 3 110 ? 265.262 265.960 235.355 1.00 40.35  ? 110 ASN C OD1   1 
ATOM 2238  N ND2   . ASN C 3 110 ? 267.471 266.328 235.321 1.00 40.35  ? 110 ASN C ND2   1 
ATOM 2239  N N     . ILE C 3 111 ? 266.059 269.267 233.220 1.00 40.00  ? 111 ILE C N     1 
ATOM 2240  C CA    . ILE C 3 111 ? 265.321 269.239 231.963 1.00 40.00  ? 111 ILE C CA    1 
ATOM 2241  C C     . ILE C 3 111 ? 265.657 267.942 231.245 1.00 40.00  ? 111 ILE C C     1 
ATOM 2242  O O     . ILE C 3 111 ? 266.834 267.615 231.066 1.00 40.00  ? 111 ILE C O     1 
ATOM 2243  C CB    . ILE C 3 111 ? 265.657 270.450 231.080 1.00 40.00  ? 111 ILE C CB    1 
ATOM 2244  C CG1   . ILE C 3 111 ? 265.301 271.746 231.800 1.00 40.00  ? 111 ILE C CG1   1 
ATOM 2245  C CG2   . ILE C 3 111 ? 264.931 270.352 229.756 1.00 40.00  ? 111 ILE C CG2   1 
ATOM 2246  C CD1   . ILE C 3 111 ? 265.745 272.968 231.077 1.00 40.00  ? 111 ILE C CD1   1 
ATOM 2247  N N     . GLN C 3 112 ? 264.630 267.199 230.853 1.00 41.31  ? 112 GLN C N     1 
ATOM 2248  C CA    . GLN C 3 112 ? 264.843 265.963 230.117 1.00 41.31  ? 112 GLN C CA    1 
ATOM 2249  C C     . GLN C 3 112 ? 265.495 266.249 228.772 1.00 41.31  ? 112 GLN C C     1 
ATOM 2250  O O     . GLN C 3 112 ? 265.051 267.120 228.021 1.00 41.31  ? 112 GLN C O     1 
ATOM 2251  C CB    . GLN C 3 112 ? 263.520 265.236 229.920 1.00 41.31  ? 112 GLN C CB    1 
ATOM 2252  C CG    . GLN C 3 112 ? 262.835 264.880 231.210 1.00 41.31  ? 112 GLN C CG    1 
ATOM 2253  C CD    . GLN C 3 112 ? 263.622 263.884 232.022 1.00 41.31  ? 112 GLN C CD    1 
ATOM 2254  O OE1   . GLN C 3 112 ? 263.940 264.125 233.184 1.00 41.31  ? 112 GLN C OE1   1 
ATOM 2255  N NE2   . GLN C 3 112 ? 263.940 262.749 231.414 1.00 41.31  ? 112 GLN C NE2   1 
ATOM 2256  N N     . SER C 3 113 ? 266.547 265.490 228.462 1.00 42.77  ? 113 SER C N     1 
ATOM 2257  C CA    . SER C 3 113 ? 267.387 265.798 227.308 1.00 42.77  ? 113 SER C CA    1 
ATOM 2258  C C     . SER C 3 113 ? 266.624 265.716 225.994 1.00 42.77  ? 113 SER C C     1 
ATOM 2259  O O     . SER C 3 113 ? 267.009 266.365 225.018 1.00 42.77  ? 113 SER C O     1 
ATOM 2260  C CB    . SER C 3 113 ? 268.585 264.855 227.272 1.00 42.77  ? 113 SER C CB    1 
ATOM 2261  O OG    . SER C 3 113 ? 268.180 263.541 226.940 1.00 42.77  ? 113 SER C OG    1 
ATOM 2262  N N     . VAL C 3 114 ? 265.552 264.927 225.941 1.00 41.51  ? 114 VAL C N     1 
ATOM 2263  C CA    . VAL C 3 114 ? 264.768 264.832 224.719 1.00 41.51  ? 114 VAL C CA    1 
ATOM 2264  C C     . VAL C 3 114 ? 264.007 266.120 224.440 1.00 41.51  ? 114 VAL C C     1 
ATOM 2265  O O     . VAL C 3 114 ? 263.504 266.311 223.329 1.00 41.51  ? 114 VAL C O     1 
ATOM 2266  C CB    . VAL C 3 114 ? 263.813 263.628 224.802 1.00 41.51  ? 114 VAL C CB    1 
ATOM 2267  C CG1   . VAL C 3 114 ? 262.649 263.939 225.713 1.00 41.51  ? 114 VAL C CG1   1 
ATOM 2268  C CG2   . VAL C 3 114 ? 263.329 263.227 223.427 1.00 41.51  ? 114 VAL C CG2   1 
ATOM 2269  N N     . LEU C 3 115 ? 263.927 267.024 225.412 1.00 41.18  ? 115 LEU C N     1 
ATOM 2270  C CA    . LEU C 3 115 ? 263.223 268.285 225.242 1.00 41.18  ? 115 LEU C CA    1 
ATOM 2271  C C     . LEU C 3 115 ? 264.127 269.413 224.780 1.00 41.18  ? 115 LEU C C     1 
ATOM 2272  O O     . LEU C 3 115 ? 263.622 270.455 224.357 1.00 41.18  ? 115 LEU C O     1 
ATOM 2273  C CB    . LEU C 3 115 ? 262.544 268.692 226.550 1.00 41.18  ? 115 LEU C CB    1 
ATOM 2274  C CG    . LEU C 3 115 ? 261.634 267.646 227.189 1.00 41.18  ? 115 LEU C CG    1 
ATOM 2275  C CD1   . LEU C 3 115 ? 261.033 268.180 228.465 1.00 41.18  ? 115 LEU C CD1   1 
ATOM 2276  C CD2   . LEU C 3 115 ? 260.552 267.227 226.229 1.00 41.18  ? 115 LEU C CD2   1 
ATOM 2277  N N     . LEU C 3 116 ? 265.439 269.240 224.858 1.00 44.28  ? 116 LEU C N     1 
ATOM 2278  C CA    . LEU C 3 116 ? 266.350 270.304 224.488 1.00 44.28  ? 116 LEU C CA    1 
ATOM 2279  C C     . LEU C 3 116 ? 266.338 270.509 222.976 1.00 44.28  ? 116 LEU C C     1 
ATOM 2280  O O     . LEU C 3 116 ? 266.060 269.579 222.218 1.00 44.28  ? 116 LEU C O     1 
ATOM 2281  C CB    . LEU C 3 116 ? 267.759 269.980 224.966 1.00 44.28  ? 116 LEU C CB    1 
ATOM 2282  C CG    . LEU C 3 116 ? 267.919 269.936 226.484 1.00 44.28  ? 116 LEU C CG    1 
ATOM 2283  C CD1   . LEU C 3 116 ? 269.272 269.377 226.872 1.00 44.28  ? 116 LEU C CD1   1 
ATOM 2284  C CD2   . LEU C 3 116 ? 267.716 271.314 227.070 1.00 44.28  ? 116 LEU C CD2   1 
ATOM 2285  N N     . PRO C 3 117 ? 266.619 271.722 222.512 1.00 48.44  ? 117 PRO C N     1 
ATOM 2286  C CA    . PRO C 3 117 ? 266.662 271.962 221.068 1.00 48.44  ? 117 PRO C CA    1 
ATOM 2287  C C     . PRO C 3 117 ? 267.788 271.183 220.413 1.00 48.44  ? 117 PRO C C     1 
ATOM 2288  O O     . PRO C 3 117 ? 268.823 270.903 221.022 1.00 48.44  ? 117 PRO C O     1 
ATOM 2289  C CB    . PRO C 3 117 ? 266.900 273.471 220.969 1.00 48.44  ? 117 PRO C CB    1 
ATOM 2290  C CG    . PRO C 3 117 ? 267.570 273.820 222.241 1.00 48.44  ? 117 PRO C CG    1 
ATOM 2291  C CD    . PRO C 3 117 ? 266.966 272.930 223.277 1.00 48.44  ? 117 PRO C CD    1 
ATOM 2292  N N     . LYS C 3 118 ? 267.575 270.834 219.147 1.00 54.01  ? 118 LYS C N     1 
ATOM 2293  C CA    . LYS C 3 118 ? 268.547 270.045 218.403 1.00 54.01  ? 118 LYS C CA    1 
ATOM 2294  C C     . LYS C 3 118 ? 269.750 270.887 217.997 1.00 54.01  ? 118 LYS C C     1 
ATOM 2295  O O     . LYS C 3 118 ? 269.755 271.490 216.919 1.00 54.01  ? 118 LYS C O     1 
ATOM 2296  C CB    . LYS C 3 118 ? 267.894 269.432 217.165 1.00 54.01  ? 118 LYS C CB    1 
ATOM 2297  C CG    . LYS C 3 118 ? 266.575 268.739 217.445 1.00 54.01  ? 118 LYS C CG    1 
ATOM 2298  C CD    . LYS C 3 118 ? 265.941 268.239 216.162 1.00 54.01  ? 118 LYS C CD    1 
ATOM 2299  C CE    . LYS C 3 118 ? 264.547 267.691 216.409 1.00 54.01  ? 118 LYS C CE    1 
ATOM 2300  N NZ    . LYS C 3 118 ? 263.930 267.183 215.152 1.00 54.01  ? 118 LYS C NZ    1 
ATOM 2301  N N     . LYS C 3 119 ? 270.768 270.927 218.853 1.00 55.46  ? 119 LYS C N     1 
ATOM 2302  C CA    . LYS C 3 119 ? 271.993 271.685 218.603 1.00 55.46  ? 119 LYS C CA    1 
ATOM 2303  C C     . LYS C 3 119 ? 271.707 273.147 218.264 1.00 55.46  ? 119 LYS C C     1 
ATOM 2304  O O     . LYS C 3 119 ? 270.704 273.712 218.699 1.00 55.46  ? 119 LYS C O     1 
ATOM 2305  C CB    . LYS C 3 119 ? 272.804 271.033 217.478 1.00 55.46  ? 119 LYS C CB    1 
ATOM 2306  C CG    . LYS C 3 119 ? 273.328 269.650 217.825 1.00 55.46  ? 119 LYS C CG    1 
ATOM 2307  C CD    . LYS C 3 119 ? 274.129 269.041 216.685 1.00 55.46  ? 119 LYS C CD    1 
ATOM 2308  C CE    . LYS C 3 119 ? 274.799 267.744 217.123 1.00 55.46  ? 119 LYS C CE    1 
ATOM 2309  N NZ    . LYS C 3 119 ? 275.600 267.120 216.036 1.00 55.46  ? 119 LYS C NZ    1 
ATOM 2310  N N     . LYS D 4 25  ? 252.079 292.649 277.798 1.00 63.07  ? 25  LYS D N     1 
ATOM 2311  C CA    . LYS D 4 25  ? 251.993 292.534 279.248 1.00 63.07  ? 25  LYS D CA    1 
ATOM 2312  C C     . LYS D 4 25  ? 252.628 291.235 279.730 1.00 63.07  ? 25  LYS D C     1 
ATOM 2313  O O     . LYS D 4 25  ? 253.723 291.241 280.289 1.00 63.07  ? 25  LYS D O     1 
ATOM 2314  C CB    . LYS D 4 25  ? 250.536 292.613 279.710 1.00 63.07  ? 25  LYS D CB    1 
ATOM 2315  C CG    . LYS D 4 25  ? 250.341 292.353 281.195 1.00 63.07  ? 25  LYS D CG    1 
ATOM 2316  C CD    . LYS D 4 25  ? 249.531 291.087 281.428 1.00 63.07  ? 25  LYS D CD    1 
ATOM 2317  C CE    . LYS D 4 25  ? 249.541 290.684 282.894 1.00 63.07  ? 25  LYS D CE    1 
ATOM 2318  N NZ    . LYS D 4 25  ? 250.920 290.440 283.392 1.00 63.07  ? 25  LYS D NZ    1 
ATOM 2319  N N     . ARG D 4 26  ? 251.941 290.121 279.502 1.00 60.88  ? 26  ARG D N     1 
ATOM 2320  C CA    . ARG D 4 26  ? 252.417 288.810 279.913 1.00 60.88  ? 26  ARG D CA    1 
ATOM 2321  C C     . ARG D 4 26  ? 253.229 288.188 278.788 1.00 60.88  ? 26  ARG D C     1 
ATOM 2322  O O     . ARG D 4 26  ? 252.830 288.237 277.620 1.00 60.88  ? 26  ARG D O     1 
ATOM 2323  C CB    . ARG D 4 26  ? 251.258 287.885 280.292 1.00 60.88  ? 26  ARG D CB    1 
ATOM 2324  C CG    . ARG D 4 26  ? 251.641 286.416 280.295 1.00 60.88  ? 26  ARG D CG    1 
ATOM 2325  C CD    . ARG D 4 26  ? 250.505 285.515 280.735 1.00 60.88  ? 26  ARG D CD    1 
ATOM 2326  N NE    . ARG D 4 26  ? 250.551 285.240 282.168 1.00 60.88  ? 26  ARG D NE    1 
ATOM 2327  C CZ    . ARG D 4 26  ? 249.872 284.264 282.758 1.00 60.88  ? 26  ARG D CZ    1 
ATOM 2328  N NH1   . ARG D 4 26  ? 249.100 283.467 282.034 1.00 60.88  ? 26  ARG D NH1   1 
ATOM 2329  N NH2   . ARG D 4 26  ? 249.969 284.080 284.068 1.00 60.88  ? 26  ARG D NH2   1 
ATOM 2330  N N     . ARG D 4 27  ? 254.374 287.615 279.147 1.00 58.08  ? 27  ARG D N     1 
ATOM 2331  C CA    . ARG D 4 27  ? 255.196 286.922 278.170 1.00 58.08  ? 27  ARG D CA    1 
ATOM 2332  C C     . ARG D 4 27  ? 254.472 285.686 277.656 1.00 58.08  ? 27  ARG D C     1 
ATOM 2333  O O     . ARG D 4 27  ? 253.768 284.997 278.398 1.00 58.08  ? 27  ARG D O     1 
ATOM 2334  C CB    . ARG D 4 27  ? 256.536 286.517 278.781 1.00 58.08  ? 27  ARG D CB    1 
ATOM 2335  C CG    . ARG D 4 27  ? 257.165 287.570 279.670 1.00 58.08  ? 27  ARG D CG    1 
ATOM 2336  C CD    . ARG D 4 27  ? 258.664 287.664 279.440 1.00 58.08  ? 27  ARG D CD    1 
ATOM 2337  N NE    . ARG D 4 27  ? 259.382 286.458 279.840 1.00 58.08  ? 27  ARG D NE    1 
ATOM 2338  C CZ    . ARG D 4 27  ? 260.646 286.208 279.515 1.00 58.08  ? 27  ARG D CZ    1 
ATOM 2339  N NH1   . ARG D 4 27  ? 261.326 287.076 278.780 1.00 58.08  ? 27  ARG D NH1   1 
ATOM 2340  N NH2   . ARG D 4 27  ? 261.230 285.090 279.919 1.00 58.08  ? 27  ARG D NH2   1 
ATOM 2341  N N     . LYS D 4 28  ? 254.650 285.411 276.369 1.00 57.27  ? 28  LYS D N     1 
ATOM 2342  C CA    . LYS D 4 28  ? 254.123 284.187 275.790 1.00 57.27  ? 28  LYS D CA    1 
ATOM 2343  C C     . LYS D 4 28  ? 254.679 282.978 276.533 1.00 57.27  ? 28  LYS D C     1 
ATOM 2344  O O     . LYS D 4 28  ? 255.787 283.012 277.076 1.00 57.27  ? 28  LYS D O     1 
ATOM 2345  C CB    . LYS D 4 28  ? 254.486 284.101 274.309 1.00 57.27  ? 28  LYS D CB    1 
ATOM 2346  C CG    . LYS D 4 28  ? 254.339 285.409 273.553 1.00 57.27  ? 28  LYS D CG    1 
ATOM 2347  C CD    . LYS D 4 28  ? 254.716 285.239 272.090 1.00 57.27  ? 28  LYS D CD    1 
ATOM 2348  C CE    . LYS D 4 28  ? 254.232 286.408 271.240 1.00 57.27  ? 28  LYS D CE    1 
ATOM 2349  N NZ    . LYS D 4 28  ? 254.900 287.697 271.574 1.00 57.27  ? 28  LYS D NZ    1 
ATOM 2350  N N     . THR D 4 29  ? 253.890 281.909 276.574 1.00 55.53  ? 29  THR D N     1 
ATOM 2351  C CA    . THR D 4 29  ? 254.357 280.667 277.174 1.00 55.53  ? 29  THR D CA    1 
ATOM 2352  C C     . THR D 4 29  ? 255.561 280.143 276.405 1.00 55.53  ? 29  THR D C     1 
ATOM 2353  O O     . THR D 4 29  ? 255.583 280.175 275.172 1.00 55.53  ? 29  THR D O     1 
ATOM 2354  C CB    . THR D 4 29  ? 253.236 279.631 277.180 1.00 55.53  ? 29  THR D CB    1 
ATOM 2355  O OG1   . THR D 4 29  ? 252.092 280.178 277.844 1.00 55.53  ? 29  THR D OG1   1 
ATOM 2356  C CG2   . THR D 4 29  ? 253.672 278.379 277.911 1.00 55.53  ? 29  THR D CG2   1 
ATOM 2357  N N     . ARG D 4 30  ? 256.573 279.676 277.133 1.00 52.58  ? 30  ARG D N     1 
ATOM 2358  C CA    . ARG D 4 30  ? 257.818 279.290 276.486 1.00 52.58  ? 30  ARG D CA    1 
ATOM 2359  C C     . ARG D 4 30  ? 257.638 278.022 275.666 1.00 52.58  ? 30  ARG D C     1 
ATOM 2360  O O     . ARG D 4 30  ? 256.971 277.074 276.084 1.00 52.58  ? 30  ARG D O     1 
ATOM 2361  C CB    . ARG D 4 30  ? 258.940 279.119 277.511 1.00 52.58  ? 30  ARG D CB    1 
ATOM 2362  C CG    . ARG D 4 30  ? 258.676 278.183 278.663 1.00 52.58  ? 30  ARG D CG    1 
ATOM 2363  C CD    . ARG D 4 30  ? 259.859 278.229 279.628 1.00 52.58  ? 30  ARG D CD    1 
ATOM 2364  N NE    . ARG D 4 30  ? 260.332 279.599 279.822 1.00 52.58  ? 30  ARG D NE    1 
ATOM 2365  C CZ    . ARG D 4 30  ? 261.293 279.955 280.669 1.00 52.58  ? 30  ARG D CZ    1 
ATOM 2366  N NH1   . ARG D 4 30  ? 261.897 279.046 281.421 1.00 52.58  ? 30  ARG D NH1   1 
ATOM 2367  N NH2   . ARG D 4 30  ? 261.649 281.228 280.771 1.00 52.58  ? 30  ARG D NH2   1 
ATOM 2368  N N     . LYS D 4 31  ? 258.246 278.019 274.485 1.00 48.99  ? 31  LYS D N     1 
ATOM 2369  C CA    . LYS D 4 31  ? 258.100 276.957 273.499 1.00 48.99  ? 31  LYS D CA    1 
ATOM 2370  C C     . LYS D 4 31  ? 259.492 276.469 273.126 1.00 48.99  ? 31  LYS D C     1 
ATOM 2371  O O     . LYS D 4 31  ? 260.268 277.210 272.516 1.00 48.99  ? 31  LYS D O     1 
ATOM 2372  C CB    . LYS D 4 31  ? 257.348 277.466 272.273 1.00 48.99  ? 31  LYS D CB    1 
ATOM 2373  C CG    . LYS D 4 31  ? 257.145 276.439 271.190 1.00 48.99  ? 31  LYS D CG    1 
ATOM 2374  C CD    . LYS D 4 31  ? 256.520 277.073 269.966 1.00 48.99  ? 31  LYS D CD    1 
ATOM 2375  C CE    . LYS D 4 31  ? 256.047 276.017 268.985 1.00 48.99  ? 31  LYS D CE    1 
ATOM 2376  N NZ    . LYS D 4 31  ? 255.007 275.144 269.594 1.00 48.99  ? 31  LYS D NZ    1 
ATOM 2377  N N     . GLU D 4 32  ? 259.809 275.233 273.493 1.00 44.69  ? 32  GLU D N     1 
ATOM 2378  C CA    . GLU D 4 32  ? 261.151 274.712 273.283 1.00 44.69  ? 32  GLU D CA    1 
ATOM 2379  C C     . GLU D 4 32  ? 261.373 274.323 271.830 1.00 44.69  ? 32  GLU D C     1 
ATOM 2380  O O     . GLU D 4 32  ? 260.497 273.752 271.180 1.00 44.69  ? 32  GLU D O     1 
ATOM 2381  C CB    . GLU D 4 32  ? 261.398 273.504 274.179 1.00 44.69  ? 32  GLU D CB    1 
ATOM 2382  C CG    . GLU D 4 32  ? 261.612 273.853 275.632 1.00 44.69  ? 32  GLU D CG    1 
ATOM 2383  C CD    . GLU D 4 32  ? 261.821 272.624 276.493 1.00 44.69  ? 32  GLU D CD    1 
ATOM 2384  O OE1   . GLU D 4 32  ? 262.027 272.784 277.715 1.00 44.69  ? 32  GLU D OE1   1 
ATOM 2385  O OE2   . GLU D 4 32  ? 261.785 271.501 275.946 1.00 44.69  ? 32  GLU D OE2   1 
ATOM 2386  N N     . SER D 4 33  ? 262.567 274.617 271.331 1.00 40.05  ? 33  SER D N     1 
ATOM 2387  C CA    . SER D 4 33  ? 262.973 274.222 269.996 1.00 40.05  ? 33  SER D CA    1 
ATOM 2388  C C     . SER D 4 33  ? 264.419 273.764 270.058 1.00 40.05  ? 33  SER D C     1 
ATOM 2389  O O     . SER D 4 33  ? 265.065 273.819 271.105 1.00 40.05  ? 33  SER D O     1 
ATOM 2390  C CB    . SER D 4 33  ? 262.802 275.368 268.997 1.00 40.05  ? 33  SER D CB    1 
ATOM 2391  O OG    . SER D 4 33  ? 263.740 276.396 269.239 1.00 40.05  ? 33  SER D OG    1 
ATOM 2392  N N     . TYR D 4 34  ? 264.931 273.307 268.922 1.00 36.22  ? 34  TYR D N     1 
ATOM 2393  C CA    . TYR D 4 34  ? 266.324 272.919 268.798 1.00 36.22  ? 34  TYR D CA    1 
ATOM 2394  C C     . TYR D 4 34  ? 267.168 274.013 268.180 1.00 36.22  ? 34  TYR D C     1 
ATOM 2395  O O     . TYR D 4 34  ? 268.277 273.737 267.722 1.00 36.22  ? 34  TYR D O     1 
ATOM 2396  C CB    . TYR D 4 34  ? 266.451 271.648 267.966 1.00 36.22  ? 34  TYR D CB    1 
ATOM 2397  C CG    . TYR D 4 34  ? 265.937 270.416 268.643 1.00 36.22  ? 34  TYR D CG    1 
ATOM 2398  C CD1   . TYR D 4 34  ? 266.704 269.754 269.580 1.00 36.22  ? 34  TYR D CD1   1 
ATOM 2399  C CD2   . TYR D 4 34  ? 264.689 269.911 268.340 1.00 36.22  ? 34  TYR D CD2   1 
ATOM 2400  C CE1   . TYR D 4 34  ? 266.242 268.627 270.200 1.00 36.22  ? 34  TYR D CE1   1 
ATOM 2401  C CE2   . TYR D 4 34  ? 264.219 268.785 268.954 1.00 36.22  ? 34  TYR D CE2   1 
ATOM 2402  C CZ    . TYR D 4 34  ? 265.000 268.147 269.883 1.00 36.22  ? 34  TYR D CZ    1 
ATOM 2403  O OH    . TYR D 4 34  ? 264.536 267.018 270.498 1.00 36.22  ? 34  TYR D OH    1 
ATOM 2404  N N     . ALA D 4 35  ? 266.668 275.246 268.162 1.00 36.66  ? 35  ALA D N     1 
ATOM 2405  C CA    . ALA D 4 35  ? 267.283 276.286 267.348 1.00 36.66  ? 35  ALA D CA    1 
ATOM 2406  C C     . ALA D 4 35  ? 268.690 276.616 267.826 1.00 36.66  ? 35  ALA D C     1 
ATOM 2407  O O     . ALA D 4 35  ? 269.611 276.727 267.015 1.00 36.66  ? 35  ALA D O     1 
ATOM 2408  C CB    . ALA D 4 35  ? 266.409 277.535 267.339 1.00 36.66  ? 35  ALA D CB    1 
ATOM 2409  N N     . ILE D 4 36  ? 268.888 276.754 269.136 1.00 37.72  ? 36  ILE D N     1 
ATOM 2410  C CA    . ILE D 4 36  ? 270.211 277.133 269.621 1.00 37.72  ? 36  ILE D CA    1 
ATOM 2411  C C     . ILE D 4 36  ? 271.212 276.013 269.374 1.00 37.72  ? 36  ILE D C     1 
ATOM 2412  O O     . ILE D 4 36  ? 272.393 276.265 269.118 1.00 37.72  ? 36  ILE D O     1 
ATOM 2413  C CB    . ILE D 4 36  ? 270.158 277.534 271.104 1.00 37.72  ? 36  ILE D CB    1 
ATOM 2414  C CG1   . ILE D 4 36  ? 269.719 276.363 271.970 1.00 37.72  ? 36  ILE D CG1   1 
ATOM 2415  C CG2   . ILE D 4 36  ? 269.211 278.690 271.307 1.00 37.72  ? 36  ILE D CG2   1 
ATOM 2416  C CD1   . ILE D 4 36  ? 269.746 276.667 273.421 1.00 37.72  ? 36  ILE D CD1   1 
ATOM 2417  N N     . TYR D 4 37  ? 270.755 274.763 269.419 1.00 37.46  ? 37  TYR D N     1 
ATOM 2418  C CA    . TYR D 4 37  ? 271.657 273.642 269.193 1.00 37.46  ? 37  TYR D CA    1 
ATOM 2419  C C     . TYR D 4 37  ? 272.029 273.531 267.724 1.00 37.46  ? 37  TYR D C     1 
ATOM 2420  O O     . TYR D 4 37  ? 273.200 273.326 267.384 1.00 37.46  ? 37  TYR D O     1 
ATOM 2421  C CB    . TYR D 4 37  ? 271.012 272.354 269.692 1.00 37.46  ? 37  TYR D CB    1 
ATOM 2422  C CG    . TYR D 4 37  ? 270.454 272.482 271.083 1.00 37.46  ? 37  TYR D CG    1 
ATOM 2423  C CD1   . TYR D 4 37  ? 271.294 272.637 272.169 1.00 37.46  ? 37  TYR D CD1   1 
ATOM 2424  C CD2   . TYR D 4 37  ? 269.093 272.462 271.309 1.00 37.46  ? 37  TYR D CD2   1 
ATOM 2425  C CE1   . TYR D 4 37  ? 270.797 272.762 273.432 1.00 37.46  ? 37  TYR D CE1   1 
ATOM 2426  C CE2   . TYR D 4 37  ? 268.587 272.588 272.573 1.00 37.46  ? 37  TYR D CE2   1 
ATOM 2427  C CZ    . TYR D 4 37  ? 269.444 272.736 273.630 1.00 37.46  ? 37  TYR D CZ    1 
ATOM 2428  O OH    . TYR D 4 37  ? 268.945 272.861 274.897 1.00 37.46  ? 37  TYR D OH    1 
ATOM 2429  N N     . VAL D 4 38  ? 271.045 273.680 266.842 1.00 37.22  ? 38  VAL D N     1 
ATOM 2430  C CA    . VAL D 4 38  ? 271.323 273.735 265.414 1.00 37.22  ? 38  VAL D CA    1 
ATOM 2431  C C     . VAL D 4 38  ? 272.274 274.878 265.106 1.00 37.22  ? 38  VAL D C     1 
ATOM 2432  O O     . VAL D 4 38  ? 273.161 274.754 264.260 1.00 37.22  ? 38  VAL D O     1 
ATOM 2433  C CB    . VAL D 4 38  ? 270.011 273.861 264.622 1.00 37.22  ? 38  VAL D CB    1 
ATOM 2434  C CG1   . VAL D 4 38  ? 270.299 274.106 263.160 1.00 37.22  ? 38  VAL D CG1   1 
ATOM 2435  C CG2   . VAL D 4 38  ? 269.180 272.617 264.798 1.00 37.22  ? 38  VAL D CG2   1 
ATOM 2436  N N     . TYR D 4 39  ? 272.130 275.995 265.813 1.00 40.20  ? 39  TYR D N     1 
ATOM 2437  C CA    . TYR D 4 39  ? 272.991 277.138 265.554 1.00 40.20  ? 39  TYR D CA    1 
ATOM 2438  C C     . TYR D 4 39  ? 274.412 276.883 266.036 1.00 40.20  ? 39  TYR D C     1 
ATOM 2439  O O     . TYR D 4 39  ? 275.374 277.311 265.393 1.00 40.20  ? 39  TYR D O     1 
ATOM 2440  C CB    . TYR D 4 39  ? 272.408 278.384 266.207 1.00 40.20  ? 39  TYR D CB    1 
ATOM 2441  C CG    . TYR D 4 39  ? 272.974 279.654 265.654 1.00 40.20  ? 39  TYR D CG    1 
ATOM 2442  C CD1   . TYR D 4 39  ? 272.459 280.215 264.502 1.00 40.20  ? 39  TYR D CD1   1 
ATOM 2443  C CD2   . TYR D 4 39  ? 274.035 280.284 266.273 1.00 40.20  ? 39  TYR D CD2   1 
ATOM 2444  C CE1   . TYR D 4 39  ? 272.981 281.368 263.984 1.00 40.20  ? 39  TYR D CE1   1 
ATOM 2445  C CE2   . TYR D 4 39  ? 274.565 281.440 265.766 1.00 40.20  ? 39  TYR D CE2   1 
ATOM 2446  C CZ    . TYR D 4 39  ? 274.034 281.980 264.623 1.00 40.20  ? 39  TYR D CZ    1 
ATOM 2447  O OH    . TYR D 4 39  ? 274.560 283.138 264.112 1.00 40.20  ? 39  TYR D OH    1 
ATOM 2448  N N     . LYS D 4 40  ? 274.568 276.190 267.160 1.00 38.72  ? 40  LYS D N     1 
ATOM 2449  C CA    . LYS D 4 40  ? 275.906 275.803 267.594 1.00 38.72  ? 40  LYS D CA    1 
ATOM 2450  C C     . LYS D 4 40  ? 276.559 274.864 266.590 1.00 38.72  ? 40  LYS D C     1 
ATOM 2451  O O     . LYS D 4 40  ? 277.737 275.023 266.245 1.00 38.72  ? 40  LYS D O     1 
ATOM 2452  C CB    . LYS D 4 40  ? 275.841 275.152 268.968 1.00 38.72  ? 40  LYS D CB    1 
ATOM 2453  C CG    . LYS D 4 40  ? 275.596 276.111 270.098 1.00 38.72  ? 40  LYS D CG    1 
ATOM 2454  C CD    . LYS D 4 40  ? 275.157 275.359 271.330 1.00 38.72  ? 40  LYS D CD    1 
ATOM 2455  C CE    . LYS D 4 40  ? 274.976 276.286 272.505 1.00 38.72  ? 40  LYS D CE    1 
ATOM 2456  N NZ    . LYS D 4 40  ? 274.485 275.550 273.695 1.00 38.72  ? 40  LYS D NZ    1 
ATOM 2457  N N     . VAL D 4 41  ? 275.804 273.888 266.093 1.00 38.30  ? 41  VAL D N     1 
ATOM 2458  C CA    . VAL D 4 41  ? 276.351 272.982 265.091 1.00 38.30  ? 41  VAL D CA    1 
ATOM 2459  C C     . VAL D 4 41  ? 276.711 273.744 263.821 1.00 38.30  ? 41  VAL D C     1 
ATOM 2460  O O     . VAL D 4 41  ? 277.720 273.455 263.162 1.00 38.30  ? 41  VAL D O     1 
ATOM 2461  C CB    . VAL D 4 41  ? 275.357 271.844 264.819 1.00 38.30  ? 41  VAL D CB    1 
ATOM 2462  C CG1   . VAL D 4 41  ? 275.828 270.997 263.681 1.00 38.30  ? 41  VAL D CG1   1 
ATOM 2463  C CG2   . VAL D 4 41  ? 275.191 271.011 266.060 1.00 38.30  ? 41  VAL D CG2   1 
ATOM 2464  N N     . LEU D 4 42  ? 275.900 274.736 263.464 1.00 39.64  ? 42  LEU D N     1 
ATOM 2465  C CA    . LEU D 4 42  ? 276.190 275.539 262.286 1.00 39.64  ? 42  LEU D CA    1 
ATOM 2466  C C     . LEU D 4 42  ? 277.462 276.345 262.474 1.00 39.64  ? 42  LEU D C     1 
ATOM 2467  O O     . LEU D 4 42  ? 278.262 276.473 261.549 1.00 39.64  ? 42  LEU D O     1 
ATOM 2468  C CB    . LEU D 4 42  ? 275.020 276.465 261.976 1.00 39.64  ? 42  LEU D CB    1 
ATOM 2469  C CG    . LEU D 4 42  ? 275.308 277.430 260.834 1.00 39.64  ? 42  LEU D CG    1 
ATOM 2470  C CD1   . LEU D 4 42  ? 275.554 276.660 259.558 1.00 39.64  ? 42  LEU D CD1   1 
ATOM 2471  C CD2   . LEU D 4 42  ? 274.182 278.406 260.676 1.00 39.64  ? 42  LEU D CD2   1 
ATOM 2472  N N     . LYS D 4 43  ? 277.661 276.911 263.659 1.00 41.35  ? 43  LYS D N     1 
ATOM 2473  C CA    . LYS D 4 43  ? 278.893 277.644 263.896 1.00 41.35  ? 43  LYS D CA    1 
ATOM 2474  C C     . LYS D 4 43  ? 280.092 276.719 263.985 1.00 41.35  ? 43  LYS D C     1 
ATOM 2475  O O     . LYS D 4 43  ? 281.227 277.184 263.864 1.00 41.35  ? 43  LYS D O     1 
ATOM 2476  C CB    . LYS D 4 43  ? 278.775 278.496 265.154 1.00 41.35  ? 43  LYS D CB    1 
ATOM 2477  C CG    . LYS D 4 43  ? 277.875 279.696 264.953 1.00 41.35  ? 43  LYS D CG    1 
ATOM 2478  C CD    . LYS D 4 43  ? 278.078 280.266 263.561 1.00 41.35  ? 43  LYS D CD    1 
ATOM 2479  C CE    . LYS D 4 43  ? 277.201 281.465 263.307 1.00 41.35  ? 43  LYS D CE    1 
ATOM 2480  N NZ    . LYS D 4 43  ? 277.472 282.062 261.978 1.00 41.35  ? 43  LYS D NZ    1 
ATOM 2481  N N     . GLN D 4 44  ? 279.871 275.428 264.210 1.00 41.81  ? 44  GLN D N     1 
ATOM 2482  C CA    . GLN D 4 44  ? 280.981 274.486 264.122 1.00 41.81  ? 44  GLN D CA    1 
ATOM 2483  C C     . GLN D 4 44  ? 281.345 274.190 262.671 1.00 41.81  ? 44  GLN D C     1 
ATOM 2484  O O     . GLN D 4 44  ? 282.520 274.244 262.297 1.00 41.81  ? 44  GLN D O     1 
ATOM 2485  C CB    . GLN D 4 44  ? 280.649 273.198 264.868 1.00 41.81  ? 44  GLN D CB    1 
ATOM 2486  C CG    . GLN D 4 44  ? 280.900 273.268 266.358 1.00 41.81  ? 44  GLN D CG    1 
ATOM 2487  C CD    . GLN D 4 44  ? 280.445 272.019 267.078 1.00 41.81  ? 44  GLN D CD    1 
ATOM 2488  O OE1   . GLN D 4 44  ? 279.701 271.211 266.529 1.00 41.81  ? 44  GLN D OE1   1 
ATOM 2489  N NE2   . GLN D 4 44  ? 280.893 271.852 268.315 1.00 41.81  ? 44  GLN D NE2   1 
ATOM 2490  N N     . VAL D 4 45  ? 280.353 273.883 261.833 1.00 41.46  ? 45  VAL D N     1 
ATOM 2491  C CA    . VAL D 4 45  ? 280.687 273.441 260.477 1.00 41.46  ? 45  VAL D CA    1 
ATOM 2492  C C     . VAL D 4 45  ? 280.978 274.612 259.535 1.00 41.46  ? 45  VAL D C     1 
ATOM 2493  O O     . VAL D 4 45  ? 281.799 274.480 258.624 1.00 41.46  ? 45  VAL D O     1 
ATOM 2494  C CB    . VAL D 4 45  ? 279.587 272.531 259.900 1.00 41.46  ? 45  VAL D CB    1 
ATOM 2495  C CG1   . VAL D 4 45  ? 279.365 271.339 260.795 1.00 41.46  ? 45  VAL D CG1   1 
ATOM 2496  C CG2   . VAL D 4 45  ? 278.301 273.289 259.701 1.00 41.46  ? 45  VAL D CG2   1 
ATOM 2497  N N     . HIS D 4 46  ? 280.322 275.757 259.714 1.00 41.90  ? 46  HIS D N     1 
ATOM 2498  C CA    . HIS D 4 46  ? 280.545 276.940 258.884 1.00 41.90  ? 46  HIS D CA    1 
ATOM 2499  C C     . HIS D 4 46  ? 280.584 278.145 259.811 1.00 41.90  ? 46  HIS D C     1 
ATOM 2500  O O     . HIS D 4 46  ? 279.546 278.780 260.052 1.00 41.90  ? 46  HIS D O     1 
ATOM 2501  C CB    . HIS D 4 46  ? 279.457 277.118 257.831 1.00 41.90  ? 46  HIS D CB    1 
ATOM 2502  C CG    . HIS D 4 46  ? 279.493 276.108 256.733 1.00 41.90  ? 46  HIS D CG    1 
ATOM 2503  N ND1   . HIS D 4 46  ? 280.362 276.195 255.669 1.00 41.90  ? 46  HIS D ND1   1 
ATOM 2504  C CD2   . HIS D 4 46  ? 278.748 275.000 256.520 1.00 41.90  ? 46  HIS D CD2   1 
ATOM 2505  C CE1   . HIS D 4 46  ? 280.162 275.175 254.857 1.00 41.90  ? 46  HIS D CE1   1 
ATOM 2506  N NE2   . HIS D 4 46  ? 279.190 274.433 255.352 1.00 41.90  ? 46  HIS D NE2   1 
ATOM 2507  N N     . PRO D 4 47  ? 281.754 278.498 260.338 1.00 42.99  ? 47  PRO D N     1 
ATOM 2508  C CA    . PRO D 4 47  ? 281.802 279.526 261.389 1.00 42.99  ? 47  PRO D CA    1 
ATOM 2509  C C     . PRO D 4 47  ? 281.271 280.880 260.964 1.00 42.99  ? 47  PRO D C     1 
ATOM 2510  O O     . PRO D 4 47  ? 280.900 281.685 261.825 1.00 42.99  ? 47  PRO D O     1 
ATOM 2511  C CB    . PRO D 4 47  ? 283.293 279.595 261.732 1.00 42.99  ? 47  PRO D CB    1 
ATOM 2512  C CG    . PRO D 4 47  ? 283.819 278.269 261.348 1.00 42.99  ? 47  PRO D CG    1 
ATOM 2513  C CD    . PRO D 4 47  ? 283.065 277.871 260.124 1.00 42.99  ? 47  PRO D CD    1 
ATOM 2514  N N     . ASP D 4 48  ? 281.215 281.160 259.669 1.00 45.29  ? 48  ASP D N     1 
ATOM 2515  C CA    . ASP D 4 48  ? 280.804 282.467 259.188 1.00 45.29  ? 48  ASP D CA    1 
ATOM 2516  C C     . ASP D 4 48  ? 279.393 282.487 258.622 1.00 45.29  ? 48  ASP D C     1 
ATOM 2517  O O     . ASP D 4 48  ? 278.851 283.572 258.398 1.00 45.29  ? 48  ASP D O     1 
ATOM 2518  C CB    . ASP D 4 48  ? 281.782 282.953 258.118 1.00 45.29  ? 48  ASP D CB    1 
ATOM 2519  C CG    . ASP D 4 48  ? 282.010 281.920 257.040 1.00 45.29  ? 48  ASP D CG    1 
ATOM 2520  O OD1   . ASP D 4 48  ? 281.960 280.711 257.355 1.00 45.29  ? 48  ASP D OD1   1 
ATOM 2521  O OD2   . ASP D 4 48  ? 282.234 282.313 255.877 1.00 45.29  ? 48  ASP D OD2   1 
ATOM 2522  N N     . THR D 4 49  ? 278.787 281.329 258.396 1.00 44.27  ? 49  THR D N     1 
ATOM 2523  C CA    . THR D 4 49  ? 277.476 281.244 257.774 1.00 44.27  ? 49  THR D CA    1 
ATOM 2524  C C     . THR D 4 49  ? 276.381 281.395 258.819 1.00 44.27  ? 49  THR D C     1 
ATOM 2525  O O     . THR D 4 49  ? 276.500 280.894 259.938 1.00 44.27  ? 49  THR D O     1 
ATOM 2526  C CB    . THR D 4 49  ? 277.329 279.910 257.040 1.00 44.27  ? 49  THR D CB    1 
ATOM 2527  O OG1   . THR D 4 49  ? 278.279 279.841 255.973 1.00 44.27  ? 49  THR D OG1   1 
ATOM 2528  C CG2   . THR D 4 49  ? 275.943 279.748 256.469 1.00 44.27  ? 49  THR D CG2   1 
ATOM 2529  N N     . GLY D 4 50  ? 275.322 282.116 258.455 1.00 43.04  ? 50  GLY D N     1 
ATOM 2530  C CA    . GLY D 4 50  ? 274.133 282.218 259.268 1.00 43.04  ? 50  GLY D CA    1 
ATOM 2531  C C     . GLY D 4 50  ? 272.973 281.436 258.681 1.00 43.04  ? 50  GLY D C     1 
ATOM 2532  O O     . GLY D 4 50  ? 273.124 280.625 257.768 1.00 43.04  ? 50  GLY D O     1 
ATOM 2533  N N     . ILE D 4 51  ? 271.787 281.704 259.215 1.00 40.28  ? 51  ILE D N     1 
ATOM 2534  C CA    . ILE D 4 51  ? 270.603 280.949 258.830 1.00 40.28  ? 51  ILE D CA    1 
ATOM 2535  C C     . ILE D 4 51  ? 269.351 281.787 259.059 1.00 40.28  ? 51  ILE D C     1 
ATOM 2536  O O     . ILE D 4 51  ? 269.243 282.505 260.055 1.00 40.28  ? 51  ILE D O     1 
ATOM 2537  C CB    . ILE D 4 51  ? 270.546 279.612 259.596 1.00 40.28  ? 51  ILE D CB    1 
ATOM 2538  C CG1   . ILE D 4 51  ? 269.433 278.719 259.058 1.00 40.28  ? 51  ILE D CG1   1 
ATOM 2539  C CG2   . ILE D 4 51  ? 270.381 279.840 261.076 1.00 40.28  ? 51  ILE D CG2   1 
ATOM 2540  C CD1   . ILE D 4 51  ? 269.386 277.358 259.697 1.00 40.28  ? 51  ILE D CD1   1 
ATOM 2541  N N     . SER D 4 52  ? 268.403 281.708 258.136 1.00 38.64  ? 52  SER D N     1 
ATOM 2542  C CA    . SER D 4 52  ? 267.160 282.449 258.245 1.00 38.64  ? 52  SER D CA    1 
ATOM 2543  C C     . SER D 4 52  ? 266.192 281.753 259.196 1.00 38.64  ? 52  SER D C     1 
ATOM 2544  O O     . SER D 4 52  ? 266.367 280.591 259.560 1.00 38.64  ? 52  SER D O     1 
ATOM 2545  C CB    . SER D 4 52  ? 266.515 282.610 256.874 1.00 38.64  ? 52  SER D CB    1 
ATOM 2546  O OG    . SER D 4 52  ? 266.060 281.367 256.385 1.00 38.64  ? 52  SER D OG    1 
ATOM 2547  N N     . SER D 4 53  ? 265.156 282.485 259.602 1.00 38.12  ? 53  SER D N     1 
ATOM 2548  C CA    . SER D 4 53  ? 264.162 281.906 260.495 1.00 38.12  ? 53  SER D CA    1 
ATOM 2549  C C     . SER D 4 53  ? 263.413 280.760 259.832 1.00 38.12  ? 53  SER D C     1 
ATOM 2550  O O     . SER D 4 53  ? 263.099 279.766 260.492 1.00 38.12  ? 53  SER D O     1 
ATOM 2551  C CB    . SER D 4 53  ? 263.182 282.976 260.960 1.00 38.12  ? 53  SER D CB    1 
ATOM 2552  O OG    . SER D 4 53  ? 262.451 283.491 259.869 1.00 38.12  ? 53  SER D OG    1 
ATOM 2553  N N     . LYS D 4 54  ? 263.139 280.863 258.534 1.00 36.29  ? 54  LYS D N     1 
ATOM 2554  C CA    . LYS D 4 54  ? 262.453 279.779 257.841 1.00 36.29  ? 54  LYS D CA    1 
ATOM 2555  C C     . LYS D 4 54  ? 263.341 278.550 257.707 1.00 36.29  ? 54  LYS D C     1 
ATOM 2556  O O     . LYS D 4 54  ? 262.880 277.418 257.889 1.00 36.29  ? 54  LYS D O     1 
ATOM 2557  C CB    . LYS D 4 54  ? 261.977 280.260 256.476 1.00 36.29  ? 54  LYS D CB    1 
ATOM 2558  C CG    . LYS D 4 54  ? 260.522 280.642 256.448 1.00 36.29  ? 54  LYS D CG    1 
ATOM 2559  C CD    . LYS D 4 54  ? 259.659 279.408 256.598 1.00 36.29  ? 54  LYS D CD    1 
ATOM 2560  C CE    . LYS D 4 54  ? 258.186 279.730 256.407 1.00 36.29  ? 54  LYS D CE    1 
ATOM 2561  N NZ    . LYS D 4 54  ? 257.418 278.509 256.048 1.00 36.29  ? 54  LYS D NZ    1 
ATOM 2562  N N     . ALA D 4 55  ? 264.625 278.746 257.415 1.00 35.41  ? 55  ALA D N     1 
ATOM 2563  C CA    . ALA D 4 55  ? 265.524 277.604 257.337 1.00 35.41  ? 55  ALA D CA    1 
ATOM 2564  C C     . ALA D 4 55  ? 265.729 276.969 258.703 1.00 35.41  ? 55  ALA D C     1 
ATOM 2565  O O     . ALA D 4 55  ? 265.849 275.746 258.805 1.00 35.41  ? 55  ALA D O     1 
ATOM 2566  C CB    . ALA D 4 55  ? 266.857 278.019 256.727 1.00 35.41  ? 55  ALA D CB    1 
ATOM 2567  N N     . MET D 4 56  ? 265.742 277.777 259.761 1.00 35.42  ? 56  MET D N     1 
ATOM 2568  C CA    . MET D 4 56  ? 265.825 277.235 261.109 1.00 35.42  ? 56  MET D CA    1 
ATOM 2569  C C     . MET D 4 56  ? 264.569 276.459 261.471 1.00 35.42  ? 56  MET D C     1 
ATOM 2570  O O     . MET D 4 56  ? 264.644 275.441 262.159 1.00 35.42  ? 56  MET D O     1 
ATOM 2571  C CB    . MET D 4 56  ? 266.060 278.355 262.115 1.00 35.42  ? 56  MET D CB    1 
ATOM 2572  C CG    . MET D 4 56  ? 266.089 277.877 263.543 1.00 35.42  ? 56  MET D CG    1 
ATOM 2573  S SD    . MET D 4 56  ? 267.380 276.660 263.823 1.00 35.42  ? 56  MET D SD    1 
ATOM 2574  C CE    . MET D 4 56  ? 268.814 277.719 263.930 1.00 35.42  ? 56  MET D CE    1 
ATOM 2575  N N     . SER D 4 57  ? 263.405 276.925 261.022 1.00 34.74  ? 57  SER D N     1 
ATOM 2576  C CA    . SER D 4 57  ? 262.176 276.175 261.246 1.00 34.74  ? 57  SER D CA    1 
ATOM 2577  C C     . SER D 4 57  ? 262.226 274.827 260.548 1.00 34.74  ? 57  SER D C     1 
ATOM 2578  O O     . SER D 4 57  ? 261.807 273.807 261.107 1.00 34.74  ? 57  SER D O     1 
ATOM 2579  C CB    . SER D 4 57  ? 260.981 276.988 260.760 1.00 34.74  ? 57  SER D CB    1 
ATOM 2580  O OG    . SER D 4 57  ? 259.802 276.219 260.777 1.00 34.74  ? 57  SER D OG    1 
ATOM 2581  N N     . ILE D 4 58  ? 262.749 274.803 259.324 1.00 33.78  ? 58  ILE D N     1 
ATOM 2582  C CA    . ILE D 4 58  ? 262.913 273.541 258.615 1.00 33.78  ? 58  ILE D CA    1 
ATOM 2583  C C     . ILE D 4 58  ? 263.862 272.624 259.371 1.00 33.78  ? 58  ILE D C     1 
ATOM 2584  O O     . ILE D 4 58  ? 263.603 271.428 259.517 1.00 33.78  ? 58  ILE D O     1 
ATOM 2585  C CB    . ILE D 4 58  ? 263.397 273.803 257.181 1.00 33.78  ? 58  ILE D CB    1 
ATOM 2586  C CG1   . ILE D 4 58  ? 262.280 274.462 256.386 1.00 33.78  ? 58  ILE D CG1   1 
ATOM 2587  C CG2   . ILE D 4 58  ? 263.869 272.525 256.520 1.00 33.78  ? 58  ILE D CG2   1 
ATOM 2588  C CD1   . ILE D 4 58  ? 262.756 275.130 255.178 1.00 33.78  ? 58  ILE D CD1   1 
ATOM 2589  N N     . MET D 4 59  ? 264.973 273.168 259.860 1.00 34.07  ? 59  MET D N     1 
ATOM 2590  C CA    . MET D 4 59  ? 265.920 272.347 260.604 1.00 34.07  ? 59  MET D CA    1 
ATOM 2591  C C     . MET D 4 59  ? 265.294 271.791 261.874 1.00 34.07  ? 59  MET D C     1 
ATOM 2592  O O     . MET D 4 59  ? 265.517 270.629 262.225 1.00 34.07  ? 59  MET D O     1 
ATOM 2593  C CB    . MET D 4 59  ? 267.173 273.150 260.930 1.00 34.07  ? 59  MET D CB    1 
ATOM 2594  C CG    . MET D 4 59  ? 268.020 273.482 259.726 1.00 34.07  ? 59  MET D CG    1 
ATOM 2595  S SD    . MET D 4 59  ? 268.346 272.059 258.688 1.00 34.07  ? 59  MET D SD    1 
ATOM 2596  C CE    . MET D 4 59  ? 269.240 271.020 259.823 1.00 34.07  ? 59  MET D CE    1 
ATOM 2597  N N     . ASN D 4 60  ? 264.511 272.606 262.576 1.00 34.10  ? 60  ASN D N     1 
ATOM 2598  C CA    . ASN D 4 60  ? 263.856 272.141 263.788 1.00 34.10  ? 60  ASN D CA    1 
ATOM 2599  C C     . ASN D 4 60  ? 262.880 271.016 263.484 1.00 34.10  ? 60  ASN D C     1 
ATOM 2600  O O     . ASN D 4 60  ? 262.863 269.997 264.184 1.00 34.10  ? 60  ASN D O     1 
ATOM 2601  C CB    . ASN D 4 60  ? 263.145 273.297 264.482 1.00 34.10  ? 60  ASN D CB    1 
ATOM 2602  C CG    . ASN D 4 60  ? 262.588 272.904 265.821 1.00 34.10  ? 60  ASN D CG    1 
ATOM 2603  O OD1   . ASN D 4 60  ? 263.321 272.473 266.702 1.00 34.10  ? 60  ASN D OD1   1 
ATOM 2604  N ND2   . ASN D 4 60  ? 261.284 273.047 265.986 1.00 34.10  ? 60  ASN D ND2   1 
ATOM 2605  N N     . SER D 4 61  ? 262.066 271.174 262.440 1.00 33.11  ? 61  SER D N     1 
ATOM 2606  C CA    . SER D 4 61  ? 261.151 270.100 262.082 1.00 33.11  ? 61  SER D CA    1 
ATOM 2607  C C     . SER D 4 61  ? 261.899 268.857 261.620 1.00 33.11  ? 61  SER D C     1 
ATOM 2608  O O     . SER D 4 61  ? 261.439 267.743 261.860 1.00 33.11  ? 61  SER D O     1 
ATOM 2609  C CB    . SER D 4 61  ? 260.172 270.561 261.010 1.00 33.11  ? 61  SER D CB    1 
ATOM 2610  O OG    . SER D 4 61  ? 260.760 270.488 259.735 1.00 33.11  ? 61  SER D OG    1 
ATOM 2611  N N     . PHE D 4 62  ? 263.051 269.020 260.972 1.00 33.06  ? 62  PHE D N     1 
ATOM 2612  C CA    . PHE D 4 62  ? 263.845 267.861 260.581 1.00 33.06  ? 62  PHE D CA    1 
ATOM 2613  C C     . PHE D 4 62  ? 264.349 267.101 261.799 1.00 33.06  ? 62  PHE D C     1 
ATOM 2614  O O     . PHE D 4 62  ? 264.288 265.868 261.839 1.00 33.06  ? 62  PHE D O     1 
ATOM 2615  C CB    . PHE D 4 62  ? 265.016 268.290 259.700 1.00 33.06  ? 62  PHE D CB    1 
ATOM 2616  C CG    . PHE D 4 62  ? 266.066 267.234 259.538 1.00 33.06  ? 62  PHE D CG    1 
ATOM 2617  C CD1   . PHE D 4 62  ? 265.859 266.148 258.707 1.00 33.06  ? 62  PHE D CD1   1 
ATOM 2618  C CD2   . PHE D 4 62  ? 267.265 267.330 260.210 1.00 33.06  ? 62  PHE D CD2   1 
ATOM 2619  C CE1   . PHE D 4 62  ? 266.819 265.181 258.565 1.00 33.06  ? 62  PHE D CE1   1 
ATOM 2620  C CE2   . PHE D 4 62  ? 268.229 266.364 260.068 1.00 33.06  ? 62  PHE D CE2   1 
ATOM 2621  C CZ    . PHE D 4 62  ? 268.006 265.288 259.246 1.00 33.06  ? 62  PHE D CZ    1 
ATOM 2622  N N     . VAL D 4 63  ? 264.877 267.821 262.790 1.00 33.13  ? 63  VAL D N     1 
ATOM 2623  C CA    . VAL D 4 63  ? 265.339 267.168 264.011 1.00 33.13  ? 63  VAL D CA    1 
ATOM 2624  C C     . VAL D 4 63  ? 264.190 266.442 264.695 1.00 33.13  ? 63  VAL D C     1 
ATOM 2625  O O     . VAL D 4 63  ? 264.331 265.289 265.109 1.00 33.13  ? 63  VAL D O     1 
ATOM 2626  C CB    . VAL D 4 63  ? 266.001 268.184 264.957 1.00 33.13  ? 63  VAL D CB    1 
ATOM 2627  C CG1   . VAL D 4 63  ? 266.303 267.533 266.281 1.00 33.13  ? 63  VAL D CG1   1 
ATOM 2628  C CG2   . VAL D 4 63  ? 267.257 268.737 264.344 1.00 33.13  ? 63  VAL D CG2   1 
ATOM 2629  N N     . ASN D 4 64  ? 263.037 267.100 264.820 1.00 33.19  ? 64  ASN D N     1 
ATOM 2630  C CA    . ASN D 4 64  ? 261.886 266.448 265.439 1.00 33.19  ? 64  ASN D CA    1 
ATOM 2631  C C     . ASN D 4 64  ? 261.467 265.200 264.674 1.00 33.19  ? 64  ASN D C     1 
ATOM 2632  O O     . ASN D 4 64  ? 261.142 264.174 265.278 1.00 33.19  ? 64  ASN D O     1 
ATOM 2633  C CB    . ASN D 4 64  ? 260.721 267.423 265.536 1.00 33.19  ? 64  ASN D CB    1 
ATOM 2634  C CG    . ASN D 4 64  ? 260.848 268.358 266.704 1.00 33.19  ? 64  ASN D CG    1 
ATOM 2635  O OD1   . ASN D 4 64  ? 261.037 267.929 267.834 1.00 33.19  ? 64  ASN D OD1   1 
ATOM 2636  N ND2   . ASN D 4 64  ? 260.760 269.646 266.439 1.00 33.19  ? 64  ASN D ND2   1 
ATOM 2637  N N     . ASP D 4 65  ? 261.467 265.267 263.347 1.00 34.00  ? 65  ASP D N     1 
ATOM 2638  C CA    . ASP D 4 65  ? 261.046 264.132 262.538 1.00 34.00  ? 65  ASP D CA    1 
ATOM 2639  C C     . ASP D 4 65  ? 261.997 262.958 262.713 1.00 34.00  ? 65  ASP D C     1 
ATOM 2640  O O     . ASP D 4 65  ? 261.566 261.813 262.879 1.00 34.00  ? 65  ASP D O     1 
ATOM 2641  C CB    . ASP D 4 65  ? 260.965 264.563 261.075 1.00 34.00  ? 65  ASP D CB    1 
ATOM 2642  C CG    . ASP D 4 65  ? 260.511 263.457 260.153 1.00 34.00  ? 65  ASP D CG    1 
ATOM 2643  O OD1   . ASP D 4 65  ? 259.898 262.483 260.628 1.00 34.00  ? 65  ASP D OD1   1 
ATOM 2644  O OD2   . ASP D 4 65  ? 260.761 263.564 258.939 1.00 34.00  ? 65  ASP D OD2   1 
ATOM 2645  N N     . VAL D 4 66  ? 263.300 263.222 262.673 1.00 33.26  ? 66  VAL D N     1 
ATOM 2646  C CA    . VAL D 4 66  ? 264.266 262.144 262.830 1.00 33.26  ? 66  VAL D CA    1 
ATOM 2647  C C     . VAL D 4 66  ? 264.171 261.550 264.225 1.00 33.26  ? 66  VAL D C     1 
ATOM 2648  O O     . VAL D 4 66  ? 264.239 260.329 264.399 1.00 33.26  ? 66  VAL D O     1 
ATOM 2649  C CB    . VAL D 4 66  ? 265.685 262.646 262.512 1.00 33.26  ? 66  VAL D CB    1 
ATOM 2650  C CG1   . VAL D 4 66  ? 266.704 261.611 262.880 1.00 33.26  ? 66  VAL D CG1   1 
ATOM 2651  C CG2   . VAL D 4 66  ? 265.800 262.944 261.045 1.00 33.26  ? 66  VAL D CG2   1 
ATOM 2652  N N     . PHE D 4 67  ? 264.017 262.401 265.240 1.00 33.22  ? 67  PHE D N     1 
ATOM 2653  C CA    . PHE D 4 67  ? 263.829 261.903 266.593 1.00 33.22  ? 67  PHE D CA    1 
ATOM 2654  C C     . PHE D 4 67  ? 262.633 260.970 266.653 1.00 33.22  ? 67  PHE D C     1 
ATOM 2655  O O     . PHE D 4 67  ? 262.712 259.882 267.226 1.00 33.22  ? 67  PHE D O     1 
ATOM 2656  C CB    . PHE D 4 67  ? 263.652 263.072 267.566 1.00 33.22  ? 67  PHE D CB    1 
ATOM 2657  C CG    . PHE D 4 67  ? 263.380 262.654 268.984 1.00 33.22  ? 67  PHE D CG    1 
ATOM 2658  C CD1   . PHE D 4 67  ? 262.125 262.223 269.372 1.00 33.22  ? 67  PHE D CD1   1 
ATOM 2659  C CD2   . PHE D 4 67  ? 264.374 262.700 269.930 1.00 33.22  ? 67  PHE D CD2   1 
ATOM 2660  C CE1   . PHE D 4 67  ? 261.881 261.826 270.661 1.00 33.22  ? 67  PHE D CE1   1 
ATOM 2661  C CE2   . PHE D 4 67  ? 264.126 262.314 271.225 1.00 33.22  ? 67  PHE D CE2   1 
ATOM 2662  C CZ    . PHE D 4 67  ? 262.880 261.875 271.587 1.00 33.22  ? 67  PHE D CZ    1 
ATOM 2663  N N     . GLU D 4 68  ? 261.511 261.387 266.067 1.00 34.78  ? 68  GLU D N     1 
ATOM 2664  C CA    . GLU D 4 68  ? 260.309 260.568 266.117 1.00 34.78  ? 68  GLU D CA    1 
ATOM 2665  C C     . GLU D 4 68  ? 260.521 259.238 265.420 1.00 34.78  ? 68  GLU D C     1 
ATOM 2666  O O     . GLU D 4 68  ? 260.111 258.196 265.933 1.00 34.78  ? 68  GLU D O     1 
ATOM 2667  C CB    . GLU D 4 68  ? 259.132 261.310 265.496 1.00 34.78  ? 68  GLU D CB    1 
ATOM 2668  C CG    . GLU D 4 68  ? 258.530 262.362 266.392 1.00 34.78  ? 68  GLU D CG    1 
ATOM 2669  C CD    . GLU D 4 68  ? 257.402 263.124 265.720 1.00 34.78  ? 68  GLU D CD    1 
ATOM 2670  O OE1   . GLU D 4 68  ? 257.396 263.208 264.472 1.00 34.78  ? 68  GLU D OE1   1 
ATOM 2671  O OE2   . GLU D 4 68  ? 256.520 263.637 266.439 1.00 34.78  ? 68  GLU D OE2   1 
ATOM 2672  N N     . ARG D 4 69  ? 261.166 259.251 264.256 1.00 34.10  ? 69  ARG D N     1 
ATOM 2673  C CA    . ARG D 4 69  ? 261.415 258.004 263.542 1.00 34.10  ? 69  ARG D CA    1 
ATOM 2674  C C     . ARG D 4 69  ? 262.279 257.061 264.363 1.00 34.10  ? 69  ARG D C     1 
ATOM 2675  O O     . ARG D 4 69  ? 261.951 255.878 264.521 1.00 34.10  ? 69  ARG D O     1 
ATOM 2676  C CB    . ARG D 4 69  ? 262.075 258.288 262.200 1.00 34.10  ? 69  ARG D CB    1 
ATOM 2677  C CG    . ARG D 4 69  ? 261.159 258.865 261.167 1.00 34.10  ? 69  ARG D CG    1 
ATOM 2678  C CD    . ARG D 4 69  ? 261.811 258.784 259.817 1.00 34.10  ? 69  ARG D CD    1 
ATOM 2679  N NE    . ARG D 4 69  ? 261.745 260.047 259.107 1.00 34.10  ? 69  ARG D NE    1 
ATOM 2680  C CZ    . ARG D 4 69  ? 262.258 260.244 257.903 1.00 34.10  ? 69  ARG D CZ    1 
ATOM 2681  N NH1   . ARG D 4 69  ? 262.880 259.257 257.280 1.00 34.10  ? 69  ARG D NH1   1 
ATOM 2682  N NH2   . ARG D 4 69  ? 262.157 261.429 257.329 1.00 34.10  ? 69  ARG D NH2   1 
ATOM 2683  N N     . ILE D 4 70  ? 263.388 257.568 264.902 1.00 33.06  ? 70  ILE D N     1 
ATOM 2684  C CA    . ILE D 4 70  ? 264.315 256.704 265.622 1.00 33.06  ? 70  ILE D CA    1 
ATOM 2685  C C     . ILE D 4 70  ? 263.677 256.182 266.895 1.00 33.06  ? 70  ILE D C     1 
ATOM 2686  O O     . ILE D 4 70  ? 263.832 255.009 267.241 1.00 33.06  ? 70  ILE D O     1 
ATOM 2687  C CB    . ILE D 4 70  ? 265.633 257.440 265.912 1.00 33.06  ? 70  ILE D CB    1 
ATOM 2688  C CG1   . ILE D 4 70  ? 266.362 257.742 264.613 1.00 33.06  ? 70  ILE D CG1   1 
ATOM 2689  C CG2   . ILE D 4 70  ? 266.513 256.601 266.803 1.00 33.06  ? 70  ILE D CG2   1 
ATOM 2690  C CD1   . ILE D 4 70  ? 267.574 258.592 264.800 1.00 33.06  ? 70  ILE D CD1   1 
ATOM 2691  N N     . ALA D 4 71  ? 262.928 257.028 267.596 1.00 33.99  ? 71  ALA D N     1 
ATOM 2692  C CA    . ALA D 4 71  ? 262.311 256.601 268.841 1.00 33.99  ? 71  ALA D CA    1 
ATOM 2693  C C     . ALA D 4 71  ? 261.176 255.625 268.587 1.00 33.99  ? 71  ALA D C     1 
ATOM 2694  O O     . ALA D 4 71  ? 260.993 254.678 269.351 1.00 33.99  ? 71  ALA D O     1 
ATOM 2695  C CB    . ALA D 4 71  ? 261.820 257.813 269.622 1.00 33.99  ? 71  ALA D CB    1 
ATOM 2696  N N     . GLY D 4 72  ? 260.408 255.825 267.517 1.00 34.25  ? 72  GLY D N     1 
ATOM 2697  C CA    . GLY D 4 72  ? 259.388 254.857 267.170 1.00 34.25  ? 72  GLY D CA    1 
ATOM 2698  C C     . GLY D 4 72  ? 259.977 253.505 266.833 1.00 34.25  ? 72  GLY D C     1 
ATOM 2699  O O     . GLY D 4 72  ? 259.473 252.470 267.277 1.00 34.25  ? 72  GLY D O     1 
ATOM 2700  N N     . GLU D 4 73  ? 261.062 253.491 266.060 1.00 35.10  ? 73  GLU D N     1 
ATOM 2701  C CA    . GLU D 4 73  ? 261.676 252.216 265.723 1.00 35.10  ? 73  GLU D CA    1 
ATOM 2702  C C     . GLU D 4 73  ? 262.286 251.553 266.951 1.00 35.10  ? 73  GLU D C     1 
ATOM 2703  O O     . GLU D 4 73  ? 262.171 250.339 267.120 1.00 35.10  ? 73  GLU D O     1 
ATOM 2704  C CB    . GLU D 4 73  ? 262.723 252.398 264.628 1.00 35.10  ? 73  GLU D CB    1 
ATOM 2705  C CG    . GLU D 4 73  ? 263.163 251.094 264.000 1.00 35.10  ? 73  GLU D CG    1 
ATOM 2706  C CD    . GLU D 4 73  ? 261.996 250.270 263.481 1.00 35.10  ? 73  GLU D CD    1 
ATOM 2707  O OE1   . GLU D 4 73  ? 261.242 250.780 262.627 1.00 35.10  ? 73  GLU D OE1   1 
ATOM 2708  O OE2   . GLU D 4 73  ? 261.821 249.119 263.934 1.00 35.10  ? 73  GLU D OE2   1 
ATOM 2709  N N     . ALA D 4 74  ? 262.922 252.329 267.827 1.00 34.34  ? 74  ALA D N     1 
ATOM 2710  C CA    . ALA D 4 74  ? 263.496 251.754 269.039 1.00 34.34  ? 74  ALA D CA    1 
ATOM 2711  C C     . ALA D 4 74  ? 262.412 251.218 269.962 1.00 34.34  ? 74  ALA D C     1 
ATOM 2712  O O     . ALA D 4 74  ? 262.574 250.155 270.570 1.00 34.34  ? 74  ALA D O     1 
ATOM 2713  C CB    . ALA D 4 74  ? 264.349 252.794 269.754 1.00 34.34  ? 74  ALA D CB    1 
ATOM 2714  N N     . SER D 4 75  ? 261.296 251.936 270.067 1.00 34.31  ? 75  SER D N     1 
ATOM 2715  C CA    . SER D 4 75  ? 260.148 251.457 270.821 1.00 34.31  ? 75  SER D CA    1 
ATOM 2716  C C     . SER D 4 75  ? 259.666 250.119 270.285 1.00 34.31  ? 75  SER D C     1 
ATOM 2717  O O     . SER D 4 75  ? 259.511 249.151 271.039 1.00 34.31  ? 75  SER D O     1 
ATOM 2718  C CB    . SER D 4 75  ? 259.035 252.497 270.752 1.00 34.31  ? 75  SER D CB    1 
ATOM 2719  O OG    . SER D 4 75  ? 257.912 252.101 271.502 1.00 34.31  ? 75  SER D OG    1 
ATOM 2720  N N     . ARG D 4 76  ? 259.431 250.048 268.974 1.00 35.20  ? 76  ARG D N     1 
ATOM 2721  C CA    . ARG D 4 76  ? 258.973 248.802 268.371 1.00 35.20  ? 76  ARG D CA    1 
ATOM 2722  C C     . ARG D 4 76  ? 259.974 247.679 268.592 1.00 35.20  ? 76  ARG D C     1 
ATOM 2723  O O     . ARG D 4 76  ? 259.589 246.550 268.904 1.00 35.20  ? 76  ARG D O     1 
ATOM 2724  C CB    . ARG D 4 76  ? 258.715 249.010 266.883 1.00 35.20  ? 76  ARG D CB    1 
ATOM 2725  C CG    . ARG D 4 76  ? 257.297 249.388 266.570 1.00 35.20  ? 76  ARG D CG    1 
ATOM 2726  C CD    . ARG D 4 76  ? 257.104 249.683 265.099 1.00 35.20  ? 76  ARG D CD    1 
ATOM 2727  N NE    . ARG D 4 76  ? 257.040 251.116 264.844 1.00 35.20  ? 76  ARG D NE    1 
ATOM 2728  C CZ    . ARG D 4 76  ? 257.925 251.785 264.117 1.00 35.20  ? 76  ARG D CZ    1 
ATOM 2729  N NH1   . ARG D 4 76  ? 258.941 251.148 263.561 1.00 35.20  ? 76  ARG D NH1   1 
ATOM 2730  N NH2   . ARG D 4 76  ? 257.789 253.088 263.940 1.00 35.20  ? 76  ARG D NH2   1 
ATOM 2731  N N     . LEU D 4 77  ? 261.264 247.974 268.455 1.00 34.91  ? 77  LEU D N     1 
ATOM 2732  C CA    . LEU D 4 77  ? 262.294 246.979 268.725 1.00 34.91  ? 77  LEU D CA    1 
ATOM 2733  C C     . LEU D 4 77  ? 262.177 246.432 270.135 1.00 34.91  ? 77  LEU D C     1 
ATOM 2734  O O     . LEU D 4 77  ? 262.283 245.222 270.352 1.00 34.91  ? 77  LEU D O     1 
ATOM 2735  C CB    . LEU D 4 77  ? 263.675 247.584 268.521 1.00 34.91  ? 77  LEU D CB    1 
ATOM 2736  C CG    . LEU D 4 77  ? 264.180 247.677 267.100 1.00 34.91  ? 77  LEU D CG    1 
ATOM 2737  C CD1   . LEU D 4 77  ? 265.348 248.613 267.086 1.00 34.91  ? 77  LEU D CD1   1 
ATOM 2738  C CD2   . LEU D 4 77  ? 264.582 246.306 266.624 1.00 34.91  ? 77  LEU D CD2   1 
ATOM 2739  N N     . ALA D 4 78  ? 261.989 247.314 271.115 1.00 35.72  ? 78  ALA D N     1 
ATOM 2740  C CA    . ALA D 4 78  ? 261.860 246.852 272.490 1.00 35.72  ? 78  ALA D CA    1 
ATOM 2741  C C     . ALA D 4 78  ? 260.622 245.988 272.654 1.00 35.72  ? 78  ALA D C     1 
ATOM 2742  O O     . ALA D 4 78  ? 260.631 245.014 273.412 1.00 35.72  ? 78  ALA D O     1 
ATOM 2743  C CB    . ALA D 4 78  ? 261.820 248.040 273.447 1.00 35.72  ? 78  ALA D CB    1 
ATOM 2744  N N     . HIS D 4 79  ? 259.552 246.327 271.942 1.00 36.89  ? 79  HIS D N     1 
ATOM 2745  C CA    . HIS D 4 79  ? 258.331 245.539 272.018 1.00 36.89  ? 79  HIS D CA    1 
ATOM 2746  C C     . HIS D 4 79  ? 258.504 244.164 271.378 1.00 36.89  ? 79  HIS D C     1 
ATOM 2747  O O     . HIS D 4 79  ? 258.106 243.153 271.963 1.00 36.89  ? 79  HIS D O     1 
ATOM 2748  C CB    . HIS D 4 79  ? 257.191 246.302 271.357 1.00 36.89  ? 79  HIS D CB    1 
ATOM 2749  C CG    . HIS D 4 79  ? 255.849 245.688 271.578 1.00 36.89  ? 79  HIS D CG    1 
ATOM 2750  N ND1   . HIS D 4 79  ? 255.158 245.823 272.761 1.00 36.89  ? 79  HIS D ND1   1 
ATOM 2751  C CD2   . HIS D 4 79  ? 255.070 244.932 270.770 1.00 36.89  ? 79  HIS D CD2   1 
ATOM 2752  C CE1   . HIS D 4 79  ? 254.010 245.177 272.672 1.00 36.89  ? 79  HIS D CE1   1 
ATOM 2753  N NE2   . HIS D 4 79  ? 253.932 244.628 271.473 1.00 36.89  ? 79  HIS D NE2   1 
ATOM 2754  N N     . TYR D 4 80  ? 259.093 244.104 270.181 1.00 35.98  ? 80  TYR D N     1 
ATOM 2755  C CA    . TYR D 4 80  ? 259.280 242.821 269.510 1.00 35.98  ? 80  TYR D CA    1 
ATOM 2756  C C     . TYR D 4 80  ? 260.078 241.854 270.361 1.00 35.98  ? 80  TYR D C     1 
ATOM 2757  O O     . TYR D 4 80  ? 259.847 240.643 270.307 1.00 35.98  ? 80  TYR D O     1 
ATOM 2758  C CB    . TYR D 4 80  ? 259.996 243.002 268.176 1.00 35.98  ? 80  TYR D CB    1 
ATOM 2759  C CG    . TYR D 4 80  ? 259.258 243.811 267.148 1.00 35.98  ? 80  TYR D CG    1 
ATOM 2760  C CD1   . TYR D 4 80  ? 257.885 243.962 267.203 1.00 35.98  ? 80  TYR D CD1   1 
ATOM 2761  C CD2   . TYR D 4 80  ? 259.943 244.427 266.115 1.00 35.98  ? 80  TYR D CD2   1 
ATOM 2762  C CE1   . TYR D 4 80  ? 257.221 244.707 266.261 1.00 35.98  ? 80  TYR D CE1   1 
ATOM 2763  C CE2   . TYR D 4 80  ? 259.287 245.162 265.171 1.00 35.98  ? 80  TYR D CE2   1 
ATOM 2764  C CZ    . TYR D 4 80  ? 257.930 245.300 265.246 1.00 35.98  ? 80  TYR D CZ    1 
ATOM 2765  O OH    . TYR D 4 80  ? 257.281 246.044 264.296 1.00 35.98  ? 80  TYR D OH    1 
ATOM 2766  N N     . ASN D 4 81  ? 261.022 242.364 271.141 1.00 36.90  ? 81  ASN D N     1 
ATOM 2767  C CA    . ASN D 4 81  ? 261.886 241.539 271.963 1.00 36.90  ? 81  ASN D CA    1 
ATOM 2768  C C     . ASN D 4 81  ? 261.427 241.475 273.404 1.00 36.90  ? 81  ASN D C     1 
ATOM 2769  O O     . ASN D 4 81  ? 262.187 241.025 274.264 1.00 36.90  ? 81  ASN D O     1 
ATOM 2770  C CB    . ASN D 4 81  ? 263.319 242.047 271.882 1.00 36.90  ? 81  ASN D CB    1 
ATOM 2771  C CG    . ASN D 4 81  ? 263.943 241.769 270.544 1.00 36.90  ? 81  ASN D CG    1 
ATOM 2772  O OD1   . ASN D 4 81  ? 264.429 240.674 270.300 1.00 36.90  ? 81  ASN D OD1   1 
ATOM 2773  N ND2   . ASN D 4 81  ? 263.929 242.755 269.664 1.00 36.90  ? 81  ASN D ND2   1 
ATOM 2774  N N     . LYS D 4 82  ? 260.198 241.902 273.677 1.00 38.81  ? 82  LYS D N     1 
ATOM 2775  C CA    . LYS D 4 82  ? 259.608 241.848 275.011 1.00 38.81  ? 82  LYS D CA    1 
ATOM 2776  C C     . LYS D 4 82  ? 260.520 242.483 276.053 1.00 38.81  ? 82  LYS D C     1 
ATOM 2777  O O     . LYS D 4 82  ? 260.760 241.921 277.119 1.00 38.81  ? 82  LYS D O     1 
ATOM 2778  C CB    . LYS D 4 82  ? 259.250 240.415 275.392 1.00 38.81  ? 82  LYS D CB    1 
ATOM 2779  C CG    . LYS D 4 82  ? 258.212 239.798 274.482 1.00 38.81  ? 82  LYS D CG    1 
ATOM 2780  C CD    . LYS D 4 82  ? 258.175 238.303 274.649 1.00 38.81  ? 82  LYS D CD    1 
ATOM 2781  C CE    . LYS D 4 82  ? 259.575 237.725 274.538 1.00 38.81  ? 82  LYS D CE    1 
ATOM 2782  N NZ    . LYS D 4 82  ? 259.632 236.304 274.964 1.00 38.81  ? 82  LYS D NZ    1 
ATOM 2783  N N     . ARG D 4 83  ? 261.034 243.663 275.740 1.00 40.93  ? 83  ARG D N     1 
ATOM 2784  C CA    . ARG D 4 83  ? 261.842 244.440 276.660 1.00 40.93  ? 83  ARG D CA    1 
ATOM 2785  C C     . ARG D 4 83  ? 261.050 245.637 277.157 1.00 40.93  ? 83  ARG D C     1 
ATOM 2786  O O     . ARG D 4 83  ? 260.141 246.131 276.492 1.00 40.93  ? 83  ARG D O     1 
ATOM 2787  C CB    . ARG D 4 83  ? 263.137 244.912 275.998 1.00 40.93  ? 83  ARG D CB    1 
ATOM 2788  C CG    . ARG D 4 83  ? 264.101 243.800 275.717 1.00 40.93  ? 83  ARG D CG    1 
ATOM 2789  C CD    . ARG D 4 83  ? 264.472 243.105 277.001 1.00 40.93  ? 83  ARG D CD    1 
ATOM 2790  N NE    . ARG D 4 83  ? 265.030 241.782 276.766 1.00 40.93  ? 83  ARG D NE    1 
ATOM 2791  C CZ    . ARG D 4 83  ? 266.323 241.536 276.610 1.00 40.93  ? 83  ARG D CZ    1 
ATOM 2792  N NH1   . ARG D 4 83  ? 267.201 242.527 276.660 1.00 40.93  ? 83  ARG D NH1   1 
ATOM 2793  N NH2   . ARG D 4 83  ? 266.739 240.298 276.401 1.00 40.93  ? 83  ARG D NH2   1 
ATOM 2794  N N     . SER D 4 84  ? 261.406 246.098 278.347 1.00 42.60  ? 84  SER D N     1 
ATOM 2795  C CA    . SER D 4 84  ? 260.757 247.250 278.945 1.00 42.60  ? 84  SER D CA    1 
ATOM 2796  C C     . SER D 4 84  ? 261.542 248.532 278.753 1.00 42.60  ? 84  SER D C     1 
ATOM 2797  O O     . SER D 4 84  ? 260.998 249.610 278.986 1.00 42.60  ? 84  SER D O     1 
ATOM 2798  C CB    . SER D 4 84  ? 260.541 247.016 280.442 1.00 42.60  ? 84  SER D CB    1 
ATOM 2799  O OG    . SER D 4 84  ? 259.732 245.880 280.660 1.00 42.60  ? 84  SER D OG    1 
ATOM 2800  N N     . THR D 4 85  ? 262.788 248.437 278.306 1.00 40.13  ? 85  THR D N     1 
ATOM 2801  C CA    . THR D 4 85  ? 263.730 249.542 278.317 1.00 40.13  ? 85  THR D CA    1 
ATOM 2802  C C     . THR D 4 85  ? 264.173 249.850 276.897 1.00 40.13  ? 85  THR D C     1 
ATOM 2803  O O     . THR D 4 85  ? 264.437 248.935 276.115 1.00 40.13  ? 85  THR D O     1 
ATOM 2804  C CB    . THR D 4 85  ? 264.952 249.203 279.176 1.00 40.13  ? 85  THR D CB    1 
ATOM 2805  O OG1   . THR D 4 85  ? 264.523 248.692 280.439 1.00 40.13  ? 85  THR D OG1   1 
ATOM 2806  C CG2   . THR D 4 85  ? 265.800 250.425 279.412 1.00 40.13  ? 85  THR D CG2   1 
ATOM 2807  N N     . ILE D 4 86  ? 264.253 251.130 276.570 1.00 37.26  ? 86  ILE D N     1 
ATOM 2808  C CA    . ILE D 4 86  ? 264.944 251.574 275.368 1.00 37.26  ? 86  ILE D CA    1 
ATOM 2809  C C     . ILE D 4 86  ? 266.369 251.932 275.758 1.00 37.26  ? 86  ILE D C     1 
ATOM 2810  O O     . ILE D 4 86  ? 266.587 252.816 276.590 1.00 37.26  ? 86  ILE D O     1 
ATOM 2811  C CB    . ILE D 4 86  ? 264.229 252.762 274.715 1.00 37.26  ? 86  ILE D CB    1 
ATOM 2812  C CG1   . ILE D 4 86  ? 262.948 252.284 274.048 1.00 37.26  ? 86  ILE D CG1   1 
ATOM 2813  C CG2   . ILE D 4 86  ? 265.126 253.422 273.698 1.00 37.26  ? 86  ILE D CG2   1 
ATOM 2814  C CD1   . ILE D 4 86  ? 262.250 253.348 273.300 1.00 37.26  ? 86  ILE D CD1   1 
ATOM 2815  N N     . THR D 4 87  ? 267.334 251.234 275.181 1.00 35.95  ? 87  THR D N     1 
ATOM 2816  C CA    . THR D 4 87  ? 268.738 251.398 275.513 1.00 35.95  ? 87  THR D CA    1 
ATOM 2817  C C     . THR D 4 87  ? 269.515 251.903 274.302 1.00 35.95  ? 87  THR D C     1 
ATOM 2818  O O     . THR D 4 87  ? 268.970 252.099 273.211 1.00 35.95  ? 87  THR D O     1 
ATOM 2819  C CB    . THR D 4 87  ? 269.335 250.082 276.011 1.00 35.95  ? 87  THR D CB    1 
ATOM 2820  O OG1   . THR D 4 87  ? 269.241 249.099 274.977 1.00 35.95  ? 87  THR D OG1   1 
ATOM 2821  C CG2   . THR D 4 87  ? 268.593 249.586 277.227 1.00 35.95  ? 87  THR D CG2   1 
ATOM 2822  N N     . SER D 4 88  ? 270.816 252.109 274.513 1.00 35.25  ? 88  SER D N     1 
ATOM 2823  C CA    . SER D 4 88  ? 271.704 252.421 273.403 1.00 35.25  ? 88  SER D CA    1 
ATOM 2824  C C     . SER D 4 88  ? 271.607 251.381 272.305 1.00 35.25  ? 88  SER D C     1 
ATOM 2825  O O     . SER D 4 88  ? 271.731 251.713 271.127 1.00 35.25  ? 88  SER D O     1 
ATOM 2826  C CB    . SER D 4 88  ? 273.151 252.506 273.877 1.00 35.25  ? 88  SER D CB    1 
ATOM 2827  O OG    . SER D 4 88  ? 273.295 253.415 274.939 1.00 35.25  ? 88  SER D OG    1 
ATOM 2828  N N     . ARG D 4 89  ? 271.389 250.122 272.667 1.00 35.97  ? 89  ARG D N     1 
ATOM 2829  C CA    . ARG D 4 89  ? 271.355 249.065 271.667 1.00 35.97  ? 89  ARG D CA    1 
ATOM 2830  C C     . ARG D 4 89  ? 270.130 249.198 270.776 1.00 35.97  ? 89  ARG D C     1 
ATOM 2831  O O     . ARG D 4 89  ? 270.228 249.087 269.550 1.00 35.97  ? 89  ARG D O     1 
ATOM 2832  C CB    . ARG D 4 89  ? 271.389 247.708 272.356 1.00 35.97  ? 89  ARG D CB    1 
ATOM 2833  C CG    . ARG D 4 89  ? 272.250 246.718 271.636 1.00 35.97  ? 89  ARG D CG    1 
ATOM 2834  C CD    . ARG D 4 89  ? 272.417 245.449 272.416 1.00 35.97  ? 89  ARG D CD    1 
ATOM 2835  N NE    . ARG D 4 89  ? 272.627 244.332 271.510 1.00 35.97  ? 89  ARG D NE    1 
ATOM 2836  C CZ    . ARG D 4 89  ? 271.650 243.570 271.042 1.00 35.97  ? 89  ARG D CZ    1 
ATOM 2837  N NH1   . ARG D 4 89  ? 270.401 243.800 271.407 1.00 35.97  ? 89  ARG D NH1   1 
ATOM 2838  N NH2   . ARG D 4 89  ? 271.926 242.575 270.215 1.00 35.97  ? 89  ARG D NH2   1 
ATOM 2839  N N     . GLU D 4 90  ? 268.969 249.458 271.376 1.00 36.25  ? 90  GLU D N     1 
ATOM 2840  C CA    . GLU D 4 90  ? 267.780 249.758 270.591 1.00 36.25  ? 90  GLU D CA    1 
ATOM 2841  C C     . GLU D 4 90  ? 267.993 250.971 269.704 1.00 36.25  ? 90  GLU D C     1 
ATOM 2842  O O     . GLU D 4 90  ? 267.584 250.967 268.542 1.00 36.25  ? 90  GLU D O     1 
ATOM 2843  C CB    . GLU D 4 90  ? 266.582 249.998 271.501 1.00 36.25  ? 90  GLU D CB    1 
ATOM 2844  C CG    . GLU D 4 90  ? 265.782 248.776 271.818 1.00 36.25  ? 90  GLU D CG    1 
ATOM 2845  C CD    . GLU D 4 90  ? 266.298 248.039 273.026 1.00 36.25  ? 90  GLU D CD    1 
ATOM 2846  O OE1   . GLU D 4 90  ? 267.440 248.304 273.449 1.00 36.25  ? 90  GLU D OE1   1 
ATOM 2847  O OE2   . GLU D 4 90  ? 265.554 247.191 273.561 1.00 36.25  ? 90  GLU D OE2   1 
ATOM 2848  N N     . ILE D 4 91  ? 268.599 252.031 270.237 1.00 33.83  ? 91  ILE D N     1 
ATOM 2849  C CA    . ILE D 4 91  ? 268.793 253.226 269.422 1.00 33.83  ? 91  ILE D CA    1 
ATOM 2850  C C     . ILE D 4 91  ? 269.698 252.925 268.236 1.00 33.83  ? 91  ILE D C     1 
ATOM 2851  O O     . ILE D 4 91  ? 269.425 253.341 267.106 1.00 33.83  ? 91  ILE D O     1 
ATOM 2852  C CB    . ILE D 4 91  ? 269.343 254.379 270.275 1.00 33.83  ? 91  ILE D CB    1 
ATOM 2853  C CG1   . ILE D 4 91  ? 268.342 254.762 271.360 1.00 33.83  ? 91  ILE D CG1   1 
ATOM 2854  C CG2   . ILE D 4 91  ? 269.642 255.565 269.397 1.00 33.83  ? 91  ILE D CG2   1 
ATOM 2855  C CD1   . ILE D 4 91  ? 267.119 255.436 270.839 1.00 33.83  ? 91  ILE D CD1   1 
ATOM 2856  N N     . GLN D 4 92  ? 270.780 252.189 268.473 1.00 34.13  ? 92  GLN D N     1 
ATOM 2857  C CA    . GLN D 4 92  ? 271.721 251.858 267.412 1.00 34.13  ? 92  GLN D CA    1 
ATOM 2858  C C     . GLN D 4 92  ? 271.078 250.987 266.343 1.00 34.13  ? 92  GLN D C     1 
ATOM 2859  O O     . GLN D 4 92  ? 271.296 251.194 265.144 1.00 34.13  ? 92  GLN D O     1 
ATOM 2860  C CB    . GLN D 4 92  ? 272.931 251.165 268.019 1.00 34.13  ? 92  GLN D CB    1 
ATOM 2861  C CG    . GLN D 4 92  ? 273.792 250.431 267.037 1.00 34.13  ? 92  GLN D CG    1 
ATOM 2862  C CD    . GLN D 4 92  ? 275.154 250.150 267.595 1.00 34.13  ? 92  GLN D CD    1 
ATOM 2863  O OE1   . GLN D 4 92  ? 275.747 250.994 268.252 1.00 34.13  ? 92  GLN D OE1   1 
ATOM 2864  N NE2   . GLN D 4 92  ? 275.657 248.955 267.350 1.00 34.13  ? 92  GLN D NE2   1 
ATOM 2865  N N     . THR D 4 93  ? 270.270 250.014 266.757 1.00 33.55  ? 93  THR D N     1 
ATOM 2866  C CA    . THR D 4 93  ? 269.566 249.190 265.784 1.00 33.55  ? 93  THR D CA    1 
ATOM 2867  C C     . THR D 4 93  ? 268.530 250.004 265.020 1.00 33.55  ? 93  THR D C     1 
ATOM 2868  O O     . THR D 4 93  ? 268.325 249.789 263.822 1.00 33.55  ? 93  THR D O     1 
ATOM 2869  C CB    . THR D 4 93  ? 268.917 248.000 266.483 1.00 33.55  ? 93  THR D CB    1 
ATOM 2870  O OG1   . THR D 4 93  ? 269.927 247.215 267.120 1.00 33.55  ? 93  THR D OG1   1 
ATOM 2871  C CG2   . THR D 4 93  ? 268.185 247.128 265.495 1.00 33.55  ? 93  THR D CG2   1 
ATOM 2872  N N     . ALA D 4 94  ? 267.874 250.949 265.686 1.00 33.60  ? 94  ALA D N     1 
ATOM 2873  C CA    . ALA D 4 94  ? 266.939 251.817 264.988 1.00 33.60  ? 94  ALA D CA    1 
ATOM 2874  C C     . ALA D 4 94  ? 267.655 252.654 263.940 1.00 33.60  ? 94  ALA D C     1 
ATOM 2875  O O     . ALA D 4 94  ? 267.136 252.858 262.839 1.00 33.60  ? 94  ALA D O     1 
ATOM 2876  C CB    . ALA D 4 94  ? 266.202 252.705 265.988 1.00 33.60  ? 94  ALA D CB    1 
ATOM 2877  N N     . VAL D 4 95  ? 268.857 253.126 264.261 1.00 34.03  ? 95  VAL D N     1 
ATOM 2878  C CA    . VAL D 4 95  ? 269.654 253.890 263.307 1.00 34.03  ? 95  VAL D CA    1 
ATOM 2879  C C     . VAL D 4 95  ? 270.056 253.020 262.125 1.00 34.03  ? 95  VAL D C     1 
ATOM 2880  O O     . VAL D 4 95  ? 270.044 253.467 260.975 1.00 34.03  ? 95  VAL D O     1 
ATOM 2881  C CB    . VAL D 4 95  ? 270.880 254.492 264.013 1.00 34.03  ? 95  VAL D CB    1 
ATOM 2882  C CG1   . VAL D 4 95  ? 271.869 255.025 263.007 1.00 34.03  ? 95  VAL D CG1   1 
ATOM 2883  C CG2   . VAL D 4 95  ? 270.445 255.583 264.954 1.00 34.03  ? 95  VAL D CG2   1 
ATOM 2884  N N     . ARG D 4 96  ? 270.411 251.765 262.385 1.00 34.88  ? 96  ARG D N     1 
ATOM 2885  C CA    . ARG D 4 96  ? 270.774 250.875 261.288 1.00 34.88  ? 96  ARG D CA    1 
ATOM 2886  C C     . ARG D 4 96  ? 269.571 250.497 260.436 1.00 34.88  ? 96  ARG D C     1 
ATOM 2887  O O     . ARG D 4 96  ? 269.730 250.161 259.261 1.00 34.88  ? 96  ARG D O     1 
ATOM 2888  C CB    . ARG D 4 96  ? 271.445 249.617 261.820 1.00 34.88  ? 96  ARG D CB    1 
ATOM 2889  C CG    . ARG D 4 96  ? 272.846 249.833 262.304 1.00 34.88  ? 96  ARG D CG    1 
ATOM 2890  C CD    . ARG D 4 96  ? 273.552 248.510 262.462 1.00 34.88  ? 96  ARG D CD    1 
ATOM 2891  N NE    . ARG D 4 96  ? 274.951 248.678 262.828 1.00 34.88  ? 96  ARG D NE    1 
ATOM 2892  C CZ    . ARG D 4 96  ? 275.492 248.198 263.940 1.00 34.88  ? 96  ARG D CZ    1 
ATOM 2893  N NH1   . ARG D 4 96  ? 274.751 247.508 264.796 1.00 34.88  ? 96  ARG D NH1   1 
ATOM 2894  N NH2   . ARG D 4 96  ? 276.775 248.396 264.192 1.00 34.88  ? 96  ARG D NH2   1 
ATOM 2895  N N     . LEU D 4 97  ? 268.372 250.515 261.010 1.00 34.42  ? 97  LEU D N     1 
ATOM 2896  C CA    . LEU D 4 97  ? 267.181 250.225 260.222 1.00 34.42  ? 97  LEU D CA    1 
ATOM 2897  C C     . LEU D 4 97  ? 266.733 251.442 259.423 1.00 34.42  ? 97  LEU D C     1 
ATOM 2898  O O     . LEU D 4 97  ? 266.147 251.298 258.347 1.00 34.42  ? 97  LEU D O     1 
ATOM 2899  C CB    . LEU D 4 97  ? 266.052 249.744 261.129 1.00 34.42  ? 97  LEU D CB    1 
ATOM 2900  C CG    . LEU D 4 97  ? 266.148 248.339 261.720 1.00 34.42  ? 97  LEU D CG    1 
ATOM 2901  C CD1   . LEU D 4 97  ? 265.070 248.111 262.754 1.00 34.42  ? 97  LEU D CD1   1 
ATOM 2902  C CD2   . LEU D 4 97  ? 266.061 247.299 260.631 1.00 34.42  ? 97  LEU D CD2   1 
ATOM 2903  N N     . LEU D 4 98  ? 266.989 252.645 259.932 1.00 35.41  ? 98  LEU D N     1 
ATOM 2904  C CA    . LEU D 4 98  ? 266.432 253.856 259.344 1.00 35.41  ? 98  LEU D CA    1 
ATOM 2905  C C     . LEU D 4 98  ? 267.399 254.623 258.461 1.00 35.41  ? 98  LEU D C     1 
ATOM 2906  O O     . LEU D 4 98  ? 266.953 255.330 257.557 1.00 35.41  ? 98  LEU D O     1 
ATOM 2907  C CB    . LEU D 4 98  ? 265.938 254.795 260.441 1.00 35.41  ? 98  LEU D CB    1 
ATOM 2908  C CG    . LEU D 4 98  ? 264.766 254.298 261.275 1.00 35.41  ? 98  LEU D CG    1 
ATOM 2909  C CD1   . LEU D 4 98  ? 264.645 255.147 262.504 1.00 35.41  ? 98  LEU D CD1   1 
ATOM 2910  C CD2   . LEU D 4 98  ? 263.482 254.331 260.483 1.00 35.41  ? 98  LEU D CD2   1 
ATOM 2911  N N     . LEU D 4 99  ? 268.626 254.542 258.693 1.00 37.12  ? 99  LEU D N     1 
ATOM 2912  C CA    . LEU D 4 99  ? 269.438 255.388 257.837 1.00 37.12  ? 99  LEU D CA    1 
ATOM 2913  C C     . LEU D 4 99  ? 270.069 254.574 256.716 1.00 37.12  ? 99  LEU D C     1 
ATOM 2914  O O     . LEU D 4 99  ? 270.392 253.399 256.897 1.00 37.12  ? 99  LEU D O     1 
ATOM 2915  C CB    . LEU D 4 99  ? 270.534 256.069 258.640 1.00 37.12  ? 99  LEU D CB    1 
ATOM 2916  C CG    . LEU D 4 99  ? 270.122 256.910 259.841 1.00 37.12  ? 99  LEU D CG    1 
ATOM 2917  C CD1   . LEU D 4 99  ? 271.331 257.603 260.413 1.00 37.12  ? 99  LEU D CD1   1 
ATOM 2918  C CD2   . LEU D 4 99  ? 269.069 257.914 259.465 1.00 37.12  ? 99  LEU D CD2   1 
ATOM 2919  N N     . PRO D 4 100 ? 270.252 255.184 255.544 1.00 39.86  ? 100 PRO D N     1 
ATOM 2920  C CA    . PRO D 4 100 ? 270.818 254.456 254.400 1.00 39.86  ? 100 PRO D CA    1 
ATOM 2921  C C     . PRO D 4 100 ? 272.340 254.445 254.437 1.00 39.86  ? 100 PRO D C     1 
ATOM 2922  O O     . PRO D 4 100 ? 272.980 255.497 254.400 1.00 39.86  ? 100 PRO D O     1 
ATOM 2923  C CB    . PRO D 4 100 ? 270.293 255.241 253.195 1.00 39.86  ? 100 PRO D CB    1 
ATOM 2924  C CG    . PRO D 4 100 ? 270.106 256.612 253.709 1.00 39.86  ? 100 PRO D CG    1 
ATOM 2925  C CD    . PRO D 4 100 ? 269.711 256.495 255.151 1.00 39.86  ? 100 PRO D CD    1 
ATOM 2926  N N     . GLY D 4 101 ? 272.914 253.249 254.521 1.00 40.78  ? 101 GLY D N     1 
ATOM 2927  C CA    . GLY D 4 101 ? 274.322 253.022 254.255 1.00 40.78  ? 101 GLY D CA    1 
ATOM 2928  C C     . GLY D 4 101 ? 275.351 253.830 255.016 1.00 40.78  ? 101 GLY D C     1 
ATOM 2929  O O     . GLY D 4 101 ? 275.599 253.600 256.206 1.00 40.78  ? 101 GLY D O     1 
ATOM 2930  N N     . GLU D 4 102 ? 275.993 254.757 254.304 1.00 41.72  ? 102 GLU D N     1 
ATOM 2931  C CA    . GLU D 4 102 ? 277.092 255.515 254.887 1.00 41.72  ? 102 GLU D CA    1 
ATOM 2932  C C     . GLU D 4 102 ? 276.610 256.405 256.019 1.00 41.72  ? 102 GLU D C     1 
ATOM 2933  O O     . GLU D 4 102 ? 277.301 256.562 257.033 1.00 41.72  ? 102 GLU D O     1 
ATOM 2934  C CB    . GLU D 4 102 ? 277.784 256.347 253.811 1.00 41.72  ? 102 GLU D CB    1 
ATOM 2935  C CG    . GLU D 4 102 ? 278.365 255.528 252.679 1.00 41.72  ? 102 GLU D CG    1 
ATOM 2936  C CD    . GLU D 4 102 ? 279.353 254.488 253.165 1.00 41.72  ? 102 GLU D CD    1 
ATOM 2937  O OE1   . GLU D 4 102 ? 278.941 253.331 253.392 1.00 41.72  ? 102 GLU D OE1   1 
ATOM 2938  O OE2   . GLU D 4 102 ? 280.541 254.829 253.330 1.00 41.72  ? 102 GLU D OE2   1 
ATOM 2939  N N     . LEU D 4 103 ? 275.432 257.009 255.857 1.00 39.96  ? 103 LEU D N     1 
ATOM 2940  C CA    . LEU D 4 103 ? 274.835 257.753 256.956 1.00 39.96  ? 103 LEU D CA    1 
ATOM 2941  C C     . LEU D 4 103 ? 274.687 256.871 258.181 1.00 39.96  ? 103 LEU D C     1 
ATOM 2942  O O     . LEU D 4 103 ? 274.975 257.299 259.300 1.00 39.96  ? 103 LEU D O     1 
ATOM 2943  C CB    . LEU D 4 103 ? 273.481 258.324 256.542 1.00 39.96  ? 103 LEU D CB    1 
ATOM 2944  C CG    . LEU D 4 103 ? 273.480 259.635 255.767 1.00 39.96  ? 103 LEU D CG    1 
ATOM 2945  C CD1   . LEU D 4 103 ? 272.056 260.071 255.522 1.00 39.96  ? 103 LEU D CD1   1 
ATOM 2946  C CD2   . LEU D 4 103 ? 274.247 260.700 256.520 1.00 39.96  ? 103 LEU D CD2   1 
ATOM 2947  N N     . ALA D 4 104 ? 274.281 255.619 257.980 1.00 39.29  ? 104 ALA D N     1 
ATOM 2948  C CA    . ALA D 4 104 ? 274.099 254.712 259.104 1.00 39.29  ? 104 ALA D CA    1 
ATOM 2949  C C     . ALA D 4 104 ? 275.421 254.400 259.786 1.00 39.29  ? 104 ALA D C     1 
ATOM 2950  O O     . ALA D 4 104 ? 275.509 254.438 261.017 1.00 39.29  ? 104 ALA D O     1 
ATOM 2951  C CB    . ALA D 4 104 ? 273.423 253.428 258.640 1.00 39.29  ? 104 ALA D CB    1 
ATOM 2952  N N     . LYS D 4 105 ? 276.464 254.093 259.016 1.00 40.15  ? 105 LYS D N     1 
ATOM 2953  C CA    . LYS D 4 105 ? 277.716 253.721 259.668 1.00 40.15  ? 105 LYS D CA    1 
ATOM 2954  C C     . LYS D 4 105 ? 278.339 254.911 260.388 1.00 40.15  ? 105 LYS D C     1 
ATOM 2955  O O     . LYS D 4 105 ? 278.855 254.768 261.504 1.00 40.15  ? 105 LYS D O     1 
ATOM 2956  C CB    . LYS D 4 105 ? 278.689 253.105 258.664 1.00 40.15  ? 105 LYS D CB    1 
ATOM 2957  C CG    . LYS D 4 105 ? 279.234 254.035 257.618 1.00 40.15  ? 105 LYS D CG    1 
ATOM 2958  C CD    . LYS D 4 105 ? 280.359 253.367 256.851 1.00 40.15  ? 105 LYS D CD    1 
ATOM 2959  C CE    . LYS D 4 105 ? 279.960 251.981 256.376 1.00 40.15  ? 105 LYS D CE    1 
ATOM 2960  N NZ    . LYS D 4 105 ? 278.777 252.010 255.472 1.00 40.15  ? 105 LYS D NZ    1 
ATOM 2961  N N     . HIS D 4 106 ? 278.252 256.105 259.801 1.00 39.69  ? 106 HIS D N     1 
ATOM 2962  C CA    . HIS D 4 106 ? 278.807 257.276 260.468 1.00 39.69  ? 106 HIS D CA    1 
ATOM 2963  C C     . HIS D 4 106 ? 278.006 257.652 261.706 1.00 39.69  ? 106 HIS D C     1 
ATOM 2964  O O     . HIS D 4 106 ? 278.584 258.027 262.732 1.00 39.69  ? 106 HIS D O     1 
ATOM 2965  C CB    . HIS D 4 106 ? 278.873 258.448 259.501 1.00 39.69  ? 106 HIS D CB    1 
ATOM 2966  C CG    . HIS D 4 106 ? 279.951 258.320 258.476 1.00 39.69  ? 106 HIS D CG    1 
ATOM 2967  N ND1   . HIS D 4 106 ? 281.046 259.154 258.441 1.00 39.69  ? 106 HIS D ND1   1 
ATOM 2968  C CD2   . HIS D 4 106 ? 280.111 257.447 257.456 1.00 39.69  ? 106 HIS D CD2   1 
ATOM 2969  C CE1   . HIS D 4 106 ? 281.830 258.804 257.438 1.00 39.69  ? 106 HIS D CE1   1 
ATOM 2970  N NE2   . HIS D 4 106 ? 281.285 257.770 256.824 1.00 39.69  ? 106 HIS D NE2   1 
ATOM 2971  N N     . ALA D 4 107 ? 276.677 257.579 261.627 1.00 38.23  ? 107 ALA D N     1 
ATOM 2972  C CA    . ALA D 4 107 ? 275.852 257.854 262.793 1.00 38.23  ? 107 ALA D CA    1 
ATOM 2973  C C     . ALA D 4 107 ? 276.139 256.866 263.909 1.00 38.23  ? 107 ALA D C     1 
ATOM 2974  O O     . ALA D 4 107 ? 276.185 257.244 265.083 1.00 38.23  ? 107 ALA D O     1 
ATOM 2975  C CB    . ALA D 4 107 ? 274.378 257.815 262.405 1.00 38.23  ? 107 ALA D CB    1 
ATOM 2976  N N     . VAL D 4 108 ? 276.337 255.594 263.563 1.00 37.64  ? 108 VAL D N     1 
ATOM 2977  C CA    . VAL D 4 108 ? 276.665 254.597 264.573 1.00 37.64  ? 108 VAL D CA    1 
ATOM 2978  C C     . VAL D 4 108 ? 277.999 254.921 265.225 1.00 37.64  ? 108 VAL D C     1 
ATOM 2979  O O     . VAL D 4 108 ? 278.153 254.804 266.446 1.00 37.64  ? 108 VAL D O     1 
ATOM 2980  C CB    . VAL D 4 108 ? 276.660 253.189 263.956 1.00 37.64  ? 108 VAL D CB    1 
ATOM 2981  C CG1   . VAL D 4 108 ? 277.432 252.234 264.833 1.00 37.64  ? 108 VAL D CG1   1 
ATOM 2982  C CG2   . VAL D 4 108 ? 275.237 252.704 263.788 1.00 37.64  ? 108 VAL D CG2   1 
ATOM 2983  N N     . SER D 4 109 ? 278.986 255.335 264.432 1.00 39.08  ? 109 SER D N     1 
ATOM 2984  C CA    . SER D 4 109 ? 280.278 255.658 265.024 1.00 39.08  ? 109 SER D CA    1 
ATOM 2985  C C     . SER D 4 109 ? 280.165 256.858 265.955 1.00 39.08  ? 109 SER D C     1 
ATOM 2986  O O     . SER D 4 109 ? 280.739 256.857 267.050 1.00 39.08  ? 109 SER D O     1 
ATOM 2987  C CB    . SER D 4 109 ? 281.319 255.909 263.938 1.00 39.08  ? 109 SER D CB    1 
ATOM 2988  O OG    . SER D 4 109 ? 281.012 257.069 263.198 1.00 39.08  ? 109 SER D OG    1 
ATOM 2989  N N     . GLU D 4 110 ? 279.406 257.877 265.547 1.00 39.43  ? 110 GLU D N     1 
ATOM 2990  C CA    . GLU D 4 110 ? 279.181 259.035 266.407 1.00 39.43  ? 110 GLU D CA    1 
ATOM 2991  C C     . GLU D 4 110 ? 278.505 258.635 267.709 1.00 39.43  ? 110 GLU D C     1 
ATOM 2992  O O     . GLU D 4 110 ? 278.893 259.088 268.789 1.00 39.43  ? 110 GLU D O     1 
ATOM 2993  C CB    . GLU D 4 110 ? 278.340 260.080 265.680 1.00 39.43  ? 110 GLU D CB    1 
ATOM 2994  C CG    . GLU D 4 110 ? 279.020 260.715 264.501 1.00 39.43  ? 110 GLU D CG    1 
ATOM 2995  C CD    . GLU D 4 110 ? 280.319 261.379 264.871 1.00 39.43  ? 110 GLU D CD    1 
ATOM 2996  O OE1   . GLU D 4 110 ? 280.292 262.549 265.298 1.00 39.43  ? 110 GLU D OE1   1 
ATOM 2997  O OE2   . GLU D 4 110 ? 281.375 260.730 264.737 1.00 39.43  ? 110 GLU D OE2   1 
ATOM 2998  N N     . GLY D 4 111 ? 277.483 257.785 267.623 1.00 37.93  ? 111 GLY D N     1 
ATOM 2999  C CA    . GLY D 4 111 ? 276.775 257.376 268.820 1.00 37.93  ? 111 GLY D CA    1 
ATOM 3000  C C     . GLY D 4 111 ? 277.639 256.574 269.772 1.00 37.93  ? 111 GLY D C     1 
ATOM 3001  O O     . GLY D 4 111 ? 277.648 256.833 270.977 1.00 37.93  ? 111 GLY D O     1 
ATOM 3002  N N     . THR D 4 112 ? 278.375 255.591 269.252 1.00 38.57  ? 112 THR D N     1 
ATOM 3003  C CA    . THR D 4 112 ? 279.233 254.803 270.129 1.00 38.57  ? 112 THR D CA    1 
ATOM 3004  C C     . THR D 4 112 ? 280.323 255.663 270.742 1.00 38.57  ? 112 THR D C     1 
ATOM 3005  O O     . THR D 4 112 ? 280.662 255.492 271.915 1.00 38.57  ? 112 THR D O     1 
ATOM 3006  C CB    . THR D 4 112 ? 279.852 253.626 269.382 1.00 38.57  ? 112 THR D CB    1 
ATOM 3007  O OG1   . THR D 4 112 ? 280.733 254.110 268.368 1.00 38.57  ? 112 THR D OG1   1 
ATOM 3008  C CG2   . THR D 4 112 ? 278.780 252.772 268.760 1.00 38.57  ? 112 THR D CG2   1 
ATOM 3009  N N     . LYS D 4 113 ? 280.876 256.603 269.974 1.00 38.99  ? 113 LYS D N     1 
ATOM 3010  C CA    . LYS D 4 113 ? 281.894 257.490 270.519 1.00 38.99  ? 113 LYS D CA    1 
ATOM 3011  C C     . LYS D 4 113 ? 281.330 258.354 271.636 1.00 38.99  ? 113 LYS D C     1 
ATOM 3012  O O     . LYS D 4 113 ? 281.960 258.517 272.687 1.00 38.99  ? 113 LYS D O     1 
ATOM 3013  C CB    . LYS D 4 113 ? 282.466 258.357 269.405 1.00 38.99  ? 113 LYS D CB    1 
ATOM 3014  C CG    . LYS D 4 113 ? 283.609 259.229 269.834 1.00 38.99  ? 113 LYS D CG    1 
ATOM 3015  C CD    . LYS D 4 113 ? 283.478 260.607 269.239 1.00 38.99  ? 113 LYS D CD    1 
ATOM 3016  C CE    . LYS D 4 113 ? 283.339 260.544 267.736 1.00 38.99  ? 113 LYS D CE    1 
ATOM 3017  N NZ    . LYS D 4 113 ? 282.990 261.875 267.177 1.00 38.99  ? 113 LYS D NZ    1 
ATOM 3018  N N     . ALA D 4 114 ? 280.135 258.906 271.435 1.00 38.54  ? 114 ALA D N     1 
ATOM 3019  C CA    . ALA D 4 114 ? 279.543 259.759 272.455 1.00 38.54  ? 114 ALA D CA    1 
ATOM 3020  C C     . ALA D 4 114 ? 279.211 258.966 273.709 1.00 38.54  ? 114 ALA D C     1 
ATOM 3021  O O     . ALA D 4 114 ? 279.393 259.454 274.825 1.00 38.54  ? 114 ALA D O     1 
ATOM 3022  C CB    . ALA D 4 114 ? 278.297 260.449 271.911 1.00 38.54  ? 114 ALA D CB    1 
ATOM 3023  N N     . VAL D 4 115 ? 278.735 257.732 273.550 1.00 38.80  ? 115 VAL D N     1 
ATOM 3024  C CA    . VAL D 4 115 ? 278.390 256.934 274.724 1.00 38.80  ? 115 VAL D CA    1 
ATOM 3025  C C     . VAL D 4 115 ? 279.647 256.512 275.471 1.00 38.80  ? 115 VAL D C     1 
ATOM 3026  O O     . VAL D 4 115 ? 279.681 256.510 276.706 1.00 38.80  ? 115 VAL D O     1 
ATOM 3027  C CB    . VAL D 4 115 ? 277.531 255.724 274.323 1.00 38.80  ? 115 VAL D CB    1 
ATOM 3028  C CG1   . VAL D 4 115 ? 277.365 254.787 275.491 1.00 38.80  ? 115 VAL D CG1   1 
ATOM 3029  C CG2   . VAL D 4 115 ? 276.179 256.184 273.843 1.00 38.80  ? 115 VAL D CG2   1 
ATOM 3030  N N     . THR D 4 116 ? 280.700 256.148 274.740 1.00 40.29  ? 116 THR D N     1 
ATOM 3031  C CA    . THR D 4 116 ? 281.966 255.812 275.378 1.00 40.29  ? 116 THR D CA    1 
ATOM 3032  C C     . THR D 4 116 ? 282.500 256.986 276.180 1.00 40.29  ? 116 THR D C     1 
ATOM 3033  O O     . THR D 4 116 ? 282.928 256.828 277.329 1.00 40.29  ? 116 THR D O     1 
ATOM 3034  C CB    . THR D 4 116 ? 282.980 255.383 274.322 1.00 40.29  ? 116 THR D CB    1 
ATOM 3035  O OG1   . THR D 4 116 ? 282.638 254.084 273.835 1.00 40.29  ? 116 THR D OG1   1 
ATOM 3036  C CG2   . THR D 4 116 ? 284.376 255.353 274.900 1.00 40.29  ? 116 THR D CG2   1 
ATOM 3037  N N     . LYS D 4 117 ? 282.479 258.179 275.588 1.00 41.48  ? 117 LYS D N     1 
ATOM 3038  C CA    . LYS D 4 117 ? 282.946 259.362 276.298 1.00 41.48  ? 117 LYS D CA    1 
ATOM 3039  C C     . LYS D 4 117 ? 282.060 259.678 277.497 1.00 41.48  ? 117 LYS D C     1 
ATOM 3040  O O     . LYS D 4 117 ? 282.560 260.063 278.557 1.00 41.48  ? 117 LYS D O     1 
ATOM 3041  C CB    . LYS D 4 117 ? 283.012 260.541 275.334 1.00 41.48  ? 117 LYS D CB    1 
ATOM 3042  C CG    . LYS D 4 117 ? 283.314 261.856 275.982 1.00 41.48  ? 117 LYS D CG    1 
ATOM 3043  C CD    . LYS D 4 117 ? 283.955 262.816 275.008 1.00 41.48  ? 117 LYS D CD    1 
ATOM 3044  C CE    . LYS D 4 117 ? 284.080 264.195 275.629 1.00 41.48  ? 117 LYS D CE    1 
ATOM 3045  N NZ    . LYS D 4 117 ? 284.241 264.110 277.105 1.00 41.48  ? 117 LYS D NZ    1 
ATOM 3046  N N     . TYR D 4 118 ? 280.747 259.492 277.364 1.00 42.05  ? 118 TYR D N     1 
ATOM 3047  C CA    . TYR D 4 118 ? 279.839 259.787 278.465 1.00 42.05  ? 118 TYR D CA    1 
ATOM 3048  C C     . TYR D 4 118 ? 280.069 258.851 279.642 1.00 42.05  ? 118 TYR D C     1 
ATOM 3049  O O     . TYR D 4 118 ? 280.106 259.290 280.794 1.00 42.05  ? 118 TYR D O     1 
ATOM 3050  C CB    . TYR D 4 118 ? 278.392 259.700 277.990 1.00 42.05  ? 118 TYR D CB    1 
ATOM 3051  C CG    . TYR D 4 118 ? 277.385 259.880 279.095 1.00 42.05  ? 118 TYR D CG    1 
ATOM 3052  C CD1   . TYR D 4 118 ? 277.115 261.134 279.611 1.00 42.05  ? 118 TYR D CD1   1 
ATOM 3053  C CD2   . TYR D 4 118 ? 276.702 258.798 279.621 1.00 42.05  ? 118 TYR D CD2   1 
ATOM 3054  C CE1   . TYR D 4 118 ? 276.200 261.305 280.613 1.00 42.05  ? 118 TYR D CE1   1 
ATOM 3055  C CE2   . TYR D 4 118 ? 275.787 258.961 280.626 1.00 42.05  ? 118 TYR D CE2   1 
ATOM 3056  C CZ    . TYR D 4 118 ? 275.541 260.215 281.118 1.00 42.05  ? 118 TYR D CZ    1 
ATOM 3057  O OH    . TYR D 4 118 ? 274.626 260.384 282.123 1.00 42.05  ? 118 TYR D OH    1 
ATOM 3058  N N     . THR D 4 119 ? 280.210 257.554 279.378 1.00 43.44  ? 119 THR D N     1 
ATOM 3059  C CA    . THR D 4 119 ? 280.408 256.622 280.480 1.00 43.44  ? 119 THR D CA    1 
ATOM 3060  C C     . THR D 4 119 ? 281.808 256.729 281.063 1.00 43.44  ? 119 THR D C     1 
ATOM 3061  O O     . THR D 4 119 ? 281.995 256.489 282.258 1.00 43.44  ? 119 THR D O     1 
ATOM 3062  C CB    . THR D 4 119 ? 280.129 255.191 280.036 1.00 43.44  ? 119 THR D CB    1 
ATOM 3063  O OG1   . THR D 4 119 ? 281.085 254.798 279.049 1.00 43.44  ? 119 THR D OG1   1 
ATOM 3064  C CG2   . THR D 4 119 ? 278.738 255.085 279.458 1.00 43.44  ? 119 THR D CG2   1 
ATOM 3065  N N     . SER D 4 120 ? 282.800 257.102 280.254 1.00 44.59  ? 120 SER D N     1 
ATOM 3066  C CA    . SER D 4 120 ? 284.134 257.297 280.807 1.00 44.59  ? 120 SER D CA    1 
ATOM 3067  C C     . SER D 4 120 ? 284.195 258.533 281.690 1.00 44.59  ? 120 SER D C     1 
ATOM 3068  O O     . SER D 4 120 ? 284.989 258.578 282.635 1.00 44.59  ? 120 SER D O     1 
ATOM 3069  C CB    . SER D 4 120 ? 285.162 257.406 279.688 1.00 44.59  ? 120 SER D CB    1 
ATOM 3070  O OG    . SER D 4 120 ? 285.161 258.705 279.131 1.00 44.59  ? 120 SER D OG    1 
ATOM 3071  N N     . ALA D 4 121 ? 283.375 259.543 281.399 1.00 46.42  ? 121 ALA D N     1 
ATOM 3072  C CA    . ALA D 4 121 ? 283.326 260.729 282.245 1.00 46.42  ? 121 ALA D CA    1 
ATOM 3073  C C     . ALA D 4 121 ? 282.548 260.449 283.524 1.00 46.42  ? 121 ALA D C     1 
ATOM 3074  O O     . ALA D 4 121 ? 283.102 260.512 284.628 1.00 46.42  ? 121 ALA D O     1 
ATOM 3075  C CB    . ALA D 4 121 ? 282.707 261.896 281.476 1.00 46.42  ? 121 ALA D CB    1 
ATOM 3076  N N     . LYS D 4 122 ? 281.264 260.127 283.392 1.00 48.16  ? 122 LYS D N     1 
ATOM 3077  C CA    . LYS D 4 122 ? 280.437 259.698 284.517 1.00 48.16  ? 122 LYS D CA    1 
ATOM 3078  C C     . LYS D 4 122 ? 279.065 259.233 284.035 1.00 48.16  ? 122 LYS D C     1 
ATOM 3079  O O     . LYS D 4 122 ? 278.466 259.829 283.139 1.00 48.16  ? 122 LYS D O     1 
ATOM 3080  C CB    . LYS D 4 122 ? 280.275 260.821 285.545 1.00 48.16  ? 122 LYS D CB    1 
ATOM 3081  C CG    . LYS D 4 122 ? 280.683 260.429 286.960 1.00 48.16  ? 122 LYS D CG    1 
ATOM 3082  C CD    . LYS D 4 122 ? 280.807 261.646 287.865 1.00 48.16  ? 122 LYS D CD    1 
ATOM 3083  C CE    . LYS D 4 122 ? 281.962 262.536 287.439 1.00 48.16  ? 122 LYS D CE    1 
ATOM 3084  N NZ    . LYS D 4 122 ? 282.029 263.791 288.238 1.00 48.16  ? 122 LYS D NZ    1 
ATOM 3085  O OXT   . LYS D 4 122 ? 278.514 258.251 284.534 1.00 48.16  ? 122 LYS D OXT   1 
ATOM 3086  N N     . LYS E 1 37  ? 259.462 292.918 209.764 1.00 63.97  ? 37  LYS E N     1 
ATOM 3087  C CA    . LYS E 1 37  ? 259.068 291.620 210.295 1.00 63.97  ? 37  LYS E CA    1 
ATOM 3088  C C     . LYS E 1 37  ? 259.415 291.536 211.777 1.00 63.97  ? 37  LYS E C     1 
ATOM 3089  O O     . LYS E 1 37  ? 260.586 291.487 212.140 1.00 63.97  ? 37  LYS E O     1 
ATOM 3090  C CB    . LYS E 1 37  ? 259.747 290.494 209.516 1.00 63.97  ? 37  LYS E CB    1 
ATOM 3091  C CG    . LYS E 1 37  ? 259.270 289.103 209.880 1.00 63.97  ? 37  LYS E CG    1 
ATOM 3092  C CD    . LYS E 1 37  ? 257.777 288.956 209.657 1.00 63.97  ? 37  LYS E CD    1 
ATOM 3093  C CE    . LYS E 1 37  ? 257.335 287.511 209.821 1.00 63.97  ? 37  LYS E CE    1 
ATOM 3094  N NZ    . LYS E 1 37  ? 255.850 287.378 209.830 1.00 63.97  ? 37  LYS E NZ    1 
ATOM 3095  N N     . PRO E 1 38  ? 258.392 291.533 212.629 1.00 62.64  ? 38  PRO E N     1 
ATOM 3096  C CA    . PRO E 1 38  ? 258.638 291.545 214.073 1.00 62.64  ? 38  PRO E CA    1 
ATOM 3097  C C     . PRO E 1 38  ? 259.262 290.244 214.547 1.00 62.64  ? 38  PRO E C     1 
ATOM 3098  O O     . PRO E 1 38  ? 259.141 289.196 213.909 1.00 62.64  ? 38  PRO E O     1 
ATOM 3099  C CB    . PRO E 1 38  ? 257.240 291.742 214.666 1.00 62.64  ? 38  PRO E CB    1 
ATOM 3100  C CG    . PRO E 1 38  ? 256.328 291.174 213.641 1.00 62.64  ? 38  PRO E CG    1 
ATOM 3101  C CD    . PRO E 1 38  ? 256.956 291.492 212.314 1.00 62.64  ? 38  PRO E CD    1 
ATOM 3102  N N     . HIS E 1 39  ? 259.944 290.328 215.683 1.00 60.43  ? 39  HIS E N     1 
ATOM 3103  C CA    . HIS E 1 39  ? 260.666 289.180 216.211 1.00 60.43  ? 39  HIS E CA    1 
ATOM 3104  C C     . HIS E 1 39  ? 259.705 288.150 216.792 1.00 60.43  ? 39  HIS E C     1 
ATOM 3105  O O     . HIS E 1 39  ? 258.745 288.493 217.485 1.00 60.43  ? 39  HIS E O     1 
ATOM 3106  C CB    . HIS E 1 39  ? 261.654 289.635 217.281 1.00 60.43  ? 39  HIS E CB    1 
ATOM 3107  C CG    . HIS E 1 39  ? 262.492 288.531 217.840 1.00 60.43  ? 39  HIS E CG    1 
ATOM 3108  N ND1   . HIS E 1 39  ? 263.730 288.207 217.331 1.00 60.43  ? 39  HIS E ND1   1 
ATOM 3109  C CD2   . HIS E 1 39  ? 262.272 287.680 218.868 1.00 60.43  ? 39  HIS E CD2   1 
ATOM 3110  C CE1   . HIS E 1 39  ? 264.237 287.202 218.021 1.00 60.43  ? 39  HIS E CE1   1 
ATOM 3111  N NE2   . HIS E 1 39  ? 263.371 286.863 218.959 1.00 60.43  ? 39  HIS E NE2   1 
ATOM 3112  N N     . ARG E 1 40  ? 259.973 286.878 216.511 1.00 53.38  ? 40  ARG E N     1 
ATOM 3113  C CA    . ARG E 1 40  ? 259.242 285.784 217.134 1.00 53.38  ? 40  ARG E CA    1 
ATOM 3114  C C     . ARG E 1 40  ? 260.206 284.667 217.478 1.00 53.38  ? 40  ARG E C     1 
ATOM 3115  O O     . ARG E 1 40  ? 260.948 284.195 216.614 1.00 53.38  ? 40  ARG E O     1 
ATOM 3116  C CB    . ARG E 1 40  ? 258.141 285.238 216.225 1.00 53.38  ? 40  ARG E CB    1 
ATOM 3117  C CG    . ARG E 1 40  ? 256.947 286.138 216.096 1.00 53.38  ? 40  ARG E CG    1 
ATOM 3118  C CD    . ARG E 1 40  ? 255.841 285.433 215.362 1.00 53.38  ? 40  ARG E CD    1 
ATOM 3119  N NE    . ARG E 1 40  ? 255.393 284.245 216.077 1.00 53.38  ? 40  ARG E NE    1 
ATOM 3120  C CZ    . ARG E 1 40  ? 254.430 284.247 216.987 1.00 53.38  ? 40  ARG E CZ    1 
ATOM 3121  N NH1   . ARG E 1 40  ? 253.814 285.376 217.300 1.00 53.38  ? 40  ARG E NH1   1 
ATOM 3122  N NH2   . ARG E 1 40  ? 254.083 283.119 217.582 1.00 53.38  ? 40  ARG E NH2   1 
ATOM 3123  N N     . TYR E 1 41  ? 260.189 284.245 218.733 1.00 55.99  ? 41  TYR E N     1 
ATOM 3124  C CA    . TYR E 1 41  ? 260.878 283.028 219.107 1.00 55.99  ? 41  TYR E CA    1 
ATOM 3125  C C     . TYR E 1 41  ? 260.114 281.826 218.579 1.00 55.99  ? 41  TYR E C     1 
ATOM 3126  O O     . TYR E 1 41  ? 258.904 281.878 218.360 1.00 55.99  ? 41  TYR E O     1 
ATOM 3127  C CB    . TYR E 1 41  ? 261.035 282.937 220.620 1.00 55.99  ? 41  TYR E CB    1 
ATOM 3128  C CG    . TYR E 1 41  ? 262.057 283.894 221.163 1.00 55.99  ? 41  TYR E CG    1 
ATOM 3129  C CD1   . TYR E 1 41  ? 263.404 283.666 220.979 1.00 55.99  ? 41  TYR E CD1   1 
ATOM 3130  C CD2   . TYR E 1 41  ? 261.676 285.030 221.850 1.00 55.99  ? 41  TYR E CD2   1 
ATOM 3131  C CE1   . TYR E 1 41  ? 264.339 284.536 221.466 1.00 55.99  ? 41  TYR E CE1   1 
ATOM 3132  C CE2   . TYR E 1 41  ? 262.604 285.902 222.342 1.00 55.99  ? 41  TYR E CE2   1 
ATOM 3133  C CZ    . TYR E 1 41  ? 263.936 285.652 222.145 1.00 55.99  ? 41  TYR E CZ    1 
ATOM 3134  O OH    . TYR E 1 41  ? 264.877 286.522 222.632 1.00 55.99  ? 41  TYR E OH    1 
ATOM 3135  N N     . ARG E 1 42  ? 260.840 280.741 218.360 1.00 57.05  ? 42  ARG E N     1 
ATOM 3136  C CA    . ARG E 1 42  ? 260.236 279.539 217.834 1.00 57.05  ? 42  ARG E CA    1 
ATOM 3137  C C     . ARG E 1 42  ? 259.500 278.782 218.937 1.00 57.05  ? 42  ARG E C     1 
ATOM 3138  O O     . ARG E 1 42  ? 259.783 278.958 220.121 1.00 57.05  ? 42  ARG E O     1 
ATOM 3139  C CB    . ARG E 1 42  ? 261.309 278.679 217.182 1.00 57.05  ? 42  ARG E CB    1 
ATOM 3140  C CG    . ARG E 1 42  ? 261.798 279.273 215.881 1.00 57.05  ? 42  ARG E CG    1 
ATOM 3141  C CD    . ARG E 1 42  ? 263.207 278.857 215.570 1.00 57.05  ? 42  ARG E CD    1 
ATOM 3142  N NE    . ARG E 1 42  ? 263.384 277.427 215.755 1.00 57.05  ? 42  ARG E NE    1 
ATOM 3143  C CZ    . ARG E 1 42  ? 263.093 276.522 214.832 1.00 57.05  ? 42  ARG E CZ    1 
ATOM 3144  N NH1   . ARG E 1 42  ? 262.618 276.907 213.656 1.00 57.05  ? 42  ARG E NH1   1 
ATOM 3145  N NH2   . ARG E 1 42  ? 263.281 275.237 215.082 1.00 57.05  ? 42  ARG E NH2   1 
ATOM 3146  N N     . PRO E 1 43  ? 258.553 277.934 218.571 1.00 48.60  ? 43  PRO E N     1 
ATOM 3147  C CA    . PRO E 1 43  ? 257.687 277.308 219.578 1.00 48.60  ? 43  PRO E CA    1 
ATOM 3148  C C     . PRO E 1 43  ? 258.393 276.271 220.431 1.00 48.60  ? 43  PRO E C     1 
ATOM 3149  O O     . PRO E 1 43  ? 258.487 275.100 220.061 1.00 48.60  ? 43  PRO E O     1 
ATOM 3150  C CB    . PRO E 1 43  ? 256.568 276.676 218.742 1.00 48.60  ? 43  PRO E CB    1 
ATOM 3151  C CG    . PRO E 1 43  ? 257.064 276.667 217.369 1.00 48.60  ? 43  PRO E CG    1 
ATOM 3152  C CD    . PRO E 1 43  ? 257.999 277.790 217.219 1.00 48.60  ? 43  PRO E CD    1 
ATOM 3153  N N     . GLY E 1 44  ? 258.936 276.717 221.556 1.00 46.18  ? 44  GLY E N     1 
ATOM 3154  C CA    . GLY E 1 44  ? 259.615 275.855 222.498 1.00 46.18  ? 44  GLY E CA    1 
ATOM 3155  C C     . GLY E 1 44  ? 260.756 276.584 223.165 1.00 46.18  ? 44  GLY E C     1 
ATOM 3156  O O     . GLY E 1 44  ? 261.199 276.202 224.249 1.00 46.18  ? 44  GLY E O     1 
ATOM 3157  N N     . THR E 1 45  ? 261.212 277.664 222.534 1.00 48.98  ? 45  THR E N     1 
ATOM 3158  C CA    . THR E 1 45  ? 262.283 278.470 223.105 1.00 48.98  ? 45  THR E CA    1 
ATOM 3159  C C     . THR E 1 45  ? 261.826 279.149 224.386 1.00 48.98  ? 45  THR E C     1 
ATOM 3160  O O     . THR E 1 45  ? 262.485 279.055 225.427 1.00 48.98  ? 45  THR E O     1 
ATOM 3161  C CB    . THR E 1 45  ? 262.750 279.499 222.079 1.00 48.98  ? 45  THR E CB    1 
ATOM 3162  O OG1   . THR E 1 45  ? 263.137 278.824 220.882 1.00 48.98  ? 45  THR E OG1   1 
ATOM 3163  C CG2   . THR E 1 45  ? 263.925 280.285 222.601 1.00 48.98  ? 45  THR E CG2   1 
ATOM 3164  N N     . VAL E 1 46  ? 260.690 279.840 224.325 1.00 44.26  ? 46  VAL E N     1 
ATOM 3165  C CA    . VAL E 1 46  ? 260.146 280.488 225.507 1.00 44.26  ? 46  VAL E CA    1 
ATOM 3166  C C     . VAL E 1 46  ? 259.700 279.456 226.530 1.00 44.26  ? 46  VAL E C     1 
ATOM 3167  O O     . VAL E 1 46  ? 259.762 279.704 227.736 1.00 44.26  ? 46  VAL E O     1 
ATOM 3168  C CB    . VAL E 1 46  ? 259.004 281.429 225.096 1.00 44.26  ? 46  VAL E CB    1 
ATOM 3169  C CG1   . VAL E 1 46  ? 258.385 282.079 226.304 1.00 44.26  ? 46  VAL E CG1   1 
ATOM 3170  C CG2   . VAL E 1 46  ? 259.523 282.468 224.135 1.00 44.26  ? 46  VAL E CG2   1 
ATOM 3171  N N     . ALA E 1 47  ? 259.264 278.280 226.079 1.00 42.07  ? 47  ALA E N     1 
ATOM 3172  C CA    . ALA E 1 47  ? 258.897 277.226 227.016 1.00 42.07  ? 47  ALA E CA    1 
ATOM 3173  C C     . ALA E 1 47  ? 260.103 276.757 227.818 1.00 42.07  ? 47  ALA E C     1 
ATOM 3174  O O     . ALA E 1 47  ? 260.022 276.606 229.040 1.00 42.07  ? 47  ALA E O     1 
ATOM 3175  C CB    . ALA E 1 47  ? 258.259 276.057 226.273 1.00 42.07  ? 47  ALA E CB    1 
ATOM 3176  N N     . LEU E 1 48  ? 261.237 276.543 227.150 1.00 42.29  ? 48  LEU E N     1 
ATOM 3177  C CA    . LEU E 1 48  ? 262.449 276.146 227.858 1.00 42.29  ? 48  LEU E CA    1 
ATOM 3178  C C     . LEU E 1 48  ? 262.947 277.259 228.764 1.00 42.29  ? 48  LEU E C     1 
ATOM 3179  O O     . LEU E 1 48  ? 263.445 276.999 229.867 1.00 42.29  ? 48  LEU E O     1 
ATOM 3180  C CB    . LEU E 1 48  ? 263.530 275.750 226.859 1.00 42.29  ? 48  LEU E CB    1 
ATOM 3181  C CG    . LEU E 1 48  ? 263.344 274.395 226.196 1.00 42.29  ? 48  LEU E CG    1 
ATOM 3182  C CD1   . LEU E 1 48  ? 264.073 274.364 224.878 1.00 42.29  ? 48  LEU E CD1   1 
ATOM 3183  C CD2   . LEU E 1 48  ? 263.855 273.311 227.107 1.00 42.29  ? 48  LEU E CD2   1 
ATOM 3184  N N     . ARG E 1 49  ? 262.833 278.505 228.309 1.00 47.71  ? 49  ARG E N     1 
ATOM 3185  C CA    . ARG E 1 49  ? 263.191 279.637 229.151 1.00 47.71  ? 49  ARG E CA    1 
ATOM 3186  C C     . ARG E 1 49  ? 262.356 279.654 230.424 1.00 47.71  ? 49  ARG E C     1 
ATOM 3187  O O     . ARG E 1 49  ? 262.878 279.876 231.520 1.00 47.71  ? 49  ARG E O     1 
ATOM 3188  C CB    . ARG E 1 49  ? 263.017 280.931 228.368 1.00 47.71  ? 49  ARG E CB    1 
ATOM 3189  C CG    . ARG E 1 49  ? 263.903 282.045 228.839 1.00 47.71  ? 49  ARG E CG    1 
ATOM 3190  C CD    . ARG E 1 49  ? 264.194 282.991 227.705 1.00 47.71  ? 49  ARG E CD    1 
ATOM 3191  N NE    . ARG E 1 49  ? 263.014 283.741 227.306 1.00 47.71  ? 49  ARG E NE    1 
ATOM 3192  C CZ    . ARG E 1 49  ? 262.751 284.084 226.054 1.00 47.71  ? 49  ARG E CZ    1 
ATOM 3193  N NH1   . ARG E 1 49  ? 263.580 283.728 225.085 1.00 47.71  ? 49  ARG E NH1   1 
ATOM 3194  N NH2   . ARG E 1 49  ? 261.659 284.771 225.773 1.00 47.71  ? 49  ARG E NH2   1 
ATOM 3195  N N     . GLU E 1 50  ? 261.053 279.402 230.295 1.00 41.15  ? 50  GLU E N     1 
ATOM 3196  C CA    . GLU E 1 50  ? 260.184 279.322 231.463 1.00 41.15  ? 50  GLU E CA    1 
ATOM 3197  C C     . GLU E 1 50  ? 260.579 278.172 232.374 1.00 41.15  ? 50  GLU E C     1 
ATOM 3198  O O     . GLU E 1 50  ? 260.550 278.310 233.599 1.00 41.15  ? 50  GLU E O     1 
ATOM 3199  C CB    . GLU E 1 50  ? 258.732 279.155 231.034 1.00 41.15  ? 50  GLU E CB    1 
ATOM 3200  C CG    . GLU E 1 50  ? 258.083 280.389 230.471 1.00 41.15  ? 50  GLU E CG    1 
ATOM 3201  C CD    . GLU E 1 50  ? 256.698 280.103 229.932 1.00 41.15  ? 50  GLU E CD    1 
ATOM 3202  O OE1   . GLU E 1 50  ? 256.536 280.040 228.696 1.00 41.15  ? 50  GLU E OE1   1 
ATOM 3203  O OE2   . GLU E 1 50  ? 255.766 279.924 230.743 1.00 41.15  ? 50  GLU E OE2   1 
ATOM 3204  N N     . ILE E 1 51  ? 260.884 277.009 231.799 1.00 37.79  ? 51  ILE E N     1 
ATOM 3205  C CA    . ILE E 1 51  ? 261.318 275.880 232.616 1.00 37.79  ? 51  ILE E CA    1 
ATOM 3206  C C     . ILE E 1 51  ? 262.512 276.280 233.464 1.00 37.79  ? 51  ILE E C     1 
ATOM 3207  O O     . ILE E 1 51  ? 262.541 276.046 234.675 1.00 37.79  ? 51  ILE E O     1 
ATOM 3208  C CB    . ILE E 1 51  ? 261.650 274.660 231.744 1.00 37.79  ? 51  ILE E CB    1 
ATOM 3209  C CG1   . ILE E 1 51  ? 260.399 274.109 231.080 1.00 37.79  ? 51  ILE E CG1   1 
ATOM 3210  C CG2   . ILE E 1 51  ? 262.291 273.582 232.586 1.00 37.79  ? 51  ILE E CG2   1 
ATOM 3211  C CD1   . ILE E 1 51  ? 260.688 272.991 230.130 1.00 37.79  ? 51  ILE E CD1   1 
ATOM 3212  N N     . ARG E 1 52  ? 263.515 276.889 232.837 1.00 40.03  ? 52  ARG E N     1 
ATOM 3213  C CA    . ARG E 1 52  ? 264.702 277.299 233.578 1.00 40.03  ? 52  ARG E CA    1 
ATOM 3214  C C     . ARG E 1 52  ? 264.355 278.318 234.655 1.00 40.03  ? 52  ARG E C     1 
ATOM 3215  O O     . ARG E 1 52  ? 264.800 278.201 235.802 1.00 40.03  ? 52  ARG E O     1 
ATOM 3216  C CB    . ARG E 1 52  ? 265.750 277.848 232.620 1.00 40.03  ? 52  ARG E CB    1 
ATOM 3217  C CG    . ARG E 1 52  ? 266.259 276.805 231.674 1.00 40.03  ? 52  ARG E CG    1 
ATOM 3218  C CD    . ARG E 1 52  ? 267.375 277.325 230.821 1.00 40.03  ? 52  ARG E CD    1 
ATOM 3219  N NE    . ARG E 1 52  ? 267.901 276.267 229.972 1.00 40.03  ? 52  ARG E NE    1 
ATOM 3220  C CZ    . ARG E 1 52  ? 267.547 276.081 228.708 1.00 40.03  ? 52  ARG E CZ    1 
ATOM 3221  N NH1   . ARG E 1 52  ? 266.674 276.896 228.136 1.00 40.03  ? 52  ARG E NH1   1 
ATOM 3222  N NH2   . ARG E 1 52  ? 268.074 275.084 228.014 1.00 40.03  ? 52  ARG E NH2   1 
ATOM 3223  N N     . ARG E 1 53  ? 263.528 279.303 234.313 1.00 39.17  ? 53  ARG E N     1 
ATOM 3224  C CA    . ARG E 1 53  ? 263.149 280.334 235.274 1.00 39.17  ? 53  ARG E CA    1 
ATOM 3225  C C     . ARG E 1 53  ? 262.473 279.737 236.507 1.00 39.17  ? 53  ARG E C     1 
ATOM 3226  O O     . ARG E 1 53  ? 262.880 279.999 237.648 1.00 39.17  ? 53  ARG E O     1 
ATOM 3227  C CB    . ARG E 1 53  ? 262.232 281.342 234.594 1.00 39.17  ? 53  ARG E CB    1 
ATOM 3228  C CG    . ARG E 1 53  ? 261.719 282.398 235.516 1.00 39.17  ? 53  ARG E CG    1 
ATOM 3229  C CD    . ARG E 1 53  ? 260.529 283.102 234.935 1.00 39.17  ? 53  ARG E CD    1 
ATOM 3230  N NE    . ARG E 1 53  ? 260.053 284.143 235.833 1.00 39.17  ? 53  ARG E NE    1 
ATOM 3231  C CZ    . ARG E 1 53  ? 258.972 284.880 235.619 1.00 39.17  ? 53  ARG E CZ    1 
ATOM 3232  N NH1   . ARG E 1 53  ? 258.242 284.688 234.530 1.00 39.17  ? 53  ARG E NH1   1 
ATOM 3233  N NH2   . ARG E 1 53  ? 258.618 285.805 236.498 1.00 39.17  ? 53  ARG E NH2   1 
ATOM 3234  N N     . TYR E 1 54  ? 261.451 278.912 236.298 1.00 37.15  ? 54  TYR E N     1 
ATOM 3235  C CA    . TYR E 1 54  ? 260.668 278.406 237.417 1.00 37.15  ? 54  TYR E CA    1 
ATOM 3236  C C     . TYR E 1 54  ? 261.343 277.267 238.154 1.00 37.15  ? 54  TYR E C     1 
ATOM 3237  O O     . TYR E 1 54  ? 261.008 277.026 239.315 1.00 37.15  ? 54  TYR E O     1 
ATOM 3238  C CB    . TYR E 1 54  ? 259.286 277.968 236.944 1.00 37.15  ? 54  TYR E CB    1 
ATOM 3239  C CG    . TYR E 1 54  ? 258.493 279.129 236.446 1.00 37.15  ? 54  TYR E CG    1 
ATOM 3240  C CD1   . TYR E 1 54  ? 258.211 280.197 237.278 1.00 37.15  ? 54  TYR E CD1   1 
ATOM 3241  C CD2   . TYR E 1 54  ? 258.047 279.179 235.144 1.00 37.15  ? 54  TYR E CD2   1 
ATOM 3242  C CE1   . TYR E 1 54  ? 257.506 281.269 236.828 1.00 37.15  ? 54  TYR E CE1   1 
ATOM 3243  C CE2   . TYR E 1 54  ? 257.342 280.246 234.686 1.00 37.15  ? 54  TYR E CE2   1 
ATOM 3244  C CZ    . TYR E 1 54  ? 257.069 281.288 235.530 1.00 37.15  ? 54  TYR E CZ    1 
ATOM 3245  O OH    . TYR E 1 54  ? 256.355 282.362 235.071 1.00 37.15  ? 54  TYR E OH    1 
ATOM 3246  N N     . GLN E 1 55  ? 262.271 276.555 237.527 1.00 37.58  ? 55  GLN E N     1 
ATOM 3247  C CA    . GLN E 1 55  ? 263.069 275.619 238.296 1.00 37.58  ? 55  GLN E CA    1 
ATOM 3248  C C     . GLN E 1 55  ? 264.178 276.322 239.049 1.00 37.58  ? 55  GLN E C     1 
ATOM 3249  O O     . GLN E 1 55  ? 264.744 275.743 239.979 1.00 37.58  ? 55  GLN E O     1 
ATOM 3250  C CB    . GLN E 1 55  ? 263.652 274.540 237.391 1.00 37.58  ? 55  GLN E CB    1 
ATOM 3251  C CG    . GLN E 1 55  ? 262.611 273.650 236.789 1.00 37.58  ? 55  GLN E CG    1 
ATOM 3252  C CD    . GLN E 1 55  ? 263.193 272.420 236.168 1.00 37.58  ? 55  GLN E CD    1 
ATOM 3253  O OE1   . GLN E 1 55  ? 264.316 272.430 235.688 1.00 37.58  ? 55  GLN E OE1   1 
ATOM 3254  N NE2   . GLN E 1 55  ? 262.432 271.343 236.176 1.00 37.58  ? 55  GLN E NE2   1 
ATOM 3255  N N     . LYS E 1 56  ? 264.499 277.552 238.664 1.00 38.93  ? 56  LYS E N     1 
ATOM 3256  C CA    . LYS E 1 56  ? 265.439 278.344 239.436 1.00 38.93  ? 56  LYS E CA    1 
ATOM 3257  C C     . LYS E 1 56  ? 264.782 278.985 240.649 1.00 38.93  ? 56  LYS E C     1 
ATOM 3258  O O     . LYS E 1 56  ? 265.410 279.073 241.706 1.00 38.93  ? 56  LYS E O     1 
ATOM 3259  C CB    . LYS E 1 56  ? 266.060 279.406 238.531 1.00 38.93  ? 56  LYS E CB    1 
ATOM 3260  C CG    . LYS E 1 56  ? 267.094 280.272 239.181 1.00 38.93  ? 56  LYS E CG    1 
ATOM 3261  C CD    . LYS E 1 56  ? 267.626 281.284 238.191 1.00 38.93  ? 56  LYS E CD    1 
ATOM 3262  C CE    . LYS E 1 56  ? 268.472 282.330 238.885 1.00 38.93  ? 56  LYS E CE    1 
ATOM 3263  N NZ    . LYS E 1 56  ? 269.555 281.705 239.689 1.00 38.93  ? 56  LYS E NZ    1 
ATOM 3264  N N     . SER E 1 57  ? 263.528 279.412 240.536 1.00 38.74  ? 57  SER E N     1 
ATOM 3265  C CA    . SER E 1 57  ? 262.894 280.142 241.627 1.00 38.74  ? 57  SER E CA    1 
ATOM 3266  C C     . SER E 1 57  ? 262.191 279.201 242.607 1.00 38.74  ? 57  SER E C     1 
ATOM 3267  O O     . SER E 1 57  ? 262.065 277.999 242.380 1.00 38.74  ? 57  SER E O     1 
ATOM 3268  C CB    . SER E 1 57  ? 261.907 281.163 241.074 1.00 38.74  ? 57  SER E CB    1 
ATOM 3269  O OG    . SER E 1 57  ? 260.760 280.529 240.548 1.00 38.74  ? 57  SER E OG    1 
ATOM 3270  N N     . THR E 1 58  ? 261.733 279.769 243.727 1.00 38.68  ? 58  THR E N     1 
ATOM 3271  C CA    . THR E 1 58  ? 261.032 278.994 244.742 1.00 38.68  ? 58  THR E CA    1 
ATOM 3272  C C     . THR E 1 58  ? 259.675 279.555 245.133 1.00 38.68  ? 58  THR E C     1 
ATOM 3273  O O     . THR E 1 58  ? 258.974 278.917 245.922 1.00 38.68  ? 58  THR E O     1 
ATOM 3274  C CB    . THR E 1 58  ? 261.871 278.872 246.022 1.00 38.68  ? 58  THR E CB    1 
ATOM 3275  O OG1   . THR E 1 58  ? 262.132 280.176 246.551 1.00 38.68  ? 58  THR E OG1   1 
ATOM 3276  C CG2   . THR E 1 58  ? 263.171 278.179 245.746 1.00 38.68  ? 58  THR E CG2   1 
ATOM 3277  N N     . GLU E 1 59  ? 259.289 280.720 244.629 1.00 39.05  ? 59  GLU E N     1 
ATOM 3278  C CA    . GLU E 1 59  ? 258.043 281.326 245.060 1.00 39.05  ? 59  GLU E CA    1 
ATOM 3279  C C     . GLU E 1 59  ? 256.856 280.485 244.604 1.00 39.05  ? 59  GLU E C     1 
ATOM 3280  O O     . GLU E 1 59  ? 256.943 279.708 243.654 1.00 39.05  ? 59  GLU E O     1 
ATOM 3281  C CB    . GLU E 1 59  ? 257.927 282.750 244.518 1.00 39.05  ? 59  GLU E CB    1 
ATOM 3282  C CG    . GLU E 1 59  ? 257.318 282.867 243.132 1.00 39.05  ? 59  GLU E CG    1 
ATOM 3283  C CD    . GLU E 1 59  ? 258.267 282.487 242.015 1.00 39.05  ? 59  GLU E CD    1 
ATOM 3284  O OE1   . GLU E 1 59  ? 259.078 281.563 242.199 1.00 39.05  ? 59  GLU E OE1   1 
ATOM 3285  O OE2   . GLU E 1 59  ? 258.205 283.119 240.941 1.00 39.05  ? 59  GLU E OE2   1 
ATOM 3286  N N     . LEU E 1 60  ? 255.742 280.635 245.309 1.00 37.26  ? 60  LEU E N     1 
ATOM 3287  C CA    . LEU E 1 60  ? 254.535 279.910 244.943 1.00 37.26  ? 60  LEU E CA    1 
ATOM 3288  C C     . LEU E 1 60  ? 254.025 280.378 243.588 1.00 37.26  ? 60  LEU E C     1 
ATOM 3289  O O     . LEU E 1 60  ? 254.229 281.523 243.181 1.00 37.26  ? 60  LEU E O     1 
ATOM 3290  C CB    . LEU E 1 60  ? 253.454 280.091 246.003 1.00 37.26  ? 60  LEU E CB    1 
ATOM 3291  C CG    . LEU E 1 60  ? 253.676 279.315 247.300 1.00 37.26  ? 60  LEU E CG    1 
ATOM 3292  C CD1   . LEU E 1 60  ? 252.501 279.497 248.224 1.00 37.26  ? 60  LEU E CD1   1 
ATOM 3293  C CD2   . LEU E 1 60  ? 253.900 277.847 247.014 1.00 37.26  ? 60  LEU E CD2   1 
ATOM 3294  N N     . LEU E 1 61  ? 253.357 279.471 242.883 1.00 35.78  ? 61  LEU E N     1 
ATOM 3295  C CA    . LEU E 1 61  ? 252.980 279.711 241.502 1.00 35.78  ? 61  LEU E CA    1 
ATOM 3296  C C     . LEU E 1 61  ? 251.488 279.866 241.290 1.00 35.78  ? 61  LEU E C     1 
ATOM 3297  O O     . LEU E 1 61  ? 251.080 280.283 240.206 1.00 35.78  ? 61  LEU E O     1 
ATOM 3298  C CB    . LEU E 1 61  ? 253.500 278.576 240.613 1.00 35.78  ? 61  LEU E CB    1 
ATOM 3299  C CG    . LEU E 1 61  ? 255.022 278.444 240.620 1.00 35.78  ? 61  LEU E CG    1 
ATOM 3300  C CD1   . LEU E 1 61  ? 255.469 277.388 239.649 1.00 35.78  ? 61  LEU E CD1   1 
ATOM 3301  C CD2   . LEU E 1 61  ? 255.658 279.772 240.299 1.00 35.78  ? 61  LEU E CD2   1 
ATOM 3302  N N     . ILE E 1 62  ? 250.688 279.555 242.270 1.00 35.98  ? 62  ILE E N     1 
ATOM 3303  C CA    . ILE E 1 62  ? 249.253 279.794 242.230 1.00 35.98  ? 62  ILE E CA    1 
ATOM 3304  C C     . ILE E 1 62  ? 248.975 281.104 242.947 1.00 35.98  ? 62  ILE E C     1 
ATOM 3305  O O     . ILE E 1 62  ? 249.682 281.478 243.884 1.00 35.98  ? 62  ILE E O     1 
ATOM 3306  C CB    . ILE E 1 62  ? 248.490 278.614 242.862 1.00 35.98  ? 62  ILE E CB    1 
ATOM 3307  C CG1   . ILE E 1 62  ? 248.896 277.305 242.197 1.00 35.98  ? 62  ILE E CG1   1 
ATOM 3308  C CG2   . ILE E 1 62  ? 246.997 278.795 242.740 1.00 35.98  ? 62  ILE E CG2   1 
ATOM 3309  C CD1   . ILE E 1 62  ? 248.171 276.114 242.740 1.00 35.98  ? 62  ILE E CD1   1 
ATOM 3310  N N     . ARG E 1 63  ? 247.952 281.821 242.499 1.00 38.16  ? 63  ARG E N     1 
ATOM 3311  C CA    . ARG E 1 63  ? 247.564 283.055 243.165 1.00 38.16  ? 63  ARG E CA    1 
ATOM 3312  C C     . ARG E 1 63  ? 246.972 282.755 244.538 1.00 38.16  ? 63  ARG E C     1 
ATOM 3313  O O     . ARG E 1 63  ? 246.139 281.855 244.699 1.00 38.16  ? 63  ARG E O     1 
ATOM 3314  C CB    . ARG E 1 63  ? 246.557 283.828 242.317 1.00 38.16  ? 63  ARG E CB    1 
ATOM 3315  C CG    . ARG E 1 63  ? 246.982 284.138 240.898 1.00 38.16  ? 63  ARG E CG    1 
ATOM 3316  C CD    . ARG E 1 63  ? 247.957 285.294 240.839 1.00 38.16  ? 63  ARG E CD    1 
ATOM 3317  N NE    . ARG E 1 63  ? 249.319 284.851 241.080 1.00 38.16  ? 63  ARG E NE    1 
ATOM 3318  C CZ    . ARG E 1 63  ? 250.303 285.643 241.475 1.00 38.16  ? 63  ARG E CZ    1 
ATOM 3319  N NH1   . ARG E 1 63  ? 250.074 286.930 241.680 1.00 38.16  ? 63  ARG E NH1   1 
ATOM 3320  N NH2   . ARG E 1 63  ? 251.514 285.144 241.672 1.00 38.16  ? 63  ARG E NH2   1 
ATOM 3321  N N     . LYS E 1 64  ? 247.381 283.546 245.526 1.00 37.54  ? 64  LYS E N     1 
ATOM 3322  C CA    . LYS E 1 64  ? 247.084 283.223 246.914 1.00 37.54  ? 64  LYS E CA    1 
ATOM 3323  C C     . LYS E 1 64  ? 245.604 283.383 247.241 1.00 37.54  ? 64  LYS E C     1 
ATOM 3324  O O     . LYS E 1 64  ? 245.021 282.521 247.900 1.00 37.54  ? 64  LYS E O     1 
ATOM 3325  C CB    . LYS E 1 64  ? 247.951 284.076 247.838 1.00 37.54  ? 64  LYS E CB    1 
ATOM 3326  C CG    . LYS E 1 64  ? 249.428 283.763 247.705 1.00 37.54  ? 64  LYS E CG    1 
ATOM 3327  C CD    . LYS E 1 64  ? 250.202 284.121 248.952 1.00 37.54  ? 64  LYS E CD    1 
ATOM 3328  C CE    . LYS E 1 64  ? 250.160 285.612 249.219 1.00 37.54  ? 64  LYS E CE    1 
ATOM 3329  N NZ    . LYS E 1 64  ? 250.963 285.989 250.419 1.00 37.54  ? 64  LYS E NZ    1 
ATOM 3330  N N     . LEU E 1 65  ? 244.976 284.473 246.806 1.00 37.93  ? 65  LEU E N     1 
ATOM 3331  C CA    . LEU E 1 65  ? 243.552 284.643 247.085 1.00 37.93  ? 65  LEU E CA    1 
ATOM 3332  C C     . LEU E 1 65  ? 242.674 283.617 246.379 1.00 37.93  ? 65  LEU E C     1 
ATOM 3333  O O     . LEU E 1 65  ? 241.762 283.078 247.031 1.00 37.93  ? 65  LEU E O     1 
ATOM 3334  C CB    . LEU E 1 65  ? 243.105 286.066 246.731 1.00 37.93  ? 65  LEU E CB    1 
ATOM 3335  C CG    . LEU E 1 65  ? 243.469 287.201 247.679 1.00 37.93  ? 65  LEU E CG    1 
ATOM 3336  C CD1   . LEU E 1 65  ? 242.833 288.474 247.188 1.00 37.93  ? 65  LEU E CD1   1 
ATOM 3337  C CD2   . LEU E 1 65  ? 243.008 286.894 249.081 1.00 37.93  ? 65  LEU E CD2   1 
ATOM 3338  N N     . PRO E 1 66  ? 242.846 283.327 245.087 1.00 37.45  ? 66  PRO E N     1 
ATOM 3339  C CA    . PRO E 1 66  ? 242.099 282.205 244.509 1.00 37.45  ? 66  PRO E CA    1 
ATOM 3340  C C     . PRO E 1 66  ? 242.331 280.896 245.232 1.00 37.45  ? 66  PRO E C     1 
ATOM 3341  O O     . PRO E 1 66  ? 241.373 280.146 245.459 1.00 37.45  ? 66  PRO E O     1 
ATOM 3342  C CB    . PRO E 1 66  ? 242.616 282.162 243.070 1.00 37.45  ? 66  PRO E CB    1 
ATOM 3343  C CG    . PRO E 1 66  ? 242.964 283.540 242.784 1.00 37.45  ? 66  PRO E CG    1 
ATOM 3344  C CD    . PRO E 1 66  ? 243.554 284.080 244.041 1.00 37.45  ? 66  PRO E CD    1 
ATOM 3345  N N     . PHE E 1 67  ? 243.574 280.590 245.611 1.00 35.86  ? 67  PHE E N     1 
ATOM 3346  C CA    . PHE E 1 67  ? 243.799 279.330 246.307 1.00 35.86  ? 67  PHE E CA    1 
ATOM 3347  C C     . PHE E 1 67  ? 243.094 279.313 247.655 1.00 35.86  ? 67  PHE E C     1 
ATOM 3348  O O     . PHE E 1 67  ? 242.566 278.280 248.077 1.00 35.86  ? 67  PHE E O     1 
ATOM 3349  C CB    . PHE E 1 67  ? 245.287 279.068 246.490 1.00 35.86  ? 67  PHE E CB    1 
ATOM 3350  C CG    . PHE E 1 67  ? 245.574 277.754 247.135 1.00 35.86  ? 67  PHE E CG    1 
ATOM 3351  C CD1   . PHE E 1 67  ? 245.669 276.609 246.375 1.00 35.86  ? 67  PHE E CD1   1 
ATOM 3352  C CD2   . PHE E 1 67  ? 245.722 277.659 248.505 1.00 35.86  ? 67  PHE E CD2   1 
ATOM 3353  C CE1   . PHE E 1 67  ? 245.920 275.401 246.967 1.00 35.86  ? 67  PHE E CE1   1 
ATOM 3354  C CE2   . PHE E 1 67  ? 245.955 276.453 249.097 1.00 35.86  ? 67  PHE E CE2   1 
ATOM 3355  C CZ    . PHE E 1 67  ? 246.054 275.323 248.328 1.00 35.86  ? 67  PHE E CZ    1 
ATOM 3356  N N     . GLN E 1 68  ? 243.078 280.449 248.345 1.00 37.21  ? 68  GLN E N     1 
ATOM 3357  C CA    . GLN E 1 68  ? 242.428 280.517 249.644 1.00 37.21  ? 68  GLN E CA    1 
ATOM 3358  C C     . GLN E 1 68  ? 240.925 280.343 249.515 1.00 37.21  ? 68  GLN E C     1 
ATOM 3359  O O     . GLN E 1 68  ? 240.300 279.664 250.336 1.00 37.21  ? 68  GLN E O     1 
ATOM 3360  C CB    . GLN E 1 68  ? 242.758 281.842 250.313 1.00 37.21  ? 68  GLN E CB    1 
ATOM 3361  C CG    . GLN E 1 68  ? 242.160 281.998 251.674 1.00 37.21  ? 68  GLN E CG    1 
ATOM 3362  C CD    . GLN E 1 68  ? 242.790 283.126 252.434 1.00 37.21  ? 68  GLN E CD    1 
ATOM 3363  O OE1   . GLN E 1 68  ? 243.422 284.000 251.853 1.00 37.21  ? 68  GLN E OE1   1 
ATOM 3364  N NE2   . GLN E 1 68  ? 242.639 283.110 253.747 1.00 37.21  ? 68  GLN E NE2   1 
ATOM 3365  N N     . ARG E 1 69  ? 240.327 280.953 248.495 1.00 38.13  ? 69  ARG E N     1 
ATOM 3366  C CA    . ARG E 1 69  ? 238.907 280.737 248.256 1.00 38.13  ? 69  ARG E CA    1 
ATOM 3367  C C     . ARG E 1 69  ? 238.622 279.274 247.962 1.00 38.13  ? 69  ARG E C     1 
ATOM 3368  O O     . ARG E 1 69  ? 237.627 278.723 248.440 1.00 38.13  ? 69  ARG E O     1 
ATOM 3369  C CB    . ARG E 1 69  ? 238.419 281.621 247.115 1.00 38.13  ? 69  ARG E CB    1 
ATOM 3370  C CG    . ARG E 1 69  ? 238.258 283.065 247.500 1.00 38.13  ? 69  ARG E CG    1 
ATOM 3371  C CD    . ARG E 1 69  ? 237.440 283.813 246.476 1.00 38.13  ? 69  ARG E CD    1 
ATOM 3372  N NE    . ARG E 1 69  ? 238.124 283.896 245.195 1.00 38.13  ? 69  ARG E NE    1 
ATOM 3373  C CZ    . ARG E 1 69  ? 238.943 284.879 244.860 1.00 38.13  ? 69  ARG E CZ    1 
ATOM 3374  N NH1   . ARG E 1 69  ? 239.180 285.863 245.710 1.00 38.13  ? 69  ARG E NH1   1 
ATOM 3375  N NH2   . ARG E 1 69  ? 239.527 284.876 243.677 1.00 38.13  ? 69  ARG E NH2   1 
ATOM 3376  N N     . LEU E 1 70  ? 239.489 278.625 247.182 1.00 37.55  ? 70  LEU E N     1 
ATOM 3377  C CA    . LEU E 1 70  ? 239.296 277.205 246.907 1.00 37.55  ? 70  LEU E CA    1 
ATOM 3378  C C     . LEU E 1 70  ? 239.341 276.384 248.187 1.00 37.55  ? 70  LEU E C     1 
ATOM 3379  O O     . LEU E 1 70  ? 238.501 275.503 248.397 1.00 37.55  ? 70  LEU E O     1 
ATOM 3380  C CB    . LEU E 1 70  ? 240.347 276.710 245.920 1.00 37.55  ? 70  LEU E CB    1 
ATOM 3381  C CG    . LEU E 1 70  ? 240.342 275.212 245.643 1.00 37.55  ? 70  LEU E CG    1 
ATOM 3382  C CD1   . LEU E 1 70  ? 239.069 274.801 244.937 1.00 37.55  ? 70  LEU E CD1   1 
ATOM 3383  C CD2   . LEU E 1 70  ? 241.546 274.828 244.824 1.00 37.55  ? 70  LEU E CD2   1 
ATOM 3384  N N     . VAL E 1 71  ? 240.316 276.660 249.053 1.00 37.21  ? 71  VAL E N     1 
ATOM 3385  C CA    . VAL E 1 71  ? 240.446 275.914 250.301 1.00 37.21  ? 71  VAL E CA    1 
ATOM 3386  C C     . VAL E 1 71  ? 239.212 276.103 251.170 1.00 37.21  ? 71  VAL E C     1 
ATOM 3387  O O     . VAL E 1 71  ? 238.655 275.138 251.702 1.00 37.21  ? 71  VAL E O     1 
ATOM 3388  C CB    . VAL E 1 71  ? 241.727 276.328 251.042 1.00 37.21  ? 71  VAL E CB    1 
ATOM 3389  C CG1   . VAL E 1 71  ? 241.632 275.968 252.499 1.00 37.21  ? 71  VAL E CG1   1 
ATOM 3390  C CG2   . VAL E 1 71  ? 242.904 275.640 250.420 1.00 37.21  ? 71  VAL E CG2   1 
ATOM 3391  N N     . ARG E 1 72  ? 238.764 277.349 251.323 1.00 38.45  ? 72  ARG E N     1 
ATOM 3392  C CA    . ARG E 1 72  ? 237.609 277.606 252.176 1.00 38.45  ? 72  ARG E CA    1 
ATOM 3393  C C     . ARG E 1 72  ? 236.358 276.951 251.611 1.00 38.45  ? 72  ARG E C     1 
ATOM 3394  O O     . ARG E 1 72  ? 235.529 276.423 252.361 1.00 38.45  ? 72  ARG E O     1 
ATOM 3395  C CB    . ARG E 1 72  ? 237.413 279.108 252.351 1.00 38.45  ? 72  ARG E CB    1 
ATOM 3396  C CG    . ARG E 1 72  ? 238.484 279.747 253.196 1.00 38.45  ? 72  ARG E CG    1 
ATOM 3397  C CD    . ARG E 1 72  ? 238.288 281.229 253.340 1.00 38.45  ? 72  ARG E CD    1 
ATOM 3398  N NE    . ARG E 1 72  ? 239.427 281.842 254.005 1.00 38.45  ? 72  ARG E NE    1 
ATOM 3399  C CZ    . ARG E 1 72  ? 239.557 281.936 255.319 1.00 38.45  ? 72  ARG E CZ    1 
ATOM 3400  N NH1   . ARG E 1 72  ? 238.613 281.460 256.113 1.00 38.45  ? 72  ARG E NH1   1 
ATOM 3401  N NH2   . ARG E 1 72  ? 240.631 282.498 255.837 1.00 38.45  ? 72  ARG E NH2   1 
ATOM 3402  N N     . GLU E 1 73  ? 236.219 276.947 250.288 1.00 42.25  ? 73  GLU E N     1 
ATOM 3403  C CA    . GLU E 1 73  ? 235.059 276.318 249.674 1.00 42.25  ? 73  GLU E CA    1 
ATOM 3404  C C     . GLU E 1 73  ? 235.074 274.811 249.883 1.00 42.25  ? 73  GLU E C     1 
ATOM 3405  O O     . GLU E 1 73  ? 234.037 274.204 250.160 1.00 42.25  ? 73  GLU E O     1 
ATOM 3406  C CB    . GLU E 1 73  ? 235.013 276.657 248.189 1.00 42.25  ? 73  GLU E CB    1 
ATOM 3407  C CG    . GLU E 1 73  ? 234.258 275.649 247.361 1.00 42.25  ? 73  GLU E CG    1 
ATOM 3408  C CD    . GLU E 1 73  ? 234.251 275.998 245.894 1.00 42.25  ? 73  GLU E CD    1 
ATOM 3409  O OE1   . GLU E 1 73  ? 234.244 277.200 245.571 1.00 42.25  ? 73  GLU E OE1   1 
ATOM 3410  O OE2   . GLU E 1 73  ? 234.260 275.073 245.060 1.00 42.25  ? 73  GLU E OE2   1 
ATOM 3411  N N     . ILE E 1 74  ? 236.241 274.185 249.737 1.00 38.91  ? 74  ILE E N     1 
ATOM 3412  C CA    . ILE E 1 74  ? 236.335 272.748 249.977 1.00 38.91  ? 74  ILE E CA    1 
ATOM 3413  C C     . ILE E 1 74  ? 236.031 272.431 251.432 1.00 38.91  ? 74  ILE E C     1 
ATOM 3414  O O     . ILE E 1 74  ? 235.320 271.468 251.739 1.00 38.91  ? 74  ILE E O     1 
ATOM 3415  C CB    . ILE E 1 74  ? 237.718 272.224 249.562 1.00 38.91  ? 74  ILE E CB    1 
ATOM 3416  C CG1   . ILE E 1 74  ? 237.864 272.267 248.047 1.00 38.91  ? 74  ILE E CG1   1 
ATOM 3417  C CG2   . ILE E 1 74  ? 237.930 270.818 250.080 1.00 38.91  ? 74  ILE E CG2   1 
ATOM 3418  C CD1   . ILE E 1 74  ? 239.205 271.823 247.568 1.00 38.91  ? 74  ILE E CD1   1 
ATOM 3419  N N     . ALA E 1 75  ? 236.550 273.243 252.351 1.00 39.50  ? 75  ALA E N     1 
ATOM 3420  C CA    . ALA E 1 75  ? 236.340 272.990 253.767 1.00 39.50  ? 75  ALA E CA    1 
ATOM 3421  C C     . ALA E 1 75  ? 234.901 273.227 254.192 1.00 39.50  ? 75  ALA E C     1 
ATOM 3422  O O     . ALA E 1 75  ? 234.476 272.675 255.209 1.00 39.50  ? 75  ALA E O     1 
ATOM 3423  C CB    . ALA E 1 75  ? 237.278 273.855 254.599 1.00 39.50  ? 75  ALA E CB    1 
ATOM 3424  N N     . GLN E 1 76  ? 234.143 274.030 253.439 1.00 42.84  ? 76  GLN E N     1 
ATOM 3425  C CA    . GLN E 1 76  ? 232.726 274.203 253.742 1.00 42.84  ? 76  GLN E CA    1 
ATOM 3426  C C     . GLN E 1 76  ? 231.980 272.880 253.786 1.00 42.84  ? 76  GLN E C     1 
ATOM 3427  O O     . GLN E 1 76  ? 231.025 272.732 254.551 1.00 42.84  ? 76  GLN E O     1 
ATOM 3428  C CB    . GLN E 1 76  ? 232.070 275.110 252.709 1.00 42.84  ? 76  GLN E CB    1 
ATOM 3429  C CG    . GLN E 1 76  ? 232.191 276.572 252.999 1.00 42.84  ? 76  GLN E CG    1 
ATOM 3430  C CD    . GLN E 1 76  ? 231.752 277.411 251.824 1.00 42.84  ? 76  GLN E CD    1 
ATOM 3431  O OE1   . GLN E 1 76  ? 231.080 276.922 250.917 1.00 42.84  ? 76  GLN E OE1   1 
ATOM 3432  N NE2   . GLN E 1 76  ? 232.140 278.680 251.824 1.00 42.84  ? 76  GLN E NE2   1 
ATOM 3433  N N     . ASP E 1 77  ? 232.391 271.911 252.976 1.00 43.30  ? 77  ASP E N     1 
ATOM 3434  C CA    . ASP E 1 77  ? 231.690 270.638 252.914 1.00 43.30  ? 77  ASP E CA    1 
ATOM 3435  C C     . ASP E 1 77  ? 231.944 269.758 254.126 1.00 43.30  ? 77  ASP E C     1 
ATOM 3436  O O     . ASP E 1 77  ? 231.214 268.785 254.329 1.00 43.30  ? 77  ASP E O     1 
ATOM 3437  C CB    . ASP E 1 77  ? 232.089 269.886 251.649 1.00 43.30  ? 77  ASP E CB    1 
ATOM 3438  C CG    . ASP E 1 77  ? 231.636 270.588 250.392 1.00 43.30  ? 77  ASP E CG    1 
ATOM 3439  O OD1   . ASP E 1 77  ? 230.547 271.195 250.412 1.00 43.30  ? 77  ASP E OD1   1 
ATOM 3440  O OD2   . ASP E 1 77  ? 232.368 270.541 249.383 1.00 43.30  ? 77  ASP E OD2   1 
ATOM 3441  N N     . PHE E 1 78  ? 232.952 270.070 254.932 1.00 40.00  ? 78  PHE E N     1 
ATOM 3442  C CA    . PHE E 1 78  ? 233.291 269.240 256.076 1.00 40.00  ? 78  PHE E CA    1 
ATOM 3443  C C     . PHE E 1 78  ? 232.821 269.822 257.396 1.00 40.00  ? 78  PHE E C     1 
ATOM 3444  O O     . PHE E 1 78  ? 232.531 269.063 258.323 1.00 40.00  ? 78  PHE E O     1 
ATOM 3445  C CB    . PHE E 1 78  ? 234.802 269.018 256.125 1.00 40.00  ? 78  PHE E CB    1 
ATOM 3446  C CG    . PHE E 1 78  ? 235.351 268.388 254.887 1.00 40.00  ? 78  PHE E CG    1 
ATOM 3447  C CD1   . PHE E 1 78  ? 234.826 267.209 254.409 1.00 40.00  ? 78  PHE E CD1   1 
ATOM 3448  C CD2   . PHE E 1 78  ? 236.378 268.985 254.188 1.00 40.00  ? 78  PHE E CD2   1 
ATOM 3449  C CE1   . PHE E 1 78  ? 235.320 266.632 253.270 1.00 40.00  ? 78  PHE E CE1   1 
ATOM 3450  C CE2   . PHE E 1 78  ? 236.874 268.408 253.045 1.00 40.00  ? 78  PHE E CE2   1 
ATOM 3451  C CZ    . PHE E 1 78  ? 236.345 267.233 252.584 1.00 40.00  ? 78  PHE E CZ    1 
ATOM 3452  N N     . LYS E 1 79  ? 232.727 271.142 257.496 1.00 41.78  ? 79  LYS E N     1 
ATOM 3453  C CA    . LYS E 1 79  ? 232.257 271.806 258.701 1.00 41.78  ? 79  LYS E CA    1 
ATOM 3454  C C     . LYS E 1 79  ? 231.998 273.265 258.371 1.00 41.78  ? 79  LYS E C     1 
ATOM 3455  O O     . LYS E 1 79  ? 232.789 273.891 257.669 1.00 41.78  ? 79  LYS E O     1 
ATOM 3456  C CB    . LYS E 1 79  ? 233.278 271.686 259.836 1.00 41.78  ? 79  LYS E CB    1 
ATOM 3457  C CG    . LYS E 1 79  ? 232.875 272.417 261.090 1.00 41.78  ? 79  LYS E CG    1 
ATOM 3458  C CD    . LYS E 1 79  ? 233.979 272.420 262.113 1.00 41.78  ? 79  LYS E CD    1 
ATOM 3459  C CE    . LYS E 1 79  ? 233.535 273.147 263.365 1.00 41.78  ? 79  LYS E CE    1 
ATOM 3460  N NZ    . LYS E 1 79  ? 234.648 273.346 264.319 1.00 41.78  ? 79  LYS E NZ    1 
ATOM 3461  N N     . THR E 1 80  ? 230.892 273.793 258.871 1.00 43.37  ? 80  THR E N     1 
ATOM 3462  C CA    . THR E 1 80  ? 230.496 275.154 258.549 1.00 43.37  ? 80  THR E CA    1 
ATOM 3463  C C     . THR E 1 80  ? 231.172 276.155 259.474 1.00 43.37  ? 80  THR E C     1 
ATOM 3464  O O     . THR E 1 80  ? 231.513 275.852 260.618 1.00 43.37  ? 80  THR E O     1 
ATOM 3465  C CB    . THR E 1 80  ? 228.980 275.311 258.640 1.00 43.37  ? 80  THR E CB    1 
ATOM 3466  O OG1   . THR E 1 80  ? 228.535 274.900 259.937 1.00 43.37  ? 80  THR E OG1   1 
ATOM 3467  C CG2   . THR E 1 80  ? 228.300 274.464 257.586 1.00 43.37  ? 80  THR E CG2   1 
ATOM 3468  N N     . ASP E 1 81  ? 231.367 277.364 258.949 1.00 44.59  ? 81  ASP E N     1 
ATOM 3469  C CA    . ASP E 1 81  ? 231.906 278.497 259.703 1.00 44.59  ? 81  ASP E CA    1 
ATOM 3470  C C     . ASP E 1 81  ? 233.335 278.255 260.176 1.00 44.59  ? 81  ASP E C     1 
ATOM 3471  O O     . ASP E 1 81  ? 233.727 278.718 261.247 1.00 44.59  ? 81  ASP E O     1 
ATOM 3472  C CB    . ASP E 1 81  ? 231.011 278.848 260.894 1.00 44.59  ? 81  ASP E CB    1 
ATOM 3473  C CG    . ASP E 1 81  ? 229.583 279.136 260.487 1.00 44.59  ? 81  ASP E CG    1 
ATOM 3474  O OD1   . ASP E 1 81  ? 229.377 279.781 259.437 1.00 44.59  ? 81  ASP E OD1   1 
ATOM 3475  O OD2   . ASP E 1 81  ? 228.661 278.719 261.220 1.00 44.59  ? 81  ASP E OD2   1 
ATOM 3476  N N     . LEU E 1 82  ? 234.131 277.544 259.384 1.00 40.14  ? 82  LEU E N     1 
ATOM 3477  C CA    . LEU E 1 82  ? 235.516 277.291 259.752 1.00 40.14  ? 82  LEU E CA    1 
ATOM 3478  C C     . LEU E 1 82  ? 236.376 278.522 259.527 1.00 40.14  ? 82  LEU E C     1 
ATOM 3479  O O     . LEU E 1 82  ? 236.260 279.204 258.509 1.00 40.14  ? 82  LEU E O     1 
ATOM 3480  C CB    . LEU E 1 82  ? 236.084 276.132 258.941 1.00 40.14  ? 82  LEU E CB    1 
ATOM 3481  C CG    . LEU E 1 82  ? 235.895 274.721 259.470 1.00 40.14  ? 82  LEU E CG    1 
ATOM 3482  C CD1   . LEU E 1 82  ? 236.384 273.739 258.439 1.00 40.14  ? 82  LEU E CD1   1 
ATOM 3483  C CD2   . LEU E 1 82  ? 236.632 274.540 260.768 1.00 40.14  ? 82  LEU E CD2   1 
ATOM 3484  N N     . ARG E 1 83  ? 237.257 278.793 260.473 1.00 39.72  ? 83  ARG E N     1 
ATOM 3485  C CA    . ARG E 1 83  ? 238.300 279.783 260.286 1.00 39.72  ? 83  ARG E CA    1 
ATOM 3486  C C     . ARG E 1 83  ? 239.603 279.080 259.945 1.00 39.72  ? 83  ARG E C     1 
ATOM 3487  O O     . ARG E 1 83  ? 239.787 277.897 260.225 1.00 39.72  ? 83  ARG E O     1 
ATOM 3488  C CB    . ARG E 1 83  ? 238.469 280.642 261.534 1.00 39.72  ? 83  ARG E CB    1 
ATOM 3489  C CG    . ARG E 1 83  ? 237.232 281.414 261.881 1.00 39.72  ? 83  ARG E CG    1 
ATOM 3490  C CD    . ARG E 1 83  ? 237.302 281.941 263.283 1.00 39.72  ? 83  ARG E CD    1 
ATOM 3491  N NE    . ARG E 1 83  ? 237.750 283.324 263.342 1.00 39.72  ? 83  ARG E NE    1 
ATOM 3492  C CZ    . ARG E 1 83  ? 236.954 284.368 263.154 1.00 39.72  ? 83  ARG E CZ    1 
ATOM 3493  N NH1   . ARG E 1 83  ? 235.672 284.181 262.880 1.00 39.72  ? 83  ARG E NH1   1 
ATOM 3494  N NH2   . ARG E 1 83  ? 237.440 285.596 263.233 1.00 39.72  ? 83  ARG E NH2   1 
ATOM 3495  N N     . PHE E 1 84  ? 240.509 279.825 259.331 1.00 37.37  ? 84  PHE E N     1 
ATOM 3496  C CA    . PHE E 1 84  ? 241.793 279.290 258.915 1.00 37.37  ? 84  PHE E CA    1 
ATOM 3497  C C     . PHE E 1 84  ? 242.886 280.227 259.384 1.00 37.37  ? 84  PHE E C     1 
ATOM 3498  O O     . PHE E 1 84  ? 242.738 281.446 259.299 1.00 37.37  ? 84  PHE E O     1 
ATOM 3499  C CB    . PHE E 1 84  ? 241.864 279.124 257.395 1.00 37.37  ? 84  PHE E CB    1 
ATOM 3500  C CG    . PHE E 1 84  ? 241.215 277.881 256.893 1.00 37.37  ? 84  PHE E CG    1 
ATOM 3501  C CD1   . PHE E 1 84  ? 239.863 277.849 256.640 1.00 37.37  ? 84  PHE E CD1   1 
ATOM 3502  C CD2   . PHE E 1 84  ? 241.958 276.744 256.670 1.00 37.37  ? 84  PHE E CD2   1 
ATOM 3503  C CE1   . PHE E 1 84  ? 239.268 276.709 256.191 1.00 37.37  ? 84  PHE E CE1   1 
ATOM 3504  C CE2   . PHE E 1 84  ? 241.363 275.602 256.219 1.00 37.37  ? 84  PHE E CE2   1 
ATOM 3505  C CZ    . PHE E 1 84  ? 240.018 275.586 255.975 1.00 37.37  ? 84  PHE E CZ    1 
ATOM 3506  N N     . GLN E 1 85  ? 243.978 279.665 259.877 1.00 36.65  ? 85  GLN E N     1 
ATOM 3507  C CA    . GLN E 1 85  ? 245.169 280.466 260.084 1.00 36.65  ? 85  GLN E CA    1 
ATOM 3508  C C     . GLN E 1 85  ? 245.843 280.736 258.748 1.00 36.65  ? 85  GLN E C     1 
ATOM 3509  O O     . GLN E 1 85  ? 245.843 279.889 257.845 1.00 36.65  ? 85  GLN E O     1 
ATOM 3510  C CB    . GLN E 1 85  ? 246.136 279.764 261.025 1.00 36.65  ? 85  GLN E CB    1 
ATOM 3511  C CG    . GLN E 1 85  ? 245.675 279.687 262.447 1.00 36.65  ? 85  GLN E CG    1 
ATOM 3512  C CD    . GLN E 1 85  ? 246.692 279.014 263.336 1.00 36.65  ? 85  GLN E CD    1 
ATOM 3513  O OE1   . GLN E 1 85  ? 247.754 278.612 262.880 1.00 36.65  ? 85  GLN E OE1   1 
ATOM 3514  N NE2   . GLN E 1 85  ? 246.372 278.890 264.613 1.00 36.65  ? 85  GLN E NE2   1 
ATOM 3515  N N     . SER E 1 86  ? 246.396 281.941 258.619 1.00 36.60  ? 86  SER E N     1 
ATOM 3516  C CA    . SER E 1 86  ? 247.146 282.282 257.420 1.00 36.60  ? 86  SER E CA    1 
ATOM 3517  C C     . SER E 1 86  ? 248.194 281.225 257.127 1.00 36.60  ? 86  SER E C     1 
ATOM 3518  O O     . SER E 1 86  ? 248.381 280.820 255.977 1.00 36.60  ? 86  SER E O     1 
ATOM 3519  C CB    . SER E 1 86  ? 247.799 283.651 257.580 1.00 36.60  ? 86  SER E CB    1 
ATOM 3520  O OG    . SER E 1 86  ? 246.822 284.667 257.628 1.00 36.60  ? 86  SER E OG    1 
ATOM 3521  N N     . SER E 1 87  ? 248.877 280.755 258.166 1.00 35.56  ? 87  SER E N     1 
ATOM 3522  C CA    . SER E 1 87  ? 249.887 279.730 257.977 1.00 35.56  ? 87  SER E CA    1 
ATOM 3523  C C     . SER E 1 87  ? 249.272 278.395 257.585 1.00 35.56  ? 87  SER E C     1 
ATOM 3524  O O     . SER E 1 87  ? 249.916 277.614 256.891 1.00 35.56  ? 87  SER E O     1 
ATOM 3525  C CB    . SER E 1 87  ? 250.731 279.592 259.239 1.00 35.56  ? 87  SER E CB    1 
ATOM 3526  O OG    . SER E 1 87  ? 249.914 279.441 260.380 1.00 35.56  ? 87  SER E OG    1 
ATOM 3527  N N     . ALA E 1 88  ? 248.035 278.118 257.997 1.00 34.59  ? 88  ALA E N     1 
ATOM 3528  C CA    . ALA E 1 88  ? 247.378 276.888 257.563 1.00 34.59  ? 88  ALA E CA    1 
ATOM 3529  C C     . ALA E 1 88  ? 247.102 276.923 256.068 1.00 34.59  ? 88  ALA E C     1 
ATOM 3530  O O     . ALA E 1 88  ? 247.330 275.938 255.357 1.00 34.59  ? 88  ALA E O     1 
ATOM 3531  C CB    . ALA E 1 88  ? 246.087 276.666 258.348 1.00 34.59  ? 88  ALA E CB    1 
ATOM 3532  N N     . VAL E 1 89  ? 246.642 278.068 255.566 1.00 35.00  ? 89  VAL E N     1 
ATOM 3533  C CA    . VAL E 1 89  ? 246.433 278.197 254.126 1.00 35.00  ? 89  VAL E CA    1 
ATOM 3534  C C     . VAL E 1 89  ? 247.763 278.152 253.382 1.00 35.00  ? 89  VAL E C     1 
ATOM 3535  O O     . VAL E 1 89  ? 247.870 277.551 252.307 1.00 35.00  ? 89  VAL E O     1 
ATOM 3536  C CB    . VAL E 1 89  ? 245.648 279.481 253.813 1.00 35.00  ? 89  VAL E CB    1 
ATOM 3537  C CG1   . VAL E 1 89  ? 245.506 279.660 252.324 1.00 35.00  ? 89  VAL E CG1   1 
ATOM 3538  C CG2   . VAL E 1 89  ? 244.289 279.429 254.456 1.00 35.00  ? 89  VAL E CG2   1 
ATOM 3539  N N     . MET E 1 90  ? 248.798 278.780 253.937 1.00 35.99  ? 90  MET E N     1 
ATOM 3540  C CA    . MET E 1 90  ? 250.102 278.743 253.288 1.00 35.99  ? 90  MET E CA    1 
ATOM 3541  C C     . MET E 1 90  ? 250.672 277.331 253.260 1.00 35.99  ? 90  MET E C     1 
ATOM 3542  O O     . MET E 1 90  ? 251.298 276.933 252.274 1.00 35.99  ? 90  MET E O     1 
ATOM 3543  C CB    . MET E 1 90  ? 251.070 279.703 253.975 1.00 35.99  ? 90  MET E CB    1 
ATOM 3544  C CG    . MET E 1 90  ? 250.678 281.167 253.873 1.00 35.99  ? 90  MET E CG    1 
ATOM 3545  S SD    . MET E 1 90  ? 250.160 281.688 252.226 1.00 35.99  ? 90  MET E SD    1 
ATOM 3546  C CE    . MET E 1 90  ? 251.622 281.305 251.273 1.00 35.99  ? 90  MET E CE    1 
ATOM 3547  N N     . ALA E 1 91  ? 250.470 276.556 254.324 1.00 34.31  ? 91  ALA E N     1 
ATOM 3548  C CA    . ALA E 1 91  ? 250.940 275.178 254.325 1.00 34.31  ? 91  ALA E CA    1 
ATOM 3549  C C     . ALA E 1 91  ? 250.176 274.344 253.312 1.00 34.31  ? 91  ALA E C     1 
ATOM 3550  O O     . ALA E 1 91  ? 250.769 273.523 252.600 1.00 34.31  ? 91  ALA E O     1 
ATOM 3551  C CB    . ALA E 1 91  ? 250.810 274.573 255.718 1.00 34.31  ? 91  ALA E CB    1 
ATOM 3552  N N     . LEU E 1 92  ? 248.859 274.540 253.232 1.00 34.23  ? 92  LEU E N     1 
ATOM 3553  C CA    . LEU E 1 92  ? 248.082 273.870 252.197 1.00 34.23  ? 92  LEU E CA    1 
ATOM 3554  C C     . LEU E 1 92  ? 248.610 274.198 250.810 1.00 34.23  ? 92  LEU E C     1 
ATOM 3555  O O     . LEU E 1 92  ? 248.710 273.314 249.960 1.00 34.23  ? 92  LEU E O     1 
ATOM 3556  C CB    . LEU E 1 92  ? 246.611 274.249 252.305 1.00 34.23  ? 92  LEU E CB    1 
ATOM 3557  C CG    . LEU E 1 92  ? 245.865 273.445 253.358 1.00 34.23  ? 92  LEU E CG    1 
ATOM 3558  C CD1   . LEU E 1 92  ? 244.448 273.918 253.476 1.00 34.23  ? 92  LEU E CD1   1 
ATOM 3559  C CD2   . LEU E 1 92  ? 245.911 271.981 253.012 1.00 34.23  ? 92  LEU E CD2   1 
ATOM 3560  N N     . GLN E 1 93  ? 248.971 275.456 250.564 1.00 35.32  ? 93  GLN E N     1 
ATOM 3561  C CA    . GLN E 1 93  ? 249.413 275.817 249.224 1.00 35.32  ? 93  GLN E CA    1 
ATOM 3562  C C     . GLN E 1 93  ? 250.800 275.265 248.930 1.00 35.32  ? 93  GLN E C     1 
ATOM 3563  O O     . GLN E 1 93  ? 251.052 274.775 247.827 1.00 35.32  ? 93  GLN E O     1 
ATOM 3564  C CB    . GLN E 1 93  ? 249.376 277.327 249.037 1.00 35.32  ? 93  GLN E CB    1 
ATOM 3565  C CG    . GLN E 1 93  ? 249.369 277.724 247.583 1.00 35.32  ? 93  GLN E CG    1 
ATOM 3566  C CD    . GLN E 1 93  ? 249.108 279.191 247.383 1.00 35.32  ? 93  GLN E CD    1 
ATOM 3567  O OE1   . GLN E 1 93  ? 248.729 279.893 248.312 1.00 35.32  ? 93  GLN E OE1   1 
ATOM 3568  N NE2   . GLN E 1 93  ? 249.316 279.667 246.168 1.00 35.32  ? 93  GLN E NE2   1 
ATOM 3569  N N     . GLU E 1 94  ? 251.707 275.316 249.904 1.00 35.85  ? 94  GLU E N     1 
ATOM 3570  C CA    . GLU E 1 94  ? 253.010 274.683 249.731 1.00 35.85  ? 94  GLU E CA    1 
ATOM 3571  C C     . GLU E 1 94  ? 252.859 273.214 249.369 1.00 35.85  ? 94  GLU E C     1 
ATOM 3572  O O     . GLU E 1 94  ? 253.449 272.738 248.392 1.00 35.85  ? 94  GLU E O     1 
ATOM 3573  C CB    . GLU E 1 94  ? 253.842 274.832 251.000 1.00 35.85  ? 94  GLU E CB    1 
ATOM 3574  C CG    . GLU E 1 94  ? 254.400 276.213 251.220 1.00 35.85  ? 94  GLU E CG    1 
ATOM 3575  C CD    . GLU E 1 94  ? 255.550 276.535 250.290 1.00 35.85  ? 94  GLU E CD    1 
ATOM 3576  O OE1   . GLU E 1 94  ? 256.108 275.602 249.677 1.00 35.85  ? 94  GLU E OE1   1 
ATOM 3577  O OE2   . GLU E 1 94  ? 255.899 277.724 250.170 1.00 35.85  ? 94  GLU E OE2   1 
ATOM 3578  N N     . ALA E 1 95  ? 252.059 272.482 250.146 1.00 34.10  ? 95  ALA E N     1 
ATOM 3579  C CA    . ALA E 1 95  ? 251.885 271.059 249.890 1.00 34.10  ? 95  ALA E CA    1 
ATOM 3580  C C     . ALA E 1 95  ? 251.220 270.805 248.545 1.00 34.10  ? 95  ALA E C     1 
ATOM 3581  O O     . ALA E 1 95  ? 251.654 269.926 247.795 1.00 34.10  ? 95  ALA E O     1 
ATOM 3582  C CB    . ALA E 1 95  ? 251.080 270.419 251.013 1.00 34.10  ? 95  ALA E CB    1 
ATOM 3583  N N     . SER E 1 96  ? 250.161 271.554 248.224 1.00 34.17  ? 96  SER E N     1 
ATOM 3584  C CA    . SER E 1 96  ? 249.459 271.360 246.963 1.00 34.17  ? 96  SER E CA    1 
ATOM 3585  C C     . SER E 1 96  ? 250.386 271.587 245.785 1.00 34.17  ? 96  SER E C     1 
ATOM 3586  O O     . SER E 1 96  ? 250.377 270.814 244.823 1.00 34.17  ? 96  SER E O     1 
ATOM 3587  C CB    . SER E 1 96  ? 248.264 272.305 246.871 1.00 34.17  ? 96  SER E CB    1 
ATOM 3588  O OG    . SER E 1 96  ? 247.426 272.193 247.997 1.00 34.17  ? 96  SER E OG    1 
ATOM 3589  N N     . GLU E 1 97  ? 251.206 272.631 245.850 1.00 35.37  ? 97  GLU E N     1 
ATOM 3590  C CA    . GLU E 1 97  ? 252.067 272.947 244.723 1.00 35.37  ? 97  GLU E CA    1 
ATOM 3591  C C     . GLU E 1 97  ? 253.195 271.940 244.591 1.00 35.37  ? 97  GLU E C     1 
ATOM 3592  O O     . GLU E 1 97  ? 253.536 271.537 243.476 1.00 35.37  ? 97  GLU E O     1 
ATOM 3593  C CB    . GLU E 1 97  ? 252.605 274.363 244.860 1.00 35.37  ? 97  GLU E CB    1 
ATOM 3594  C CG    . GLU E 1 97  ? 251.523 275.412 244.776 1.00 35.37  ? 97  GLU E CG    1 
ATOM 3595  C CD    . GLU E 1 97  ? 252.051 276.750 244.329 1.00 35.37  ? 97  GLU E CD    1 
ATOM 3596  O OE1   . GLU E 1 97  ? 253.185 276.794 243.809 1.00 35.37  ? 97  GLU E OE1   1 
ATOM 3597  O OE2   . GLU E 1 97  ? 251.334 277.757 244.495 1.00 35.37  ? 97  GLU E OE2   1 
ATOM 3598  N N     . ALA E 1 98  ? 253.773 271.500 245.709 1.00 33.25  ? 98  ALA E N     1 
ATOM 3599  C CA    . ALA E 1 98  ? 254.782 270.453 245.625 1.00 33.25  ? 98  ALA E CA    1 
ATOM 3600  C C     . ALA E 1 98  ? 254.198 269.181 245.029 1.00 33.25  ? 98  ALA E C     1 
ATOM 3601  O O     . ALA E 1 98  ? 254.833 268.526 244.193 1.00 33.25  ? 98  ALA E O     1 
ATOM 3602  C CB    . ALA E 1 98  ? 255.375 270.185 247.003 1.00 33.25  ? 98  ALA E CB    1 
ATOM 3603  N N     . TYR E 1 99  ? 252.982 268.823 245.438 1.00 33.06  ? 99  TYR E N     1 
ATOM 3604  C CA    . TYR E 1 99  ? 252.332 267.637 244.900 1.00 33.06  ? 99  TYR E CA    1 
ATOM 3605  C C     . TYR E 1 99  ? 252.104 267.764 243.401 1.00 33.06  ? 99  TYR E C     1 
ATOM 3606  O O     . TYR E 1 99  ? 252.391 266.836 242.640 1.00 33.06  ? 99  TYR E O     1 
ATOM 3607  C CB    . TYR E 1 99  ? 251.014 267.398 245.632 1.00 33.06  ? 99  TYR E CB    1 
ATOM 3608  C CG    . TYR E 1 99  ? 250.143 266.345 245.009 1.00 33.06  ? 99  TYR E CG    1 
ATOM 3609  C CD1   . TYR E 1 99  ? 250.350 265.007 245.275 1.00 33.06  ? 99  TYR E CD1   1 
ATOM 3610  C CD2   . TYR E 1 99  ? 249.100 266.689 244.170 1.00 33.06  ? 99  TYR E CD2   1 
ATOM 3611  C CE1   . TYR E 1 99  ? 249.555 264.044 244.719 1.00 33.06  ? 99  TYR E CE1   1 
ATOM 3612  C CE2   . TYR E 1 99  ? 248.303 265.734 243.610 1.00 33.06  ? 99  TYR E CE2   1 
ATOM 3613  C CZ    . TYR E 1 99  ? 248.536 264.412 243.883 1.00 33.06  ? 99  TYR E CZ    1 
ATOM 3614  O OH    . TYR E 1 99  ? 247.737 263.451 243.325 1.00 33.06  ? 99  TYR E OH    1 
ATOM 3615  N N     . LEU E 1 100 ? 251.576 268.906 242.959 1.00 32.21  ? 100 LEU E N     1 
ATOM 3616  C CA    . LEU E 1 100 ? 251.298 269.086 241.540 1.00 32.21  ? 100 LEU E CA    1 
ATOM 3617  C C     . LEU E 1 100 ? 252.577 269.093 240.716 1.00 32.21  ? 100 LEU E C     1 
ATOM 3618  O O     . LEU E 1 100 ? 252.608 268.547 239.611 1.00 32.21  ? 100 LEU E O     1 
ATOM 3619  C CB    . LEU E 1 100 ? 250.504 270.366 241.319 1.00 32.21  ? 100 LEU E CB    1 
ATOM 3620  C CG    . LEU E 1 100 ? 249.029 270.257 241.680 1.00 32.21  ? 100 LEU E CG    1 
ATOM 3621  C CD1   . LEU E 1 100 ? 248.334 271.571 241.470 1.00 32.21  ? 100 LEU E CD1   1 
ATOM 3622  C CD2   . LEU E 1 100 ? 248.369 269.175 240.859 1.00 32.21  ? 100 LEU E CD2   1 
ATOM 3623  N N     . VAL E 1 101 ? 253.654 269.666 241.250 1.00 32.39  ? 101 VAL E N     1 
ATOM 3624  C CA    . VAL E 1 101 ? 254.911 269.695 240.513 1.00 32.39  ? 101 VAL E CA    1 
ATOM 3625  C C     . VAL E 1 101 ? 255.497 268.296 240.386 1.00 32.39  ? 101 VAL E C     1 
ATOM 3626  O O     . VAL E 1 101 ? 255.961 267.902 239.310 1.00 32.39  ? 101 VAL E O     1 
ATOM 3627  C CB    . VAL E 1 101 ? 255.899 270.672 241.172 1.00 32.39  ? 101 VAL E CB    1 
ATOM 3628  C CG1   . VAL E 1 101 ? 257.286 270.466 240.620 1.00 32.39  ? 101 VAL E CG1   1 
ATOM 3629  C CG2   . VAL E 1 101 ? 255.460 272.098 240.929 1.00 32.39  ? 101 VAL E CG2   1 
ATOM 3630  N N     . ALA E 1 102 ? 255.499 267.524 241.474 1.00 33.04  ? 102 ALA E N     1 
ATOM 3631  C CA    . ALA E 1 102 ? 256.022 266.166 241.385 1.00 33.04  ? 102 ALA E CA    1 
ATOM 3632  C C     . ALA E 1 102 ? 255.180 265.322 240.438 1.00 33.04  ? 102 ALA E C     1 
ATOM 3633  O O     . ALA E 1 102 ? 255.709 264.514 239.659 1.00 33.04  ? 102 ALA E O     1 
ATOM 3634  C CB    . ALA E 1 102 ? 256.081 265.534 242.771 1.00 33.04  ? 102 ALA E CB    1 
ATOM 3635  N N     . LEU E 1 103 ? 253.864 265.519 240.471 1.00 33.11  ? 103 LEU E N     1 
ATOM 3636  C CA    . LEU E 1 103 ? 253.000 264.825 239.531 1.00 33.11  ? 103 LEU E CA    1 
ATOM 3637  C C     . LEU E 1 103 ? 253.334 265.195 238.096 1.00 33.11  ? 103 LEU E C     1 
ATOM 3638  O O     . LEU E 1 103 ? 253.340 264.332 237.220 1.00 33.11  ? 103 LEU E O     1 
ATOM 3639  C CB    . LEU E 1 103 ? 251.544 265.134 239.837 1.00 33.11  ? 103 LEU E CB    1 
ATOM 3640  C CG    . LEU E 1 103 ? 250.537 264.416 238.954 1.00 33.11  ? 103 LEU E CG    1 
ATOM 3641  C CD1   . LEU E 1 103 ? 250.828 262.935 238.957 1.00 33.11  ? 103 LEU E CD1   1 
ATOM 3642  C CD2   . LEU E 1 103 ? 249.155 264.692 239.465 1.00 33.11  ? 103 LEU E CD2   1 
ATOM 3643  N N     . PHE E 1 104 ? 253.601 266.472 237.833 1.00 32.74  ? 104 PHE E N     1 
ATOM 3644  C CA    . PHE E 1 104 ? 253.959 266.880 236.480 1.00 32.74  ? 104 PHE E CA    1 
ATOM 3645  C C     . PHE E 1 104 ? 255.287 266.286 236.037 1.00 32.74  ? 104 PHE E C     1 
ATOM 3646  O O     . PHE E 1 104 ? 255.460 266.000 234.853 1.00 32.74  ? 104 PHE E O     1 
ATOM 3647  C CB    . PHE E 1 104 ? 253.991 268.399 236.379 1.00 32.74  ? 104 PHE E CB    1 
ATOM 3648  C CG    . PHE E 1 104 ? 252.652 269.008 236.134 1.00 32.74  ? 104 PHE E CG    1 
ATOM 3649  C CD1   . PHE E 1 104 ? 251.810 268.479 235.182 1.00 32.74  ? 104 PHE E CD1   1 
ATOM 3650  C CD2   . PHE E 1 104 ? 252.227 270.098 236.858 1.00 32.74  ? 104 PHE E CD2   1 
ATOM 3651  C CE1   . PHE E 1 104 ? 250.579 269.033 234.952 1.00 32.74  ? 104 PHE E CE1   1 
ATOM 3652  C CE2   . PHE E 1 104 ? 250.999 270.648 236.630 1.00 32.74  ? 104 PHE E CE2   1 
ATOM 3653  C CZ    . PHE E 1 104 ? 250.173 270.118 235.676 1.00 32.74  ? 104 PHE E CZ    1 
ATOM 3654  N N     . GLU E 1 105 ? 256.229 266.084 236.956 1.00 34.85  ? 105 GLU E N     1 
ATOM 3655  C CA    . GLU E 1 105 ? 257.477 265.421 236.582 1.00 34.85  ? 105 GLU E CA    1 
ATOM 3656  C C     . GLU E 1 105 ? 257.226 263.971 236.177 1.00 34.85  ? 105 GLU E C     1 
ATOM 3657  O O     . GLU E 1 105 ? 257.707 263.508 235.132 1.00 34.85  ? 105 GLU E O     1 
ATOM 3658  C CB    . GLU E 1 105 ? 258.480 265.500 237.729 1.00 34.85  ? 105 GLU E CB    1 
ATOM 3659  C CG    . GLU E 1 105 ? 258.767 266.914 238.166 1.00 34.85  ? 105 GLU E CG    1 
ATOM 3660  C CD    . GLU E 1 105 ? 259.794 267.005 239.276 1.00 34.85  ? 105 GLU E CD    1 
ATOM 3661  O OE1   . GLU E 1 105 ? 260.124 265.962 239.876 1.00 34.85  ? 105 GLU E OE1   1 
ATOM 3662  O OE2   . GLU E 1 105 ? 260.275 268.125 239.546 1.00 34.85  ? 105 GLU E OE2   1 
ATOM 3663  N N     . ASP E 1 106 ? 256.453 263.242 236.985 1.00 35.80  ? 106 ASP E N     1 
ATOM 3664  C CA    . ASP E 1 106 ? 256.090 261.875 236.609 1.00 35.80  ? 106 ASP E CA    1 
ATOM 3665  C C     . ASP E 1 106 ? 255.327 261.842 235.288 1.00 35.80  ? 106 ASP E C     1 
ATOM 3666  O O     . ASP E 1 106 ? 255.540 260.954 234.451 1.00 35.80  ? 106 ASP E O     1 
ATOM 3667  C CB    . ASP E 1 106 ? 255.259 261.228 237.713 1.00 35.80  ? 106 ASP E CB    1 
ATOM 3668  C CG    . ASP E 1 106 ? 256.083 260.870 238.927 1.00 35.80  ? 106 ASP E CG    1 
ATOM 3669  O OD1   . ASP E 1 106 ? 257.317 260.762 238.795 1.00 35.80  ? 106 ASP E OD1   1 
ATOM 3670  O OD2   . ASP E 1 106 ? 255.498 260.690 240.014 1.00 35.80  ? 106 ASP E OD2   1 
ATOM 3671  N N     . THR E 1 107 ? 254.431 262.804 235.087 1.00 34.17  ? 107 THR E N     1 
ATOM 3672  C CA    . THR E 1 107 ? 253.648 262.877 233.861 1.00 34.17  ? 107 THR E CA    1 
ATOM 3673  C C     . THR E 1 107 ? 254.537 263.114 232.653 1.00 34.17  ? 107 THR E C     1 
ATOM 3674  O O     . THR E 1 107 ? 254.322 262.531 231.588 1.00 34.17  ? 107 THR E O     1 
ATOM 3675  C CB    . THR E 1 107 ? 252.618 263.994 233.989 1.00 34.17  ? 107 THR E CB    1 
ATOM 3676  O OG1   . THR E 1 107 ? 251.757 263.729 235.098 1.00 34.17  ? 107 THR E OG1   1 
ATOM 3677  C CG2   . THR E 1 107 ? 251.802 264.119 232.739 1.00 34.17  ? 107 THR E CG2   1 
ATOM 3678  N N     . ASN E 1 108 ? 255.530 263.986 232.798 1.00 33.33  ? 108 ASN E N     1 
ATOM 3679  C CA    . ASN E 1 108 ? 256.465 264.237 231.713 1.00 33.33  ? 108 ASN E CA    1 
ATOM 3680  C C     . ASN E 1 108 ? 257.247 262.981 231.371 1.00 33.33  ? 108 ASN E C     1 
ATOM 3681  O O     . ASN E 1 108 ? 257.515 262.706 230.197 1.00 33.33  ? 108 ASN E O     1 
ATOM 3682  C CB    . ASN E 1 108 ? 257.408 265.369 232.101 1.00 33.33  ? 108 ASN E CB    1 
ATOM 3683  C CG    . ASN E 1 108 ? 258.019 266.042 230.908 1.00 33.33  ? 108 ASN E CG    1 
ATOM 3684  O OD1   . ASN E 1 108 ? 257.434 266.065 229.835 1.00 33.33  ? 108 ASN E OD1   1 
ATOM 3685  N ND2   . ASN E 1 108 ? 259.208 266.584 231.081 1.00 33.33  ? 108 ASN E ND2   1 
ATOM 3686  N N     . LEU E 1 109 ? 257.624 262.208 232.387 1.00 33.82  ? 109 LEU E N     1 
ATOM 3687  C CA    . LEU E 1 109 ? 258.283 260.934 232.119 1.00 33.82  ? 109 LEU E CA    1 
ATOM 3688  C C     . LEU E 1 109 ? 257.379 259.999 231.329 1.00 33.82  ? 109 LEU E C     1 
ATOM 3689  O O     . LEU E 1 109 ? 257.818 259.360 230.369 1.00 33.82  ? 109 LEU E O     1 
ATOM 3690  C CB    . LEU E 1 109 ? 258.714 260.280 233.424 1.00 33.82  ? 109 LEU E CB    1 
ATOM 3691  C CG    . LEU E 1 109 ? 259.895 260.960 234.102 1.00 33.82  ? 109 LEU E CG    1 
ATOM 3692  C CD1   . LEU E 1 109 ? 260.211 260.279 235.400 1.00 33.82  ? 109 LEU E CD1   1 
ATOM 3693  C CD2   . LEU E 1 109 ? 261.088 260.944 233.190 1.00 33.82  ? 109 LEU E CD2   1 
ATOM 3694  N N     . CYS E 1 110 ? 256.108 259.915 231.714 1.00 35.15  ? 110 CYS E N     1 
ATOM 3695  C CA    . CYS E 1 110 ? 255.191 259.020 231.017 1.00 35.15  ? 110 CYS E CA    1 
ATOM 3696  C C     . CYS E 1 110 ? 254.920 259.488 229.591 1.00 35.15  ? 110 CYS E C     1 
ATOM 3697  O O     . CYS E 1 110 ? 254.656 258.670 228.706 1.00 35.15  ? 110 CYS E O     1 
ATOM 3698  C CB    . CYS E 1 110 ? 253.889 258.894 231.799 1.00 35.15  ? 110 CYS E CB    1 
ATOM 3699  S SG    . CYS E 1 110 ? 254.112 258.216 233.436 1.00 35.15  ? 110 CYS E SG    1 
ATOM 3700  N N     . ALA E 1 111 ? 254.957 260.798 229.352 1.00 34.55  ? 111 ALA E N     1 
ATOM 3701  C CA    . ALA E 1 111 ? 254.760 261.301 227.997 1.00 34.55  ? 111 ALA E CA    1 
ATOM 3702  C C     . ALA E 1 111 ? 255.984 261.051 227.129 1.00 34.55  ? 111 ALA E C     1 
ATOM 3703  O O     . ALA E 1 111 ? 255.855 260.760 225.937 1.00 34.55  ? 111 ALA E O     1 
ATOM 3704  C CB    . ALA E 1 111 ? 254.420 262.788 228.023 1.00 34.55  ? 111 ALA E CB    1 
ATOM 3705  N N     . ILE E 1 112 ? 257.182 261.178 227.702 1.00 34.73  ? 112 ILE E N     1 
ATOM 3706  C CA    . ILE E 1 112 ? 258.394 260.845 226.962 1.00 34.73  ? 112 ILE E CA    1 
ATOM 3707  C C     . ILE E 1 112 ? 258.443 259.359 226.659 1.00 34.73  ? 112 ILE E C     1 
ATOM 3708  O O     . ILE E 1 112 ? 258.923 258.948 225.598 1.00 34.73  ? 112 ILE E O     1 
ATOM 3709  C CB    . ILE E 1 112 ? 259.634 261.303 227.748 1.00 34.73  ? 112 ILE E CB    1 
ATOM 3710  C CG1   . ILE E 1 112 ? 259.685 262.824 227.801 1.00 34.73  ? 112 ILE E CG1   1 
ATOM 3711  C CG2   . ILE E 1 112 ? 260.894 260.760 227.123 1.00 34.73  ? 112 ILE E CG2   1 
ATOM 3712  C CD1   . ILE E 1 112 ? 260.709 263.355 228.736 1.00 34.73  ? 112 ILE E CD1   1 
ATOM 3713  N N     . HIS E 1 113 ? 257.935 258.533 227.571 1.00 35.14  ? 113 HIS E N     1 
ATOM 3714  C CA    . HIS E 1 113 ? 257.932 257.093 227.355 1.00 35.14  ? 113 HIS E CA    1 
ATOM 3715  C C     . HIS E 1 113 ? 257.185 256.727 226.081 1.00 35.14  ? 113 HIS E C     1 
ATOM 3716  O O     . HIS E 1 113 ? 257.579 255.801 225.367 1.00 35.14  ? 113 HIS E O     1 
ATOM 3717  C CB    . HIS E 1 113 ? 257.313 256.397 228.560 1.00 35.14  ? 113 HIS E CB    1 
ATOM 3718  C CG    . HIS E 1 113 ? 257.473 254.914 228.547 1.00 35.14  ? 113 HIS E CG    1 
ATOM 3719  N ND1   . HIS E 1 113 ? 258.637 254.292 228.933 1.00 35.14  ? 113 HIS E ND1   1 
ATOM 3720  C CD2   . HIS E 1 113 ? 256.617 253.929 228.195 1.00 35.14  ? 113 HIS E CD2   1 
ATOM 3721  C CE1   . HIS E 1 113 ? 258.491 252.986 228.822 1.00 35.14  ? 113 HIS E CE1   1 
ATOM 3722  N NE2   . HIS E 1 113 ? 257.275 252.739 228.375 1.00 35.14  ? 113 HIS E NE2   1 
ATOM 3723  N N     . ALA E 1 114 ? 256.107 257.444 225.780 1.00 34.96  ? 114 ALA E N     1 
ATOM 3724  C CA    . ALA E 1 114 ? 255.336 257.239 224.566 1.00 34.96  ? 114 ALA E CA    1 
ATOM 3725  C C     . ALA E 1 114 ? 255.862 258.039 223.394 1.00 34.96  ? 114 ALA E C     1 
ATOM 3726  O O     . ALA E 1 114 ? 255.138 258.207 222.410 1.00 34.96  ? 114 ALA E O     1 
ATOM 3727  C CB    . ALA E 1 114 ? 253.868 257.581 224.810 1.00 34.96  ? 114 ALA E CB    1 
ATOM 3728  N N     . LYS E 1 115 ? 257.091 258.543 223.484 1.00 35.32  ? 115 LYS E N     1 
ATOM 3729  C CA    . LYS E 1 115 ? 257.748 259.243 222.382 1.00 35.32  ? 115 LYS E CA    1 
ATOM 3730  C C     . LYS E 1 115 ? 256.993 260.509 221.996 1.00 35.32  ? 115 LYS E C     1 
ATOM 3731  O O     . LYS E 1 115 ? 256.919 260.881 220.827 1.00 35.32  ? 115 LYS E O     1 
ATOM 3732  C CB    . LYS E 1 115 ? 257.927 258.325 221.175 1.00 35.32  ? 115 LYS E CB    1 
ATOM 3733  C CG    . LYS E 1 115 ? 258.640 257.033 221.502 1.00 35.32  ? 115 LYS E CG    1 
ATOM 3734  C CD    . LYS E 1 115 ? 258.698 256.122 220.299 1.00 35.32  ? 115 LYS E CD    1 
ATOM 3735  C CE    . LYS E 1 115 ? 259.485 254.868 220.614 1.00 35.32  ? 115 LYS E CE    1 
ATOM 3736  N NZ    . LYS E 1 115 ? 260.815 255.202 221.190 1.00 35.32  ? 115 LYS E NZ    1 
ATOM 3737  N N     . ARG E 1 116 ? 256.428 261.174 222.990 1.00 35.21  ? 116 ARG E N     1 
ATOM 3738  C CA    . ARG E 1 116 ? 255.821 262.477 222.820 1.00 35.21  ? 116 ARG E CA    1 
ATOM 3739  C C     . ARG E 1 116 ? 256.613 263.493 223.623 1.00 35.21  ? 116 ARG E C     1 
ATOM 3740  O O     . ARG E 1 116 ? 257.418 263.141 224.485 1.00 35.21  ? 116 ARG E O     1 
ATOM 3741  C CB    . ARG E 1 116 ? 254.358 262.484 223.274 1.00 35.21  ? 116 ARG E CB    1 
ATOM 3742  C CG    . ARG E 1 116 ? 253.424 261.754 222.349 1.00 35.21  ? 116 ARG E CG    1 
ATOM 3743  C CD    . ARG E 1 116 ? 251.987 261.828 222.809 1.00 35.21  ? 116 ARG E CD    1 
ATOM 3744  N NE    . ARG E 1 116 ? 251.620 260.764 223.739 1.00 35.21  ? 116 ARG E NE    1 
ATOM 3745  C CZ    . ARG E 1 116 ? 251.572 260.899 225.059 1.00 35.21  ? 116 ARG E CZ    1 
ATOM 3746  N NH1   . ARG E 1 116 ? 251.877 262.052 225.625 1.00 35.21  ? 116 ARG E NH1   1 
ATOM 3747  N NH2   . ARG E 1 116 ? 251.220 259.874 225.816 1.00 35.21  ? 116 ARG E NH2   1 
ATOM 3748  N N     . VAL E 1 117 ? 256.401 264.763 223.303 1.00 36.37  ? 117 VAL E N     1 
ATOM 3749  C CA    . VAL E 1 117 ? 256.891 265.866 224.113 1.00 36.37  ? 117 VAL E CA    1 
ATOM 3750  C C     . VAL E 1 117 ? 255.761 266.631 224.757 1.00 36.37  ? 117 VAL E C     1 
ATOM 3751  O O     . VAL E 1 117 ? 256.012 267.605 225.475 1.00 36.37  ? 117 VAL E O     1 
ATOM 3752  C CB    . VAL E 1 117 ? 257.782 266.815 223.291 1.00 36.37  ? 117 VAL E CB    1 
ATOM 3753  C CG1   . VAL E 1 117 ? 258.947 266.060 222.705 1.00 36.37  ? 117 VAL E CG1   1 
ATOM 3754  C CG2   . VAL E 1 117 ? 256.982 267.474 222.197 1.00 36.37  ? 117 VAL E CG2   1 
ATOM 3755  N N     . THR E 1 118 ? 254.525 266.206 224.544 1.00 36.01  ? 118 THR E N     1 
ATOM 3756  C CA    . THR E 1 118 ? 253.336 266.907 224.995 1.00 36.01  ? 118 THR E CA    1 
ATOM 3757  C C     . THR E 1 118 ? 252.667 266.060 226.058 1.00 36.01  ? 118 THR E C     1 
ATOM 3758  O O     . THR E 1 118 ? 252.280 264.922 225.786 1.00 36.01  ? 118 THR E O     1 
ATOM 3759  C CB    . THR E 1 118 ? 252.370 267.139 223.836 1.00 36.01  ? 118 THR E CB    1 
ATOM 3760  O OG1   . THR E 1 118 ? 253.096 267.597 222.694 1.00 36.01  ? 118 THR E OG1   1 
ATOM 3761  C CG2   . THR E 1 118 ? 251.317 268.160 224.218 1.00 36.01  ? 118 THR E CG2   1 
ATOM 3762  N N     . ILE E 1 119 ? 252.518 266.609 227.259 1.00 34.67  ? 119 ILE E N     1 
ATOM 3763  C CA    . ILE E 1 119 ? 251.835 265.852 228.296 1.00 34.67  ? 119 ILE E CA    1 
ATOM 3764  C C     . ILE E 1 119 ? 250.340 265.872 228.027 1.00 34.67  ? 119 ILE E C     1 
ATOM 3765  O O     . ILE E 1 119 ? 249.780 266.881 227.591 1.00 34.67  ? 119 ILE E O     1 
ATOM 3766  C CB    . ILE E 1 119 ? 252.160 266.379 229.702 1.00 34.67  ? 119 ILE E CB    1 
ATOM 3767  C CG1   . ILE E 1 119 ? 251.751 267.840 229.848 1.00 34.67  ? 119 ILE E CG1   1 
ATOM 3768  C CG2   . ILE E 1 119 ? 253.616 266.156 230.020 1.00 34.67  ? 119 ILE E CG2   1 
ATOM 3769  C CD1   . ILE E 1 119 ? 251.592 268.267 231.262 1.00 34.67  ? 119 ILE E CD1   1 
ATOM 3770  N N     . MET E 1 120 ? 249.692 264.748 228.280 1.00 36.36  ? 120 MET E N     1 
ATOM 3771  C CA    . MET E 1 120 ? 248.279 264.553 228.014 1.00 36.36  ? 120 MET E CA    1 
ATOM 3772  C C     . MET E 1 120 ? 247.599 263.940 229.228 1.00 36.36  ? 120 MET E C     1 
ATOM 3773  O O     . MET E 1 120 ? 248.260 263.400 230.128 1.00 36.36  ? 120 MET E O     1 
ATOM 3774  C CB    . MET E 1 120 ? 248.073 263.660 226.781 1.00 36.36  ? 120 MET E CB    1 
ATOM 3775  C CG    . MET E 1 120 ? 248.841 264.127 225.557 1.00 36.36  ? 120 MET E CG    1 
ATOM 3776  S SD    . MET E 1 120 ? 248.454 263.256 224.034 1.00 36.36  ? 120 MET E SD    1 
ATOM 3777  C CE    . MET E 1 120 ? 246.848 263.940 223.660 1.00 36.36  ? 120 MET E CE    1 
ATOM 3778  N N     . PRO E 1 121 ? 246.272 264.048 229.303 1.00 35.35  ? 121 PRO E N     1 
ATOM 3779  C CA    . PRO E 1 121 ? 245.561 263.455 230.439 1.00 35.35  ? 121 PRO E CA    1 
ATOM 3780  C C     . PRO E 1 121 ? 245.846 261.983 230.625 1.00 35.35  ? 121 PRO E C     1 
ATOM 3781  O O     . PRO E 1 121 ? 245.875 261.520 231.767 1.00 35.35  ? 121 PRO E O     1 
ATOM 3782  C CB    . PRO E 1 121 ? 244.093 263.716 230.091 1.00 35.35  ? 121 PRO E CB    1 
ATOM 3783  C CG    . PRO E 1 121 ? 244.134 264.951 229.308 1.00 35.35  ? 121 PRO E CG    1 
ATOM 3784  C CD    . PRO E 1 121 ? 245.382 264.894 228.492 1.00 35.35  ? 121 PRO E CD    1 
ATOM 3785  N N     . LYS E 1 122 ? 246.052 261.230 229.545 1.00 35.60  ? 122 LYS E N     1 
ATOM 3786  C CA    . LYS E 1 122 ? 246.438 259.832 229.691 1.00 35.60  ? 122 LYS E CA    1 
ATOM 3787  C C     . LYS E 1 122 ? 247.767 259.703 230.424 1.00 35.60  ? 122 LYS E C     1 
ATOM 3788  O O     . LYS E 1 122 ? 247.959 258.772 231.210 1.00 35.60  ? 122 LYS E O     1 
ATOM 3789  C CB    . LYS E 1 122 ? 246.503 259.157 228.323 1.00 35.60  ? 122 LYS E CB    1 
ATOM 3790  C CG    . LYS E 1 122 ? 247.580 259.700 227.414 1.00 35.60  ? 122 LYS E CG    1 
ATOM 3791  C CD    . LYS E 1 122 ? 247.716 258.888 226.149 1.00 35.60  ? 122 LYS E CD    1 
ATOM 3792  C CE    . LYS E 1 122 ? 246.689 259.299 225.124 1.00 35.60  ? 122 LYS E CE    1 
ATOM 3793  N NZ    . LYS E 1 122 ? 246.980 258.698 223.797 1.00 35.60  ? 122 LYS E NZ    1 
ATOM 3794  N N     . ASP E 1 123 ? 248.689 260.642 230.202 1.00 35.67  ? 123 ASP E N     1 
ATOM 3795  C CA    . ASP E 1 123 ? 249.940 260.632 230.950 1.00 35.67  ? 123 ASP E CA    1 
ATOM 3796  C C     . ASP E 1 123 ? 249.684 260.858 232.429 1.00 35.67  ? 123 ASP E C     1 
ATOM 3797  O O     . ASP E 1 123 ? 250.222 260.144 233.281 1.00 35.67  ? 123 ASP E O     1 
ATOM 3798  C CB    . ASP E 1 123 ? 250.896 261.691 230.408 1.00 35.67  ? 123 ASP E CB    1 
ATOM 3799  C CG    . ASP E 1 123 ? 251.150 261.543 228.942 1.00 35.67  ? 123 ASP E CG    1 
ATOM 3800  O OD1   . ASP E 1 123 ? 251.261 260.399 228.477 1.00 35.67  ? 123 ASP E OD1   1 
ATOM 3801  O OD2   . ASP E 1 123 ? 251.220 262.569 228.243 1.00 35.67  ? 123 ASP E OD2   1 
ATOM 3802  N N     . ILE E 1 124 ? 248.860 261.857 232.754 1.00 35.74  ? 124 ILE E N     1 
ATOM 3803  C CA    . ILE E 1 124 ? 248.555 262.115 234.162 1.00 35.74  ? 124 ILE E CA    1 
ATOM 3804  C C     . ILE E 1 124 ? 247.913 260.894 234.807 1.00 35.74  ? 124 ILE E C     1 
ATOM 3805  O O     . ILE E 1 124 ? 248.245 260.517 235.939 1.00 35.74  ? 124 ILE E O     1 
ATOM 3806  C CB    . ILE E 1 124 ? 247.656 263.355 234.306 1.00 35.74  ? 124 ILE E CB    1 
ATOM 3807  C CG1   . ILE E 1 124 ? 248.451 264.629 234.060 1.00 35.74  ? 124 ILE E CG1   1 
ATOM 3808  C CG2   . ILE E 1 124 ? 247.038 263.401 235.685 1.00 35.74  ? 124 ILE E CG2   1 
ATOM 3809  C CD1   . ILE E 1 124 ? 247.663 265.875 234.303 1.00 35.74  ? 124 ILE E CD1   1 
ATOM 3810  N N     . GLN E 1 125 ? 246.980 260.265 234.100 1.00 36.70  ? 125 GLN E N     1 
ATOM 3811  C CA    . GLN E 1 125 ? 246.252 259.135 234.656 1.00 36.70  ? 125 GLN E CA    1 
ATOM 3812  C C     . GLN E 1 125 ? 247.163 257.937 234.859 1.00 36.70  ? 125 GLN E C     1 
ATOM 3813  O O     . GLN E 1 125 ? 247.055 257.244 235.871 1.00 36.70  ? 125 GLN E O     1 
ATOM 3814  C CB    . GLN E 1 125 ? 245.075 258.778 233.754 1.00 36.70  ? 125 GLN E CB    1 
ATOM 3815  C CG    . GLN E 1 125 ? 244.012 259.853 233.705 1.00 36.70  ? 125 GLN E CG    1 
ATOM 3816  C CD    . GLN E 1 125 ? 243.111 259.731 232.497 1.00 36.70  ? 125 GLN E CD    1 
ATOM 3817  O OE1   . GLN E 1 125 ? 243.037 258.682 231.867 1.00 36.70  ? 125 GLN E OE1   1 
ATOM 3818  N NE2   . GLN E 1 125 ? 242.428 260.813 232.162 1.00 36.70  ? 125 GLN E NE2   1 
ATOM 3819  N N     . LEU E 1 126 ? 248.081 257.691 233.924 1.00 35.84  ? 126 LEU E N     1 
ATOM 3820  C CA    . LEU E 1 126 ? 249.039 256.610 234.108 1.00 35.84  ? 126 LEU E CA    1 
ATOM 3821  C C     . LEU E 1 126 ? 249.957 256.879 235.289 1.00 35.84  ? 126 LEU E C     1 
ATOM 3822  O O     . LEU E 1 126 ? 250.252 255.970 236.070 1.00 35.84  ? 126 LEU E O     1 
ATOM 3823  C CB    . LEU E 1 126 ? 249.867 256.409 232.846 1.00 35.84  ? 126 LEU E CB    1 
ATOM 3824  C CG    . LEU E 1 126 ? 250.976 255.378 233.036 1.00 35.84  ? 126 LEU E CG    1 
ATOM 3825  C CD1   . LEU E 1 126 ? 250.388 253.990 233.129 1.00 35.84  ? 126 LEU E CD1   1 
ATOM 3826  C CD2   . LEU E 1 126 ? 252.001 255.459 231.937 1.00 35.84  ? 126 LEU E CD2   1 
ATOM 3827  N N     . ALA E 1 127 ? 250.430 258.115 235.430 1.00 36.30  ? 127 ALA E N     1 
ATOM 3828  C CA    . ALA E 1 127 ? 251.304 258.431 236.552 1.00 36.30  ? 127 ALA E CA    1 
ATOM 3829  C C     . ALA E 1 127 ? 250.593 258.201 237.880 1.00 36.30  ? 127 ALA E C     1 
ATOM 3830  O O     . ALA E 1 127 ? 251.147 257.580 238.795 1.00 36.30  ? 127 ALA E O     1 
ATOM 3831  C CB    . ALA E 1 127 ? 251.806 259.867 236.441 1.00 36.30  ? 127 ALA E CB    1 
ATOM 3832  N N     . ARG E 1 128 ? 249.348 258.666 237.995 1.00 37.58  ? 128 ARG E N     1 
ATOM 3833  C CA    . ARG E 1 128 ? 248.630 258.490 239.253 1.00 37.58  ? 128 ARG E CA    1 
ATOM 3834  C C     . ARG E 1 128 ? 248.215 257.041 239.471 1.00 37.58  ? 128 ARG E C     1 
ATOM 3835  O O     . ARG E 1 128 ? 248.063 256.609 240.615 1.00 37.58  ? 128 ARG E O     1 
ATOM 3836  C CB    . ARG E 1 128 ? 247.419 259.417 239.308 1.00 37.58  ? 128 ARG E CB    1 
ATOM 3837  C CG    . ARG E 1 128 ? 247.810 260.873 239.383 1.00 37.58  ? 128 ARG E CG    1 
ATOM 3838  C CD    . ARG E 1 128 ? 246.628 261.794 239.543 1.00 37.58  ? 128 ARG E CD    1 
ATOM 3839  N NE    . ARG E 1 128 ? 246.036 261.686 240.867 1.00 37.58  ? 128 ARG E NE    1 
ATOM 3840  C CZ    . ARG E 1 128 ? 244.859 261.130 241.109 1.00 37.58  ? 128 ARG E CZ    1 
ATOM 3841  N NH1   . ARG E 1 128 ? 244.136 260.650 240.112 1.00 37.58  ? 128 ARG E NH1   1 
ATOM 3842  N NH2   . ARG E 1 128 ? 244.400 261.070 242.346 1.00 37.58  ? 128 ARG E NH2   1 
ATOM 3843  N N     . ARG E 1 129 ? 248.040 256.276 238.397 1.00 38.33  ? 129 ARG E N     1 
ATOM 3844  C CA    . ARG E 1 129 ? 247.749 254.857 238.543 1.00 38.33  ? 129 ARG E CA    1 
ATOM 3845  C C     . ARG E 1 129 ? 248.964 254.091 239.048 1.00 38.33  ? 129 ARG E C     1 
ATOM 3846  O O     . ARG E 1 129 ? 248.844 253.248 239.940 1.00 38.33  ? 129 ARG E O     1 
ATOM 3847  C CB    . ARG E 1 129 ? 247.258 254.301 237.210 1.00 38.33  ? 129 ARG E CB    1 
ATOM 3848  C CG    . ARG E 1 129 ? 247.226 252.801 237.115 1.00 38.33  ? 129 ARG E CG    1 
ATOM 3849  C CD    . ARG E 1 129 ? 246.322 252.191 238.147 1.00 38.33  ? 129 ARG E CD    1 
ATOM 3850  N NE    . ARG E 1 129 ? 246.210 250.747 237.976 1.00 38.33  ? 129 ARG E NE    1 
ATOM 3851  C CZ    . ARG E 1 129 ? 247.114 249.867 238.395 1.00 38.33  ? 129 ARG E CZ    1 
ATOM 3852  N NH1   . ARG E 1 129 ? 248.216 250.274 239.006 1.00 38.33  ? 129 ARG E NH1   1 
ATOM 3853  N NH2   . ARG E 1 129 ? 246.919 248.574 238.190 1.00 38.33  ? 129 ARG E NH2   1 
ATOM 3854  N N     . ILE E 1 130 ? 250.144 254.373 238.500 1.00 37.06  ? 130 ILE E N     1 
ATOM 3855  C CA    . ILE E 1 130 ? 251.341 253.668 238.939 1.00 37.06  ? 130 ILE E CA    1 
ATOM 3856  C C     . ILE E 1 130 ? 251.712 254.075 240.357 1.00 37.06  ? 130 ILE E C     1 
ATOM 3857  O O     . ILE E 1 130 ? 252.202 253.256 241.142 1.00 37.06  ? 130 ILE E O     1 
ATOM 3858  C CB    . ILE E 1 130 ? 252.500 253.915 237.963 1.00 37.06  ? 130 ILE E CB    1 
ATOM 3859  C CG1   . ILE E 1 130 ? 252.192 253.295 236.611 1.00 37.06  ? 130 ILE E CG1   1 
ATOM 3860  C CG2   . ILE E 1 130 ? 253.790 253.340 238.500 1.00 37.06  ? 130 ILE E CG2   1 
ATOM 3861  C CD1   . ILE E 1 130 ? 253.140 253.725 235.564 1.00 37.06  ? 130 ILE E CD1   1 
ATOM 3862  N N     . ARG E 1 131 ? 251.497 255.342 240.710 1.00 37.24  ? 131 ARG E N     1 
ATOM 3863  C CA    . ARG E 1 131 ? 251.770 255.764 242.078 1.00 37.24  ? 131 ARG E CA    1 
ATOM 3864  C C     . ARG E 1 131 ? 250.900 255.028 243.083 1.00 37.24  ? 131 ARG E C     1 
ATOM 3865  O O     . ARG E 1 131 ? 251.324 254.799 244.218 1.00 37.24  ? 131 ARG E O     1 
ATOM 3866  C CB    . ARG E 1 131 ? 251.555 257.262 242.221 1.00 37.24  ? 131 ARG E CB    1 
ATOM 3867  C CG    . ARG E 1 131 ? 252.668 258.104 241.680 1.00 37.24  ? 131 ARG E CG    1 
ATOM 3868  C CD    . ARG E 1 131 ? 252.274 259.541 241.797 1.00 37.24  ? 131 ARG E CD    1 
ATOM 3869  N NE    . ARG E 1 131 ? 253.388 260.444 241.581 1.00 37.24  ? 131 ARG E NE    1 
ATOM 3870  C CZ    . ARG E 1 131 ? 253.387 261.710 241.967 1.00 37.24  ? 131 ARG E CZ    1 
ATOM 3871  N NH1   . ARG E 1 131 ? 252.333 262.206 242.598 1.00 37.24  ? 131 ARG E NH1   1 
ATOM 3872  N NH2   . ARG E 1 131 ? 254.441 262.471 241.734 1.00 37.24  ? 131 ARG E NH2   1 
ATOM 3873  N N     . GLY E 1 132 ? 249.691 254.652 242.695 1.00 39.65  ? 132 GLY E N     1 
ATOM 3874  C CA    . GLY E 1 132 ? 248.779 254.024 243.623 1.00 39.65  ? 132 GLY E CA    1 
ATOM 3875  C C     . GLY E 1 132 ? 247.807 255.021 244.208 1.00 39.65  ? 132 GLY E C     1 
ATOM 3876  O O     . GLY E 1 132 ? 247.446 254.936 245.383 1.00 39.65  ? 132 GLY E O     1 
ATOM 3877  N N     . GLU E 1 133 ? 247.384 255.982 243.393 1.00 40.56  ? 133 GLU E N     1 
ATOM 3878  C CA    . GLU E 1 133 ? 246.400 256.967 243.800 1.00 40.56  ? 133 GLU E CA    1 
ATOM 3879  C C     . GLU E 1 133 ? 245.055 256.775 243.120 1.00 40.56  ? 133 GLU E C     1 
ATOM 3880  O O     . GLU E 1 133 ? 244.063 257.359 243.570 1.00 40.56  ? 133 GLU E O     1 
ATOM 3881  C CB    . GLU E 1 133 ? 246.929 258.382 243.525 1.00 40.56  ? 133 GLU E CB    1 
ATOM 3882  C CG    . GLU E 1 133 ? 248.268 258.640 244.193 1.00 40.56  ? 133 GLU E CG    1 
ATOM 3883  C CD    . GLU E 1 133 ? 248.895 259.959 243.799 1.00 40.56  ? 133 GLU E CD    1 
ATOM 3884  O OE1   . GLU E 1 133 ? 248.227 260.764 243.126 1.00 40.56  ? 133 GLU E OE1   1 
ATOM 3885  O OE2   . GLU E 1 133 ? 250.066 260.187 244.167 1.00 40.56  ? 133 GLU E OE2   1 
ATOM 3886  N N     . ARG E 1 134 ? 244.990 255.965 242.071 1.00 41.93  ? 134 ARG E N     1 
ATOM 3887  C CA    . ARG E 1 134 ? 243.732 255.662 241.406 1.00 41.93  ? 134 ARG E CA    1 
ATOM 3888  C C     . ARG E 1 134 ? 243.350 254.209 241.657 1.00 41.93  ? 134 ARG E C     1 
ATOM 3889  O O     . ARG E 1 134 ? 244.177 253.308 241.508 1.00 41.93  ? 134 ARG E O     1 
ATOM 3890  C CB    . ARG E 1 134 ? 243.828 255.925 239.903 1.00 41.93  ? 134 ARG E CB    1 
ATOM 3891  C CG    . ARG E 1 134 ? 244.448 257.255 239.539 1.00 41.93  ? 134 ARG E CG    1 
ATOM 3892  C CD    . ARG E 1 134 ? 244.113 257.627 238.107 1.00 41.93  ? 134 ARG E CD    1 
ATOM 3893  N NE    . ARG E 1 134 ? 244.347 256.520 237.189 1.00 41.93  ? 134 ARG E NE    1 
ATOM 3894  C CZ    . ARG E 1 134 ? 243.594 256.266 236.124 1.00 41.93  ? 134 ARG E CZ    1 
ATOM 3895  N NH1   . ARG E 1 134 ? 242.552 257.039 235.849 1.00 41.93  ? 134 ARG E NH1   1 
ATOM 3896  N NH2   . ARG E 1 134 ? 243.875 255.239 235.337 1.00 41.93  ? 134 ARG E NH2   1 
ATOM 3897  N N     . VAL F 2 21  ? 228.757 281.747 251.268 1.00 50.68  ? 21  VAL F N     1 
ATOM 3898  C CA    . VAL F 2 21  ? 228.981 280.504 250.542 1.00 50.68  ? 21  VAL F CA    1 
ATOM 3899  C C     . VAL F 2 21  ? 229.819 280.752 249.296 1.00 50.68  ? 21  VAL F C     1 
ATOM 3900  O O     . VAL F 2 21  ? 229.509 281.628 248.489 1.00 50.68  ? 21  VAL F O     1 
ATOM 3901  C CB    . VAL F 2 21  ? 227.650 279.828 250.168 1.00 50.68  ? 21  VAL F CB    1 
ATOM 3902  C CG1   . VAL F 2 21  ? 227.900 278.630 249.271 1.00 50.68  ? 21  VAL F CG1   1 
ATOM 3903  C CG2   . VAL F 2 21  ? 226.899 279.406 251.418 1.00 50.68  ? 21  VAL F CG2   1 
ATOM 3904  N N     . LEU F 2 22  ? 230.879 279.968 249.142 1.00 48.17  ? 22  LEU F N     1 
ATOM 3905  C CA    . LEU F 2 22  ? 231.769 280.063 247.998 1.00 48.17  ? 22  LEU F CA    1 
ATOM 3906  C C     . LEU F 2 22  ? 231.370 279.048 246.933 1.00 48.17  ? 22  LEU F C     1 
ATOM 3907  O O     . LEU F 2 22  ? 230.905 277.949 247.242 1.00 48.17  ? 22  LEU F O     1 
ATOM 3908  C CB    . LEU F 2 22  ? 233.219 279.840 248.429 1.00 48.17  ? 22  LEU F CB    1 
ATOM 3909  C CG    . LEU F 2 22  ? 233.925 281.028 249.086 1.00 48.17  ? 22  LEU F CG    1 
ATOM 3910  C CD1   . LEU F 2 22  ? 235.319 280.644 249.537 1.00 48.17  ? 22  LEU F CD1   1 
ATOM 3911  C CD2   . LEU F 2 22  ? 233.977 282.211 248.129 1.00 48.17  ? 22  LEU F CD2   1 
ATOM 3912  N N     . ARG F 2 23  ? 231.563 279.426 245.671 1.00 49.81  ? 23  ARG F N     1 
ATOM 3913  C CA    . ARG F 2 23  ? 231.183 278.570 244.557 1.00 49.81  ? 23  ARG F CA    1 
ATOM 3914  C C     . ARG F 2 23  ? 232.144 278.779 243.396 1.00 49.81  ? 23  ARG F C     1 
ATOM 3915  O O     . ARG F 2 23  ? 232.570 279.902 243.115 1.00 49.81  ? 23  ARG F O     1 
ATOM 3916  C CB    . ARG F 2 23  ? 229.736 278.840 244.114 1.00 49.81  ? 23  ARG F CB    1 
ATOM 3917  C CG    . ARG F 2 23  ? 229.355 280.321 244.020 1.00 49.81  ? 23  ARG F CG    1 
ATOM 3918  C CD    . ARG F 2 23  ? 229.640 280.907 242.639 1.00 49.81  ? 23  ARG F CD    1 
ATOM 3919  N NE    . ARG F 2 23  ? 229.566 282.367 242.624 1.00 49.81  ? 23  ARG F NE    1 
ATOM 3920  C CZ    . ARG F 2 23  ? 230.062 283.128 241.652 1.00 49.81  ? 23  ARG F CZ    1 
ATOM 3921  N NH1   . ARG F 2 23  ? 230.676 282.572 240.617 1.00 49.81  ? 23  ARG F NH1   1 
ATOM 3922  N NH2   . ARG F 2 23  ? 229.953 284.448 241.716 1.00 49.81  ? 23  ARG F NH2   1 
ATOM 3923  N N     . ASP F 2 24  ? 232.492 277.671 242.736 1.00 46.97  ? 24  ASP F N     1 
ATOM 3924  C CA    . ASP F 2 24  ? 233.235 277.687 241.473 1.00 46.97  ? 24  ASP F CA    1 
ATOM 3925  C C     . ASP F 2 24  ? 234.609 278.338 241.624 1.00 46.97  ? 24  ASP F C     1 
ATOM 3926  O O     . ASP F 2 24  ? 235.070 279.074 240.753 1.00 46.97  ? 24  ASP F O     1 
ATOM 3927  C CB    . ASP F 2 24  ? 232.420 278.375 240.375 1.00 46.97  ? 24  ASP F CB    1 
ATOM 3928  C CG    . ASP F 2 24  ? 233.058 278.254 239.009 1.00 46.97  ? 24  ASP F CG    1 
ATOM 3929  O OD1   . ASP F 2 24  ? 233.297 277.112 238.562 1.00 46.97  ? 24  ASP F OD1   1 
ATOM 3930  O OD2   . ASP F 2 24  ? 233.326 279.303 238.387 1.00 46.97  ? 24  ASP F OD2   1 
ATOM 3931  N N     . ASN F 2 25  ? 235.282 278.053 242.730 1.00 43.20  ? 25  ASN F N     1 
ATOM 3932  C CA    . ASN F 2 25  ? 236.596 278.628 242.953 1.00 43.20  ? 25  ASN F CA    1 
ATOM 3933  C C     . ASN F 2 25  ? 237.722 277.799 242.359 1.00 43.20  ? 25  ASN F C     1 
ATOM 3934  O O     . ASN F 2 25  ? 238.862 278.269 242.334 1.00 43.20  ? 25  ASN F O     1 
ATOM 3935  C CB    . ASN F 2 25  ? 236.839 278.822 244.447 1.00 43.20  ? 25  ASN F CB    1 
ATOM 3936  C CG    . ASN F 2 25  ? 235.876 279.798 245.060 1.00 43.20  ? 25  ASN F CG    1 
ATOM 3937  O OD1   . ASN F 2 25  ? 235.923 280.991 244.784 1.00 43.20  ? 25  ASN F OD1   1 
ATOM 3938  N ND2   . ASN F 2 25  ? 234.995 279.299 245.900 1.00 43.20  ? 25  ASN F ND2   1 
ATOM 3939  N N     . ILE F 2 26  ? 237.440 276.590 241.874 1.00 40.61  ? 26  ILE F N     1 
ATOM 3940  C CA    . ILE F 2 26  ? 238.494 275.790 241.263 1.00 40.61  ? 26  ILE F CA    1 
ATOM 3941  C C     . ILE F 2 26  ? 238.956 276.428 239.962 1.00 40.61  ? 26  ILE F C     1 
ATOM 3942  O O     . ILE F 2 26  ? 240.115 276.277 239.563 1.00 40.61  ? 26  ILE F O     1 
ATOM 3943  C CB    . ILE F 2 26  ? 238.016 274.339 241.062 1.00 40.61  ? 26  ILE F CB    1 
ATOM 3944  C CG1   . ILE F 2 26  ? 239.174 273.449 240.620 1.00 40.61  ? 26  ILE F CG1   1 
ATOM 3945  C CG2   . ILE F 2 26  ? 236.887 274.278 240.059 1.00 40.61  ? 26  ILE F CG2   1 
ATOM 3946  C CD1   . ILE F 2 26  ? 240.311 273.390 241.604 1.00 40.61  ? 26  ILE F CD1   1 
ATOM 3947  N N     . GLN F 2 27  ? 238.077 277.174 239.294 1.00 41.07  ? 27  GLN F N     1 
ATOM 3948  C CA    . GLN F 2 27  ? 238.498 277.923 238.119 1.00 41.07  ? 27  GLN F CA    1 
ATOM 3949  C C     . GLN F 2 27  ? 239.473 279.033 238.472 1.00 41.07  ? 27  GLN F C     1 
ATOM 3950  O O     . GLN F 2 27  ? 240.137 279.565 237.579 1.00 41.07  ? 27  GLN F O     1 
ATOM 3951  C CB    . GLN F 2 27  ? 237.284 278.501 237.402 1.00 41.07  ? 27  GLN F CB    1 
ATOM 3952  C CG    . GLN F 2 27  ? 236.288 277.451 236.972 1.00 41.07  ? 27  GLN F CG    1 
ATOM 3953  C CD    . GLN F 2 27  ? 236.918 276.375 236.116 1.00 41.07  ? 27  GLN F CD    1 
ATOM 3954  O OE1   . GLN F 2 27  ? 237.722 276.661 235.233 1.00 41.07  ? 27  GLN F OE1   1 
ATOM 3955  N NE2   . GLN F 2 27  ? 236.556 275.125 236.376 1.00 41.07  ? 27  GLN F NE2   1 
ATOM 3956  N N     . GLY F 2 28  ? 239.563 279.401 239.748 1.00 38.98  ? 28  GLY F N     1 
ATOM 3957  C CA    . GLY F 2 28  ? 240.619 280.291 240.180 1.00 38.98  ? 28  GLY F CA    1 
ATOM 3958  C C     . GLY F 2 28  ? 241.998 279.707 239.998 1.00 38.98  ? 28  GLY F C     1 
ATOM 3959  O O     . GLY F 2 28  ? 242.975 280.455 239.939 1.00 38.98  ? 28  GLY F O     1 
ATOM 3960  N N     . ILE F 2 29  ? 242.100 278.383 239.908 1.00 37.31  ? 29  ILE F N     1 
ATOM 3961  C CA    . ILE F 2 29  ? 243.350 277.730 239.551 1.00 37.31  ? 29  ILE F CA    1 
ATOM 3962  C C     . ILE F 2 29  ? 243.456 277.806 238.040 1.00 37.31  ? 29  ILE F C     1 
ATOM 3963  O O     . ILE F 2 29  ? 242.950 276.939 237.323 1.00 37.31  ? 29  ILE F O     1 
ATOM 3964  C CB    . ILE F 2 29  ? 243.398 276.280 240.049 1.00 37.31  ? 29  ILE F CB    1 
ATOM 3965  C CG1   . ILE F 2 29  ? 242.925 276.209 241.501 1.00 37.31  ? 29  ILE F CG1   1 
ATOM 3966  C CG2   . ILE F 2 29  ? 244.794 275.718 239.892 1.00 37.31  ? 29  ILE F CG2   1 
ATOM 3967  C CD1   . ILE F 2 29  ? 243.745 277.028 242.452 1.00 37.31  ? 29  ILE F CD1   1 
ATOM 3968  N N     . THR F 2 30  ? 244.097 278.855 237.552 1.00 36.13  ? 30  THR F N     1 
ATOM 3969  C CA    . THR F 2 30  ? 243.984 279.226 236.158 1.00 36.13  ? 30  THR F CA    1 
ATOM 3970  C C     . THR F 2 30  ? 244.923 278.404 235.288 1.00 36.13  ? 30  THR F C     1 
ATOM 3971  O O     . THR F 2 30  ? 245.834 277.720 235.763 1.00 36.13  ? 30  THR F O     1 
ATOM 3972  C CB    . THR F 2 30  ? 244.287 280.709 235.975 1.00 36.13  ? 30  THR F CB    1 
ATOM 3973  O OG1   . THR F 2 30  ? 245.632 280.970 236.380 1.00 36.13  ? 30  THR F OG1   1 
ATOM 3974  C CG2   . THR F 2 30  ? 243.351 281.549 236.800 1.00 36.13  ? 30  THR F CG2   1 
ATOM 3975  N N     . LYS F 2 31  ? 244.677 278.479 233.989 1.00 35.23  ? 31  LYS F N     1 
ATOM 3976  C CA    . LYS F 2 31  ? 245.580 277.872 233.021 1.00 35.23  ? 31  LYS F CA    1 
ATOM 3977  C C     . LYS F 2 31  ? 246.999 278.419 233.104 1.00 35.23  ? 31  LYS F C     1 
ATOM 3978  O O     . LYS F 2 31  ? 247.938 277.610 233.058 1.00 35.23  ? 31  LYS F O     1 
ATOM 3979  C CB    . LYS F 2 31  ? 244.984 278.045 231.619 1.00 35.23  ? 31  LYS F CB    1 
ATOM 3980  C CG    . LYS F 2 31  ? 245.920 277.721 230.494 1.00 35.23  ? 31  LYS F CG    1 
ATOM 3981  C CD    . LYS F 2 31  ? 245.238 277.928 229.166 1.00 35.23  ? 31  LYS F CD    1 
ATOM 3982  C CE    . LYS F 2 31  ? 246.196 277.720 228.015 1.00 35.23  ? 31  LYS F CE    1 
ATOM 3983  N NZ    . LYS F 2 31  ? 245.513 277.871 226.708 1.00 35.23  ? 31  LYS F NZ    1 
ATOM 3984  N N     . PRO F 2 32  ? 247.241 279.729 233.213 1.00 34.54  ? 32  PRO F N     1 
ATOM 3985  C CA    . PRO F 2 32  ? 248.627 280.182 233.407 1.00 34.54  ? 32  PRO F CA    1 
ATOM 3986  C C     . PRO F 2 32  ? 249.277 279.623 234.658 1.00 34.54  ? 32  PRO F C     1 
ATOM 3987  O O     . PRO F 2 32  ? 250.465 279.287 234.631 1.00 34.54  ? 32  PRO F O     1 
ATOM 3988  C CB    . PRO F 2 32  ? 248.483 281.705 233.476 1.00 34.54  ? 32  PRO F CB    1 
ATOM 3989  C CG    . PRO F 2 32  ? 247.236 281.996 232.813 1.00 34.54  ? 32  PRO F CG    1 
ATOM 3990  C CD    . PRO F 2 32  ? 246.326 280.872 233.087 1.00 34.54  ? 32  PRO F CD    1 
ATOM 3991  N N     . ALA F 2 33  ? 248.533 279.501 235.757 1.00 34.07  ? 33  ALA F N     1 
ATOM 3992  C CA    . ALA F 2 33  ? 249.100 278.925 236.973 1.00 34.07  ? 33  ALA F CA    1 
ATOM 3993  C C     . ALA F 2 33  ? 249.458 277.459 236.781 1.00 34.07  ? 33  ALA F C     1 
ATOM 3994  O O     . ALA F 2 33  ? 250.528 277.012 237.212 1.00 34.07  ? 33  ALA F O     1 
ATOM 3995  C CB    . ALA F 2 33  ? 248.124 279.083 238.134 1.00 34.07  ? 33  ALA F CB    1 
ATOM 3996  N N     . ILE F 2 34  ? 248.564 276.688 236.164 1.00 33.70  ? 34  ILE F N     1 
ATOM 3997  C CA    . ILE F 2 34  ? 248.868 275.287 235.902 1.00 33.70  ? 34  ILE F CA    1 
ATOM 3998  C C     . ILE F 2 34  ? 250.075 275.170 234.985 1.00 33.70  ? 34  ILE F C     1 
ATOM 3999  O O     . ILE F 2 34  ? 250.922 274.291 235.164 1.00 33.70  ? 34  ILE F O     1 
ATOM 4000  C CB    . ILE F 2 34  ? 247.638 274.571 235.320 1.00 33.70  ? 34  ILE F CB    1 
ATOM 4001  C CG1   . ILE F 2 34  ? 246.509 274.540 236.346 1.00 33.70  ? 34  ILE F CG1   1 
ATOM 4002  C CG2   . ILE F 2 34  ? 248.000 273.171 234.888 1.00 33.70  ? 34  ILE F CG2   1 
ATOM 4003  C CD1   . ILE F 2 34  ? 245.143 274.424 235.737 1.00 33.70  ? 34  ILE F CD1   1 
ATOM 4004  N N     . ARG F 2 35  ? 250.186 276.065 234.005 1.00 34.89  ? 35  ARG F N     1 
ATOM 4005  C CA    . ARG F 2 35  ? 251.346 276.051 233.123 1.00 34.89  ? 35  ARG F CA    1 
ATOM 4006  C C     . ARG F 2 35  ? 252.623 276.342 233.886 1.00 34.89  ? 35  ARG F C     1 
ATOM 4007  O O     . ARG F 2 35  ? 253.654 275.726 233.620 1.00 34.89  ? 35  ARG F O     1 
ATOM 4008  C CB    . ARG F 2 35  ? 251.179 277.059 231.994 1.00 34.89  ? 35  ARG F CB    1 
ATOM 4009  C CG    . ARG F 2 35  ? 250.165 276.653 230.969 1.00 34.89  ? 35  ARG F CG    1 
ATOM 4010  C CD    . ARG F 2 35  ? 249.923 277.753 229.968 1.00 34.89  ? 35  ARG F CD    1 
ATOM 4011  N NE    . ARG F 2 35  ? 251.035 277.938 229.046 1.00 34.89  ? 35  ARG F NE    1 
ATOM 4012  C CZ    . ARG F 2 35  ? 251.220 277.199 227.961 1.00 34.89  ? 35  ARG F CZ    1 
ATOM 4013  N NH1   . ARG F 2 35  ? 250.378 276.221 227.682 1.00 34.89  ? 35  ARG F NH1   1 
ATOM 4014  N NH2   . ARG F 2 35  ? 252.246 277.434 227.160 1.00 34.89  ? 35  ARG F NH2   1 
ATOM 4015  N N     . ARG F 2 36  ? 252.583 277.287 234.821 1.00 34.02  ? 36  ARG F N     1 
ATOM 4016  C CA    . ARG F 2 36  ? 253.767 277.563 235.626 1.00 34.02  ? 36  ARG F CA    1 
ATOM 4017  C C     . ARG F 2 36  ? 254.168 276.345 236.442 1.00 34.02  ? 36  ARG F C     1 
ATOM 4018  O O     . ARG F 2 36  ? 255.356 276.012 236.537 1.00 34.02  ? 36  ARG F O     1 
ATOM 4019  C CB    . ARG F 2 36  ? 253.516 278.753 236.541 1.00 34.02  ? 36  ARG F CB    1 
ATOM 4020  C CG    . ARG F 2 36  ? 253.456 280.064 235.833 1.00 34.02  ? 36  ARG F CG    1 
ATOM 4021  C CD    . ARG F 2 36  ? 253.493 281.192 236.820 1.00 34.02  ? 36  ARG F CD    1 
ATOM 4022  N NE    . ARG F 2 36  ? 252.288 281.244 237.629 1.00 34.02  ? 36  ARG F NE    1 
ATOM 4023  C CZ    . ARG F 2 36  ? 251.220 281.960 237.314 1.00 34.02  ? 36  ARG F CZ    1 
ATOM 4024  N NH1   . ARG F 2 36  ? 251.220 282.681 236.208 1.00 34.02  ? 36  ARG F NH1   1 
ATOM 4025  N NH2   . ARG F 2 36  ? 250.161 281.960 238.101 1.00 34.02  ? 36  ARG F NH2   1 
ATOM 4026  N N     . LEU F 2 37  ? 253.187 275.677 237.049 1.00 33.22  ? 37  LEU F N     1 
ATOM 4027  C CA    . LEU F 2 37  ? 253.474 274.450 237.781 1.00 33.22  ? 37  LEU F CA    1 
ATOM 4028  C C     . LEU F 2 37  ? 254.108 273.407 236.877 1.00 33.22  ? 37  LEU F C     1 
ATOM 4029  O O     . LEU F 2 37  ? 255.074 272.745 237.264 1.00 33.22  ? 37  LEU F O     1 
ATOM 4030  C CB    . LEU F 2 37  ? 252.199 273.895 238.406 1.00 33.22  ? 37  LEU F CB    1 
ATOM 4031  C CG    . LEU F 2 37  ? 251.594 274.703 239.542 1.00 33.22  ? 37  LEU F CG    1 
ATOM 4032  C CD1   . LEU F 2 37  ? 250.195 274.233 239.804 1.00 33.22  ? 37  LEU F CD1   1 
ATOM 4033  C CD2   . LEU F 2 37  ? 252.440 274.557 240.771 1.00 33.22  ? 37  LEU F CD2   1 
ATOM 4034  N N     . ALA F 2 38  ? 253.576 273.247 235.666 1.00 32.95  ? 38  ALA F N     1 
ATOM 4035  C CA    . ALA F 2 38  ? 254.135 272.273 234.736 1.00 32.95  ? 38  ALA F CA    1 
ATOM 4036  C C     . ALA F 2 38  ? 255.549 272.651 234.325 1.00 32.95  ? 38  ALA F C     1 
ATOM 4037  O O     . ALA F 2 38  ? 256.411 271.782 234.169 1.00 32.95  ? 38  ALA F O     1 
ATOM 4038  C CB    . ALA F 2 38  ? 253.239 272.143 233.511 1.00 32.95  ? 38  ALA F CB    1 
ATOM 4039  N N     . ARG F 2 39  ? 255.812 273.946 234.165 1.00 34.60  ? 39  ARG F N     1 
ATOM 4040  C CA    . ARG F 2 39  ? 257.157 274.386 233.821 1.00 34.60  ? 39  ARG F CA    1 
ATOM 4041  C C     . ARG F 2 39  ? 258.135 274.035 234.924 1.00 34.60  ? 39  ARG F C     1 
ATOM 4042  O O     . ARG F 2 39  ? 259.213 273.497 234.656 1.00 34.60  ? 39  ARG F O     1 
ATOM 4043  C CB    . ARG F 2 39  ? 257.182 275.886 233.555 1.00 34.60  ? 39  ARG F CB    1 
ATOM 4044  C CG    . ARG F 2 39  ? 256.384 276.325 232.366 1.00 34.60  ? 39  ARG F CG    1 
ATOM 4045  C CD    . ARG F 2 39  ? 256.923 275.765 231.084 1.00 34.60  ? 39  ARG F CD    1 
ATOM 4046  N NE    . ARG F 2 39  ? 256.258 276.381 229.948 1.00 34.60  ? 39  ARG F NE    1 
ATOM 4047  C CZ    . ARG F 2 39  ? 255.554 275.719 229.042 1.00 34.60  ? 39  ARG F CZ    1 
ATOM 4048  N NH1   . ARG F 2 39  ? 255.443 274.407 229.116 1.00 34.60  ? 39  ARG F NH1   1 
ATOM 4049  N NH2   . ARG F 2 39  ? 254.981 276.374 228.050 1.00 34.60  ? 39  ARG F NH2   1 
ATOM 4050  N N     . ARG F 2 40  ? 257.777 274.325 236.174 1.00 34.36  ? 40  ARG F N     1 
ATOM 4051  C CA    . ARG F 2 40  ? 258.640 273.906 237.271 1.00 34.36  ? 40  ARG F CA    1 
ATOM 4052  C C     . ARG F 2 40  ? 258.775 272.391 237.316 1.00 34.36  ? 40  ARG F C     1 
ATOM 4053  O O     . ARG F 2 40  ? 259.828 271.873 237.695 1.00 34.36  ? 40  ARG F O     1 
ATOM 4054  C CB    . ARG F 2 40  ? 258.123 274.444 238.602 1.00 34.36  ? 40  ARG F CB    1 
ATOM 4055  C CG    . ARG F 2 40  ? 258.968 274.011 239.774 1.00 34.36  ? 40  ARG F CG    1 
ATOM 4056  C CD    . ARG F 2 40  ? 258.612 274.736 241.033 1.00 34.36  ? 40  ARG F CD    1 
ATOM 4057  N NE    . ARG F 2 40  ? 258.985 276.139 240.971 1.00 34.36  ? 40  ARG F NE    1 
ATOM 4058  C CZ    . ARG F 2 40  ? 258.521 277.061 241.801 1.00 34.36  ? 40  ARG F CZ    1 
ATOM 4059  N NH1   . ARG F 2 40  ? 257.658 276.723 242.742 1.00 34.36  ? 40  ARG F NH1   1 
ATOM 4060  N NH2   . ARG F 2 40  ? 258.903 278.319 241.680 1.00 34.36  ? 40  ARG F NH2   1 
ATOM 4061  N N     . GLY F 2 41  ? 257.746 271.669 236.899 1.00 33.23  ? 41  GLY F N     1 
ATOM 4062  C CA    . GLY F 2 41  ? 257.844 270.241 236.714 1.00 33.23  ? 41  GLY F CA    1 
ATOM 4063  C C     . GLY F 2 41  ? 258.640 269.795 235.513 1.00 33.23  ? 41  GLY F C     1 
ATOM 4064  O O     . GLY F 2 41  ? 258.830 268.595 235.320 1.00 33.23  ? 41  GLY F O     1 
ATOM 4065  N N     . GLY F 2 42  ? 259.087 270.725 234.679 1.00 33.55  ? 42  GLY F N     1 
ATOM 4066  C CA    . GLY F 2 42  ? 259.927 270.399 233.549 1.00 33.55  ? 42  GLY F CA    1 
ATOM 4067  C C     . GLY F 2 42  ? 259.199 270.125 232.259 1.00 33.55  ? 42  GLY F C     1 
ATOM 4068  O O     . GLY F 2 42  ? 259.813 269.609 231.323 1.00 33.55  ? 42  GLY F O     1 
ATOM 4069  N N     . VAL F 2 43  ? 257.916 270.436 232.182 1.00 33.83  ? 43  VAL F N     1 
ATOM 4070  C CA    . VAL F 2 43  ? 257.121 270.134 231.003 1.00 33.83  ? 43  VAL F CA    1 
ATOM 4071  C C     . VAL F 2 43  ? 257.334 271.216 229.959 1.00 33.83  ? 43  VAL F C     1 
ATOM 4072  O O     . VAL F 2 43  ? 257.270 272.412 230.259 1.00 33.83  ? 43  VAL F O     1 
ATOM 4073  C CB    . VAL F 2 43  ? 255.639 270.001 231.374 1.00 33.83  ? 43  VAL F CB    1 
ATOM 4074  C CG1   . VAL F 2 43  ? 254.788 269.904 230.131 1.00 33.83  ? 43  VAL F CG1   1 
ATOM 4075  C CG2   . VAL F 2 43  ? 255.449 268.791 232.248 1.00 33.83  ? 43  VAL F CG2   1 
ATOM 4076  N N     . LYS F 2 44  ? 257.580 270.796 228.727 1.00 37.25  ? 44  LYS F N     1 
ATOM 4077  C CA    . LYS F 2 44  ? 257.818 271.716 227.630 1.00 37.25  ? 44  LYS F CA    1 
ATOM 4078  C C     . LYS F 2 44  ? 256.564 272.039 226.840 1.00 37.25  ? 44  LYS F C     1 
ATOM 4079  O O     . LYS F 2 44  ? 256.458 273.140 226.297 1.00 37.25  ? 44  LYS F O     1 
ATOM 4080  C CB    . LYS F 2 44  ? 258.870 271.136 226.685 1.00 37.25  ? 44  LYS F CB    1 
ATOM 4081  C CG    . LYS F 2 44  ? 259.414 272.118 225.685 1.00 37.25  ? 44  LYS F CG    1 
ATOM 4082  C CD    . LYS F 2 44  ? 260.262 271.424 224.654 1.00 37.25  ? 44  LYS F CD    1 
ATOM 4083  C CE    . LYS F 2 44  ? 260.760 272.409 223.628 1.00 37.25  ? 44  LYS F CE    1 
ATOM 4084  N NZ    . LYS F 2 44  ? 261.643 271.760 222.633 1.00 37.25  ? 44  LYS F NZ    1 
ATOM 4085  N N     . ARG F 2 45  ? 255.605 271.122 226.780 1.00 37.06  ? 45  ARG F N     1 
ATOM 4086  C CA    . ARG F 2 45  ? 254.452 271.271 225.907 1.00 37.06  ? 45  ARG F CA    1 
ATOM 4087  C C     . ARG F 2 45  ? 253.252 270.605 226.558 1.00 37.06  ? 45  ARG F C     1 
ATOM 4088  O O     . ARG F 2 45  ? 253.330 269.445 226.969 1.00 37.06  ? 45  ARG F O     1 
ATOM 4089  C CB    . ARG F 2 45  ? 254.739 270.655 224.542 1.00 37.06  ? 45  ARG F CB    1 
ATOM 4090  C CG    . ARG F 2 45  ? 253.817 271.092 223.454 1.00 37.06  ? 45  ARG F CG    1 
ATOM 4091  C CD    . ARG F 2 45  ? 254.220 270.442 222.160 1.00 37.06  ? 45  ARG F CD    1 
ATOM 4092  N NE    . ARG F 2 45  ? 253.117 270.421 221.216 1.00 37.06  ? 45  ARG F NE    1 
ATOM 4093  C CZ    . ARG F 2 45  ? 252.936 271.344 220.288 1.00 37.06  ? 45  ARG F CZ    1 
ATOM 4094  N NH1   . ARG F 2 45  ? 253.795 272.343 220.182 1.00 37.06  ? 45  ARG F NH1   1 
ATOM 4095  N NH2   . ARG F 2 45  ? 251.907 271.265 219.463 1.00 37.06  ? 45  ARG F NH2   1 
ATOM 4096  N N     . ILE F 2 46  ? 252.143 271.335 226.630 1.00 35.62  ? 46  ILE F N     1 
ATOM 4097  C CA    . ILE F 2 46  ? 250.994 270.947 227.433 1.00 35.62  ? 46  ILE F CA    1 
ATOM 4098  C C     . ILE F 2 46  ? 249.771 270.842 226.538 1.00 35.62  ? 46  ILE F C     1 
ATOM 4099  O O     . ILE F 2 46  ? 249.437 271.791 225.822 1.00 35.62  ? 46  ILE F O     1 
ATOM 4100  C CB    . ILE F 2 46  ? 250.737 271.943 228.571 1.00 35.62  ? 46  ILE F CB    1 
ATOM 4101  C CG1   . ILE F 2 46  ? 252.034 272.225 229.322 1.00 35.62  ? 46  ILE F CG1   1 
ATOM 4102  C CG2   . ILE F 2 46  ? 249.684 271.405 229.499 1.00 35.62  ? 46  ILE F CG2   1 
ATOM 4103  C CD1   . ILE F 2 46  ? 251.940 273.346 230.286 1.00 35.62  ? 46  ILE F CD1   1 
ATOM 4104  N N     . SER F 2 47  ? 249.100 269.701 226.583 1.00 36.06  ? 47  SER F N     1 
ATOM 4105  C CA    . SER F 2 47  ? 247.854 269.549 225.851 1.00 36.06  ? 47  SER F CA    1 
ATOM 4106  C C     . SER F 2 47  ? 246.754 270.364 226.514 1.00 36.06  ? 47  SER F C     1 
ATOM 4107  O O     . SER F 2 47  ? 246.749 270.568 227.728 1.00 36.06  ? 47  SER F O     1 
ATOM 4108  C CB    . SER F 2 47  ? 247.457 268.082 225.780 1.00 36.06  ? 47  SER F CB    1 
ATOM 4109  O OG    . SER F 2 47  ? 246.055 267.939 225.755 1.00 36.06  ? 47  SER F OG    1 
ATOM 4110  N N     . GLY F 2 48  ? 245.812 270.837 225.699 1.00 35.29  ? 48  GLY F N     1 
ATOM 4111  C CA    . GLY F 2 48  ? 244.757 271.704 226.189 1.00 35.29  ? 48  GLY F CA    1 
ATOM 4112  C C     . GLY F 2 48  ? 243.800 271.041 227.155 1.00 35.29  ? 48  GLY F C     1 
ATOM 4113  O O     . GLY F 2 48  ? 243.104 271.738 227.895 1.00 35.29  ? 48  GLY F O     1 
ATOM 4114  N N     . LEU F 2 49  ? 243.753 269.718 227.171 1.00 35.09  ? 49  LEU F N     1 
ATOM 4115  C CA    . LEU F 2 49  ? 242.899 268.994 228.098 1.00 35.09  ? 49  LEU F CA    1 
ATOM 4116  C C     . LEU F 2 49  ? 243.547 268.775 229.454 1.00 35.09  ? 49  LEU F C     1 
ATOM 4117  O O     . LEU F 2 49  ? 242.922 268.180 230.332 1.00 35.09  ? 49  LEU F O     1 
ATOM 4118  C CB    . LEU F 2 49  ? 242.510 267.644 227.503 1.00 35.09  ? 49  LEU F CB    1 
ATOM 4119  C CG    . LEU F 2 49  ? 241.697 267.671 226.215 1.00 35.09  ? 49  LEU F CG    1 
ATOM 4120  C CD1   . LEU F 2 49  ? 241.600 266.276 225.659 1.00 35.09  ? 49  LEU F CD1   1 
ATOM 4121  C CD2   . LEU F 2 49  ? 240.322 268.235 226.477 1.00 35.09  ? 49  LEU F CD2   1 
ATOM 4122  N N     . ILE F 2 50  ? 244.781 269.239 229.644 1.00 35.07  ? 50  ILE F N     1 
ATOM 4123  C CA    . ILE F 2 50  ? 245.483 268.997 230.896 1.00 35.07  ? 50  ILE F CA    1 
ATOM 4124  C C     . ILE F 2 50  ? 244.884 269.822 232.021 1.00 35.07  ? 50  ILE F C     1 
ATOM 4125  O O     . ILE F 2 50  ? 244.916 269.408 233.179 1.00 35.07  ? 50  ILE F O     1 
ATOM 4126  C CB    . ILE F 2 50  ? 246.986 269.284 230.711 1.00 35.07  ? 50  ILE F CB    1 
ATOM 4127  C CG1   . ILE F 2 50  ? 247.675 268.115 230.018 1.00 35.07  ? 50  ILE F CG1   1 
ATOM 4128  C CG2   . ILE F 2 50  ? 247.674 269.579 232.030 1.00 35.07  ? 50  ILE F CG2   1 
ATOM 4129  C CD1   . ILE F 2 50  ? 247.846 266.924 230.892 1.00 35.07  ? 50  ILE F CD1   1 
ATOM 4130  N N     . TYR F 2 51  ? 244.310 270.978 231.708 1.00 35.45  ? 51  TYR F N     1 
ATOM 4131  C CA    . TYR F 2 51  ? 243.965 271.926 232.759 1.00 35.45  ? 51  TYR F CA    1 
ATOM 4132  C C     . TYR F 2 51  ? 242.776 271.449 233.585 1.00 35.45  ? 51  TYR F C     1 
ATOM 4133  O O     . TYR F 2 51  ? 242.801 271.534 234.815 1.00 35.45  ? 51  TYR F O     1 
ATOM 4134  C CB    . TYR F 2 51  ? 243.720 273.296 232.140 1.00 35.45  ? 51  TYR F CB    1 
ATOM 4135  C CG    . TYR F 2 51  ? 244.884 273.745 231.297 1.00 35.45  ? 51  TYR F CG    1 
ATOM 4136  C CD1   . TYR F 2 51  ? 246.077 274.128 231.880 1.00 35.45  ? 51  TYR F CD1   1 
ATOM 4137  C CD2   . TYR F 2 51  ? 244.800 273.765 229.919 1.00 35.45  ? 51  TYR F CD2   1 
ATOM 4138  C CE1   . TYR F 2 51  ? 247.142 274.526 231.117 1.00 35.45  ? 51  TYR F CE1   1 
ATOM 4139  C CE2   . TYR F 2 51  ? 245.860 274.163 229.150 1.00 35.45  ? 51  TYR F CE2   1 
ATOM 4140  C CZ    . TYR F 2 51  ? 247.027 274.540 229.753 1.00 35.45  ? 51  TYR F CZ    1 
ATOM 4141  O OH    . TYR F 2 51  ? 248.087 274.936 228.981 1.00 35.45  ? 51  TYR F OH    1 
ATOM 4142  N N     . GLU F 2 52  ? 241.738 270.922 232.943 1.00 37.41  ? 52  GLU F N     1 
ATOM 4143  C CA    . GLU F 2 52  ? 240.622 270.385 233.712 1.00 37.41  ? 52  GLU F CA    1 
ATOM 4144  C C     . GLU F 2 52  ? 241.029 269.142 234.489 1.00 37.41  ? 52  GLU F C     1 
ATOM 4145  O O     . GLU F 2 52  ? 240.620 268.962 235.643 1.00 37.41  ? 52  GLU F O     1 
ATOM 4146  C CB    . GLU F 2 52  ? 239.447 270.089 232.792 1.00 37.41  ? 52  GLU F CB    1 
ATOM 4147  C CG    . GLU F 2 52  ? 238.680 271.335 232.424 1.00 37.41  ? 52  GLU F CG    1 
ATOM 4148  C CD    . GLU F 2 52  ? 238.207 272.100 233.644 1.00 37.41  ? 52  GLU F CD    1 
ATOM 4149  O OE1   . GLU F 2 52  ? 237.677 271.464 234.578 1.00 37.41  ? 52  GLU F OE1   1 
ATOM 4150  O OE2   . GLU F 2 52  ? 238.370 273.336 233.678 1.00 37.41  ? 52  GLU F OE2   1 
ATOM 4151  N N     . GLU F 2 53  ? 241.828 268.273 233.872 1.00 37.04  ? 53  GLU F N     1 
ATOM 4152  C CA    . GLU F 2 53  ? 242.349 267.108 234.575 1.00 37.04  ? 53  GLU F CA    1 
ATOM 4153  C C     . GLU F 2 53  ? 243.123 267.520 235.818 1.00 37.04  ? 53  GLU F C     1 
ATOM 4154  O O     . GLU F 2 53  ? 242.958 266.929 236.890 1.00 37.04  ? 53  GLU F O     1 
ATOM 4155  C CB    . GLU F 2 53  ? 243.236 266.300 233.632 1.00 37.04  ? 53  GLU F CB    1 
ATOM 4156  C CG    . GLU F 2 53  ? 243.802 265.048 234.232 1.00 37.04  ? 53  GLU F CG    1 
ATOM 4157  C CD    . GLU F 2 53  ? 242.811 263.915 234.233 1.00 37.04  ? 53  GLU F CD    1 
ATOM 4158  O OE1   . GLU F 2 53  ? 242.994 262.967 235.021 1.00 37.04  ? 53  GLU F OE1   1 
ATOM 4159  O OE2   . GLU F 2 53  ? 241.850 263.969 233.439 1.00 37.04  ? 53  GLU F OE2   1 
ATOM 4160  N N     . THR F 2 54  ? 243.950 268.554 235.698 1.00 35.26  ? 54  THR F N     1 
ATOM 4161  C CA    . THR F 2 54  ? 244.761 268.999 236.821 1.00 35.26  ? 54  THR F CA    1 
ATOM 4162  C C     . THR F 2 54  ? 243.902 269.643 237.894 1.00 35.26  ? 54  THR F C     1 
ATOM 4163  O O     . THR F 2 54  ? 244.170 269.478 239.084 1.00 35.26  ? 54  THR F O     1 
ATOM 4164  C CB    . THR F 2 54  ? 245.838 269.969 236.341 1.00 35.26  ? 54  THR F CB    1 
ATOM 4165  O OG1   . THR F 2 54  ? 246.616 269.340 235.320 1.00 35.26  ? 54  THR F OG1   1 
ATOM 4166  C CG2   . THR F 2 54  ? 246.752 270.356 237.476 1.00 35.26  ? 54  THR F CG2   1 
ATOM 4167  N N     . ARG F 2 55  ? 242.870 270.384 237.498 1.00 35.75  ? 55  ARG F N     1 
ATOM 4168  C CA    . ARG F 2 55  ? 241.978 270.957 238.496 1.00 35.75  ? 55  ARG F CA    1 
ATOM 4169  C C     . ARG F 2 55  ? 241.276 269.863 239.282 1.00 35.75  ? 55  ARG F C     1 
ATOM 4170  O O     . ARG F 2 55  ? 241.156 269.953 240.507 1.00 35.75  ? 55  ARG F O     1 
ATOM 4171  C CB    . ARG F 2 55  ? 240.976 271.896 237.834 1.00 35.75  ? 55  ARG F CB    1 
ATOM 4172  C CG    . ARG F 2 55  ? 241.597 273.194 237.392 1.00 35.75  ? 55  ARG F CG    1 
ATOM 4173  C CD    . ARG F 2 55  ? 240.577 274.121 236.788 1.00 35.75  ? 55  ARG F CD    1 
ATOM 4174  N NE    . ARG F 2 55  ? 241.212 275.271 236.165 1.00 35.75  ? 55  ARG F NE    1 
ATOM 4175  C CZ    . ARG F 2 55  ? 241.319 275.437 234.856 1.00 35.75  ? 55  ARG F CZ    1 
ATOM 4176  N NH1   . ARG F 2 55  ? 240.814 274.536 234.036 1.00 35.75  ? 55  ARG F NH1   1 
ATOM 4177  N NH2   . ARG F 2 55  ? 241.915 276.509 234.369 1.00 35.75  ? 55  ARG F NH2   1 
ATOM 4178  N N     . GLY F 2 56  ? 240.843 268.803 238.601 1.00 34.77  ? 56  GLY F N     1 
ATOM 4179  C CA    . GLY F 2 56  ? 240.272 267.671 239.312 1.00 34.77  ? 56  GLY F CA    1 
ATOM 4180  C C     . GLY F 2 56  ? 241.259 267.003 240.250 1.00 34.77  ? 56  GLY F C     1 
ATOM 4181  O O     . GLY F 2 56  ? 240.915 266.649 241.381 1.00 34.77  ? 56  GLY F O     1 
ATOM 4182  N N     . VAL F 2 57  ? 242.497 266.821 239.791 1.00 34.04  ? 57  VAL F N     1 
ATOM 4183  C CA    . VAL F 2 57  ? 243.524 266.197 240.625 1.00 34.04  ? 57  VAL F CA    1 
ATOM 4184  C C     . VAL F 2 57  ? 243.773 267.030 241.877 1.00 34.04  ? 57  VAL F C     1 
ATOM 4185  O O     . VAL F 2 57  ? 243.824 266.508 242.997 1.00 34.04  ? 57  VAL F O     1 
ATOM 4186  C CB    . VAL F 2 57  ? 244.817 266.000 239.815 1.00 34.04  ? 57  VAL F CB    1 
ATOM 4187  C CG1   . VAL F 2 57  ? 245.951 265.654 240.727 1.00 34.04  ? 57  VAL F CG1   1 
ATOM 4188  C CG2   . VAL F 2 57  ? 244.633 264.915 238.786 1.00 34.04  ? 57  VAL F CG2   1 
ATOM 4189  N N     . LEU F 2 58  ? 243.919 268.342 241.701 1.00 33.92  ? 58  LEU F N     1 
ATOM 4190  C CA    . LEU F 2 58  ? 244.173 269.221 242.832 1.00 33.92  ? 58  LEU F CA    1 
ATOM 4191  C C     . LEU F 2 58  ? 242.997 269.227 243.789 1.00 33.92  ? 58  LEU F C     1 
ATOM 4192  O O     . LEU F 2 58  ? 243.181 269.240 245.009 1.00 33.92  ? 58  LEU F O     1 
ATOM 4193  C CB    . LEU F 2 58  ? 244.472 270.635 242.345 1.00 33.92  ? 58  LEU F CB    1 
ATOM 4194  C CG    . LEU F 2 58  ? 244.653 271.686 243.435 1.00 33.92  ? 58  LEU F CG    1 
ATOM 4195  C CD1   . LEU F 2 58  ? 245.854 271.360 244.297 1.00 33.92  ? 58  LEU F CD1   1 
ATOM 4196  C CD2   . LEU F 2 58  ? 244.787 273.061 242.826 1.00 33.92  ? 58  LEU F CD2   1 
ATOM 4197  N N     . LYS F 2 59  ? 241.779 269.194 243.254 1.00 35.41  ? 59  LYS F N     1 
ATOM 4198  C CA    . LYS F 2 59  ? 240.610 269.144 244.115 1.00 35.41  ? 59  LYS F CA    1 
ATOM 4199  C C     . LYS F 2 59  ? 240.598 267.877 244.958 1.00 35.41  ? 59  LYS F C     1 
ATOM 4200  O O     . LYS F 2 59  ? 240.303 267.930 246.153 1.00 35.41  ? 59  LYS F O     1 
ATOM 4201  C CB    . LYS F 2 59  ? 239.341 269.240 243.280 1.00 35.41  ? 59  LYS F CB    1 
ATOM 4202  C CG    . LYS F 2 59  ? 238.169 269.797 244.041 1.00 35.41  ? 59  LYS F CG    1 
ATOM 4203  C CD    . LYS F 2 59  ? 236.899 269.726 243.232 1.00 35.41  ? 59  LYS F CD    1 
ATOM 4204  C CE    . LYS F 2 59  ? 235.823 270.597 243.844 1.00 35.41  ? 59  LYS F CE    1 
ATOM 4205  N NZ    . LYS F 2 59  ? 235.626 270.296 245.287 1.00 35.41  ? 59  LYS F NZ    1 
ATOM 4206  N N     . VAL F 2 60  ? 240.908 266.730 244.357 1.00 34.59  ? 60  VAL F N     1 
ATOM 4207  C CA    . VAL F 2 60  ? 240.920 265.477 245.113 1.00 34.59  ? 60  VAL F CA    1 
ATOM 4208  C C     . VAL F 2 60  ? 241.971 265.524 246.216 1.00 34.59  ? 60  VAL F C     1 
ATOM 4209  O O     . VAL F 2 60  ? 241.719 265.126 247.364 1.00 34.59  ? 60  VAL F O     1 
ATOM 4210  C CB    . VAL F 2 60  ? 241.148 264.286 244.168 1.00 34.59  ? 60  VAL F CB    1 
ATOM 4211  C CG1   . VAL F 2 60  ? 241.662 263.088 244.936 1.00 34.59  ? 60  VAL F CG1   1 
ATOM 4212  C CG2   . VAL F 2 60  ? 239.867 263.940 243.457 1.00 34.59  ? 60  VAL F CG2   1 
ATOM 4213  N N     . PHE F 2 61  ? 243.171 265.999 245.876 1.00 33.10  ? 61  PHE F N     1 
ATOM 4214  C CA    . PHE F 2 61  ? 244.237 266.122 246.865 1.00 33.10  ? 61  PHE F CA    1 
ATOM 4215  C C     . PHE F 2 61  ? 243.800 266.996 248.031 1.00 33.10  ? 61  PHE F C     1 
ATOM 4216  O O     . PHE F 2 61  ? 243.932 266.613 249.202 1.00 33.10  ? 61  PHE F O     1 
ATOM 4217  C CB    . PHE F 2 61  ? 245.486 266.700 246.200 1.00 33.10  ? 61  PHE F CB    1 
ATOM 4218  C CG    . PHE F 2 61  ? 246.639 266.896 247.133 1.00 33.10  ? 61  PHE F CG    1 
ATOM 4219  C CD1   . PHE F 2 61  ? 247.463 265.844 247.452 1.00 33.10  ? 61  PHE F CD1   1 
ATOM 4220  C CD2   . PHE F 2 61  ? 246.910 268.134 247.681 1.00 33.10  ? 61  PHE F CD2   1 
ATOM 4221  C CE1   . PHE F 2 61  ? 248.522 266.019 248.299 1.00 33.10  ? 61  PHE F CE1   1 
ATOM 4222  C CE2   . PHE F 2 61  ? 247.969 268.306 248.531 1.00 33.10  ? 61  PHE F CE2   1 
ATOM 4223  C CZ    . PHE F 2 61  ? 248.774 267.249 248.842 1.00 33.10  ? 61  PHE F CZ    1 
ATOM 4224  N N     . LEU F 2 62  ? 243.277 268.180 247.724 1.00 34.04  ? 62  LEU F N     1 
ATOM 4225  C CA    . LEU F 2 62  ? 242.884 269.110 248.769 1.00 34.04  ? 62  LEU F CA    1 
ATOM 4226  C C     . LEU F 2 62  ? 241.739 268.557 249.594 1.00 34.04  ? 62  LEU F C     1 
ATOM 4227  O O     . LEU F 2 62  ? 241.680 268.790 250.798 1.00 34.04  ? 62  LEU F O     1 
ATOM 4228  C CB    . LEU F 2 62  ? 242.512 270.454 248.159 1.00 34.04  ? 62  LEU F CB    1 
ATOM 4229  C CG    . LEU F 2 62  ? 243.701 271.328 247.795 1.00 34.04  ? 62  LEU F CG    1 
ATOM 4230  C CD1   . LEU F 2 62  ? 243.224 272.541 247.059 1.00 34.04  ? 62  LEU F CD1   1 
ATOM 4231  C CD2   . LEU F 2 62  ? 244.449 271.716 249.043 1.00 34.04  ? 62  LEU F CD2   1 
ATOM 4232  N N     . GLU F 2 63  ? 240.826 267.815 248.973 1.00 35.98  ? 63  GLU F N     1 
ATOM 4233  C CA    . GLU F 2 63  ? 239.740 267.221 249.736 1.00 35.98  ? 63  GLU F CA    1 
ATOM 4234  C C     . GLU F 2 63  ? 240.268 266.233 250.759 1.00 35.98  ? 63  GLU F C     1 
ATOM 4235  O O     . GLU F 2 63  ? 239.877 266.282 251.926 1.00 35.98  ? 63  GLU F O     1 
ATOM 4236  C CB    . GLU F 2 63  ? 238.736 266.558 248.801 1.00 35.98  ? 63  GLU F CB    1 
ATOM 4237  C CG    . GLU F 2 63  ? 237.688 267.521 248.297 1.00 35.98  ? 63  GLU F CG    1 
ATOM 4238  C CD    . GLU F 2 63  ? 237.078 267.100 246.982 1.00 35.98  ? 63  GLU F CD    1 
ATOM 4239  O OE1   . GLU F 2 63  ? 237.440 266.024 246.467 1.00 35.98  ? 63  GLU F OE1   1 
ATOM 4240  O OE2   . GLU F 2 63  ? 236.230 267.851 246.460 1.00 35.98  ? 63  GLU F OE2   1 
ATOM 4241  N N     . ASN F 2 64  ? 241.177 265.347 250.355 1.00 35.41  ? 64  ASN F N     1 
ATOM 4242  C CA    . ASN F 2 64  ? 241.751 264.415 251.323 1.00 35.41  ? 64  ASN F CA    1 
ATOM 4243  C C     . ASN F 2 64  ? 242.446 265.156 252.463 1.00 35.41  ? 64  ASN F C     1 
ATOM 4244  O O     . ASN F 2 64  ? 242.157 264.925 253.650 1.00 35.41  ? 64  ASN F O     1 
ATOM 4245  C CB    . ASN F 2 64  ? 242.721 263.468 250.625 1.00 35.41  ? 64  ASN F CB    1 
ATOM 4246  C CG    . ASN F 2 64  ? 242.038 262.593 249.619 1.00 35.41  ? 64  ASN F CG    1 
ATOM 4247  O OD1   . ASN F 2 64  ? 240.885 262.216 249.796 1.00 35.41  ? 64  ASN F OD1   1 
ATOM 4248  N ND2   . ASN F 2 64  ? 242.740 262.262 248.550 1.00 35.41  ? 64  ASN F ND2   1 
ATOM 4249  N N     . VAL F 2 65  ? 243.344 266.080 252.118 1.00 34.29  ? 65  VAL F N     1 
ATOM 4250  C CA    . VAL F 2 65  ? 244.129 266.763 253.143 1.00 34.29  ? 65  VAL F CA    1 
ATOM 4251  C C     . VAL F 2 65  ? 243.233 267.576 254.065 1.00 34.29  ? 65  VAL F C     1 
ATOM 4252  O O     . VAL F 2 65  ? 243.403 267.558 255.287 1.00 34.29  ? 65  VAL F O     1 
ATOM 4253  C CB    . VAL F 2 65  ? 245.210 267.644 252.499 1.00 34.29  ? 65  VAL F CB    1 
ATOM 4254  C CG1   . VAL F 2 65  ? 245.979 268.359 253.571 1.00 34.29  ? 65  VAL F CG1   1 
ATOM 4255  C CG2   . VAL F 2 65  ? 246.137 266.811 251.668 1.00 34.29  ? 65  VAL F CG2   1 
ATOM 4256  N N     . ILE F 2 66  ? 242.269 268.302 253.503 1.00 35.20  ? 66  ILE F N     1 
ATOM 4257  C CA    . ILE F 2 66  ? 241.436 269.188 254.303 1.00 35.20  ? 66  ILE F CA    1 
ATOM 4258  C C     . ILE F 2 66  ? 240.471 268.388 255.156 1.00 35.20  ? 66  ILE F C     1 
ATOM 4259  O O     . ILE F 2 66  ? 240.175 268.771 256.288 1.00 35.20  ? 66  ILE F O     1 
ATOM 4260  C CB    . ILE F 2 66  ? 240.699 270.192 253.397 1.00 35.20  ? 66  ILE F CB    1 
ATOM 4261  C CG1   . ILE F 2 66  ? 241.680 271.206 252.817 1.00 35.20  ? 66  ILE F CG1   1 
ATOM 4262  C CG2   . ILE F 2 66  ? 239.611 270.913 254.162 1.00 35.20  ? 66  ILE F CG2   1 
ATOM 4263  C CD1   . ILE F 2 66  ? 241.095 272.055 251.738 1.00 35.20  ? 66  ILE F CD1   1 
ATOM 4264  N N     . ARG F 2 67  ? 239.952 267.275 254.638 1.00 36.63  ? 67  ARG F N     1 
ATOM 4265  C CA    . ARG F 2 67  ? 239.130 266.409 255.470 1.00 36.63  ? 67  ARG F CA    1 
ATOM 4266  C C     . ARG F 2 67  ? 239.899 265.973 256.705 1.00 36.63  ? 67  ARG F C     1 
ATOM 4267  O O     . ARG F 2 67  ? 239.392 266.059 257.827 1.00 36.63  ? 67  ARG F O     1 
ATOM 4268  C CB    . ARG F 2 67  ? 238.658 265.196 254.672 1.00 36.63  ? 67  ARG F CB    1 
ATOM 4269  C CG    . ARG F 2 67  ? 237.712 264.294 255.440 1.00 36.63  ? 67  ARG F CG    1 
ATOM 4270  C CD    . ARG F 2 67  ? 237.553 262.937 254.777 1.00 36.63  ? 67  ARG F CD    1 
ATOM 4271  N NE    . ARG F 2 67  ? 236.960 263.027 253.449 1.00 36.63  ? 67  ARG F NE    1 
ATOM 4272  C CZ    . ARG F 2 67  ? 237.639 262.885 252.316 1.00 36.63  ? 67  ARG F CZ    1 
ATOM 4273  N NH1   . ARG F 2 67  ? 238.940 262.639 252.344 1.00 36.63  ? 67  ARG F NH1   1 
ATOM 4274  N NH2   . ARG F 2 67  ? 237.016 262.988 251.154 1.00 36.63  ? 67  ARG F NH2   1 
ATOM 4275  N N     . ASP F 2 68  ? 241.147 265.537 256.527 1.00 36.20  ? 68  ASP F N     1 
ATOM 4276  C CA    . ASP F 2 68  ? 241.906 265.108 257.702 1.00 36.20  ? 68  ASP F CA    1 
ATOM 4277  C C     . ASP F 2 68  ? 242.240 266.276 258.626 1.00 36.20  ? 68  ASP F C     1 
ATOM 4278  O O     . ASP F 2 68  ? 242.212 266.128 259.853 1.00 36.20  ? 68  ASP F O     1 
ATOM 4279  C CB    . ASP F 2 68  ? 243.171 264.376 257.280 1.00 36.20  ? 68  ASP F CB    1 
ATOM 4280  C CG    . ASP F 2 68  ? 242.882 263.001 256.736 1.00 36.20  ? 68  ASP F CG    1 
ATOM 4281  O OD1   . ASP F 2 68  ? 241.699 262.611 256.718 1.00 36.20  ? 68  ASP F OD1   1 
ATOM 4282  O OD2   . ASP F 2 68  ? 243.833 262.307 256.327 1.00 36.20  ? 68  ASP F OD2   1 
ATOM 4283  N N     . ALA F 2 69  ? 242.565 267.441 258.063 1.00 34.73  ? 69  ALA F N     1 
ATOM 4284  C CA    . ALA F 2 69  ? 242.885 268.598 258.893 1.00 34.73  ? 69  ALA F CA    1 
ATOM 4285  C C     . ALA F 2 69  ? 241.680 269.052 259.704 1.00 34.73  ? 69  ALA F C     1 
ATOM 4286  O O     . ALA F 2 69  ? 241.811 269.398 260.878 1.00 34.73  ? 69  ALA F O     1 
ATOM 4287  C CB    . ALA F 2 69  ? 243.408 269.742 258.032 1.00 34.73  ? 69  ALA F CB    1 
ATOM 4288  N N     . VAL F 2 70  ? 240.493 269.033 259.107 1.00 34.90  ? 70  VAL F N     1 
ATOM 4289  C CA    . VAL F 2 70  ? 239.292 269.382 259.848 1.00 34.90  ? 70  VAL F CA    1 
ATOM 4290  C C     . VAL F 2 70  ? 238.948 268.301 260.863 1.00 34.90  ? 70  VAL F C     1 
ATOM 4291  O O     . VAL F 2 70  ? 238.381 268.597 261.913 1.00 34.90  ? 70  VAL F O     1 
ATOM 4292  C CB    . VAL F 2 70  ? 238.134 269.655 258.873 1.00 34.90  ? 70  VAL F CB    1 
ATOM 4293  C CG1   . VAL F 2 70  ? 236.856 269.918 259.624 1.00 34.90  ? 70  VAL F CG1   1 
ATOM 4294  C CG2   . VAL F 2 70  ? 238.474 270.838 257.999 1.00 34.90  ? 70  VAL F CG2   1 
ATOM 4295  N N     . THR F 2 71  ? 239.307 267.047 260.601 1.00 34.55  ? 71  THR F N     1 
ATOM 4296  C CA    . THR F 2 71  ? 239.140 266.020 261.624 1.00 34.55  ? 71  THR F CA    1 
ATOM 4297  C C     . THR F 2 71  ? 240.011 266.314 262.840 1.00 34.55  ? 71  THR F C     1 
ATOM 4298  O O     . THR F 2 71  ? 239.552 266.238 263.986 1.00 34.55  ? 71  THR F O     1 
ATOM 4299  C CB    . THR F 2 71  ? 239.463 264.646 261.043 1.00 34.55  ? 71  THR F CB    1 
ATOM 4300  O OG1   . THR F 2 71  ? 238.460 264.284 260.092 1.00 34.55  ? 71  THR F OG1   1 
ATOM 4301  C CG2   . THR F 2 71  ? 239.485 263.613 262.123 1.00 34.55  ? 71  THR F CG2   1 
ATOM 4302  N N     . TYR F 2 72  ? 241.276 266.664 262.603 1.00 34.42  ? 72  TYR F N     1 
ATOM 4303  C CA    . TYR F 2 72  ? 242.154 267.060 263.700 1.00 34.42  ? 72  TYR F CA    1 
ATOM 4304  C C     . TYR F 2 72  ? 241.618 268.292 264.418 1.00 34.42  ? 72  TYR F C     1 
ATOM 4305  O O     . TYR F 2 72  ? 241.680 268.378 265.646 1.00 34.42  ? 72  TYR F O     1 
ATOM 4306  C CB    . TYR F 2 72  ? 243.569 267.321 263.187 1.00 34.42  ? 72  TYR F CB    1 
ATOM 4307  C CG    . TYR F 2 72  ? 244.391 266.086 262.928 1.00 34.42  ? 72  TYR F CG    1 
ATOM 4308  C CD1   . TYR F 2 72  ? 244.795 265.269 263.965 1.00 34.42  ? 72  TYR F CD1   1 
ATOM 4309  C CD2   . TYR F 2 72  ? 244.788 265.753 261.650 1.00 34.42  ? 72  TYR F CD2   1 
ATOM 4310  C CE1   . TYR F 2 72  ? 245.549 264.149 263.733 1.00 34.42  ? 72  TYR F CE1   1 
ATOM 4311  C CE2   . TYR F 2 72  ? 245.538 264.638 261.410 1.00 34.42  ? 72  TYR F CE2   1 
ATOM 4312  C CZ    . TYR F 2 72  ? 245.920 263.841 262.452 1.00 34.42  ? 72  TYR F CZ    1 
ATOM 4313  O OH    . TYR F 2 72  ? 246.672 262.724 262.208 1.00 34.42  ? 72  TYR F OH    1 
ATOM 4314  N N     . THR F 2 73  ? 241.077 269.248 263.666 1.00 35.81  ? 73  THR F N     1 
ATOM 4315  C CA    . THR F 2 73  ? 240.557 270.478 264.256 1.00 35.81  ? 73  THR F CA    1 
ATOM 4316  C C     . THR F 2 73  ? 239.348 270.201 265.137 1.00 35.81  ? 73  THR F C     1 
ATOM 4317  O O     . THR F 2 73  ? 239.234 270.737 266.241 1.00 35.81  ? 73  THR F O     1 
ATOM 4318  C CB    . THR F 2 73  ? 240.192 271.467 263.152 1.00 35.81  ? 73  THR F CB    1 
ATOM 4319  O OG1   . THR F 2 73  ? 241.371 271.833 262.435 1.00 35.81  ? 73  THR F OG1   1 
ATOM 4320  C CG2   . THR F 2 73  ? 239.560 272.712 263.734 1.00 35.81  ? 73  THR F CG2   1 
ATOM 4321  N N     . GLU F 2 74  ? 238.428 269.367 264.657 1.00 36.92  ? 74  GLU F N     1 
ATOM 4322  C CA    . GLU F 2 74  ? 237.228 269.056 265.420 1.00 36.92  ? 74  GLU F CA    1 
ATOM 4323  C C     . GLU F 2 74  ? 237.558 268.246 266.660 1.00 36.92  ? 74  GLU F C     1 
ATOM 4324  O O     . GLU F 2 74  ? 236.927 268.422 267.705 1.00 36.92  ? 74  GLU F O     1 
ATOM 4325  C CB    . GLU F 2 74  ? 236.233 268.300 264.547 1.00 36.92  ? 74  GLU F CB    1 
ATOM 4326  C CG    . GLU F 2 74  ? 235.431 269.180 263.618 1.00 36.92  ? 74  GLU F CG    1 
ATOM 4327  C CD    . GLU F 2 74  ? 234.747 268.391 262.522 1.00 36.92  ? 74  GLU F CD    1 
ATOM 4328  O OE1   . GLU F 2 74  ? 235.209 267.271 262.216 1.00 36.92  ? 74  GLU F OE1   1 
ATOM 4329  O OE2   . GLU F 2 74  ? 233.744 268.889 261.965 1.00 36.92  ? 74  GLU F OE2   1 
ATOM 4330  N N     . HIS F 2 75  ? 238.535 267.344 266.567 1.00 34.95  ? 75  HIS F N     1 
ATOM 4331  C CA    . HIS F 2 75  ? 238.919 266.595 267.755 1.00 34.95  ? 75  HIS F CA    1 
ATOM 4332  C C     . HIS F 2 75  ? 239.406 267.522 268.855 1.00 34.95  ? 75  HIS F C     1 
ATOM 4333  O O     . HIS F 2 75  ? 239.122 267.299 270.035 1.00 34.95  ? 75  HIS F O     1 
ATOM 4334  C CB    . HIS F 2 75  ? 239.995 265.573 267.430 1.00 34.95  ? 75  HIS F CB    1 
ATOM 4335  C CG    . HIS F 2 75  ? 240.494 264.849 268.634 1.00 34.95  ? 75  HIS F CG    1 
ATOM 4336  N ND1   . HIS F 2 75  ? 239.764 263.864 269.259 1.00 34.95  ? 75  HIS F ND1   1 
ATOM 4337  C CD2   . HIS F 2 75  ? 241.629 264.990 269.352 1.00 34.95  ? 75  HIS F CD2   1 
ATOM 4338  C CE1   . HIS F 2 75  ? 240.438 263.416 270.300 1.00 34.95  ? 75  HIS F CE1   1 
ATOM 4339  N NE2   . HIS F 2 75  ? 241.573 264.082 270.379 1.00 34.95  ? 75  HIS F NE2   1 
ATOM 4340  N N     . ALA F 2 76  ? 240.139 268.565 268.488 1.00 35.32  ? 76  ALA F N     1 
ATOM 4341  C CA    . ALA F 2 76  ? 240.620 269.543 269.449 1.00 35.32  ? 76  ALA F CA    1 
ATOM 4342  C C     . ALA F 2 76  ? 239.541 270.507 269.899 1.00 35.32  ? 76  ALA F C     1 
ATOM 4343  O O     . ALA F 2 76  ? 239.828 271.373 270.726 1.00 35.32  ? 76  ALA F O     1 
ATOM 4344  C CB    . ALA F 2 76  ? 241.789 270.323 268.856 1.00 35.32  ? 76  ALA F CB    1 
ATOM 4345  N N     . LYS F 2 77  ? 238.326 270.387 269.367 1.00 36.57  ? 77  LYS F N     1 
ATOM 4346  C CA    . LYS F 2 77  ? 237.208 271.267 269.704 1.00 36.57  ? 77  LYS F CA    1 
ATOM 4347  C C     . LYS F 2 77  ? 237.489 272.719 269.337 1.00 36.57  ? 77  LYS F C     1 
ATOM 4348  O O     . LYS F 2 77  ? 236.978 273.639 269.973 1.00 36.57  ? 77  LYS F O     1 
ATOM 4349  C CB    . LYS F 2 77  ? 236.835 271.152 271.182 1.00 36.57  ? 77  LYS F CB    1 
ATOM 4350  C CG    . LYS F 2 77  ? 236.298 269.793 271.560 1.00 36.57  ? 77  LYS F CG    1 
ATOM 4351  C CD    . LYS F 2 77  ? 236.147 269.653 273.056 1.00 36.57  ? 77  LYS F CD    1 
ATOM 4352  C CE    . LYS F 2 77  ? 235.573 268.296 273.419 1.00 36.57  ? 77  LYS F CE    1 
ATOM 4353  N NZ    . LYS F 2 77  ? 235.366 268.159 274.885 1.00 36.57  ? 77  LYS F NZ    1 
ATOM 4354  N N     . ARG F 2 78  ? 238.308 272.939 268.320 1.00 36.65  ? 78  ARG F N     1 
ATOM 4355  C CA    . ARG F 2 78  ? 238.536 274.276 267.805 1.00 36.65  ? 78  ARG F CA    1 
ATOM 4356  C C     . ARG F 2 78  ? 237.597 274.555 266.644 1.00 36.65  ? 78  ARG F C     1 
ATOM 4357  O O     . ARG F 2 78  ? 237.002 273.651 266.060 1.00 36.65  ? 78  ARG F O     1 
ATOM 4358  C CB    . ARG F 2 78  ? 239.983 274.450 267.350 1.00 36.65  ? 78  ARG F CB    1 
ATOM 4359  C CG    . ARG F 2 78  ? 240.982 274.540 268.475 1.00 36.65  ? 78  ARG F CG    1 
ATOM 4360  C CD    . ARG F 2 78  ? 242.393 274.739 267.965 1.00 36.65  ? 78  ARG F CD    1 
ATOM 4361  N NE    . ARG F 2 78  ? 243.059 273.480 267.658 1.00 36.65  ? 78  ARG F NE    1 
ATOM 4362  C CZ    . ARG F 2 78  ? 243.179 272.969 266.440 1.00 36.65  ? 78  ARG F CZ    1 
ATOM 4363  N NH1   . ARG F 2 78  ? 242.679 273.604 265.395 1.00 36.65  ? 78  ARG F NH1   1 
ATOM 4364  N NH2   . ARG F 2 78  ? 243.800 271.816 266.265 1.00 36.65  ? 78  ARG F NH2   1 
ATOM 4365  N N     . LYS F 2 79  ? 237.467 275.831 266.319 1.00 39.55  ? 79  LYS F N     1 
ATOM 4366  C CA    . LYS F 2 79  ? 236.786 276.259 265.114 1.00 39.55  ? 79  LYS F CA    1 
ATOM 4367  C C     . LYS F 2 79  ? 237.757 276.769 264.065 1.00 39.55  ? 79  LYS F C     1 
ATOM 4368  O O     . LYS F 2 79  ? 237.334 277.125 262.965 1.00 39.55  ? 79  LYS F O     1 
ATOM 4369  C CB    . LYS F 2 79  ? 235.760 277.338 265.456 1.00 39.55  ? 79  LYS F CB    1 
ATOM 4370  C CG    . LYS F 2 79  ? 234.754 276.893 266.488 1.00 39.55  ? 79  LYS F CG    1 
ATOM 4371  C CD    . LYS F 2 79  ? 234.091 278.076 267.130 1.00 39.55  ? 79  LYS F CD    1 
ATOM 4372  C CE    . LYS F 2 79  ? 232.991 277.661 268.079 1.00 39.55  ? 79  LYS F CE    1 
ATOM 4373  N NZ    . LYS F 2 79  ? 231.874 277.007 267.354 1.00 39.55  ? 79  LYS F NZ    1 
ATOM 4374  N N     . THR F 2 80  ? 239.046 276.804 264.377 1.00 38.26  ? 80  THR F N     1 
ATOM 4375  C CA    . THR F 2 80  ? 240.067 277.370 263.511 1.00 38.26  ? 80  THR F CA    1 
ATOM 4376  C C     . THR F 2 80  ? 241.003 276.258 263.074 1.00 38.26  ? 80  THR F C     1 
ATOM 4377  O O     . THR F 2 80  ? 241.621 275.601 263.915 1.00 38.26  ? 80  THR F O     1 
ATOM 4378  C CB    . THR F 2 80  ? 240.851 278.465 264.234 1.00 38.26  ? 80  THR F CB    1 
ATOM 4379  O OG1   . THR F 2 80  ? 239.952 279.470 264.710 1.00 38.26  ? 80  THR F OG1   1 
ATOM 4380  C CG2   . THR F 2 80  ? 241.860 279.096 263.306 1.00 38.26  ? 80  THR F CG2   1 
ATOM 4381  N N     . VAL F 2 81  ? 241.106 276.048 261.766 1.00 36.09  ? 81  VAL F N     1 
ATOM 4382  C CA    . VAL F 2 81  ? 242.079 275.102 261.243 1.00 36.09  ? 81  VAL F CA    1 
ATOM 4383  C C     . VAL F 2 81  ? 243.468 275.707 261.359 1.00 36.09  ? 81  VAL F C     1 
ATOM 4384  O O     . VAL F 2 81  ? 243.735 276.796 260.841 1.00 36.09  ? 81  VAL F O     1 
ATOM 4385  C CB    . VAL F 2 81  ? 241.751 274.734 259.791 1.00 36.09  ? 81  VAL F CB    1 
ATOM 4386  C CG1   . VAL F 2 81  ? 242.740 273.720 259.276 1.00 36.09  ? 81  VAL F CG1   1 
ATOM 4387  C CG2   . VAL F 2 81  ? 240.348 274.206 259.700 1.00 36.09  ? 81  VAL F CG2   1 
ATOM 4388  N N     . THR F 2 82  ? 244.361 275.000 262.027 1.00 35.22  ? 82  THR F N     1 
ATOM 4389  C CA    . THR F 2 82  ? 245.690 275.508 262.302 1.00 35.22  ? 82  THR F CA    1 
ATOM 4390  C C     . THR F 2 82  ? 246.710 274.888 261.357 1.00 35.22  ? 82  THR F C     1 
ATOM 4391  O O     . THR F 2 82  ? 246.495 273.822 260.760 1.00 35.22  ? 82  THR F O     1 
ATOM 4392  C CB    . THR F 2 82  ? 246.087 275.236 263.755 1.00 35.22  ? 82  THR F CB    1 
ATOM 4393  O OG1   . THR F 2 82  ? 246.117 273.828 263.982 1.00 35.22  ? 82  THR F OG1   1 
ATOM 4394  C CG2   . THR F 2 82  ? 245.092 275.856 264.706 1.00 35.22  ? 82  THR F CG2   1 
ATOM 4395  N N     . ALA F 2 83  ? 247.825 275.600 261.212 1.00 34.51  ? 83  ALA F N     1 
ATOM 4396  C CA    . ALA F 2 83  ? 248.955 275.055 260.482 1.00 34.51  ? 83  ALA F CA    1 
ATOM 4397  C C     . ALA F 2 83  ? 249.343 273.690 261.013 1.00 34.51  ? 83  ALA F C     1 
ATOM 4398  O O     . ALA F 2 83  ? 249.734 272.816 260.240 1.00 34.51  ? 83  ALA F O     1 
ATOM 4399  C CB    . ALA F 2 83  ? 250.145 276.006 260.562 1.00 34.51  ? 83  ALA F CB    1 
ATOM 4400  N N     . MET F 2 84  ? 249.229 273.480 262.324 1.00 35.27  ? 84  MET F N     1 
ATOM 4401  C CA    . MET F 2 84  ? 249.593 272.186 262.880 1.00 35.27  ? 84  MET F CA    1 
ATOM 4402  C C     . MET F 2 84  ? 248.625 271.104 262.433 1.00 35.27  ? 84  MET F C     1 
ATOM 4403  O O     . MET F 2 84  ? 249.047 269.988 262.136 1.00 35.27  ? 84  MET F O     1 
ATOM 4404  C CB    . MET F 2 84  ? 249.668 272.252 264.402 1.00 35.27  ? 84  MET F CB    1 
ATOM 4405  C CG    . MET F 2 84  ? 250.968 272.809 264.923 1.00 35.27  ? 84  MET F CG    1 
ATOM 4406  S SD    . MET F 2 84  ? 252.352 272.552 263.798 1.00 35.27  ? 84  MET F SD    1 
ATOM 4407  C CE    . MET F 2 84  ? 252.635 270.795 263.940 1.00 35.27  ? 84  MET F CE    1 
ATOM 4408  N N     . ASP F 2 85  ? 247.328 271.412 262.377 1.00 35.25  ? 85  ASP F N     1 
ATOM 4409  C CA    . ASP F 2 85  ? 246.372 270.463 261.820 1.00 35.25  ? 85  ASP F CA    1 
ATOM 4410  C C     . ASP F 2 85  ? 246.759 270.075 260.406 1.00 35.25  ? 85  ASP F C     1 
ATOM 4411  O O     . ASP F 2 85  ? 246.758 268.893 260.049 1.00 35.25  ? 85  ASP F O     1 
ATOM 4412  C CB    . ASP F 2 85  ? 244.967 271.053 261.822 1.00 35.25  ? 85  ASP F CB    1 
ATOM 4413  C CG    . ASP F 2 85  ? 244.467 271.360 263.198 1.00 35.25  ? 85  ASP F CG    1 
ATOM 4414  O OD1   . ASP F 2 85  ? 244.860 270.662 264.153 1.00 35.25  ? 85  ASP F OD1   1 
ATOM 4415  O OD2   . ASP F 2 85  ? 243.671 272.307 263.328 1.00 35.25  ? 85  ASP F OD2   1 
ATOM 4416  N N     . VAL F 2 86  ? 247.080 271.067 259.579 1.00 33.14  ? 86  VAL F N     1 
ATOM 4417  C CA    . VAL F 2 86  ? 247.446 270.760 258.200 1.00 33.14  ? 86  VAL F CA    1 
ATOM 4418  C C     . VAL F 2 86  ? 248.704 269.904 258.153 1.00 33.14  ? 86  VAL F C     1 
ATOM 4419  O O     . VAL F 2 86  ? 248.788 268.944 257.381 1.00 33.14  ? 86  VAL F O     1 
ATOM 4420  C CB    . VAL F 2 86  ? 247.608 272.054 257.389 1.00 33.14  ? 86  VAL F CB    1 
ATOM 4421  C CG1   . VAL F 2 86  ? 248.040 271.725 255.982 1.00 33.14  ? 86  VAL F CG1   1 
ATOM 4422  C CG2   . VAL F 2 86  ? 246.314 272.812 257.381 1.00 33.14  ? 86  VAL F CG2   1 
ATOM 4423  N N     . VAL F 2 87  ? 249.698 270.236 258.971 1.00 33.29  ? 87  VAL F N     1 
ATOM 4424  C CA    . VAL F 2 87  ? 250.941 269.471 258.984 1.00 33.29  ? 87  VAL F CA    1 
ATOM 4425  C C     . VAL F 2 87  ? 250.682 268.034 259.410 1.00 33.29  ? 87  VAL F C     1 
ATOM 4426  O O     . VAL F 2 87  ? 251.220 267.095 258.819 1.00 33.29  ? 87  VAL F O     1 
ATOM 4427  C CB    . VAL F 2 87  ? 251.978 270.152 259.893 1.00 33.29  ? 87  VAL F CB    1 
ATOM 4428  C CG1   . VAL F 2 87  ? 253.176 269.255 260.097 1.00 33.29  ? 87  VAL F CG1   1 
ATOM 4429  C CG2   . VAL F 2 87  ? 252.403 271.464 259.304 1.00 33.29  ? 87  VAL F CG2   1 
ATOM 4430  N N     . TYR F 2 88  ? 249.844 267.840 260.427 1.00 34.24  ? 88  TYR F N     1 
ATOM 4431  C CA    . TYR F 2 88  ? 249.537 266.493 260.892 1.00 34.24  ? 88  TYR F CA    1 
ATOM 4432  C C     . TYR F 2 88  ? 248.799 265.696 259.830 1.00 34.24  ? 88  TYR F C     1 
ATOM 4433  O O     . TYR F 2 88  ? 249.051 264.502 259.662 1.00 34.24  ? 88  TYR F O     1 
ATOM 4434  C CB    . TYR F 2 88  ? 248.708 266.548 262.170 1.00 34.24  ? 88  TYR F CB    1 
ATOM 4435  C CG    . TYR F 2 88  ? 249.429 267.120 263.352 1.00 34.24  ? 88  TYR F CG    1 
ATOM 4436  C CD1   . TYR F 2 88  ? 250.796 266.985 263.486 1.00 34.24  ? 88  TYR F CD1   1 
ATOM 4437  C CD2   . TYR F 2 88  ? 248.742 267.803 264.336 1.00 34.24  ? 88  TYR F CD2   1 
ATOM 4438  C CE1   . TYR F 2 88  ? 251.453 267.506 264.565 1.00 34.24  ? 88  TYR F CE1   1 
ATOM 4439  C CE2   . TYR F 2 88  ? 249.392 268.330 265.416 1.00 34.24  ? 88  TYR F CE2   1 
ATOM 4440  C CZ    . TYR F 2 88  ? 250.747 268.180 265.527 1.00 34.24  ? 88  TYR F CZ    1 
ATOM 4441  O OH    . TYR F 2 88  ? 251.400 268.704 266.611 1.00 34.24  ? 88  TYR F OH    1 
ATOM 4442  N N     . ALA F 2 89  ? 247.870 266.331 259.119 1.00 33.89  ? 89  ALA F N     1 
ATOM 4443  C CA    . ALA F 2 89  ? 247.149 265.631 258.063 1.00 33.89  ? 89  ALA F CA    1 
ATOM 4444  C C     . ALA F 2 89  ? 248.086 265.226 256.932 1.00 33.89  ? 89  ALA F C     1 
ATOM 4445  O O     . ALA F 2 89  ? 248.040 264.087 256.447 1.00 33.89  ? 89  ALA F O     1 
ATOM 4446  C CB    . ALA F 2 89  ? 246.015 266.506 257.542 1.00 33.89  ? 89  ALA F CB    1 
ATOM 4447  N N     . LEU F 2 90  ? 248.964 266.142 256.520 1.00 33.94  ? 90  LEU F N     1 
ATOM 4448  C CA    . LEU F 2 90  ? 249.957 265.828 255.502 1.00 33.94  ? 90  LEU F CA    1 
ATOM 4449  C C     . LEU F 2 90  ? 250.863 264.693 255.947 1.00 33.94  ? 90  LEU F C     1 
ATOM 4450  O O     . LEU F 2 90  ? 251.215 263.821 255.150 1.00 33.94  ? 90  LEU F O     1 
ATOM 4451  C CB    . LEU F 2 90  ? 250.781 267.068 255.182 1.00 33.94  ? 90  LEU F CB    1 
ATOM 4452  C CG    . LEU F 2 90  ? 250.041 268.141 254.400 1.00 33.94  ? 90  LEU F CG    1 
ATOM 4453  C CD1   . LEU F 2 90  ? 250.831 269.417 254.400 1.00 33.94  ? 90  LEU F CD1   1 
ATOM 4454  C CD2   . LEU F 2 90  ? 249.795 267.656 252.999 1.00 33.94  ? 90  LEU F CD2   1 
ATOM 4455  N N     . LYS F 2 91  ? 251.254 264.688 257.218 1.00 34.90  ? 91  LYS F N     1 
ATOM 4456  C CA    . LYS F 2 91  ? 252.094 263.610 257.716 1.00 34.90  ? 91  LYS F CA    1 
ATOM 4457  C C     . LYS F 2 91  ? 251.347 262.289 257.708 1.00 34.90  ? 91  LYS F C     1 
ATOM 4458  O O     . LYS F 2 91  ? 251.914 261.249 257.362 1.00 34.90  ? 91  LYS F O     1 
ATOM 4459  C CB    . LYS F 2 91  ? 252.594 263.938 259.118 1.00 34.90  ? 91  LYS F CB    1 
ATOM 4460  C CG    . LYS F 2 91  ? 253.046 262.722 259.887 1.00 34.90  ? 91  LYS F CG    1 
ATOM 4461  C CD    . LYS F 2 91  ? 253.603 263.087 261.240 1.00 34.90  ? 91  LYS F CD    1 
ATOM 4462  C CE    . LYS F 2 91  ? 254.976 263.693 261.103 1.00 34.90  ? 91  LYS F CE    1 
ATOM 4463  N NZ    . LYS F 2 91  ? 255.900 262.769 260.395 1.00 34.90  ? 91  LYS F NZ    1 
ATOM 4464  N N     . ARG F 2 92  ? 250.069 262.311 258.084 1.00 35.91  ? 92  ARG F N     1 
ATOM 4465  C CA    . ARG F 2 92  ? 249.283 261.087 258.088 1.00 35.91  ? 92  ARG F CA    1 
ATOM 4466  C C     . ARG F 2 92  ? 249.136 260.522 256.689 1.00 35.91  ? 92  ARG F C     1 
ATOM 4467  O O     . ARG F 2 92  ? 249.073 259.303 256.519 1.00 35.91  ? 92  ARG F O     1 
ATOM 4468  C CB    . ARG F 2 92  ? 247.909 261.339 258.696 1.00 35.91  ? 92  ARG F CB    1 
ATOM 4469  C CG    . ARG F 2 92  ? 247.397 260.160 259.495 1.00 35.91  ? 92  ARG F CG    1 
ATOM 4470  C CD    . ARG F 2 92  ? 245.920 260.257 259.721 1.00 35.91  ? 92  ARG F CD    1 
ATOM 4471  N NE    . ARG F 2 92  ? 245.209 260.393 258.462 1.00 35.91  ? 92  ARG F NE    1 
ATOM 4472  C CZ    . ARG F 2 92  ? 244.863 259.371 257.691 1.00 35.91  ? 92  ARG F CZ    1 
ATOM 4473  N NH1   . ARG F 2 92  ? 245.168 258.135 258.055 1.00 35.91  ? 92  ARG F NH1   1 
ATOM 4474  N NH2   . ARG F 2 92  ? 244.216 259.587 256.556 1.00 35.91  ? 92  ARG F NH2   1 
ATOM 4475  N N     . GLN F 2 93  ? 249.100 261.379 255.679 1.00 36.33  ? 93  GLN F N     1 
ATOM 4476  C CA    . GLN F 2 93  ? 249.032 260.911 254.305 1.00 36.33  ? 93  GLN F CA    1 
ATOM 4477  C C     . GLN F 2 93  ? 250.397 260.663 253.689 1.00 36.33  ? 93  GLN F C     1 
ATOM 4478  O O     . GLN F 2 93  ? 250.498 260.567 252.466 1.00 36.33  ? 93  GLN F O     1 
ATOM 4479  C CB    . GLN F 2 93  ? 248.257 261.905 253.453 1.00 36.33  ? 93  GLN F CB    1 
ATOM 4480  C CG    . GLN F 2 93  ? 246.856 262.108 253.945 1.00 36.33  ? 93  GLN F CG    1 
ATOM 4481  C CD    . GLN F 2 93  ? 246.043 262.938 253.003 1.00 36.33  ? 93  GLN F CD    1 
ATOM 4482  O OE1   . GLN F 2 93  ? 246.586 263.625 252.143 1.00 36.33  ? 93  GLN F OE1   1 
ATOM 4483  N NE2   . GLN F 2 93  ? 244.730 262.879 253.150 1.00 36.33  ? 93  GLN F NE2   1 
ATOM 4484  N N     . GLY F 2 94  ? 251.443 260.561 254.500 1.00 35.54  ? 94  GLY F N     1 
ATOM 4485  C CA    . GLY F 2 94  ? 252.758 260.255 253.979 1.00 35.54  ? 94  GLY F CA    1 
ATOM 4486  C C     . GLY F 2 94  ? 253.363 261.351 253.141 1.00 35.54  ? 94  GLY F C     1 
ATOM 4487  O O     . GLY F 2 94  ? 254.157 261.068 252.245 1.00 35.54  ? 94  GLY F O     1 
ATOM 4488  N N     . ARG F 2 95  ? 253.009 262.601 253.411 1.00 35.69  ? 95  ARG F N     1 
ATOM 4489  C CA    . ARG F 2 95  ? 253.487 263.767 252.681 1.00 35.69  ? 95  ARG F CA    1 
ATOM 4490  C C     . ARG F 2 95  ? 253.987 264.819 253.650 1.00 35.69  ? 95  ARG F C     1 
ATOM 4491  O O     . ARG F 2 95  ? 253.573 265.976 253.614 1.00 35.69  ? 95  ARG F O     1 
ATOM 4492  C CB    . ARG F 2 95  ? 252.402 264.338 251.784 1.00 35.69  ? 95  ARG F CB    1 
ATOM 4493  C CG    . ARG F 2 95  ? 251.924 263.368 250.752 1.00 35.69  ? 95  ARG F CG    1 
ATOM 4494  C CD    . ARG F 2 95  ? 250.906 263.986 249.846 1.00 35.69  ? 95  ARG F CD    1 
ATOM 4495  N NE    . ARG F 2 95  ? 250.135 262.968 249.146 1.00 35.69  ? 95  ARG F NE    1 
ATOM 4496  C CZ    . ARG F 2 95  ? 250.541 262.354 248.043 1.00 35.69  ? 95  ARG F CZ    1 
ATOM 4497  N NH1   . ARG F 2 95  ? 251.716 262.652 247.514 1.00 35.69  ? 95  ARG F NH1   1 
ATOM 4498  N NH2   . ARG F 2 95  ? 249.770 261.441 247.474 1.00 35.69  ? 95  ARG F NH2   1 
ATOM 4499  N N     . THR F 2 96  ? 254.860 264.396 254.560 1.00 34.09  ? 96  THR F N     1 
ATOM 4500  C CA    . THR F 2 96  ? 255.464 265.258 255.569 1.00 34.09  ? 96  THR F CA    1 
ATOM 4501  C C     . THR F 2 96  ? 255.883 266.600 254.993 1.00 34.09  ? 96  THR F C     1 
ATOM 4502  O O     . THR F 2 96  ? 256.519 266.664 253.945 1.00 34.09  ? 96  THR F O     1 
ATOM 4503  C CB    . THR F 2 96  ? 256.684 264.559 256.168 1.00 34.09  ? 96  THR F CB    1 
ATOM 4504  O OG1   . THR F 2 96  ? 256.323 263.244 256.589 1.00 34.09  ? 96  THR F OG1   1 
ATOM 4505  C CG2   . THR F 2 96  ? 257.218 265.327 257.349 1.00 34.09  ? 96  THR F CG2   1 
ATOM 4506  N N     . LEU F 2 97  ? 255.520 267.670 255.686 1.00 32.85  ? 97  LEU F N     1 
ATOM 4507  C CA    . LEU F 2 97  ? 255.874 269.026 255.297 1.00 32.85  ? 97  LEU F CA    1 
ATOM 4508  C C     . LEU F 2 97  ? 256.803 269.607 256.350 1.00 32.85  ? 97  LEU F C     1 
ATOM 4509  O O     . LEU F 2 97  ? 256.517 269.522 257.545 1.00 32.85  ? 97  LEU F O     1 
ATOM 4510  C CB    . LEU F 2 97  ? 254.624 269.892 255.142 1.00 32.85  ? 97  LEU F CB    1 
ATOM 4511  C CG    . LEU F 2 97  ? 254.827 271.334 254.685 1.00 32.85  ? 97  LEU F CG    1 
ATOM 4512  C CD1   . LEU F 2 97  ? 255.499 271.361 253.340 1.00 32.85  ? 97  LEU F CD1   1 
ATOM 4513  C CD2   . LEU F 2 97  ? 253.504 272.058 254.625 1.00 32.85  ? 97  LEU F CD2   1 
ATOM 4514  N N     . TYR F 2 98  ? 257.922 270.166 255.910 1.00 32.89  ? 98  TYR F N     1 
ATOM 4515  C CA    . TYR F 2 98  ? 258.820 270.901 256.785 1.00 32.89  ? 98  TYR F CA    1 
ATOM 4516  C C     . TYR F 2 98  ? 258.640 272.395 256.587 1.00 32.89  ? 98  TYR F C     1 
ATOM 4517  O O     . TYR F 2 98  ? 258.457 272.874 255.469 1.00 32.89  ? 98  TYR F O     1 
ATOM 4518  C CB    . TYR F 2 98  ? 260.284 270.556 256.520 1.00 32.89  ? 98  TYR F CB    1 
ATOM 4519  C CG    . TYR F 2 98  ? 260.747 269.206 256.989 1.00 32.89  ? 98  TYR F CG    1 
ATOM 4520  C CD1   . TYR F 2 98  ? 259.879 268.318 257.596 1.00 32.89  ? 98  TYR F CD1   1 
ATOM 4521  C CD2   . TYR F 2 98  ? 262.065 268.823 256.829 1.00 32.89  ? 98  TYR F CD2   1 
ATOM 4522  C CE1   . TYR F 2 98  ? 260.310 267.092 258.019 1.00 32.89  ? 98  TYR F CE1   1 
ATOM 4523  C CE2   . TYR F 2 98  ? 262.502 267.601 257.251 1.00 32.89  ? 98  TYR F CE2   1 
ATOM 4524  C CZ    . TYR F 2 98  ? 261.620 266.737 257.839 1.00 32.89  ? 98  TYR F CZ    1 
ATOM 4525  O OH    . TYR F 2 98  ? 262.060 265.515 258.260 1.00 32.89  ? 98  TYR F OH    1 
ATOM 4526  N N     . GLY F 2 99  ? 258.729 273.133 257.682 1.00 34.66  ? 99  GLY F N     1 
ATOM 4527  C CA    . GLY F 2 99  ? 258.734 274.575 257.627 1.00 34.66  ? 99  GLY F CA    1 
ATOM 4528  C C     . GLY F 2 99  ? 257.536 275.256 258.234 1.00 34.66  ? 99  GLY F C     1 
ATOM 4529  O O     . GLY F 2 99  ? 257.456 276.484 258.179 1.00 34.66  ? 99  GLY F O     1 
ATOM 4530  N N     . PHE F 2 100 ? 256.613 274.507 258.828 1.00 34.98  ? 100 PHE F N     1 
ATOM 4531  C CA    . PHE F 2 100 ? 255.420 275.082 259.433 1.00 34.98  ? 100 PHE F CA    1 
ATOM 4532  C C     . PHE F 2 100 ? 255.213 274.582 260.854 1.00 34.98  ? 100 PHE F C     1 
ATOM 4533  O O     . PHE F 2 100 ? 254.078 274.550 261.332 1.00 34.98  ? 100 PHE F O     1 
ATOM 4534  C CB    . PHE F 2 100 ? 254.186 274.780 258.585 1.00 34.98  ? 100 PHE F CB    1 
ATOM 4535  C CG    . PHE F 2 100 ? 254.096 275.602 257.340 1.00 34.98  ? 100 PHE F CG    1 
ATOM 4536  C CD1   . PHE F 2 100 ? 253.564 276.874 257.377 1.00 34.98  ? 100 PHE F CD1   1 
ATOM 4537  C CD2   . PHE F 2 100 ? 254.534 275.103 256.133 1.00 34.98  ? 100 PHE F CD2   1 
ATOM 4538  C CE1   . PHE F 2 100 ? 253.479 277.633 256.236 1.00 34.98  ? 100 PHE F CE1   1 
ATOM 4539  C CE2   . PHE F 2 100 ? 254.451 275.856 254.991 1.00 34.98  ? 100 PHE F CE2   1 
ATOM 4540  C CZ    . PHE F 2 100 ? 253.927 277.122 255.041 1.00 34.98  ? 100 PHE F CZ    1 
ATOM 4541  N N     . GLY F 2 101 ? 256.280 274.191 261.536 1.00 35.40  ? 101 GLY F N     1 
ATOM 4542  C CA    . GLY F 2 101 ? 256.172 273.672 262.882 1.00 35.40  ? 101 GLY F CA    1 
ATOM 4543  C C     . GLY F 2 101 ? 256.114 272.163 262.925 1.00 35.40  ? 101 GLY F C     1 
ATOM 4544  O O     . GLY F 2 101 ? 255.527 271.537 262.047 1.00 35.40  ? 101 GLY F O     1 
ATOM 4545  N N     . THR G 3 10  ? 229.269 238.476 300.092 1.00 57.89  ? 10  THR G N     1 
ATOM 4546  C CA    . THR G 3 10  ? 229.787 237.708 298.965 1.00 57.89  ? 10  THR G CA    1 
ATOM 4547  C C     . THR G 3 10  ? 229.864 238.572 297.715 1.00 57.89  ? 10  THR G C     1 
ATOM 4548  O O     . THR G 3 10  ? 229.171 239.582 297.604 1.00 57.89  ? 10  THR G O     1 
ATOM 4549  C CB    . THR G 3 10  ? 228.917 236.469 298.669 1.00 57.89  ? 10  THR G CB    1 
ATOM 4550  O OG1   . THR G 3 10  ? 227.549 236.865 298.518 1.00 57.89  ? 10  THR G OG1   1 
ATOM 4551  C CG2   . THR G 3 10  ? 229.031 235.449 299.794 1.00 57.89  ? 10  THR G CG2   1 
ATOM 4552  N N     . ARG G 3 11  ? 230.703 238.159 296.772 1.00 54.50  ? 11  ARG G N     1 
ATOM 4553  C CA    . ARG G 3 11  ? 230.931 238.914 295.552 1.00 54.50  ? 11  ARG G CA    1 
ATOM 4554  C C     . ARG G 3 11  ? 229.874 238.580 294.510 1.00 54.50  ? 11  ARG G C     1 
ATOM 4555  O O     . ARG G 3 11  ? 229.339 237.469 294.473 1.00 54.50  ? 11  ARG G O     1 
ATOM 4556  C CB    . ARG G 3 11  ? 232.322 238.617 294.995 1.00 54.50  ? 11  ARG G CB    1 
ATOM 4557  C CG    . ARG G 3 11  ? 232.917 239.760 294.216 1.00 54.50  ? 11  ARG G CG    1 
ATOM 4558  C CD    . ARG G 3 11  ? 234.395 239.556 293.987 1.00 54.50  ? 11  ARG G CD    1 
ATOM 4559  N NE    . ARG G 3 11  ? 234.650 238.485 293.036 1.00 54.50  ? 11  ARG G NE    1 
ATOM 4560  C CZ    . ARG G 3 11  ? 235.861 238.046 292.726 1.00 54.50  ? 11  ARG G CZ    1 
ATOM 4561  N NH1   . ARG G 3 11  ? 236.925 238.588 293.302 1.00 54.50  ? 11  ARG G NH1   1 
ATOM 4562  N NH2   . ARG G 3 11  ? 236.011 237.065 291.848 1.00 54.50  ? 11  ARG G NH2   1 
ATOM 4563  N N     . ALA G 3 12  ? 229.576 239.559 293.661 1.00 53.79  ? 12  ALA G N     1 
ATOM 4564  C CA    . ALA G 3 12  ? 228.607 239.356 292.598 1.00 53.79  ? 12  ALA G CA    1 
ATOM 4565  C C     . ALA G 3 12  ? 229.189 238.467 291.507 1.00 53.79  ? 12  ALA G C     1 
ATOM 4566  O O     . ALA G 3 12  ? 230.405 238.300 291.393 1.00 53.79  ? 12  ALA G O     1 
ATOM 4567  C CB    . ALA G 3 12  ? 228.173 240.693 292.002 1.00 53.79  ? 12  ALA G CB    1 
ATOM 4568  N N     . LYS G 3 13  ? 228.301 237.879 290.711 1.00 52.48  ? 13  LYS G N     1 
ATOM 4569  C CA    . LYS G 3 13  ? 228.735 237.036 289.608 1.00 52.48  ? 13  LYS G CA    1 
ATOM 4570  C C     . LYS G 3 13  ? 229.470 237.874 288.569 1.00 52.48  ? 13  LYS G C     1 
ATOM 4571  O O     . LYS G 3 13  ? 229.067 238.998 288.261 1.00 52.48  ? 13  LYS G O     1 
ATOM 4572  C CB    . LYS G 3 13  ? 227.535 236.330 288.981 1.00 52.48  ? 13  LYS G CB    1 
ATOM 4573  C CG    . LYS G 3 13  ? 227.900 235.230 288.005 1.00 52.48  ? 13  LYS G CG    1 
ATOM 4574  C CD    . LYS G 3 13  ? 228.791 234.191 288.658 1.00 52.48  ? 13  LYS G CD    1 
ATOM 4575  C CE    . LYS G 3 13  ? 228.956 232.957 287.779 1.00 52.48  ? 13  LYS G CE    1 
ATOM 4576  N NZ    . LYS G 3 13  ? 229.623 233.259 286.482 1.00 52.48  ? 13  LYS G NZ    1 
ATOM 4577  N N     . ALA G 3 14  ? 230.567 237.333 288.049 1.00 49.73  ? 14  ALA G N     1 
ATOM 4578  C CA    . ALA G 3 14  ? 231.409 238.077 287.124 1.00 49.73  ? 14  ALA G CA    1 
ATOM 4579  C C     . ALA G 3 14  ? 230.778 238.136 285.739 1.00 49.73  ? 14  ALA G C     1 
ATOM 4580  O O     . ALA G 3 14  ? 230.320 237.122 285.208 1.00 49.73  ? 14  ALA G O     1 
ATOM 4581  C CB    . ALA G 3 14  ? 232.794 237.440 287.046 1.00 49.73  ? 14  ALA G CB    1 
ATOM 4582  N N     . LYS G 3 15  ? 230.756 239.330 285.157 1.00 47.23  ? 15  LYS G N     1 
ATOM 4583  C CA    . LYS G 3 15  ? 230.311 239.543 283.789 1.00 47.23  ? 15  LYS G CA    1 
ATOM 4584  C C     . LYS G 3 15  ? 231.454 240.143 282.992 1.00 47.23  ? 15  LYS G C     1 
ATOM 4585  O O     . LYS G 3 15  ? 232.061 241.129 283.419 1.00 47.23  ? 15  LYS G O     1 
ATOM 4586  C CB    . LYS G 3 15  ? 229.102 240.473 283.733 1.00 47.23  ? 15  LYS G CB    1 
ATOM 4587  C CG    . LYS G 3 15  ? 227.832 239.881 284.283 1.00 47.23  ? 15  LYS G CG    1 
ATOM 4588  C CD    . LYS G 3 15  ? 226.703 240.890 284.230 1.00 47.23  ? 15  LYS G CD    1 
ATOM 4589  C CE    . LYS G 3 15  ? 226.586 241.519 282.852 1.00 47.23  ? 15  LYS G CE    1 
ATOM 4590  N NZ    . LYS G 3 15  ? 226.442 240.506 281.768 1.00 47.23  ? 15  LYS G NZ    1 
ATOM 4591  N N     . THR G 3 16  ? 231.747 239.557 281.840 1.00 43.41  ? 16  THR G N     1 
ATOM 4592  C CA    . THR G 3 16  ? 232.764 240.139 280.987 1.00 43.41  ? 16  THR G CA    1 
ATOM 4593  C C     . THR G 3 16  ? 232.279 241.473 280.438 1.00 43.41  ? 16  THR G C     1 
ATOM 4594  O O     . THR G 3 16  ? 231.091 241.680 280.190 1.00 43.41  ? 16  THR G O     1 
ATOM 4595  C CB    . THR G 3 16  ? 233.118 239.195 279.842 1.00 43.41  ? 16  THR G CB    1 
ATOM 4596  O OG1   . THR G 3 16  ? 232.076 239.220 278.864 1.00 43.41  ? 16  THR G OG1   1 
ATOM 4597  C CG2   . THR G 3 16  ? 233.260 237.787 280.359 1.00 43.41  ? 16  THR G CG2   1 
ATOM 4598  N N     . ARG G 3 17  ? 233.223 242.392 280.253 1.00 40.79  ? 17  ARG G N     1 
ATOM 4599  C CA    . ARG G 3 17  ? 232.881 243.676 279.664 1.00 40.79  ? 17  ARG G CA    1 
ATOM 4600  C C     . ARG G 3 17  ? 232.404 243.519 278.231 1.00 40.79  ? 17  ARG G C     1 
ATOM 4601  O O     . ARG G 3 17  ? 231.624 244.343 277.744 1.00 40.79  ? 17  ARG G O     1 
ATOM 4602  C CB    . ARG G 3 17  ? 234.078 244.611 279.728 1.00 40.79  ? 17  ARG G CB    1 
ATOM 4603  C CG    . ARG G 3 17  ? 234.452 244.996 281.122 1.00 40.79  ? 17  ARG G CG    1 
ATOM 4604  C CD    . ARG G 3 17  ? 235.472 246.087 281.096 1.00 40.79  ? 17  ARG G CD    1 
ATOM 4605  N NE    . ARG G 3 17  ? 236.818 245.555 281.029 1.00 40.79  ? 17  ARG G NE    1 
ATOM 4606  C CZ    . ARG G 3 17  ? 237.902 246.306 280.941 1.00 40.79  ? 17  ARG G CZ    1 
ATOM 4607  N NH1   . ARG G 3 17  ? 237.784 247.622 280.900 1.00 40.79  ? 17  ARG G NH1   1 
ATOM 4608  N NH2   . ARG G 3 17  ? 239.096 245.742 280.900 1.00 40.79  ? 17  ARG G NH2   1 
ATOM 4609  N N     . SER G 3 18  ? 232.856 242.470 277.547 1.00 40.49  ? 18  SER G N     1 
ATOM 4610  C CA    . SER G 3 18  ? 232.325 242.172 276.225 1.00 40.49  ? 18  SER G CA    1 
ATOM 4611  C C     . SER G 3 18  ? 230.835 241.885 276.287 1.00 40.49  ? 18  SER G C     1 
ATOM 4612  O O     . SER G 3 18  ? 230.078 242.324 275.420 1.00 40.49  ? 18  SER G O     1 
ATOM 4613  C CB    . SER G 3 18  ? 233.073 240.993 275.611 1.00 40.49  ? 18  SER G CB    1 
ATOM 4614  O OG    . SER G 3 18  ? 234.458 241.253 275.565 1.00 40.49  ? 18  SER G OG    1 
ATOM 4615  N N     . SER G 3 19  ? 230.389 241.164 277.314 1.00 42.44  ? 19  SER G N     1 
ATOM 4616  C CA    . SER G 3 19  ? 228.966 240.877 277.442 1.00 42.44  ? 19  SER G CA    1 
ATOM 4617  C C     . SER G 3 19  ? 228.174 242.139 277.753 1.00 42.44  ? 19  SER G C     1 
ATOM 4618  O O     . SER G 3 19  ? 227.081 242.338 277.217 1.00 42.44  ? 19  SER G O     1 
ATOM 4619  C CB    . SER G 3 19  ? 228.740 239.828 278.523 1.00 42.44  ? 19  SER G CB    1 
ATOM 4620  O OG    . SER G 3 19  ? 228.960 240.382 279.802 1.00 42.44  ? 19  SER G OG    1 
ATOM 4621  N N     . ARG G 3 20  ? 228.708 243.002 278.617 1.00 43.59  ? 20  ARG G N     1 
ATOM 4622  C CA    . ARG G 3 20  ? 228.035 244.261 278.915 1.00 43.59  ? 20  ARG G CA    1 
ATOM 4623  C C     . ARG G 3 20  ? 227.920 245.129 277.674 1.00 43.59  ? 20  ARG G C     1 
ATOM 4624  O O     . ARG G 3 20  ? 226.911 245.814 277.479 1.00 43.59  ? 20  ARG G O     1 
ATOM 4625  C CB    . ARG G 3 20  ? 228.785 245.023 280.001 1.00 43.59  ? 20  ARG G CB    1 
ATOM 4626  C CG    . ARG G 3 20  ? 228.960 244.300 281.303 1.00 43.59  ? 20  ARG G CG    1 
ATOM 4627  C CD    . ARG G 3 20  ? 229.594 245.229 282.310 1.00 43.59  ? 20  ARG G CD    1 
ATOM 4628  N NE    . ARG G 3 20  ? 230.100 244.523 283.476 1.00 43.59  ? 20  ARG G NE    1 
ATOM 4629  C CZ    . ARG G 3 20  ? 229.418 244.364 284.602 1.00 43.59  ? 20  ARG G CZ    1 
ATOM 4630  N NH1   . ARG G 3 20  ? 228.199 244.861 284.715 1.00 43.59  ? 20  ARG G NH1   1 
ATOM 4631  N NH2   . ARG G 3 20  ? 229.957 243.709 285.615 1.00 43.59  ? 20  ARG G NH2   1 
ATOM 4632  N N     . ALA G 3 21  ? 228.953 245.132 276.836 1.00 40.28  ? 21  ALA G N     1 
ATOM 4633  C CA    . ALA G 3 21  ? 228.942 245.922 275.617 1.00 40.28  ? 21  ALA G CA    1 
ATOM 4634  C C     . ALA G 3 21  ? 228.189 245.254 274.478 1.00 40.28  ? 21  ALA G C     1 
ATOM 4635  O O     . ALA G 3 21  ? 227.900 245.917 273.480 1.00 40.28  ? 21  ALA G O     1 
ATOM 4636  C CB    . ALA G 3 21  ? 230.373 246.216 275.180 1.00 40.28  ? 21  ALA G CB    1 
ATOM 4637  N N     . GLY G 3 22  ? 227.872 243.971 274.596 1.00 39.55  ? 22  GLY G N     1 
ATOM 4638  C CA    . GLY G 3 22  ? 227.233 243.244 273.516 1.00 39.55  ? 22  GLY G CA    1 
ATOM 4639  C C     . GLY G 3 22  ? 228.180 242.860 272.403 1.00 39.55  ? 22  GLY G C     1 
ATOM 4640  O O     . GLY G 3 22  ? 227.757 242.743 271.249 1.00 39.55  ? 22  GLY G O     1 
ATOM 4641  N N     . LEU G 3 23  ? 229.452 242.653 272.719 1.00 38.25  ? 23  LEU G N     1 
ATOM 4642  C CA    . LEU G 3 23  ? 230.481 242.419 271.721 1.00 38.25  ? 23  LEU G CA    1 
ATOM 4643  C C     . LEU G 3 23  ? 230.997 240.991 271.802 1.00 38.25  ? 23  LEU G C     1 
ATOM 4644  O O     . LEU G 3 23  ? 230.992 240.362 272.860 1.00 38.25  ? 23  LEU G O     1 
ATOM 4645  C CB    . LEU G 3 23  ? 231.650 243.387 271.901 1.00 38.25  ? 23  LEU G CB    1 
ATOM 4646  C CG    . LEU G 3 23  ? 231.298 244.862 271.795 1.00 38.25  ? 23  LEU G CG    1 
ATOM 4647  C CD1   . LEU G 3 23  ? 232.507 245.709 272.098 1.00 38.25  ? 23  LEU G CD1   1 
ATOM 4648  C CD2   . LEU G 3 23  ? 230.769 245.158 270.418 1.00 38.25  ? 23  LEU G CD2   1 
ATOM 4649  N N     . GLN G 3 24  ? 231.454 240.487 270.662 1.00 38.30  ? 24  GLN G N     1 
ATOM 4650  C CA    . GLN G 3 24  ? 232.138 239.206 270.621 1.00 38.30  ? 24  GLN G CA    1 
ATOM 4651  C C     . GLN G 3 24  ? 233.637 239.337 270.828 1.00 38.30  ? 24  GLN G C     1 
ATOM 4652  O O     . GLN G 3 24  ? 234.255 238.412 271.360 1.00 38.30  ? 24  GLN G O     1 
ATOM 4653  C CB    . GLN G 3 24  ? 231.869 238.500 269.291 1.00 38.30  ? 24  GLN G CB    1 
ATOM 4654  C CG    . GLN G 3 24  ? 230.404 238.358 268.952 1.00 38.30  ? 24  GLN G CG    1 
ATOM 4655  C CD    . GLN G 3 24  ? 229.640 237.550 269.976 1.00 38.30  ? 24  GLN G CD    1 
ATOM 4656  O OE1   . GLN G 3 24  ? 230.150 236.579 270.525 1.00 38.30  ? 24  GLN G OE1   1 
ATOM 4657  N NE2   . GLN G 3 24  ? 228.407 237.954 270.244 1.00 38.30  ? 24  GLN G NE2   1 
ATOM 4658  N N     . PHE G 3 25  ? 234.229 240.452 270.440 1.00 36.23  ? 25  PHE G N     1 
ATOM 4659  C CA    . PHE G 3 25  ? 235.648 240.657 270.667 1.00 36.23  ? 25  PHE G CA    1 
ATOM 4660  C C     . PHE G 3 25  ? 235.920 240.985 272.135 1.00 36.23  ? 25  PHE G C     1 
ATOM 4661  O O     . PHE G 3 25  ? 235.070 241.560 272.814 1.00 36.23  ? 25  PHE G O     1 
ATOM 4662  C CB    . PHE G 3 25  ? 236.163 241.770 269.766 1.00 36.23  ? 25  PHE G CB    1 
ATOM 4663  C CG    . PHE G 3 25  ? 236.698 241.276 268.462 1.00 36.23  ? 25  PHE G CG    1 
ATOM 4664  C CD1   . PHE G 3 25  ? 235.970 240.393 267.694 1.00 36.23  ? 25  PHE G CD1   1 
ATOM 4665  C CD2   . PHE G 3 25  ? 237.933 241.680 268.011 1.00 36.23  ? 25  PHE G CD2   1 
ATOM 4666  C CE1   . PHE G 3 25  ? 236.460 239.926 266.506 1.00 36.23  ? 25  PHE G CE1   1 
ATOM 4667  C CE2   . PHE G 3 25  ? 238.428 241.218 266.820 1.00 36.23  ? 25  PHE G CE2   1 
ATOM 4668  C CZ    . PHE G 3 25  ? 237.691 240.341 266.065 1.00 36.23  ? 25  PHE G CZ    1 
ATOM 4669  N N     . PRO G 3 26  ? 237.103 240.621 272.653 1.00 36.62  ? 26  PRO G N     1 
ATOM 4670  C CA    . PRO G 3 26  ? 237.353 240.689 274.101 1.00 36.62  ? 26  PRO G CA    1 
ATOM 4671  C C     . PRO G 3 26  ? 237.731 242.085 274.572 1.00 36.62  ? 26  PRO G C     1 
ATOM 4672  O O     . PRO G 3 26  ? 238.844 242.564 274.331 1.00 36.62  ? 26  PRO G O     1 
ATOM 4673  C CB    . PRO G 3 26  ? 238.500 239.691 274.295 1.00 36.62  ? 26  PRO G CB    1 
ATOM 4674  C CG    . PRO G 3 26  ? 239.241 239.765 273.022 1.00 36.62  ? 26  PRO G CG    1 
ATOM 4675  C CD    . PRO G 3 26  ? 238.242 240.026 271.935 1.00 36.62  ? 26  PRO G CD    1 
ATOM 4676  N N     . VAL G 3 27  ? 236.818 242.722 275.303 1.00 36.72  ? 27  VAL G N     1 
ATOM 4677  C CA    . VAL G 3 27  ? 237.065 244.080 275.768 1.00 36.72  ? 27  VAL G CA    1 
ATOM 4678  C C     . VAL G 3 27  ? 238.195 244.108 276.787 1.00 36.72  ? 27  VAL G C     1 
ATOM 4679  O O     . VAL G 3 27  ? 239.042 245.001 276.754 1.00 36.72  ? 27  VAL G O     1 
ATOM 4680  C CB    . VAL G 3 27  ? 235.777 244.700 276.335 1.00 36.72  ? 27  VAL G CB    1 
ATOM 4681  C CG1   . VAL G 3 27  ? 236.079 246.039 276.958 1.00 36.72  ? 27  VAL G CG1   1 
ATOM 4682  C CG2   . VAL G 3 27  ? 234.751 244.860 275.243 1.00 36.72  ? 27  VAL G CG2   1 
ATOM 4683  N N     . GLY G 3 28  ? 238.236 243.138 277.700 1.00 37.90  ? 28  GLY G N     1 
ATOM 4684  C CA    . GLY G 3 28  ? 239.296 243.124 278.696 1.00 37.90  ? 28  GLY G CA    1 
ATOM 4685  C C     . GLY G 3 28  ? 240.671 242.929 278.088 1.00 37.90  ? 28  GLY G C     1 
ATOM 4686  O O     . GLY G 3 28  ? 241.639 243.581 278.490 1.00 37.90  ? 28  GLY G O     1 
ATOM 4687  N N     . ARG G 3 29  ? 240.774 242.039 277.104 1.00 38.39  ? 29  ARG G N     1 
ATOM 4688  C CA    . ARG G 3 29  ? 242.047 241.838 276.427 1.00 38.39  ? 29  ARG G CA    1 
ATOM 4689  C C     . ARG G 3 29  ? 242.454 243.071 275.634 1.00 38.39  ? 29  ARG G C     1 
ATOM 4690  O O     . ARG G 3 29  ? 243.628 243.444 275.627 1.00 38.39  ? 29  ARG G O     1 
ATOM 4691  C CB    . ARG G 3 29  ? 241.974 240.620 275.514 1.00 38.39  ? 29  ARG G CB    1 
ATOM 4692  C CG    . ARG G 3 29  ? 243.245 240.380 274.733 1.00 38.39  ? 29  ARG G CG    1 
ATOM 4693  C CD    . ARG G 3 29  ? 243.146 239.155 273.857 1.00 38.39  ? 29  ARG G CD    1 
ATOM 4694  N NE    . ARG G 3 29  ? 242.913 237.944 274.630 1.00 38.39  ? 29  ARG G NE    1 
ATOM 4695  C CZ    . ARG G 3 29  ? 242.966 236.717 274.128 1.00 38.39  ? 29  ARG G CZ    1 
ATOM 4696  N NH1   . ARG G 3 29  ? 243.252 236.531 272.853 1.00 38.39  ? 29  ARG G NH1   1 
ATOM 4697  N NH2   . ARG G 3 29  ? 242.740 235.676 274.905 1.00 38.39  ? 29  ARG G NH2   1 
ATOM 4698  N N     . VAL G 3 30  ? 241.503 243.717 274.958 1.00 36.06  ? 30  VAL G N     1 
ATOM 4699  C CA    . VAL G 3 30  ? 241.827 244.948 274.245 1.00 36.06  ? 30  VAL G CA    1 
ATOM 4700  C C     . VAL G 3 30  ? 242.285 246.021 275.221 1.00 36.06  ? 30  VAL G C     1 
ATOM 4701  O O     . VAL G 3 30  ? 243.212 246.787 274.938 1.00 36.06  ? 30  VAL G O     1 
ATOM 4702  C CB    . VAL G 3 30  ? 240.620 245.412 273.411 1.00 36.06  ? 30  VAL G CB    1 
ATOM 4703  C CG1   . VAL G 3 30  ? 240.811 246.829 272.934 1.00 36.06  ? 30  VAL G CG1   1 
ATOM 4704  C CG2   . VAL G 3 30  ? 240.434 244.502 272.236 1.00 36.06  ? 30  VAL G CG2   1 
ATOM 4705  N N     . HIS G 3 31  ? 241.649 246.087 276.389 1.00 37.26  ? 31  HIS G N     1 
ATOM 4706  C CA    . HIS G 3 31  ? 242.039 247.062 277.397 1.00 37.26  ? 31  HIS G CA    1 
ATOM 4707  C C     . HIS G 3 31  ? 243.470 246.832 277.840 1.00 37.26  ? 31  HIS G C     1 
ATOM 4708  O O     . HIS G 3 31  ? 244.266 247.772 277.914 1.00 37.26  ? 31  HIS G O     1 
ATOM 4709  C CB    . HIS G 3 31  ? 241.095 246.980 278.592 1.00 37.26  ? 31  HIS G CB    1 
ATOM 4710  C CG    . HIS G 3 31  ? 241.189 248.144 279.521 1.00 37.26  ? 31  HIS G CG    1 
ATOM 4711  N ND1   . HIS G 3 31  ? 241.840 249.309 279.189 1.00 37.26  ? 31  HIS G ND1   1 
ATOM 4712  C CD2   . HIS G 3 31  ? 240.707 248.326 280.771 1.00 37.26  ? 31  HIS G CD2   1 
ATOM 4713  C CE1   . HIS G 3 31  ? 241.754 250.160 280.194 1.00 37.26  ? 31  HIS G CE1   1 
ATOM 4714  N NE2   . HIS G 3 31  ? 241.072 249.587 281.167 1.00 37.26  ? 31  HIS G NE2   1 
ATOM 4715  N N     . ARG G 3 32  ? 243.813 245.583 278.138 1.00 37.97  ? 32  ARG G N     1 
ATOM 4716  C CA    . ARG G 3 32  ? 245.167 245.279 278.577 1.00 37.97  ? 32  ARG G CA    1 
ATOM 4717  C C     . ARG G 3 32  ? 246.183 245.527 277.468 1.00 37.97  ? 32  ARG G C     1 
ATOM 4718  O O     . ARG G 3 32  ? 247.296 245.987 277.735 1.00 37.97  ? 32  ARG G O     1 
ATOM 4719  C CB    . ARG G 3 32  ? 245.235 243.839 279.068 1.00 37.97  ? 32  ARG G CB    1 
ATOM 4720  C CG    . ARG G 3 32  ? 246.555 243.457 279.669 1.00 37.97  ? 32  ARG G CG    1 
ATOM 4721  C CD    . ARG G 3 32  ? 247.277 242.521 278.751 1.00 37.97  ? 32  ARG G CD    1 
ATOM 4722  N NE    . ARG G 3 32  ? 246.466 241.346 278.481 1.00 37.97  ? 32  ARG G NE    1 
ATOM 4723  C CZ    . ARG G 3 32  ? 246.719 240.464 277.525 1.00 37.97  ? 32  ARG G CZ    1 
ATOM 4724  N NH1   . ARG G 3 32  ? 247.767 240.620 276.734 1.00 37.97  ? 32  ARG G NH1   1 
ATOM 4725  N NH2   . ARG G 3 32  ? 245.918 239.425 277.361 1.00 37.97  ? 32  ARG G NH2   1 
ATOM 4726  N N     . LEU G 3 33  ? 245.829 245.224 276.219 1.00 36.26  ? 33  LEU G N     1 
ATOM 4727  C CA    . LEU G 3 33  ? 246.741 245.496 275.114 1.00 36.26  ? 33  LEU G CA    1 
ATOM 4728  C C     . LEU G 3 33  ? 246.959 246.988 274.921 1.00 36.26  ? 33  LEU G C     1 
ATOM 4729  O O     . LEU G 3 33  ? 248.055 247.407 274.540 1.00 36.26  ? 33  LEU G O     1 
ATOM 4730  C CB    . LEU G 3 33  ? 246.215 244.867 273.828 1.00 36.26  ? 33  LEU G CB    1 
ATOM 4731  C CG    . LEU G 3 33  ? 246.278 243.346 273.744 1.00 36.26  ? 33  LEU G CG    1 
ATOM 4732  C CD1   . LEU G 3 33  ? 245.710 242.867 272.437 1.00 36.26  ? 33  LEU G CD1   1 
ATOM 4733  C CD2   . LEU G 3 33  ? 247.695 242.865 273.907 1.00 36.26  ? 33  LEU G CD2   1 
ATOM 4734  N N     . LEU G 3 34  ? 245.933 247.803 275.170 1.00 35.95  ? 34  LEU G N     1 
ATOM 4735  C CA    . LEU G 3 34  ? 246.116 249.249 275.134 1.00 35.95  ? 34  LEU G CA    1 
ATOM 4736  C C     . LEU G 3 34  ? 246.982 249.723 276.288 1.00 35.95  ? 34  LEU G C     1 
ATOM 4737  O O     . LEU G 3 34  ? 247.851 250.578 276.106 1.00 35.95  ? 34  LEU G O     1 
ATOM 4738  C CB    . LEU G 3 34  ? 244.768 249.960 275.169 1.00 35.95  ? 34  LEU G CB    1 
ATOM 4739  C CG    . LEU G 3 34  ? 243.970 250.008 273.874 1.00 35.95  ? 34  LEU G CG    1 
ATOM 4740  C CD1   . LEU G 3 34  ? 242.561 250.468 274.152 1.00 35.95  ? 34  LEU G CD1   1 
ATOM 4741  C CD2   . LEU G 3 34  ? 244.650 250.916 272.878 1.00 35.95  ? 34  LEU G CD2   1 
ATOM 4742  N N     . ARG G 3 35  ? 246.765 249.170 277.481 1.00 38.62  ? 35  ARG G N     1 
ATOM 4743  C CA    . ARG G 3 35  ? 247.499 249.630 278.655 1.00 38.62  ? 35  ARG G CA    1 
ATOM 4744  C C     . ARG G 3 35  ? 248.971 249.266 278.570 1.00 38.62  ? 35  ARG G C     1 
ATOM 4745  O O     . ARG G 3 35  ? 249.830 250.050 278.981 1.00 38.62  ? 35  ARG G O     1 
ATOM 4746  C CB    . ARG G 3 35  ? 246.887 249.050 279.925 1.00 38.62  ? 35  ARG G CB    1 
ATOM 4747  C CG    . ARG G 3 35  ? 245.671 249.789 280.431 1.00 38.62  ? 35  ARG G CG    1 
ATOM 4748  C CD    . ARG G 3 35  ? 245.259 249.311 281.816 1.00 38.62  ? 35  ARG G CD    1 
ATOM 4749  N NE    . ARG G 3 35  ? 244.586 248.014 281.789 1.00 38.62  ? 35  ARG G NE    1 
ATOM 4750  C CZ    . ARG G 3 35  ? 245.188 246.849 282.005 1.00 38.62  ? 35  ARG G CZ    1 
ATOM 4751  N NH1   . ARG G 3 35  ? 246.486 246.806 282.267 1.00 38.62  ? 35  ARG G NH1   1 
ATOM 4752  N NH2   . ARG G 3 35  ? 244.492 245.724 281.960 1.00 38.62  ? 35  ARG G NH2   1 
ATOM 4753  N N     . LYS G 3 36  ? 249.288 248.091 278.036 1.00 38.33  ? 36  LYS G N     1 
ATOM 4754  C CA    . LYS G 3 36  ? 250.666 247.626 277.968 1.00 38.33  ? 36  LYS G CA    1 
ATOM 4755  C C     . LYS G 3 36  ? 251.298 247.890 276.612 1.00 38.33  ? 36  LYS G C     1 
ATOM 4756  O O     . LYS G 3 36  ? 252.289 247.250 276.256 1.00 38.33  ? 36  LYS G O     1 
ATOM 4757  C CB    . LYS G 3 36  ? 250.741 246.139 278.302 1.00 38.33  ? 36  LYS G CB    1 
ATOM 4758  C CG    . LYS G 3 36  ? 250.176 245.775 279.656 1.00 38.33  ? 36  LYS G CG    1 
ATOM 4759  C CD    . LYS G 3 36  ? 250.534 244.343 280.013 1.00 38.33  ? 36  LYS G CD    1 
ATOM 4760  C CE    . LYS G 3 36  ? 249.895 243.913 281.319 1.00 38.33  ? 36  LYS G CE    1 
ATOM 4761  N NZ    . LYS G 3 36  ? 250.185 244.860 282.429 1.00 38.33  ? 36  LYS G NZ    1 
ATOM 4762  N N     . GLY G 3 37  ? 250.753 248.825 275.849 1.00 37.33  ? 37  GLY G N     1 
ATOM 4763  C CA    . GLY G 3 37  ? 251.230 249.040 274.502 1.00 37.33  ? 37  GLY G CA    1 
ATOM 4764  C C     . GLY G 3 37  ? 251.994 250.328 274.299 1.00 37.33  ? 37  GLY G C     1 
ATOM 4765  O O     . GLY G 3 37  ? 252.322 250.668 273.162 1.00 37.33  ? 37  GLY G O     1 
ATOM 4766  N N     . ASN G 3 38  ? 252.280 251.051 275.382 1.00 37.38  ? 38  ASN G N     1 
ATOM 4767  C CA    . ASN G 3 38  ? 252.980 252.335 275.317 1.00 37.38  ? 38  ASN G CA    1 
ATOM 4768  C C     . ASN G 3 38  ? 252.248 253.312 274.406 1.00 37.38  ? 38  ASN G C     1 
ATOM 4769  O O     . ASN G 3 38  ? 252.846 253.974 273.560 1.00 37.38  ? 38  ASN G O     1 
ATOM 4770  C CB    . ASN G 3 38  ? 254.430 252.164 274.857 1.00 37.38  ? 38  ASN G CB    1 
ATOM 4771  C CG    . ASN G 3 38  ? 255.211 251.227 275.734 1.00 37.38  ? 38  ASN G CG    1 
ATOM 4772  O OD1   . ASN G 3 38  ? 255.616 250.155 275.303 1.00 37.38  ? 38  ASN G OD1   1 
ATOM 4773  N ND2   . ASN G 3 38  ? 255.424 251.624 276.975 1.00 37.38  ? 38  ASN G ND2   1 
ATOM 4774  N N     . TYR G 3 39  ? 250.936 253.386 274.567 1.00 35.65  ? 39  TYR G N     1 
ATOM 4775  C CA    . TYR G 3 39  ? 250.151 254.312 273.770 1.00 35.65  ? 39  TYR G CA    1 
ATOM 4776  C C     . TYR G 3 39  ? 249.862 255.607 274.501 1.00 35.65  ? 39  TYR G C     1 
ATOM 4777  O O     . TYR G 3 39  ? 250.099 256.682 273.954 1.00 35.65  ? 39  TYR G O     1 
ATOM 4778  C CB    . TYR G 3 39  ? 248.845 253.651 273.335 1.00 35.65  ? 39  TYR G CB    1 
ATOM 4779  C CG    . TYR G 3 39  ? 249.070 252.485 272.415 1.00 35.65  ? 39  TYR G CG    1 
ATOM 4780  C CD1   . TYR G 3 39  ? 249.555 252.674 271.138 1.00 35.65  ? 39  TYR G CD1   1 
ATOM 4781  C CD2   . TYR G 3 39  ? 248.801 251.197 272.824 1.00 35.65  ? 39  TYR G CD2   1 
ATOM 4782  C CE1   . TYR G 3 39  ? 249.769 251.617 270.300 1.00 35.65  ? 39  TYR G CE1   1 
ATOM 4783  C CE2   . TYR G 3 39  ? 249.009 250.136 271.994 1.00 35.65  ? 39  TYR G CE2   1 
ATOM 4784  C CZ    . TYR G 3 39  ? 249.490 250.348 270.732 1.00 35.65  ? 39  TYR G CZ    1 
ATOM 4785  O OH    . TYR G 3 39  ? 249.699 249.281 269.899 1.00 35.65  ? 39  TYR G OH    1 
ATOM 4786  N N     . ALA G 3 40  ? 249.374 255.533 275.731 1.00 38.01  ? 40  ALA G N     1 
ATOM 4787  C CA    . ALA G 3 40  ? 249.220 256.716 276.556 1.00 38.01  ? 40  ALA G CA    1 
ATOM 4788  C C     . ALA G 3 40  ? 249.456 256.323 277.999 1.00 38.01  ? 40  ALA G C     1 
ATOM 4789  O O     . ALA G 3 40  ? 249.506 255.143 278.343 1.00 38.01  ? 40  ALA G O     1 
ATOM 4790  C CB    . ALA G 3 40  ? 247.845 257.357 276.384 1.00 38.01  ? 40  ALA G CB    1 
ATOM 4791  N N     . GLU G 3 41  ? 249.613 257.336 278.844 1.00 41.61  ? 41  GLU G N     1 
ATOM 4792  C CA    . GLU G 3 41  ? 249.783 257.090 280.267 1.00 41.61  ? 41  GLU G CA    1 
ATOM 4793  C C     . GLU G 3 41  ? 248.537 256.448 280.863 1.00 41.61  ? 41  GLU G C     1 
ATOM 4794  O O     . GLU G 3 41  ? 248.636 255.584 281.739 1.00 41.61  ? 41  GLU G O     1 
ATOM 4795  C CB    . GLU G 3 41  ? 250.117 258.402 280.972 1.00 41.61  ? 41  GLU G CB    1 
ATOM 4796  C CG    . GLU G 3 41  ? 250.380 258.277 282.450 1.00 41.61  ? 41  GLU G CG    1 
ATOM 4797  C CD    . GLU G 3 41  ? 250.490 259.624 283.135 1.00 41.61  ? 41  GLU G CD    1 
ATOM 4798  O OE1   . GLU G 3 41  ? 249.445 260.186 283.522 1.00 41.61  ? 41  GLU G OE1   1 
ATOM 4799  O OE2   . GLU G 3 41  ? 251.624 260.129 283.277 1.00 41.61  ? 41  GLU G OE2   1 
ATOM 4800  N N     . ARG G 3 42  ? 247.360 256.831 280.378 1.00 41.49  ? 42  ARG G N     1 
ATOM 4801  C CA    . ARG G 3 42  ? 246.096 256.342 280.900 1.00 41.49  ? 42  ARG G CA    1 
ATOM 4802  C C     . ARG G 3 42  ? 245.199 255.914 279.753 1.00 41.49  ? 42  ARG G C     1 
ATOM 4803  O O     . ARG G 3 42  ? 245.269 256.463 278.654 1.00 41.49  ? 42  ARG G O     1 
ATOM 4804  C CB    . ARG G 3 42  ? 245.384 257.405 281.733 1.00 41.49  ? 42  ARG G CB    1 
ATOM 4805  C CG    . ARG G 3 42  ? 246.075 257.732 283.019 1.00 41.49  ? 42  ARG G CG    1 
ATOM 4806  C CD    . ARG G 3 42  ? 246.004 259.204 283.287 1.00 41.49  ? 42  ARG G CD    1 
ATOM 4807  N NE    . ARG G 3 42  ? 244.643 259.700 283.163 1.00 41.49  ? 42  ARG G NE    1 
ATOM 4808  C CZ    . ARG G 3 42  ? 243.765 259.700 284.154 1.00 41.49  ? 42  ARG G CZ    1 
ATOM 4809  N NH1   . ARG G 3 42  ? 244.107 259.228 285.341 1.00 41.49  ? 42  ARG G NH1   1 
ATOM 4810  N NH2   . ARG G 3 42  ? 242.545 260.171 283.954 1.00 41.49  ? 42  ARG G NH2   1 
ATOM 4811  N N     . VAL G 3 43  ? 244.343 254.937 280.025 1.00 38.57  ? 43  VAL G N     1 
ATOM 4812  C CA    . VAL G 3 43  ? 243.407 254.409 279.044 1.00 38.57  ? 43  VAL G CA    1 
ATOM 4813  C C     . VAL G 3 43  ? 242.009 254.507 279.629 1.00 38.57  ? 43  VAL G C     1 
ATOM 4814  O O     . VAL G 3 43  ? 241.716 253.882 280.652 1.00 38.57  ? 43  VAL G O     1 
ATOM 4815  C CB    . VAL G 3 43  ? 243.741 252.961 278.657 1.00 38.57  ? 43  VAL G CB    1 
ATOM 4816  C CG1   . VAL G 3 43  ? 242.697 252.416 277.720 1.00 38.57  ? 43  VAL G CG1   1 
ATOM 4817  C CG2   . VAL G 3 43  ? 245.101 252.903 278.006 1.00 38.57  ? 43  VAL G CG2   1 
ATOM 4818  N N     . GLY G 3 44  ? 241.152 255.294 278.987 1.00 37.88  ? 44  GLY G N     1 
ATOM 4819  C CA    . GLY G 3 44  ? 239.803 255.467 279.473 1.00 37.88  ? 44  GLY G CA    1 
ATOM 4820  C C     . GLY G 3 44  ? 239.001 254.185 279.424 1.00 37.88  ? 44  GLY G C     1 
ATOM 4821  O O     . GLY G 3 44  ? 239.369 253.207 278.780 1.00 37.88  ? 44  GLY G O     1 
ATOM 4822  N N     . ALA G 3 45  ? 237.871 254.197 280.123 1.00 37.48  ? 45  ALA G N     1 
ATOM 4823  C CA    . ALA G 3 45  ? 237.070 252.987 280.248 1.00 37.48  ? 45  ALA G CA    1 
ATOM 4824  C C     . ALA G 3 45  ? 236.380 252.620 278.943 1.00 37.48  ? 45  ALA G C     1 
ATOM 4825  O O     . ALA G 3 45  ? 236.262 251.434 278.623 1.00 37.48  ? 45  ALA G O     1 
ATOM 4826  C CB    . ALA G 3 45  ? 236.038 253.158 281.358 1.00 37.48  ? 45  ALA G CB    1 
ATOM 4827  N N     . GLY G 3 46  ? 235.929 253.613 278.177 1.00 35.83  ? 46  GLY G N     1 
ATOM 4828  C CA    . GLY G 3 46  ? 235.212 253.340 276.947 1.00 35.83  ? 46  GLY G CA    1 
ATOM 4829  C C     . GLY G 3 46  ? 236.083 253.104 275.736 1.00 35.83  ? 46  GLY G C     1 
ATOM 4830  O O     . GLY G 3 46  ? 235.581 252.623 274.718 1.00 35.83  ? 46  GLY G O     1 
ATOM 4831  N N     . ALA G 3 47  ? 237.367 253.437 275.815 1.00 34.86  ? 47  ALA G N     1 
ATOM 4832  C CA    . ALA G 3 47  ? 238.264 253.210 274.685 1.00 34.86  ? 47  ALA G CA    1 
ATOM 4833  C C     . ALA G 3 47  ? 238.359 251.744 274.288 1.00 34.86  ? 47  ALA G C     1 
ATOM 4834  O O     . ALA G 3 47  ? 238.298 251.452 273.083 1.00 34.86  ? 47  ALA G O     1 
ATOM 4835  C CB    . ALA G 3 47  ? 239.644 253.790 274.996 1.00 34.86  ? 47  ALA G CB    1 
ATOM 4836  N N     . PRO G 3 48  ? 238.500 250.783 275.207 1.00 34.82  ? 48  PRO G N     1 
ATOM 4837  C CA    . PRO G 3 48  ? 238.539 249.389 274.763 1.00 34.82  ? 48  PRO G CA    1 
ATOM 4838  C C     . PRO G 3 48  ? 237.216 248.908 274.221 1.00 34.82  ? 48  PRO G C     1 
ATOM 4839  O O     . PRO G 3 48  ? 237.212 248.118 273.275 1.00 34.82  ? 48  PRO G O     1 
ATOM 4840  C CB    . PRO G 3 48  ? 238.945 248.632 276.030 1.00 34.82  ? 48  PRO G CB    1 
ATOM 4841  C CG    . PRO G 3 48  ? 238.505 249.485 277.116 1.00 34.82  ? 48  PRO G CG    1 
ATOM 4842  C CD    . PRO G 3 48  ? 238.729 250.874 276.657 1.00 34.82  ? 48  PRO G CD    1 
ATOM 4843  N N     . VAL G 3 49  ? 236.096 249.362 274.779 1.00 34.99  ? 49  VAL G N     1 
ATOM 4844  C CA    . VAL G 3 49  ? 234.790 249.000 274.241 1.00 34.99  ? 49  VAL G CA    1 
ATOM 4845  C C     . VAL G 3 49  ? 234.657 249.488 272.808 1.00 34.99  ? 49  VAL G C     1 
ATOM 4846  O O     . VAL G 3 49  ? 234.260 248.741 271.906 1.00 34.99  ? 49  VAL G O     1 
ATOM 4847  C CB    . VAL G 3 49  ? 233.672 249.570 275.128 1.00 34.99  ? 49  VAL G CB    1 
ATOM 4848  C CG1   . VAL G 3 49  ? 232.325 249.191 274.574 1.00 34.99  ? 49  VAL G CG1   1 
ATOM 4849  C CG2   . VAL G 3 49  ? 233.832 249.090 276.549 1.00 34.99  ? 49  VAL G CG2   1 
ATOM 4850  N N     . TYR G 3 50  ? 234.993 250.754 272.582 1.00 35.36  ? 50  TYR G N     1 
ATOM 4851  C CA    . TYR G 3 50  ? 234.905 251.322 271.247 1.00 35.36  ? 50  TYR G CA    1 
ATOM 4852  C C     . TYR G 3 50  ? 235.804 250.575 270.276 1.00 35.36  ? 50  TYR G C     1 
ATOM 4853  O O     . TYR G 3 50  ? 235.369 250.185 269.186 1.00 35.36  ? 50  TYR G O     1 
ATOM 4854  C CB    . TYR G 3 50  ? 235.281 252.798 271.301 1.00 35.36  ? 50  TYR G CB    1 
ATOM 4855  C CG    . TYR G 3 50  ? 234.683 253.624 270.199 1.00 35.36  ? 50  TYR G CG    1 
ATOM 4856  C CD1   . TYR G 3 50  ? 235.091 253.463 268.890 1.00 35.36  ? 50  TYR G CD1   1 
ATOM 4857  C CD2   . TYR G 3 50  ? 233.720 254.572 270.469 1.00 35.36  ? 50  TYR G CD2   1 
ATOM 4858  C CE1   . TYR G 3 50  ? 234.554 254.215 267.888 1.00 35.36  ? 50  TYR G CE1   1 
ATOM 4859  C CE2   . TYR G 3 50  ? 233.182 255.332 269.473 1.00 35.36  ? 50  TYR G CE2   1 
ATOM 4860  C CZ    . TYR G 3 50  ? 233.598 255.146 268.183 1.00 35.36  ? 50  TYR G CZ    1 
ATOM 4861  O OH    . TYR G 3 50  ? 233.066 255.895 267.176 1.00 35.36  ? 50  TYR G OH    1 
ATOM 4862  N N     . LEU G 3 51  ? 237.057 250.351 270.663 1.00 34.30  ? 51  LEU G N     1 
ATOM 4863  C CA    . LEU G 3 51  ? 238.002 249.713 269.763 1.00 34.30  ? 51  LEU G CA    1 
ATOM 4864  C C     . LEU G 3 51  ? 237.590 248.281 269.454 1.00 34.30  ? 51  LEU G C     1 
ATOM 4865  O O     . LEU G 3 51  ? 237.695 247.840 268.309 1.00 34.30  ? 51  LEU G O     1 
ATOM 4866  C CB    . LEU G 3 51  ? 239.400 249.770 270.368 1.00 34.30  ? 51  LEU G CB    1 
ATOM 4867  C CG    . LEU G 3 51  ? 240.578 249.276 269.540 1.00 34.30  ? 51  LEU G CG    1 
ATOM 4868  C CD1   . LEU G 3 51  ? 240.615 249.975 268.209 1.00 34.30  ? 51  LEU G CD1   1 
ATOM 4869  C CD2   . LEU G 3 51  ? 241.844 249.541 270.298 1.00 34.30  ? 51  LEU G CD2   1 
ATOM 4870  N N     . ALA G 3 52  ? 237.111 247.543 270.454 1.00 34.66  ? 52  ALA G N     1 
ATOM 4871  C CA    . ALA G 3 52  ? 236.672 246.177 270.214 1.00 34.66  ? 52  ALA G CA    1 
ATOM 4872  C C     . ALA G 3 52  ? 235.454 246.138 269.306 1.00 34.66  ? 52  ALA G C     1 
ATOM 4873  O O     . ALA G 3 52  ? 235.338 245.254 268.456 1.00 34.66  ? 52  ALA G O     1 
ATOM 4874  C CB    . ALA G 3 52  ? 236.380 245.481 271.538 1.00 34.66  ? 52  ALA G CB    1 
ATOM 4875  N N     . ALA G 3 53  ? 234.534 247.089 269.466 1.00 34.67  ? 53  ALA G N     1 
ATOM 4876  C CA    . ALA G 3 53  ? 233.394 247.153 268.561 1.00 34.67  ? 53  ALA G CA    1 
ATOM 4877  C C     . ALA G 3 53  ? 233.842 247.422 267.133 1.00 34.67  ? 53  ALA G C     1 
ATOM 4878  O O     . ALA G 3 53  ? 233.321 246.822 266.187 1.00 34.67  ? 53  ALA G O     1 
ATOM 4879  C CB    . ALA G 3 53  ? 232.418 248.226 269.024 1.00 34.67  ? 53  ALA G CB    1 
ATOM 4880  N N     . VAL G 3 54  ? 234.818 248.311 266.961 1.00 34.11  ? 54  VAL G N     1 
ATOM 4881  C CA    . VAL G 3 54  ? 235.316 248.616 265.622 1.00 34.11  ? 54  VAL G CA    1 
ATOM 4882  C C     . VAL G 3 54  ? 236.006 247.400 265.017 1.00 34.11  ? 54  VAL G C     1 
ATOM 4883  O O     . VAL G 3 54  ? 235.813 247.079 263.838 1.00 34.11  ? 54  VAL G O     1 
ATOM 4884  C CB    . VAL G 3 54  ? 236.245 249.842 265.668 1.00 34.11  ? 54  VAL G CB    1 
ATOM 4885  C CG1   . VAL G 3 54  ? 236.909 250.059 264.331 1.00 34.11  ? 54  VAL G CG1   1 
ATOM 4886  C CG2   . VAL G 3 54  ? 235.458 251.073 266.060 1.00 34.11  ? 54  VAL G CG2   1 
ATOM 4887  N N     . LEU G 3 55  ? 236.808 246.698 265.813 1.00 34.23  ? 55  LEU G N     1 
ATOM 4888  C CA    . LEU G 3 55  ? 237.499 245.517 265.314 1.00 34.23  ? 55  LEU G CA    1 
ATOM 4889  C C     . LEU G 3 55  ? 236.510 244.425 264.940 1.00 34.23  ? 55  LEU G C     1 
ATOM 4890  O O     . LEU G 3 55  ? 236.643 243.787 263.894 1.00 34.23  ? 55  LEU G O     1 
ATOM 4891  C CB    . LEU G 3 55  ? 238.500 245.013 266.352 1.00 34.23  ? 55  LEU G CB    1 
ATOM 4892  C CG    . LEU G 3 55  ? 239.702 245.920 266.626 1.00 34.23  ? 55  LEU G CG    1 
ATOM 4893  C CD1   . LEU G 3 55  ? 240.518 245.407 267.786 1.00 34.23  ? 55  LEU G CD1   1 
ATOM 4894  C CD2   . LEU G 3 55  ? 240.568 246.061 265.397 1.00 34.23  ? 55  LEU G CD2   1 
ATOM 4895  N N     . GLU G 3 56  ? 235.500 244.205 265.779 1.00 36.50  ? 56  GLU G N     1 
ATOM 4896  C CA    . GLU G 3 56  ? 234.475 243.226 265.452 1.00 36.50  ? 56  GLU G CA    1 
ATOM 4897  C C     . GLU G 3 56  ? 233.731 243.604 264.179 1.00 36.50  ? 56  GLU G C     1 
ATOM 4898  O O     . GLU G 3 56  ? 233.429 242.740 263.353 1.00 36.50  ? 56  GLU G O     1 
ATOM 4899  C CB    . GLU G 3 56  ? 233.507 243.080 266.618 1.00 36.50  ? 56  GLU G CB    1 
ATOM 4900  C CG    . GLU G 3 56  ? 232.281 242.279 266.293 1.00 36.50  ? 56  GLU G CG    1 
ATOM 4901  C CD    . GLU G 3 56  ? 231.518 241.890 267.527 1.00 36.50  ? 56  GLU G CD    1 
ATOM 4902  O OE1   . GLU G 3 56  ? 232.143 241.799 268.599 1.00 36.50  ? 56  GLU G OE1   1 
ATOM 4903  O OE2   . GLU G 3 56  ? 230.294 241.680 267.432 1.00 36.50  ? 56  GLU G OE2   1 
ATOM 4904  N N     . TYR G 3 57  ? 233.440 244.888 263.990 1.00 36.86  ? 57  TYR G N     1 
ATOM 4905  C CA    . TYR G 3 57  ? 232.742 245.300 262.780 1.00 36.86  ? 57  TYR G CA    1 
ATOM 4906  C C     . TYR G 3 57  ? 233.595 245.071 261.537 1.00 36.86  ? 57  TYR G C     1 
ATOM 4907  O O     . TYR G 3 57  ? 233.100 244.598 260.510 1.00 36.86  ? 57  TYR G O     1 
ATOM 4908  C CB    . TYR G 3 57  ? 232.326 246.764 262.880 1.00 36.86  ? 57  TYR G CB    1 
ATOM 4909  C CG    . TYR G 3 57  ? 231.938 247.316 261.543 1.00 36.86  ? 57  TYR G CG    1 
ATOM 4910  C CD1   . TYR G 3 57  ? 230.702 247.035 260.994 1.00 36.86  ? 57  TYR G CD1   1 
ATOM 4911  C CD2   . TYR G 3 57  ? 232.824 248.076 260.806 1.00 36.86  ? 57  TYR G CD2   1 
ATOM 4912  C CE1   . TYR G 3 57  ? 230.353 247.517 259.762 1.00 36.86  ? 57  TYR G CE1   1 
ATOM 4913  C CE2   . TYR G 3 57  ? 232.483 248.560 259.576 1.00 36.86  ? 57  TYR G CE2   1 
ATOM 4914  C CZ    . TYR G 3 57  ? 231.248 248.275 259.057 1.00 36.86  ? 57  TYR G CZ    1 
ATOM 4915  O OH    . TYR G 3 57  ? 230.904 248.761 257.821 1.00 36.86  ? 57  TYR G OH    1 
ATOM 4916  N N     . LEU G 3 58  ? 234.874 245.438 261.596 1.00 35.49  ? 58  LEU G N     1 
ATOM 4917  C CA    . LEU G 3 58  ? 235.737 245.255 260.432 1.00 35.49  ? 58  LEU G CA    1 
ATOM 4918  C C     . LEU G 3 58  ? 235.932 243.778 260.119 1.00 35.49  ? 58  LEU G C     1 
ATOM 4919  O O     . LEU G 3 58  ? 235.929 243.371 258.946 1.00 35.49  ? 58  LEU G O     1 
ATOM 4920  C CB    . LEU G 3 58  ? 237.081 245.940 260.660 1.00 35.49  ? 58  LEU G CB    1 
ATOM 4921  C CG    . LEU G 3 58  ? 237.053 247.465 260.648 1.00 35.49  ? 58  LEU G CG    1 
ATOM 4922  C CD1   . LEU G 3 58  ? 238.448 248.030 260.760 1.00 35.49  ? 58  LEU G CD1   1 
ATOM 4923  C CD2   . LEU G 3 58  ? 236.380 247.965 259.393 1.00 35.49  ? 58  LEU G CD2   1 
ATOM 4924  N N     . THR G 3 59  ? 236.097 242.964 261.159 1.00 35.70  ? 59  THR G N     1 
ATOM 4925  C CA    . THR G 3 59  ? 236.160 241.522 260.983 1.00 35.70  ? 59  THR G CA    1 
ATOM 4926  C C     . THR G 3 59  ? 234.895 240.998 260.332 1.00 35.70  ? 59  THR G C     1 
ATOM 4927  O O     . THR G 3 59  ? 234.955 240.155 259.437 1.00 35.70  ? 59  THR G O     1 
ATOM 4928  C CB    . THR G 3 59  ? 236.380 240.847 262.332 1.00 35.70  ? 59  THR G CB    1 
ATOM 4929  O OG1   . THR G 3 59  ? 237.624 241.282 262.880 1.00 35.70  ? 59  THR G OG1   1 
ATOM 4930  C CG2   . THR G 3 59  ? 236.398 239.350 262.179 1.00 35.70  ? 59  THR G CG2   1 
ATOM 4931  N N     . ALA G 3 60  ? 233.736 241.490 260.770 1.00 36.79  ? 60  ALA G N     1 
ATOM 4932  C CA    . ALA G 3 60  ? 232.476 241.030 260.206 1.00 36.79  ? 60  ALA G CA    1 
ATOM 4933  C C     . ALA G 3 60  ? 232.363 241.401 258.737 1.00 36.79  ? 60  ALA G C     1 
ATOM 4934  O O     . ALA G 3 60  ? 231.903 240.597 257.927 1.00 36.79  ? 60  ALA G O     1 
ATOM 4935  C CB    . ALA G 3 60  ? 231.306 241.609 260.993 1.00 36.79  ? 60  ALA G CB    1 
ATOM 4936  N N     . GLU G 3 61  ? 232.790 242.607 258.371 1.00 38.56  ? 61  GLU G N     1 
ATOM 4937  C CA    . GLU G 3 61  ? 232.771 242.993 256.963 1.00 38.56  ? 61  GLU G CA    1 
ATOM 4938  C C     . GLU G 3 61  ? 233.622 242.049 256.125 1.00 38.56  ? 61  GLU G C     1 
ATOM 4939  O O     . GLU G 3 61  ? 233.156 241.491 255.119 1.00 38.56  ? 61  GLU G O     1 
ATOM 4940  C CB    . GLU G 3 61  ? 233.260 244.429 256.803 1.00 38.56  ? 61  GLU G CB    1 
ATOM 4941  C CG    . GLU G 3 61  ? 232.246 245.464 257.187 1.00 38.56  ? 61  GLU G CG    1 
ATOM 4942  C CD    . GLU G 3 61  ? 231.096 245.529 256.209 1.00 38.56  ? 61  GLU G CD    1 
ATOM 4943  O OE1   . GLU G 3 61  ? 231.331 245.889 255.035 1.00 38.56  ? 61  GLU G OE1   1 
ATOM 4944  O OE2   . GLU G 3 61  ? 229.960 245.201 256.610 1.00 38.56  ? 61  GLU G OE2   1 
ATOM 4945  N N     . ILE G 3 62  ? 234.878 241.858 256.530 1.00 37.11  ? 62  ILE G N     1 
ATOM 4946  C CA    . ILE G 3 62  ? 235.773 241.023 255.738 1.00 37.11  ? 62  ILE G CA    1 
ATOM 4947  C C     . ILE G 3 62  ? 235.263 239.592 255.681 1.00 37.11  ? 62  ILE G C     1 
ATOM 4948  O O     . ILE G 3 62  ? 235.316 238.947 254.633 1.00 37.11  ? 62  ILE G O     1 
ATOM 4949  C CB    . ILE G 3 62  ? 237.206 241.087 256.286 1.00 37.11  ? 62  ILE G CB    1 
ATOM 4950  C CG1   . ILE G 3 62  ? 237.702 242.526 256.262 1.00 37.11  ? 62  ILE G CG1   1 
ATOM 4951  C CG2   . ILE G 3 62  ? 238.110 240.211 255.461 1.00 37.11  ? 62  ILE G CG2   1 
ATOM 4952  C CD1   . ILE G 3 62  ? 239.182 242.651 256.129 1.00 37.11  ? 62  ILE G CD1   1 
ATOM 4953  N N     . LEU G 3 63  ? 234.735 239.081 256.792 1.00 37.63  ? 63  LEU G N     1 
ATOM 4954  C CA    . LEU G 3 63  ? 234.308 237.688 256.831 1.00 37.63  ? 63  LEU G CA    1 
ATOM 4955  C C     . LEU G 3 63  ? 233.023 237.478 256.054 1.00 37.63  ? 63  LEU G C     1 
ATOM 4956  O O     . LEU G 3 63  ? 232.828 236.420 255.460 1.00 37.63  ? 63  LEU G O     1 
ATOM 4957  C CB    . LEU G 3 63  ? 234.137 237.222 258.272 1.00 37.63  ? 63  LEU G CB    1 
ATOM 4958  C CG    . LEU G 3 63  ? 235.420 236.912 259.033 1.00 37.63  ? 63  LEU G CG    1 
ATOM 4959  C CD1   . LEU G 3 63  ? 235.095 236.380 260.403 1.00 37.63  ? 63  LEU G CD1   1 
ATOM 4960  C CD2   . LEU G 3 63  ? 236.272 235.931 258.273 1.00 37.63  ? 63  LEU G CD2   1 
ATOM 4961  N N     . GLU G 3 64  ? 232.140 238.473 256.029 1.00 40.27  ? 64  GLU G N     1 
ATOM 4962  C CA    . GLU G 3 64  ? 230.940 238.368 255.214 1.00 40.27  ? 64  GLU G CA    1 
ATOM 4963  C C     . GLU G 3 64  ? 231.297 238.312 253.738 1.00 40.27  ? 64  GLU G C     1 
ATOM 4964  O O     . GLU G 3 64  ? 230.842 237.423 253.007 1.00 40.27  ? 64  GLU G O     1 
ATOM 4965  C CB    . GLU G 3 64  ? 230.014 239.544 255.505 1.00 40.27  ? 64  GLU G CB    1 
ATOM 4966  C CG    . GLU G 3 64  ? 228.697 239.494 254.778 1.00 40.27  ? 64  GLU G CG    1 
ATOM 4967  C CD    . GLU G 3 64  ? 228.481 240.706 253.906 1.00 40.27  ? 64  GLU G CD    1 
ATOM 4968  O OE1   . GLU G 3 64  ? 227.840 240.571 252.844 1.00 40.27  ? 64  GLU G OE1   1 
ATOM 4969  O OE2   . GLU G 3 64  ? 228.965 241.796 254.274 1.00 40.27  ? 64  GLU G OE2   1 
ATOM 4970  N N     . LEU G 3 65  ? 232.141 239.240 253.286 1.00 39.21  ? 65  LEU G N     1 
ATOM 4971  C CA    . LEU G 3 65  ? 232.527 239.215 251.879 1.00 39.21  ? 65  LEU G CA    1 
ATOM 4972  C C     . LEU G 3 65  ? 233.329 237.962 251.539 1.00 39.21  ? 65  LEU G C     1 
ATOM 4973  O O     . LEU G 3 65  ? 233.200 237.414 250.440 1.00 39.21  ? 65  LEU G O     1 
ATOM 4974  C CB    . LEU G 3 65  ? 233.308 240.473 251.528 1.00 39.21  ? 65  LEU G CB    1 
ATOM 4975  C CG    . LEU G 3 65  ? 232.480 241.750 251.531 1.00 39.21  ? 65  LEU G CG    1 
ATOM 4976  C CD1   . LEU G 3 65  ? 233.370 242.918 251.257 1.00 39.21  ? 65  LEU G CD1   1 
ATOM 4977  C CD2   . LEU G 3 65  ? 231.370 241.677 250.508 1.00 39.21  ? 65  LEU G CD2   1 
ATOM 4978  N N     . ALA G 3 66  ? 234.144 237.477 252.477 1.00 38.86  ? 66  ALA G N     1 
ATOM 4979  C CA    . ALA G 3 66  ? 234.939 236.286 252.219 1.00 38.86  ? 66  ALA G CA    1 
ATOM 4980  C C     . ALA G 3 66  ? 234.084 235.030 252.201 1.00 38.86  ? 66  ALA G C     1 
ATOM 4981  O O     . ALA G 3 66  ? 234.337 234.130 251.402 1.00 38.86  ? 66  ALA G O     1 
ATOM 4982  C CB    . ALA G 3 66  ? 236.053 236.164 253.255 1.00 38.86  ? 66  ALA G CB    1 
ATOM 4983  N N     . GLY G 3 67  ? 233.058 234.956 253.045 1.00 40.26  ? 67  GLY G N     1 
ATOM 4984  C CA    . GLY G 3 67  ? 232.138 233.838 252.974 1.00 40.26  ? 67  GLY G CA    1 
ATOM 4985  C C     . GLY G 3 67  ? 231.329 233.841 251.694 1.00 40.26  ? 67  GLY G C     1 
ATOM 4986  O O     . GLY G 3 67  ? 231.057 232.785 251.120 1.00 40.26  ? 67  GLY G O     1 
ATOM 4987  N N     . ASN G 3 68  ? 230.944 235.027 251.220 1.00 42.11  ? 68  ASN G N     1 
ATOM 4988  C CA    . ASN G 3 68  ? 230.316 235.110 249.906 1.00 42.11  ? 68  ASN G CA    1 
ATOM 4989  C C     . ASN G 3 68  ? 231.250 234.582 248.828 1.00 42.11  ? 68  ASN G C     1 
ATOM 4990  O O     . ASN G 3 68  ? 230.861 233.749 248.002 1.00 42.11  ? 68  ASN G O     1 
ATOM 4991  C CB    . ASN G 3 68  ? 229.913 236.547 249.597 1.00 42.11  ? 68  ASN G CB    1 
ATOM 4992  C CG    . ASN G 3 68  ? 228.820 237.046 250.497 1.00 42.11  ? 68  ASN G CG    1 
ATOM 4993  O OD1   . ASN G 3 68  ? 228.030 236.267 251.020 1.00 42.11  ? 68  ASN G OD1   1 
ATOM 4994  N ND2   . ASN G 3 68  ? 228.765 238.353 250.686 1.00 42.11  ? 68  ASN G ND2   1 
ATOM 4995  N N     . ALA G 3 69  ? 232.496 235.055 248.830 1.00 41.54  ? 69  ALA G N     1 
ATOM 4996  C CA    . ALA G 3 69  ? 233.465 234.592 247.846 1.00 41.54  ? 69  ALA G CA    1 
ATOM 4997  C C     . ALA G 3 69  ? 233.681 233.090 247.924 1.00 41.54  ? 69  ALA G C     1 
ATOM 4998  O O     . ALA G 3 69  ? 233.881 232.443 246.893 1.00 41.54  ? 69  ALA G O     1 
ATOM 4999  C CB    . ALA G 3 69  ? 234.791 235.322 248.035 1.00 41.54  ? 69  ALA G CB    1 
ATOM 5000  N N     . ALA G 3 70  ? 233.644 232.518 249.125 1.00 42.47  ? 70  ALA G N     1 
ATOM 5001  C CA    . ALA G 3 70  ? 233.828 231.081 249.260 1.00 42.47  ? 70  ALA G CA    1 
ATOM 5002  C C     . ALA G 3 70  ? 232.634 230.324 248.709 1.00 42.47  ? 70  ALA G C     1 
ATOM 5003  O O     . ALA G 3 70  ? 232.799 229.299 248.040 1.00 42.47  ? 70  ALA G O     1 
ATOM 5004  C CB    . ALA G 3 70  ? 234.065 230.711 250.720 1.00 42.47  ? 70  ALA G CB    1 
ATOM 5005  N N     . ARG G 3 71  ? 231.423 230.811 248.976 1.00 44.67  ? 71  ARG G N     1 
ATOM 5006  C CA    . ARG G 3 71  ? 230.240 230.156 248.432 1.00 44.67  ? 71  ARG G CA    1 
ATOM 5007  C C     . ARG G 3 71  ? 230.224 230.222 246.912 1.00 44.67  ? 71  ARG G C     1 
ATOM 5008  O O     . ARG G 3 71  ? 229.759 229.289 246.249 1.00 44.67  ? 71  ARG G O     1 
ATOM 5009  C CB    . ARG G 3 71  ? 228.977 230.787 249.002 1.00 44.67  ? 71  ARG G CB    1 
ATOM 5010  C CG    . ARG G 3 71  ? 227.718 230.023 248.662 1.00 44.67  ? 71  ARG G CG    1 
ATOM 5011  C CD    . ARG G 3 71  ? 226.508 230.931 248.602 1.00 44.67  ? 71  ARG G CD    1 
ATOM 5012  N NE    . ARG G 3 71  ? 226.580 232.017 249.570 1.00 44.67  ? 71  ARG G NE    1 
ATOM 5013  C CZ    . ARG G 3 71  ? 226.774 233.290 249.246 1.00 44.67  ? 71  ARG G CZ    1 
ATOM 5014  N NH1   . ARG G 3 71  ? 226.904 233.636 247.974 1.00 44.67  ? 71  ARG G NH1   1 
ATOM 5015  N NH2   . ARG G 3 71  ? 226.831 234.215 250.192 1.00 44.67  ? 71  ARG G NH2   1 
ATOM 5016  N N     . ASP G 3 72  ? 230.731 231.314 246.339 1.00 45.87  ? 72  ASP G N     1 
ATOM 5017  C CA    . ASP G 3 72  ? 230.783 231.422 244.885 1.00 45.87  ? 72  ASP G CA    1 
ATOM 5018  C C     . ASP G 3 72  ? 231.661 230.355 244.249 1.00 45.87  ? 72  ASP G C     1 
ATOM 5019  O O     . ASP G 3 72  ? 231.408 229.970 243.105 1.00 45.87  ? 72  ASP G O     1 
ATOM 5020  C CB    . ASP G 3 72  ? 231.290 232.799 244.468 1.00 45.87  ? 72  ASP G CB    1 
ATOM 5021  C CG    . ASP G 3 72  ? 230.345 233.904 244.853 1.00 45.87  ? 72  ASP G CG    1 
ATOM 5022  O OD1   . ASP G 3 72  ? 229.130 233.642 244.937 1.00 45.87  ? 72  ASP G OD1   1 
ATOM 5023  O OD2   . ASP G 3 72  ? 230.816 235.040 245.066 1.00 45.87  ? 72  ASP G OD2   1 
ATOM 5024  N N     . ASN G 3 73  ? 232.683 229.875 244.954 1.00 46.14  ? 73  ASN G N     1 
ATOM 5025  C CA    . ASN G 3 73  ? 233.539 228.800 244.475 1.00 46.14  ? 73  ASN G CA    1 
ATOM 5026  C C     . ASN G 3 73  ? 233.082 227.438 244.971 1.00 46.14  ? 73  ASN G C     1 
ATOM 5027  O O     . ASN G 3 73  ? 233.829 226.463 244.860 1.00 46.14  ? 73  ASN G O     1 
ATOM 5028  C CB    . ASN G 3 73  ? 234.988 229.048 244.891 1.00 46.14  ? 73  ASN G CB    1 
ATOM 5029  C CG    . ASN G 3 73  ? 235.556 230.313 244.292 1.00 46.14  ? 73  ASN G CG    1 
ATOM 5030  O OD1   . ASN G 3 73  ? 235.428 231.396 244.860 1.00 46.14  ? 73  ASN G OD1   1 
ATOM 5031  N ND2   . ASN G 3 73  ? 236.192 230.184 243.135 1.00 46.14  ? 73  ASN G ND2   1 
ATOM 5032  N N     . LYS G 3 74  ? 231.878 227.360 245.533 1.00 47.44  ? 74  LYS G N     1 
ATOM 5033  C CA    . LYS G 3 74  ? 231.297 226.108 246.016 1.00 47.44  ? 74  LYS G CA    1 
ATOM 5034  C C     . LYS G 3 74  ? 232.137 225.477 247.122 1.00 47.44  ? 74  LYS G C     1 
ATOM 5035  O O     . LYS G 3 74  ? 232.208 224.254 247.238 1.00 47.44  ? 74  LYS G O     1 
ATOM 5036  C CB    . LYS G 3 74  ? 231.080 225.109 244.876 1.00 47.44  ? 74  LYS G CB    1 
ATOM 5037  C CG    . LYS G 3 74  ? 229.877 225.402 243.997 1.00 47.44  ? 74  LYS G CG    1 
ATOM 5038  C CD    . LYS G 3 74  ? 230.124 226.557 243.050 1.00 47.44  ? 74  LYS G CD    1 
ATOM 5039  C CE    . LYS G 3 74  ? 228.875 226.889 242.252 1.00 47.44  ? 74  LYS G CE    1 
ATOM 5040  N NZ    . LYS G 3 74  ? 229.080 228.069 241.371 1.00 47.44  ? 74  LYS G NZ    1 
ATOM 5041  N N     . LYS G 3 75  ? 232.773 226.301 247.942 1.00 47.75  ? 75  LYS G N     1 
ATOM 5042  C CA    . LYS G 3 75  ? 233.511 225.837 249.104 1.00 47.75  ? 75  LYS G CA    1 
ATOM 5043  C C     . LYS G 3 75  ? 232.773 226.235 250.373 1.00 47.75  ? 75  LYS G C     1 
ATOM 5044  O O     . LYS G 3 75  ? 232.118 227.276 250.427 1.00 47.75  ? 75  LYS G O     1 
ATOM 5045  C CB    . LYS G 3 75  ? 234.919 226.425 249.125 1.00 47.75  ? 75  LYS G CB    1 
ATOM 5046  C CG    . LYS G 3 75  ? 235.710 226.187 247.866 1.00 47.75  ? 75  LYS G CG    1 
ATOM 5047  C CD    . LYS G 3 75  ? 236.018 224.721 247.675 1.00 47.75  ? 75  LYS G CD    1 
ATOM 5048  C CE    . LYS G 3 75  ? 236.656 224.484 246.328 1.00 47.75  ? 75  LYS G CE    1 
ATOM 5049  N NZ    . LYS G 3 75  ? 236.847 223.035 246.058 1.00 47.75  ? 75  LYS G NZ    1 
ATOM 5050  N N     . THR G 3 76  ? 232.881 225.399 251.398 1.00 48.95  ? 76  THR G N     1 
ATOM 5051  C CA    . THR G 3 76  ? 232.277 225.689 252.689 1.00 48.95  ? 76  THR G CA    1 
ATOM 5052  C C     . THR G 3 76  ? 233.294 226.173 253.707 1.00 48.95  ? 76  THR G C     1 
ATOM 5053  O O     . THR G 3 76  ? 233.015 226.147 254.906 1.00 48.95  ? 76  THR G O     1 
ATOM 5054  C CB    . THR G 3 76  ? 231.555 224.457 253.234 1.00 48.95  ? 76  THR G CB    1 
ATOM 5055  O OG1   . THR G 3 76  ? 232.463 223.677 254.017 1.00 48.95  ? 76  THR G OG1   1 
ATOM 5056  C CG2   . THR G 3 76  ? 231.040 223.605 252.097 1.00 48.95  ? 76  THR G CG2   1 
ATOM 5057  N N     . ARG G 3 77  ? 234.463 226.607 253.261 1.00 45.24  ? 77  ARG G N     1 
ATOM 5058  C CA    . ARG G 3 77  ? 235.555 226.937 254.158 1.00 45.24  ? 77  ARG G CA    1 
ATOM 5059  C C     . ARG G 3 77  ? 236.377 228.055 253.542 1.00 45.24  ? 77  ARG G C     1 
ATOM 5060  O O     . ARG G 3 77  ? 236.875 227.916 252.424 1.00 45.24  ? 77  ARG G O     1 
ATOM 5061  C CB    . ARG G 3 77  ? 236.415 225.704 254.414 1.00 45.24  ? 77  ARG G CB    1 
ATOM 5062  C CG    . ARG G 3 77  ? 237.476 225.865 255.460 1.00 45.24  ? 77  ARG G CG    1 
ATOM 5063  C CD    . ARG G 3 77  ? 238.237 224.572 255.616 1.00 45.24  ? 77  ARG G CD    1 
ATOM 5064  N NE    . ARG G 3 77  ? 237.386 223.507 256.131 1.00 45.24  ? 77  ARG G NE    1 
ATOM 5065  C CZ    . ARG G 3 77  ? 237.679 222.216 256.047 1.00 45.24  ? 77  ARG G CZ    1 
ATOM 5066  N NH1   . ARG G 3 77  ? 238.797 221.826 255.459 1.00 45.24  ? 77  ARG G NH1   1 
ATOM 5067  N NH2   . ARG G 3 77  ? 236.853 221.317 256.551 1.00 45.24  ? 77  ARG G NH2   1 
ATOM 5068  N N     . ILE G 3 78  ? 236.503 229.160 254.271 1.00 38.86  ? 78  ILE G N     1 
ATOM 5069  C CA    . ILE G 3 78  ? 237.226 230.324 253.780 1.00 38.86  ? 78  ILE G CA    1 
ATOM 5070  C C     . ILE G 3 78  ? 238.715 230.020 253.722 1.00 38.86  ? 78  ILE G C     1 
ATOM 5071  O O     . ILE G 3 78  ? 239.294 229.481 254.671 1.00 38.86  ? 78  ILE G O     1 
ATOM 5072  C CB    . ILE G 3 78  ? 236.939 231.537 254.675 1.00 38.86  ? 78  ILE G CB    1 
ATOM 5073  C CG1   . ILE G 3 78  ? 235.489 231.980 254.518 1.00 38.86  ? 78  ILE G CG1   1 
ATOM 5074  C CG2   . ILE G 3 78  ? 237.887 232.676 254.376 1.00 38.86  ? 78  ILE G CG2   1 
ATOM 5075  C CD1   . ILE G 3 78  ? 235.104 233.070 255.460 1.00 38.86  ? 78  ILE G CD1   1 
ATOM 5076  N N     . ILE G 3 79  ? 239.345 230.379 252.610 1.00 36.61  ? 79  ILE G N     1 
ATOM 5077  C CA    . ILE G 3 79  ? 240.789 230.253 252.458 1.00 36.61  ? 79  ILE G CA    1 
ATOM 5078  C C     . ILE G 3 79  ? 241.375 231.628 252.149 1.00 36.61  ? 79  ILE G C     1 
ATOM 5079  O O     . ILE G 3 79  ? 240.620 232.590 251.927 1.00 36.61  ? 79  ILE G O     1 
ATOM 5080  C CB    . ILE G 3 79  ? 241.142 229.221 251.374 1.00 36.61  ? 79  ILE G CB    1 
ATOM 5081  C CG1   . ILE G 3 79  ? 240.620 229.668 250.017 1.00 36.61  ? 79  ILE G CG1   1 
ATOM 5082  C CG2   . ILE G 3 79  ? 240.619 227.859 251.745 1.00 36.61  ? 79  ILE G CG2   1 
ATOM 5083  C CD1   . ILE G 3 79  ? 240.990 228.741 248.918 1.00 36.61  ? 79  ILE G CD1   1 
ATOM 5084  N N     . PRO G 3 80  ? 242.703 231.779 252.148 1.00 35.26  ? 80  PRO G N     1 
ATOM 5085  C CA    . PRO G 3 80  ? 243.291 233.074 251.781 1.00 35.26  ? 80  PRO G CA    1 
ATOM 5086  C C     . PRO G 3 80  ? 242.851 233.592 250.432 1.00 35.26  ? 80  PRO G C     1 
ATOM 5087  O O     . PRO G 3 80  ? 242.749 234.806 250.255 1.00 35.26  ? 80  PRO G O     1 
ATOM 5088  C CB    . PRO G 3 80  ? 244.791 232.777 251.798 1.00 35.26  ? 80  PRO G CB    1 
ATOM 5089  C CG    . PRO G 3 80  ? 244.931 231.704 252.765 1.00 35.26  ? 80  PRO G CG    1 
ATOM 5090  C CD    . PRO G 3 80  ? 243.738 230.841 252.610 1.00 35.26  ? 80  PRO G CD    1 
ATOM 5091  N N     . ARG G 3 81  ? 242.610 232.714 249.464 1.00 35.90  ? 81  ARG G N     1 
ATOM 5092  C CA    . ARG G 3 81  ? 242.094 233.162 248.179 1.00 35.90  ? 81  ARG G CA    1 
ATOM 5093  C C     . ARG G 3 81  ? 240.779 233.906 248.345 1.00 35.90  ? 81  ARG G C     1 
ATOM 5094  O O     . ARG G 3 81  ? 240.573 234.959 247.737 1.00 35.90  ? 81  ARG G O     1 
ATOM 5095  C CB    . ARG G 3 81  ? 241.924 231.966 247.250 1.00 35.90  ? 81  ARG G CB    1 
ATOM 5096  C CG    . ARG G 3 81  ? 241.270 232.285 245.940 1.00 35.90  ? 81  ARG G CG    1 
ATOM 5097  C CD    . ARG G 3 81  ? 242.070 233.296 245.180 1.00 35.90  ? 81  ARG G CD    1 
ATOM 5098  N NE    . ARG G 3 81  ? 241.639 233.387 243.796 1.00 35.90  ? 81  ARG G NE    1 
ATOM 5099  C CZ    . ARG G 3 81  ? 242.136 234.247 242.920 1.00 35.90  ? 81  ARG G CZ    1 
ATOM 5100  N NH1   . ARG G 3 81  ? 243.082 235.091 243.287 1.00 35.90  ? 81  ARG G NH1   1 
ATOM 5101  N NH2   . ARG G 3 81  ? 241.680 234.264 241.680 1.00 35.90  ? 81  ARG G NH2   1 
ATOM 5102  N N     . HIS G 3 82  ? 239.880 233.378 249.175 1.00 37.34  ? 82  HIS G N     1 
ATOM 5103  C CA    . HIS G 3 82  ? 238.598 234.036 249.391 1.00 37.34  ? 82  HIS G CA    1 
ATOM 5104  C C     . HIS G 3 82  ? 238.772 235.338 250.151 1.00 37.34  ? 82  HIS G C     1 
ATOM 5105  O O     . HIS G 3 82  ? 238.087 236.324 249.865 1.00 37.34  ? 82  HIS G O     1 
ATOM 5106  C CB    . HIS G 3 82  ? 237.652 233.097 250.130 1.00 37.34  ? 82  HIS G CB    1 
ATOM 5107  C CG    . HIS G 3 82  ? 237.506 231.767 249.469 1.00 37.34  ? 82  HIS G CG    1 
ATOM 5108  N ND1   . HIS G 3 82  ? 237.440 230.589 250.174 1.00 37.34  ? 82  HIS G ND1   1 
ATOM 5109  C CD2   . HIS G 3 82  ? 237.440 231.428 248.163 1.00 37.34  ? 82  HIS G CD2   1 
ATOM 5110  C CE1   . HIS G 3 82  ? 237.330 229.581 249.332 1.00 37.34  ? 82  HIS G CE1   1 
ATOM 5111  N NE2   . HIS G 3 82  ? 237.328 230.063 248.104 1.00 37.34  ? 82  HIS G NE2   1 
ATOM 5112  N N     . LEU G 3 83  ? 239.701 235.374 251.104 1.00 35.77  ? 83  LEU G N     1 
ATOM 5113  C CA    . LEU G 3 83  ? 240.002 236.642 251.762 1.00 35.77  ? 83  LEU G CA    1 
ATOM 5114  C C     . LEU G 3 83  ? 240.498 237.684 250.763 1.00 35.77  ? 83  LEU G C     1 
ATOM 5115  O O     . LEU G 3 83  ? 240.072 238.843 250.799 1.00 35.77  ? 83  LEU G O     1 
ATOM 5116  C CB    . LEU G 3 83  ? 241.028 236.426 252.868 1.00 35.77  ? 83  LEU G CB    1 
ATOM 5117  C CG    . LEU G 3 83  ? 240.520 235.623 254.057 1.00 35.77  ? 83  LEU G CG    1 
ATOM 5118  C CD1   . LEU G 3 83  ? 241.627 235.347 255.040 1.00 35.77  ? 83  LEU G CD1   1 
ATOM 5119  C CD2   . LEU G 3 83  ? 239.405 236.380 254.715 1.00 35.77  ? 83  LEU G CD2   1 
ATOM 5120  N N     . GLN G 3 84  ? 241.386 237.286 249.856 1.00 36.84  ? 84  GLN G N     1 
ATOM 5121  C CA    . GLN G 3 84  ? 241.918 238.214 248.864 1.00 36.84  ? 84  GLN G CA    1 
ATOM 5122  C C     . GLN G 3 84  ? 240.833 238.685 247.907 1.00 36.84  ? 84  GLN G C     1 
ATOM 5123  O O     . GLN G 3 84  ? 240.763 239.872 247.579 1.00 36.84  ? 84  GLN G O     1 
ATOM 5124  C CB    . GLN G 3 84  ? 243.060 237.553 248.096 1.00 36.84  ? 84  GLN G CB    1 
ATOM 5125  C CG    . GLN G 3 84  ? 243.577 238.336 246.907 1.00 36.84  ? 84  GLN G CG    1 
ATOM 5126  C CD    . GLN G 3 84  ? 244.698 239.280 247.256 1.00 36.84  ? 84  GLN G CD    1 
ATOM 5127  O OE1   . GLN G 3 84  ? 244.799 239.752 248.380 1.00 36.84  ? 84  GLN G OE1   1 
ATOM 5128  N NE2   . GLN G 3 84  ? 245.551 239.560 246.289 1.00 36.84  ? 84  GLN G NE2   1 
ATOM 5129  N N     . LEU G 3 85  ? 239.985 237.773 247.439 1.00 37.18  ? 85  LEU G N     1 
ATOM 5130  C CA    . LEU G 3 85  ? 238.906 238.170 246.545 1.00 37.18  ? 85  LEU G CA    1 
ATOM 5131  C C     . LEU G 3 85  ? 237.934 239.110 247.238 1.00 37.18  ? 85  LEU G C     1 
ATOM 5132  O O     . LEU G 3 85  ? 237.440 240.058 246.624 1.00 37.18  ? 85  LEU G O     1 
ATOM 5133  C CB    . LEU G 3 85  ? 238.175 236.944 246.014 1.00 37.18  ? 85  LEU G CB    1 
ATOM 5134  C CG    . LEU G 3 85  ? 238.947 236.045 245.056 1.00 37.18  ? 85  LEU G CG    1 
ATOM 5135  C CD1   . LEU G 3 85  ? 238.121 234.828 244.726 1.00 37.18  ? 85  LEU G CD1   1 
ATOM 5136  C CD2   . LEU G 3 85  ? 239.329 236.798 243.800 1.00 37.18  ? 85  LEU G CD2   1 
ATOM 5137  N N     . ALA G 3 86  ? 237.646 238.869 248.515 1.00 37.50  ? 86  ALA G N     1 
ATOM 5138  C CA    . ALA G 3 86  ? 236.800 239.793 249.256 1.00 37.50  ? 86  ALA G CA    1 
ATOM 5139  C C     . ALA G 3 86  ? 237.440 241.168 249.351 1.00 37.50  ? 86  ALA G C     1 
ATOM 5140  O O     . ALA G 3 86  ? 236.785 242.182 249.100 1.00 37.50  ? 86  ALA G O     1 
ATOM 5141  C CB    . ALA G 3 86  ? 236.515 239.245 250.649 1.00 37.50  ? 86  ALA G CB    1 
ATOM 5142  N N     . VAL G 3 87  ? 238.723 241.220 249.704 1.00 37.68  ? 87  VAL G N     1 
ATOM 5143  C CA    . VAL G 3 87  ? 239.373 242.501 249.958 1.00 37.68  ? 87  VAL G CA    1 
ATOM 5144  C C     . VAL G 3 87  ? 239.515 243.304 248.671 1.00 37.68  ? 87  VAL G C     1 
ATOM 5145  O O     . VAL G 3 87  ? 239.150 244.480 248.616 1.00 37.68  ? 87  VAL G O     1 
ATOM 5146  C CB    . VAL G 3 87  ? 240.735 242.282 250.636 1.00 37.68  ? 87  VAL G CB    1 
ATOM 5147  C CG1   . VAL G 3 87  ? 241.539 243.561 250.626 1.00 37.68  ? 87  VAL G CG1   1 
ATOM 5148  C CG2   . VAL G 3 87  ? 240.538 241.791 252.048 1.00 37.68  ? 87  VAL G CG2   1 
ATOM 5149  N N     . ARG G 3 88  ? 240.043 242.688 247.616 1.00 38.04  ? 88  ARG G N     1 
ATOM 5150  C CA    . ARG G 3 88  ? 240.344 243.455 246.415 1.00 38.04  ? 88  ARG G CA    1 
ATOM 5151  C C     . ARG G 3 88  ? 239.103 243.800 245.611 1.00 38.04  ? 88  ARG G C     1 
ATOM 5152  O O     . ARG G 3 88  ? 239.163 244.701 244.772 1.00 38.04  ? 88  ARG G O     1 
ATOM 5153  C CB    . ARG G 3 88  ? 241.333 242.704 245.532 1.00 38.04  ? 88  ARG G CB    1 
ATOM 5154  C CG    . ARG G 3 88  ? 242.617 242.326 246.223 1.00 38.04  ? 88  ARG G CG    1 
ATOM 5155  C CD    . ARG G 3 88  ? 243.217 243.487 246.976 1.00 38.04  ? 88  ARG G CD    1 
ATOM 5156  N NE    . ARG G 3 88  ? 244.232 243.030 247.914 1.00 38.04  ? 88  ARG G NE    1 
ATOM 5157  C CZ    . ARG G 3 88  ? 244.860 243.812 248.780 1.00 38.04  ? 88  ARG G CZ    1 
ATOM 5158  N NH1   . ARG G 3 88  ? 244.585 245.103 248.837 1.00 38.04  ? 88  ARG G NH1   1 
ATOM 5159  N NH2   . ARG G 3 88  ? 245.769 243.297 249.592 1.00 38.04  ? 88  ARG G NH2   1 
ATOM 5160  N N     . ASN G 3 89  ? 237.986 243.114 245.835 1.00 39.03  ? 89  ASN G N     1 
ATOM 5161  C CA    . ASN G 3 89  ? 236.766 243.448 245.113 1.00 39.03  ? 89  ASN G CA    1 
ATOM 5162  C C     . ASN G 3 89  ? 235.942 244.520 245.810 1.00 39.03  ? 89  ASN G C     1 
ATOM 5163  O O     . ASN G 3 89  ? 235.132 245.177 245.152 1.00 39.03  ? 89  ASN G O     1 
ATOM 5164  C CB    . ASN G 3 89  ? 235.915 242.200 244.903 1.00 39.03  ? 89  ASN G CB    1 
ATOM 5165  C CG    . ASN G 3 89  ? 236.379 241.375 243.732 1.00 39.03  ? 89  ASN G CG    1 
ATOM 5166  O OD1   . ASN G 3 89  ? 236.689 241.906 242.673 1.00 39.03  ? 89  ASN G OD1   1 
ATOM 5167  N ND2   . ASN G 3 89  ? 236.425 240.066 243.912 1.00 39.03  ? 89  ASN G ND2   1 
ATOM 5168  N N     . ASP G 3 90  ? 236.124 244.715 247.110 1.00 41.80  ? 90  ASP G N     1 
ATOM 5169  C CA    . ASP G 3 90  ? 235.431 245.766 247.842 1.00 41.80  ? 90  ASP G CA    1 
ATOM 5170  C C     . ASP G 3 90  ? 236.294 247.019 247.845 1.00 41.80  ? 90  ASP G C     1 
ATOM 5171  O O     . ASP G 3 90  ? 237.464 246.965 248.224 1.00 41.80  ? 90  ASP G O     1 
ATOM 5172  C CB    . ASP G 3 90  ? 235.132 245.316 249.268 1.00 41.80  ? 90  ASP G CB    1 
ATOM 5173  C CG    . ASP G 3 90  ? 234.260 246.296 250.017 1.00 41.80  ? 90  ASP G CG    1 
ATOM 5174  O OD1   . ASP G 3 90  ? 233.026 246.263 249.833 1.00 41.80  ? 90  ASP G OD1   1 
ATOM 5175  O OD2   . ASP G 3 90  ? 234.810 247.105 250.788 1.00 41.80  ? 90  ASP G OD2   1 
ATOM 5176  N N     . GLU G 3 91  ? 235.718 248.142 247.418 1.00 43.12  ? 91  GLU G N     1 
ATOM 5177  C CA    . GLU G 3 91  ? 236.512 249.344 247.184 1.00 43.12  ? 91  GLU G CA    1 
ATOM 5178  C C     . GLU G 3 91  ? 237.140 249.865 248.472 1.00 43.12  ? 91  GLU G C     1 
ATOM 5179  O O     . GLU G 3 91  ? 238.340 250.160 248.517 1.00 43.12  ? 91  GLU G O     1 
ATOM 5180  C CB    . GLU G 3 91  ? 235.650 250.424 246.539 1.00 43.12  ? 91  GLU G CB    1 
ATOM 5181  C CG    . GLU G 3 91  ? 236.384 251.731 246.341 1.00 43.12  ? 91  GLU G CG    1 
ATOM 5182  C CD    . GLU G 3 91  ? 235.457 252.879 246.020 1.00 43.12  ? 91  GLU G CD    1 
ATOM 5183  O OE1   . GLU G 3 91  ? 234.238 252.640 245.896 1.00 43.12  ? 91  GLU G OE1   1 
ATOM 5184  O OE2   . GLU G 3 91  ? 235.946 254.022 245.894 1.00 43.12  ? 91  GLU G OE2   1 
ATOM 5185  N N     . GLU G 3 92  ? 236.353 249.961 249.538 1.00 41.66  ? 92  GLU G N     1 
ATOM 5186  C CA    . GLU G 3 92  ? 236.861 250.540 250.774 1.00 41.66  ? 92  GLU G CA    1 
ATOM 5187  C C     . GLU G 3 92  ? 237.776 249.586 251.530 1.00 41.66  ? 92  GLU G C     1 
ATOM 5188  O O     . GLU G 3 92  ? 238.763 250.023 252.127 1.00 41.66  ? 92  GLU G O     1 
ATOM 5189  C CB    . GLU G 3 92  ? 235.698 250.984 251.649 1.00 41.66  ? 92  GLU G CB    1 
ATOM 5190  C CG    . GLU G 3 92  ? 235.139 252.307 251.211 1.00 41.66  ? 92  GLU G CG    1 
ATOM 5191  C CD    . GLU G 3 92  ? 233.823 252.623 251.863 1.00 41.66  ? 92  GLU G CD    1 
ATOM 5192  O OE1   . GLU G 3 92  ? 233.125 251.677 252.280 1.00 41.66  ? 92  GLU G OE1   1 
ATOM 5193  O OE2   . GLU G 3 92  ? 233.486 253.821 251.956 1.00 41.66  ? 92  GLU G OE2   1 
ATOM 5194  N N     . LEU G 3 93  ? 237.470 248.289 251.531 1.00 39.99  ? 93  LEU G N     1 
ATOM 5195  C CA    . LEU G 3 93  ? 238.401 247.333 252.120 1.00 39.99  ? 93  LEU G CA    1 
ATOM 5196  C C     . LEU G 3 93  ? 239.705 247.297 251.343 1.00 39.99  ? 93  LEU G C     1 
ATOM 5197  O O     . LEU G 3 93  ? 240.778 247.118 251.925 1.00 39.99  ? 93  LEU G O     1 
ATOM 5198  C CB    . LEU G 3 93  ? 237.782 245.942 252.173 1.00 39.99  ? 93  LEU G CB    1 
ATOM 5199  C CG    . LEU G 3 93  ? 236.803 245.646 253.298 1.00 39.99  ? 93  LEU G CG    1 
ATOM 5200  C CD1   . LEU G 3 93  ? 236.371 244.207 253.203 1.00 39.99  ? 93  LEU G CD1   1 
ATOM 5201  C CD2   . LEU G 3 93  ? 237.441 245.920 254.632 1.00 39.99  ? 93  LEU G CD2   1 
ATOM 5202  N N     . ASN G 3 94  ? 239.632 247.460 250.025 1.00 40.13  ? 94  ASN G N     1 
ATOM 5203  C CA    . ASN G 3 94  ? 240.839 247.471 249.214 1.00 40.13  ? 94  ASN G CA    1 
ATOM 5204  C C     . ASN G 3 94  ? 241.630 248.750 249.418 1.00 40.13  ? 94  ASN G C     1 
ATOM 5205  O O     . ASN G 3 94  ? 242.847 248.762 249.222 1.00 40.13  ? 94  ASN G O     1 
ATOM 5206  C CB    . ASN G 3 94  ? 240.479 247.284 247.744 1.00 40.13  ? 94  ASN G CB    1 
ATOM 5207  C CG    . ASN G 3 94  ? 241.672 247.392 246.841 1.00 40.13  ? 94  ASN G CG    1 
ATOM 5208  O OD1   . ASN G 3 94  ? 242.626 246.635 246.964 1.00 40.13  ? 94  ASN G OD1   1 
ATOM 5209  N ND2   . ASN G 3 94  ? 241.625 248.333 245.918 1.00 40.13  ? 94  ASN G ND2   1 
ATOM 5210  N N     . LYS G 3 95  ? 240.962 249.833 249.802 1.00 40.01  ? 95  LYS G N     1 
ATOM 5211  C CA    . LYS G 3 95  ? 241.699 251.032 250.179 1.00 40.01  ? 95  LYS G CA    1 
ATOM 5212  C C     . LYS G 3 95  ? 242.340 250.871 251.551 1.00 40.01  ? 95  LYS G C     1 
ATOM 5213  O O     . LYS G 3 95  ? 243.475 251.305 251.768 1.00 40.01  ? 95  LYS G O     1 
ATOM 5214  C CB    . LYS G 3 95  ? 240.782 252.245 250.160 1.00 40.01  ? 95  LYS G CB    1 
ATOM 5215  C CG    . LYS G 3 95  ? 241.529 253.551 250.239 1.00 40.01  ? 95  LYS G CG    1 
ATOM 5216  C CD    . LYS G 3 95  ? 240.572 254.718 250.298 1.00 40.01  ? 95  LYS G CD    1 
ATOM 5217  C CE    . LYS G 3 95  ? 239.560 254.661 249.169 1.00 40.01  ? 95  LYS G CE    1 
ATOM 5218  N NZ    . LYS G 3 95  ? 238.485 255.673 249.362 1.00 40.01  ? 95  LYS G NZ    1 
ATOM 5219  N N     . LEU G 3 96  ? 241.629 250.243 252.486 1.00 37.68  ? 96  LEU G N     1 
ATOM 5220  C CA    . LEU G 3 96  ? 242.182 250.017 253.815 1.00 37.68  ? 96  LEU G CA    1 
ATOM 5221  C C     . LEU G 3 96  ? 243.396 249.100 253.760 1.00 37.68  ? 96  LEU G C     1 
ATOM 5222  O O     . LEU G 3 96  ? 244.416 249.368 254.400 1.00 37.68  ? 96  LEU G O     1 
ATOM 5223  C CB    . LEU G 3 96  ? 241.114 249.423 254.730 1.00 37.68  ? 96  LEU G CB    1 
ATOM 5224  C CG    . LEU G 3 96  ? 241.582 249.134 256.153 1.00 37.68  ? 96  LEU G CG    1 
ATOM 5225  C CD1   . LEU G 3 96  ? 241.887 250.431 256.854 1.00 37.68  ? 96  LEU G CD1   1 
ATOM 5226  C CD2   . LEU G 3 96  ? 240.546 248.345 256.912 1.00 37.68  ? 96  LEU G CD2   1 
ATOM 5227  N N     . LEU G 3 97  ? 243.304 248.013 253.000 1.00 36.85  ? 97  LEU G N     1 
ATOM 5228  C CA    . LEU G 3 97  ? 244.376 247.037 252.879 1.00 36.85  ? 97  LEU G CA    1 
ATOM 5229  C C     . LEU G 3 97  ? 245.188 247.234 251.608 1.00 36.85  ? 97  LEU G C     1 
ATOM 5230  O O     . LEU G 3 97  ? 245.632 246.262 250.996 1.00 36.85  ? 97  LEU G O     1 
ATOM 5231  C CB    . LEU G 3 97  ? 243.801 245.625 252.942 1.00 36.85  ? 97  LEU G CB    1 
ATOM 5232  C CG    . LEU G 3 97  ? 243.012 245.325 254.215 1.00 36.85  ? 97  LEU G CG    1 
ATOM 5233  C CD1   . LEU G 3 97  ? 242.655 243.864 254.287 1.00 36.85  ? 97  LEU G CD1   1 
ATOM 5234  C CD2   . LEU G 3 97  ? 243.800 245.741 255.437 1.00 36.85  ? 97  LEU G CD2   1 
ATOM 5235  N N     . GLY G 3 98  ? 245.399 248.488 251.208 1.00 38.07  ? 98  GLY G N     1 
ATOM 5236  C CA    . GLY G 3 98  ? 246.046 248.760 249.939 1.00 38.07  ? 98  GLY G CA    1 
ATOM 5237  C C     . GLY G 3 98  ? 247.517 248.410 249.906 1.00 38.07  ? 98  GLY G C     1 
ATOM 5238  O O     . GLY G 3 98  ? 248.040 248.032 248.857 1.00 38.07  ? 98  GLY G O     1 
ATOM 5239  N N     . ARG G 3 99  ? 248.206 248.530 251.036 1.00 38.02  ? 99  ARG G N     1 
ATOM 5240  C CA    . ARG G 3 99  ? 249.632 248.246 251.106 1.00 38.02  ? 99  ARG G CA    1 
ATOM 5241  C C     . ARG G 3 99  ? 249.923 246.919 251.786 1.00 38.02  ? 99  ARG G C     1 
ATOM 5242  O O     . ARG G 3 99  ? 250.990 246.752 252.378 1.00 38.02  ? 99  ARG G O     1 
ATOM 5243  C CB    . ARG G 3 99  ? 250.360 249.375 251.831 1.00 38.02  ? 99  ARG G CB    1 
ATOM 5244  C CG    . ARG G 3 99  ? 250.137 250.729 251.217 1.00 38.02  ? 99  ARG G CG    1 
ATOM 5245  C CD    . ARG G 3 99  ? 250.699 250.803 249.813 1.00 38.02  ? 99  ARG G CD    1 
ATOM 5246  N NE    . ARG G 3 99  ? 250.160 251.946 249.085 1.00 38.02  ? 99  ARG G NE    1 
ATOM 5247  C CZ    . ARG G 3 99  ? 250.646 252.405 247.937 1.00 38.02  ? 99  ARG G CZ    1 
ATOM 5248  N NH1   . ARG G 3 99  ? 251.696 251.823 247.373 1.00 38.02  ? 99  ARG G NH1   1 
ATOM 5249  N NH2   . ARG G 3 99  ? 250.081 253.454 247.353 1.00 38.02  ? 99  ARG G NH2   1 
ATOM 5250  N N     . VAL G 3 100 ? 248.995 245.975 251.718 1.00 34.50  ? 100 VAL G N     1 
ATOM 5251  C CA    . VAL G 3 100 ? 249.087 244.714 252.437 1.00 34.50  ? 100 VAL G CA    1 
ATOM 5252  C C     . VAL G 3 100 ? 249.100 243.579 251.428 1.00 34.50  ? 100 VAL G C     1 
ATOM 5253  O O     . VAL G 3 100 ? 248.347 243.602 250.450 1.00 34.50  ? 100 VAL G O     1 
ATOM 5254  C CB    . VAL G 3 100 ? 247.926 244.553 253.430 1.00 34.50  ? 100 VAL G CB    1 
ATOM 5255  C CG1   . VAL G 3 100 ? 248.019 243.231 254.143 1.00 34.50  ? 100 VAL G CG1   1 
ATOM 5256  C CG2   . VAL G 3 100 ? 247.935 245.681 254.426 1.00 34.50  ? 100 VAL G CG2   1 
ATOM 5257  N N     . THR G 3 101 ? 249.960 242.596 251.663 1.00 33.99  ? 101 THR G N     1 
ATOM 5258  C CA    . THR G 3 101 ? 249.991 241.367 250.889 1.00 33.99  ? 101 THR G CA    1 
ATOM 5259  C C     . THR G 3 101 ? 249.358 240.246 251.698 1.00 33.99  ? 101 THR G C     1 
ATOM 5260  O O     . THR G 3 101 ? 249.773 239.981 252.828 1.00 33.99  ? 101 THR G O     1 
ATOM 5261  C CB    . THR G 3 101 ? 251.422 240.986 250.515 1.00 33.99  ? 101 THR G CB    1 
ATOM 5262  O OG1   . THR G 3 101 ? 251.988 242.000 249.681 1.00 33.99  ? 101 THR G OG1   1 
ATOM 5263  C CG2   . THR G 3 101 ? 251.445 239.663 249.785 1.00 33.99  ? 101 THR G CG2   1 
ATOM 5264  N N     . ILE G 3 102 ? 248.370 239.585 251.117 1.00 34.40  ? 102 ILE G N     1 
ATOM 5265  C CA    . ILE G 3 102 ? 247.742 238.424 251.724 1.00 34.40  ? 102 ILE G CA    1 
ATOM 5266  C C     . ILE G 3 102 ? 248.409 237.183 251.152 1.00 34.40  ? 102 ILE G C     1 
ATOM 5267  O O     . ILE G 3 102 ? 248.315 236.921 249.949 1.00 34.40  ? 102 ILE G O     1 
ATOM 5268  C CB    . ILE G 3 102 ? 246.228 238.415 251.472 1.00 34.40  ? 102 ILE G CB    1 
ATOM 5269  C CG1   . ILE G 3 102 ? 245.557 239.529 252.272 1.00 34.40  ? 102 ILE G CG1   1 
ATOM 5270  C CG2   . ILE G 3 102 ? 245.639 237.080 251.837 1.00 34.40  ? 102 ILE G CG2   1 
ATOM 5271  C CD1   . ILE G 3 102 ? 244.073 239.564 252.118 1.00 34.40  ? 102 ILE G CD1   1 
ATOM 5272  N N     . ALA G 3 103 ? 249.091 236.426 252.008 1.00 35.66  ? 103 ALA G N     1 
ATOM 5273  C CA    . ALA G 3 103 ? 249.778 235.221 251.570 1.00 35.66  ? 103 ALA G CA    1 
ATOM 5274  C C     . ALA G 3 103 ? 248.796 234.255 250.929 1.00 35.66  ? 103 ALA G C     1 
ATOM 5275  O O     . ALA G 3 103 ? 247.665 234.112 251.394 1.00 35.66  ? 103 ALA G O     1 
ATOM 5276  C CB    . ALA G 3 103 ? 250.471 234.551 252.749 1.00 35.66  ? 103 ALA G CB    1 
ATOM 5277  N N     . GLN G 3 104 ? 249.226 233.606 249.847 1.00 37.28  ? 104 GLN G N     1 
ATOM 5278  C CA    . GLN G 3 104 ? 248.419 232.620 249.125 1.00 37.28  ? 104 GLN G CA    1 
ATOM 5279  C C     . GLN G 3 104 ? 247.108 233.207 248.620 1.00 37.28  ? 104 GLN G C     1 
ATOM 5280  O O     . GLN G 3 104 ? 246.134 232.485 248.417 1.00 37.28  ? 104 GLN G O     1 
ATOM 5281  C CB    . GLN G 3 104 ? 248.147 231.386 249.986 1.00 37.28  ? 104 GLN G CB    1 
ATOM 5282  C CG    . GLN G 3 104 ? 249.345 230.487 250.162 1.00 37.28  ? 104 GLN G CG    1 
ATOM 5283  C CD    . GLN G 3 104 ? 249.849 229.929 248.845 1.00 37.28  ? 104 GLN G CD    1 
ATOM 5284  O OE1   . GLN G 3 104 ? 250.908 230.323 248.356 1.00 37.28  ? 104 GLN G OE1   1 
ATOM 5285  N NE2   . GLN G 3 104 ? 249.093 229.006 248.263 1.00 37.28  ? 104 GLN G NE2   1 
ATOM 5286  N N     . GLY G 3 105 ? 247.075 234.511 248.389 1.00 36.63  ? 105 GLY G N     1 
ATOM 5287  C CA    . GLY G 3 105 ? 245.857 235.156 247.956 1.00 36.63  ? 105 GLY G CA    1 
ATOM 5288  C C     . GLY G 3 105 ? 245.739 235.254 246.454 1.00 36.63  ? 105 GLY G C     1 
ATOM 5289  O O     . GLY G 3 105 ? 244.632 235.320 245.920 1.00 36.63  ? 105 GLY G O     1 
ATOM 5290  N N     . GLY G 3 106 ? 246.870 235.246 245.759 1.00 36.55  ? 106 GLY G N     1 
ATOM 5291  C CA    . GLY G 3 106 ? 246.819 235.409 244.326 1.00 36.55  ? 106 GLY G CA    1 
ATOM 5292  C C     . GLY G 3 106 ? 246.427 236.831 243.971 1.00 36.55  ? 106 GLY G C     1 
ATOM 5293  O O     . GLY G 3 106 ? 246.552 237.757 244.770 1.00 36.55  ? 106 GLY G O     1 
ATOM 5294  N N     . VAL G 3 107 ? 245.927 237.000 242.752 1.00 36.68  ? 107 VAL G N     1 
ATOM 5295  C CA    . VAL G 3 107 ? 245.566 238.306 242.224 1.00 36.68  ? 107 VAL G CA    1 
ATOM 5296  C C     . VAL G 3 107 ? 244.149 238.231 241.680 1.00 36.68  ? 107 VAL G C     1 
ATOM 5297  O O     . VAL G 3 107 ? 243.566 237.157 241.549 1.00 36.68  ? 107 VAL G O     1 
ATOM 5298  C CB    . VAL G 3 107 ? 246.538 238.782 241.125 1.00 36.68  ? 107 VAL G CB    1 
ATOM 5299  C CG1   . VAL G 3 107 ? 247.936 238.921 241.680 1.00 36.68  ? 107 VAL G CG1   1 
ATOM 5300  C CG2   . VAL G 3 107 ? 246.519 237.829 239.951 1.00 36.68  ? 107 VAL G CG2   1 
ATOM 5301  N N     . LEU G 3 108 ? 243.599 239.392 241.369 1.00 38.29  ? 108 LEU G N     1 
ATOM 5302  C CA    . LEU G 3 108 ? 242.320 239.440 240.686 1.00 38.29  ? 108 LEU G CA    1 
ATOM 5303  C C     . LEU G 3 108 ? 242.505 239.107 239.208 1.00 38.29  ? 108 LEU G C     1 
ATOM 5304  O O     . LEU G 3 108 ? 243.459 239.574 238.581 1.00 38.29  ? 108 LEU G O     1 
ATOM 5305  C CB    . LEU G 3 108 ? 241.692 240.820 240.831 1.00 38.29  ? 108 LEU G CB    1 
ATOM 5306  C CG    . LEU G 3 108 ? 240.429 240.904 241.680 1.00 38.29  ? 108 LEU G CG    1 
ATOM 5307  C CD1   . LEU G 3 108 ? 240.620 240.180 242.990 1.00 38.29  ? 108 LEU G CD1   1 
ATOM 5308  C CD2   . LEU G 3 108 ? 240.077 242.348 241.920 1.00 38.29  ? 108 LEU G CD2   1 
ATOM 5309  N N     . PRO G 3 109 ? 241.626 238.293 238.630 1.00 39.34  ? 109 PRO G N     1 
ATOM 5310  C CA    . PRO G 3 109 ? 241.679 238.062 237.181 1.00 39.34  ? 109 PRO G CA    1 
ATOM 5311  C C     . PRO G 3 109 ? 241.425 239.355 236.426 1.00 39.34  ? 109 PRO G C     1 
ATOM 5312  O O     . PRO G 3 109 ? 240.349 239.944 236.517 1.00 39.34  ? 109 PRO G O     1 
ATOM 5313  C CB    . PRO G 3 109 ? 240.563 237.041 236.947 1.00 39.34  ? 109 PRO G CB    1 
ATOM 5314  C CG    . PRO G 3 109 ? 240.367 236.390 238.265 1.00 39.34  ? 109 PRO G CG    1 
ATOM 5315  C CD    . PRO G 3 109 ? 240.620 237.445 239.286 1.00 39.34  ? 109 PRO G CD    1 
ATOM 5316  N N     . ASN G 3 110 ? 242.427 239.797 235.677 1.00 41.40  ? 110 ASN G N     1 
ATOM 5317  C CA    . ASN G 3 110 ? 242.350 241.096 235.021 1.00 41.40  ? 110 ASN G CA    1 
ATOM 5318  C C     . ASN G 3 110 ? 243.257 241.085 233.802 1.00 41.40  ? 110 ASN G C     1 
ATOM 5319  O O     . ASN G 3 110 ? 244.479 241.157 233.937 1.00 41.40  ? 110 ASN G O     1 
ATOM 5320  C CB    . ASN G 3 110 ? 242.740 242.211 235.983 1.00 41.40  ? 110 ASN G CB    1 
ATOM 5321  C CG    . ASN G 3 110 ? 242.753 243.564 235.321 1.00 41.40  ? 110 ASN G CG    1 
ATOM 5322  O OD1   . ASN G 3 110 ? 243.808 244.078 234.957 1.00 41.40  ? 110 ASN G OD1   1 
ATOM 5323  N ND2   . ASN G 3 110 ? 241.577 244.150 235.152 1.00 41.40  ? 110 ASN G ND2   1 
ATOM 5324  N N     . ILE G 3 111 ? 242.659 241.008 232.621 1.00 40.66  ? 111 ILE G N     1 
ATOM 5325  C CA    . ILE G 3 111 ? 243.375 241.103 231.357 1.00 40.66  ? 111 ILE G CA    1 
ATOM 5326  C C     . ILE G 3 111 ? 243.020 242.435 230.719 1.00 40.66  ? 111 ILE G C     1 
ATOM 5327  O O     . ILE G 3 111 ? 241.838 242.748 230.546 1.00 40.66  ? 111 ILE G O     1 
ATOM 5328  C CB    . ILE G 3 111 ? 243.021 239.937 230.422 1.00 40.66  ? 111 ILE G CB    1 
ATOM 5329  C CG1   . ILE G 3 111 ? 243.248 238.605 231.126 1.00 40.66  ? 111 ILE G CG1   1 
ATOM 5330  C CG2   . ILE G 3 111 ? 243.845 240.003 229.164 1.00 40.66  ? 111 ILE G CG2   1 
ATOM 5331  C CD1   . ILE G 3 111 ? 242.750 237.422 230.348 1.00 40.66  ? 111 ILE G CD1   1 
ATOM 5332  N N     . GLN G 3 112 ? 244.036 243.217 230.375 1.00 42.52  ? 112 GLN G N     1 
ATOM 5333  C CA    . GLN G 3 112 ? 243.800 244.479 229.693 1.00 42.52  ? 112 GLN G CA    1 
ATOM 5334  C C     . GLN G 3 112 ? 243.114 244.228 228.359 1.00 42.52  ? 112 GLN G C     1 
ATOM 5335  O O     . GLN G 3 112 ? 243.437 243.276 227.648 1.00 42.52  ? 112 GLN G O     1 
ATOM 5336  C CB    . GLN G 3 112 ? 245.115 245.219 229.483 1.00 42.52  ? 112 GLN G CB    1 
ATOM 5337  C CG    . GLN G 3 112 ? 245.847 245.538 230.762 1.00 42.52  ? 112 GLN G CG    1 
ATOM 5338  C CD    . GLN G 3 112 ? 245.075 246.482 231.644 1.00 42.52  ? 112 GLN G CD    1 
ATOM 5339  O OE1   . GLN G 3 112 ? 244.670 247.555 231.212 1.00 42.52  ? 112 GLN G OE1   1 
ATOM 5340  N NE2   . GLN G 3 112 ? 244.860 246.085 232.889 1.00 42.52  ? 112 GLN G NE2   1 
ATOM 5341  N N     . SER G 3 113 ? 242.154 245.090 228.023 1.00 43.91  ? 113 SER G N     1 
ATOM 5342  C CA    . SER G 3 113 ? 241.297 244.830 226.873 1.00 43.91  ? 113 SER G CA    1 
ATOM 5343  C C     . SER G 3 113 ? 242.069 244.860 225.563 1.00 43.91  ? 113 SER G C     1 
ATOM 5344  O O     . SER G 3 113 ? 241.680 244.186 224.605 1.00 43.91  ? 113 SER G O     1 
ATOM 5345  C CB    . SER G 3 113 ? 240.151 245.837 226.832 1.00 43.91  ? 113 SER G CB    1 
ATOM 5346  O OG    . SER G 3 113 ? 240.621 247.138 226.541 1.00 43.91  ? 113 SER G OG    1 
ATOM 5347  N N     . VAL G 3 114 ? 243.163 245.618 225.496 1.00 42.86  ? 114 VAL G N     1 
ATOM 5348  C CA    . VAL G 3 114 ? 243.937 245.672 224.265 1.00 42.86  ? 114 VAL G CA    1 
ATOM 5349  C C     . VAL G 3 114 ? 244.662 244.359 224.001 1.00 42.86  ? 114 VAL G C     1 
ATOM 5350  O O     . VAL G 3 114 ? 245.011 244.065 222.854 1.00 42.86  ? 114 VAL G O     1 
ATOM 5351  C CB    . VAL G 3 114 ? 244.916 246.858 224.313 1.00 42.86  ? 114 VAL G CB    1 
ATOM 5352  C CG1   . VAL G 3 114 ? 245.943 246.658 225.407 1.00 42.86  ? 114 VAL G CG1   1 
ATOM 5353  C CG2   . VAL G 3 114 ? 245.589 247.052 222.975 1.00 42.86  ? 114 VAL G CG2   1 
ATOM 5354  N N     . LEU G 3 115 ? 244.860 243.536 225.022 1.00 41.29  ? 115 LEU G N     1 
ATOM 5355  C CA    . LEU G 3 115 ? 245.531 242.259 224.849 1.00 41.29  ? 115 LEU G CA    1 
ATOM 5356  C C     . LEU G 3 115 ? 244.604 241.160 224.351 1.00 41.29  ? 115 LEU G C     1 
ATOM 5357  O O     . LEU G 3 115 ? 245.091 240.116 223.914 1.00 41.29  ? 115 LEU G O     1 
ATOM 5358  C CB    . LEU G 3 115 ? 246.179 241.824 226.165 1.00 41.29  ? 115 LEU G CB    1 
ATOM 5359  C CG    . LEU G 3 115 ? 247.114 242.856 226.796 1.00 41.29  ? 115 LEU G CG    1 
ATOM 5360  C CD1   . LEU G 3 115 ? 247.833 242.292 227.999 1.00 41.29  ? 115 LEU G CD1   1 
ATOM 5361  C CD2   . LEU G 3 115 ? 248.107 243.369 225.780 1.00 41.29  ? 115 LEU G CD2   1 
ATOM 5362  N N     . LEU G 3 116 ? 243.294 241.368 224.390 1.00 44.70  ? 116 LEU G N     1 
ATOM 5363  C CA    . LEU G 3 116 ? 242.372 240.345 223.934 1.00 44.70  ? 116 LEU G CA    1 
ATOM 5364  C C     . LEU G 3 116 ? 242.404 240.233 222.411 1.00 44.70  ? 116 LEU G C     1 
ATOM 5365  O O     . LEU G 3 116 ? 242.740 241.194 221.718 1.00 44.70  ? 116 LEU G O     1 
ATOM 5366  C CB    . LEU G 3 116 ? 240.957 240.653 224.404 1.00 44.70  ? 116 LEU G CB    1 
ATOM 5367  C CG    . LEU G 3 116 ? 240.794 240.679 225.919 1.00 44.70  ? 116 LEU G CG    1 
ATOM 5368  C CD1   . LEU G 3 116 ? 239.344 240.872 226.301 1.00 44.70  ? 116 LEU G CD1   1 
ATOM 5369  C CD2   . LEU G 3 116 ? 241.345 239.406 226.519 1.00 44.70  ? 116 LEU G CD2   1 
ATOM 5370  N N     . PRO G 3 117 ? 242.070 239.064 221.868 1.00 49.65  ? 117 PRO G N     1 
ATOM 5371  C CA    . PRO G 3 117 ? 242.087 238.899 220.411 1.00 49.65  ? 117 PRO G CA    1 
ATOM 5372  C C     . PRO G 3 117 ? 241.072 239.802 219.734 1.00 49.65  ? 117 PRO G C     1 
ATOM 5373  O O     . PRO G 3 117 ? 239.988 240.058 220.262 1.00 49.65  ? 117 PRO G O     1 
ATOM 5374  C CB    . PRO G 3 117 ? 241.730 237.423 220.218 1.00 49.65  ? 117 PRO G CB    1 
ATOM 5375  C CG    . PRO G 3 117 ? 242.051 236.784 221.509 1.00 49.65  ? 117 PRO G CG    1 
ATOM 5376  C CD    . PRO G 3 117 ? 241.758 237.801 222.554 1.00 49.65  ? 117 PRO G CD    1 
ATOM 5377  N N     . LYS G 3 118 ? 241.436 240.288 218.553 1.00 53.55  ? 118 LYS G N     1 
ATOM 5378  C CA    . LYS G 3 118 ? 240.581 241.205 217.806 1.00 53.55  ? 118 LYS G CA    1 
ATOM 5379  C C     . LYS G 3 118 ? 239.466 240.408 217.145 1.00 53.55  ? 118 LYS G C     1 
ATOM 5380  O O     . LYS G 3 118 ? 239.554 240.041 215.972 1.00 53.55  ? 118 LYS G O     1 
ATOM 5381  C CB    . LYS G 3 118 ? 241.405 241.967 216.776 1.00 53.55  ? 118 LYS G CB    1 
ATOM 5382  C CG    . LYS G 3 118 ? 242.661 242.603 217.354 1.00 53.55  ? 118 LYS G CG    1 
ATOM 5383  C CD    . LYS G 3 118 ? 242.320 243.541 218.503 1.00 53.55  ? 118 LYS G CD    1 
ATOM 5384  C CE    . LYS G 3 118 ? 243.560 243.963 219.268 1.00 53.55  ? 118 LYS G CE    1 
ATOM 5385  N NZ    . LYS G 3 118 ? 243.244 244.925 220.360 1.00 53.55  ? 118 LYS G NZ    1 
ATOM 5386  N N     . LYS G 3 119 ? 238.401 240.153 217.896 1.00 57.17  ? 119 LYS G N     1 
ATOM 5387  C CA    . LYS G 3 119 ? 237.259 239.406 217.390 1.00 57.17  ? 119 LYS G CA    1 
ATOM 5388  C C     . LYS G 3 119 ? 236.190 240.362 216.886 1.00 57.17  ? 119 LYS G C     1 
ATOM 5389  O O     . LYS G 3 119 ? 235.852 241.334 217.562 1.00 57.17  ? 119 LYS G O     1 
ATOM 5390  C CB    . LYS G 3 119 ? 236.685 238.495 218.476 1.00 57.17  ? 119 LYS G CB    1 
ATOM 5391  C CG    . LYS G 3 119 ? 237.671 237.474 219.022 1.00 57.17  ? 119 LYS G CG    1 
ATOM 5392  C CD    . LYS G 3 119 ? 237.053 236.668 220.157 1.00 57.17  ? 119 LYS G CD    1 
ATOM 5393  C CE    . LYS G 3 119 ? 238.077 235.762 220.818 1.00 57.17  ? 119 LYS G CE    1 
ATOM 5394  N NZ    . LYS G 3 119 ? 237.548 235.149 222.065 1.00 57.17  ? 119 LYS G NZ    1 
ATOM 5395  N N     . LYS H 4 25  ? 257.302 216.113 277.740 1.00 66.15  ? 25  LYS H N     1 
ATOM 5396  C CA    . LYS H 4 25  ? 256.053 216.574 278.332 1.00 66.15  ? 25  LYS H CA    1 
ATOM 5397  C C     . LYS H 4 25  ? 256.141 218.041 278.740 1.00 66.15  ? 25  LYS H C     1 
ATOM 5398  O O     . LYS H 4 25  ? 255.624 218.441 279.784 1.00 66.15  ? 25  LYS H O     1 
ATOM 5399  C CB    . LYS H 4 25  ? 255.681 215.707 279.537 1.00 66.15  ? 25  LYS H CB    1 
ATOM 5400  C CG    . LYS H 4 25  ? 255.458 214.245 279.184 1.00 66.15  ? 25  LYS H CG    1 
ATOM 5401  C CD    . LYS H 4 25  ? 254.872 213.469 280.353 1.00 66.15  ? 25  LYS H CD    1 
ATOM 5402  C CE    . LYS H 4 25  ? 254.361 212.106 279.906 1.00 66.15  ? 25  LYS H CE    1 
ATOM 5403  N NZ    . LYS H 4 25  ? 253.508 211.467 280.951 1.00 66.15  ? 25  LYS H NZ    1 
ATOM 5404  N N     . ARG H 4 26  ? 256.801 218.836 277.903 1.00 63.16  ? 26  ARG H N     1 
ATOM 5405  C CA    . ARG H 4 26  ? 256.875 220.285 278.084 1.00 63.16  ? 26  ARG H CA    1 
ATOM 5406  C C     . ARG H 4 26  ? 255.722 220.921 277.318 1.00 63.16  ? 26  ARG H C     1 
ATOM 5407  O O     . ARG H 4 26  ? 255.707 220.926 276.086 1.00 63.16  ? 26  ARG H O     1 
ATOM 5408  C CB    . ARG H 4 26  ? 258.219 220.820 277.603 1.00 63.16  ? 26  ARG H CB    1 
ATOM 5409  C CG    . ARG H 4 26  ? 258.453 222.285 277.928 1.00 63.16  ? 26  ARG H CG    1 
ATOM 5410  C CD    . ARG H 4 26  ? 258.544 222.494 279.427 1.00 63.16  ? 26  ARG H CD    1 
ATOM 5411  N NE    . ARG H 4 26  ? 257.634 223.532 279.896 1.00 63.16  ? 26  ARG H NE    1 
ATOM 5412  C CZ    . ARG H 4 26  ? 257.257 223.668 281.163 1.00 63.16  ? 26  ARG H CZ    1 
ATOM 5413  N NH1   . ARG H 4 26  ? 256.426 224.640 281.511 1.00 63.16  ? 26  ARG H NH1   1 
ATOM 5414  N NH2   . ARG H 4 26  ? 257.708 222.824 282.082 1.00 63.16  ? 26  ARG H NH2   1 
ATOM 5415  N N     . ARG H 4 27  ? 254.742 221.448 278.049 1.00 59.35  ? 27  ARG H N     1 
ATOM 5416  C CA    . ARG H 4 27  ? 253.602 222.097 277.413 1.00 59.35  ? 27  ARG H CA    1 
ATOM 5417  C C     . ARG H 4 27  ? 254.027 223.418 276.786 1.00 59.35  ? 27  ARG H C     1 
ATOM 5418  O O     . ARG H 4 27  ? 254.689 224.239 277.428 1.00 59.35  ? 27  ARG H O     1 
ATOM 5419  C CB    . ARG H 4 27  ? 252.494 222.325 278.439 1.00 59.35  ? 27  ARG H CB    1 
ATOM 5420  C CG    . ARG H 4 27  ? 251.144 222.668 277.844 1.00 59.35  ? 27  ARG H CG    1 
ATOM 5421  C CD    . ARG H 4 27  ? 250.158 223.044 278.938 1.00 59.35  ? 27  ARG H CD    1 
ATOM 5422  N NE    . ARG H 4 27  ? 248.811 223.270 278.426 1.00 59.35  ? 27  ARG H NE    1 
ATOM 5423  C CZ    . ARG H 4 27  ? 247.894 222.318 278.299 1.00 59.35  ? 27  ARG H CZ    1 
ATOM 5424  N NH1   . ARG H 4 27  ? 248.182 221.072 278.645 1.00 59.35  ? 27  ARG H NH1   1 
ATOM 5425  N NH2   . ARG H 4 27  ? 246.691 222.608 277.827 1.00 59.35  ? 27  ARG H NH2   1 
ATOM 5426  N N     . LYS H 4 28  ? 253.644 223.621 275.526 1.00 57.84  ? 28  LYS H N     1 
ATOM 5427  C CA    . LYS H 4 28  ? 254.013 224.837 274.813 1.00 57.84  ? 28  LYS H CA    1 
ATOM 5428  C C     . LYS H 4 28  ? 253.502 226.069 275.549 1.00 57.84  ? 28  LYS H C     1 
ATOM 5429  O O     . LYS H 4 28  ? 252.513 226.017 276.283 1.00 57.84  ? 28  LYS H O     1 
ATOM 5430  C CB    . LYS H 4 28  ? 253.451 224.813 273.393 1.00 57.84  ? 28  LYS H CB    1 
ATOM 5431  C CG    . LYS H 4 28  ? 253.946 223.662 272.540 1.00 57.84  ? 28  LYS H CG    1 
ATOM 5432  C CD    . LYS H 4 28  ? 253.332 223.717 271.151 1.00 57.84  ? 28  LYS H CD    1 
ATOM 5433  C CE    . LYS H 4 28  ? 253.771 222.540 270.298 1.00 57.84  ? 28  LYS H CE    1 
ATOM 5434  N NZ    . LYS H 4 28  ? 253.358 221.237 270.885 1.00 57.84  ? 28  LYS H NZ    1 
ATOM 5435  N N     . THR H 4 29  ? 254.192 227.187 275.350 1.00 55.49  ? 29  THR H N     1 
ATOM 5436  C CA    . THR H 4 29  ? 253.796 228.423 276.008 1.00 55.49  ? 29  THR H CA    1 
ATOM 5437  C C     . THR H 4 29  ? 252.486 228.945 275.431 1.00 55.49  ? 29  THR H C     1 
ATOM 5438  O O     . THR H 4 29  ? 252.136 228.684 274.277 1.00 55.49  ? 29  THR H O     1 
ATOM 5439  C CB    . THR H 4 29  ? 254.881 229.486 275.867 1.00 55.49  ? 29  THR H CB    1 
ATOM 5440  O OG1   . THR H 4 29  ? 254.538 230.628 276.659 1.00 55.49  ? 29  THR H OG1   1 
ATOM 5441  C CG2   . THR H 4 29  ? 255.019 229.913 274.416 1.00 55.49  ? 29  THR H CG2   1 
ATOM 5442  N N     . ARG H 4 30  ? 251.758 229.687 276.256 1.00 52.40  ? 30  ARG H N     1 
ATOM 5443  C CA    . ARG H 4 30  ? 250.465 230.213 275.849 1.00 52.40  ? 30  ARG H CA    1 
ATOM 5444  C C     . ARG H 4 30  ? 250.644 231.337 274.840 1.00 52.40  ? 30  ARG H C     1 
ATOM 5445  O O     . ARG H 4 30  ? 251.310 232.336 275.119 1.00 52.40  ? 30  ARG H O     1 
ATOM 5446  C CB    . ARG H 4 30  ? 249.703 230.708 277.072 1.00 52.40  ? 30  ARG H CB    1 
ATOM 5447  C CG    . ARG H 4 30  ? 248.558 231.644 276.771 1.00 52.40  ? 30  ARG H CG    1 
ATOM 5448  C CD    . ARG H 4 30  ? 247.749 231.973 278.023 1.00 52.40  ? 30  ARG H CD    1 
ATOM 5449  N NE    . ARG H 4 30  ? 246.979 230.826 278.496 1.00 52.40  ? 30  ARG H NE    1 
ATOM 5450  C CZ    . ARG H 4 30  ? 247.407 229.956 279.405 1.00 52.40  ? 30  ARG H CZ    1 
ATOM 5451  N NH1   . ARG H 4 30  ? 248.604 230.102 279.949 1.00 52.40  ? 30  ARG H NH1   1 
ATOM 5452  N NH2   . ARG H 4 30  ? 246.640 228.942 279.773 1.00 52.40  ? 30  ARG H NH2   1 
ATOM 5453  N N     . LYS H 4 31  ? 250.043 231.175 273.666 1.00 50.24  ? 31  LYS H N     1 
ATOM 5454  C CA    . LYS H 4 31  ? 250.070 232.192 272.620 1.00 50.24  ? 31  LYS H CA    1 
ATOM 5455  C C     . LYS H 4 31  ? 248.654 232.707 272.418 1.00 50.24  ? 31  LYS H C     1 
ATOM 5456  O O     . LYS H 4 31  ? 247.769 231.950 272.012 1.00 50.24  ? 31  LYS H O     1 
ATOM 5457  C CB    . LYS H 4 31  ? 250.629 231.632 271.314 1.00 50.24  ? 31  LYS H CB    1 
ATOM 5458  C CG    . LYS H 4 31  ? 252.094 231.285 271.360 1.00 50.24  ? 31  LYS H CG    1 
ATOM 5459  C CD    . LYS H 4 31  ? 252.615 230.972 269.972 1.00 50.24  ? 31  LYS H CD    1 
ATOM 5460  C CE    . LYS H 4 31  ? 254.130 230.977 269.932 1.00 50.24  ? 31  LYS H CE    1 
ATOM 5461  N NZ    . LYS H 4 31  ? 254.639 230.971 268.532 1.00 50.24  ? 31  LYS H NZ    1 
ATOM 5462  N N     . GLU H 4 32  ? 248.439 233.987 272.693 1.00 44.86  ? 32  GLU H N     1 
ATOM 5463  C CA    . GLU H 4 32  ? 247.127 234.585 272.517 1.00 44.86  ? 32  GLU H CA    1 
ATOM 5464  C C     . GLU H 4 32  ? 246.900 234.965 271.061 1.00 44.86  ? 32  GLU H C     1 
ATOM 5465  O O     . GLU H 4 32  ? 247.832 235.335 270.346 1.00 44.86  ? 32  GLU H O     1 
ATOM 5466  C CB    . GLU H 4 32  ? 246.979 235.817 273.402 1.00 44.86  ? 32  GLU H CB    1 
ATOM 5467  C CG    . GLU H 4 32  ? 246.980 235.518 274.876 1.00 44.86  ? 32  GLU H CG    1 
ATOM 5468  C CD    . GLU H 4 32  ? 246.650 236.739 275.705 1.00 44.86  ? 32  GLU H CD    1 
ATOM 5469  O OE1   . GLU H 4 32  ? 246.125 236.577 276.825 1.00 44.86  ? 32  GLU H OE1   1 
ATOM 5470  O OE2   . GLU H 4 32  ? 246.908 237.865 275.228 1.00 44.86  ? 32  GLU H OE2   1 
ATOM 5471  N N     . SER H 4 33  ? 245.654 234.844 270.618 1.00 39.48  ? 33  SER H N     1 
ATOM 5472  C CA    . SER H 4 33  ? 245.256 235.297 269.298 1.00 39.48  ? 33  SER H CA    1 
ATOM 5473  C C     . SER H 4 33  ? 243.770 235.601 269.327 1.00 39.48  ? 33  SER H C     1 
ATOM 5474  O O     . SER H 4 33  ? 243.075 235.308 270.300 1.00 39.48  ? 33  SER H O     1 
ATOM 5475  C CB    . SER H 4 33  ? 245.585 234.260 268.222 1.00 39.48  ? 33  SER H CB    1 
ATOM 5476  O OG    . SER H 4 33  ? 244.720 233.150 268.310 1.00 39.48  ? 33  SER H OG    1 
ATOM 5477  N N     . TYR H 4 34  ? 243.278 236.197 268.248 1.00 35.77  ? 34  TYR H N     1 
ATOM 5478  C CA    . TYR H 4 34  ? 241.867 236.512 268.122 1.00 35.77  ? 34  TYR H CA    1 
ATOM 5479  C C     . TYR H 4 34  ? 241.079 235.401 267.454 1.00 35.77  ? 34  TYR H C     1 
ATOM 5480  O O     . TYR H 4 34  ? 239.916 235.608 267.120 1.00 35.77  ? 34  TYR H O     1 
ATOM 5481  C CB    . TYR H 4 34  ? 241.686 237.807 267.341 1.00 35.77  ? 34  TYR H CB    1 
ATOM 5482  C CG    . TYR H 4 34  ? 242.254 239.017 268.020 1.00 35.77  ? 34  TYR H CG    1 
ATOM 5483  C CD1   . TYR H 4 34  ? 241.561 239.653 269.030 1.00 35.77  ? 34  TYR H CD1   1 
ATOM 5484  C CD2   . TYR H 4 34  ? 243.476 239.533 267.638 1.00 35.77  ? 34  TYR H CD2   1 
ATOM 5485  C CE1   . TYR H 4 34  ? 242.071 240.760 269.644 1.00 35.77  ? 34  TYR H CE1   1 
ATOM 5486  C CE2   . TYR H 4 34  ? 243.993 240.636 268.243 1.00 35.77  ? 34  TYR H CE2   1 
ATOM 5487  C CZ    . TYR H 4 34  ? 243.287 241.250 269.245 1.00 35.77  ? 34  TYR H CZ    1 
ATOM 5488  O OH    . TYR H 4 34  ? 243.801 242.361 269.857 1.00 35.77  ? 34  TYR H OH    1 
ATOM 5489  N N     . ALA H 4 35  ? 241.680 234.228 267.276 1.00 36.26  ? 35  ALA H N     1 
ATOM 5490  C CA    . ALA H 4 35  ? 241.067 233.186 266.463 1.00 36.26  ? 35  ALA H CA    1 
ATOM 5491  C C     . ALA H 4 35  ? 239.670 232.827 266.952 1.00 36.26  ? 35  ALA H C     1 
ATOM 5492  O O     . ALA H 4 35  ? 238.753 232.656 266.145 1.00 36.26  ? 35  ALA H O     1 
ATOM 5493  C CB    . ALA H 4 35  ? 241.963 231.953 266.439 1.00 36.26  ? 35  ALA H CB    1 
ATOM 5494  N N     . ILE H 4 36  ? 239.477 232.718 268.266 1.00 37.85  ? 36  ILE H N     1 
ATOM 5495  C CA    . ILE H 4 36  ? 238.168 232.301 268.763 1.00 37.85  ? 36  ILE H CA    1 
ATOM 5496  C C     . ILE H 4 36  ? 237.122 233.377 268.501 1.00 37.85  ? 36  ILE H C     1 
ATOM 5497  O O     . ILE H 4 36  ? 235.969 233.076 268.180 1.00 37.85  ? 36  ILE H O     1 
ATOM 5498  C CB    . ILE H 4 36  ? 238.240 231.930 270.254 1.00 37.85  ? 36  ILE H CB    1 
ATOM 5499  C CG1   . ILE H 4 36  ? 238.750 233.102 271.086 1.00 37.85  ? 36  ILE H CG1   1 
ATOM 5500  C CG2   . ILE H 4 36  ? 239.113 230.721 270.452 1.00 37.85  ? 36  ILE H CG2   1 
ATOM 5501  C CD1   . ILE H 4 36  ? 238.480 232.950 272.541 1.00 37.85  ? 36  ILE H CD1   1 
ATOM 5502  N N     . TYR H 4 37  ? 237.503 234.645 268.616 1.00 37.23  ? 37  TYR H N     1 
ATOM 5503  C CA    . TYR H 4 37  ? 236.548 235.719 268.385 1.00 37.23  ? 37  TYR H CA    1 
ATOM 5504  C C     . TYR H 4 37  ? 236.249 235.874 266.905 1.00 37.23  ? 37  TYR H C     1 
ATOM 5505  O O     . TYR H 4 37  ? 235.111 236.164 266.521 1.00 37.23  ? 37  TYR H O     1 
ATOM 5506  C CB    . TYR H 4 37  ? 237.087 237.012 268.975 1.00 37.23  ? 37  TYR H CB    1 
ATOM 5507  C CG    . TYR H 4 37  ? 237.695 236.800 270.328 1.00 37.23  ? 37  TYR H CG    1 
ATOM 5508  C CD1   . TYR H 4 37  ? 236.898 236.577 271.433 1.00 37.23  ? 37  TYR H CD1   1 
ATOM 5509  C CD2   . TYR H 4 37  ? 239.063 236.794 270.496 1.00 37.23  ? 37  TYR H CD2   1 
ATOM 5510  C CE1   . TYR H 4 37  ? 237.443 236.380 272.662 1.00 37.23  ? 37  TYR H CE1   1 
ATOM 5511  C CE2   . TYR H 4 37  ? 239.617 236.588 271.726 1.00 37.23  ? 37  TYR H CE2   1 
ATOM 5512  C CZ    . TYR H 4 37  ? 238.805 236.381 272.805 1.00 37.23  ? 37  TYR H CZ    1 
ATOM 5513  O OH    . TYR H 4 37  ? 239.363 236.185 274.036 1.00 37.23  ? 37  TYR H OH    1 
ATOM 5514  N N     . VAL H 4 38  ? 237.261 235.685 266.061 1.00 36.83  ? 38  VAL H N     1 
ATOM 5515  C CA    . VAL H 4 38  ? 237.031 235.634 264.625 1.00 36.83  ? 38  VAL H CA    1 
ATOM 5516  C C     . VAL H 4 38  ? 236.072 234.506 264.295 1.00 36.83  ? 38  VAL H C     1 
ATOM 5517  O O     . VAL H 4 38  ? 235.188 234.653 263.450 1.00 36.83  ? 38  VAL H O     1 
ATOM 5518  C CB    . VAL H 4 38  ? 238.366 235.488 263.874 1.00 36.83  ? 38  VAL H CB    1 
ATOM 5519  C CG1   . VAL H 4 38  ? 238.120 235.320 262.404 1.00 36.83  ? 38  VAL H CG1   1 
ATOM 5520  C CG2   . VAL H 4 38  ? 239.242 236.694 264.117 1.00 36.83  ? 38  VAL H CG2   1 
ATOM 5521  N N     . TYR H 4 39  ? 236.196 233.380 264.991 1.00 40.00  ? 39  TYR H N     1 
ATOM 5522  C CA    . TYR H 4 39  ? 235.319 232.255 264.704 1.00 40.00  ? 39  TYR H CA    1 
ATOM 5523  C C     . TYR H 4 39  ? 233.892 232.530 265.156 1.00 40.00  ? 39  TYR H C     1 
ATOM 5524  O O     . TYR H 4 39  ? 232.938 232.141 264.476 1.00 40.00  ? 39  TYR H O     1 
ATOM 5525  C CB    . TYR H 4 39  ? 235.861 230.990 265.355 1.00 40.00  ? 39  TYR H CB    1 
ATOM 5526  C CG    . TYR H 4 39  ? 235.223 229.744 264.817 1.00 40.00  ? 39  TYR H CG    1 
ATOM 5527  C CD1   . TYR H 4 39  ? 235.629 229.207 263.611 1.00 40.00  ? 39  TYR H CD1   1 
ATOM 5528  C CD2   . TYR H 4 39  ? 234.205 229.112 265.506 1.00 40.00  ? 39  TYR H CD2   1 
ATOM 5529  C CE1   . TYR H 4 39  ? 235.046 228.075 263.107 1.00 40.00  ? 39  TYR H CE1   1 
ATOM 5530  C CE2   . TYR H 4 39  ? 233.614 227.976 265.011 1.00 40.00  ? 39  TYR H CE2   1 
ATOM 5531  C CZ    . TYR H 4 39  ? 234.042 227.459 263.813 1.00 40.00  ? 39  TYR H CZ    1 
ATOM 5532  O OH    . TYR H 4 39  ? 233.453 226.324 263.315 1.00 40.00  ? 39  TYR H OH    1 
ATOM 5533  N N     . LYS H 4 40  ? 233.723 233.200 266.297 1.00 38.63  ? 40  LYS H N     1 
ATOM 5534  C CA    . LYS H 4 40  ? 232.383 233.599 266.726 1.00 38.63  ? 40  LYS H CA    1 
ATOM 5535  C C     . LYS H 4 40  ? 231.745 234.563 265.734 1.00 38.63  ? 40  LYS H C     1 
ATOM 5536  O O     . LYS H 4 40  ? 230.577 234.401 265.357 1.00 38.63  ? 40  LYS H O     1 
ATOM 5537  C CB    . LYS H 4 40  ? 232.433 234.237 268.111 1.00 38.63  ? 40  LYS H CB    1 
ATOM 5538  C CG    . LYS H 4 40  ? 232.767 233.290 269.238 1.00 38.63  ? 40  LYS H CG    1 
ATOM 5539  C CD    . LYS H 4 40  ? 233.018 234.067 270.514 1.00 38.63  ? 40  LYS H CD    1 
ATOM 5540  C CE    . LYS H 4 40  ? 233.514 233.172 271.631 1.00 38.63  ? 40  LYS H CE    1 
ATOM 5541  N NZ    . LYS H 4 40  ? 233.992 233.968 272.795 1.00 38.63  ? 40  LYS H NZ    1 
ATOM 5542  N N     . VAL H 4 41  ? 232.494 235.579 265.303 1.00 37.26  ? 41  VAL H N     1 
ATOM 5543  C CA    . VAL H 4 41  ? 231.968 236.534 264.332 1.00 37.26  ? 41  VAL H CA    1 
ATOM 5544  C C     . VAL H 4 41  ? 231.601 235.828 263.035 1.00 37.26  ? 41  VAL H C     1 
ATOM 5545  O O     . VAL H 4 41  ? 230.579 236.134 262.403 1.00 37.26  ? 41  VAL H O     1 
ATOM 5546  C CB    . VAL H 4 41  ? 232.985 237.663 264.091 1.00 37.26  ? 41  VAL H CB    1 
ATOM 5547  C CG1   . VAL H 4 41  ? 232.543 238.529 262.938 1.00 37.26  ? 41  VAL H CG1   1 
ATOM 5548  C CG2   . VAL H 4 41  ? 233.156 238.497 265.340 1.00 37.26  ? 41  VAL H CG2   1 
ATOM 5549  N N     . LEU H 4 42  ? 232.426 234.869 262.620 1.00 38.95  ? 42  LEU H N     1 
ATOM 5550  C CA    . LEU H 4 42  ? 232.134 234.117 261.411 1.00 38.95  ? 42  LEU H CA    1 
ATOM 5551  C C     . LEU H 4 42  ? 230.870 233.292 261.573 1.00 38.95  ? 42  LEU H C     1 
ATOM 5552  O O     . LEU H 4 42  ? 230.064 233.200 260.650 1.00 38.95  ? 42  LEU H O     1 
ATOM 5553  C CB    . LEU H 4 42  ? 233.311 233.218 261.052 1.00 38.95  ? 42  LEU H CB    1 
ATOM 5554  C CG    . LEU H 4 42  ? 233.075 232.258 259.893 1.00 38.95  ? 42  LEU H CG    1 
ATOM 5555  C CD1   . LEU H 4 42  ? 232.768 233.035 258.636 1.00 38.95  ? 42  LEU H CD1   1 
ATOM 5556  C CD2   . LEU H 4 42  ? 234.268 231.360 259.700 1.00 38.95  ? 42  LEU H CD2   1 
ATOM 5557  N N     . LYS H 4 43  ? 230.676 232.684 262.737 1.00 40.54  ? 43  LYS H N     1 
ATOM 5558  C CA    . LYS H 4 43  ? 229.460 231.910 262.934 1.00 40.54  ? 43  LYS H CA    1 
ATOM 5559  C C     . LYS H 4 43  ? 228.237 232.805 263.010 1.00 40.54  ? 43  LYS H C     1 
ATOM 5560  O O     . LYS H 4 43  ? 227.114 232.335 262.814 1.00 40.54  ? 43  LYS H O     1 
ATOM 5561  C CB    . LYS H 4 43  ? 229.587 231.047 264.181 1.00 40.54  ? 43  LYS H CB    1 
ATOM 5562  C CG    . LYS H 4 43  ? 230.468 229.851 263.940 1.00 40.54  ? 43  LYS H CG    1 
ATOM 5563  C CD    . LYS H 4 43  ? 230.070 229.197 262.631 1.00 40.54  ? 43  LYS H CD    1 
ATOM 5564  C CE    . LYS H 4 43  ? 231.080 228.182 262.167 1.00 40.54  ? 43  LYS H CE    1 
ATOM 5565  N NZ    . LYS H 4 43  ? 230.665 227.585 260.877 1.00 40.54  ? 43  LYS H NZ    1 
ATOM 5566  N N     . GLN H 4 44  ? 228.429 234.084 263.311 1.00 40.29  ? 44  GLN H N     1 
ATOM 5567  C CA    . GLN H 4 44  ? 227.314 235.021 263.228 1.00 40.29  ? 44  GLN H CA    1 
ATOM 5568  C C     . GLN H 4 44  ? 226.974 235.356 261.781 1.00 40.29  ? 44  GLN H C     1 
ATOM 5569  O O     . GLN H 4 44  ? 225.806 235.320 261.387 1.00 40.29  ? 44  GLN H O     1 
ATOM 5570  C CB    . GLN H 4 44  ? 227.631 236.292 264.007 1.00 40.29  ? 44  GLN H CB    1 
ATOM 5571  C CG    . GLN H 4 44  ? 227.593 236.113 265.498 1.00 40.29  ? 44  GLN H CG    1 
ATOM 5572  C CD    . GLN H 4 44  ? 227.528 237.431 266.228 1.00 40.29  ? 44  GLN H CD    1 
ATOM 5573  O OE1   . GLN H 4 44  ? 227.985 238.454 265.725 1.00 40.29  ? 44  GLN H OE1   1 
ATOM 5574  N NE2   . GLN H 4 44  ? 226.942 237.419 267.417 1.00 40.29  ? 44  GLN H NE2   1 
ATOM 5575  N N     . VAL H 4 45  ? 227.980 235.693 260.973 1.00 40.14  ? 45  VAL H N     1 
ATOM 5576  C CA    . VAL H 4 45  ? 227.672 236.196 259.632 1.00 40.14  ? 45  VAL H CA    1 
ATOM 5577  C C     . VAL H 4 45  ? 227.400 235.063 258.640 1.00 40.14  ? 45  VAL H C     1 
ATOM 5578  O O     . VAL H 4 45  ? 226.614 235.236 257.705 1.00 40.14  ? 45  VAL H O     1 
ATOM 5579  C CB    . VAL H 4 45  ? 228.783 237.127 259.113 1.00 40.14  ? 45  VAL H CB    1 
ATOM 5580  C CG1   . VAL H 4 45  ? 228.960 238.306 260.037 1.00 40.14  ? 45  VAL H CG1   1 
ATOM 5581  C CG2   . VAL H 4 45  ? 230.083 236.380 258.939 1.00 40.14  ? 45  VAL H CG2   1 
ATOM 5582  N N     . HIS H 4 46  ? 228.032 233.906 258.815 1.00 40.92  ? 46  HIS H N     1 
ATOM 5583  C CA    . HIS H 4 46  ? 227.883 232.760 257.920 1.00 40.92  ? 46  HIS H CA    1 
ATOM 5584  C C     . HIS H 4 46  ? 227.869 231.516 258.785 1.00 40.92  ? 46  HIS H C     1 
ATOM 5585  O O     . HIS H 4 46  ? 228.920 230.925 259.060 1.00 40.92  ? 46  HIS H O     1 
ATOM 5586  C CB    . HIS H 4 46  ? 229.017 232.679 256.900 1.00 40.92  ? 46  HIS H CB    1 
ATOM 5587  C CG    . HIS H 4 46  ? 228.936 233.697 255.810 1.00 40.92  ? 46  HIS H CG    1 
ATOM 5588  N ND1   . HIS H 4 46  ? 227.960 233.669 254.841 1.00 40.92  ? 46  HIS H ND1   1 
ATOM 5589  C CD2   . HIS H 4 46  ? 229.722 234.758 255.522 1.00 40.92  ? 46  HIS H CD2   1 
ATOM 5590  C CE1   . HIS H 4 46  ? 228.141 234.676 254.008 1.00 40.92  ? 46  HIS H CE1   1 
ATOM 5591  N NE2   . HIS H 4 46  ? 229.203 235.353 254.400 1.00 40.92  ? 46  HIS H NE2   1 
ATOM 5592  N N     . PRO H 4 47  ? 226.692 231.080 259.233 1.00 42.52  ? 47  PRO H N     1 
ATOM 5593  C CA    . PRO H 4 47  ? 226.653 229.981 260.209 1.00 42.52  ? 47  PRO H CA    1 
ATOM 5594  C C     . PRO H 4 47  ? 227.224 228.674 259.692 1.00 42.52  ? 47  PRO H C     1 
ATOM 5595  O O     . PRO H 4 47  ? 227.901 227.967 260.444 1.00 42.52  ? 47  PRO H O     1 
ATOM 5596  C CB    . PRO H 4 47  ? 225.160 229.864 260.534 1.00 42.52  ? 47  PRO H CB    1 
ATOM 5597  C CG    . PRO H 4 47  ? 224.592 231.175 260.168 1.00 42.52  ? 47  PRO H CG    1 
ATOM 5598  C CD    . PRO H 4 47  ? 225.361 231.648 258.993 1.00 42.52  ? 47  PRO H CD    1 
ATOM 5599  N N     . ASP H 4 48  ? 226.961 228.315 258.442 1.00 45.47  ? 48  ASP H N     1 
ATOM 5600  C CA    . ASP H 4 48  ? 227.454 227.055 257.888 1.00 45.47  ? 48  ASP H CA    1 
ATOM 5601  C C     . ASP H 4 48  ? 228.713 227.276 257.052 1.00 45.47  ? 48  ASP H C     1 
ATOM 5602  O O     . ASP H 4 48  ? 228.807 226.858 255.902 1.00 45.47  ? 48  ASP H O     1 
ATOM 5603  C CB    . ASP H 4 48  ? 226.358 226.386 257.068 1.00 45.47  ? 48  ASP H CB    1 
ATOM 5604  C CG    . ASP H 4 48  ? 225.100 226.141 257.875 1.00 45.47  ? 48  ASP H CG    1 
ATOM 5605  O OD1   . ASP H 4 48  ? 225.219 225.678 259.027 1.00 45.47  ? 48  ASP H OD1   1 
ATOM 5606  O OD2   . ASP H 4 48  ? 223.995 226.427 257.367 1.00 45.47  ? 48  ASP H OD2   1 
ATOM 5607  N N     . THR H 4 49  ? 229.709 227.912 257.658 1.00 43.38  ? 49  THR H N     1 
ATOM 5608  C CA    . THR H 4 49  ? 230.940 228.241 256.954 1.00 43.38  ? 49  THR H CA    1 
ATOM 5609  C C     . THR H 4 49  ? 232.096 228.183 257.933 1.00 43.38  ? 49  THR H C     1 
ATOM 5610  O O     . THR H 4 49  ? 232.038 228.796 259.001 1.00 43.38  ? 49  THR H O     1 
ATOM 5611  C CB    . THR H 4 49  ? 230.865 229.630 256.316 1.00 43.38  ? 49  THR H CB    1 
ATOM 5612  O OG1   . THR H 4 49  ? 229.773 229.673 255.393 1.00 43.38  ? 49  THR H OG1   1 
ATOM 5613  C CG2   . THR H 4 49  ? 232.140 229.947 255.573 1.00 43.38  ? 49  THR H CG2   1 
ATOM 5614  N N     . GLY H 4 50  ? 233.138 227.443 257.572 1.00 41.60  ? 50  GLY H N     1 
ATOM 5615  C CA    . GLY H 4 50  ? 234.331 227.349 258.376 1.00 41.60  ? 50  GLY H CA    1 
ATOM 5616  C C     . GLY H 4 50  ? 235.468 228.171 257.806 1.00 41.60  ? 50  GLY H C     1 
ATOM 5617  O O     . GLY H 4 50  ? 235.309 228.960 256.877 1.00 41.60  ? 50  GLY H O     1 
ATOM 5618  N N     . ILE H 4 51  ? 236.645 227.962 258.372 1.00 39.38  ? 51  ILE H N     1 
ATOM 5619  C CA    . ILE H 4 51  ? 237.805 228.742 257.971 1.00 39.38  ? 51  ILE H CA    1 
ATOM 5620  C C     . ILE H 4 51  ? 239.048 227.901 258.202 1.00 39.38  ? 51  ILE H C     1 
ATOM 5621  O O     . ILE H 4 51  ? 239.187 227.242 259.233 1.00 39.38  ? 51  ILE H O     1 
ATOM 5622  C CB    . ILE H 4 51  ? 237.838 230.089 258.727 1.00 39.38  ? 51  ILE H CB    1 
ATOM 5623  C CG1   . ILE H 4 51  ? 238.996 230.961 258.263 1.00 39.38  ? 51  ILE H CG1   1 
ATOM 5624  C CG2   . ILE H 4 51  ? 237.883 229.876 260.221 1.00 39.38  ? 51  ILE H CG2   1 
ATOM 5625  C CD1   . ILE H 4 51  ? 238.840 232.396 258.640 1.00 39.38  ? 51  ILE H CD1   1 
ATOM 5626  N N     . SER H 4 52  ? 239.937 227.901 257.223 1.00 38.62  ? 52  SER H N     1 
ATOM 5627  C CA    . SER H 4 52  ? 241.181 227.176 257.368 1.00 38.62  ? 52  SER H CA    1 
ATOM 5628  C C     . SER H 4 52  ? 242.124 227.935 258.292 1.00 38.62  ? 52  SER H C     1 
ATOM 5629  O O     . SER H 4 52  ? 241.917 229.108 258.608 1.00 38.62  ? 52  SER H O     1 
ATOM 5630  C CB    . SER H 4 52  ? 241.833 226.956 256.011 1.00 38.62  ? 52  SER H CB    1 
ATOM 5631  O OG    . SER H 4 52  ? 242.256 228.183 255.461 1.00 38.62  ? 52  SER H OG    1 
ATOM 5632  N N     . SER H 4 53  ? 243.176 227.249 258.727 1.00 37.72  ? 53  SER H N     1 
ATOM 5633  C CA    . SER H 4 53  ? 244.084 227.871 259.679 1.00 37.72  ? 53  SER H CA    1 
ATOM 5634  C C     . SER H 4 53  ? 244.916 228.967 259.030 1.00 37.72  ? 53  SER H C     1 
ATOM 5635  O O     . SER H 4 53  ? 245.277 229.935 259.700 1.00 37.72  ? 53  SER H O     1 
ATOM 5636  C CB    . SER H 4 53  ? 244.987 226.823 260.317 1.00 37.72  ? 53  SER H CB    1 
ATOM 5637  O OG    . SER H 4 53  ? 245.919 226.320 259.386 1.00 37.72  ? 53  SER H OG    1 
ATOM 5638  N N     . LYS H 4 54  ? 245.219 228.849 257.737 1.00 36.70  ? 54  LYS H N     1 
ATOM 5639  C CA    . LYS H 4 54  ? 245.938 229.921 257.056 1.00 36.70  ? 54  LYS H CA    1 
ATOM 5640  C C     . LYS H 4 54  ? 245.091 231.179 256.960 1.00 36.70  ? 54  LYS H C     1 
ATOM 5641  O O     . LYS H 4 54  ? 245.567 232.281 257.256 1.00 36.70  ? 54  LYS H O     1 
ATOM 5642  C CB    . LYS H 4 54  ? 246.371 229.471 255.665 1.00 36.70  ? 54  LYS H CB    1 
ATOM 5643  C CG    . LYS H 4 54  ? 247.650 228.672 255.638 1.00 36.70  ? 54  LYS H CG    1 
ATOM 5644  C CD    . LYS H 4 54  ? 248.831 229.484 256.143 1.00 36.70  ? 54  LYS H CD    1 
ATOM 5645  C CE    . LYS H 4 54  ? 249.056 230.726 255.298 1.00 36.70  ? 54  LYS H CE    1 
ATOM 5646  N NZ    . LYS H 4 54  ? 250.453 231.233 255.404 1.00 36.70  ? 54  LYS H NZ    1 
ATOM 5647  N N     . ALA H 4 55  ? 243.836 231.036 256.539 1.00 35.41  ? 55  ALA H N     1 
ATOM 5648  C CA    . ALA H 4 55  ? 242.931 232.175 256.533 1.00 35.41  ? 55  ALA H CA    1 
ATOM 5649  C C     . ALA H 4 55  ? 242.740 232.744 257.932 1.00 35.41  ? 55  ALA H C     1 
ATOM 5650  O O     . ALA H 4 55  ? 242.627 233.961 258.089 1.00 35.41  ? 55  ALA H O     1 
ATOM 5651  C CB    . ALA H 4 55  ? 241.592 231.778 255.925 1.00 35.41  ? 55  ALA H CB    1 
ATOM 5652  N N     . MET H 4 56  ? 242.736 231.895 258.958 1.00 35.48  ? 56  MET H N     1 
ATOM 5653  C CA    . MET H 4 56  ? 242.593 232.398 260.319 1.00 35.48  ? 56  MET H CA    1 
ATOM 5654  C C     . MET H 4 56  ? 243.832 233.168 260.754 1.00 35.48  ? 56  MET H C     1 
ATOM 5655  O O     . MET H 4 56  ? 243.731 234.171 261.463 1.00 35.48  ? 56  MET H O     1 
ATOM 5656  C CB    . MET H 4 56  ? 242.311 231.249 261.279 1.00 35.48  ? 56  MET H CB    1 
ATOM 5657  C CG    . MET H 4 56  ? 242.127 231.699 262.707 1.00 35.48  ? 56  MET H CG    1 
ATOM 5658  S SD    . MET H 4 56  ? 240.822 232.920 262.880 1.00 35.48  ? 56  MET H SD    1 
ATOM 5659  C CE    . MET H 4 56  ? 239.386 231.871 262.880 1.00 35.48  ? 56  MET H CE    1 
ATOM 5660  N N     . SER H 4 57  ? 245.007 232.712 260.337 1.00 34.74  ? 57  SER H N     1 
ATOM 5661  C CA    . SER H 4 57  ? 246.233 233.453 260.598 1.00 34.74  ? 57  SER H CA    1 
ATOM 5662  C C     . SER H 4 57  ? 246.199 234.818 259.925 1.00 34.74  ? 57  SER H C     1 
ATOM 5663  O O     . SER H 4 57  ? 246.615 235.822 260.514 1.00 34.74  ? 57  SER H O     1 
ATOM 5664  C CB    . SER H 4 57  ? 247.427 232.638 260.113 1.00 34.74  ? 57  SER H CB    1 
ATOM 5665  O OG    . SER H 4 57  ? 248.647 233.243 260.473 1.00 34.74  ? 57  SER H OG    1 
ATOM 5666  N N     . ILE H 4 58  ? 245.704 234.873 258.690 1.00 33.72  ? 58  ILE H N     1 
ATOM 5667  C CA    . ILE H 4 58  ? 245.570 236.154 258.002 1.00 33.72  ? 58  ILE H CA    1 
ATOM 5668  C C     . ILE H 4 58  ? 244.602 237.064 258.741 1.00 33.72  ? 58  ILE H C     1 
ATOM 5669  O O     . ILE H 4 58  ? 244.860 238.260 258.905 1.00 33.72  ? 58  ILE H O     1 
ATOM 5670  C CB    . ILE H 4 58  ? 245.133 235.937 256.546 1.00 33.72  ? 58  ILE H CB    1 
ATOM 5671  C CG1   . ILE H 4 58  ? 246.273 235.313 255.760 1.00 33.72  ? 58  ILE H CG1   1 
ATOM 5672  C CG2   . ILE H 4 58  ? 244.723 237.246 255.913 1.00 33.72  ? 58  ILE H CG2   1 
ATOM 5673  C CD1   . ILE H 4 58  ? 245.860 234.743 254.480 1.00 33.72  ? 58  ILE H CD1   1 
ATOM 5674  N N     . MET H 4 59  ? 243.478 236.515 259.201 1.00 34.48  ? 59  MET H N     1 
ATOM 5675  C CA    . MET H 4 59  ? 242.500 237.317 259.932 1.00 34.48  ? 59  MET H CA    1 
ATOM 5676  C C     . MET H 4 59  ? 243.063 237.811 261.252 1.00 34.48  ? 59  MET H C     1 
ATOM 5677  O O     . MET H 4 59  ? 242.771 238.929 261.684 1.00 34.48  ? 59  MET H O     1 
ATOM 5678  C CB    . MET H 4 59  ? 241.230 236.508 260.174 1.00 34.48  ? 59  MET H CB    1 
ATOM 5679  C CG    . MET H 4 59  ? 240.370 236.353 258.957 1.00 34.48  ? 59  MET H CG    1 
ATOM 5680  S SD    . MET H 4 59  ? 239.890 237.925 258.239 1.00 34.48  ? 59  MET H SD    1 
ATOM 5681  C CE    . MET H 4 59  ? 239.082 238.699 259.627 1.00 34.48  ? 59  MET H CE    1 
ATOM 5682  N N     . ASN H 4 60  ? 243.875 236.990 261.903 1.00 34.25  ? 60  ASN H N     1 
ATOM 5683  C CA    . ASN H 4 60  ? 244.519 237.395 263.140 1.00 34.25  ? 60  ASN H CA    1 
ATOM 5684  C C     . ASN H 4 60  ? 245.491 238.541 262.904 1.00 34.25  ? 60  ASN H C     1 
ATOM 5685  O O     . ASN H 4 60  ? 245.488 239.532 263.647 1.00 34.25  ? 60  ASN H O     1 
ATOM 5686  C CB    . ASN H 4 60  ? 245.229 236.192 263.749 1.00 34.25  ? 60  ASN H CB    1 
ATOM 5687  C CG    . ASN H 4 60  ? 245.683 236.437 265.151 1.00 34.25  ? 60  ASN H CG    1 
ATOM 5688  O OD1   . ASN H 4 60  ? 244.872 236.555 266.061 1.00 34.25  ? 60  ASN H OD1   1 
ATOM 5689  N ND2   . ASN H 4 60  ? 246.987 236.505 265.345 1.00 34.25  ? 60  ASN H ND2   1 
ATOM 5690  N N     . SER H 4 61  ? 246.319 238.438 261.867 1.00 33.40  ? 61  SER H N     1 
ATOM 5691  C CA    . SER H 4 61  ? 247.240 239.532 261.598 1.00 33.40  ? 61  SER H CA    1 
ATOM 5692  C C     . SER H 4 61  ? 246.505 240.774 261.119 1.00 33.40  ? 61  SER H C     1 
ATOM 5693  O O     . SER H 4 61  ? 246.979 241.883 261.348 1.00 33.40  ? 61  SER H O     1 
ATOM 5694  C CB    . SER H 4 61  ? 248.312 239.109 260.598 1.00 33.40  ? 61  SER H CB    1 
ATOM 5695  O OG    . SER H 4 61  ? 247.760 238.491 259.465 1.00 33.40  ? 61  SER H OG    1 
ATOM 5696  N N     . PHE H 4 62  ? 245.330 240.617 260.512 1.00 33.40  ? 62  PHE H N     1 
ATOM 5697  C CA    . PHE H 4 62  ? 244.527 241.777 260.138 1.00 33.40  ? 62  PHE H CA    1 
ATOM 5698  C C     . PHE H 4 62  ? 243.960 242.482 261.364 1.00 33.40  ? 62  PHE H C     1 
ATOM 5699  O O     . PHE H 4 62  ? 243.987 243.715 261.452 1.00 33.40  ? 62  PHE H O     1 
ATOM 5700  C CB    . PHE H 4 62  ? 243.398 241.360 259.200 1.00 33.40  ? 62  PHE H CB    1 
ATOM 5701  C CG    . PHE H 4 62  ? 242.314 242.382 259.074 1.00 33.40  ? 62  PHE H CG    1 
ATOM 5702  C CD1   . PHE H 4 62  ? 242.513 243.530 258.340 1.00 33.40  ? 62  PHE H CD1   1 
ATOM 5703  C CD2   . PHE H 4 62  ? 241.098 242.198 259.700 1.00 33.40  ? 62  PHE H CD2   1 
ATOM 5704  C CE1   . PHE H 4 62  ? 241.525 244.472 258.225 1.00 33.40  ? 62  PHE H CE1   1 
ATOM 5705  C CE2   . PHE H 4 62  ? 240.103 243.138 259.591 1.00 33.40  ? 62  PHE H CE2   1 
ATOM 5706  C CZ    . PHE H 4 62  ? 240.317 244.280 258.852 1.00 33.40  ? 62  PHE H CZ    1 
ATOM 5707  N N     . VAL H 4 63  ? 243.420 241.718 262.313 1.00 33.73  ? 63  VAL H N     1 
ATOM 5708  C CA    . VAL H 4 63  ? 242.925 242.329 263.542 1.00 33.73  ? 63  VAL H CA    1 
ATOM 5709  C C     . VAL H 4 63  ? 244.057 243.042 264.263 1.00 33.73  ? 63  VAL H C     1 
ATOM 5710  O O     . VAL H 4 63  ? 243.890 244.163 264.751 1.00 33.73  ? 63  VAL H O     1 
ATOM 5711  C CB    . VAL H 4 63  ? 242.253 241.279 264.446 1.00 33.73  ? 63  VAL H CB    1 
ATOM 5712  C CG1   . VAL H 4 63  ? 241.793 241.918 265.737 1.00 33.73  ? 63  VAL H CG1   1 
ATOM 5713  C CG2   . VAL H 4 63  ? 241.081 240.649 263.747 1.00 33.73  ? 63  VAL H CG2   1 
ATOM 5714  N N     . ASN H 4 64  ? 245.233 242.417 264.318 1.00 34.65  ? 64  ASN H N     1 
ATOM 5715  C CA    . ASN H 4 64  ? 246.363 243.037 265.000 1.00 34.65  ? 64  ASN H CA    1 
ATOM 5716  C C     . ASN H 4 64  ? 246.835 244.289 264.277 1.00 34.65  ? 64  ASN H C     1 
ATOM 5717  O O     . ASN H 4 64  ? 247.116 245.310 264.910 1.00 34.65  ? 64  ASN H O     1 
ATOM 5718  C CB    . ASN H 4 64  ? 247.502 242.036 265.134 1.00 34.65  ? 64  ASN H CB    1 
ATOM 5719  C CG    . ASN H 4 64  ? 247.289 241.081 266.270 1.00 34.65  ? 64  ASN H CG    1 
ATOM 5720  O OD1   . ASN H 4 64  ? 246.979 241.492 267.379 1.00 34.65  ? 64  ASN H OD1   1 
ATOM 5721  N ND2   . ASN H 4 64  ? 247.445 239.796 266.004 1.00 34.65  ? 64  ASN H ND2   1 
ATOM 5722  N N     . ASP H 4 65  ? 246.908 244.233 262.950 1.00 34.71  ? 65  ASP H N     1 
ATOM 5723  C CA    . ASP H 4 65  ? 247.306 245.381 262.150 1.00 34.71  ? 65  ASP H CA    1 
ATOM 5724  C C     . ASP H 4 65  ? 246.381 246.564 262.383 1.00 34.71  ? 65  ASP H C     1 
ATOM 5725  O O     . ASP H 4 65  ? 246.840 247.684 262.628 1.00 34.71  ? 65  ASP H O     1 
ATOM 5726  C CB    . ASP H 4 65  ? 247.316 244.977 260.679 1.00 34.71  ? 65  ASP H CB    1 
ATOM 5727  C CG    . ASP H 4 65  ? 247.779 246.083 259.767 1.00 34.71  ? 65  ASP H CG    1 
ATOM 5728  O OD1   . ASP H 4 65  ? 248.525 246.968 260.223 1.00 34.71  ? 65  ASP H OD1   1 
ATOM 5729  O OD2   . ASP H 4 65  ? 247.386 246.070 258.585 1.00 34.71  ? 65  ASP H OD2   1 
ATOM 5730  N N     . VAL H 4 66  ? 245.070 246.333 262.312 1.00 34.21  ? 66  VAL H N     1 
ATOM 5731  C CA    . VAL H 4 66  ? 244.118 247.426 262.472 1.00 34.21  ? 66  VAL H CA    1 
ATOM 5732  C C     . VAL H 4 66  ? 244.120 247.943 263.904 1.00 34.21  ? 66  VAL H C     1 
ATOM 5733  O O     . VAL H 4 66  ? 244.011 249.154 264.137 1.00 34.21  ? 66  VAL H O     1 
ATOM 5734  C CB    . VAL H 4 66  ? 242.717 246.980 262.026 1.00 34.21  ? 66  VAL H CB    1 
ATOM 5735  C CG1   . VAL H 4 66  ? 241.679 247.958 262.507 1.00 34.21  ? 66  VAL H CG1   1 
ATOM 5736  C CG2   . VAL H 4 66  ? 242.671 246.888 260.529 1.00 34.21  ? 66  VAL H CG2   1 
ATOM 5737  N N     . PHE H 4 67  ? 244.240 247.043 264.885 1.00 34.45  ? 67  PHE H N     1 
ATOM 5738  C CA    . PHE H 4 67  ? 244.404 247.482 266.265 1.00 34.45  ? 67  PHE H CA    1 
ATOM 5739  C C     . PHE H 4 67  ? 245.579 248.434 266.386 1.00 34.45  ? 67  PHE H C     1 
ATOM 5740  O O     . PHE H 4 67  ? 245.466 249.494 267.002 1.00 34.45  ? 67  PHE H O     1 
ATOM 5741  C CB    . PHE H 4 67  ? 244.601 246.282 267.196 1.00 34.45  ? 67  PHE H CB    1 
ATOM 5742  C CG    . PHE H 4 67  ? 244.832 246.658 268.637 1.00 34.45  ? 67  PHE H CG    1 
ATOM 5743  C CD1   . PHE H 4 67  ? 246.073 247.079 269.081 1.00 34.45  ? 67  PHE H CD1   1 
ATOM 5744  C CD2   . PHE H 4 67  ? 243.808 246.574 269.553 1.00 34.45  ? 67  PHE H CD2   1 
ATOM 5745  C CE1   . PHE H 4 67  ? 246.273 247.427 270.395 1.00 34.45  ? 67  PHE H CE1   1 
ATOM 5746  C CE2   . PHE H 4 67  ? 244.013 246.911 270.870 1.00 34.45  ? 67  PHE H CE2   1 
ATOM 5747  C CZ    . PHE H 4 67  ? 245.242 247.338 271.289 1.00 34.45  ? 67  PHE H CZ    1 
ATOM 5748  N N     . GLU H 4 68  ? 246.727 248.056 265.830 1.00 35.97  ? 68  GLU H N     1 
ATOM 5749  C CA    . GLU H 4 68  ? 247.908 248.900 265.948 1.00 35.97  ? 68  GLU H CA    1 
ATOM 5750  C C     . GLU H 4 68  ? 247.725 250.225 265.222 1.00 35.97  ? 68  GLU H C     1 
ATOM 5751  O O     . GLU H 4 68  ? 248.136 251.268 265.729 1.00 35.97  ? 68  GLU H O     1 
ATOM 5752  C CB    . GLU H 4 68  ? 249.137 248.168 265.428 1.00 35.97  ? 68  GLU H CB    1 
ATOM 5753  C CG    . GLU H 4 68  ? 249.846 247.359 266.488 1.00 35.97  ? 68  GLU H CG    1 
ATOM 5754  C CD    . GLU H 4 68  ? 249.694 245.867 266.291 1.00 35.97  ? 68  GLU H CD    1 
ATOM 5755  O OE1   . GLU H 4 68  ? 250.160 245.350 265.251 1.00 35.97  ? 68  GLU H OE1   1 
ATOM 5756  O OE2   . GLU H 4 68  ? 249.101 245.209 267.172 1.00 35.97  ? 68  GLU H OE2   1 
ATOM 5757  N N     . ARG H 4 69  ? 247.088 250.215 264.051 1.00 34.55  ? 69  ARG H N     1 
ATOM 5758  C CA    . ARG H 4 69  ? 246.865 251.471 263.341 1.00 34.55  ? 69  ARG H CA    1 
ATOM 5759  C C     . ARG H 4 69  ? 246.004 252.422 264.161 1.00 34.55  ? 69  ARG H C     1 
ATOM 5760  O O     . ARG H 4 69  ? 246.369 253.585 264.372 1.00 34.55  ? 69  ARG H O     1 
ATOM 5761  C CB    . ARG H 4 69  ? 246.215 251.220 261.985 1.00 34.55  ? 69  ARG H CB    1 
ATOM 5762  C CG    . ARG H 4 69  ? 247.108 250.568 260.970 1.00 34.55  ? 69  ARG H CG    1 
ATOM 5763  C CD    . ARG H 4 69  ? 246.528 250.734 259.590 1.00 34.55  ? 69  ARG H CD    1 
ATOM 5764  N NE    . ARG H 4 69  ? 246.583 249.504 258.819 1.00 34.55  ? 69  ARG H NE    1 
ATOM 5765  C CZ    . ARG H 4 69  ? 246.124 249.386 257.580 1.00 34.55  ? 69  ARG H CZ    1 
ATOM 5766  N NH1   . ARG H 4 69  ? 245.584 250.427 256.974 1.00 34.55  ? 69  ARG H NH1   1 
ATOM 5767  N NH2   . ARG H 4 69  ? 246.209 248.228 256.949 1.00 34.55  ? 69  ARG H NH2   1 
ATOM 5768  N N     . ILE H 4 70  ? 244.864 251.937 264.652 1.00 33.68  ? 70  ILE H N     1 
ATOM 5769  C CA    . ILE H 4 70  ? 243.959 252.805 265.394 1.00 33.68  ? 70  ILE H CA    1 
ATOM 5770  C C     . ILE H 4 70  ? 244.586 253.232 266.711 1.00 33.68  ? 70  ILE H C     1 
ATOM 5771  O O     . ILE H 4 70  ? 244.472 254.390 267.120 1.00 33.68  ? 70  ILE H O     1 
ATOM 5772  C CB    . ILE H 4 70  ? 242.601 252.114 265.601 1.00 33.68  ? 70  ILE H CB    1 
ATOM 5773  C CG1   . ILE H 4 70  ? 241.950 251.841 264.251 1.00 33.68  ? 70  ILE H CG1   1 
ATOM 5774  C CG2   . ILE H 4 70  ? 241.687 252.974 266.442 1.00 33.68  ? 70  ILE H CG2   1 
ATOM 5775  C CD1   . ILE H 4 70  ? 240.674 251.089 264.342 1.00 33.68  ? 70  ILE H CD1   1 
ATOM 5776  N N     . ALA H 4 71  ? 245.264 252.314 267.393 1.00 34.25  ? 71  ALA H N     1 
ATOM 5777  C CA    . ALA H 4 71  ? 245.859 252.655 268.674 1.00 34.25  ? 71  ALA H CA    1 
ATOM 5778  C C     . ALA H 4 71  ? 246.984 253.663 268.509 1.00 34.25  ? 71  ALA H C     1 
ATOM 5779  O O     . ALA H 4 71  ? 247.101 254.591 269.309 1.00 34.25  ? 71  ALA H O     1 
ATOM 5780  C CB    . ALA H 4 71  ? 246.350 251.394 269.374 1.00 34.25  ? 71  ALA H CB    1 
ATOM 5781  N N     . GLY H 4 72  ? 247.810 253.517 267.472 1.00 34.21  ? 72  GLY H N     1 
ATOM 5782  C CA    . GLY H 4 72  ? 248.857 254.494 267.232 1.00 34.21  ? 72  GLY H CA    1 
ATOM 5783  C C     . GLY H 4 72  ? 248.313 255.860 266.871 1.00 34.21  ? 72  GLY H C     1 
ATOM 5784  O O     . GLY H 4 72  ? 248.838 256.885 267.316 1.00 34.21  ? 72  GLY H O     1 
ATOM 5785  N N     . GLU H 4 73  ? 247.255 255.900 266.060 1.00 34.88  ? 73  GLU H N     1 
ATOM 5786  C CA    . GLU H 4 73  ? 246.677 257.194 265.723 1.00 34.88  ? 73  GLU H CA    1 
ATOM 5787  C C     . GLU H 4 73  ? 246.032 257.847 266.938 1.00 34.88  ? 73  GLU H C     1 
ATOM 5788  O O     . GLU H 4 73  ? 246.145 259.059 267.120 1.00 34.88  ? 73  GLU H O     1 
ATOM 5789  C CB    . GLU H 4 73  ? 245.673 257.052 264.587 1.00 34.88  ? 73  GLU H CB    1 
ATOM 5790  C CG    . GLU H 4 73  ? 245.108 258.379 264.120 1.00 34.88  ? 73  GLU H CG    1 
ATOM 5791  C CD    . GLU H 4 73  ? 246.191 259.408 263.832 1.00 34.88  ? 73  GLU H CD    1 
ATOM 5792  O OE1   . GLU H 4 73  ? 247.100 259.110 263.032 1.00 34.88  ? 73  GLU H OE1   1 
ATOM 5793  O OE2   . GLU H 4 73  ? 246.140 260.513 264.411 1.00 34.88  ? 73  GLU H OE2   1 
ATOM 5794  N N     . ALA H 4 74  ? 245.371 257.065 267.789 1.00 34.17  ? 74  ALA H N     1 
ATOM 5795  C CA    . ALA H 4 74  ? 244.817 257.623 269.016 1.00 34.17  ? 74  ALA H CA    1 
ATOM 5796  C C     . ALA H 4 74  ? 245.923 258.108 269.947 1.00 34.17  ? 74  ALA H C     1 
ATOM 5797  O O     . ALA H 4 74  ? 245.786 259.147 270.599 1.00 34.17  ? 74  ALA H O     1 
ATOM 5798  C CB    . ALA H 4 74  ? 243.935 256.588 269.707 1.00 34.17  ? 74  ALA H CB    1 
ATOM 5799  N N     . SER H 4 75  ? 247.034 257.377 270.000 1.00 34.14  ? 75  SER H N     1 
ATOM 5800  C CA    . SER H 4 75  ? 248.168 257.781 270.819 1.00 34.14  ? 75  SER H CA    1 
ATOM 5801  C C     . SER H 4 75  ? 248.715 259.131 270.375 1.00 34.14  ? 75  SER H C     1 
ATOM 5802  O O     . SER H 4 75  ? 248.932 260.031 271.197 1.00 34.14  ? 75  SER H O     1 
ATOM 5803  C CB    . SER H 4 75  ? 249.250 256.707 270.751 1.00 34.14  ? 75  SER H CB    1 
ATOM 5804  O OG    . SER H 4 75  ? 250.445 257.143 271.360 1.00 34.14  ? 75  SER H OG    1 
ATOM 5805  N N     . ARG H 4 76  ? 248.938 259.300 269.074 1.00 34.87  ? 76  ARG H N     1 
ATOM 5806  C CA    . ARG H 4 76  ? 249.478 260.582 268.649 1.00 34.87  ? 76  ARG H CA    1 
ATOM 5807  C C     . ARG H 4 76  ? 248.428 261.685 268.662 1.00 34.87  ? 76  ARG H C     1 
ATOM 5808  O O     . ARG H 4 76  ? 248.793 262.846 268.812 1.00 34.87  ? 76  ARG H O     1 
ATOM 5809  C CB    . ARG H 4 76  ? 250.160 260.467 267.286 1.00 34.87  ? 76  ARG H CB    1 
ATOM 5810  C CG    . ARG H 4 76  ? 249.281 260.233 266.104 1.00 34.87  ? 76  ARG H CG    1 
ATOM 5811  C CD    . ARG H 4 76  ? 250.154 260.001 264.878 1.00 34.87  ? 76  ARG H CD    1 
ATOM 5812  N NE    . ARG H 4 76  ? 250.919 258.769 265.000 1.00 34.87  ? 76  ARG H NE    1 
ATOM 5813  C CZ    . ARG H 4 76  ? 250.544 257.611 264.471 1.00 34.87  ? 76  ARG H CZ    1 
ATOM 5814  N NH1   . ARG H 4 76  ? 249.422 257.535 263.776 1.00 34.87  ? 76  ARG H NH1   1 
ATOM 5815  N NH2   . ARG H 4 76  ? 251.290 256.531 264.638 1.00 34.87  ? 76  ARG H NH2   1 
ATOM 5816  N N     . LEU H 4 77  ? 247.138 261.359 268.580 1.00 34.89  ? 77  LEU H N     1 
ATOM 5817  C CA    . LEU H 4 77  ? 246.106 262.364 268.823 1.00 34.89  ? 77  LEU H CA    1 
ATOM 5818  C C     . LEU H 4 77  ? 246.181 262.896 270.244 1.00 34.89  ? 77  LEU H C     1 
ATOM 5819  O O     . LEU H 4 77  ? 246.178 264.113 270.470 1.00 34.89  ? 77  LEU H O     1 
ATOM 5820  C CB    . LEU H 4 77  ? 244.726 261.774 268.574 1.00 34.89  ? 77  LEU H CB    1 
ATOM 5821  C CG    . LEU H 4 77  ? 244.168 261.820 267.168 1.00 34.89  ? 77  LEU H CG    1 
ATOM 5822  C CD1   . LEU H 4 77  ? 242.986 260.892 267.092 1.00 34.89  ? 77  LEU H CD1   1 
ATOM 5823  C CD2   . LEU H 4 77  ? 243.774 263.234 266.837 1.00 34.89  ? 77  LEU H CD2   1 
ATOM 5824  N N     . ALA H 4 78  ? 246.226 261.988 271.219 1.00 35.94  ? 78  ALA H N     1 
ATOM 5825  C CA    . ALA H 4 78  ? 246.359 262.399 272.609 1.00 35.94  ? 78  ALA H CA    1 
ATOM 5826  C C     . ALA H 4 78  ? 247.623 263.217 272.822 1.00 35.94  ? 78  ALA H C     1 
ATOM 5827  O O     . ALA H 4 78  ? 247.620 264.185 273.584 1.00 35.94  ? 78  ALA H O     1 
ATOM 5828  C CB    . ALA H 4 78  ? 246.352 261.176 273.520 1.00 35.94  ? 78  ALA H CB    1 
ATOM 5829  N N     . HIS H 4 79  ? 248.713 262.849 272.153 1.00 37.56  ? 79  HIS H N     1 
ATOM 5830  C CA    . HIS H 4 79  ? 249.938 263.629 272.289 1.00 37.56  ? 79  HIS H CA    1 
ATOM 5831  C C     . HIS H 4 79  ? 249.799 265.011 271.657 1.00 37.56  ? 79  HIS H C     1 
ATOM 5832  O O     . HIS H 4 79  ? 250.261 266.003 272.227 1.00 37.56  ? 79  HIS H O     1 
ATOM 5833  C CB    . HIS H 4 79  ? 251.111 262.877 271.673 1.00 37.56  ? 79  HIS H CB    1 
ATOM 5834  C CG    . HIS H 4 79  ? 252.401 263.627 271.738 1.00 37.56  ? 79  HIS H CG    1 
ATOM 5835  N ND1   . HIS H 4 79  ? 253.192 263.649 272.866 1.00 37.56  ? 79  HIS H ND1   1 
ATOM 5836  C CD2   . HIS H 4 79  ? 253.033 264.393 270.820 1.00 37.56  ? 79  HIS H CD2   1 
ATOM 5837  C CE1   . HIS H 4 79  ? 254.259 264.392 272.637 1.00 37.56  ? 79  HIS H CE1   1 
ATOM 5838  N NE2   . HIS H 4 79  ? 254.186 264.857 271.404 1.00 37.56  ? 79  HIS H NE2   1 
ATOM 5839  N N     . TYR H 4 80  ? 249.169 265.097 270.482 1.00 36.02  ? 80  TYR H N     1 
ATOM 5840  C CA    . TYR H 4 80  ? 248.978 266.386 269.827 1.00 36.02  ? 80  TYR H CA    1 
ATOM 5841  C C     . TYR H 4 80  ? 248.174 267.324 270.703 1.00 36.02  ? 80  TYR H C     1 
ATOM 5842  O O     . TYR H 4 80  ? 248.462 268.522 270.774 1.00 36.02  ? 80  TYR H O     1 
ATOM 5843  C CB    . TYR H 4 80  ? 248.257 266.220 268.490 1.00 36.02  ? 80  TYR H CB    1 
ATOM 5844  C CG    . TYR H 4 80  ? 248.998 265.465 267.420 1.00 36.02  ? 80  TYR H CG    1 
ATOM 5845  C CD1   . TYR H 4 80  ? 250.361 265.276 267.490 1.00 36.02  ? 80  TYR H CD1   1 
ATOM 5846  C CD2   . TYR H 4 80  ? 248.320 264.943 266.333 1.00 36.02  ? 80  TYR H CD2   1 
ATOM 5847  C CE1   . TYR H 4 80  ? 251.028 264.587 266.510 1.00 36.02  ? 80  TYR H CE1   1 
ATOM 5848  C CE2   . TYR H 4 80  ? 248.978 264.251 265.351 1.00 36.02  ? 80  TYR H CE2   1 
ATOM 5849  C CZ    . TYR H 4 80  ? 250.332 264.075 265.444 1.00 36.02  ? 80  TYR H CZ    1 
ATOM 5850  O OH    . TYR H 4 80  ? 251.000 263.387 264.465 1.00 36.02  ? 80  TYR H OH    1 
ATOM 5851  N N     . ASN H 4 81  ? 247.150 266.805 271.363 1.00 37.00  ? 81  ASN H N     1 
ATOM 5852  C CA    . ASN H 4 81  ? 246.294 267.629 272.195 1.00 37.00  ? 81  ASN H CA    1 
ATOM 5853  C C     . ASN H 4 81  ? 246.765 267.690 273.637 1.00 37.00  ? 81  ASN H C     1 
ATOM 5854  O O     . ASN H 4 81  ? 246.034 268.193 274.492 1.00 37.00  ? 81  ASN H O     1 
ATOM 5855  C CB    . ASN H 4 81  ? 244.862 267.120 272.109 1.00 37.00  ? 81  ASN H CB    1 
ATOM 5856  C CG    . ASN H 4 81  ? 244.314 267.208 270.708 1.00 37.00  ? 81  ASN H CG    1 
ATOM 5857  O OD1   . ASN H 4 81  ? 243.799 268.240 270.301 1.00 37.00  ? 81  ASN H OD1   1 
ATOM 5858  N ND2   . ASN H 4 81  ? 244.444 266.132 269.953 1.00 37.00  ? 81  ASN H ND2   1 
ATOM 5859  N N     . LYS H 4 82  ? 247.970 267.194 273.919 1.00 39.65  ? 82  LYS H N     1 
ATOM 5860  C CA    . LYS H 4 82  ? 248.580 267.275 275.246 1.00 39.65  ? 82  LYS H CA    1 
ATOM 5861  C C     . LYS H 4 82  ? 247.693 266.644 276.314 1.00 39.65  ? 82  LYS H C     1 
ATOM 5862  O O     . LYS H 4 82  ? 247.535 267.176 277.411 1.00 39.65  ? 82  LYS H O     1 
ATOM 5863  C CB    . LYS H 4 82  ? 248.932 268.721 275.599 1.00 39.65  ? 82  LYS H CB    1 
ATOM 5864  C CG    . LYS H 4 82  ? 250.158 269.240 274.861 1.00 39.65  ? 82  LYS H CG    1 
ATOM 5865  C CD    . LYS H 4 82  ? 250.143 270.750 274.723 1.00 39.65  ? 82  LYS H CD    1 
ATOM 5866  C CE    . LYS H 4 82  ? 249.892 271.437 276.057 1.00 39.65  ? 82  LYS H CE    1 
ATOM 5867  N NZ    . LYS H 4 82  ? 250.953 271.155 277.063 1.00 39.65  ? 82  LYS H NZ    1 
ATOM 5868  N N     . ARG H 4 83  ? 247.105 265.503 275.984 1.00 41.48  ? 83  ARG H N     1 
ATOM 5869  C CA    . ARG H 4 83  ? 246.326 264.714 276.921 1.00 41.48  ? 83  ARG H CA    1 
ATOM 5870  C C     . ARG H 4 83  ? 247.107 263.478 277.338 1.00 41.48  ? 83  ARG H C     1 
ATOM 5871  O O     . ARG H 4 83  ? 247.979 262.999 276.613 1.00 41.48  ? 83  ARG H O     1 
ATOM 5872  C CB    . ARG H 4 83  ? 244.994 264.294 276.307 1.00 41.48  ? 83  ARG H CB    1 
ATOM 5873  C CG    . ARG H 4 83  ? 244.077 265.439 275.976 1.00 41.48  ? 83  ARG H CG    1 
ATOM 5874  C CD    . ARG H 4 83  ? 243.271 265.848 277.184 1.00 41.48  ? 83  ARG H CD    1 
ATOM 5875  N NE    . ARG H 4 83  ? 242.333 266.916 276.868 1.00 41.48  ? 83  ARG H NE    1 
ATOM 5876  C CZ    . ARG H 4 83  ? 242.600 268.203 277.038 1.00 41.48  ? 83  ARG H CZ    1 
ATOM 5877  N NH1   . ARG H 4 83  ? 243.774 268.572 277.525 1.00 41.48  ? 83  ARG H NH1   1 
ATOM 5878  N NH2   . ARG H 4 83  ? 241.696 269.119 276.723 1.00 41.48  ? 83  ARG H NH2   1 
ATOM 5879  N N     . SER H 4 84  ? 246.788 262.966 278.518 1.00 42.28  ? 84  SER H N     1 
ATOM 5880  C CA    . SER H 4 84  ? 247.404 261.751 279.019 1.00 42.28  ? 84  SER H CA    1 
ATOM 5881  C C     . SER H 4 84  ? 246.567 260.514 278.756 1.00 42.28  ? 84  SER H C     1 
ATOM 5882  O O     . SER H 4 84  ? 247.088 259.403 278.854 1.00 42.28  ? 84  SER H O     1 
ATOM 5883  C CB    . SER H 4 84  ? 247.654 261.865 280.523 1.00 42.28  ? 84  SER H CB    1 
ATOM 5884  O OG    . SER H 4 84  ? 248.261 263.098 280.845 1.00 42.28  ? 84  SER H OG    1 
ATOM 5885  N N     . THR H 4 85  ? 245.301 260.678 278.403 1.00 39.95  ? 85  THR H N     1 
ATOM 5886  C CA    . THR H 4 85  ? 244.350 259.581 278.359 1.00 39.95  ? 85  THR H CA    1 
ATOM 5887  C C     . THR H 4 85  ? 243.883 259.350 276.934 1.00 39.95  ? 85  THR H C     1 
ATOM 5888  O O     . THR H 4 85  ? 243.581 260.302 276.212 1.00 39.95  ? 85  THR H O     1 
ATOM 5889  C CB    . THR H 4 85  ? 243.147 259.869 279.256 1.00 39.95  ? 85  THR H CB    1 
ATOM 5890  O OG1   . THR H 4 85  ? 243.605 260.279 280.546 1.00 39.95  ? 85  THR H OG1   1 
ATOM 5891  C CG2   . THR H 4 85  ? 242.282 258.640 279.408 1.00 39.95  ? 85  THR H CG2   1 
ATOM 5892  N N     . ILE H 4 86  ? 243.836 258.088 276.535 1.00 36.84  ? 86  ILE H N     1 
ATOM 5893  C CA    . ILE H 4 86  ? 243.153 257.679 275.317 1.00 36.84  ? 86  ILE H CA    1 
ATOM 5894  C C     . ILE H 4 86  ? 241.720 257.341 275.689 1.00 36.84  ? 86  ILE H C     1 
ATOM 5895  O O     . ILE H 4 86  ? 241.479 256.445 276.500 1.00 36.84  ? 86  ILE H O     1 
ATOM 5896  C CB    . ILE H 4 86  ? 243.853 256.488 274.655 1.00 36.84  ? 86  ILE H CB    1 
ATOM 5897  C CG1   . ILE H 4 86  ? 245.175 256.940 274.048 1.00 36.84  ? 86  ILE H CG1   1 
ATOM 5898  C CG2   . ILE H 4 86  ? 242.961 255.867 273.598 1.00 36.84  ? 86  ILE H CG2   1 
ATOM 5899  C CD1   . ILE H 4 86  ? 245.929 255.850 273.390 1.00 36.84  ? 86  ILE H CD1   1 
ATOM 5900  N N     . THR H 4 87  ? 240.775 258.067 275.118 1.00 36.00  ? 87  THR H N     1 
ATOM 5901  C CA    . THR H 4 87  ? 239.369 257.923 275.439 1.00 36.00  ? 87  THR H CA    1 
ATOM 5902  C C     . THR H 4 87  ? 238.602 257.463 274.206 1.00 36.00  ? 87  THR H C     1 
ATOM 5903  O O     . THR H 4 87  ? 239.163 257.293 273.120 1.00 36.00  ? 87  THR H O     1 
ATOM 5904  C CB    . THR H 4 87  ? 238.794 259.238 275.967 1.00 36.00  ? 87  THR H CB    1 
ATOM 5905  O OG1   . THR H 4 87  ? 238.884 260.239 274.951 1.00 36.00  ? 87  THR H OG1   1 
ATOM 5906  C CG2   . THR H 4 87  ? 239.560 259.700 277.180 1.00 36.00  ? 87  THR H CG2   1 
ATOM 5907  N N     . SER H 4 88  ? 237.297 257.270 274.394 1.00 35.82  ? 88  SER H N     1 
ATOM 5908  C CA    . SER H 4 88  ? 236.444 256.839 273.295 1.00 35.82  ? 88  SER H CA    1 
ATOM 5909  C C     . SER H 4 88  ? 236.469 257.835 272.151 1.00 35.82  ? 88  SER H C     1 
ATOM 5910  O O     . SER H 4 88  ? 236.379 257.447 270.987 1.00 35.82  ? 88  SER H O     1 
ATOM 5911  C CB    . SER H 4 88  ? 235.012 256.641 273.772 1.00 35.82  ? 88  SER H CB    1 
ATOM 5912  O OG    . SER H 4 88  ? 234.954 255.703 274.817 1.00 35.82  ? 88  SER H OG    1 
ATOM 5913  N N     . ARG H 4 89  ? 236.607 259.123 272.449 1.00 36.03  ? 89  ARG H N     1 
ATOM 5914  C CA    . ARG H 4 89  ? 236.598 260.081 271.355 1.00 36.03  ? 89  ARG H CA    1 
ATOM 5915  C C     . ARG H 4 89  ? 237.948 260.166 270.653 1.00 36.03  ? 89  ARG H C     1 
ATOM 5916  O O     . ARG H 4 89  ? 237.991 260.486 269.463 1.00 36.03  ? 89  ARG H O     1 
ATOM 5917  C CB    . ARG H 4 89  ? 236.136 261.451 271.843 1.00 36.03  ? 89  ARG H CB    1 
ATOM 5918  C CG    . ARG H 4 89  ? 237.122 262.236 272.632 1.00 36.03  ? 89  ARG H CG    1 
ATOM 5919  C CD    . ARG H 4 89  ? 236.486 263.542 273.074 1.00 36.03  ? 89  ARG H CD    1 
ATOM 5920  N NE    . ARG H 4 89  ? 236.029 264.346 271.944 1.00 36.03  ? 89  ARG H NE    1 
ATOM 5921  C CZ    . ARG H 4 89  ? 236.750 265.303 271.375 1.00 36.03  ? 89  ARG H CZ    1 
ATOM 5922  N NH1   . ARG H 4 89  ? 237.957 265.575 271.837 1.00 36.03  ? 89  ARG H NH1   1 
ATOM 5923  N NH2   . ARG H 4 89  ? 236.267 265.991 270.353 1.00 36.03  ? 89  ARG H NH2   1 
ATOM 5924  N N     . GLU H 4 90  ? 239.050 259.851 271.334 1.00 36.22  ? 90  GLU H N     1 
ATOM 5925  C CA    . GLU H 4 90  ? 240.299 259.646 270.607 1.00 36.22  ? 90  GLU H CA    1 
ATOM 5926  C C     . GLU H 4 90  ? 240.183 258.447 269.682 1.00 36.22  ? 90  GLU H C     1 
ATOM 5927  O O     . GLU H 4 90  ? 240.620 258.495 268.529 1.00 36.22  ? 90  GLU H O     1 
ATOM 5928  C CB    . GLU H 4 90  ? 241.471 259.454 271.564 1.00 36.22  ? 90  GLU H CB    1 
ATOM 5929  C CG    . GLU H 4 90  ? 242.207 260.710 271.929 1.00 36.22  ? 90  GLU H CG    1 
ATOM 5930  C CD    . GLU H 4 90  ? 241.636 261.365 273.156 1.00 36.22  ? 90  GLU H CD    1 
ATOM 5931  O OE1   . GLU H 4 90  ? 240.750 260.762 273.788 1.00 36.22  ? 90  GLU H OE1   1 
ATOM 5932  O OE2   . GLU H 4 90  ? 242.069 262.485 273.492 1.00 36.22  ? 90  GLU H OE2   1 
ATOM 5933  N N     . ILE H 4 91  ? 239.585 257.359 270.170 1.00 34.55  ? 91  ILE H N     1 
ATOM 5934  C CA    . ILE H 4 91  ? 239.395 256.191 269.314 1.00 34.55  ? 91  ILE H CA    1 
ATOM 5935  C C     . ILE H 4 91  ? 238.498 256.543 268.133 1.00 34.55  ? 91  ILE H C     1 
ATOM 5936  O O     . ILE H 4 91  ? 238.728 256.103 267.005 1.00 34.55  ? 91  ILE H O     1 
ATOM 5937  C CB    . ILE H 4 91  ? 238.832 255.008 270.124 1.00 34.55  ? 91  ILE H CB    1 
ATOM 5938  C CG1   . ILE H 4 91  ? 239.830 254.550 271.184 1.00 34.55  ? 91  ILE H CG1   1 
ATOM 5939  C CG2   . ILE H 4 91  ? 238.500 253.853 269.214 1.00 34.55  ? 91  ILE H CG2   1 
ATOM 5940  C CD1   . ILE H 4 91  ? 241.173 254.184 270.633 1.00 34.55  ? 91  ILE H CD1   1 
ATOM 5941  N N     . GLN H 4 92  ? 237.489 257.378 268.367 1.00 34.91  ? 92  GLN H N     1 
ATOM 5942  C CA    . GLN H 4 92  ? 236.572 257.764 267.304 1.00 34.91  ? 92  GLN H CA    1 
ATOM 5943  C C     . GLN H 4 92  ? 237.257 258.628 266.256 1.00 34.91  ? 92  GLN H C     1 
ATOM 5944  O O     . GLN H 4 92  ? 237.065 258.422 265.054 1.00 34.91  ? 92  GLN H O     1 
ATOM 5945  C CB    . GLN H 4 92  ? 235.382 258.498 267.900 1.00 34.91  ? 92  GLN H CB    1 
ATOM 5946  C CG    . GLN H 4 92  ? 234.301 258.815 266.911 1.00 34.91  ? 92  GLN H CG    1 
ATOM 5947  C CD    . GLN H 4 92  ? 233.140 259.498 267.566 1.00 34.91  ? 92  GLN H CD    1 
ATOM 5948  O OE1   . GLN H 4 92  ? 233.204 259.852 268.735 1.00 34.91  ? 92  GLN H OE1   1 
ATOM 5949  N NE2   . GLN H 4 92  ? 232.067 259.685 266.824 1.00 34.91  ? 92  GLN H NE2   1 
ATOM 5950  N N     . THR H 4 93  ? 238.041 259.615 266.688 1.00 34.01  ? 93  THR H N     1 
ATOM 5951  C CA    . THR H 4 93  ? 238.769 260.428 265.727 1.00 34.01  ? 93  THR H CA    1 
ATOM 5952  C C     . THR H 4 93  ? 239.764 259.583 264.950 1.00 34.01  ? 93  THR H C     1 
ATOM 5953  O O     . THR H 4 93  ? 239.923 259.760 263.741 1.00 34.01  ? 93  THR H O     1 
ATOM 5954  C CB    . THR H 4 93  ? 239.472 261.584 266.432 1.00 34.01  ? 93  THR H CB    1 
ATOM 5955  O OG1   . THR H 4 93  ? 238.500 262.399 267.089 1.00 34.01  ? 93  THR H OG1   1 
ATOM 5956  C CG2   . THR H 4 93  ? 240.223 262.428 265.438 1.00 34.01  ? 93  THR H CG2   1 
ATOM 5957  N N     . ALA H 4 94  ? 240.424 258.638 265.619 1.00 33.92  ? 94  ALA H N     1 
ATOM 5958  C CA    . ALA H 4 94  ? 241.346 257.748 264.925 1.00 33.92  ? 94  ALA H CA    1 
ATOM 5959  C C     . ALA H 4 94  ? 240.626 256.908 263.880 1.00 33.92  ? 94  ALA H C     1 
ATOM 5960  O O     . ALA H 4 94  ? 241.147 256.691 262.782 1.00 33.92  ? 94  ALA H O     1 
ATOM 5961  C CB    . ALA H 4 94  ? 242.062 256.853 265.932 1.00 33.92  ? 94  ALA H CB    1 
ATOM 5962  N N     . VAL H 4 95  ? 239.430 256.424 264.200 1.00 34.06  ? 95  VAL H N     1 
ATOM 5963  C CA    . VAL H 4 95  ? 238.672 255.647 263.228 1.00 34.06  ? 95  VAL H CA    1 
ATOM 5964  C C     . VAL H 4 95  ? 238.289 256.520 262.044 1.00 34.06  ? 95  VAL H C     1 
ATOM 5965  O O     . VAL H 4 95  ? 238.416 256.111 260.887 1.00 34.06  ? 95  VAL H O     1 
ATOM 5966  C CB    . VAL H 4 95  ? 237.440 255.008 263.893 1.00 34.06  ? 95  VAL H CB    1 
ATOM 5967  C CG1   . VAL H 4 95  ? 236.537 254.400 262.855 1.00 34.06  ? 95  VAL H CG1   1 
ATOM 5968  C CG2   . VAL H 4 95  ? 237.867 253.959 264.876 1.00 34.06  ? 95  VAL H CG2   1 
ATOM 5969  N N     . ARG H 4 96  ? 237.837 257.743 262.312 1.00 35.26  ? 96  ARG H N     1 
ATOM 5970  C CA    . ARG H 4 96  ? 237.466 258.642 261.227 1.00 35.26  ? 96  ARG H CA    1 
ATOM 5971  C C     . ARG H 4 96  ? 238.663 259.015 260.364 1.00 35.26  ? 96  ARG H C     1 
ATOM 5972  O O     . ARG H 4 96  ? 238.500 259.301 259.176 1.00 35.26  ? 96  ARG H O     1 
ATOM 5973  C CB    . ARG H 4 96  ? 236.815 259.900 261.789 1.00 35.26  ? 96  ARG H CB    1 
ATOM 5974  C CG    . ARG H 4 96  ? 235.416 259.705 262.315 1.00 35.26  ? 96  ARG H CG    1 
ATOM 5975  C CD    . ARG H 4 96  ? 234.853 261.035 262.747 1.00 35.26  ? 96  ARG H CD    1 
ATOM 5976  N NE    . ARG H 4 96  ? 235.026 262.023 261.686 1.00 35.26  ? 96  ARG H NE    1 
ATOM 5977  C CZ    . ARG H 4 96  ? 235.167 263.330 261.881 1.00 35.26  ? 96  ARG H CZ    1 
ATOM 5978  N NH1   . ARG H 4 96  ? 235.164 263.829 263.106 1.00 35.26  ? 96  ARG H NH1   1 
ATOM 5979  N NH2   . ARG H 4 96  ? 235.320 264.138 260.843 1.00 35.26  ? 96  ARG H NH2   1 
ATOM 5980  N N     . LEU H 4 97  ? 239.861 259.031 260.939 1.00 34.71  ? 97  LEU H N     1 
ATOM 5981  C CA    . LEU H 4 97  ? 241.055 259.342 260.165 1.00 34.71  ? 97  LEU H CA    1 
ATOM 5982  C C     . LEU H 4 97  ? 241.500 258.161 259.319 1.00 34.71  ? 97  LEU H C     1 
ATOM 5983  O O     . LEU H 4 97  ? 241.849 258.334 258.149 1.00 34.71  ? 97  LEU H O     1 
ATOM 5984  C CB    . LEU H 4 97  ? 242.191 259.766 261.088 1.00 34.71  ? 97  LEU H CB    1 
ATOM 5985  C CG    . LEU H 4 97  ? 242.131 261.167 261.683 1.00 34.71  ? 97  LEU H CG    1 
ATOM 5986  C CD1   . LEU H 4 97  ? 243.067 261.269 262.859 1.00 34.71  ? 97  LEU H CD1   1 
ATOM 5987  C CD2   . LEU H 4 97  ? 242.493 262.191 260.639 1.00 34.71  ? 97  LEU H CD2   1 
ATOM 5988  N N     . LEU H 4 98  ? 241.476 256.958 259.882 1.00 35.33  ? 98  LEU H N     1 
ATOM 5989  C CA    . LEU H 4 98  ? 242.045 255.793 259.222 1.00 35.33  ? 98  LEU H CA    1 
ATOM 5990  C C     . LEU H 4 98  ? 241.070 255.047 258.332 1.00 35.33  ? 98  LEU H C     1 
ATOM 5991  O O     . LEU H 4 98  ? 241.506 254.396 257.382 1.00 35.33  ? 98  LEU H O     1 
ATOM 5992  C CB    . LEU H 4 98  ? 242.598 254.822 260.261 1.00 35.33  ? 98  LEU H CB    1 
ATOM 5993  C CG    . LEU H 4 98  ? 243.720 255.411 261.101 1.00 35.33  ? 98  LEU H CG    1 
ATOM 5994  C CD1   . LEU H 4 98  ? 243.897 254.573 262.327 1.00 35.33  ? 98  LEU H CD1   1 
ATOM 5995  C CD2   . LEU H 4 98  ? 244.998 255.460 260.301 1.00 35.33  ? 98  LEU H CD2   1 
ATOM 5996  N N     . LEU H 4 99  ? 239.830 255.112 258.591 1.00 36.91  ? 99  LEU H N     1 
ATOM 5997  C CA    . LEU H 4 99  ? 239.032 254.255 257.739 1.00 36.91  ? 99  LEU H CA    1 
ATOM 5998  C C     . LEU H 4 99  ? 238.459 255.031 256.563 1.00 36.91  ? 99  LEU H C     1 
ATOM 5999  O O     . LEU H 4 99  ? 238.174 256.225 256.670 1.00 36.91  ? 99  LEU H O     1 
ATOM 6000  C CB    . LEU H 4 99  ? 237.891 253.605 258.522 1.00 36.91  ? 99  LEU H CB    1 
ATOM 6001  C CG    . LEU H 4 99  ? 238.278 252.685 259.676 1.00 36.91  ? 99  LEU H CG    1 
ATOM 6002  C CD1   . LEU H 4 99  ? 237.085 251.871 260.089 1.00 36.91  ? 99  LEU H CD1   1 
ATOM 6003  C CD2   . LEU H 4 99  ? 239.428 251.788 259.302 1.00 36.91  ? 99  LEU H CD2   1 
ATOM 6004  N N     . PRO H 4 100 ? 238.288 254.359 255.442 1.00 39.89  ? 100 PRO H N     1 
ATOM 6005  C CA    . PRO H 4 100 ? 237.802 255.025 254.229 1.00 39.89  ? 100 PRO H CA    1 
ATOM 6006  C C     . PRO H 4 100 ? 236.297 255.213 254.168 1.00 39.89  ? 100 PRO H C     1 
ATOM 6007  O O     . PRO H 4 100 ? 235.594 254.315 253.708 1.00 39.89  ? 100 PRO H O     1 
ATOM 6008  C CB    . PRO H 4 100 ? 238.269 254.085 253.109 1.00 39.89  ? 100 PRO H CB    1 
ATOM 6009  C CG    . PRO H 4 100 ? 239.220 253.132 253.752 1.00 39.89  ? 100 PRO H CG    1 
ATOM 6010  C CD    . PRO H 4 100 ? 238.773 253.005 255.153 1.00 39.89  ? 100 PRO H CD    1 
ATOM 6011  N N     . GLY H 4 101 ? 235.779 256.330 254.662 1.00 40.94  ? 101 GLY H N     1 
ATOM 6012  C CA    . GLY H 4 101 ? 234.432 256.735 254.302 1.00 40.94  ? 101 GLY H CA    1 
ATOM 6013  C C     . GLY H 4 101 ? 233.286 255.962 254.918 1.00 40.94  ? 101 GLY H C     1 
ATOM 6014  O O     . GLY H 4 101 ? 232.997 256.114 256.109 1.00 40.94  ? 101 GLY H O     1 
ATOM 6015  N N     . GLU H 4 102 ? 232.601 255.156 254.101 1.00 41.47  ? 102 GLU H N     1 
ATOM 6016  C CA    . GLU H 4 102 ? 231.460 254.393 254.595 1.00 41.47  ? 102 GLU H CA    1 
ATOM 6017  C C     . GLU H 4 102 ? 231.882 253.409 255.672 1.00 41.47  ? 102 GLU H C     1 
ATOM 6018  O O     . GLU H 4 102 ? 231.161 253.208 256.658 1.00 41.47  ? 102 GLU H O     1 
ATOM 6019  C CB    . GLU H 4 102 ? 230.777 253.656 253.446 1.00 41.47  ? 102 GLU H CB    1 
ATOM 6020  C CG    . GLU H 4 102 ? 230.077 254.570 252.475 1.00 41.47  ? 102 GLU H CG    1 
ATOM 6021  C CD    . GLU H 4 102 ? 228.889 255.263 253.099 1.00 41.47  ? 102 GLU H CD    1 
ATOM 6022  O OE1   . GLU H 4 102 ? 227.879 254.579 253.367 1.00 41.47  ? 102 GLU H OE1   1 
ATOM 6023  O OE2   . GLU H 4 102 ? 228.965 256.485 253.333 1.00 41.47  ? 102 GLU H OE2   1 
ATOM 6024  N N     . LEU H 4 103 ? 233.039 252.770 255.489 1.00 39.67  ? 103 LEU H N     1 
ATOM 6025  C CA    . LEU H 4 103 ? 233.613 251.971 256.560 1.00 39.67  ? 103 LEU H CA    1 
ATOM 6026  C C     . LEU H 4 103 ? 233.715 252.782 257.835 1.00 39.67  ? 103 LEU H C     1 
ATOM 6027  O O     . LEU H 4 103 ? 233.322 252.315 258.906 1.00 39.67  ? 103 LEU H O     1 
ATOM 6028  C CB    . LEU H 4 103 ? 234.994 251.456 256.167 1.00 39.67  ? 103 LEU H CB    1 
ATOM 6029  C CG    . LEU H 4 103 ? 235.108 250.115 255.460 1.00 39.67  ? 103 LEU H CG    1 
ATOM 6030  C CD1   . LEU H 4 103 ? 236.553 249.693 255.451 1.00 39.67  ? 103 LEU H CD1   1 
ATOM 6031  C CD2   . LEU H 4 103 ? 234.260 249.090 256.162 1.00 39.67  ? 103 LEU H CD2   1 
ATOM 6032  N N     . ALA H 4 104 ? 234.222 254.010 257.733 1.00 39.25  ? 104 ALA H N     1 
ATOM 6033  C CA    . ALA H 4 104 ? 234.425 254.830 258.918 1.00 39.25  ? 104 ALA H CA    1 
ATOM 6034  C C     . ALA H 4 104 ? 233.108 255.172 259.594 1.00 39.25  ? 104 ALA H C     1 
ATOM 6035  O O     . ALA H 4 104 ? 233.022 255.154 260.823 1.00 39.25  ? 104 ALA H O     1 
ATOM 6036  C CB    . ALA H 4 104 ? 235.189 256.102 258.561 1.00 39.25  ? 104 ALA H CB    1 
ATOM 6037  N N     . LYS H 4 105 ? 232.062 255.466 258.822 1.00 40.02  ? 105 LYS H N     1 
ATOM 6038  C CA    . LYS H 4 105 ? 230.820 255.877 259.470 1.00 40.02  ? 105 LYS H CA    1 
ATOM 6039  C C     . LYS H 4 105 ? 230.089 254.690 260.082 1.00 40.02  ? 105 LYS H C     1 
ATOM 6040  O O     . LYS H 4 105 ? 229.527 254.804 261.177 1.00 40.02  ? 105 LYS H O     1 
ATOM 6041  C CB    . LYS H 4 105 ? 229.918 256.635 258.500 1.00 40.02  ? 105 LYS H CB    1 
ATOM 6042  C CG    . LYS H 4 105 ? 229.331 255.829 257.378 1.00 40.02  ? 105 LYS H CG    1 
ATOM 6043  C CD    . LYS H 4 105 ? 228.287 256.650 256.644 1.00 40.02  ? 105 LYS H CD    1 
ATOM 6044  C CE    . LYS H 4 105 ? 228.784 258.069 256.392 1.00 40.02  ? 105 LYS H CE    1 
ATOM 6045  N NZ    . LYS H 4 105 ? 230.020 258.099 255.562 1.00 40.02  ? 105 LYS H NZ    1 
ATOM 6046  N N     . HIS H 4 106 ? 230.118 253.531 259.427 1.00 39.75  ? 106 HIS H N     1 
ATOM 6047  C CA    . HIS H 4 106 ? 229.527 252.354 260.051 1.00 39.75  ? 106 HIS H CA    1 
ATOM 6048  C C     . HIS H 4 106 ? 230.326 251.915 261.269 1.00 39.75  ? 106 HIS H C     1 
ATOM 6049  O O     . HIS H 4 106 ? 229.753 251.442 262.255 1.00 39.75  ? 106 HIS H O     1 
ATOM 6050  C CB    . HIS H 4 106 ? 229.412 251.220 259.042 1.00 39.75  ? 106 HIS H CB    1 
ATOM 6051  C CG    . HIS H 4 106 ? 228.371 251.455 257.998 1.00 39.75  ? 106 HIS H CG    1 
ATOM 6052  N ND1   . HIS H 4 106 ? 227.217 250.709 257.915 1.00 39.75  ? 106 HIS H ND1   1 
ATOM 6053  C CD2   . HIS H 4 106 ? 228.301 252.367 257.002 1.00 39.75  ? 106 HIS H CD2   1 
ATOM 6054  C CE1   . HIS H 4 106 ? 226.486 251.145 256.907 1.00 39.75  ? 106 HIS H CE1   1 
ATOM 6055  N NE2   . HIS H 4 106 ? 227.121 252.151 256.336 1.00 39.75  ? 106 HIS H NE2   1 
ATOM 6056  N N     . ALA H 4 107 ? 231.648 252.070 261.228 1.00 38.27  ? 107 ALA H N     1 
ATOM 6057  C CA    . ALA H 4 107 ? 232.465 251.708 262.375 1.00 38.27  ? 107 ALA H CA    1 
ATOM 6058  C C     . ALA H 4 107 ? 232.209 252.642 263.544 1.00 38.27  ? 107 ALA H C     1 
ATOM 6059  O O     . ALA H 4 107 ? 232.140 252.198 264.692 1.00 38.27  ? 107 ALA H O     1 
ATOM 6060  C CB    . ALA H 4 107 ? 233.941 251.721 261.991 1.00 38.27  ? 107 ALA H CB    1 
ATOM 6061  N N     . VAL H 4 108 ? 232.078 253.940 263.274 1.00 38.12  ? 108 VAL H N     1 
ATOM 6062  C CA    . VAL H 4 108 ? 231.732 254.889 264.323 1.00 38.12  ? 108 VAL H CA    1 
ATOM 6063  C C     . VAL H 4 108 ? 230.369 254.558 264.911 1.00 38.12  ? 108 VAL H C     1 
ATOM 6064  O O     . VAL H 4 108 ? 230.172 254.617 266.129 1.00 38.12  ? 108 VAL H O     1 
ATOM 6065  C CB    . VAL H 4 108 ? 231.785 256.325 263.775 1.00 38.12  ? 108 VAL H CB    1 
ATOM 6066  C CG1   . VAL H 4 108 ? 231.076 257.279 264.704 1.00 38.12  ? 108 VAL H CG1   1 
ATOM 6067  C CG2   . VAL H 4 108 ? 233.218 256.753 263.585 1.00 38.12  ? 108 VAL H CG2   1 
ATOM 6068  N N     . SER H 4 109 ? 229.407 254.204 264.060 1.00 39.62  ? 109 SER H N     1 
ATOM 6069  C CA    . SER H 4 109 ? 228.096 253.806 264.555 1.00 39.62  ? 109 SER H CA    1 
ATOM 6070  C C     . SER H 4 109 ? 228.199 252.605 265.489 1.00 39.62  ? 109 SER H C     1 
ATOM 6071  O O     . SER H 4 109 ? 227.664 252.628 266.603 1.00 39.62  ? 109 SER H O     1 
ATOM 6072  C CB    . SER H 4 109 ? 227.171 253.502 263.381 1.00 39.62  ? 109 SER H CB    1 
ATOM 6073  O OG    . SER H 4 109 ? 225.921 253.029 263.834 1.00 39.62  ? 109 SER H OG    1 
ATOM 6074  N N     . GLU H 4 110 ? 228.887 251.546 265.052 1.00 39.95  ? 110 GLU H N     1 
ATOM 6075  C CA    . GLU H 4 110 ? 229.043 250.362 265.895 1.00 39.95  ? 110 GLU H CA    1 
ATOM 6076  C C     . GLU H 4 110 ? 229.733 250.703 267.208 1.00 39.95  ? 110 GLU H C     1 
ATOM 6077  O O     . GLU H 4 110 ? 229.309 250.250 268.278 1.00 39.95  ? 110 GLU H O     1 
ATOM 6078  C CB    . GLU H 4 110 ? 229.835 249.282 265.162 1.00 39.95  ? 110 GLU H CB    1 
ATOM 6079  C CG    . GLU H 4 110 ? 229.177 248.772 263.912 1.00 39.95  ? 110 GLU H CG    1 
ATOM 6080  C CD    . GLU H 4 110 ? 227.806 248.209 264.177 1.00 39.95  ? 110 GLU H CD    1 
ATOM 6081  O OE1   . GLU H 4 110 ? 227.717 247.129 264.795 1.00 39.95  ? 110 GLU H OE1   1 
ATOM 6082  O OE2   . GLU H 4 110 ? 226.816 248.858 263.784 1.00 39.95  ? 110 GLU H OE2   1 
ATOM 6083  N N     . GLY H 4 111 ? 230.797 251.502 267.144 1.00 38.24  ? 111 GLY H N     1 
ATOM 6084  C CA    . GLY H 4 111 ? 231.548 251.823 268.343 1.00 38.24  ? 111 GLY H CA    1 
ATOM 6085  C C     . GLY H 4 111 ? 230.747 252.625 269.346 1.00 38.24  ? 111 GLY H C     1 
ATOM 6086  O O     . GLY H 4 111 ? 230.773 252.334 270.544 1.00 38.24  ? 111 GLY H O     1 
ATOM 6087  N N     . THR H 4 112 ? 230.020 253.641 268.878 1.00 39.17  ? 112 THR H N     1 
ATOM 6088  C CA    . THR H 4 112 ? 229.237 254.452 269.802 1.00 39.17  ? 112 THR H CA    1 
ATOM 6089  C C     . THR H 4 112 ? 228.054 253.671 270.348 1.00 39.17  ? 112 THR H C     1 
ATOM 6090  O O     . THR H 4 112 ? 227.692 253.834 271.515 1.00 39.17  ? 112 THR H O     1 
ATOM 6091  C CB    . THR H 4 112 ? 228.758 255.739 269.137 1.00 39.17  ? 112 THR H CB    1 
ATOM 6092  O OG1   . THR H 4 112 ? 227.891 255.426 268.047 1.00 39.17  ? 112 THR H OG1   1 
ATOM 6093  C CG2   . THR H 4 112 ? 229.928 256.543 268.627 1.00 39.17  ? 112 THR H CG2   1 
ATOM 6094  N N     . LYS H 4 113 ? 227.450 252.809 269.531 1.00 39.72  ? 113 LYS H N     1 
ATOM 6095  C CA    . LYS H 4 113 ? 226.391 251.951 270.044 1.00 39.72  ? 113 LYS H CA    1 
ATOM 6096  C C     . LYS H 4 113 ? 226.912 251.049 271.150 1.00 39.72  ? 113 LYS H C     1 
ATOM 6097  O O     . LYS H 4 113 ? 226.264 250.889 272.190 1.00 39.72  ? 113 LYS H O     1 
ATOM 6098  C CB    . LYS H 4 113 ? 225.798 251.125 268.908 1.00 39.72  ? 113 LYS H CB    1 
ATOM 6099  C CG    . LYS H 4 113 ? 224.759 250.129 269.341 1.00 39.72  ? 113 LYS H CG    1 
ATOM 6100  C CD    . LYS H 4 113 ? 224.384 249.223 268.196 1.00 39.72  ? 113 LYS H CD    1 
ATOM 6101  C CE    . LYS H 4 113 ? 225.599 248.482 267.680 1.00 39.72  ? 113 LYS H CE    1 
ATOM 6102  N NZ    . LYS H 4 113 ? 225.317 247.759 266.415 1.00 39.72  ? 113 LYS H NZ    1 
ATOM 6103  N N     . ALA H 4 114 ? 228.097 250.470 270.954 1.00 39.33  ? 114 ALA H N     1 
ATOM 6104  C CA    . ALA H 4 114 ? 228.681 249.608 271.974 1.00 39.33  ? 114 ALA H CA    1 
ATOM 6105  C C     . ALA H 4 114 ? 229.004 250.379 273.244 1.00 39.33  ? 114 ALA H C     1 
ATOM 6106  O O     . ALA H 4 114 ? 228.783 249.879 274.347 1.00 39.33  ? 114 ALA H O     1 
ATOM 6107  C CB    . ALA H 4 114 ? 229.935 248.932 271.434 1.00 39.33  ? 114 ALA H CB    1 
ATOM 6108  N N     . VAL H 4 115 ? 229.550 251.587 273.116 1.00 39.48  ? 115 VAL H N     1 
ATOM 6109  C CA    . VAL H 4 115 ? 229.899 252.350 274.311 1.00 39.48  ? 115 VAL H CA    1 
ATOM 6110  C C     . VAL H 4 115 ? 228.643 252.767 275.062 1.00 39.48  ? 115 VAL H C     1 
ATOM 6111  O O     . VAL H 4 115 ? 228.602 252.732 276.296 1.00 39.48  ? 115 VAL H O     1 
ATOM 6112  C CB    . VAL H 4 115 ? 230.777 253.559 273.950 1.00 39.48  ? 115 VAL H CB    1 
ATOM 6113  C CG1   . VAL H 4 115 ? 230.942 254.460 275.145 1.00 39.48  ? 115 VAL H CG1   1 
ATOM 6114  C CG2   . VAL H 4 115 ? 232.129 253.096 273.480 1.00 39.48  ? 115 VAL H CG2   1 
ATOM 6115  N N     . THR H 4 116 ? 227.594 253.149 274.337 1.00 41.34  ? 116 THR H N     1 
ATOM 6116  C CA    . THR H 4 116 ? 226.325 253.472 274.978 1.00 41.34  ? 116 THR H CA    1 
ATOM 6117  C C     . THR H 4 116 ? 225.758 252.266 275.712 1.00 41.34  ? 116 THR H C     1 
ATOM 6118  O O     . THR H 4 116 ? 225.323 252.371 276.865 1.00 41.34  ? 116 THR H O     1 
ATOM 6119  C CB    . THR H 4 116 ? 225.333 253.980 273.934 1.00 41.34  ? 116 THR H CB    1 
ATOM 6120  O OG1   . THR H 4 116 ? 225.784 255.235 273.420 1.00 41.34  ? 116 THR H OG1   1 
ATOM 6121  C CG2   . THR H 4 116 ? 223.962 254.159 274.540 1.00 41.34  ? 116 THR H CG2   1 
ATOM 6122  N N     . LYS H 4 117 ? 225.755 251.106 275.059 1.00 41.57  ? 117 LYS H N     1 
ATOM 6123  C CA    . LYS H 4 117 ? 225.215 249.910 275.693 1.00 41.57  ? 117 LYS H CA    1 
ATOM 6124  C C     . LYS H 4 117 ? 226.032 249.519 276.914 1.00 41.57  ? 117 LYS H C     1 
ATOM 6125  O O     . LYS H 4 117 ? 225.479 249.100 277.933 1.00 41.57  ? 117 LYS H O     1 
ATOM 6126  C CB    . LYS H 4 117 ? 225.167 248.766 274.687 1.00 41.57  ? 117 LYS H CB    1 
ATOM 6127  C CG    . LYS H 4 117 ? 224.683 247.464 275.262 1.00 41.57  ? 117 LYS H CG    1 
ATOM 6128  C CD    . LYS H 4 117 ? 224.413 246.467 274.161 1.00 41.57  ? 117 LYS H CD    1 
ATOM 6129  C CE    . LYS H 4 117 ? 223.660 245.259 274.677 1.00 41.57  ? 117 LYS H CE    1 
ATOM 6130  N NZ    . LYS H 4 117 ? 224.453 244.479 275.664 1.00 41.57  ? 117 LYS H NZ    1 
ATOM 6131  N N     . TYR H 4 118 ? 227.351 249.656 276.832 1.00 41.84  ? 118 TYR H N     1 
ATOM 6132  C CA    . TYR H 4 118 ? 228.203 249.317 277.963 1.00 41.84  ? 118 TYR H CA    1 
ATOM 6133  C C     . TYR H 4 118 ? 227.979 250.273 279.123 1.00 41.84  ? 118 TYR H C     1 
ATOM 6134  O O     . TYR H 4 118 ? 227.921 249.850 280.281 1.00 41.84  ? 118 TYR H O     1 
ATOM 6135  C CB    . TYR H 4 118 ? 229.661 249.329 277.517 1.00 41.84  ? 118 TYR H CB    1 
ATOM 6136  C CG    . TYR H 4 118 ? 230.674 249.250 278.621 1.00 41.84  ? 118 TYR H CG    1 
ATOM 6137  C CD1   . TYR H 4 118 ? 231.079 248.030 279.128 1.00 41.84  ? 118 TYR H CD1   1 
ATOM 6138  C CD2   . TYR H 4 118 ? 231.252 250.394 279.131 1.00 41.84  ? 118 TYR H CD2   1 
ATOM 6139  C CE1   . TYR H 4 118 ? 232.011 247.955 280.125 1.00 41.84  ? 118 TYR H CE1   1 
ATOM 6140  C CE2   . TYR H 4 118 ? 232.185 250.328 280.127 1.00 41.84  ? 118 TYR H CE2   1 
ATOM 6141  C CZ    . TYR H 4 118 ? 232.564 249.106 280.622 1.00 41.84  ? 118 TYR H CZ    1 
ATOM 6142  O OH    . TYR H 4 118 ? 233.500 249.034 281.621 1.00 41.84  ? 118 TYR H OH    1 
ATOM 6143  N N     . THR H 4 119 ? 227.853 251.567 278.833 1.00 43.37  ? 119 THR H N     1 
ATOM 6144  C CA    . THR H 4 119 ? 227.606 252.537 279.891 1.00 43.37  ? 119 THR H CA    1 
ATOM 6145  C C     . THR H 4 119 ? 226.262 252.294 280.563 1.00 43.37  ? 119 THR H C     1 
ATOM 6146  O O     . THR H 4 119 ? 226.147 252.407 281.787 1.00 43.37  ? 119 THR H O     1 
ATOM 6147  C CB    . THR H 4 119 ? 227.668 253.954 279.329 1.00 43.37  ? 119 THR H CB    1 
ATOM 6148  O OG1   . THR H 4 119 ? 228.905 254.141 278.636 1.00 43.37  ? 119 THR H OG1   1 
ATOM 6149  C CG2   . THR H 4 119 ? 227.577 254.963 280.447 1.00 43.37  ? 119 THR H CG2   1 
ATOM 6150  N N     . SER H 4 120 ? 225.232 251.959 279.783 1.00 44.91  ? 120 SER H N     1 
ATOM 6151  C CA    . SER H 4 120 ? 223.930 251.694 280.385 1.00 44.91  ? 120 SER H CA    1 
ATOM 6152  C C     . SER H 4 120 ? 223.968 250.445 281.255 1.00 44.91  ? 120 SER H C     1 
ATOM 6153  O O     . SER H 4 120 ? 223.343 250.408 282.320 1.00 44.91  ? 120 SER H O     1 
ATOM 6154  C CB    . SER H 4 120 ? 222.859 251.557 279.307 1.00 44.91  ? 120 SER H CB    1 
ATOM 6155  O OG    . SER H 4 120 ? 222.883 250.269 278.723 1.00 44.91  ? 120 SER H OG    1 
ATOM 6156  N N     . ALA H 4 121 ? 224.689 249.412 280.822 1.00 46.42  ? 121 ALA H N     1 
ATOM 6157  C CA    . ALA H 4 121 ? 224.806 248.195 281.615 1.00 46.42  ? 121 ALA H CA    1 
ATOM 6158  C C     . ALA H 4 121 ? 225.470 248.504 282.947 1.00 46.42  ? 121 ALA H C     1 
ATOM 6159  O O     . ALA H 4 121 ? 224.826 248.419 283.997 1.00 46.42  ? 121 ALA H O     1 
ATOM 6160  C CB    . ALA H 4 121 ? 225.597 247.125 280.864 1.00 46.42  ? 121 ALA H CB    1 
ATOM 6161  N N     . LYS H 4 122 ? 226.738 248.901 282.902 1.00 48.04  ? 122 LYS H N     1 
ATOM 6162  C CA    . LYS H 4 122 ? 227.495 249.295 284.085 1.00 48.04  ? 122 LYS H CA    1 
ATOM 6163  C C     . LYS H 4 122 ? 228.885 249.782 283.679 1.00 48.04  ? 122 LYS H C     1 
ATOM 6164  O O     . LYS H 4 122 ? 229.555 249.157 282.860 1.00 48.04  ? 122 LYS H O     1 
ATOM 6165  C CB    . LYS H 4 122 ? 227.609 248.137 285.078 1.00 48.04  ? 122 LYS H CB    1 
ATOM 6166  C CG    . LYS H 4 122 ? 226.842 248.359 286.376 1.00 48.04  ? 122 LYS H CG    1 
ATOM 6167  C CD    . LYS H 4 122 ? 226.582 247.046 287.103 1.00 48.04  ? 122 LYS H CD    1 
ATOM 6168  C CE    . LYS H 4 122 ? 225.579 246.189 286.345 1.00 48.04  ? 122 LYS H CE    1 
ATOM 6169  N NZ    . LYS H 4 122 ? 225.381 244.861 286.992 1.00 48.04  ? 122 LYS H NZ    1 
ATOM 6170  O OXT   . LYS H 4 122 ? 229.373 250.807 284.153 1.00 48.04  ? 122 LYS H OXT   1 
ATOM 6171  P P     . DT  I 5 8   ? 267.838 275.144 192.955 1.00 140.05 ? -76 DT  I P     1 
ATOM 6172  O OP1   . DT  I 5 8   ? 266.599 274.759 192.244 1.00 140.05 ? -76 DT  I OP1   1 
ATOM 6173  O OP2   . DT  I 5 8   ? 267.783 276.154 194.036 1.00 140.05 ? -76 DT  I OP2   1 
ATOM 6174  O "O5'" . DT  I 5 8   ? 268.543 273.828 193.534 1.00 140.05 ? -76 DT  I "O5'" 1 
ATOM 6175  C "C5'" . DT  I 5 8   ? 269.954 273.796 193.714 1.00 140.05 ? -76 DT  I "C5'" 1 
ATOM 6176  C "C4'" . DT  I 5 8   ? 270.304 273.431 195.144 1.00 140.05 ? -76 DT  I "C4'" 1 
ATOM 6177  O "O4'" . DT  I 5 8   ? 271.565 274.055 195.495 1.00 140.05 ? -76 DT  I "O4'" 1 
ATOM 6178  C "C3'" . DT  I 5 8   ? 269.325 273.943 196.184 1.00 140.05 ? -76 DT  I "C3'" 1 
ATOM 6179  O "O3'" . DT  I 5 8   ? 269.454 273.190 197.381 1.00 140.05 ? -76 DT  I "O3'" 1 
ATOM 6180  C "C2'" . DT  I 5 8   ? 269.822 275.363 196.377 1.00 140.05 ? -76 DT  I "C2'" 1 
ATOM 6181  C "C1'" . DT  I 5 8   ? 271.326 275.129 196.388 1.00 140.05 ? -76 DT  I "C1'" 1 
ATOM 6182  N N1    . DT  I 5 8   ? 272.113 276.297 195.940 1.00 140.05 ? -76 DT  I N1    1 
ATOM 6183  C C2    . DT  I 5 8   ? 273.465 276.310 196.158 1.00 140.05 ? -76 DT  I C2    1 
ATOM 6184  O O2    . DT  I 5 8   ? 274.063 275.402 196.706 1.00 140.05 ? -76 DT  I O2    1 
ATOM 6185  N N3    . DT  I 5 8   ? 274.103 277.431 195.713 1.00 140.05 ? -76 DT  I N3    1 
ATOM 6186  C C4    . DT  I 5 8   ? 273.536 278.519 195.078 1.00 140.05 ? -76 DT  I C4    1 
ATOM 6187  O O4    . DT  I 5 8   ? 274.199 279.482 194.714 1.00 140.05 ? -76 DT  I O4    1 
ATOM 6188  C C5    . DT  I 5 8   ? 272.110 278.443 194.881 1.00 140.05 ? -76 DT  I C5    1 
ATOM 6189  C C7    . DT  I 5 8   ? 271.382 279.565 194.207 1.00 140.05 ? -76 DT  I C7    1 
ATOM 6190  C C6    . DT  I 5 8   ? 271.474 277.346 195.316 1.00 140.05 ? -76 DT  I C6    1 
ATOM 6191  P P     . DG  I 5 9   ? 268.153 272.834 198.255 1.00 138.33 ? -75 DG  I P     1 
ATOM 6192  O OP1   . DG  I 5 9   ? 267.502 271.662 197.629 1.00 138.33 ? -75 DG  I OP1   1 
ATOM 6193  O OP2   . DG  I 5 9   ? 267.389 274.087 198.451 1.00 138.33 ? -75 DG  I OP2   1 
ATOM 6194  O "O5'" . DG  I 5 9   ? 268.752 272.395 199.670 1.00 138.33 ? -75 DG  I "O5'" 1 
ATOM 6195  C "C5'" . DG  I 5 9   ? 269.561 271.231 199.771 1.00 138.33 ? -75 DG  I "C5'" 1 
ATOM 6196  C "C4'" . DG  I 5 9   ? 270.847 271.530 200.523 1.00 138.33 ? -75 DG  I "C4'" 1 
ATOM 6197  O "O4'" . DG  I 5 9   ? 271.486 272.700 199.942 1.00 138.33 ? -75 DG  I "O4'" 1 
ATOM 6198  C "C3'" . DG  I 5 9   ? 270.673 271.851 202.004 1.00 138.33 ? -75 DG  I "C3'" 1 
ATOM 6199  O "O3'" . DG  I 5 9   ? 271.819 271.417 202.725 1.00 138.33 ? -75 DG  I "O3'" 1 
ATOM 6200  C "C2'" . DG  I 5 9   ? 270.570 273.370 201.991 1.00 138.33 ? -75 DG  I "C2'" 1 
ATOM 6201  C "C1'" . DG  I 5 9   ? 271.592 273.716 200.918 1.00 138.33 ? -75 DG  I "C1'" 1 
ATOM 6202  N N9    . DG  I 5 9   ? 271.364 275.008 200.275 1.00 138.33 ? -75 DG  I N9    1 
ATOM 6203  C C8    . DG  I 5 9   ? 270.170 275.509 199.815 1.00 138.33 ? -75 DG  I C8    1 
ATOM 6204  N N7    . DG  I 5 9   ? 270.276 276.695 199.280 1.00 138.33 ? -75 DG  I N7    1 
ATOM 6205  C C5    . DG  I 5 9   ? 271.627 276.998 199.387 1.00 138.33 ? -75 DG  I C5    1 
ATOM 6206  C C6    . DG  I 5 9   ? 272.339 278.151 198.982 1.00 138.33 ? -75 DG  I C6    1 
ATOM 6207  O O6    . DG  I 5 9   ? 271.903 279.163 198.421 1.00 138.33 ? -75 DG  I O6    1 
ATOM 6208  N N1    . DG  I 5 9   ? 273.696 278.051 199.280 1.00 138.33 ? -75 DG  I N1    1 
ATOM 6209  C C2    . DG  I 5 9   ? 274.288 276.974 199.897 1.00 138.33 ? -75 DG  I C2    1 
ATOM 6210  N N2    . DG  I 5 9   ? 275.610 277.055 200.105 1.00 138.33 ? -75 DG  I N2    1 
ATOM 6211  N N3    . DG  I 5 9   ? 273.631 275.891 200.284 1.00 138.33 ? -75 DG  I N3    1 
ATOM 6212  C C4    . DG  I 5 9   ? 272.310 275.970 199.998 1.00 138.33 ? -75 DG  I C4    1 
ATOM 6213  P P     . DC  I 5 10  ? 271.731 271.141 204.306 1.00 133.44 ? -74 DC  I P     1 
ATOM 6214  O OP1   . DC  I 5 10  ? 271.957 269.694 204.522 1.00 133.44 ? -74 DC  I OP1   1 
ATOM 6215  O OP2   . DC  I 5 10  ? 270.492 271.776 204.808 1.00 133.44 ? -74 DC  I OP2   1 
ATOM 6216  O "O5'" . DC  I 5 10  ? 272.981 271.944 204.903 1.00 133.44 ? -74 DC  I "O5'" 1 
ATOM 6217  C "C5'" . DC  I 5 10  ? 274.302 271.584 204.515 1.00 133.44 ? -74 DC  I "C5'" 1 
ATOM 6218  C "C4'" . DC  I 5 10  ? 275.226 272.788 204.543 1.00 133.44 ? -74 DC  I "C4'" 1 
ATOM 6219  O "O4'" . DC  I 5 10  ? 274.677 273.848 203.710 1.00 133.44 ? -74 DC  I "O4'" 1 
ATOM 6220  C "C3'" . DC  I 5 10  ? 275.439 273.418 205.925 1.00 133.44 ? -74 DC  I "C3'" 1 
ATOM 6221  O "O3'" . DC  I 5 10  ? 276.811 273.828 206.061 1.00 133.44 ? -74 DC  I "O3'" 1 
ATOM 6222  C "C2'" . DC  I 5 10  ? 274.489 274.615 205.882 1.00 133.44 ? -74 DC  I "C2'" 1 
ATOM 6223  C "C1'" . DC  I 5 10  ? 274.702 275.047 204.448 1.00 133.44 ? -74 DC  I "C1'" 1 
ATOM 6224  N N1    . DC  I 5 10  ? 273.686 275.987 203.907 1.00 133.44 ? -74 DC  I N1    1 
ATOM 6225  C C2    . DC  I 5 10  ? 274.089 277.255 203.481 1.00 133.44 ? -74 DC  I C2    1 
ATOM 6226  O O2    . DC  I 5 10  ? 275.281 277.565 203.575 1.00 133.44 ? -74 DC  I O2    1 
ATOM 6227  N N3    . DC  I 5 10  ? 273.164 278.101 202.973 1.00 133.44 ? -74 DC  I N3    1 
ATOM 6228  C C4    . DC  I 5 10  ? 271.892 277.722 202.887 1.00 133.44 ? -74 DC  I C4    1 
ATOM 6229  N N4    . DC  I 5 10  ? 271.011 278.590 202.383 1.00 133.44 ? -74 DC  I N4    1 
ATOM 6230  C C5    . DC  I 5 10  ? 271.462 276.435 203.318 1.00 133.44 ? -74 DC  I C5    1 
ATOM 6231  C C6    . DC  I 5 10  ? 272.385 275.607 203.816 1.00 133.44 ? -74 DC  I C6    1 
ATOM 6232  P P     . DA  I 5 11  ? 277.189 275.131 206.924 1.00 124.07 ? -73 DA  I P     1 
ATOM 6233  O OP1   . DA  I 5 11  ? 276.639 274.932 208.283 1.00 124.07 ? -73 DA  I OP1   1 
ATOM 6234  O OP2   . DA  I 5 11  ? 276.892 276.325 206.098 1.00 124.07 ? -73 DA  I OP2   1 
ATOM 6235  O "O5'" . DA  I 5 11  ? 278.779 275.112 207.051 1.00 124.07 ? -73 DA  I "O5'" 1 
ATOM 6236  C "C5'" . DA  I 5 11  ? 279.394 275.570 208.255 1.00 124.07 ? -73 DA  I "C5'" 1 
ATOM 6237  C "C4'" . DA  I 5 11  ? 279.555 277.086 208.281 1.00 124.07 ? -73 DA  I "C4'" 1 
ATOM 6238  O "O4'" . DA  I 5 11  ? 278.493 277.728 207.516 1.00 124.07 ? -73 DA  I "O4'" 1 
ATOM 6239  C "C3'" . DA  I 5 11  ? 279.457 277.704 209.668 1.00 124.07 ? -73 DA  I "C3'" 1 
ATOM 6240  O "O3'" . DA  I 5 11  ? 280.137 278.937 209.684 1.00 124.07 ? -73 DA  I "O3'" 1 
ATOM 6241  C "C2'" . DA  I 5 11  ? 277.962 277.933 209.770 1.00 124.07 ? -73 DA  I "C2'" 1 
ATOM 6242  C "C1'" . DA  I 5 11  ? 277.708 278.514 208.390 1.00 124.07 ? -73 DA  I "C1'" 1 
ATOM 6243  N N9    . DA  I 5 11  ? 276.305 278.471 207.970 1.00 124.07 ? -73 DA  I N9    1 
ATOM 6244  C C8    . DA  I 5 11  ? 275.395 277.486 208.232 1.00 124.07 ? -73 DA  I C8    1 
ATOM 6245  N N7    . DA  I 5 11  ? 274.208 277.710 207.730 1.00 124.07 ? -73 DA  I N7    1 
ATOM 6246  C C5    . DA  I 5 11  ? 274.337 278.939 207.113 1.00 124.07 ? -73 DA  I C5    1 
ATOM 6247  C C6    . DA  I 5 11  ? 273.425 279.739 206.407 1.00 124.07 ? -73 DA  I C6    1 
ATOM 6248  N N6    . DA  I 5 11  ? 272.156 279.388 206.197 1.00 124.07 ? -73 DA  I N6    1 
ATOM 6249  N N1    . DA  I 5 11  ? 273.870 280.912 205.919 1.00 124.07 ? -73 DA  I N1    1 
ATOM 6250  C C2    . DA  I 5 11  ? 275.144 281.259 206.132 1.00 124.07 ? -73 DA  I C2    1 
ATOM 6251  N N3    . DA  I 5 11  ? 276.095 280.590 206.783 1.00 124.07 ? -73 DA  I N3    1 
ATOM 6252  C C4    . DA  I 5 11  ? 275.621 279.427 207.253 1.00 124.07 ? -73 DA  I C4    1 
ATOM 6253  P P     . DC  I 5 12  ? 281.681 279.030 210.113 1.00 115.85 ? -72 DC  I P     1 
ATOM 6254  O OP1   . DC  I 5 12  ? 282.489 278.498 208.995 1.00 115.85 ? -72 DC  I OP1   1 
ATOM 6255  O OP2   . DC  I 5 12  ? 281.833 278.457 211.470 1.00 115.85 ? -72 DC  I OP2   1 
ATOM 6256  O "O5'" . DC  I 5 12  ? 281.919 280.604 210.227 1.00 115.85 ? -72 DC  I "O5'" 1 
ATOM 6257  C "C5'" . DC  I 5 12  ? 280.962 281.404 210.907 1.00 115.85 ? -72 DC  I "C5'" 1 
ATOM 6258  C "C4'" . DC  I 5 12  ? 280.497 282.560 210.040 1.00 115.85 ? -72 DC  I "C4'" 1 
ATOM 6259  O "O4'" . DC  I 5 12  ? 279.247 282.208 209.379 1.00 115.85 ? -72 DC  I "O4'" 1 
ATOM 6260  C "C3'" . DC  I 5 12  ? 280.191 283.838 210.806 1.00 115.85 ? -72 DC  I "C3'" 1 
ATOM 6261  O "O3'" . DC  I 5 12  ? 280.402 284.956 209.968 1.00 115.85 ? -72 DC  I "O3'" 1 
ATOM 6262  C "C2'" . DC  I 5 12  ? 278.715 283.659 211.118 1.00 115.85 ? -72 DC  I "C2'" 1 
ATOM 6263  C "C1'" . DC  I 5 12  ? 278.234 283.108 209.792 1.00 115.85 ? -72 DC  I "C1'" 1 
ATOM 6264  N N1    . DC  I 5 12  ? 276.945 282.373 209.864 1.00 115.85 ? -72 DC  I N1    1 
ATOM 6265  C C2    . DC  I 5 12  ? 275.786 282.947 209.330 1.00 115.85 ? -72 DC  I C2    1 
ATOM 6266  O O2    . DC  I 5 12  ? 275.850 284.069 208.820 1.00 115.85 ? -72 DC  I O2    1 
ATOM 6267  N N3    . DC  I 5 12  ? 274.622 282.254 209.395 1.00 115.85 ? -72 DC  I N3    1 
ATOM 6268  C C4    . DC  I 5 12  ? 274.597 281.047 209.952 1.00 115.85 ? -72 DC  I C4    1 
ATOM 6269  N N4    . DC  I 5 12  ? 273.432 280.399 209.995 1.00 115.85 ? -72 DC  I N4    1 
ATOM 6270  C C5    . DC  I 5 12  ? 275.766 280.450 210.501 1.00 115.85 ? -72 DC  I C5    1 
ATOM 6271  C C6    . DC  I 5 12  ? 276.906 281.140 210.433 1.00 115.85 ? -72 DC  I C6    1 
ATOM 6272  P P     . DA  I 5 13  ? 281.096 286.279 210.552 1.00 102.97 ? -71 DA  I P     1 
ATOM 6273  O OP1   . DA  I 5 13  ? 282.522 286.240 210.164 1.00 102.97 ? -71 DA  I OP1   1 
ATOM 6274  O OP2   . DA  I 5 13  ? 280.719 286.384 211.978 1.00 102.97 ? -71 DA  I OP2   1 
ATOM 6275  O "O5'" . DA  I 5 13  ? 280.387 287.466 209.753 1.00 102.97 ? -71 DA  I "O5'" 1 
ATOM 6276  C "C5'" . DA  I 5 13  ? 279.036 287.334 209.344 1.00 102.97 ? -71 DA  I "C5'" 1 
ATOM 6277  C "C4'" . DA  I 5 13  ? 278.395 288.695 209.180 1.00 102.97 ? -71 DA  I "C4'" 1 
ATOM 6278  O "O4'" . DA  I 5 13  ? 276.960 288.564 209.224 1.00 102.97 ? -71 DA  I "O4'" 1 
ATOM 6279  C "C3'" . DA  I 5 13  ? 278.709 289.672 210.287 1.00 102.97 ? -71 DA  I "C3'" 1 
ATOM 6280  O "O3'" . DA  I 5 13  ? 278.506 290.996 209.822 1.00 102.97 ? -71 DA  I "O3'" 1 
ATOM 6281  C "C2'" . DA  I 5 13  ? 277.695 289.282 211.366 1.00 102.97 ? -71 DA  I "C2'" 1 
ATOM 6282  C "C1'" . DA  I 5 13  ? 276.518 288.705 210.561 1.00 102.97 ? -71 DA  I "C1'" 1 
ATOM 6283  N N9    . DA  I 5 13  ? 276.083 287.388 211.022 1.00 102.97 ? -71 DA  I N9    1 
ATOM 6284  C C8    . DA  I 5 13  ? 276.855 286.436 211.617 1.00 102.97 ? -71 DA  I C8    1 
ATOM 6285  N N7    . DA  I 5 13  ? 276.210 285.335 211.907 1.00 102.97 ? -71 DA  I N7    1 
ATOM 6286  C C5    . DA  I 5 13  ? 274.927 285.575 211.470 1.00 102.97 ? -71 DA  I C5    1 
ATOM 6287  C C6    . DA  I 5 13  ? 273.768 284.792 211.495 1.00 102.97 ? -71 DA  I C6    1 
ATOM 6288  N N6    . DA  I 5 13  ? 273.733 283.559 212.000 1.00 102.97 ? -71 DA  I N6    1 
ATOM 6289  N N1    . DA  I 5 13  ? 272.646 285.320 210.979 1.00 102.97 ? -71 DA  I N1    1 
ATOM 6290  C C2    . DA  I 5 13  ? 272.688 286.559 210.476 1.00 102.97 ? -71 DA  I C2    1 
ATOM 6291  N N3    . DA  I 5 13  ? 273.723 287.395 210.397 1.00 102.97 ? -71 DA  I N3    1 
ATOM 6292  C C4    . DA  I 5 13  ? 274.824 286.835 210.919 1.00 102.97 ? -71 DA  I C4    1 
ATOM 6293  P P     . DG  I 5 14  ? 278.676 292.242 210.817 1.00 94.97  ? -70 DG  I P     1 
ATOM 6294  O OP1   . DG  I 5 14  ? 279.020 293.424 209.994 1.00 94.97  ? -70 DG  I OP1   1 
ATOM 6295  O OP2   . DG  I 5 14  ? 279.563 291.823 211.924 1.00 94.97  ? -70 DG  I OP2   1 
ATOM 6296  O "O5'" . DG  I 5 14  ? 277.209 292.451 211.405 1.00 94.97  ? -70 DG  I "O5'" 1 
ATOM 6297  C "C5'" . DG  I 5 14  ? 276.113 292.597 210.516 1.00 94.97  ? -70 DG  I "C5'" 1 
ATOM 6298  C "C4'" . DG  I 5 14  ? 274.797 292.500 211.259 1.00 94.97  ? -70 DG  I "C4'" 1 
ATOM 6299  O "O4'" . DG  I 5 14  ? 274.505 291.108 211.567 1.00 94.97  ? -70 DG  I "O4'" 1 
ATOM 6300  C "C3'" . DG  I 5 14  ? 274.751 293.238 212.601 1.00 94.97  ? -70 DG  I "C3'" 1 
ATOM 6301  O "O3'" . DG  I 5 14  ? 273.468 293.783 212.782 1.00 94.97  ? -70 DG  I "O3'" 1 
ATOM 6302  C "C2'" . DG  I 5 14  ? 274.990 292.107 213.589 1.00 94.97  ? -70 DG  I "C2'" 1 
ATOM 6303  C "C1'" . DG  I 5 14  ? 274.163 291.027 212.926 1.00 94.97  ? -70 DG  I "C1'" 1 
ATOM 6304  N N9    . DG  I 5 14  ? 274.419 289.683 213.428 1.00 94.97  ? -70 DG  I N9    1 
ATOM 6305  C C8    . DG  I 5 14  ? 275.612 289.169 213.860 1.00 94.97  ? -70 DG  I C8    1 
ATOM 6306  N N7    . DG  I 5 14  ? 275.526 287.934 214.266 1.00 94.97  ? -70 DG  I N7    1 
ATOM 6307  C C5    . DG  I 5 14  ? 274.188 287.619 214.108 1.00 94.97  ? -70 DG  I C5    1 
ATOM 6308  C C6    . DG  I 5 14  ? 273.497 286.421 214.383 1.00 94.97  ? -70 DG  I C6    1 
ATOM 6309  O O6    . DG  I 5 14  ? 273.948 285.366 214.839 1.00 94.97  ? -70 DG  I O6    1 
ATOM 6310  N N1    . DG  I 5 14  ? 272.148 286.526 214.077 1.00 94.97  ? -70 DG  I N1    1 
ATOM 6311  C C2    . DG  I 5 14  ? 271.542 287.644 213.568 1.00 94.97  ? -70 DG  I C2    1 
ATOM 6312  N N2    . DG  I 5 14  ? 270.228 287.558 213.330 1.00 94.97  ? -70 DG  I N2    1 
ATOM 6313  N N3    . DG  I 5 14  ? 272.178 288.771 213.303 1.00 94.97  ? -70 DG  I N3    1 
ATOM 6314  C C4    . DG  I 5 14  ? 273.494 288.685 213.597 1.00 94.97  ? -70 DG  I C4    1 
ATOM 6315  P P     . DG  I 5 15  ? 273.271 295.312 213.222 1.00 88.51  ? -69 DG  I P     1 
ATOM 6316  O OP1   . DG  I 5 15  ? 273.914 296.164 212.198 1.00 88.51  ? -69 DG  I OP1   1 
ATOM 6317  O OP2   . DG  I 5 15  ? 273.662 295.441 214.643 1.00 88.51  ? -69 DG  I OP2   1 
ATOM 6318  O "O5'" . DG  I 5 15  ? 271.688 295.497 213.144 1.00 88.51  ? -69 DG  I "O5'" 1 
ATOM 6319  C "C5'" . DG  I 5 15  ? 270.908 294.540 212.435 1.00 88.51  ? -69 DG  I "C5'" 1 
ATOM 6320  C "C4'" . DG  I 5 15  ? 269.869 293.903 213.341 1.00 88.51  ? -69 DG  I "C4'" 1 
ATOM 6321  O "O4'" . DG  I 5 15  ? 270.314 292.589 213.771 1.00 88.51  ? -69 DG  I "O4'" 1 
ATOM 6322  C "C3'" . DG  I 5 15  ? 269.551 294.680 214.613 1.00 88.51  ? -69 DG  I "C3'" 1 
ATOM 6323  O "O3'" . DG  I 5 15  ? 268.157 294.670 214.818 1.00 88.51  ? -69 DG  I "O3'" 1 
ATOM 6324  C "C2'" . DG  I 5 15  ? 270.287 293.887 215.695 1.00 88.51  ? -69 DG  I "C2'" 1 
ATOM 6325  C "C1'" . DG  I 5 15  ? 270.153 292.472 215.165 1.00 88.51  ? -69 DG  I "C1'" 1 
ATOM 6326  N N9    . DG  I 5 15  ? 271.167 291.543 215.660 1.00 88.51  ? -69 DG  I N9    1 
ATOM 6327  C C8    . DG  I 5 15  ? 272.515 291.758 215.732 1.00 88.51  ? -69 DG  I C8    1 
ATOM 6328  N N7    . DG  I 5 15  ? 273.181 290.737 216.194 1.00 88.51  ? -69 DG  I N7    1 
ATOM 6329  C C5    . DG  I 5 15  ? 272.209 289.784 216.446 1.00 88.51  ? -69 DG  I C5    1 
ATOM 6330  C C6    . DG  I 5 15  ? 272.329 288.474 216.964 1.00 88.51  ? -69 DG  I C6    1 
ATOM 6331  O O6    . DG  I 5 15  ? 273.353 287.877 217.310 1.00 88.51  ? -69 DG  I O6    1 
ATOM 6332  N N1    . DG  I 5 15  ? 271.097 287.847 217.064 1.00 88.51  ? -69 DG  I N1    1 
ATOM 6333  C C2    . DG  I 5 15  ? 269.901 288.412 216.707 1.00 88.51  ? -69 DG  I C2    1 
ATOM 6334  N N2    . DG  I 5 15  ? 268.812 287.657 216.870 1.00 88.51  ? -69 DG  I N2    1 
ATOM 6335  N N3    . DG  I 5 15  ? 269.775 289.636 216.223 1.00 88.51  ? -69 DG  I N3    1 
ATOM 6336  C C4    . DG  I 5 15  ? 270.965 290.263 216.121 1.00 88.51  ? -69 DG  I C4    1 
ATOM 6337  P P     . DA  I 5 16  ? 267.460 295.752 215.774 1.00 83.08  ? -68 DA  I P     1 
ATOM 6338  O OP1   . DA  I 5 16  ? 266.615 296.623 214.930 1.00 83.08  ? -68 DA  I OP1   1 
ATOM 6339  O OP2   . DA  I 5 16  ? 268.501 296.352 216.633 1.00 83.08  ? -68 DA  I OP2   1 
ATOM 6340  O "O5'" . DA  I 5 16  ? 266.509 294.863 216.692 1.00 83.08  ? -68 DA  I "O5'" 1 
ATOM 6341  C "C5'" . DA  I 5 16  ? 265.770 293.799 216.111 1.00 83.08  ? -68 DA  I "C5'" 1 
ATOM 6342  C "C4'" . DA  I 5 16  ? 265.399 292.764 217.154 1.00 83.08  ? -68 DA  I "C4'" 1 
ATOM 6343  O "O4'" . DA  I 5 16  ? 266.530 291.890 217.405 1.00 83.08  ? -68 DA  I "O4'" 1 
ATOM 6344  C "C3'" . DA  I 5 16  ? 265.000 293.332 218.509 1.00 83.08  ? -68 DA  I "C3'" 1 
ATOM 6345  O "O3'" . DA  I 5 16  ? 263.950 292.564 219.034 1.00 83.08  ? -68 DA  I "O3'" 1 
ATOM 6346  C "C2'" . DA  I 5 16  ? 266.278 293.176 219.333 1.00 83.08  ? -68 DA  I "C2'" 1 
ATOM 6347  C "C1'" . DA  I 5 16  ? 266.825 291.873 218.783 1.00 83.08  ? -68 DA  I "C1'" 1 
ATOM 6348  N N9    . DA  I 5 16  ? 268.268 291.725 218.941 1.00 83.08  ? -68 DA  I N9    1 
ATOM 6349  C C8    . DA  I 5 16  ? 269.225 292.648 218.647 1.00 83.08  ? -68 DA  I C8    1 
ATOM 6350  N N7    . DA  I 5 16  ? 270.448 292.237 218.883 1.00 83.08  ? -68 DA  I N7    1 
ATOM 6351  C C5    . DA  I 5 16  ? 270.279 290.955 219.361 1.00 83.08  ? -68 DA  I C5    1 
ATOM 6352  C C6    . DA  I 5 16  ? 271.191 289.980 219.786 1.00 83.08  ? -68 DA  I C6    1 
ATOM 6353  N N6    . DA  I 5 16  ? 272.510 290.169 219.797 1.00 83.08  ? -68 DA  I N6    1 
ATOM 6354  N N1    . DA  I 5 16  ? 270.695 288.800 220.206 1.00 83.08  ? -68 DA  I N1    1 
ATOM 6355  C C2    . DA  I 5 16  ? 269.375 288.617 220.192 1.00 83.08  ? -68 DA  I C2    1 
ATOM 6356  N N3    . DA  I 5 16  ? 268.419 289.457 219.808 1.00 83.08  ? -68 DA  I N3    1 
ATOM 6357  C C4    . DA  I 5 16  ? 268.943 290.620 219.402 1.00 83.08  ? -68 DA  I C4    1 
ATOM 6358  P P     . DT  I 5 17  ? 263.017 293.147 220.197 1.00 78.55  ? -67 DT  I P     1 
ATOM 6359  O OP1   . DT  I 5 17  ? 261.663 293.342 219.639 1.00 78.55  ? -67 DT  I OP1   1 
ATOM 6360  O OP2   . DT  I 5 17  ? 263.728 294.269 220.844 1.00 78.55  ? -67 DT  I OP2   1 
ATOM 6361  O "O5'" . DT  I 5 17  ? 262.951 291.942 221.230 1.00 78.55  ? -67 DT  I "O5'" 1 
ATOM 6362  C "C5'" . DT  I 5 17  ? 263.323 290.644 220.804 1.00 78.55  ? -67 DT  I "C5'" 1 
ATOM 6363  C "C4'" . DT  I 5 17  ? 264.010 289.908 221.926 1.00 78.55  ? -67 DT  I "C4'" 1 
ATOM 6364  O "O4'" . DT  I 5 17  ? 265.437 290.011 221.774 1.00 78.55  ? -67 DT  I "O4'" 1 
ATOM 6365  C "C3'" . DT  I 5 17  ? 263.696 290.451 223.312 1.00 78.55  ? -67 DT  I "C3'" 1 
ATOM 6366  O "O3'" . DT  I 5 17  ? 262.920 289.504 224.014 1.00 78.55  ? -67 DT  I "O3'" 1 
ATOM 6367  C "C2'" . DT  I 5 17  ? 265.073 290.685 223.961 1.00 78.55  ? -67 DT  I "C2'" 1 
ATOM 6368  C "C1'" . DT  I 5 17  ? 266.022 289.940 223.041 1.00 78.55  ? -67 DT  I "C1'" 1 
ATOM 6369  N N1    . DT  I 5 17  ? 267.382 290.534 222.946 1.00 78.55  ? -67 DT  I N1    1 
ATOM 6370  C C2    . DT  I 5 17  ? 268.474 289.778 223.288 1.00 78.55  ? -67 DT  I C2    1 
ATOM 6371  O O2    . DT  I 5 17  ? 268.395 288.638 223.692 1.00 78.55  ? -67 DT  I O2    1 
ATOM 6372  N N3    . DT  I 5 17  ? 269.674 290.409 223.142 1.00 78.55  ? -67 DT  I N3    1 
ATOM 6373  C C4    . DT  I 5 17  ? 269.891 291.688 222.691 1.00 78.55  ? -67 DT  I C4    1 
ATOM 6374  O O4    . DT  I 5 17  ? 271.014 292.167 222.600 1.00 78.55  ? -67 DT  I O4    1 
ATOM 6375  C C5    . DT  I 5 17  ? 268.707 292.427 222.344 1.00 78.55  ? -67 DT  I C5    1 
ATOM 6376  C C7    . DT  I 5 17  ? 268.819 293.833 221.841 1.00 78.55  ? -67 DT  I C7    1 
ATOM 6377  C C6    . DT  I 5 17  ? 267.523 291.820 222.483 1.00 78.55  ? -67 DT  I C6    1 
ATOM 6378  P P     . DG  I 5 18  ? 262.489 289.759 225.535 1.00 78.21  ? -66 DG  I P     1 
ATOM 6379  O OP1   . DG  I 5 18  ? 261.155 289.149 225.715 1.00 78.21  ? -66 DG  I OP1   1 
ATOM 6380  O OP2   . DG  I 5 18  ? 262.695 291.184 225.861 1.00 78.21  ? -66 DG  I OP2   1 
ATOM 6381  O "O5'" . DG  I 5 18  ? 263.544 288.895 226.346 1.00 78.21  ? -66 DG  I "O5'" 1 
ATOM 6382  C "C5'" . DG  I 5 18  ? 263.979 287.665 225.807 1.00 78.21  ? -66 DG  I "C5'" 1 
ATOM 6383  C "C4'" . DG  I 5 18  ? 265.079 287.070 226.650 1.00 78.21  ? -66 DG  I "C4'" 1 
ATOM 6384  O "O4'" . DG  I 5 18  ? 266.351 287.659 226.284 1.00 78.21  ? -66 DG  I "O4'" 1 
ATOM 6385  C "C3'" . DG  I 5 18  ? 264.918 287.288 228.143 1.00 78.21  ? -66 DG  I "C3'" 1 
ATOM 6386  O "O3'" . DG  I 5 18  ? 265.299 286.118 228.836 1.00 78.21  ? -66 DG  I "O3'" 1 
ATOM 6387  C "C2'" . DG  I 5 18  ? 265.857 288.458 228.429 1.00 78.21  ? -66 DG  I "C2'" 1 
ATOM 6388  C "C1'" . DG  I 5 18  ? 266.964 288.236 227.414 1.00 78.21  ? -66 DG  I "C1'" 1 
ATOM 6389  N N9    . DG  I 5 18  ? 267.619 289.463 226.986 1.00 78.21  ? -66 DG  I N9    1 
ATOM 6390  C C8    . DG  I 5 18  ? 267.018 290.608 226.548 1.00 78.21  ? -66 DG  I C8    1 
ATOM 6391  N N7    . DG  I 5 18  ? 267.859 291.539 226.213 1.00 78.21  ? -66 DG  I N7    1 
ATOM 6392  C C5    . DG  I 5 18  ? 269.098 290.973 226.451 1.00 78.21  ? -66 DG  I C5    1 
ATOM 6393  C C6    . DG  I 5 18  ? 270.387 291.509 226.277 1.00 78.21  ? -66 DG  I C6    1 
ATOM 6394  O O6    . DG  I 5 18  ? 270.701 292.629 225.863 1.00 78.21  ? -66 DG  I O6    1 
ATOM 6395  N N1    . DG  I 5 18  ? 271.371 290.600 226.635 1.00 78.21  ? -66 DG  I N1    1 
ATOM 6396  C C2    . DG  I 5 18  ? 271.134 289.336 227.104 1.00 78.21  ? -66 DG  I C2    1 
ATOM 6397  N N2    . DG  I 5 18  ? 272.207 288.594 227.401 1.00 78.21  ? -66 DG  I N2    1 
ATOM 6398  N N3    . DG  I 5 18  ? 269.932 288.825 227.264 1.00 78.21  ? -66 DG  I N3    1 
ATOM 6399  C C4    . DG  I 5 18  ? 268.966 289.695 226.919 1.00 78.21  ? -66 DG  I C4    1 
ATOM 6400  P P     . DT  I 5 19  ? 265.008 285.968 230.407 1.00 80.96  ? -65 DT  I P     1 
ATOM 6401  O OP1   . DT  I 5 19  ? 264.340 284.674 230.633 1.00 80.96  ? -65 DT  I OP1   1 
ATOM 6402  O OP2   . DT  I 5 19  ? 264.359 287.208 230.885 1.00 80.96  ? -65 DT  I OP2   1 
ATOM 6403  O "O5'" . DT  I 5 19  ? 266.469 285.866 231.024 1.00 80.96  ? -65 DT  I "O5'" 1 
ATOM 6404  C "C5'" . DT  I 5 19  ? 267.463 285.158 230.311 1.00 80.96  ? -65 DT  I "C5'" 1 
ATOM 6405  C "C4'" . DT  I 5 19  ? 268.844 285.445 230.865 1.00 80.96  ? -65 DT  I "C4'" 1 
ATOM 6406  O "O4'" . DT  I 5 19  ? 269.382 286.655 230.270 1.00 80.96  ? -65 DT  I "O4'" 1 
ATOM 6407  C "C3'" . DT  I 5 19  ? 268.913 285.656 232.375 1.00 80.96  ? -65 DT  I "C3'" 1 
ATOM 6408  O "O3'" . DT  I 5 19  ? 270.099 285.066 232.850 1.00 80.96  ? -65 DT  I "O3'" 1 
ATOM 6409  C "C2'" . DT  I 5 19  ? 268.965 287.176 232.489 1.00 80.96  ? -65 DT  I "C2'" 1 
ATOM 6410  C "C1'" . DT  I 5 19  ? 269.834 287.507 231.295 1.00 80.96  ? -65 DT  I "C1'" 1 
ATOM 6411  N N1    . DT  I 5 19  ? 269.720 288.906 230.826 1.00 80.96  ? -65 DT  I N1    1 
ATOM 6412  C C2    . DT  I 5 19  ? 270.860 289.596 230.521 1.00 80.96  ? -65 DT  I C2    1 
ATOM 6413  O O2    . DT  I 5 19  ? 271.972 289.121 230.627 1.00 80.96  ? -65 DT  I O2    1 
ATOM 6414  N N3    . DT  I 5 19  ? 270.658 290.871 230.086 1.00 80.96  ? -65 DT  I N3    1 
ATOM 6415  C C4    . DT  I 5 19  ? 269.456 291.516 229.931 1.00 80.96  ? -65 DT  I C4    1 
ATOM 6416  O O4    . DT  I 5 19  ? 269.383 292.671 229.531 1.00 80.96  ? -65 DT  I O4    1 
ATOM 6417  C C5    . DT  I 5 19  ? 268.293 290.738 230.260 1.00 80.96  ? -65 DT  I C5    1 
ATOM 6418  C C7    . DT  I 5 19  ? 266.928 291.340 230.125 1.00 80.96  ? -65 DT  I C7    1 
ATOM 6419  C C6    . DT  I 5 19  ? 268.477 289.481 230.689 1.00 80.96  ? -65 DT  I C6    1 
ATOM 6420  P P     . DA  I 5 20  ? 270.306 284.741 234.407 1.00 84.78  ? -64 DA  I P     1 
ATOM 6421  O OP1   . DA  I 5 20  ? 270.118 283.288 234.586 1.00 84.78  ? -64 DA  I OP1   1 
ATOM 6422  O OP2   . DA  I 5 20  ? 269.513 285.692 235.217 1.00 84.78  ? -64 DA  I OP2   1 
ATOM 6423  O "O5'" . DA  I 5 20  ? 271.849 285.067 234.621 1.00 84.78  ? -64 DA  I "O5'" 1 
ATOM 6424  C "C5'" . DA  I 5 20  ? 272.773 284.755 233.593 1.00 84.78  ? -64 DA  I "C5'" 1 
ATOM 6425  C "C4'" . DA  I 5 20  ? 274.068 285.532 233.764 1.00 84.78  ? -64 DA  I "C4'" 1 
ATOM 6426  O "O4'" . DA  I 5 20  ? 273.912 286.870 233.235 1.00 84.78  ? -64 DA  I "O4'" 1 
ATOM 6427  C "C3'" . DA  I 5 20  ? 274.540 285.708 235.197 1.00 84.78  ? -64 DA  I "C3'" 1 
ATOM 6428  O "O3'" . DA  I 5 20  ? 275.958 285.743 235.219 1.00 84.78  ? -64 DA  I "O3'" 1 
ATOM 6429  C "C2'" . DA  I 5 20  ? 273.927 287.053 235.591 1.00 84.78  ? -64 DA  I "C2'" 1 
ATOM 6430  C "C1'" . DA  I 5 20  ? 273.977 287.824 234.278 1.00 84.78  ? -64 DA  I "C1'" 1 
ATOM 6431  N N9    . DA  I 5 20  ? 272.872 288.757 234.091 1.00 84.78  ? -64 DA  I N9    1 
ATOM 6432  C C8    . DA  I 5 20  ? 271.539 288.496 234.215 1.00 84.78  ? -64 DA  I C8    1 
ATOM 6433  N N7    . DA  I 5 20  ? 270.773 289.530 233.961 1.00 84.78  ? -64 DA  I N7    1 
ATOM 6434  C C5    . DA  I 5 20  ? 271.666 290.530 233.637 1.00 84.78  ? -64 DA  I C5    1 
ATOM 6435  C C6    . DA  I 5 20  ? 271.494 291.873 233.264 1.00 84.78  ? -64 DA  I C6    1 
ATOM 6436  N N6    . DA  I 5 20  ? 270.302 292.464 233.156 1.00 84.78  ? -64 DA  I N6    1 
ATOM 6437  N N1    . DA  I 5 20  ? 272.601 292.593 233.015 1.00 84.78  ? -64 DA  I N1    1 
ATOM 6438  C C2    . DA  I 5 20  ? 273.790 292.004 233.136 1.00 84.78  ? -64 DA  I C2    1 
ATOM 6439  N N3    . DA  I 5 20  ? 274.077 290.756 233.461 1.00 84.78  ? -64 DA  I N3    1 
ATOM 6440  C C4    . DA  I 5 20  ? 272.963 290.066 233.707 1.00 84.78  ? -64 DA  I C4    1 
ATOM 6441  P P     . DT  I 5 21  ? 276.753 286.048 236.579 1.00 85.89  ? -63 DT  I P     1 
ATOM 6442  O OP1   . DT  I 5 21  ? 278.113 285.484 236.427 1.00 85.89  ? -63 DT  I OP1   1 
ATOM 6443  O OP2   . DT  I 5 21  ? 275.903 285.643 237.715 1.00 85.89  ? -63 DT  I OP2   1 
ATOM 6444  O "O5'" . DT  I 5 21  ? 276.883 287.637 236.582 1.00 85.89  ? -63 DT  I "O5'" 1 
ATOM 6445  C "C5'" . DT  I 5 21  ? 277.399 288.290 235.437 1.00 85.89  ? -63 DT  I "C5'" 1 
ATOM 6446  C "C4'" . DT  I 5 21  ? 277.761 289.727 235.747 1.00 85.89  ? -63 DT  I "C4'" 1 
ATOM 6447  O "O4'" . DT  I 5 21  ? 276.638 290.595 235.455 1.00 85.89  ? -63 DT  I "O4'" 1 
ATOM 6448  C "C3'" . DT  I 5 21  ? 278.132 290.012 237.197 1.00 85.89  ? -63 DT  I "C3'" 1 
ATOM 6449  O "O3'" . DT  I 5 21  ? 279.146 290.993 237.215 1.00 85.89  ? -63 DT  I "O3'" 1 
ATOM 6450  C "C2'" . DT  I 5 21  ? 276.827 290.563 237.761 1.00 85.89  ? -63 DT  I "C2'" 1 
ATOM 6451  C "C1'" . DT  I 5 21  ? 276.373 291.396 236.583 1.00 85.89  ? -63 DT  I "C1'" 1 
ATOM 6452  N N1    . DT  I 5 21  ? 274.940 291.730 236.575 1.00 85.89  ? -63 DT  I N1    1 
ATOM 6453  C C2    . DT  I 5 21  ? 274.563 292.995 236.218 1.00 85.89  ? -63 DT  I C2    1 
ATOM 6454  O O2    . DT  I 5 21  ? 275.356 293.868 235.926 1.00 85.89  ? -63 DT  I O2    1 
ATOM 6455  N N3    . DT  I 5 21  ? 273.220 293.210 236.213 1.00 85.89  ? -63 DT  I N3    1 
ATOM 6456  C C4    . DT  I 5 21  ? 272.231 292.302 236.517 1.00 85.89  ? -63 DT  I C4    1 
ATOM 6457  O O4    . DT  I 5 21  ? 271.045 292.594 236.484 1.00 85.89  ? -63 DT  I O4    1 
ATOM 6458  C C5    . DT  I 5 21  ? 272.693 290.988 236.883 1.00 85.89  ? -63 DT  I C5    1 
ATOM 6459  C C7    . DT  I 5 21  ? 271.708 289.916 237.240 1.00 85.89  ? -63 DT  I C7    1 
ATOM 6460  C C6    . DT  I 5 21  ? 274.012 290.765 236.889 1.00 85.89  ? -63 DT  I C6    1 
ATOM 6461  P P     . DA  I 5 22  ? 280.180 291.078 238.436 1.00 85.38  ? -62 DA  I P     1 
ATOM 6462  O OP1   . DA  I 5 22  ? 281.428 291.667 237.907 1.00 85.38  ? -62 DA  I OP1   1 
ATOM 6463  O OP2   . DA  I 5 22  ? 280.203 289.757 239.101 1.00 85.38  ? -62 DA  I OP2   1 
ATOM 6464  O "O5'" . DA  I 5 22  ? 279.501 292.122 239.432 1.00 85.38  ? -62 DA  I "O5'" 1 
ATOM 6465  C "C5'" . DA  I 5 22  ? 280.305 293.035 240.150 1.00 85.38  ? -62 DA  I "C5'" 1 
ATOM 6466  C "C4'" . DA  I 5 22  ? 280.441 294.343 239.394 1.00 85.38  ? -62 DA  I "C4'" 1 
ATOM 6467  O "O4'" . DA  I 5 22  ? 279.307 294.507 238.511 1.00 85.38  ? -62 DA  I "O4'" 1 
ATOM 6468  C "C3'" . DA  I 5 22  ? 280.441 295.577 240.275 1.00 85.38  ? -62 DA  I "C3'" 1 
ATOM 6469  O "O3'" . DA  I 5 22  ? 281.123 296.643 239.636 1.00 85.38  ? -62 DA  I "O3'" 1 
ATOM 6470  C "C2'" . DA  I 5 22  ? 278.956 295.870 240.414 1.00 85.38  ? -62 DA  I "C2'" 1 
ATOM 6471  C "C1'" . DA  I 5 22  ? 278.414 295.466 239.046 1.00 85.38  ? -62 DA  I "C1'" 1 
ATOM 6472  N N9    . DA  I 5 22  ? 277.087 294.870 239.115 1.00 85.38  ? -62 DA  I N9    1 
ATOM 6473  C C8    . DA  I 5 22  ? 276.781 293.571 239.395 1.00 85.38  ? -62 DA  I C8    1 
ATOM 6474  N N7    . DA  I 5 22  ? 275.497 293.319 239.400 1.00 85.38  ? -62 DA  I N7    1 
ATOM 6475  C C5    . DA  I 5 22  ? 274.922 294.537 239.100 1.00 85.38  ? -62 DA  I C5    1 
ATOM 6476  C C6    . DA  I 5 22  ? 273.588 294.936 238.947 1.00 85.38  ? -62 DA  I C6    1 
ATOM 6477  N N6    . DA  I 5 22  ? 272.556 294.105 239.091 1.00 85.38  ? -62 DA  I N6    1 
ATOM 6478  N N1    . DA  I 5 22  ? 273.354 296.225 238.646 1.00 85.38  ? -62 DA  I N1    1 
ATOM 6479  C C2    . DA  I 5 22  ? 274.391 297.054 238.508 1.00 85.38  ? -62 DA  I C2    1 
ATOM 6480  N N3    . DA  I 5 22  ? 275.688 296.794 238.623 1.00 85.38  ? -62 DA  I N3    1 
ATOM 6481  C C4    . DA  I 5 22  ? 275.887 295.505 238.923 1.00 85.38  ? -62 DA  I C4    1 
ATOM 6482  P P     . DT  I 5 23  ? 281.760 297.822 240.519 1.00 82.79  ? -61 DT  I P     1 
ATOM 6483  O OP1   . DT  I 5 23  ? 282.594 298.653 239.622 1.00 82.79  ? -61 DT  I OP1   1 
ATOM 6484  O OP2   . DT  I 5 23  ? 282.357 297.203 241.721 1.00 82.79  ? -61 DT  I OP2   1 
ATOM 6485  O "O5'" . DT  I 5 23  ? 280.493 298.672 241.000 1.00 82.79  ? -61 DT  I "O5'" 1 
ATOM 6486  C "C5'" . DT  I 5 23  ? 279.691 299.350 240.046 1.00 82.79  ? -61 DT  I "C5'" 1 
ATOM 6487  C "C4'" . DT  I 5 23  ? 278.583 300.130 240.726 1.00 82.79  ? -61 DT  I "C4'" 1 
ATOM 6488  O "O4'" . DT  I 5 23  ? 277.332 299.403 240.625 1.00 82.79  ? -61 DT  I "O4'" 1 
ATOM 6489  C "C3'" . DT  I 5 23  ? 278.798 300.404 242.215 1.00 82.79  ? -61 DT  I "C3'" 1 
ATOM 6490  O "O3'" . DT  I 5 23  ? 278.532 301.768 242.483 1.00 82.79  ? -61 DT  I "O3'" 1 
ATOM 6491  C "C2'" . DT  I 5 23  ? 277.776 299.492 242.893 1.00 82.79  ? -61 DT  I "C2'" 1 
ATOM 6492  C "C1'" . DT  I 5 23  ? 276.668 299.468 241.859 1.00 82.79  ? -61 DT  I "C1'" 1 
ATOM 6493  N N1    . DT  I 5 23  ? 275.786 298.292 241.976 1.00 82.79  ? -61 DT  I N1    1 
ATOM 6494  C C2    . DT  I 5 23  ? 274.427 298.452 241.876 1.00 82.79  ? -61 DT  I C2    1 
ATOM 6495  O O2    . DT  I 5 23  ? 273.891 299.527 241.699 1.00 82.79  ? -61 DT  I O2    1 
ATOM 6496  N N3    . DT  I 5 23  ? 273.710 297.301 242.002 1.00 82.79  ? -61 DT  I N3    1 
ATOM 6497  C C4    . DT  I 5 23  ? 274.205 296.032 242.209 1.00 82.79  ? -61 DT  I C4    1 
ATOM 6498  O O4    . DT  I 5 23  ? 273.480 295.055 242.309 1.00 82.79  ? -61 DT  I O4    1 
ATOM 6499  C C5    . DT  I 5 23  ? 275.636 295.938 242.303 1.00 82.79  ? -61 DT  I C5    1 
ATOM 6500  C C7    . DT  I 5 23  ? 276.288 294.612 242.531 1.00 82.79  ? -61 DT  I C7    1 
ATOM 6501  C C6    . DT  I 5 23  ? 276.347 297.059 242.185 1.00 82.79  ? -61 DT  I C6    1 
ATOM 6502  P P     . DA  I 5 24  ? 278.958 302.427 243.884 1.00 78.55  ? -60 DA  I P     1 
ATOM 6503  O OP1   . DA  I 5 24  ? 279.891 303.532 243.583 1.00 78.55  ? -60 DA  I OP1   1 
ATOM 6504  O OP2   . DA  I 5 24  ? 279.376 301.353 244.810 1.00 78.55  ? -60 DA  I OP2   1 
ATOM 6505  O "O5'" . DA  I 5 24  ? 277.591 303.054 244.419 1.00 78.55  ? -60 DA  I "O5'" 1 
ATOM 6506  C "C5'" . DA  I 5 24  ? 276.799 303.847 243.547 1.00 78.55  ? -60 DA  I "C5'" 1 
ATOM 6507  C "C4'" . DA  I 5 24  ? 275.361 303.920 244.027 1.00 78.55  ? -60 DA  I "C4'" 1 
ATOM 6508  O "O4'" . DA  I 5 24  ? 274.689 302.660 243.767 1.00 78.55  ? -60 DA  I "O4'" 1 
ATOM 6509  C "C3'" . DA  I 5 24  ? 275.192 304.194 245.519 1.00 78.55  ? -60 DA  I "C3'" 1 
ATOM 6510  O "O3'" . DA  I 5 24  ? 274.148 305.129 245.712 1.00 78.55  ? -60 DA  I "O3'" 1 
ATOM 6511  C "C2'" . DA  I 5 24  ? 274.828 302.825 246.082 1.00 78.55  ? -60 DA  I "C2'" 1 
ATOM 6512  C "C1'" . DA  I 5 24  ? 274.036 302.228 244.935 1.00 78.55  ? -60 DA  I "C1'" 1 
ATOM 6513  N N9    . DA  I 5 24  ? 274.020 300.771 244.942 1.00 78.55  ? -60 DA  I N9    1 
ATOM 6514  C C8    . DA  I 5 24  ? 275.099 299.944 244.939 1.00 78.55  ? -60 DA  I C8    1 
ATOM 6515  N N7    . DA  I 5 24  ? 274.794 298.675 244.943 1.00 78.55  ? -60 DA  I N7    1 
ATOM 6516  C C5    . DA  I 5 24  ? 273.416 298.667 244.953 1.00 78.55  ? -60 DA  I C5    1 
ATOM 6517  C C6    . DA  I 5 24  ? 272.481 297.622 244.959 1.00 78.55  ? -60 DA  I C6    1 
ATOM 6518  N N6    . DA  I 5 24  ? 272.821 296.332 244.960 1.00 78.55  ? -60 DA  I N6    1 
ATOM 6519  N N1    . DA  I 5 24  ? 271.181 297.951 244.964 1.00 78.55  ? -60 DA  I N1    1 
ATOM 6520  C C2    . DA  I 5 24  ? 270.843 299.243 244.964 1.00 78.55  ? -60 DA  I C2    1 
ATOM 6521  N N3    . DA  I 5 24  ? 271.632 300.314 244.956 1.00 78.55  ? -60 DA  I N3    1 
ATOM 6522  C C4    . DA  I 5 24  ? 272.920 299.951 244.951 1.00 78.55  ? -60 DA  I C4    1 
ATOM 6523  P P     . DT  I 5 25  ? 274.033 305.949 247.088 1.00 73.05  ? -59 DT  I P     1 
ATOM 6524  O OP1   . DT  I 5 25  ? 274.232 307.377 246.766 1.00 73.05  ? -59 DT  I OP1   1 
ATOM 6525  O OP2   . DT  I 5 25  ? 274.901 305.299 248.092 1.00 73.05  ? -59 DT  I OP2   1 
ATOM 6526  O "O5'" . DT  I 5 25  ? 272.515 305.713 247.522 1.00 73.05  ? -59 DT  I "O5'" 1 
ATOM 6527  C "C5'" . DT  I 5 25  ? 271.908 304.465 247.258 1.00 73.05  ? -59 DT  I "C5'" 1 
ATOM 6528  C "C4'" . DT  I 5 25  ? 270.441 304.488 247.619 1.00 73.05  ? -59 DT  I "C4'" 1 
ATOM 6529  O "O4'" . DT  I 5 25  ? 269.904 303.151 247.508 1.00 73.05  ? -59 DT  I "O4'" 1 
ATOM 6530  C "C3'" . DT  I 5 25  ? 270.151 304.881 249.046 1.00 73.05  ? -59 DT  I "C3'" 1 
ATOM 6531  O "O3'" . DT  I 5 25  ? 268.795 305.267 249.152 1.00 73.05  ? -59 DT  I "O3'" 1 
ATOM 6532  C "C2'" . DT  I 5 25  ? 270.426 303.571 249.777 1.00 73.05  ? -59 DT  I "C2'" 1 
ATOM 6533  C "C1'" . DT  I 5 25  ? 269.889 302.539 248.785 1.00 73.05  ? -59 DT  I "C1'" 1 
ATOM 6534  N N1    . DT  I 5 25  ? 270.696 301.285 248.708 1.00 73.05  ? -59 DT  I N1    1 
ATOM 6535  C C2    . DT  I 5 25  ? 270.049 300.083 248.614 1.00 73.05  ? -59 DT  I C2    1 
ATOM 6536  O O2    . DT  I 5 25  ? 268.839 299.978 248.599 1.00 73.05  ? -59 DT  I O2    1 
ATOM 6537  N N3    . DT  I 5 25  ? 270.870 298.997 248.538 1.00 73.05  ? -59 DT  I N3    1 
ATOM 6538  C C4    . DT  I 5 25  ? 272.244 298.989 248.541 1.00 73.05  ? -59 DT  I C4    1 
ATOM 6539  O O4    . DT  I 5 25  ? 272.891 297.955 248.469 1.00 73.05  ? -59 DT  I O4    1 
ATOM 6540  C C5    . DT  I 5 25  ? 272.865 300.281 248.639 1.00 73.05  ? -59 DT  I C5    1 
ATOM 6541  C C7    . DT  I 5 25  ? 274.356 300.396 248.654 1.00 73.05  ? -59 DT  I C7    1 
ATOM 6542  C C6    . DT  I 5 25  ? 272.070 301.357 248.715 1.00 73.05  ? -59 DT  I C6    1 
ATOM 6543  P P     . DC  I 5 26  ? 268.196 305.783 250.547 1.00 68.05  ? -58 DC  I P     1 
ATOM 6544  O OP1   . DC  I 5 26  ? 267.102 306.727 250.233 1.00 68.05  ? -58 DC  I OP1   1 
ATOM 6545  O OP2   . DC  I 5 26  ? 269.322 306.205 251.406 1.00 68.05  ? -58 DC  I OP2   1 
ATOM 6546  O "O5'" . DC  I 5 26  ? 267.549 304.472 251.181 1.00 68.05  ? -58 DC  I "O5'" 1 
ATOM 6547  C "C5'" . DC  I 5 26  ? 266.715 303.646 250.385 1.00 68.05  ? -58 DC  I "C5'" 1 
ATOM 6548  C "C4'" . DC  I 5 26  ? 266.192 302.471 251.185 1.00 68.05  ? -58 DC  I "C4'" 1 
ATOM 6549  O "O4'" . DC  I 5 26  ? 267.114 301.355 251.075 1.00 68.05  ? -58 DC  I "O4'" 1 
ATOM 6550  C "C3'" . DC  I 5 26  ? 266.037 302.722 252.680 1.00 68.05  ? -58 DC  I "C3'" 1 
ATOM 6551  O "O3'" . DC  I 5 26  ? 264.969 301.947 253.160 1.00 68.05  ? -58 DC  I "O3'" 1 
ATOM 6552  C "C2'" . DC  I 5 26  ? 267.360 302.203 253.222 1.00 68.05  ? -58 DC  I "C2'" 1 
ATOM 6553  C "C1'" . DC  I 5 26  ? 267.522 300.965 252.366 1.00 68.05  ? -58 DC  I "C1'" 1 
ATOM 6554  N N1    . DC  I 5 26  ? 268.903 300.450 252.280 1.00 68.05  ? -58 DC  I N1    1 
ATOM 6555  C C2    . DC  I 5 26  ? 269.097 299.090 252.100 1.00 68.05  ? -58 DC  I C2    1 
ATOM 6556  O O2    . DC  I 5 26  ? 268.107 298.363 252.024 1.00 68.05  ? -58 DC  I O2    1 
ATOM 6557  N N3    . DC  I 5 26  ? 270.353 298.611 252.011 1.00 68.05  ? -58 DC  I N3    1 
ATOM 6558  C C4    . DC  I 5 26  ? 271.385 299.441 252.096 1.00 68.05  ? -58 DC  I C4    1 
ATOM 6559  N N4    . DC  I 5 26  ? 272.611 298.922 252.005 1.00 68.05  ? -58 DC  I N4    1 
ATOM 6560  C C5    . DC  I 5 26  ? 271.209 300.842 252.280 1.00 68.05  ? -58 DC  I C5    1 
ATOM 6561  C C6    . DC  I 5 26  ? 269.960 301.298 252.366 1.00 68.05  ? -58 DC  I C6    1 
ATOM 6562  P P     . DT  I 5 27  ? 263.977 302.515 254.282 1.00 62.95  ? -57 DT  I P     1 
ATOM 6563  O OP1   . DT  I 5 27  ? 263.211 303.615 253.664 1.00 62.95  ? -57 DT  I OP1   1 
ATOM 6564  O OP2   . DT  I 5 27  ? 264.760 302.771 255.510 1.00 62.95  ? -57 DT  I OP2   1 
ATOM 6565  O "O5'" . DT  I 5 27  ? 263.007 301.277 254.563 1.00 62.95  ? -57 DT  I "O5'" 1 
ATOM 6566  C "C5'" . DT  I 5 27  ? 263.053 300.136 253.707 1.00 62.95  ? -57 DT  I "C5'" 1 
ATOM 6567  C "C4'" . DT  I 5 27  ? 263.328 298.871 254.502 1.00 62.95  ? -57 DT  I "C4'" 1 
ATOM 6568  O "O4'" . DT  I 5 27  ? 264.723 298.481 254.351 1.00 62.95  ? -57 DT  I "O4'" 1 
ATOM 6569  C "C3'" . DT  I 5 27  ? 263.099 298.991 256.007 1.00 62.95  ? -57 DT  I "C3'" 1 
ATOM 6570  O "O3'" . DT  I 5 27  ? 262.579 297.778 256.496 1.00 62.95  ? -57 DT  I "O3'" 1 
ATOM 6571  C "C2'" . DT  I 5 27  ? 264.513 299.214 256.525 1.00 62.95  ? -57 DT  I "C2'" 1 
ATOM 6572  C "C1'" . DT  I 5 27  ? 265.260 298.254 255.629 1.00 62.95  ? -57 DT  I "C1'" 1 
ATOM 6573  N N1    . DT  I 5 27  ? 266.726 298.466 255.590 1.00 62.95  ? -57 DT  I N1    1 
ATOM 6574  C C2    . DT  I 5 27  ? 267.539 297.399 255.325 1.00 62.95  ? -57 DT  I C2    1 
ATOM 6575  O O2    . DT  I 5 27  ? 267.120 296.283 255.105 1.00 62.95  ? -57 DT  I O2    1 
ATOM 6576  N N3    . DT  I 5 27  ? 268.869 297.686 255.312 1.00 62.95  ? -57 DT  I N3    1 
ATOM 6577  C C4    . DT  I 5 27  ? 269.459 298.904 255.540 1.00 62.95  ? -57 DT  I C4    1 
ATOM 6578  O O4    . DT  I 5 27  ? 270.669 299.061 255.505 1.00 62.95  ? -57 DT  I O4    1 
ATOM 6579  C C5    . DT  I 5 27  ? 268.556 299.981 255.825 1.00 62.95  ? -57 DT  I C5    1 
ATOM 6580  C C7    . DT  I 5 27  ? 269.092 301.352 256.099 1.00 62.95  ? -57 DT  I C7    1 
ATOM 6581  C C6    . DT  I 5 27  ? 267.243 299.714 255.839 1.00 62.95  ? -57 DT  I C6    1 
ATOM 6582  P P     . DG  I 5 28  ? 260.996 297.558 256.617 1.00 59.07  ? -56 DG  I P     1 
ATOM 6583  O OP1   . DG  I 5 28  ? 260.398 297.860 255.305 1.00 59.07  ? -56 DG  I OP1   1 
ATOM 6584  O OP2   . DG  I 5 28  ? 260.546 298.265 257.833 1.00 59.07  ? -56 DG  I OP2   1 
ATOM 6585  O "O5'" . DG  I 5 28  ? 260.847 295.992 256.888 1.00 59.07  ? -56 DG  I "O5'" 1 
ATOM 6586  C "C5'" . DG  I 5 28  ? 261.544 295.058 256.074 1.00 59.07  ? -56 DG  I "C5'" 1 
ATOM 6587  C "C4'" . DG  I 5 28  ? 262.342 294.082 256.920 1.00 59.07  ? -56 DG  I "C4'" 1 
ATOM 6588  O "O4'" . DG  I 5 28  ? 263.655 294.629 257.194 1.00 59.07  ? -56 DG  I "O4'" 1 
ATOM 6589  C "C3'" . DG  I 5 28  ? 261.751 293.760 258.286 1.00 59.07  ? -56 DG  I "C3'" 1 
ATOM 6590  O "O3'" . DG  I 5 28  ? 262.111 292.450 258.640 1.00 59.07  ? -56 DG  I "O3'" 1 
ATOM 6591  C "C2'" . DG  I 5 28  ? 262.464 294.762 259.176 1.00 59.07  ? -56 DG  I "C2'" 1 
ATOM 6592  C "C1'" . DG  I 5 28  ? 263.852 294.676 258.588 1.00 59.07  ? -56 DG  I "C1'" 1 
ATOM 6593  N N9    . DG  I 5 28  ? 264.692 295.814 258.874 1.00 59.07  ? -56 DG  I N9    1 
ATOM 6594  C C8    . DG  I 5 28  ? 264.300 297.047 259.313 1.00 59.07  ? -56 DG  I C8    1 
ATOM 6595  N N7    . DG  I 5 28  ? 265.291 297.875 259.468 1.00 59.07  ? -56 DG  I N7    1 
ATOM 6596  C C5    . DG  I 5 28  ? 266.402 297.139 259.102 1.00 59.07  ? -56 DG  I C5    1 
ATOM 6597  C C6    . DG  I 5 28  ? 267.758 297.502 259.065 1.00 59.07  ? -56 DG  I C6    1 
ATOM 6598  O O6    . DG  I 5 28  ? 268.273 298.586 259.355 1.00 59.07  ? -56 DG  I O6    1 
ATOM 6599  N N1    . DG  I 5 28  ? 268.555 296.452 258.640 1.00 59.07  ? -56 DG  I N1    1 
ATOM 6600  C C2    . DG  I 5 28  ? 268.099 295.209 258.291 1.00 59.07  ? -56 DG  I C2    1 
ATOM 6601  N N2    . DG  I 5 28  ? 269.021 294.326 257.900 1.00 59.07  ? -56 DG  I N2    1 
ATOM 6602  N N3    . DG  I 5 28  ? 266.832 294.858 258.321 1.00 59.07  ? -56 DG  I N3    1 
ATOM 6603  C C4    . DG  I 5 28  ? 266.044 295.871 258.730 1.00 59.07  ? -56 DG  I C4    1 
ATOM 6604  P P     . DA  I 5 29  ? 261.057 291.250 258.521 1.00 56.30  ? -55 DA  I P     1 
ATOM 6605  O OP1   . DA  I 5 29  ? 260.381 291.364 257.216 1.00 56.30  ? -55 DA  I OP1   1 
ATOM 6606  O OP2   . DA  I 5 29  ? 260.275 291.226 259.771 1.00 56.30  ? -55 DA  I OP2   1 
ATOM 6607  O "O5'" . DA  I 5 29  ? 261.980 289.953 258.493 1.00 56.30  ? -55 DA  I "O5'" 1 
ATOM 6608  C "C5'" . DA  I 5 29  ? 263.016 289.852 257.534 1.00 56.30  ? -55 DA  I "C5'" 1 
ATOM 6609  C "C4'" . DA  I 5 29  ? 264.323 289.410 258.169 1.00 56.30  ? -55 DA  I "C4'" 1 
ATOM 6610  O "O4'" . DA  I 5 29  ? 265.022 290.547 258.738 1.00 56.30  ? -55 DA  I "O4'" 1 
ATOM 6611  C "C3'" . DA  I 5 29  ? 264.212 288.409 259.302 1.00 56.30  ? -55 DA  I "C3'" 1 
ATOM 6612  O "O3'" . DA  I 5 29  ? 265.385 287.652 259.302 1.00 56.30  ? -55 DA  I "O3'" 1 
ATOM 6613  C "C2'" . DA  I 5 29  ? 264.168 289.323 260.520 1.00 56.30  ? -55 DA  I "C2'" 1 
ATOM 6614  C "C1'" . DA  I 5 29  ? 265.216 290.341 260.123 1.00 56.30  ? -55 DA  I "C1'" 1 
ATOM 6615  N N9    . DA  I 5 29  ? 265.084 291.631 260.778 1.00 56.30  ? -55 DA  I N9    1 
ATOM 6616  C C8    . DA  I 5 29  ? 263.938 292.219 261.216 1.00 56.30  ? -55 DA  I C8    1 
ATOM 6617  N N7    . DA  I 5 29  ? 264.120 293.401 261.743 1.00 56.30  ? -55 DA  I N7    1 
ATOM 6618  C C5    . DA  I 5 29  ? 265.479 293.604 261.632 1.00 56.30  ? -55 DA  I C5    1 
ATOM 6619  C C6    . DA  I 5 29  ? 266.304 294.675 261.998 1.00 56.30  ? -55 DA  I C6    1 
ATOM 6620  N N6    . DA  I 5 29  ? 265.851 295.780 262.584 1.00 56.30  ? -55 DA  I N6    1 
ATOM 6621  N N1    . DA  I 5 29  ? 267.617 294.560 261.754 1.00 56.30  ? -55 DA  I N1    1 
ATOM 6622  C C2    . DA  I 5 29  ? 268.068 293.452 261.168 1.00 56.30  ? -55 DA  I C2    1 
ATOM 6623  N N3    . DA  I 5 29  ? 267.388 292.386 260.768 1.00 56.30  ? -55 DA  I N3    1 
ATOM 6624  C C4    . DA  I 5 29  ? 266.086 292.528 261.033 1.00 56.30  ? -55 DA  I C4    1 
ATOM 6625  P P     . DC  I 5 30  ? 265.416 286.150 259.848 1.00 51.61  ? -54 DC  I P     1 
ATOM 6626  O OP1   . DC  I 5 30  ? 265.117 285.271 258.702 1.00 51.61  ? -54 DC  I OP1   1 
ATOM 6627  O OP2   . DC  I 5 30  ? 264.617 286.073 261.084 1.00 51.61  ? -54 DC  I OP2   1 
ATOM 6628  O "O5'" . DC  I 5 30  ? 266.941 285.967 260.255 1.00 51.61  ? -54 DC  I "O5'" 1 
ATOM 6629  C "C5'" . DC  I 5 30  ? 267.934 286.587 259.473 1.00 51.61  ? -54 DC  I "C5'" 1 
ATOM 6630  C "C4'" . DC  I 5 30  ? 269.145 286.964 260.302 1.00 51.61  ? -54 DC  I "C4'" 1 
ATOM 6631  O "O4'" . DC  I 5 30  ? 268.959 288.263 260.919 1.00 51.61  ? -54 DC  I "O4'" 1 
ATOM 6632  C "C3'" . DC  I 5 30  ? 269.485 286.013 261.425 1.00 51.61  ? -54 DC  I "C3'" 1 
ATOM 6633  O "O3'" . DC  I 5 30  ? 270.866 285.946 261.528 1.00 51.61  ? -54 DC  I "O3'" 1 
ATOM 6634  C "C2'" . DC  I 5 30  ? 268.864 286.694 262.642 1.00 51.61  ? -54 DC  I "C2'" 1 
ATOM 6635  C "C1'" . DC  I 5 30  ? 269.087 288.159 262.320 1.00 51.61  ? -54 DC  I "C1'" 1 
ATOM 6636  N N1    . DC  I 5 30  ? 268.077 289.061 262.918 1.00 51.61  ? -54 DC  I N1    1 
ATOM 6637  C C2    . DC  I 5 30  ? 268.459 290.307 263.423 1.00 51.61  ? -54 DC  I C2    1 
ATOM 6638  O O2    . DC  I 5 30  ? 269.642 290.632 263.386 1.00 51.61  ? -54 DC  I O2    1 
ATOM 6639  N N3    . DC  I 5 30  ? 267.514 291.119 263.941 1.00 51.61  ? -54 DC  I N3    1 
ATOM 6640  C C4    . DC  I 5 30  ? 266.250 290.732 263.961 1.00 51.61  ? -54 DC  I C4    1 
ATOM 6641  N N4    . DC  I 5 30  ? 265.347 291.561 264.486 1.00 51.61  ? -54 DC  I N4    1 
ATOM 6642  C C5    . DC  I 5 30  ? 265.844 289.470 263.456 1.00 51.61  ? -54 DC  I C5    1 
ATOM 6643  C C6    . DC  I 5 30  ? 266.778 288.680 262.940 1.00 51.61  ? -54 DC  I C6    1 
ATOM 6644  P P     . DA  I 5 31  ? 271.581 284.676 262.180 1.00 53.24  ? -53 DA  I P     1 
ATOM 6645  O OP1   . DA  I 5 31  ? 272.397 284.036 261.138 1.00 53.24  ? -53 DA  I OP1   1 
ATOM 6646  O OP2   . DA  I 5 31  ? 270.577 283.900 262.937 1.00 53.24  ? -53 DA  I OP2   1 
ATOM 6647  O "O5'" . DA  I 5 31  ? 272.587 285.350 263.200 1.00 53.24  ? -53 DA  I "O5'" 1 
ATOM 6648  C "C5'" . DA  I 5 31  ? 273.176 286.579 262.856 1.00 53.24  ? -53 DA  I "C5'" 1 
ATOM 6649  C "C4'" . DA  I 5 31  ? 273.559 287.346 264.094 1.00 53.24  ? -53 DA  I "C4'" 1 
ATOM 6650  O "O4'" . DA  I 5 31  ? 272.456 288.184 264.517 1.00 53.24  ? -53 DA  I "O4'" 1 
ATOM 6651  C "C3'" . DA  I 5 31  ? 273.916 286.479 265.289 1.00 53.24  ? -53 DA  I "C3'" 1 
ATOM 6652  O "O3'" . DA  I 5 31  ? 275.021 287.039 265.941 1.00 53.24  ? -53 DA  I "O3'" 1 
ATOM 6653  C "C2'" . DA  I 5 31  ? 272.661 286.546 266.150 1.00 53.24  ? -53 DA  I "C2'" 1 
ATOM 6654  C "C1'" . DA  I 5 31  ? 272.188 287.958 265.878 1.00 53.24  ? -53 DA  I "C1'" 1 
ATOM 6655  N N9    . DA  I 5 31  ? 270.767 288.130 266.082 1.00 53.24  ? -53 DA  I N9    1 
ATOM 6656  C C8    . DA  I 5 31  ? 269.791 287.238 265.778 1.00 53.24  ? -53 DA  I C8    1 
ATOM 6657  N N7    . DA  I 5 31  ? 268.589 287.653 266.060 1.00 53.24  ? -53 DA  I N7    1 
ATOM 6658  C C5    . DA  I 5 31  ? 268.792 288.905 266.596 1.00 53.24  ? -53 DA  I C5    1 
ATOM 6659  C C6    . DA  I 5 31  ? 267.912 289.860 267.099 1.00 53.24  ? -53 DA  I C6    1 
ATOM 6660  N N6    . DA  I 5 31  ? 266.592 289.691 267.129 1.00 53.24  ? -53 DA  I N6    1 
ATOM 6661  N N1    . DA  I 5 31  ? 268.434 291.005 267.556 1.00 53.24  ? -53 DA  I N1    1 
ATOM 6662  C C2    . DA  I 5 31  ? 269.754 291.176 267.516 1.00 53.24  ? -53 DA  I C2    1 
ATOM 6663  N N3    . DA  I 5 31  ? 270.684 290.346 267.073 1.00 53.24  ? -53 DA  I N3    1 
ATOM 6664  C C4    . DA  I 5 31  ? 270.130 289.217 266.618 1.00 53.24  ? -53 DA  I C4    1 
ATOM 6665  P P     . DC  I 5 32  ? 275.844 286.202 267.030 1.00 55.24  ? -52 DC  I P     1 
ATOM 6666  O OP1   . DC  I 5 32  ? 277.217 286.082 266.513 1.00 55.24  ? -52 DC  I OP1   1 
ATOM 6667  O OP2   . DC  I 5 32  ? 275.085 284.993 267.401 1.00 55.24  ? -52 DC  I OP2   1 
ATOM 6668  O "O5'" . DC  I 5 32  ? 275.859 287.183 268.280 1.00 55.24  ? -52 DC  I "O5'" 1 
ATOM 6669  C "C5'" . DC  I 5 32  ? 275.986 288.574 268.059 1.00 55.24  ? -52 DC  I "C5'" 1 
ATOM 6670  C "C4'" . DC  I 5 32  ? 275.413 289.351 269.216 1.00 55.24  ? -52 DC  I "C4'" 1 
ATOM 6671  O "O4'" . DC  I 5 32  ? 273.974 289.453 269.071 1.00 55.24  ? -52 DC  I "O4'" 1 
ATOM 6672  C "C3'" . DC  I 5 32  ? 275.652 288.717 270.585 1.00 55.24  ? -52 DC  I "C3'" 1 
ATOM 6673  O "O3'" . DC  I 5 32  ? 275.994 289.717 271.505 1.00 55.24  ? -52 DC  I "O3'" 1 
ATOM 6674  C "C2'" . DC  I 5 32  ? 274.298 288.110 270.917 1.00 55.24  ? -52 DC  I "C2'" 1 
ATOM 6675  C "C1'" . DC  I 5 32  ? 273.384 289.142 270.300 1.00 55.24  ? -52 DC  I "C1'" 1 
ATOM 6676  N N1    . DC  I 5 32  ? 272.020 288.656 270.068 1.00 55.24  ? -52 DC  I N1    1 
ATOM 6677  C C2    . DC  I 5 32  ? 270.957 289.415 270.514 1.00 55.24  ? -52 DC  I C2    1 
ATOM 6678  O O2    . DC  I 5 32  ? 271.197 290.472 271.095 1.00 55.24  ? -52 DC  I O2    1 
ATOM 6679  N N3    . DC  I 5 32  ? 269.705 288.968 270.315 1.00 55.24  ? -52 DC  I N3    1 
ATOM 6680  C C4    . DC  I 5 32  ? 269.505 287.815 269.692 1.00 55.24  ? -52 DC  I C4    1 
ATOM 6681  N N4    . DC  I 5 32  ? 268.248 287.412 269.512 1.00 55.24  ? -52 DC  I N4    1 
ATOM 6682  C C5    . DC  I 5 32  ? 270.583 287.022 269.224 1.00 55.24  ? -52 DC  I C5    1 
ATOM 6683  C C6    . DC  I 5 32  ? 271.816 287.477 269.432 1.00 55.24  ? -52 DC  I C6    1 
ATOM 6684  P P     . DG  I 5 33  ? 276.835 289.356 272.820 1.00 55.63  ? -51 DG  I P     1 
ATOM 6685  O OP1   . DG  I 5 33  ? 278.193 289.897 272.615 1.00 55.63  ? -51 DG  I OP1   1 
ATOM 6686  O OP2   . DG  I 5 33  ? 276.648 287.922 273.125 1.00 55.63  ? -51 DG  I OP2   1 
ATOM 6687  O "O5'" . DG  I 5 33  ? 276.104 290.198 273.958 1.00 55.63  ? -51 DG  I "O5'" 1 
ATOM 6688  C "C5'" . DG  I 5 33  ? 275.783 291.552 273.721 1.00 55.63  ? -51 DG  I "C5'" 1 
ATOM 6689  C "C4'" . DG  I 5 33  ? 274.664 292.010 274.633 1.00 55.63  ? -51 DG  I "C4'" 1 
ATOM 6690  O "O4'" . DG  I 5 33  ? 273.394 291.566 274.101 1.00 55.63  ? -51 DG  I "O4'" 1 
ATOM 6691  C "C3'" . DG  I 5 33  ? 274.736 291.476 276.060 1.00 55.63  ? -51 DG  I "C3'" 1 
ATOM 6692  O "O3'" . DG  I 5 33  ? 274.363 292.494 276.976 1.00 55.63  ? -51 DG  I "O3'" 1 
ATOM 6693  C "C2'" . DG  I 5 33  ? 273.725 290.338 276.049 1.00 55.63  ? -51 DG  I "C2'" 1 
ATOM 6694  C "C1'" . DG  I 5 33  ? 272.680 290.881 275.098 1.00 55.63  ? -51 DG  I "C1'" 1 
ATOM 6695  N N9    . DG  I 5 33  ? 271.892 289.847 274.454 1.00 55.63  ? -51 DG  I N9    1 
ATOM 6696  C C8    . DG  I 5 33  ? 272.360 288.794 273.716 1.00 55.63  ? -51 DG  I C8    1 
ATOM 6697  N N7    . DG  I 5 33  ? 271.420 288.028 273.257 1.00 55.63  ? -51 DG  I N7    1 
ATOM 6698  C C5    . DG  I 5 33  ? 270.256 288.617 273.709 1.00 55.63  ? -51 DG  I C5    1 
ATOM 6699  C C6    . DG  I 5 33  ? 268.920 288.234 273.521 1.00 55.63  ? -51 DG  I C6    1 
ATOM 6700  O O6    . DG  I 5 33  ? 268.488 287.263 272.895 1.00 55.63  ? -51 DG  I O6    1 
ATOM 6701  N N1    . DG  I 5 33  ? 268.043 289.102 274.155 1.00 55.63  ? -51 DG  I N1    1 
ATOM 6702  C C2    . DG  I 5 33  ? 268.417 290.205 274.874 1.00 55.63  ? -51 DG  I C2    1 
ATOM 6703  N N2    . DG  I 5 33  ? 267.434 290.927 275.418 1.00 55.63  ? -51 DG  I N2    1 
ATOM 6704  N N3    . DG  I 5 33  ? 269.670 290.574 275.056 1.00 55.63  ? -51 DG  I N3    1 
ATOM 6705  C C4    . DG  I 5 33  ? 270.530 289.737 274.449 1.00 55.63  ? -51 DG  I C4    1 
ATOM 6706  P P     . DT  I 5 34  ? 274.623 292.305 278.548 1.00 55.21  ? -50 DT  I P     1 
ATOM 6707  O OP1   . DT  I 5 34  ? 275.219 293.558 279.054 1.00 55.21  ? -50 DT  I OP1   1 
ATOM 6708  O OP2   . DT  I 5 34  ? 275.339 291.028 278.744 1.00 55.21  ? -50 DT  I OP2   1 
ATOM 6709  O "O5'" . DT  I 5 34  ? 273.158 292.138 279.156 1.00 55.21  ? -50 DT  I "O5'" 1 
ATOM 6710  C "C5'" . DT  I 5 34  ? 272.117 292.993 278.724 1.00 55.21  ? -50 DT  I "C5'" 1 
ATOM 6711  C "C4'" . DT  I 5 34  ? 270.836 292.705 279.480 1.00 55.21  ? -50 DT  I "C4'" 1 
ATOM 6712  O "O4'" . DT  I 5 34  ? 269.997 291.802 278.715 1.00 55.21  ? -50 DT  I "O4'" 1 
ATOM 6713  C "C3'" . DT  I 5 34  ? 271.026 292.066 280.848 1.00 55.21  ? -50 DT  I "C3'" 1 
ATOM 6714  O "O3'" . DT  I 5 34  ? 270.188 292.711 281.781 1.00 55.21  ? -50 DT  I "O3'" 1 
ATOM 6715  C "C2'" . DT  I 5 34  ? 270.619 290.610 280.625 1.00 55.21  ? -50 DT  I "C2'" 1 
ATOM 6716  C "C1'" . DT  I 5 34  ? 269.585 290.724 279.520 1.00 55.21  ? -50 DT  I "C1'" 1 
ATOM 6717  N N1    . DT  I 5 34  ? 269.520 289.525 278.659 1.00 55.21  ? -50 DT  I N1    1 
ATOM 6718  C C2    . DT  I 5 34  ? 268.302 288.989 278.332 1.00 55.21  ? -50 DT  I C2    1 
ATOM 6719  O O2    . DT  I 5 34  ? 267.248 289.442 278.727 1.00 55.21  ? -50 DT  I O2    1 
ATOM 6720  N N3    . DT  I 5 34  ? 268.365 287.891 277.525 1.00 55.21  ? -50 DT  I N3    1 
ATOM 6721  C C4    . DT  I 5 34  ? 269.496 287.295 277.020 1.00 55.21  ? -50 DT  I C4    1 
ATOM 6722  O O4    . DT  I 5 34  ? 269.456 286.311 276.300 1.00 55.21  ? -50 DT  I O4    1 
ATOM 6723  C C5    . DT  I 5 34  ? 270.734 287.909 277.396 1.00 55.21  ? -50 DT  I C5    1 
ATOM 6724  C C7    . DT  I 5 34  ? 272.027 287.343 276.903 1.00 55.21  ? -50 DT  I C7    1 
ATOM 6725  C C6    . DT  I 5 34  ? 270.688 288.983 278.184 1.00 55.21  ? -50 DT  I C6    1 
ATOM 6726  P P     . DG  I 5 35  ? 270.257 292.343 283.340 1.00 53.70  ? -49 DG  I P     1 
ATOM 6727  O OP1   . DG  I 5 35  ? 270.300 293.620 284.080 1.00 53.70  ? -49 DG  I OP1   1 
ATOM 6728  O OP2   . DG  I 5 35  ? 271.313 291.331 283.560 1.00 53.70  ? -49 DG  I OP2   1 
ATOM 6729  O "O5'" . DG  I 5 35  ? 268.849 291.651 283.607 1.00 53.70  ? -49 DG  I "O5'" 1 
ATOM 6730  C "C5'" . DG  I 5 35  ? 267.683 292.206 283.031 1.00 53.70  ? -49 DG  I "C5'" 1 
ATOM 6731  C "C4'" . DG  I 5 35  ? 266.476 291.319 283.270 1.00 53.70  ? -49 DG  I "C4'" 1 
ATOM 6732  O "O4'" . DG  I 5 35  ? 266.460 290.232 282.312 1.00 53.70  ? -49 DG  I "O4'" 1 
ATOM 6733  C "C3'" . DG  I 5 35  ? 266.410 290.657 284.634 1.00 53.70  ? -49 DG  I "C3'" 1 
ATOM 6734  O "O3'" . DG  I 5 35  ? 265.054 290.503 284.991 1.00 53.70  ? -49 DG  I "O3'" 1 
ATOM 6735  C "C2'" . DG  I 5 35  ? 267.076 289.310 284.372 1.00 53.70  ? -49 DG  I "C2'" 1 
ATOM 6736  C "C1'" . DG  I 5 35  ? 266.542 288.993 282.986 1.00 53.70  ? -49 DG  I "C1'" 1 
ATOM 6737  N N9    . DG  I 5 35  ? 267.398 288.121 282.194 1.00 53.70  ? -49 DG  I N9    1 
ATOM 6738  C C8    . DG  I 5 35  ? 268.761 288.175 282.088 1.00 53.70  ? -49 DG  I C8    1 
ATOM 6739  N N7    . DG  I 5 35  ? 269.250 287.285 281.278 1.00 53.70  ? -49 DG  I N7    1 
ATOM 6740  C C5    . DG  I 5 35  ? 268.139 286.608 280.809 1.00 53.70  ? -49 DG  I C5    1 
ATOM 6741  C C6    . DG  I 5 35  ? 268.049 285.541 279.900 1.00 53.70  ? -49 DG  I C6    1 
ATOM 6742  O O6    . DG  I 5 35  ? 268.964 284.965 279.315 1.00 53.70  ? -49 DG  I O6    1 
ATOM 6743  N N1    . DG  I 5 35  ? 266.739 285.145 279.699 1.00 53.70  ? -49 DG  I N1    1 
ATOM 6744  C C2    . DG  I 5 35  ? 265.650 285.717 280.294 1.00 53.70  ? -49 DG  I C2    1 
ATOM 6745  N N2    . DG  I 5 35  ? 264.459 285.205 279.976 1.00 53.70  ? -49 DG  I N2    1 
ATOM 6746  N N3    . DG  I 5 35  ? 265.719 286.720 281.146 1.00 53.70  ? -49 DG  I N3    1 
ATOM 6747  C C4    . DG  I 5 35  ? 266.992 287.114 281.355 1.00 53.70  ? -49 DG  I C4    1 
ATOM 6748  P P     . DC  I 5 36  ? 264.643 290.121 286.490 1.00 53.53  ? -48 DC  I P     1 
ATOM 6749  O OP1   . DC  I 5 36  ? 263.560 291.037 286.900 1.00 53.53  ? -48 DC  I OP1   1 
ATOM 6750  O OP2   . DC  I 5 36  ? 265.885 290.026 287.284 1.00 53.53  ? -48 DC  I OP2   1 
ATOM 6751  O "O5'" . DC  I 5 36  ? 264.031 288.656 286.347 1.00 53.53  ? -48 DC  I "O5'" 1 
ATOM 6752  C "C5'" . DC  I 5 36  ? 263.032 288.397 285.372 1.00 53.53  ? -48 DC  I "C5'" 1 
ATOM 6753  C "C4'" . DC  I 5 36  ? 262.785 286.907 285.229 1.00 53.53  ? -48 DC  I "C4'" 1 
ATOM 6754  O "O4'" . DC  I 5 36  ? 263.805 286.319 284.376 1.00 53.53  ? -48 DC  I "O4'" 1 
ATOM 6755  C "C3'" . DC  I 5 36  ? 262.848 286.112 286.531 1.00 53.53  ? -48 DC  I "C3'" 1 
ATOM 6756  O "O3'" . DC  I 5 36  ? 261.999 285.003 286.429 1.00 53.53  ? -48 DC  I "O3'" 1 
ATOM 6757  C "C2'" . DC  I 5 36  ? 264.292 285.649 286.530 1.00 53.53  ? -48 DC  I "C2'" 1 
ATOM 6758  C "C1'" . DC  I 5 36  ? 264.407 285.258 285.076 1.00 53.53  ? -48 DC  I "C1'" 1 
ATOM 6759  N N1    . DC  I 5 36  ? 265.788 285.079 284.601 1.00 53.53  ? -48 DC  I N1    1 
ATOM 6760  C C2    . DC  I 5 36  ? 266.035 284.160 283.591 1.00 53.53  ? -48 DC  I C2    1 
ATOM 6761  O O2    . DC  I 5 36  ? 265.084 283.542 283.114 1.00 53.53  ? -48 DC  I O2    1 
ATOM 6762  N N3    . DC  I 5 36  ? 267.297 283.987 283.159 1.00 53.53  ? -48 DC  I N3    1 
ATOM 6763  C C4    . DC  I 5 36  ? 268.285 284.679 283.710 1.00 53.53  ? -48 DC  I C4    1 
ATOM 6764  N N4    . DC  I 5 36  ? 269.518 284.475 283.250 1.00 53.53  ? -48 DC  I N4    1 
ATOM 6765  C C5    . DC  I 5 36  ? 268.055 285.621 284.749 1.00 53.53  ? -48 DC  I C5    1 
ATOM 6766  C C6    . DC  I 5 36  ? 266.800 285.785 285.162 1.00 53.53  ? -48 DC  I C6    1 
ATOM 6767  P P     . DC  I 5 37  ? 260.508 285.050 287.005 1.00 52.08  ? -47 DC  I P     1 
ATOM 6768  O OP1   . DC  I 5 37  ? 259.759 286.068 286.240 1.00 52.08  ? -47 DC  I OP1   1 
ATOM 6769  O OP2   . DC  I 5 37  ? 260.614 285.138 288.474 1.00 52.08  ? -47 DC  I OP2   1 
ATOM 6770  O "O5'" . DC  I 5 37  ? 259.926 283.613 286.623 1.00 52.08  ? -47 DC  I "O5'" 1 
ATOM 6771  C "C5'" . DC  I 5 37  ? 259.995 283.159 285.273 1.00 52.08  ? -47 DC  I "C5'" 1 
ATOM 6772  C "C4'" . DC  I 5 37  ? 260.402 281.699 285.207 1.00 52.08  ? -47 DC  I "C4'" 1 
ATOM 6773  O "O4'" . DC  I 5 37  ? 261.822 281.599 284.940 1.00 52.08  ? -47 DC  I "O4'" 1 
ATOM 6774  C "C3'" . DC  I 5 37  ? 260.171 280.901 286.486 1.00 52.08  ? -47 DC  I "C3'" 1 
ATOM 6775  O "O3'" . DC  I 5 37  ? 259.844 279.569 286.153 1.00 52.08  ? -47 DC  I "O3'" 1 
ATOM 6776  C "C2'" . DC  I 5 37  ? 261.545 280.966 287.142 1.00 52.08  ? -47 DC  I "C2'" 1 
ATOM 6777  C "C1'" . DC  I 5 37  ? 262.412 280.784 285.919 1.00 52.08  ? -47 DC  I "C1'" 1 
ATOM 6778  N N1    . DC  I 5 37  ? 263.813 281.198 286.086 1.00 52.08  ? -47 DC  I N1    1 
ATOM 6779  C C2    . DC  I 5 37  ? 264.782 280.628 285.273 1.00 52.08  ? -47 DC  I C2    1 
ATOM 6780  O O2    . DC  I 5 37  ? 264.438 279.785 284.450 1.00 52.08  ? -47 DC  I O2    1 
ATOM 6781  N N3    . DC  I 5 37  ? 266.063 281.004 285.417 1.00 52.08  ? -47 DC  I N3    1 
ATOM 6782  C C4    . DC  I 5 37  ? 266.386 281.920 286.318 1.00 52.08  ? -47 DC  I C4    1 
ATOM 6783  N N4    . DC  I 5 37  ? 267.668 282.266 286.419 1.00 52.08  ? -47 DC  I N4    1 
ATOM 6784  C C5    . DC  I 5 37  ? 265.412 282.518 287.160 1.00 52.08  ? -47 DC  I C5    1 
ATOM 6785  C C6    . DC  I 5 37  ? 264.146 282.135 287.006 1.00 52.08  ? -47 DC  I C6    1 
ATOM 6786  P P     . DT  I 5 38  ? 258.333 279.143 285.813 1.00 50.31  ? -46 DT  I P     1 
ATOM 6787  O OP1   . DT  I 5 38  ? 257.728 280.156 284.930 1.00 50.31  ? -46 DT  I OP1   1 
ATOM 6788  O OP2   . DT  I 5 38  ? 257.681 278.799 287.091 1.00 50.31  ? -46 DT  I OP2   1 
ATOM 6789  O "O5'" . DT  I 5 38  ? 258.500 277.791 284.978 1.00 50.31  ? -46 DT  I "O5'" 1 
ATOM 6790  C "C5'" . DT  I 5 38  ? 259.215 277.794 283.742 1.00 50.31  ? -46 DT  I "C5'" 1 
ATOM 6791  C "C4'" . DT  I 5 38  ? 260.173 276.612 283.639 1.00 50.31  ? -46 DT  I "C4'" 1 
ATOM 6792  O "O4'" . DT  I 5 38  ? 261.453 276.959 284.225 1.00 50.31  ? -46 DT  I "O4'" 1 
ATOM 6793  C "C3'" . DT  I 5 38  ? 259.747 275.338 284.354 1.00 50.31  ? -46 DT  I "C3'" 1 
ATOM 6794  O "O3'" . DT  I 5 38  ? 260.339 274.238 283.704 1.00 50.31  ? -46 DT  I "O3'" 1 
ATOM 6795  C "C2'" . DT  I 5 38  ? 260.394 275.535 285.714 1.00 50.31  ? -46 DT  I "C2'" 1 
ATOM 6796  C "C1'" . DT  I 5 38  ? 261.743 276.053 285.268 1.00 50.31  ? -46 DT  I "C1'" 1 
ATOM 6797  N N1    . DT  I 5 38  ? 262.487 276.774 286.303 1.00 50.31  ? -46 DT  I N1    1 
ATOM 6798  C C2    . DT  I 5 38  ? 263.820 276.991 286.123 1.00 50.31  ? -46 DT  I C2    1 
ATOM 6799  O O2    . DT  I 5 38  ? 264.427 276.607 285.150 1.00 50.31  ? -46 DT  I O2    1 
ATOM 6800  N N3    . DT  I 5 38  ? 264.427 277.682 287.120 1.00 50.31  ? -46 DT  I N3    1 
ATOM 6801  C C4    . DT  I 5 38  ? 263.843 278.168 288.265 1.00 50.31  ? -46 DT  I C4    1 
ATOM 6802  O O4    . DT  I 5 38  ? 264.477 278.780 289.108 1.00 50.31  ? -46 DT  I O4    1 
ATOM 6803  C C5    . DT  I 5 38  ? 262.437 277.910 288.394 1.00 50.31  ? -46 DT  I C5    1 
ATOM 6804  C C7    . DT  I 5 38  ? 261.692 278.394 289.598 1.00 50.31  ? -46 DT  I C7    1 
ATOM 6805  C C6    . DT  I 5 38  ? 261.831 277.234 287.415 1.00 50.31  ? -46 DT  I C6    1 
ATOM 6806  P P     . DG  I 5 39  ? 259.486 273.266 282.757 1.00 47.55  ? -45 DG  I P     1 
ATOM 6807  O OP1   . DG  I 5 39  ? 258.875 274.077 281.690 1.00 47.55  ? -45 DG  I OP1   1 
ATOM 6808  O OP2   . DG  I 5 39  ? 258.640 272.420 283.623 1.00 47.55  ? -45 DG  I OP2   1 
ATOM 6809  O "O5'" . DG  I 5 39  ? 260.602 272.335 282.097 1.00 47.55  ? -45 DG  I "O5'" 1 
ATOM 6810  C "C5'" . DG  I 5 39  ? 261.719 272.924 281.451 1.00 47.55  ? -45 DG  I "C5'" 1 
ATOM 6811  C "C4'" . DG  I 5 39  ? 263.033 272.340 281.948 1.00 47.55  ? -45 DG  I "C4'" 1 
ATOM 6812  O "O4'" . DG  I 5 39  ? 263.443 272.993 283.178 1.00 47.55  ? -45 DG  I "O4'" 1 
ATOM 6813  C "C3'" . DG  I 5 39  ? 263.028 270.850 282.270 1.00 47.55  ? -45 DG  I "C3'" 1 
ATOM 6814  O "O3'" . DG  I 5 39  ? 264.319 270.348 282.034 1.00 47.55  ? -45 DG  I "O3'" 1 
ATOM 6815  C "C2'" . DG  I 5 39  ? 262.754 270.867 283.765 1.00 47.55  ? -45 DG  I "C2'" 1 
ATOM 6816  C "C1'" . DG  I 5 39  ? 263.662 272.009 284.163 1.00 47.55  ? -45 DG  I "C1'" 1 
ATOM 6817  N N9    . DG  I 5 39  ? 263.376 272.591 285.462 1.00 47.55  ? -45 DG  I N9    1 
ATOM 6818  C C8    . DG  I 5 39  ? 262.176 272.626 286.112 1.00 47.55  ? -45 DG  I C8    1 
ATOM 6819  N N7    . DG  I 5 39  ? 262.228 273.240 287.256 1.00 47.55  ? -45 DG  I N7    1 
ATOM 6820  C C5    . DG  I 5 39  ? 263.546 273.636 287.367 1.00 47.55  ? -45 DG  I C5    1 
ATOM 6821  C C6    . DG  I 5 39  ? 264.199 274.347 288.391 1.00 47.55  ? -45 DG  I C6    1 
ATOM 6822  O O6    . DG  I 5 39  ? 263.732 274.775 289.448 1.00 47.55  ? -45 DG  I O6    1 
ATOM 6823  N N1    . DG  I 5 39  ? 265.536 274.540 288.105 1.00 47.55  ? -45 DG  I N1    1 
ATOM 6824  C C2    . DG  I 5 39  ? 266.162 274.106 286.971 1.00 47.55  ? -45 DG  I C2    1 
ATOM 6825  N N2    . DG  I 5 39  ? 267.458 274.383 286.863 1.00 47.55  ? -45 DG  I N2    1 
ATOM 6826  N N3    . DG  I 5 39  ? 265.563 273.450 286.005 1.00 47.55  ? -45 DG  I N3    1 
ATOM 6827  C C4    . DG  I 5 39  ? 264.261 273.251 286.268 1.00 47.55  ? -45 DG  I C4    1 
ATOM 6828  P P     . DG  I 5 40  ? 264.605 269.240 280.915 1.00 45.62  ? -44 DG  I P     1 
ATOM 6829  O OP1   . DG  I 5 40  ? 264.345 269.834 279.594 1.00 45.62  ? -44 DG  I OP1   1 
ATOM 6830  O OP2   . DG  I 5 40  ? 263.912 268.011 281.322 1.00 45.62  ? -44 DG  I OP2   1 
ATOM 6831  O "O5'" . DG  I 5 40  ? 266.171 268.988 281.065 1.00 45.62  ? -44 DG  I "O5'" 1 
ATOM 6832  C "C5'" . DG  I 5 40  ? 267.059 270.085 281.056 1.00 45.62  ? -44 DG  I "C5'" 1 
ATOM 6833  C "C4'" . DG  I 5 40  ? 268.180 269.908 282.068 1.00 45.62  ? -44 DG  I "C4'" 1 
ATOM 6834  O "O4'" . DG  I 5 40  ? 267.790 270.450 283.353 1.00 45.62  ? -44 DG  I "O4'" 1 
ATOM 6835  C "C3'" . DG  I 5 40  ? 268.628 268.479 282.332 1.00 45.62  ? -44 DG  I "C3'" 1 
ATOM 6836  O "O3'" . DG  I 5 40  ? 270.034 268.478 282.460 1.00 45.62  ? -44 DG  I "O3'" 1 
ATOM 6837  C "C2'" . DG  I 5 40  ? 267.942 268.148 283.655 1.00 45.62  ? -44 DG  I "C2'" 1 
ATOM 6838  C "C1'" . DG  I 5 40  ? 267.986 269.487 284.361 1.00 45.62  ? -44 DG  I "C1'" 1 
ATOM 6839  N N9    . DG  I 5 40  ? 266.935 269.678 285.349 1.00 45.62  ? -44 DG  I N9    1 
ATOM 6840  C C8    . DG  I 5 40  ? 265.620 269.327 285.231 1.00 45.62  ? -44 DG  I C8    1 
ATOM 6841  N N7    . DG  I 5 40  ? 264.905 269.654 286.263 1.00 45.62  ? -44 DG  I N7    1 
ATOM 6842  C C5    . DG  I 5 40  ? 265.800 270.273 287.115 1.00 45.62  ? -44 DG  I C5    1 
ATOM 6843  C C6    . DG  I 5 40  ? 265.599 270.835 288.390 1.00 45.62  ? -44 DG  I C6    1 
ATOM 6844  O O6    . DG  I 5 40  ? 264.553 270.900 289.040 1.00 45.62  ? -44 DG  I O6    1 
ATOM 6845  N N1    . DG  I 5 40  ? 266.769 271.358 288.909 1.00 45.62  ? -44 DG  I N1    1 
ATOM 6846  C C2    . DG  I 5 40  ? 267.980 271.338 288.277 1.00 45.62  ? -44 DG  I C2    1 
ATOM 6847  N N2    . DG  I 5 40  ? 269.003 271.887 288.931 1.00 45.62  ? -44 DG  I N2    1 
ATOM 6848  N N3    . DG  I 5 40  ? 268.181 270.813 287.085 1.00 45.62  ? -44 DG  I N3    1 
ATOM 6849  C C4    . DG  I 5 40  ? 267.050 270.300 286.566 1.00 45.62  ? -44 DG  I C4    1 
ATOM 6850  P P     . DA  I 5 41  ? 270.863 267.120 282.618 1.00 46.27  ? -43 DA  I P     1 
ATOM 6851  O OP1   . DA  I 5 41  ? 271.853 267.120 281.537 1.00 46.27  ? -43 DA  I OP1   1 
ATOM 6852  O OP2   . DA  I 5 41  ? 269.950 265.978 282.800 1.00 46.27  ? -43 DA  I OP2   1 
ATOM 6853  O "O5'" . DA  I 5 41  ? 271.652 267.337 283.975 1.00 46.27  ? -43 DA  I "O5'" 1 
ATOM 6854  C "C5'" . DA  I 5 41  ? 272.355 268.541 284.182 1.00 46.27  ? -43 DA  I "C5'" 1 
ATOM 6855  C "C4'" . DA  I 5 41  ? 272.826 268.653 285.614 1.00 46.27  ? -43 DA  I "C4'" 1 
ATOM 6856  O "O4'" . DA  I 5 41  ? 271.712 268.971 286.476 1.00 46.27  ? -43 DA  I "O4'" 1 
ATOM 6857  C "C3'" . DA  I 5 41  ? 273.451 267.397 286.192 1.00 46.27  ? -43 DA  I "C3'" 1 
ATOM 6858  O "O3'" . DA  I 5 41  ? 274.482 267.771 287.055 1.00 46.27  ? -43 DA  I "O3'" 1 
ATOM 6859  C "C2'" . DA  I 5 41  ? 272.291 266.758 286.948 1.00 46.27  ? -43 DA  I "C2'" 1 
ATOM 6860  C "C1'" . DA  I 5 41  ? 271.576 267.983 287.471 1.00 46.27  ? -43 DA  I "C1'" 1 
ATOM 6861  N N9    . DA  I 5 41  ? 270.157 267.794 287.699 1.00 46.27  ? -43 DA  I N9    1 
ATOM 6862  C C8    . DA  I 5 41  ? 269.242 267.292 286.827 1.00 46.27  ? -43 DA  I C8    1 
ATOM 6863  N N7    . DA  I 5 41  ? 268.027 267.268 287.299 1.00 46.27  ? -43 DA  I N7    1 
ATOM 6864  C C5    . DA  I 5 41  ? 268.157 267.805 288.561 1.00 46.27  ? -43 DA  I C5    1 
ATOM 6865  C C6    . DA  I 5 41  ? 267.232 268.061 289.573 1.00 46.27  ? -43 DA  I C6    1 
ATOM 6866  N N6    . DA  I 5 41  ? 265.936 267.789 289.461 1.00 46.27  ? -43 DA  I N6    1 
ATOM 6867  N N1    . DA  I 5 41  ? 267.692 268.595 290.716 1.00 46.27  ? -43 DA  I N1    1 
ATOM 6868  C C2    . DA  I 5 41  ? 268.992 268.864 290.820 1.00 46.27  ? -43 DA  I C2    1 
ATOM 6869  N N3    . DA  I 5 41  ? 269.952 268.672 289.934 1.00 46.27  ? -43 DA  I N3    1 
ATOM 6870  C C4    . DA  I 5 41  ? 269.462 268.140 288.816 1.00 46.27  ? -43 DA  I C4    1 
ATOM 6871  P P     . DG  I 5 42  ? 275.600 266.721 287.497 1.00 49.64  ? -42 DG  I P     1 
ATOM 6872  O OP1   . DG  I 5 42  ? 276.891 267.130 286.925 1.00 49.64  ? -42 DG  I OP1   1 
ATOM 6873  O OP2   . DG  I 5 42  ? 275.081 265.366 287.260 1.00 49.64  ? -42 DG  I OP2   1 
ATOM 6874  O "O5'" . DG  I 5 42  ? 275.685 266.952 289.057 1.00 49.64  ? -42 DG  I "O5'" 1 
ATOM 6875  C "C5'" . DG  I 5 42  ? 274.614 267.577 289.722 1.00 49.64  ? -42 DG  I "C5'" 1 
ATOM 6876  C "C4'" . DG  I 5 42  ? 274.803 267.476 291.210 1.00 49.64  ? -42 DG  I "C4'" 1 
ATOM 6877  O "O4'" . DG  I 5 42  ? 273.517 267.339 291.836 1.00 49.64  ? -42 DG  I "O4'" 1 
ATOM 6878  C "C3'" . DG  I 5 42  ? 275.552 266.250 291.656 1.00 49.64  ? -42 DG  I "C3'" 1 
ATOM 6879  O "O3'" . DG  I 5 42  ? 275.982 266.437 292.982 1.00 49.64  ? -42 DG  I "O3'" 1 
ATOM 6880  C "C2'" . DG  I 5 42  ? 274.460 265.195 291.568 1.00 49.64  ? -42 DG  I "C2'" 1 
ATOM 6881  C "C1'" . DG  I 5 42  ? 273.258 265.973 292.087 1.00 49.64  ? -42 DG  I "C1'" 1 
ATOM 6882  N N9    . DG  I 5 42  ? 272.008 265.641 291.433 1.00 49.64  ? -42 DG  I N9    1 
ATOM 6883  C C8    . DG  I 5 42  ? 271.822 265.230 290.142 1.00 49.64  ? -42 DG  I C8    1 
ATOM 6884  N N7    . DG  I 5 42  ? 270.574 265.028 289.841 1.00 49.64  ? -42 DG  I N7    1 
ATOM 6885  C C5    . DG  I 5 42  ? 269.898 265.336 291.004 1.00 49.64  ? -42 DG  I C5    1 
ATOM 6886  C C6    . DG  I 5 42  ? 268.524 265.311 291.289 1.00 49.64  ? -42 DG  I C6    1 
ATOM 6887  O O6    . DG  I 5 42  ? 267.594 265.000 290.544 1.00 49.64  ? -42 DG  I O6    1 
ATOM 6888  N N1    . DG  I 5 42  ? 268.266 265.702 292.594 1.00 49.64  ? -42 DG  I N1    1 
ATOM 6889  C C2    . DG  I 5 42  ? 269.223 266.060 293.505 1.00 49.64  ? -42 DG  I C2    1 
ATOM 6890  N N2    . DG  I 5 42  ? 268.800 266.404 294.722 1.00 49.64  ? -42 DG  I N2    1 
ATOM 6891  N N3    . DG  I 5 42  ? 270.509 266.089 293.245 1.00 49.64  ? -42 DG  I N3    1 
ATOM 6892  C C4    . DG  I 5 42  ? 270.771 265.722 291.983 1.00 49.64  ? -42 DG  I C4    1 
ATOM 6893  P P     . DA  I 5 43  ? 276.879 265.332 293.715 1.00 51.18  ? -41 DA  I P     1 
ATOM 6894  O OP1   . DA  I 5 43  ? 277.893 266.060 294.498 1.00 51.18  ? -41 DA  I OP1   1 
ATOM 6895  O OP2   . DA  I 5 43  ? 277.313 264.334 292.720 1.00 51.18  ? -41 DA  I OP2   1 
ATOM 6896  O "O5'" . DA  I 5 43  ? 275.858 264.642 294.722 1.00 51.18  ? -41 DA  I "O5'" 1 
ATOM 6897  C "C5'" . DA  I 5 43  ? 275.048 265.451 295.554 1.00 51.18  ? -41 DA  I "C5'" 1 
ATOM 6898  C "C4'" . DA  I 5 43  ? 274.127 264.610 296.412 1.00 51.18  ? -41 DA  I "C4'" 1 
ATOM 6899  O "O4'" . DA  I 5 43  ? 272.856 264.426 295.740 1.00 51.18  ? -41 DA  I "O4'" 1 
ATOM 6900  C "C3'" . DA  I 5 43  ? 274.637 263.211 296.734 1.00 51.18  ? -41 DA  I "C3'" 1 
ATOM 6901  O "O3'" . DA  I 5 43  ? 274.290 262.883 298.067 1.00 51.18  ? -41 DA  I "O3'" 1 
ATOM 6902  C "C2'" . DA  I 5 43  ? 273.883 262.343 295.735 1.00 51.18  ? -41 DA  I "C2'" 1 
ATOM 6903  C "C1'" . DA  I 5 43  ? 272.548 263.055 295.693 1.00 51.18  ? -41 DA  I "C1'" 1 
ATOM 6904  N N9    . DA  I 5 43  ? 271.793 262.799 294.479 1.00 51.18  ? -41 DA  I N9    1 
ATOM 6905  C C8    . DA  I 5 43  ? 272.294 262.597 293.231 1.00 51.18  ? -41 DA  I C8    1 
ATOM 6906  N N7    . DA  I 5 43  ? 271.379 262.389 292.326 1.00 51.18  ? -41 DA  I N7    1 
ATOM 6907  C C5    . DA  I 5 43  ? 270.197 262.463 293.029 1.00 51.18  ? -41 DA  I C5    1 
ATOM 6908  C C6    . DA  I 5 43  ? 268.863 262.328 292.639 1.00 51.18  ? -41 DA  I C6    1 
ATOM 6909  N N6    . DA  I 5 43  ? 268.491 262.082 291.385 1.00 51.18  ? -41 DA  I N6    1 
ATOM 6910  N N1    . DA  I 5 43  ? 267.920 262.459 293.586 1.00 51.18  ? -41 DA  I N1    1 
ATOM 6911  C C2    . DA  I 5 43  ? 268.298 262.705 294.837 1.00 51.18  ? -41 DA  I C2    1 
ATOM 6912  N N3    . DA  I 5 43  ? 269.523 262.849 295.323 1.00 51.18  ? -41 DA  I N3    1 
ATOM 6913  C C4    . DA  I 5 43  ? 270.434 262.717 294.357 1.00 51.18  ? -41 DA  I C4    1 
ATOM 6914  P P     . DC  I 5 44  ? 274.944 261.608 298.787 1.00 53.05  ? -40 DC  I P     1 
ATOM 6915  O OP1   . DC  I 5 44  ? 274.560 261.668 300.211 1.00 53.05  ? -40 DC  I OP1   1 
ATOM 6916  O OP2   . DC  I 5 44  ? 276.369 261.547 298.403 1.00 53.05  ? -40 DC  I OP2   1 
ATOM 6917  O "O5'" . DC  I 5 44  ? 274.210 260.371 298.102 1.00 53.05  ? -40 DC  I "O5'" 1 
ATOM 6918  C "C5'" . DC  I 5 44  ? 273.657 259.351 298.896 1.00 53.05  ? -40 DC  I "C5'" 1 
ATOM 6919  C "C4'" . DC  I 5 44  ? 272.142 259.339 298.798 1.00 53.05  ? -40 DC  I "C4'" 1 
ATOM 6920  O "O4'" . DC  I 5 44  ? 271.719 259.865 297.532 1.00 53.05  ? -40 DC  I "O4'" 1 
ATOM 6921  C "C3'" . DC  I 5 44  ? 271.529 257.959 298.842 1.00 53.05  ? -40 DC  I "C3'" 1 
ATOM 6922  O "O3'" . DC  I 5 44  ? 271.322 257.579 300.177 1.00 53.05  ? -40 DC  I "O3'" 1 
ATOM 6923  C "C2'" . DC  I 5 44  ? 270.203 258.130 298.089 1.00 53.05  ? -40 DC  I "C2'" 1 
ATOM 6924  C "C1'" . DC  I 5 44  ? 270.406 259.406 297.276 1.00 53.05  ? -40 DC  I "C1'" 1 
ATOM 6925  N N1    . DC  I 5 44  ? 270.236 259.233 295.803 1.00 53.05  ? -40 DC  I N1    1 
ATOM 6926  C C2    . DC  I 5 44  ? 268.958 259.084 295.261 1.00 53.05  ? -40 DC  I C2    1 
ATOM 6927  O O2    . DC  I 5 44  ? 267.988 259.075 296.013 1.00 53.05  ? -40 DC  I O2    1 
ATOM 6928  N N3    . DC  I 5 44  ? 268.825 258.947 293.925 1.00 53.05  ? -40 DC  I N3    1 
ATOM 6929  C C4    . DC  I 5 44  ? 269.897 258.965 293.146 1.00 53.05  ? -40 DC  I C4    1 
ATOM 6930  N N4    . DC  I 5 44  ? 269.719 258.828 291.832 1.00 53.05  ? -40 DC  I N4    1 
ATOM 6931  C C5    . DC  I 5 44  ? 271.205 259.121 293.677 1.00 53.05  ? -40 DC  I C5    1 
ATOM 6932  C C6    . DC  I 5 44  ? 271.326 259.253 294.996 1.00 53.05  ? -40 DC  I C6    1 
ATOM 6933  P P     . DT  I 5 45  ? 271.321 256.027 300.568 1.00 52.93  ? -39 DT  I P     1 
ATOM 6934  O OP1   . DT  I 5 45  ? 271.499 255.930 302.031 1.00 52.93  ? -39 DT  I OP1   1 
ATOM 6935  O OP2   . DT  I 5 45  ? 272.261 255.352 299.651 1.00 52.93  ? -39 DT  I OP2   1 
ATOM 6936  O "O5'" . DT  I 5 45  ? 269.847 255.549 300.200 1.00 52.93  ? -39 DT  I "O5'" 1 
ATOM 6937  C "C5'" . DT  I 5 45  ? 268.735 256.264 300.696 1.00 52.93  ? -39 DT  I "C5'" 1 
ATOM 6938  C "C4'" . DT  I 5 45  ? 267.450 255.699 300.133 1.00 52.93  ? -39 DT  I "C4'" 1 
ATOM 6939  O "O4'" . DT  I 5 45  ? 267.317 256.088 298.743 1.00 52.93  ? -39 DT  I "O4'" 1 
ATOM 6940  C "C3'" . DT  I 5 45  ? 267.358 254.177 300.164 1.00 52.93  ? -39 DT  I "C3'" 1 
ATOM 6941  O "O3'" . DT  I 5 45  ? 266.060 253.784 300.579 1.00 52.93  ? -39 DT  I "O3'" 1 
ATOM 6942  C "C2'" . DT  I 5 45  ? 267.640 253.777 298.718 1.00 52.93  ? -39 DT  I "C2'" 1 
ATOM 6943  C "C1'" . DT  I 5 45  ? 267.068 254.955 297.951 1.00 52.93  ? -39 DT  I "C1'" 1 
ATOM 6944  N N1    . DT  I 5 45  ? 267.712 255.156 296.635 1.00 52.93  ? -39 DT  I N1    1 
ATOM 6945  C C2    . DT  I 5 45  ? 266.935 255.208 295.511 1.00 52.93  ? -39 DT  I C2    1 
ATOM 6946  O O2    . DT  I 5 45  ? 265.729 255.097 295.533 1.00 52.93  ? -39 DT  I O2    1 
ATOM 6947  N N3    . DT  I 5 45  ? 267.626 255.396 294.352 1.00 52.93  ? -39 DT  I N3    1 
ATOM 6948  C C4    . DT  I 5 45  ? 268.986 255.521 294.209 1.00 52.93  ? -39 DT  I C4    1 
ATOM 6949  O O4    . DT  I 5 45  ? 269.516 255.690 293.125 1.00 52.93  ? -39 DT  I O4    1 
ATOM 6950  C C5    . DT  I 5 45  ? 269.741 255.460 295.427 1.00 52.93  ? -39 DT  I C5    1 
ATOM 6951  C C7    . DT  I 5 45  ? 271.230 255.592 295.394 1.00 52.93  ? -39 DT  I C7    1 
ATOM 6952  C C6    . DT  I 5 45  ? 269.077 255.277 296.567 1.00 52.93  ? -39 DT  I C6    1 
ATOM 6953  P P     . DA  I 5 46  ? 265.764 252.265 301.011 1.00 51.87  ? -38 DA  I P     1 
ATOM 6954  O OP1   . DA  I 5 46  ? 265.419 252.276 302.445 1.00 51.87  ? -38 DA  I OP1   1 
ATOM 6955  O OP2   . DA  I 5 46  ? 266.869 251.402 300.541 1.00 51.87  ? -38 DA  I OP2   1 
ATOM 6956  O "O5'" . DA  I 5 46  ? 264.461 251.900 300.170 1.00 51.87  ? -38 DA  I "O5'" 1 
ATOM 6957  C "C5'" . DA  I 5 46  ? 264.299 252.449 298.880 1.00 51.87  ? -38 DA  I "C5'" 1 
ATOM 6958  C "C4'" . DA  I 5 46  ? 263.152 251.799 298.142 1.00 51.87  ? -38 DA  I "C4'" 1 
ATOM 6959  O "O4'" . DA  I 5 46  ? 263.413 251.871 296.729 1.00 51.87  ? -38 DA  I "O4'" 1 
ATOM 6960  C "C3'" . DA  I 5 46  ? 262.979 250.321 298.403 1.00 51.87  ? -38 DA  I "C3'" 1 
ATOM 6961  O "O3'" . DA  I 5 46  ? 261.674 249.927 298.013 1.00 51.87  ? -38 DA  I "O3'" 1 
ATOM 6962  C "C2'" . DA  I 5 46  ? 264.045 249.716 297.494 1.00 51.87  ? -38 DA  I "C2'" 1 
ATOM 6963  C "C1'" . DA  I 5 46  ? 264.062 250.686 296.311 1.00 51.87  ? -38 DA  I "C1'" 1 
ATOM 6964  N N9    . DA  I 5 46  ? 265.403 251.035 295.865 1.00 51.87  ? -38 DA  I N9    1 
ATOM 6965  C C8    . DA  I 5 46  ? 266.538 251.081 296.618 1.00 51.87  ? -38 DA  I C8    1 
ATOM 6966  N N7    . DA  I 5 46  ? 267.603 251.430 295.944 1.00 51.87  ? -38 DA  I N7    1 
ATOM 6967  C C5    . DA  I 5 46  ? 267.133 251.627 294.663 1.00 51.87  ? -38 DA  I C5    1 
ATOM 6968  C C6    . DA  I 5 46  ? 267.766 252.016 293.476 1.00 51.87  ? -38 DA  I C6    1 
ATOM 6969  N N6    . DA  I 5 46  ? 269.068 252.280 293.397 1.00 51.87  ? -38 DA  I N6    1 
ATOM 6970  N N1    . DA  I 5 46  ? 267.008 252.118 292.367 1.00 51.87  ? -38 DA  I N1    1 
ATOM 6971  C C2    . DA  I 5 46  ? 265.706 251.851 292.456 1.00 51.87  ? -38 DA  I C2    1 
ATOM 6972  N N3    . DA  I 5 46  ? 265.000 251.480 293.518 1.00 51.87  ? -38 DA  I N3    1 
ATOM 6973  C C4    . DA  I 5 46  ? 265.781 251.385 294.596 1.00 51.87  ? -38 DA  I C4    1 
ATOM 6974  P P     . DG  I 5 47  ? 261.222 248.392 298.107 1.00 50.96  ? -37 DG  I P     1 
ATOM 6975  O OP1   . DG  I 5 47  ? 259.801 248.382 298.507 1.00 50.96  ? -37 DG  I OP1   1 
ATOM 6976  O OP2   . DG  I 5 47  ? 262.220 247.653 298.908 1.00 50.96  ? -37 DG  I OP2   1 
ATOM 6977  O "O5'" . DG  I 5 47  ? 261.321 247.881 296.602 1.00 50.96  ? -37 DG  I "O5'" 1 
ATOM 6978  C "C5'" . DG  I 5 47  ? 260.506 248.467 295.608 1.00 50.96  ? -37 DG  I "C5'" 1 
ATOM 6979  C "C4'" . DG  I 5 47  ? 260.818 247.897 294.239 1.00 50.96  ? -37 DG  I "C4'" 1 
ATOM 6980  O "O4'" . DG  I 5 47  ? 262.157 248.284 293.841 1.00 50.96  ? -37 DG  I "O4'" 1 
ATOM 6981  C "C3'" . DG  I 5 47  ? 260.792 246.376 294.137 1.00 50.96  ? -37 DG  I "C3'" 1 
ATOM 6982  O "O3'" . DG  I 5 47  ? 260.412 246.023 292.835 1.00 50.96  ? -37 DG  I "O3'" 1 
ATOM 6983  C "C2'" . DG  I 5 47  ? 262.253 246.031 294.365 1.00 50.96  ? -37 DG  I "C2'" 1 
ATOM 6984  C "C1'" . DG  I 5 47  ? 262.892 247.124 293.538 1.00 50.96  ? -37 DG  I "C1'" 1 
ATOM 6985  N N9    . DG  I 5 47  ? 264.289 247.368 293.837 1.00 50.96  ? -37 DG  I N9    1 
ATOM 6986  C C8    . DG  I 5 47  ? 264.929 247.159 295.024 1.00 50.96  ? -37 DG  I C8    1 
ATOM 6987  N N7    . DG  I 5 47  ? 266.187 247.479 294.993 1.00 50.96  ? -37 DG  I N7    1 
ATOM 6988  C C5    . DG  I 5 47  ? 266.390 247.928 293.700 1.00 50.96  ? -37 DG  I C5    1 
ATOM 6989  C C6    . DG  I 5 47  ? 267.556 248.400 293.080 1.00 50.96  ? -37 DG  I C6    1 
ATOM 6990  O O6    . DG  I 5 47  ? 268.680 248.525 293.566 1.00 50.96  ? -37 DG  I O6    1 
ATOM 6991  N N1    . DG  I 5 47  ? 267.327 248.754 291.762 1.00 50.96  ? -37 DG  I N1    1 
ATOM 6992  C C2    . DG  I 5 47  ? 266.124 248.653 291.122 1.00 50.96  ? -37 DG  I C2    1 
ATOM 6993  N N2    . DG  I 5 47  ? 266.094 249.043 289.846 1.00 50.96  ? -37 DG  I N2    1 
ATOM 6994  N N3    . DG  I 5 47  ? 265.024 248.208 291.693 1.00 50.96  ? -37 DG  I N3    1 
ATOM 6995  C C4    . DG  I 5 47  ? 265.231 247.868 292.979 1.00 50.96  ? -37 DG  I C4    1 
ATOM 6996  P P     . DG  I 5 48  ? 259.118 245.122 292.560 1.00 50.14  ? -36 DG  I P     1 
ATOM 6997  O OP1   . DG  I 5 48  ? 257.922 245.935 292.847 1.00 50.14  ? -36 DG  I OP1   1 
ATOM 6998  O OP2   . DG  I 5 48  ? 259.325 243.822 293.226 1.00 50.14  ? -36 DG  I OP2   1 
ATOM 6999  O "O5'" . DG  I 5 48  ? 259.173 244.893 290.985 1.00 50.14  ? -36 DG  I "O5'" 1 
ATOM 7000  C "C5'" . DG  I 5 48  ? 259.382 246.000 290.121 1.00 50.14  ? -36 DG  I "C5'" 1 
ATOM 7001  C "C4'" . DG  I 5 48  ? 260.394 245.675 289.037 1.00 50.14  ? -36 DG  I "C4'" 1 
ATOM 7002  O "O4'" . DG  I 5 48  ? 261.742 245.828 289.551 1.00 50.14  ? -36 DG  I "O4'" 1 
ATOM 7003  C "C3'" . DG  I 5 48  ? 260.335 244.255 288.494 1.00 50.14  ? -36 DG  I "C3'" 1 
ATOM 7004  O "O3'" . DG  I 5 48  ? 260.790 244.258 287.170 1.00 50.14  ? -36 DG  I "O3'" 1 
ATOM 7005  C "C2'" . DG  I 5 48  ? 261.346 243.555 289.380 1.00 50.14  ? -36 DG  I "C2'" 1 
ATOM 7006  C "C1'" . DG  I 5 48  ? 262.428 244.609 289.398 1.00 50.14  ? -36 DG  I "C1'" 1 
ATOM 7007  N N9    . DG  I 5 48  ? 263.365 244.472 290.492 1.00 50.14  ? -36 DG  I N9    1 
ATOM 7008  C C8    . DG  I 5 48  ? 263.109 243.981 291.742 1.00 50.14  ? -36 DG  I C8    1 
ATOM 7009  N N7    . DG  I 5 48  ? 264.149 243.989 292.521 1.00 50.14  ? -36 DG  I N7    1 
ATOM 7010  C C5    . DG  I 5 48  ? 265.153 244.519 291.733 1.00 50.14  ? -36 DG  I C5    1 
ATOM 7011  C C6    . DG  I 5 48  ? 266.500 244.766 292.035 1.00 50.14  ? -36 DG  I C6    1 
ATOM 7012  O O6    . DG  I 5 48  ? 267.095 244.564 293.092 1.00 50.14  ? -36 DG  I O6    1 
ATOM 7013  N N1    . DG  I 5 48  ? 267.175 245.302 290.957 1.00 50.14  ? -36 DG  I N1    1 
ATOM 7014  C C2    . DG  I 5 48  ? 266.619 245.571 289.740 1.00 50.14  ? -36 DG  I C2    1 
ATOM 7015  N N2    . DG  I 5 48  ? 267.432 246.091 288.821 1.00 50.14  ? -36 DG  I N2    1 
ATOM 7016  N N3    . DG  I 5 48  ? 265.356 245.346 289.443 1.00 50.14  ? -36 DG  I N3    1 
ATOM 7017  C C4    . DG  I 5 48  ? 264.686 244.822 290.485 1.00 50.14  ? -36 DG  I C4    1 
ATOM 7018  P P     . DG  I 5 49  ? 259.774 244.317 285.935 1.00 48.12  ? -35 DG  I P     1 
ATOM 7019  O OP1   . DG  I 5 49  ? 258.771 245.360 286.205 1.00 48.12  ? -35 DG  I OP1   1 
ATOM 7020  O OP2   . DG  I 5 49  ? 259.342 242.938 285.649 1.00 48.12  ? -35 DG  I OP2   1 
ATOM 7021  O "O5'" . DG  I 5 49  ? 260.710 244.813 284.741 1.00 48.12  ? -35 DG  I "O5'" 1 
ATOM 7022  C "C5'" . DG  I 5 49  ? 261.557 245.929 284.954 1.00 48.12  ? -35 DG  I "C5'" 1 
ATOM 7023  C "C4'" . DG  I 5 49  ? 262.787 245.909 284.060 1.00 48.12  ? -35 DG  I "C4'" 1 
ATOM 7024  O "O4'" . DG  I 5 49  ? 263.939 245.450 284.794 1.00 48.12  ? -35 DG  I "O4'" 1 
ATOM 7025  C "C3'" . DG  I 5 49  ? 262.736 245.023 282.841 1.00 48.12  ? -35 DG  I "C3'" 1 
ATOM 7026  O "O3'" . DG  I 5 49  ? 263.638 245.560 281.893 1.00 48.12  ? -35 DG  I "O3'" 1 
ATOM 7027  C "C2'" . DG  I 5 49  ? 263.223 243.684 283.397 1.00 48.12  ? -35 DG  I "C2'" 1 
ATOM 7028  C "C1'" . DG  I 5 49  ? 264.257 244.119 284.429 1.00 48.12  ? -35 DG  I "C1'" 1 
ATOM 7029  N N9    . DG  I 5 49  ? 264.245 243.355 285.661 1.00 48.12  ? -35 DG  I N9    1 
ATOM 7030  C C8    . DG  I 5 49  ? 263.176 242.741 286.242 1.00 48.12  ? -35 DG  I C8    1 
ATOM 7031  N N7    . DG  I 5 49  ? 263.460 242.181 287.377 1.00 48.12  ? -35 DG  I N7    1 
ATOM 7032  C C5    . DG  I 5 49  ? 264.798 242.460 287.566 1.00 48.12  ? -35 DG  I C5    1 
ATOM 7033  C C6    . DG  I 5 49  ? 265.654 242.106 288.621 1.00 48.12  ? -35 DG  I C6    1 
ATOM 7034  O O6    . DG  I 5 49  ? 265.390 241.460 289.633 1.00 48.12  ? -35 DG  I O6    1 
ATOM 7035  N N1    . DG  I 5 49  ? 266.932 242.583 288.421 1.00 48.12  ? -35 DG  I N1    1 
ATOM 7036  C C2    . DG  I 5 49  ? 267.336 243.310 287.341 1.00 48.12  ? -35 DG  I C2    1 
ATOM 7037  N N2    . DG  I 5 49  ? 268.617 243.680 287.325 1.00 48.12  ? -35 DG  I N2    1 
ATOM 7038  N N3    . DG  I 5 49  ? 266.542 243.652 286.345 1.00 48.12  ? -35 DG  I N3    1 
ATOM 7039  C C4    . DG  I 5 49  ? 265.292 243.188 286.524 1.00 48.12  ? -35 DG  I C4    1 
ATOM 7040  P P     . DA  I 5 50  ? 263.912 244.842 280.494 1.00 48.17  ? -34 DA  I P     1 
ATOM 7041  O OP1   . DA  I 5 50  ? 264.109 245.920 279.515 1.00 48.17  ? -34 DA  I OP1   1 
ATOM 7042  O OP2   . DA  I 5 50  ? 262.880 243.819 280.261 1.00 48.17  ? -34 DA  I OP2   1 
ATOM 7043  O "O5'" . DA  I 5 50  ? 265.304 244.112 280.719 1.00 48.17  ? -34 DA  I "O5'" 1 
ATOM 7044  C "C5'" . DA  I 5 50  ? 266.433 244.860 281.111 1.00 48.17  ? -34 DA  I "C5'" 1 
ATOM 7045  C "C4'" . DA  I 5 50  ? 267.584 243.952 281.500 1.00 48.17  ? -34 DA  I "C4'" 1 
ATOM 7046  O "O4'" . DA  I 5 50  ? 267.294 243.284 282.754 1.00 48.17  ? -34 DA  I "O4'" 1 
ATOM 7047  C "C3'" . DA  I 5 50  ? 267.900 242.830 280.516 1.00 48.17  ? -34 DA  I "C3'" 1 
ATOM 7048  O "O3'" . DA  I 5 50  ? 269.276 242.582 280.563 1.00 48.17  ? -34 DA  I "O3'" 1 
ATOM 7049  C "C2'" . DA  I 5 50  ? 267.143 241.665 281.129 1.00 48.17  ? -34 DA  I "C2'" 1 
ATOM 7050  C "C1'" . DA  I 5 50  ? 267.491 241.903 282.576 1.00 48.17  ? -34 DA  I "C1'" 1 
ATOM 7051  N N9    . DA  I 5 50  ? 266.665 241.192 283.530 1.00 48.17  ? -34 DA  I N9    1 
ATOM 7052  C C8    . DA  I 5 50  ? 265.339 240.922 283.430 1.00 48.17  ? -34 DA  I C8    1 
ATOM 7053  N N7    . DA  I 5 50  ? 264.857 240.286 284.460 1.00 48.17  ? -34 DA  I N7    1 
ATOM 7054  C C5    . DA  I 5 50  ? 265.946 240.128 285.289 1.00 48.17  ? -34 DA  I C5    1 
ATOM 7055  C C6    . DA  I 5 50  ? 266.095 239.530 286.541 1.00 48.17  ? -34 DA  I C6    1 
ATOM 7056  N N6    . DA  I 5 50  ? 265.093 238.951 287.196 1.00 48.17  ? -34 DA  I N6    1 
ATOM 7057  N N1    . DA  I 5 50  ? 267.314 239.546 287.100 1.00 48.17  ? -34 DA  I N1    1 
ATOM 7058  C C2    . DA  I 5 50  ? 268.316 240.125 286.441 1.00 48.17  ? -34 DA  I C2    1 
ATOM 7059  N N3    . DA  I 5 50  ? 268.294 240.719 285.259 1.00 48.17  ? -34 DA  I N3    1 
ATOM 7060  C C4    . DA  I 5 50  ? 267.065 240.684 284.733 1.00 48.17  ? -34 DA  I C4    1 
ATOM 7061  P P     . DG  I 5 51  ? 270.193 242.693 279.257 1.00 51.47  ? -33 DG  I P     1 
ATOM 7062  O OP1   . DG  I 5 51  ? 270.187 244.099 278.812 1.00 51.47  ? -33 DG  I OP1   1 
ATOM 7063  O OP2   . DG  I 5 51  ? 269.791 241.614 278.336 1.00 51.47  ? -33 DG  I OP2   1 
ATOM 7064  O "O5'" . DG  I 5 51  ? 271.642 242.342 279.819 1.00 51.47  ? -33 DG  I "O5'" 1 
ATOM 7065  C "C5'" . DG  I 5 51  ? 271.981 242.721 281.143 1.00 51.47  ? -33 DG  I "C5'" 1 
ATOM 7066  C "C4'" . DG  I 5 51  ? 272.868 241.682 281.808 1.00 51.47  ? -33 DG  I "C4'" 1 
ATOM 7067  O "O4'" . DG  I 5 51  ? 272.098 240.896 282.748 1.00 51.47  ? -33 DG  I "O4'" 1 
ATOM 7068  C "C3'" . DG  I 5 51  ? 273.516 240.679 280.876 1.00 51.47  ? -33 DG  I "C3'" 1 
ATOM 7069  O "O3'" . DG  I 5 51  ? 274.769 240.311 281.416 1.00 51.47  ? -33 DG  I "O3'" 1 
ATOM 7070  C "C2'" . DG  I 5 51  ? 272.525 239.519 280.900 1.00 51.47  ? -33 DG  I "C2'" 1 
ATOM 7071  C "C1'" . DG  I 5 51  ? 272.077 239.539 282.349 1.00 51.47  ? -33 DG  I "C1'" 1 
ATOM 7072  N N9    . DG  I 5 51  ? 270.723 239.054 282.559 1.00 51.47  ? -33 DG  I N9    1 
ATOM 7073  C C8    . DG  I 5 51  ? 269.634 239.292 281.773 1.00 51.47  ? -33 DG  I C8    1 
ATOM 7074  N N7    . DG  I 5 51  ? 268.544 238.755 282.225 1.00 51.47  ? -33 DG  I N7    1 
ATOM 7075  C C5    . DG  I 5 51  ? 268.931 238.143 283.395 1.00 51.47  ? -33 DG  I C5    1 
ATOM 7076  C C6    . DG  I 5 51  ? 268.174 237.408 284.321 1.00 51.47  ? -33 DG  I C6    1 
ATOM 7077  O O6    . DG  I 5 51  ? 266.972 237.146 284.287 1.00 51.47  ? -33 DG  I O6    1 
ATOM 7078  N N1    . DG  I 5 51  ? 268.949 236.953 285.370 1.00 51.47  ? -33 DG  I N1    1 
ATOM 7079  C C2    . DG  I 5 51  ? 270.290 237.184 285.507 1.00 51.47  ? -33 DG  I C2    1 
ATOM 7080  N N2    . DG  I 5 51  ? 270.878 236.665 286.587 1.00 51.47  ? -33 DG  I N2    1 
ATOM 7081  N N3    . DG  I 5 51  ? 271.011 237.874 284.646 1.00 51.47  ? -33 DG  I N3    1 
ATOM 7082  C C4    . DG  I 5 51  ? 270.267 238.324 283.620 1.00 51.47  ? -33 DG  I C4    1 
ATOM 7083  P P     . DT  I 5 52  ? 275.764 239.351 280.607 1.00 53.32  ? -32 DT  I P     1 
ATOM 7084  O OP1   . DT  I 5 52  ? 277.126 239.849 280.878 1.00 53.32  ? -32 DT  I OP1   1 
ATOM 7085  O OP2   . DT  I 5 52  ? 275.285 239.225 279.217 1.00 53.32  ? -32 DT  I OP2   1 
ATOM 7086  O "O5'" . DT  I 5 52  ? 275.600 237.947 281.341 1.00 53.32  ? -32 DT  I "O5'" 1 
ATOM 7087  C "C5'" . DT  I 5 52  ? 275.600 237.906 282.750 1.00 53.32  ? -32 DT  I "C5'" 1 
ATOM 7088  C "C4'" . DT  I 5 52  ? 275.455 236.488 283.257 1.00 53.32  ? -32 DT  I "C4'" 1 
ATOM 7089  O "O4'" . DT  I 5 52  ? 274.067 236.201 283.537 1.00 53.32  ? -32 DT  I "O4'" 1 
ATOM 7090  C "C3'" . DT  I 5 52  ? 275.940 235.402 282.305 1.00 53.32  ? -32 DT  I "C3'" 1 
ATOM 7091  O "O3'" . DT  I 5 52  ? 276.756 234.503 283.024 1.00 53.32  ? -32 DT  I "O3'" 1 
ATOM 7092  C "C2'" . DT  I 5 52  ? 274.647 234.741 281.826 1.00 53.32  ? -32 DT  I "C2'" 1 
ATOM 7093  C "C1'" . DT  I 5 52  ? 273.731 234.943 283.019 1.00 53.32  ? -32 DT  I "C1'" 1 
ATOM 7094  N N1    . DT  I 5 52  ? 272.294 234.977 282.669 1.00 53.32  ? -32 DT  I N1    1 
ATOM 7095  C C2    . DT  I 5 52  ? 271.392 234.331 283.468 1.00 53.32  ? -32 DT  I C2    1 
ATOM 7096  O O2    . DT  I 5 52  ? 271.708 233.707 284.458 1.00 53.32  ? -32 DT  I O2    1 
ATOM 7097  N N3    . DT  I 5 52  ? 270.098 234.437 283.066 1.00 53.32  ? -32 DT  I N3    1 
ATOM 7098  C C4    . DT  I 5 52  ? 269.622 235.115 281.971 1.00 53.32  ? -32 DT  I C4    1 
ATOM 7099  O O4    . DT  I 5 52  ? 268.435 235.154 281.692 1.00 53.32  ? -32 DT  I O4    1 
ATOM 7100  C C5    . DT  I 5 52  ? 270.617 235.770 281.177 1.00 53.32  ? -32 DT  I C5    1 
ATOM 7101  C C7    . DT  I 5 52  ? 270.219 236.534 279.957 1.00 53.32  ? -32 DT  I C7    1 
ATOM 7102  C C6    . DT  I 5 52  ? 271.891 235.675 281.562 1.00 53.32  ? -32 DT  I C6    1 
ATOM 7103  P P     . DA  I 5 53  ? 277.688 233.439 282.271 1.00 53.95  ? -31 DA  I P     1 
ATOM 7104  O OP1   . DA  I 5 53  ? 279.076 233.717 282.689 1.00 53.95  ? -31 DA  I OP1   1 
ATOM 7105  O OP2   . DA  I 5 53  ? 277.341 233.402 280.836 1.00 53.95  ? -31 DA  I OP2   1 
ATOM 7106  O "O5'" . DA  I 5 53  ? 277.236 232.064 282.928 1.00 53.95  ? -31 DA  I "O5'" 1 
ATOM 7107  C "C5'" . DA  I 5 53  ? 276.875 232.045 284.297 1.00 53.95  ? -31 DA  I "C5'" 1 
ATOM 7108  C "C4'" . DA  I 5 53  ? 276.055 230.819 284.620 1.00 53.95  ? -31 DA  I "C4'" 1 
ATOM 7109  O "O4'" . DA  I 5 53  ? 274.653 231.099 284.397 1.00 53.95  ? -31 DA  I "O4'" 1 
ATOM 7110  C "C3'" . DA  I 5 53  ? 276.384 229.593 283.781 1.00 53.95  ? -31 DA  I "C3'" 1 
ATOM 7111  O "O3'" . DA  I 5 53  ? 276.368 228.450 284.601 1.00 53.95  ? -31 DA  I "O3'" 1 
ATOM 7112  C "C2'" . DA  I 5 53  ? 275.258 229.565 282.753 1.00 53.95  ? -31 DA  I "C2'" 1 
ATOM 7113  C "C1'" . DA  I 5 53  ? 274.100 230.119 283.558 1.00 53.95  ? -31 DA  I "C1'" 1 
ATOM 7114  N N9    . DA  I 5 53  ? 273.089 230.756 282.737 1.00 53.95  ? -31 DA  I N9    1 
ATOM 7115  C C8    . DA  I 5 53  ? 273.296 231.636 281.721 1.00 53.95  ? -31 DA  I C8    1 
ATOM 7116  N N7    . DA  I 5 53  ? 272.197 232.055 281.158 1.00 53.95  ? -31 DA  I N7    1 
ATOM 7117  C C5    . DA  I 5 53  ? 271.204 231.400 281.854 1.00 53.95  ? -31 DA  I C5    1 
ATOM 7118  C C6    . DA  I 5 53  ? 269.816 231.420 281.743 1.00 53.95  ? -31 DA  I C6    1 
ATOM 7119  N N6    . DA  I 5 53  ? 269.171 232.152 280.842 1.00 53.95  ? -31 DA  I N6    1 
ATOM 7120  N N1    . DA  I 5 53  ? 269.113 230.660 282.588 1.00 53.95  ? -31 DA  I N1    1 
ATOM 7121  C C2    . DA  I 5 53  ? 269.764 229.928 283.487 1.00 53.95  ? -31 DA  I C2    1 
ATOM 7122  N N3    . DA  I 5 53  ? 271.068 229.827 283.688 1.00 53.95  ? -31 DA  I N3    1 
ATOM 7123  C C4    . DA  I 5 53  ? 271.736 230.601 282.831 1.00 53.95  ? -31 DA  I C4    1 
ATOM 7124  P P     . DA  I 5 54  ? 277.033 227.080 284.098 1.00 53.63  ? -30 DA  I P     1 
ATOM 7125  O OP1   . DA  I 5 54  ? 278.006 226.661 285.126 1.00 53.63  ? -30 DA  I OP1   1 
ATOM 7126  O OP2   . DA  I 5 54  ? 277.465 227.257 282.696 1.00 53.63  ? -30 DA  I OP2   1 
ATOM 7127  O "O5'" . DA  I 5 54  ? 275.811 226.060 284.124 1.00 53.63  ? -30 DA  I "O5'" 1 
ATOM 7128  C "C5'" . DA  I 5 54  ? 274.878 226.136 285.181 1.00 53.63  ? -30 DA  I "C5'" 1 
ATOM 7129  C "C4'" . DA  I 5 54  ? 273.586 225.432 284.818 1.00 53.63  ? -30 DA  I "C4'" 1 
ATOM 7130  O "O4'" . DA  I 5 54  ? 272.720 226.328 284.082 1.00 53.63  ? -30 DA  I "O4'" 1 
ATOM 7131  C "C3'" . DA  I 5 54  ? 273.747 224.182 283.959 1.00 53.63  ? -30 DA  I "C3'" 1 
ATOM 7132  O "O3'" . DA  I 5 54  ? 272.981 223.141 284.528 1.00 53.63  ? -30 DA  I "O3'" 1 
ATOM 7133  C "C2'" . DA  I 5 54  ? 273.205 224.616 282.592 1.00 53.63  ? -30 DA  I "C2'" 1 
ATOM 7134  C "C1'" . DA  I 5 54  ? 272.163 225.644 282.993 1.00 53.63  ? -30 DA  I "C1'" 1 
ATOM 7135  N N9    . DA  I 5 54  ? 271.859 226.627 281.960 1.00 53.63  ? -30 DA  I N9    1 
ATOM 7136  C C8    . DA  I 5 54  ? 272.749 227.397 281.280 1.00 53.63  ? -30 DA  I C8    1 
ATOM 7137  N N7    . DA  I 5 54  ? 272.194 228.209 280.420 1.00 53.63  ? -30 DA  I N7    1 
ATOM 7138  C C5    . DA  I 5 54  ? 270.845 227.962 280.553 1.00 53.63  ? -30 DA  I C5    1 
ATOM 7139  C C6    . DA  I 5 54  ? 269.723 228.508 279.916 1.00 53.63  ? -30 DA  I C6    1 
ATOM 7140  N N6    . DA  I 5 54  ? 269.803 229.450 278.980 1.00 53.63  ? -30 DA  I N6    1 
ATOM 7141  N N1    . DA  I 5 54  ? 268.516 228.045 280.273 1.00 53.63  ? -30 DA  I N1    1 
ATOM 7142  C C2    . DA  I 5 54  ? 268.441 227.099 281.210 1.00 53.63  ? -30 DA  I C2    1 
ATOM 7143  N N3    . DA  I 5 54  ? 269.428 226.512 281.884 1.00 53.63  ? -30 DA  I N3    1 
ATOM 7144  C C4    . DA  I 5 54  ? 270.617 226.994 281.500 1.00 53.63  ? -30 DA  I C4    1 
ATOM 7145  P P     . DT  I 5 55  ? 273.038 221.652 283.938 1.00 52.72  ? -29 DT  I P     1 
ATOM 7146  O OP1   . DT  I 5 55  ? 272.938 220.733 285.093 1.00 52.72  ? -29 DT  I OP1   1 
ATOM 7147  O OP2   . DT  I 5 55  ? 274.192 221.559 283.018 1.00 52.72  ? -29 DT  I OP2   1 
ATOM 7148  O "O5'" . DT  I 5 55  ? 271.684 221.543 283.100 1.00 52.72  ? -29 DT  I "O5'" 1 
ATOM 7149  C "C5'" . DT  I 5 55  ? 270.500 222.116 283.627 1.00 52.72  ? -29 DT  I "C5'" 1 
ATOM 7150  C "C4'" . DT  I 5 55  ? 269.317 221.850 282.723 1.00 52.72  ? -29 DT  I "C4'" 1 
ATOM 7151  O "O4'" . DT  I 5 55  ? 269.086 222.995 281.863 1.00 52.72  ? -29 DT  I "O4'" 1 
ATOM 7152  C "C3'" . DT  I 5 55  ? 269.473 220.652 281.796 1.00 52.72  ? -29 DT  I "C3'" 1 
ATOM 7153  O "O3'" . DT  I 5 55  ? 268.237 219.977 281.700 1.00 52.72  ? -29 DT  I "O3'" 1 
ATOM 7154  C "C2'" . DT  I 5 55  ? 269.858 221.306 280.474 1.00 52.72  ? -29 DT  I "C2'" 1 
ATOM 7155  C "C1'" . DT  I 5 55  ? 269.022 222.566 280.527 1.00 52.72  ? -29 DT  I "C1'" 1 
ATOM 7156  N N1    . DT  I 5 55  ? 269.529 223.646 279.669 1.00 52.72  ? -29 DT  I N1    1 
ATOM 7157  C C2    . DT  I 5 55  ? 268.643 224.408 278.961 1.00 52.72  ? -29 DT  I C2    1 
ATOM 7158  O O2    . DT  I 5 55  ? 267.441 224.245 279.005 1.00 52.72  ? -29 DT  I O2    1 
ATOM 7159  N N3    . DT  I 5 55  ? 269.205 225.377 278.197 1.00 52.72  ? -29 DT  I N3    1 
ATOM 7160  C C4    . DT  I 5 55  ? 270.542 225.658 278.069 1.00 52.72  ? -29 DT  I C4    1 
ATOM 7161  O O4    . DT  I 5 55  ? 270.951 226.556 277.353 1.00 52.72  ? -29 DT  I O4    1 
ATOM 7162  C C5    . DT  I 5 55  ? 271.423 224.818 278.837 1.00 52.72  ? -29 DT  I C5    1 
ATOM 7163  C C7    . DT  I 5 55  ? 272.900 225.025 278.780 1.00 52.72  ? -29 DT  I C7    1 
ATOM 7164  C C6    . DT  I 5 55  ? 270.878 223.864 279.594 1.00 52.72  ? -29 DT  I C6    1 
ATOM 7165  P P     . DC  I 5 56  ? 268.158 218.478 281.134 1.00 50.84  ? -28 DC  I P     1 
ATOM 7166  O OP1   . DC  I 5 56  ? 267.861 217.588 282.273 1.00 50.84  ? -28 DC  I OP1   1 
ATOM 7167  O OP2   . DC  I 5 56  ? 269.346 218.233 280.291 1.00 50.84  ? -28 DC  I OP2   1 
ATOM 7168  O "O5'" . DC  I 5 56  ? 266.878 218.522 280.188 1.00 50.84  ? -28 DC  I "O5'" 1 
ATOM 7169  C "C5'" . DC  I 5 56  ? 265.836 219.438 280.478 1.00 50.84  ? -28 DC  I "C5'" 1 
ATOM 7170  C "C4'" . DC  I 5 56  ? 265.073 219.815 279.223 1.00 50.84  ? -28 DC  I "C4'" 1 
ATOM 7171  O "O4'" . DC  I 5 56  ? 265.716 220.937 278.562 1.00 50.84  ? -28 DC  I "O4'" 1 
ATOM 7172  C "C3'" . DC  I 5 56  ? 264.986 218.722 278.171 1.00 50.84  ? -28 DC  I "C3'" 1 
ATOM 7173  O "O3'" . DC  I 5 56  ? 263.748 218.825 277.524 1.00 50.84  ? -28 DC  I "O3'" 1 
ATOM 7174  C "C2'" . DC  I 5 56  ? 266.127 219.091 277.230 1.00 50.84  ? -28 DC  I "C2'" 1 
ATOM 7175  C "C1'" . DC  I 5 56  ? 265.969 220.594 277.219 1.00 50.84  ? -28 DC  I "C1'" 1 
ATOM 7176  N N1    . DC  I 5 56  ? 267.157 221.346 276.762 1.00 50.84  ? -28 DC  I N1    1 
ATOM 7177  C C2    . DC  I 5 56  ? 266.975 222.447 275.938 1.00 50.84  ? -28 DC  I C2    1 
ATOM 7178  O O2    . DC  I 5 56  ? 265.832 222.747 275.600 1.00 50.84  ? -28 DC  I O2    1 
ATOM 7179  N N3    . DC  I 5 56  ? 268.050 223.151 275.537 1.00 50.84  ? -28 DC  I N3    1 
ATOM 7180  C C4    . DC  I 5 56  ? 269.263 222.787 275.931 1.00 50.84  ? -28 DC  I C4    1 
ATOM 7181  N N4    . DC  I 5 56  ? 270.296 223.516 275.511 1.00 50.84  ? -28 DC  I N4    1 
ATOM 7182  C C5    . DC  I 5 56  ? 269.473 221.666 276.781 1.00 50.84  ? -28 DC  I C5    1 
ATOM 7183  C C6    . DC  I 5 56  ? 268.399 220.981 277.171 1.00 50.84  ? -28 DC  I C6    1 
ATOM 7184  P P     . DC  I 5 57  ? 262.882 217.514 277.222 1.00 49.46  ? -27 DC  I P     1 
ATOM 7185  O OP1   . DC  I 5 57  ? 261.742 217.517 278.157 1.00 49.46  ? -27 DC  I OP1   1 
ATOM 7186  O OP2   . DC  I 5 57  ? 263.811 216.366 277.172 1.00 49.46  ? -27 DC  I OP2   1 
ATOM 7187  O "O5'" . DC  I 5 57  ? 262.327 217.780 275.754 1.00 49.46  ? -27 DC  I "O5'" 1 
ATOM 7188  C "C5'" . DC  I 5 57  ? 261.731 219.030 275.450 1.00 49.46  ? -27 DC  I "C5'" 1 
ATOM 7189  C "C4'" . DC  I 5 57  ? 262.086 219.469 274.048 1.00 49.46  ? -27 DC  I "C4'" 1 
ATOM 7190  O "O4'" . DC  I 5 57  ? 263.442 219.986 274.026 1.00 49.46  ? -27 DC  I "O4'" 1 
ATOM 7191  C "C3'" . DC  I 5 57  ? 262.052 218.360 272.996 1.00 49.46  ? -27 DC  I "C3'" 1 
ATOM 7192  O "O3'" . DC  I 5 57  ? 261.559 218.885 271.777 1.00 49.46  ? -27 DC  I "O3'" 1 
ATOM 7193  C "C2'" . DC  I 5 57  ? 263.527 218.004 272.869 1.00 49.46  ? -27 DC  I "C2'" 1 
ATOM 7194  C "C1'" . DC  I 5 57  ? 264.109 219.394 272.949 1.00 49.46  ? -27 DC  I "C1'" 1 
ATOM 7195  N N1    . DC  I 5 57  ? 265.565 219.453 273.178 1.00 49.46  ? -27 DC  I N1    1 
ATOM 7196  C C2    . DC  I 5 57  ? 266.276 220.517 272.650 1.00 49.46  ? -27 DC  I C2    1 
ATOM 7197  O O2    . DC  I 5 57  ? 265.663 221.383 272.030 1.00 49.46  ? -27 DC  I O2    1 
ATOM 7198  N N3    . DC  I 5 57  ? 267.604 220.582 272.847 1.00 49.46  ? -27 DC  I N3    1 
ATOM 7199  C C4    . DC  I 5 57  ? 268.219 219.626 273.528 1.00 49.46  ? -27 DC  I C4    1 
ATOM 7200  N N4    . DC  I 5 57  ? 269.537 219.731 273.693 1.00 49.46  ? -27 DC  I N4    1 
ATOM 7201  C C5    . DC  I 5 57  ? 267.511 218.520 274.070 1.00 49.46  ? -27 DC  I C5    1 
ATOM 7202  C C6    . DC  I 5 57  ? 266.194 218.472 273.869 1.00 49.46  ? -27 DC  I C6    1 
ATOM 7203  P P     . DC  I 5 58  ? 259.984 218.934 271.477 1.00 47.91  ? -26 DC  I P     1 
ATOM 7204  O OP1   . DC  I 5 58  ? 259.251 219.133 272.743 1.00 47.91  ? -26 DC  I OP1   1 
ATOM 7205  O OP2   . DC  I 5 58  ? 259.693 217.761 270.635 1.00 47.91  ? -26 DC  I OP2   1 
ATOM 7206  O "O5'" . DC  I 5 58  ? 259.805 220.241 270.571 1.00 47.91  ? -26 DC  I "O5'" 1 
ATOM 7207  C "C5'" . DC  I 5 58  ? 260.694 221.345 270.721 1.00 47.91  ? -26 DC  I "C5'" 1 
ATOM 7208  C "C4'" . DC  I 5 58  ? 261.102 221.910 269.370 1.00 47.91  ? -26 DC  I "C4'" 1 
ATOM 7209  O "O4'" . DC  I 5 58  ? 262.543 221.844 269.241 1.00 47.91  ? -26 DC  I "O4'" 1 
ATOM 7210  C "C3'" . DC  I 5 58  ? 260.599 221.134 268.174 1.00 47.91  ? -26 DC  I "C3'" 1 
ATOM 7211  O "O3'" . DC  I 5 58  ? 260.765 221.920 267.014 1.00 47.91  ? -26 DC  I "O3'" 1 
ATOM 7212  C "C2'" . DC  I 5 58  ? 261.615 220.012 268.157 1.00 47.91  ? -26 DC  I "C2'" 1 
ATOM 7213  C "C1'" . DC  I 5 58  ? 262.870 220.851 268.292 1.00 47.91  ? -26 DC  I "C1'" 1 
ATOM 7214  N N1    . DC  I 5 58  ? 264.043 220.122 268.774 1.00 47.91  ? -26 DC  I N1    1 
ATOM 7215  C C2    . DC  I 5 58  ? 265.289 220.720 268.677 1.00 47.91  ? -26 DC  I C2    1 
ATOM 7216  O O2    . DC  I 5 58  ? 265.376 221.843 268.180 1.00 47.91  ? -26 DC  I O2    1 
ATOM 7217  N N3    . DC  I 5 58  ? 266.369 220.055 269.122 1.00 47.91  ? -26 DC  I N3    1 
ATOM 7218  C C4    . DC  I 5 58  ? 266.233 218.846 269.643 1.00 47.91  ? -26 DC  I C4    1 
ATOM 7219  N N4    . DC  I 5 58  ? 267.334 218.233 270.075 1.00 47.91  ? -26 DC  I N4    1 
ATOM 7220  C C5    . DC  I 5 58  ? 264.968 218.216 269.751 1.00 47.91  ? -26 DC  I C5    1 
ATOM 7221  C C6    . DC  I 5 58  ? 263.907 218.886 269.307 1.00 47.91  ? -26 DC  I C6    1 
ATOM 7222  P P     . DC  I 5 59  ? 259.660 222.981 266.537 1.00 46.63  ? -25 DC  I P     1 
ATOM 7223  O OP1   . DC  I 5 59  ? 259.173 223.740 267.702 1.00 46.63  ? -25 DC  I OP1   1 
ATOM 7224  O OP2   . DC  I 5 59  ? 258.702 222.264 265.677 1.00 46.63  ? -25 DC  I OP2   1 
ATOM 7225  O "O5'" . DC  I 5 59  ? 260.496 223.965 265.601 1.00 46.63  ? -25 DC  I "O5'" 1 
ATOM 7226  C "C5'" . DC  I 5 59  ? 261.799 224.390 266.003 1.00 46.63  ? -25 DC  I "C5'" 1 
ATOM 7227  C "C4'" . DC  I 5 59  ? 262.818 224.162 264.901 1.00 46.63  ? -25 DC  I "C4'" 1 
ATOM 7228  O "O4'" . DC  I 5 59  ? 263.704 223.067 265.264 1.00 46.63  ? -25 DC  I "O4'" 1 
ATOM 7229  C "C3'" . DC  I 5 59  ? 262.233 223.761 263.553 1.00 46.63  ? -25 DC  I "C3'" 1 
ATOM 7230  O "O3'" . DC  I 5 59  ? 263.113 224.167 262.533 1.00 46.63  ? -25 DC  I "O3'" 1 
ATOM 7231  C "C2'" . DC  I 5 59  ? 262.258 222.255 263.672 1.00 46.63  ? -25 DC  I "C2'" 1 
ATOM 7232  C "C1'" . DC  I 5 59  ? 263.648 222.101 264.244 1.00 46.63  ? -25 DC  I "C1'" 1 
ATOM 7233  N N1    . DC  I 5 59  ? 263.940 220.758 264.808 1.00 46.63  ? -25 DC  I N1    1 
ATOM 7234  C C2    . DC  I 5 59  ? 265.245 220.428 265.146 1.00 46.63  ? -25 DC  I C2    1 
ATOM 7235  O O2    . DC  I 5 59  ? 266.130 221.264 265.000 1.00 46.63  ? -25 DC  I O2    1 
ATOM 7236  N N3    . DC  I 5 59  ? 265.500 219.204 265.651 1.00 46.63  ? -25 DC  I N3    1 
ATOM 7237  C C4    . DC  I 5 59  ? 264.516 218.332 265.802 1.00 46.63  ? -25 DC  I C4    1 
ATOM 7238  N N4    . DC  I 5 59  ? 264.815 217.132 266.301 1.00 46.63  ? -25 DC  I N4    1 
ATOM 7239  C C5    . DC  I 5 59  ? 263.180 218.643 265.441 1.00 46.63  ? -25 DC  I C5    1 
ATOM 7240  C C6    . DC  I 5 59  ? 262.940 219.855 264.952 1.00 46.63  ? -25 DC  I C6    1 
ATOM 7241  P P     . DT  I 5 60  ? 262.907 225.549 261.749 1.00 44.54  ? -24 DT  I P     1 
ATOM 7242  O OP1   . DT  I 5 60  ? 262.660 226.617 262.734 1.00 44.54  ? -24 DT  I OP1   1 
ATOM 7243  O OP2   . DT  I 5 60  ? 261.934 225.305 260.671 1.00 44.54  ? -24 DT  I OP2   1 
ATOM 7244  O "O5'" . DT  I 5 60  ? 264.331 225.792 261.075 1.00 44.54  ? -24 DT  I "O5'" 1 
ATOM 7245  C "C5'" . DT  I 5 60  ? 265.426 226.176 261.876 1.00 44.54  ? -24 DT  I "C5'" 1 
ATOM 7246  C "C4'" . DT  I 5 60  ? 266.712 225.508 261.424 1.00 44.54  ? -24 DT  I "C4'" 1 
ATOM 7247  O "O4'" . DT  I 5 60  ? 266.800 224.172 261.972 1.00 44.54  ? -24 DT  I "O4'" 1 
ATOM 7248  C "C3'" . DT  I 5 60  ? 266.888 225.367 259.918 1.00 44.54  ? -24 DT  I "C3'" 1 
ATOM 7249  O "O3'" . DT  I 5 60  ? 268.157 225.842 259.559 1.00 44.54  ? -24 DT  I "O3'" 1 
ATOM 7250  C "C2'" . DT  I 5 60  ? 266.764 223.862 259.679 1.00 44.54  ? -24 DT  I "C2'" 1 
ATOM 7251  C "C1'" . DT  I 5 60  ? 267.274 223.295 260.985 1.00 44.54  ? -24 DT  I "C1'" 1 
ATOM 7252  N N1    . DT  I 5 60  ? 266.766 221.923 261.300 1.00 44.54  ? -24 DT  I N1    1 
ATOM 7253  C C2    . DT  I 5 60  ? 267.643 220.964 261.745 1.00 44.54  ? -24 DT  I C2    1 
ATOM 7254  O O2    . DT  I 5 60  ? 268.829 221.157 261.877 1.00 44.54  ? -24 DT  I O2    1 
ATOM 7255  N N3    . DT  I 5 60  ? 267.079 219.756 262.005 1.00 44.54  ? -24 DT  I N3    1 
ATOM 7256  C C4    . DT  I 5 60  ? 265.763 219.413 261.891 1.00 44.54  ? -24 DT  I C4    1 
ATOM 7257  O O4    . DT  I 5 60  ? 265.353 218.295 262.161 1.00 44.54  ? -24 DT  I O4    1 
ATOM 7258  C C5    . DT  I 5 60  ? 264.892 220.456 261.432 1.00 44.54  ? -24 DT  I C5    1 
ATOM 7259  C C7    . DT  I 5 60  ? 263.432 220.182 261.258 1.00 44.54  ? -24 DT  I C7    1 
ATOM 7260  C C6    . DT  I 5 60  ? 265.427 221.652 261.166 1.00 44.54  ? -24 DT  I C6    1 
ATOM 7261  P P     . DT  I 5 61  ? 268.563 226.013 258.023 1.00 45.30  ? -23 DT  I P     1 
ATOM 7262  O OP1   . DT  I 5 61  ? 269.240 227.308 257.872 1.00 45.30  ? -23 DT  I OP1   1 
ATOM 7263  O OP2   . DT  I 5 61  ? 267.395 225.705 257.189 1.00 45.30  ? -23 DT  I OP2   1 
ATOM 7264  O "O5'" . DT  I 5 61  ? 269.657 224.892 257.819 1.00 45.30  ? -23 DT  I "O5'" 1 
ATOM 7265  C "C5'" . DT  I 5 61  ? 270.671 224.749 258.783 1.00 45.30  ? -23 DT  I "C5'" 1 
ATOM 7266  C "C4'" . DT  I 5 61  ? 271.384 223.429 258.618 1.00 45.30  ? -23 DT  I "C4'" 1 
ATOM 7267  O "O4'" . DT  I 5 61  ? 270.557 222.356 259.120 1.00 45.30  ? -23 DT  I "O4'" 1 
ATOM 7268  C "C3'" . DT  I 5 61  ? 271.716 223.064 257.177 1.00 45.30  ? -23 DT  I "C3'" 1 
ATOM 7269  O "O3'" . DT  I 5 61  ? 273.032 222.607 257.113 1.00 45.30  ? -23 DT  I "O3'" 1 
ATOM 7270  C "C2'" . DT  I 5 61  ? 270.727 221.949 256.862 1.00 45.30  ? -23 DT  I "C2'" 1 
ATOM 7271  C "C1'" . DT  I 5 61  ? 270.606 221.291 258.213 1.00 45.30  ? -23 DT  I "C1'" 1 
ATOM 7272  N N1    . DT  I 5 61  ? 269.386 220.487 258.374 1.00 45.30  ? -23 DT  I N1    1 
ATOM 7273  C C2    . DT  I 5 61  ? 269.494 219.195 258.796 1.00 45.30  ? -23 DT  I C2    1 
ATOM 7274  O O2    . DT  I 5 61  ? 270.552 218.668 259.050 1.00 45.30  ? -23 DT  I O2    1 
ATOM 7275  N N3    . DT  I 5 61  ? 268.315 218.534 258.913 1.00 45.30  ? -23 DT  I N3    1 
ATOM 7276  C C4    . DT  I 5 61  ? 267.062 219.027 258.654 1.00 45.30  ? -23 DT  I C4    1 
ATOM 7277  O O4    . DT  I 5 61  ? 266.054 218.355 258.794 1.00 45.30  ? -23 DT  I O4    1 
ATOM 7278  C C5    . DT  I 5 61  ? 267.018 220.389 258.213 1.00 45.30  ? -23 DT  I C5    1 
ATOM 7279  C C7    . DT  I 5 61  ? 265.705 221.030 257.893 1.00 45.30  ? -23 DT  I C7    1 
ATOM 7280  C C6    . DT  I 5 61  ? 268.169 221.046 258.092 1.00 45.30  ? -23 DT  I C6    1 
ATOM 7281  P P     . DG  I 5 62  ? 273.879 222.752 255.762 1.00 49.15  ? -22 DG  I P     1 
ATOM 7282  O OP1   . DG  I 5 62  ? 274.901 223.788 255.999 1.00 49.15  ? -22 DG  I OP1   1 
ATOM 7283  O OP2   . DG  I 5 62  ? 272.942 222.877 254.629 1.00 49.15  ? -22 DG  I OP2   1 
ATOM 7284  O "O5'" . DG  I 5 62  ? 274.591 221.339 255.645 1.00 49.15  ? -22 DG  I "O5'" 1 
ATOM 7285  C "C5'" . DG  I 5 62  ? 274.620 220.496 256.773 1.00 49.15  ? -22 DG  I "C5'" 1 
ATOM 7286  C "C4'" . DG  I 5 62  ? 274.541 219.050 256.355 1.00 49.15  ? -22 DG  I "C4'" 1 
ATOM 7287  O "O4'" . DG  I 5 62  ? 273.274 218.495 256.768 1.00 49.15  ? -22 DG  I "O4'" 1 
ATOM 7288  C "C3'" . DG  I 5 62  ? 274.650 218.815 254.851 1.00 49.15  ? -22 DG  I "C3'" 1 
ATOM 7289  O "O3'" . DG  I 5 62  ? 275.639 217.831 254.606 1.00 49.15  ? -22 DG  I "O3'" 1 
ATOM 7290  C "C2'" . DG  I 5 62  ? 273.252 218.339 254.455 1.00 49.15  ? -22 DG  I "C2'" 1 
ATOM 7291  C "C1'" . DG  I 5 62  ? 272.764 217.699 255.739 1.00 49.15  ? -22 DG  I "C1'" 1 
ATOM 7292  N N9    . DG  I 5 62  ? 271.313 217.668 255.860 1.00 49.15  ? -22 DG  I N9    1 
ATOM 7293  C C8    . DG  I 5 62  ? 270.445 218.705 255.674 1.00 49.15  ? -22 DG  I C8    1 
ATOM 7294  N N7    . DG  I 5 62  ? 269.199 218.375 255.848 1.00 49.15  ? -22 DG  I N7    1 
ATOM 7295  C C5    . DG  I 5 62  ? 269.250 217.034 256.176 1.00 49.15  ? -22 DG  I C5    1 
ATOM 7296  C C6    . DG  I 5 62  ? 268.212 216.132 256.480 1.00 49.15  ? -22 DG  I C6    1 
ATOM 7297  O O6    . DG  I 5 62  ? 267.001 216.345 256.520 1.00 49.15  ? -22 DG  I O6    1 
ATOM 7298  N N1    . DG  I 5 62  ? 268.696 214.866 256.738 1.00 49.15  ? -22 DG  I N1    1 
ATOM 7299  C C2    . DG  I 5 62  ? 270.017 214.518 256.722 1.00 49.15  ? -22 DG  I C2    1 
ATOM 7300  N N2    . DG  I 5 62  ? 270.304 213.248 257.004 1.00 49.15  ? -22 DG  I N2    1 
ATOM 7301  N N3    . DG  I 5 62  ? 270.997 215.351 256.449 1.00 49.15  ? -22 DG  I N3    1 
ATOM 7302  C C4    . DG  I 5 62  ? 270.542 216.587 256.186 1.00 49.15  ? -22 DG  I C4    1 
ATOM 7303  P P     . DG  I 5 63  ? 276.061 217.436 253.109 1.00 51.22  ? -21 DG  I P     1 
ATOM 7304  O OP1   . DG  I 5 63  ? 277.531 217.308 253.100 1.00 51.22  ? -21 DG  I OP1   1 
ATOM 7305  O OP2   . DG  I 5 63  ? 275.407 218.349 252.152 1.00 51.22  ? -21 DG  I OP2   1 
ATOM 7306  O "O5'" . DG  I 5 63  ? 275.433 215.985 252.934 1.00 51.22  ? -21 DG  I "O5'" 1 
ATOM 7307  C "C5'" . DG  I 5 63  ? 275.536 215.060 253.993 1.00 51.22  ? -21 DG  I "C5'" 1 
ATOM 7308  C "C4'" . DG  I 5 63  ? 274.679 213.843 253.727 1.00 51.22  ? -21 DG  I "C4'" 1 
ATOM 7309  O "O4'" . DG  I 5 63  ? 273.314 214.106 254.128 1.00 51.22  ? -21 DG  I "O4'" 1 
ATOM 7310  C "C3'" . DG  I 5 63  ? 274.621 213.413 252.264 1.00 51.22  ? -21 DG  I "C3'" 1 
ATOM 7311  O "O3'" . DG  I 5 63  ? 274.900 212.034 252.164 1.00 51.22  ? -21 DG  I "O3'" 1 
ATOM 7312  C "C2'" . DG  I 5 63  ? 273.185 213.727 251.853 1.00 51.22  ? -21 DG  I "C2'" 1 
ATOM 7313  C "C1'" . DG  I 5 63  ? 272.453 213.564 253.167 1.00 51.22  ? -21 DG  I "C1'" 1 
ATOM 7314  N N9    . DG  I 5 63  ? 271.189 214.279 253.215 1.00 51.22  ? -21 DG  I N9    1 
ATOM 7315  C C8    . DG  I 5 63  ? 270.998 215.628 253.102 1.00 51.22  ? -21 DG  I C8    1 
ATOM 7316  N N7    . DG  I 5 63  ? 269.750 215.982 253.173 1.00 51.22  ? -21 DG  I N7    1 
ATOM 7317  C C5    . DG  I 5 63  ? 269.073 214.788 253.339 1.00 51.22  ? -21 DG  I C5    1 
ATOM 7318  C C6    . DG  I 5 63  ? 267.695 214.539 253.471 1.00 51.22  ? -21 DG  I C6    1 
ATOM 7319  O O6    . DG  I 5 63  ? 266.769 215.350 253.473 1.00 51.22  ? -21 DG  I O6    1 
ATOM 7320  N N1    . DG  I 5 63  ? 267.429 213.186 253.618 1.00 51.22  ? -21 DG  I N1    1 
ATOM 7321  C C2    . DG  I 5 63  ? 268.379 212.200 253.631 1.00 51.22  ? -21 DG  I C2    1 
ATOM 7322  N N2    . DG  I 5 63  ? 267.940 210.949 253.778 1.00 51.22  ? -21 DG  I N2    1 
ATOM 7323  N N3    . DG  I 5 63  ? 269.673 212.423 253.503 1.00 51.22  ? -21 DG  I N3    1 
ATOM 7324  C C4    . DG  I 5 63  ? 269.945 213.734 253.360 1.00 51.22  ? -21 DG  I C4    1 
ATOM 7325  P P     . DC  I 5 64  ? 275.451 211.411 250.791 1.00 52.45  ? -20 DC  I P     1 
ATOM 7326  O OP1   . DC  I 5 64  ? 276.882 211.107 250.983 1.00 52.45  ? -20 DC  I OP1   1 
ATOM 7327  O OP2   . DC  I 5 64  ? 275.031 212.279 249.671 1.00 52.45  ? -20 DC  I OP2   1 
ATOM 7328  O "O5'" . DC  I 5 64  ? 274.653 210.038 250.671 1.00 52.45  ? -20 DC  I "O5'" 1 
ATOM 7329  C "C5'" . DC  I 5 64  ? 273.612 209.755 251.585 1.00 52.45  ? -20 DC  I "C5'" 1 
ATOM 7330  C "C4'" . DC  I 5 64  ? 272.440 209.125 250.870 1.00 52.45  ? -20 DC  I "C4'" 1 
ATOM 7331  O "O4'" . DC  I 5 64  ? 271.236 209.880 251.160 1.00 52.45  ? -20 DC  I "O4'" 1 
ATOM 7332  C "C3'" . DC  I 5 64  ? 272.572 209.093 249.347 1.00 52.45  ? -20 DC  I "C3'" 1 
ATOM 7333  O "O3'" . DC  I 5 64  ? 272.233 207.811 248.856 1.00 52.45  ? -20 DC  I "O3'" 1 
ATOM 7334  C "C2'" . DC  I 5 64  ? 271.578 210.148 248.887 1.00 52.45  ? -20 DC  I "C2'" 1 
ATOM 7335  C "C1'" . DC  I 5 64  ? 270.525 210.075 249.970 1.00 52.45  ? -20 DC  I "C1'" 1 
ATOM 7336  N N1    . DC  I 5 64  ? 269.742 211.318 250.073 1.00 52.45  ? -20 DC  I N1    1 
ATOM 7337  C C2    . DC  I 5 64  ? 268.359 211.254 250.160 1.00 52.45  ? -20 DC  I C2    1 
ATOM 7338  O O2    . DC  I 5 64  ? 267.814 210.153 250.178 1.00 52.45  ? -20 DC  I O2    1 
ATOM 7339  N N3    . DC  I 5 64  ? 267.657 212.400 250.217 1.00 52.45  ? -20 DC  I N3    1 
ATOM 7340  C C4    . DC  I 5 64  ? 268.287 213.566 250.185 1.00 52.45  ? -20 DC  I C4    1 
ATOM 7341  N N4    . DC  I 5 64  ? 267.555 214.672 250.251 1.00 52.45  ? -20 DC  I N4    1 
ATOM 7342  C C5    . DC  I 5 64  ? 269.697 213.652 250.088 1.00 52.45  ? -20 DC  I C5    1 
ATOM 7343  C C6    . DC  I 5 64  ? 270.377 212.513 250.027 1.00 52.45  ? -20 DC  I C6    1 
ATOM 7344  P P     . DG  I 5 65  ? 272.644 207.370 247.366 1.00 51.44  ? -19 DG  I P     1 
ATOM 7345  O OP1   . DG  I 5 65  ? 273.945 206.678 247.445 1.00 51.44  ? -19 DG  I OP1   1 
ATOM 7346  O OP2   . DG  I 5 65  ? 272.499 208.521 246.452 1.00 51.44  ? -19 DG  I OP2   1 
ATOM 7347  O "O5'" . DG  I 5 65  ? 271.516 206.314 246.975 1.00 51.44  ? -19 DG  I "O5'" 1 
ATOM 7348  C "C5'" . DG  I 5 65  ? 270.523 205.967 247.920 1.00 51.44  ? -19 DG  I "C5'" 1 
ATOM 7349  C "C4'" . DG  I 5 65  ? 269.143 206.044 247.299 1.00 51.44  ? -19 DG  I "C4'" 1 
ATOM 7350  O "O4'" . DG  I 5 65  ? 268.520 207.309 247.641 1.00 51.44  ? -19 DG  I "O4'" 1 
ATOM 7351  C "C3'" . DG  I 5 65  ? 269.110 205.958 245.773 1.00 51.44  ? -19 DG  I "C3'" 1 
ATOM 7352  O "O3'" . DG  I 5 65  ? 268.025 205.151 245.372 1.00 51.44  ? -19 DG  I "O3'" 1 
ATOM 7353  C "C2'" . DG  I 5 65  ? 268.893 207.406 245.361 1.00 51.44  ? -19 DG  I "C2'" 1 
ATOM 7354  C "C1'" . DG  I 5 65  ? 267.986 207.878 246.477 1.00 51.44  ? -19 DG  I "C1'" 1 
ATOM 7355  N N9    . DG  I 5 65  ? 267.968 209.322 246.622 1.00 51.44  ? -19 DG  I N9    1 
ATOM 7356  C C8    . DG  I 5 65  ? 269.044 210.163 246.606 1.00 51.44  ? -19 DG  I C8    1 
ATOM 7357  N N7    . DG  I 5 65  ? 268.724 211.411 246.746 1.00 51.44  ? -19 DG  I N7    1 
ATOM 7358  C C5    . DG  I 5 65  ? 267.348 211.394 246.857 1.00 51.44  ? -19 DG  I C5    1 
ATOM 7359  C C6    . DG  I 5 65  ? 266.447 212.453 247.015 1.00 51.44  ? -19 DG  I C6    1 
ATOM 7360  O O6    . DG  I 5 65  ? 266.695 213.654 247.105 1.00 51.44  ? -19 DG  I O6    1 
ATOM 7361  N N1    . DG  I 5 65  ? 265.139 212.007 247.076 1.00 51.44  ? -19 DG  I N1    1 
ATOM 7362  C C2    . DG  I 5 65  ? 264.755 210.700 246.989 1.00 51.44  ? -19 DG  I C2    1 
ATOM 7363  N N2    . DG  I 5 65  ? 263.447 210.459 247.071 1.00 51.44  ? -19 DG  I N2    1 
ATOM 7364  N N3    . DG  I 5 65  ? 265.592 209.696 246.839 1.00 51.44  ? -19 DG  I N3    1 
ATOM 7365  C C4    . DG  I 5 65  ? 266.868 210.117 246.777 1.00 51.44  ? -19 DG  I C4    1 
ATOM 7366  P P     . DG  I 5 66  ? 267.971 204.519 243.897 1.00 49.89  ? -18 DG  I P     1 
ATOM 7367  O OP1   . DG  I 5 66  ? 268.093 203.056 244.058 1.00 49.89  ? -18 DG  I OP1   1 
ATOM 7368  O OP2   . DG  I 5 66  ? 268.918 205.244 243.025 1.00 49.89  ? -18 DG  I OP2   1 
ATOM 7369  O "O5'" . DG  I 5 66  ? 266.485 204.843 243.417 1.00 49.89  ? -18 DG  I "O5'" 1 
ATOM 7370  C "C5'" . DG  I 5 66  ? 265.406 204.611 244.302 1.00 49.89  ? -18 DG  I "C5'" 1 
ATOM 7371  C "C4'" . DG  I 5 66  ? 264.167 205.371 243.868 1.00 49.89  ? -18 DG  I "C4'" 1 
ATOM 7372  O "O4'" . DG  I 5 66  ? 264.288 206.767 244.238 1.00 49.89  ? -18 DG  I "O4'" 1 
ATOM 7373  C "C3'" . DG  I 5 66  ? 263.881 205.350 242.371 1.00 49.89  ? -18 DG  I "C3'" 1 
ATOM 7374  O "O3'" . DG  I 5 66  ? 262.492 205.183 242.166 1.00 49.89  ? -18 DG  I "O3'" 1 
ATOM 7375  C "C2'" . DG  I 5 66  ? 264.359 206.722 241.906 1.00 49.89  ? -18 DG  I "C2'" 1 
ATOM 7376  C "C1'" . DG  I 5 66  ? 264.038 207.579 243.115 1.00 49.89  ? -18 DG  I "C1'" 1 
ATOM 7377  N N9    . DG  I 5 66  ? 264.873 208.761 243.228 1.00 49.89  ? -18 DG  I N9    1 
ATOM 7378  C C8    . DG  I 5 66  ? 266.238 208.818 243.148 1.00 49.89  ? -18 DG  I C8    1 
ATOM 7379  N N7    . DG  I 5 66  ? 266.713 210.016 243.303 1.00 49.89  ? -18 DG  I N7    1 
ATOM 7380  C C5    . DG  I 5 66  ? 265.592 210.798 243.508 1.00 49.89  ? -18 DG  I C5    1 
ATOM 7381  C C6    . DG  I 5 66  ? 265.485 212.177 243.735 1.00 49.89  ? -18 DG  I C6    1 
ATOM 7382  O O6    . DG  I 5 66  ? 266.390 213.012 243.800 1.00 49.89  ? -18 DG  I O6    1 
ATOM 7383  N N1    . DG  I 5 66  ? 264.162 212.574 243.881 1.00 49.89  ? -18 DG  I N1    1 
ATOM 7384  C C2    . DG  I 5 66  ? 263.086 211.733 243.828 1.00 49.89  ? -18 DG  I C2    1 
ATOM 7385  N N2    . DG  I 5 66  ? 261.882 212.288 243.999 1.00 49.89  ? -18 DG  I N2    1 
ATOM 7386  N N3    . DG  I 5 66  ? 263.176 210.435 243.622 1.00 49.89  ? -18 DG  I N3    1 
ATOM 7387  C C4    . DG  I 5 66  ? 264.455 210.040 243.469 1.00 49.89  ? -18 DG  I C4    1 
ATOM 7388  P P     . DT  I 5 67  ? 261.911 204.876 240.704 1.00 48.08  ? -17 DT  I P     1 
ATOM 7389  O OP1   . DT  I 5 67  ? 260.994 203.727 240.833 1.00 48.08  ? -17 DT  I OP1   1 
ATOM 7390  O OP2   . DT  I 5 67  ? 263.038 204.825 239.753 1.00 48.08  ? -17 DT  I OP2   1 
ATOM 7391  O "O5'" . DT  I 5 67  ? 261.039 206.169 240.383 1.00 48.08  ? -17 DT  I "O5'" 1 
ATOM 7392  C "C5'" . DT  I 5 67  ? 260.290 206.772 241.418 1.00 48.08  ? -17 DT  I "C5'" 1 
ATOM 7393  C "C4'" . DT  I 5 67  ? 259.613 208.037 240.935 1.00 48.08  ? -17 DT  I "C4'" 1 
ATOM 7394  O "O4'" . DT  I 5 67  ? 260.470 209.181 241.171 1.00 48.08  ? -17 DT  I "O4'" 1 
ATOM 7395  C "C3'" . DT  I 5 67  ? 259.278 208.072 239.452 1.00 48.08  ? -17 DT  I "C3'" 1 
ATOM 7396  O "O3'" . DT  I 5 67  ? 258.064 208.763 239.285 1.00 48.08  ? -17 DT  I "O3'" 1 
ATOM 7397  C "C2'" . DT  I 5 67  ? 260.448 208.860 238.870 1.00 48.08  ? -17 DT  I "C2'" 1 
ATOM 7398  C "C1'" . DT  I 5 67  ? 260.661 209.882 239.966 1.00 48.08  ? -17 DT  I "C1'" 1 
ATOM 7399  N N1    . DT  I 5 67  ? 262.010 210.468 240.003 1.00 48.08  ? -17 DT  I N1    1 
ATOM 7400  C C2    . DT  I 5 67  ? 262.153 211.771 240.388 1.00 48.08  ? -17 DT  I C2    1 
ATOM 7401  O O2    . DT  I 5 67  ? 261.217 212.482 240.670 1.00 48.08  ? -17 DT  I O2    1 
ATOM 7402  N N3    . DT  I 5 67  ? 263.436 212.220 240.419 1.00 48.08  ? -17 DT  I N3    1 
ATOM 7403  C C4    . DT  I 5 67  ? 264.569 211.507 240.115 1.00 48.08  ? -17 DT  I C4    1 
ATOM 7404  O O4    . DT  I 5 67  ? 265.682 212.000 240.171 1.00 48.08  ? -17 DT  I O4    1 
ATOM 7405  C C5    . DT  I 5 67  ? 264.352 210.140 239.726 1.00 48.08  ? -17 DT  I C5    1 
ATOM 7406  C C7    . DT  I 5 67  ? 265.513 209.267 239.378 1.00 48.08  ? -17 DT  I C7    1 
ATOM 7407  C C6    . DT  I 5 67  ? 263.097 209.689 239.693 1.00 48.08  ? -17 DT  I C6    1 
ATOM 7408  P P     . DT  I 5 68  ? 257.188 208.578 237.958 1.00 45.78  ? -16 DT  I P     1 
ATOM 7409  O OP1   . DT  I 5 68  ? 255.949 207.889 238.361 1.00 45.78  ? -16 DT  I OP1   1 
ATOM 7410  O OP2   . DT  I 5 68  ? 258.047 208.017 236.894 1.00 45.78  ? -16 DT  I OP2   1 
ATOM 7411  O "O5'" . DT  I 5 68  ? 256.828 210.073 237.551 1.00 45.78  ? -16 DT  I "O5'" 1 
ATOM 7412  C "C5'" . DT  I 5 68  ? 256.650 211.045 238.561 1.00 45.78  ? -16 DT  I "C5'" 1 
ATOM 7413  C "C4'" . DT  I 5 68  ? 257.162 212.389 238.102 1.00 45.78  ? -16 DT  I "C4'" 1 
ATOM 7414  O "O4'" . DT  I 5 68  ? 258.605 212.443 238.245 1.00 45.78  ? -16 DT  I "O4'" 1 
ATOM 7415  C "C3'" . DT  I 5 68  ? 256.876 212.715 236.635 1.00 45.78  ? -16 DT  I "C3'" 1 
ATOM 7416  O "O3'" . DT  I 5 68  ? 256.435 214.034 236.531 1.00 45.78  ? -16 DT  I "O3'" 1 
ATOM 7417  C "C2'" . DT  I 5 68  ? 258.242 212.559 235.986 1.00 45.78  ? -16 DT  I "C2'" 1 
ATOM 7418  C "C1'" . DT  I 5 68  ? 259.126 213.059 237.103 1.00 45.78  ? -16 DT  I "C1'" 1 
ATOM 7419  N N1    . DT  I 5 68  ? 260.537 212.691 236.937 1.00 45.78  ? -16 DT  I N1    1 
ATOM 7420  C C2    . DT  I 5 68  ? 261.509 213.583 237.300 1.00 45.78  ? -16 DT  I C2    1 
ATOM 7421  O O2    . DT  I 5 68  ? 261.270 214.665 237.786 1.00 45.78  ? -16 DT  I O2    1 
ATOM 7422  N N3    . DT  I 5 68  ? 262.783 213.155 237.079 1.00 45.78  ? -16 DT  I N3    1 
ATOM 7423  C C4    . DT  I 5 68  ? 263.173 211.959 236.533 1.00 45.78  ? -16 DT  I C4    1 
ATOM 7424  O O4    . DT  I 5 68  ? 264.349 211.664 236.380 1.00 45.78  ? -16 DT  I O4    1 
ATOM 7425  C C5    . DT  I 5 68  ? 262.105 211.073 236.168 1.00 45.78  ? -16 DT  I C5    1 
ATOM 7426  C C7    . DT  I 5 68  ? 262.409 209.739 235.565 1.00 45.78  ? -16 DT  I C7    1 
ATOM 7427  C C6    . DT  I 5 68  ? 260.852 211.480 236.377 1.00 45.78  ? -16 DT  I C6    1 
ATOM 7428  P P     . DA  I 5 69  ? 254.930 214.368 236.098 1.00 42.19  ? -15 DA  I P     1 
ATOM 7429  O OP1   . DA  I 5 69  ? 254.023 213.528 236.900 1.00 42.19  ? -15 DA  I OP1   1 
ATOM 7430  O OP2   . DA  I 5 69  ? 254.860 214.335 234.625 1.00 42.19  ? -15 DA  I OP2   1 
ATOM 7431  O "O5'" . DA  I 5 69  ? 254.764 215.876 236.570 1.00 42.19  ? -15 DA  I "O5'" 1 
ATOM 7432  C "C5'" . DA  I 5 69  ? 255.220 216.248 237.858 1.00 42.19  ? -15 DA  I "C5'" 1 
ATOM 7433  C "C4'" . DA  I 5 69  ? 256.098 217.485 237.800 1.00 42.19  ? -15 DA  I "C4'" 1 
ATOM 7434  O "O4'" . DA  I 5 69  ? 257.467 217.125 237.488 1.00 42.19  ? -15 DA  I "O4'" 1 
ATOM 7435  C "C3'" . DA  I 5 69  ? 255.688 218.531 236.783 1.00 42.19  ? -15 DA  I "C3'" 1 
ATOM 7436  O "O3'" . DA  I 5 69  ? 255.847 219.802 237.366 1.00 42.19  ? -15 DA  I "O3'" 1 
ATOM 7437  C "C2'" . DA  I 5 69  ? 256.664 218.298 235.624 1.00 42.19  ? -15 DA  I "C2'" 1 
ATOM 7438  C "C1'" . DA  I 5 69  ? 257.914 217.817 236.342 1.00 42.19  ? -15 DA  I "C1'" 1 
ATOM 7439  N N9    . DA  I 5 69  ? 258.729 216.883 235.570 1.00 42.19  ? -15 DA  I N9    1 
ATOM 7440  C C8    . DA  I 5 69  ? 258.291 215.819 234.847 1.00 42.19  ? -15 DA  I C8    1 
ATOM 7441  N N7    . DA  I 5 69  ? 259.250 215.129 234.285 1.00 42.19  ? -15 DA  I N7    1 
ATOM 7442  C C5    . DA  I 5 69  ? 260.397 215.774 234.684 1.00 42.19  ? -15 DA  I C5    1 
ATOM 7443  C C6    . DA  I 5 69  ? 261.751 215.531 234.424 1.00 42.19  ? -15 DA  I C6    1 
ATOM 7444  N N6    . DA  I 5 69  ? 262.181 214.522 233.673 1.00 42.19  ? -15 DA  I N6    1 
ATOM 7445  N N1    . DA  I 5 69  ? 262.649 216.365 234.969 1.00 42.19  ? -15 DA  I N1    1 
ATOM 7446  C C2    . DA  I 5 69  ? 262.212 217.371 235.723 1.00 42.19  ? -15 DA  I C2    1 
ATOM 7447  N N3    . DA  I 5 69  ? 260.965 217.699 236.040 1.00 42.19  ? -15 DA  I N3    1 
ATOM 7448  C C4    . DA  I 5 69  ? 260.097 216.854 235.480 1.00 42.19  ? -15 DA  I C4    1 
ATOM 7449  P P     . DA  I 5 70  ? 255.391 221.130 236.597 1.00 39.79  ? -14 DA  I P     1 
ATOM 7450  O OP1   . DA  I 5 70  ? 254.688 221.962 237.588 1.00 39.79  ? -14 DA  I OP1   1 
ATOM 7451  O OP2   . DA  I 5 70  ? 254.731 220.760 235.327 1.00 39.79  ? -14 DA  I OP2   1 
ATOM 7452  O "O5'" . DA  I 5 70  ? 256.776 221.828 236.252 1.00 39.79  ? -14 DA  I "O5'" 1 
ATOM 7453  C "C5'" . DA  I 5 70  ? 257.833 221.740 237.173 1.00 39.79  ? -14 DA  I "C5'" 1 
ATOM 7454  C "C4'" . DA  I 5 70  ? 259.149 222.081 236.516 1.00 39.79  ? -14 DA  I "C4'" 1 
ATOM 7455  O "O4'" . DA  I 5 70  ? 259.674 220.925 235.822 1.00 39.79  ? -14 DA  I "O4'" 1 
ATOM 7456  C "C3'" . DA  I 5 70  ? 259.099 223.199 235.485 1.00 39.79  ? -14 DA  I "C3'" 1 
ATOM 7457  O "O3'" . DA  I 5 70  ? 260.263 223.959 235.624 1.00 39.79  ? -14 DA  I "O3'" 1 
ATOM 7458  C "C2'" . DA  I 5 70  ? 259.103 222.429 234.168 1.00 39.79  ? -14 DA  I "C2'" 1 
ATOM 7459  C "C1'" . DA  I 5 70  ? 260.048 221.304 234.526 1.00 39.79  ? -14 DA  I "C1'" 1 
ATOM 7460  N N9    . DA  I 5 70  ? 259.971 220.129 233.665 1.00 39.79  ? -14 DA  I N9    1 
ATOM 7461  C C8    . DA  I 5 70  ? 258.854 219.475 233.249 1.00 39.79  ? -14 DA  I C8    1 
ATOM 7462  N N7    . DA  I 5 70  ? 259.102 218.435 232.501 1.00 39.79  ? -14 DA  I N7    1 
ATOM 7463  C C5    . DA  I 5 70  ? 260.476 218.401 232.433 1.00 39.79  ? -14 DA  I C5    1 
ATOM 7464  C C6    . DA  I 5 70  ? 261.367 217.534 231.795 1.00 39.79  ? -14 DA  I C6    1 
ATOM 7465  N N6    . DA  I 5 70  ? 260.979 216.491 231.069 1.00 39.79  ? -14 DA  I N6    1 
ATOM 7466  N N1    . DA  I 5 70  ? 262.677 217.782 231.930 1.00 39.79  ? -14 DA  I N1    1 
ATOM 7467  C C2    . DA  I 5 70  ? 263.059 218.822 232.658 1.00 39.79  ? -14 DA  I C2    1 
ATOM 7468  N N3    . DA  I 5 70  ? 262.319 219.700 233.303 1.00 39.79  ? -14 DA  I N3    1 
ATOM 7469  C C4    . DA  I 5 70  ? 261.024 219.428 233.156 1.00 39.79  ? -14 DA  I C4    1 
ATOM 7470  P P     . DA  I 5 71  ? 260.287 225.522 235.303 1.00 38.44  ? -13 DA  I P     1 
ATOM 7471  O OP1   . DA  I 5 71  ? 260.189 226.240 236.577 1.00 38.44  ? -13 DA  I OP1   1 
ATOM 7472  O OP2   . DA  I 5 71  ? 259.342 225.780 234.207 1.00 38.44  ? -13 DA  I OP2   1 
ATOM 7473  O "O5'" . DA  I 5 71  ? 261.761 225.733 234.760 1.00 38.44  ? -13 DA  I "O5'" 1 
ATOM 7474  C "C5'" . DA  I 5 71  ? 262.828 225.097 235.430 1.00 38.44  ? -13 DA  I "C5'" 1 
ATOM 7475  C "C4'" . DA  I 5 71  ? 263.944 224.722 234.478 1.00 38.44  ? -13 DA  I "C4'" 1 
ATOM 7476  O "O4'" . DA  I 5 71  ? 263.622 223.502 233.778 1.00 38.44  ? -13 DA  I "O4'" 1 
ATOM 7477  C "C3'" . DA  I 5 71  ? 264.280 225.753 233.415 1.00 38.44  ? -13 DA  I "C3'" 1 
ATOM 7478  O "O3'" . DA  I 5 71  ? 265.675 225.870 233.347 1.00 38.44  ? -13 DA  I "O3'" 1 
ATOM 7479  C "C2'" . DA  I 5 71  ? 263.694 225.146 232.140 1.00 38.44  ? -13 DA  I "C2'" 1 
ATOM 7480  C "C1'" . DA  I 5 71  ? 263.853 223.662 232.402 1.00 38.44  ? -13 DA  I "C1'" 1 
ATOM 7481  N N9    . DA  I 5 71  ? 262.894 222.813 231.703 1.00 38.44  ? -13 DA  I N9    1 
ATOM 7482  C C8    . DA  I 5 71  ? 261.541 222.865 231.794 1.00 38.44  ? -13 DA  I C8    1 
ATOM 7483  N N7    . DA  I 5 71  ? 260.926 221.963 231.080 1.00 38.44  ? -13 DA  I N7    1 
ATOM 7484  C C5    . DA  I 5 71  ? 261.947 221.255 230.490 1.00 38.44  ? -13 DA  I C5    1 
ATOM 7485  C C6    . DA  I 5 71  ? 261.956 220.159 229.614 1.00 38.44  ? -13 DA  I C6    1 
ATOM 7486  N N6    . DA  I 5 71  ? 260.853 219.565 229.162 1.00 38.44  ? -13 DA  I N6    1 
ATOM 7487  N N1    . DA  I 5 71  ? 263.145 219.696 229.213 1.00 38.44  ? -13 DA  I N1    1 
ATOM 7488  C C2    . DA  I 5 71  ? 264.248 220.291 229.665 1.00 38.44  ? -13 DA  I C2    1 
ATOM 7489  N N3    . DA  I 5 71  ? 264.365 221.321 230.488 1.00 38.44  ? -13 DA  I N3    1 
ATOM 7490  C C4    . DA  I 5 71  ? 263.168 221.759 230.871 1.00 38.44  ? -13 DA  I C4    1 
ATOM 7491  P P     . DA  I 5 72  ? 266.369 227.083 232.572 1.00 39.94  ? -12 DA  I P     1 
ATOM 7492  O OP1   . DA  I 5 72  ? 267.387 227.654 233.462 1.00 39.94  ? -12 DA  I OP1   1 
ATOM 7493  O OP2   . DA  I 5 72  ? 265.337 227.949 231.984 1.00 39.94  ? -12 DA  I OP2   1 
ATOM 7494  O "O5'" . DA  I 5 72  ? 267.120 226.357 231.384 1.00 39.94  ? -12 DA  I "O5'" 1 
ATOM 7495  C "C5'" . DA  I 5 72  ? 267.692 225.091 231.596 1.00 39.94  ? -12 DA  I "C5'" 1 
ATOM 7496  C "C4'" . DA  I 5 72  ? 268.153 224.498 230.288 1.00 39.94  ? -12 DA  I "C4'" 1 
ATOM 7497  O "O4'" . DA  I 5 72  ? 267.113 223.659 229.743 1.00 39.94  ? -12 DA  I "O4'" 1 
ATOM 7498  C "C3'" . DA  I 5 72  ? 268.486 225.506 229.203 1.00 39.94  ? -12 DA  I "C3'" 1 
ATOM 7499  O "O3'" . DA  I 5 72  ? 269.580 225.027 228.465 1.00 39.94  ? -12 DA  I "O3'" 1 
ATOM 7500  C "C2'" . DA  I 5 72  ? 267.210 225.537 228.367 1.00 39.94  ? -12 DA  I "C2'" 1 
ATOM 7501  C "C1'" . DA  I 5 72  ? 266.768 224.093 228.452 1.00 39.94  ? -12 DA  I "C1'" 1 
ATOM 7502  N N9    . DA  I 5 72  ? 265.339 223.896 228.304 1.00 39.94  ? -12 DA  I N9    1 
ATOM 7503  C C8    . DA  I 5 72  ? 264.341 224.590 228.917 1.00 39.94  ? -12 DA  I C8    1 
ATOM 7504  N N7    . DA  I 5 72  ? 263.144 224.162 228.615 1.00 39.94  ? -12 DA  I N7    1 
ATOM 7505  C C5    . DA  I 5 72  ? 263.380 223.111 227.760 1.00 39.94  ? -12 DA  I C5    1 
ATOM 7506  C C6    . DA  I 5 72  ? 262.525 222.239 227.079 1.00 39.94  ? -12 DA  I C6    1 
ATOM 7507  N N6    . DA  I 5 72  ? 261.201 222.291 227.173 1.00 39.94  ? -12 DA  I N6    1 
ATOM 7508  N N1    . DA  I 5 72  ? 263.087 221.297 226.302 1.00 39.94  ? -12 DA  I N1    1 
ATOM 7509  C C2    . DA  I 5 72  ? 264.412 221.248 226.216 1.00 39.94  ? -12 DA  I C2    1 
ATOM 7510  N N3    . DA  I 5 72  ? 265.312 222.014 226.805 1.00 39.94  ? -12 DA  I N3    1 
ATOM 7511  C C4    . DA  I 5 72  ? 264.726 222.933 227.567 1.00 39.94  ? -12 DA  I C4    1 
ATOM 7512  P P     . DC  I 5 73  ? 270.382 225.987 227.467 1.00 42.61  ? -11 DC  I P     1 
ATOM 7513  O OP1   . DC  I 5 73  ? 271.790 225.966 227.901 1.00 42.61  ? -11 DC  I OP1   1 
ATOM 7514  O OP2   . DC  I 5 73  ? 269.672 227.276 227.373 1.00 42.61  ? -11 DC  I OP2   1 
ATOM 7515  O "O5'" . DC  I 5 73  ? 270.259 225.230 226.070 1.00 42.61  ? -11 DC  I "O5'" 1 
ATOM 7516  C "C5'" . DC  I 5 73  ? 269.695 223.929 226.039 1.00 42.61  ? -11 DC  I "C5'" 1 
ATOM 7517  C "C4'" . DC  I 5 73  ? 269.241 223.567 224.643 1.00 42.61  ? -11 DC  I "C4'" 1 
ATOM 7518  O "O4'" . DC  I 5 73  ? 267.823 223.266 224.641 1.00 42.61  ? -11 DC  I "O4'" 1 
ATOM 7519  C "C3'" . DC  I 5 73  ? 269.441 224.649 223.596 1.00 42.61  ? -11 DC  I "C3'" 1 
ATOM 7520  O "O3'" . DC  I 5 73  ? 269.898 224.043 222.410 1.00 42.61  ? -11 DC  I "O3'" 1 
ATOM 7521  C "C2'" . DC  I 5 73  ? 268.037 225.222 223.428 1.00 42.61  ? -11 DC  I "C2'" 1 
ATOM 7522  C "C1'" . DC  I 5 73  ? 267.199 223.976 223.600 1.00 42.61  ? -11 DC  I "C1'" 1 
ATOM 7523  N N1    . DC  I 5 73  ? 265.803 224.241 224.004 1.00 42.61  ? -11 DC  I N1    1 
ATOM 7524  C C2    . DC  I 5 73  ? 264.765 223.496 223.448 1.00 42.61  ? -11 DC  I C2    1 
ATOM 7525  O O2    . DC  I 5 73  ? 265.024 222.635 222.610 1.00 42.61  ? -11 DC  I O2    1 
ATOM 7526  N N3    . DC  I 5 73  ? 263.504 223.745 223.841 1.00 42.61  ? -11 DC  I N3    1 
ATOM 7527  C C4    . DC  I 5 73  ? 263.263 224.683 224.740 1.00 42.61  ? -11 DC  I C4    1 
ATOM 7528  N N4    . DC  I 5 73  ? 261.998 224.893 225.102 1.00 42.61  ? -11 DC  I N4    1 
ATOM 7529  C C5    . DC  I 5 73  ? 264.305 225.447 225.324 1.00 42.61  ? -11 DC  I C5    1 
ATOM 7530  C C6    . DC  I 5 73  ? 265.548 225.194 224.929 1.00 42.61  ? -11 DC  I C6    1 
ATOM 7531  P P     . DG  I 5 74  ? 270.636 224.898 221.274 1.00 43.75  ? -10 DG  I P     1 
ATOM 7532  O OP1   . DG  I 5 74  ? 272.035 224.436 221.213 1.00 43.75  ? -10 DG  I OP1   1 
ATOM 7533  O OP2   . DG  I 5 74  ? 270.341 226.329 221.485 1.00 43.75  ? -10 DG  I OP2   1 
ATOM 7534  O "O5'" . DG  I 5 74  ? 269.892 224.425 219.953 1.00 43.75  ? -10 DG  I "O5'" 1 
ATOM 7535  C "C5'" . DG  I 5 74  ? 269.241 223.168 219.948 1.00 43.75  ? -10 DG  I "C5'" 1 
ATOM 7536  C "C4'" . DG  I 5 74  ? 268.194 223.109 218.863 1.00 43.75  ? -10 DG  I "C4'" 1 
ATOM 7537  O "O4'" . DG  I 5 74  ? 266.875 223.303 219.430 1.00 43.75  ? -10 DG  I "O4'" 1 
ATOM 7538  C "C3'" . DG  I 5 74  ? 268.337 224.159 217.779 1.00 43.75  ? -10 DG  I "C3'" 1 
ATOM 7539  O "O3'" . DG  I 5 74  ? 267.925 223.596 216.566 1.00 43.75  ? -10 DG  I "O3'" 1 
ATOM 7540  C "C2'" . DG  I 5 74  ? 267.374 225.243 218.247 1.00 43.75  ? -10 DG  I "C2'" 1 
ATOM 7541  C "C1'" . DG  I 5 74  ? 266.249 224.402 218.811 1.00 43.75  ? -10 DG  I "C1'" 1 
ATOM 7542  N N9    . DG  I 5 74  ? 265.461 225.087 219.818 1.00 43.75  ? -10 DG  I N9    1 
ATOM 7543  C C8    . DG  I 5 74  ? 265.913 225.962 220.762 1.00 43.75  ? -10 DG  I C8    1 
ATOM 7544  N N7    . DG  I 5 74  ? 264.977 226.412 221.540 1.00 43.75  ? -10 DG  I N7    1 
ATOM 7545  C C5    . DG  I 5 74  ? 263.835 225.781 221.087 1.00 43.75  ? -10 DG  I C5    1 
ATOM 7546  C C6    . DG  I 5 74  ? 262.509 225.875 221.540 1.00 43.75  ? -10 DG  I C6    1 
ATOM 7547  O O6    . DG  I 5 74  ? 262.066 226.556 222.469 1.00 43.75  ? -10 DG  I O6    1 
ATOM 7548  N N1    . DG  I 5 74  ? 261.656 225.075 220.799 1.00 43.75  ? -10 DG  I N1    1 
ATOM 7549  C C2    . DG  I 5 74  ? 262.038 224.287 219.751 1.00 43.75  ? -10 DG  I C2    1 
ATOM 7550  N N2    . DG  I 5 74  ? 261.079 223.584 219.155 1.00 43.75  ? -10 DG  I N2    1 
ATOM 7551  N N3    . DG  I 5 74  ? 263.277 224.189 219.317 1.00 43.75  ? -10 DG  I N3    1 
ATOM 7552  C C4    . DG  I 5 74  ? 264.119 224.961 220.030 1.00 43.75  ? -10 DG  I C4    1 
ATOM 7553  P P     . DC  I 5 75  ? 268.236 224.309 215.166 1.00 44.16  ? -9  DC  I P     1 
ATOM 7554  O OP1   . DC  I 5 75  ? 269.413 223.632 214.592 1.00 44.16  ? -9  DC  I OP1   1 
ATOM 7555  O OP2   . DC  I 5 75  ? 268.251 225.777 215.337 1.00 44.16  ? -9  DC  I OP2   1 
ATOM 7556  O "O5'" . DC  I 5 75  ? 266.951 223.932 214.309 1.00 44.16  ? -9  DC  I "O5'" 1 
ATOM 7557  C "C5'" . DC  I 5 75  ? 265.919 223.182 214.922 1.00 44.16  ? -9  DC  I "C5'" 1 
ATOM 7558  C "C4'" . DC  I 5 75  ? 264.567 223.635 214.428 1.00 44.16  ? -9  DC  I "C4'" 1 
ATOM 7559  O "O4'" . DC  I 5 75  ? 263.822 224.240 215.513 1.00 44.16  ? -9  DC  I "O4'" 1 
ATOM 7560  C "C3'" . DC  I 5 75  ? 264.621 224.670 213.321 1.00 44.16  ? -9  DC  I "C3'" 1 
ATOM 7561  O "O3'" . DC  I 5 75  ? 263.669 224.339 212.346 1.00 44.16  ? -9  DC  I "O3'" 1 
ATOM 7562  C "C2'" . DC  I 5 75  ? 264.281 225.978 214.040 1.00 44.16  ? -9  DC  I "C2'" 1 
ATOM 7563  C "C1'" . DC  I 5 75  ? 263.320 225.488 215.102 1.00 44.16  ? -9  DC  I "C1'" 1 
ATOM 7564  N N1    . DC  I 5 75  ? 263.230 226.361 216.300 1.00 44.16  ? -9  DC  I N1    1 
ATOM 7565  C C2    . DC  I 5 75  ? 261.990 226.577 216.890 1.00 44.16  ? -9  DC  I C2    1 
ATOM 7566  O O2    . DC  I 5 75  ? 261.003 226.051 216.387 1.00 44.16  ? -9  DC  I O2    1 
ATOM 7567  N N3    . DC  I 5 75  ? 261.909 227.354 217.988 1.00 44.16  ? -9  DC  I N3    1 
ATOM 7568  C C4    . DC  I 5 75  ? 263.005 227.900 218.492 1.00 44.16  ? -9  DC  I C4    1 
ATOM 7569  N N4    . DC  I 5 75  ? 262.880 228.664 219.579 1.00 44.16  ? -9  DC  I N4    1 
ATOM 7570  C C5    . DC  I 5 75  ? 264.284 227.689 217.909 1.00 44.16  ? -9  DC  I C5    1 
ATOM 7571  C C6    . DC  I 5 75  ? 264.350 226.914 216.826 1.00 44.16  ? -9  DC  I C6    1 
ATOM 7572  P P     . DG  I 5 76  ? 263.843 224.869 210.847 1.00 44.01  ? -8  DG  I P     1 
ATOM 7573  O OP1   . DG  I 5 76  ? 262.945 224.069 209.990 1.00 44.01  ? -8  DG  I OP1   1 
ATOM 7574  O OP2   . DG  I 5 76  ? 265.289 224.915 210.545 1.00 44.01  ? -8  DG  I OP2   1 
ATOM 7575  O "O5'" . DG  I 5 76  ? 263.336 226.374 210.940 1.00 44.01  ? -8  DG  I "O5'" 1 
ATOM 7576  C "C5'" . DG  I 5 76  ? 262.465 226.886 209.966 1.00 44.01  ? -8  DG  I "C5'" 1 
ATOM 7577  C "C4'" . DG  I 5 76  ? 261.022 226.508 210.255 1.00 44.01  ? -8  DG  I "C4'" 1 
ATOM 7578  O "O4'" . DG  I 5 76  ? 260.779 226.517 211.680 1.00 44.01  ? -8  DG  I "O4'" 1 
ATOM 7579  C "C3'" . DG  I 5 76  ? 260.016 227.468 209.670 1.00 44.01  ? -8  DG  I "C3'" 1 
ATOM 7580  O "O3'" . DG  I 5 76  ? 258.824 226.807 209.365 1.00 44.01  ? -8  DG  I "O3'" 1 
ATOM 7581  C "C2'" . DG  I 5 76  ? 259.835 228.487 210.784 1.00 44.01  ? -8  DG  I "C2'" 1 
ATOM 7582  C "C1'" . DG  I 5 76  ? 260.008 227.650 212.040 1.00 44.01  ? -8  DG  I "C1'" 1 
ATOM 7583  N N9    . DG  I 5 76  ? 260.710 228.350 213.106 1.00 44.01  ? -8  DG  I N9    1 
ATOM 7584  C C8    . DG  I 5 76  ? 262.057 228.557 213.194 1.00 44.01  ? -8  DG  I C8    1 
ATOM 7585  N N7    . DG  I 5 76  ? 262.414 229.203 214.259 1.00 44.01  ? -8  DG  I N7    1 
ATOM 7586  C C5    . DG  I 5 76  ? 261.227 229.442 214.923 1.00 44.01  ? -8  DG  I C5    1 
ATOM 7587  C C6    . DG  I 5 76  ? 260.996 230.099 216.140 1.00 44.01  ? -8  DG  I C6    1 
ATOM 7588  O O6    . DG  I 5 76  ? 261.820 230.621 216.888 1.00 44.01  ? -8  DG  I O6    1 
ATOM 7589  N N1    . DG  I 5 76  ? 259.649 230.131 216.464 1.00 44.01  ? -8  DG  I N1    1 
ATOM 7590  C C2    . DG  I 5 76  ? 258.651 229.588 215.707 1.00 44.01  ? -8  DG  I C2    1 
ATOM 7591  N N2    . DG  I 5 76  ? 257.409 229.714 216.184 1.00 44.01  ? -8  DG  I N2    1 
ATOM 7592  N N3    . DG  I 5 76  ? 258.855 228.960 214.558 1.00 44.01  ? -8  DG  I N3    1 
ATOM 7593  C C4    . DG  I 5 76  ? 260.166 228.928 214.229 1.00 44.01  ? -8  DG  I C4    1 
ATOM 7594  P P     . DG  I 5 77  ? 257.922 227.366 208.169 1.00 43.46  ? -7  DG  I P     1 
ATOM 7595  O OP1   . DG  I 5 77  ? 256.972 226.318 207.760 1.00 43.46  ? -7  DG  I OP1   1 
ATOM 7596  O OP2   . DG  I 5 77  ? 258.850 227.960 207.191 1.00 43.46  ? -7  DG  I OP2   1 
ATOM 7597  O "O5'" . DG  I 5 77  ? 257.123 228.567 208.839 1.00 43.46  ? -7  DG  I "O5'" 1 
ATOM 7598  C "C5'" . DG  I 5 77  ? 256.332 228.327 209.975 1.00 43.46  ? -7  DG  I "C5'" 1 
ATOM 7599  C "C4'" . DG  I 5 77  ? 255.883 229.628 210.603 1.00 43.46  ? -7  DG  I "C4'" 1 
ATOM 7600  O "O4'" . DG  I 5 77  ? 256.886 230.098 211.534 1.00 43.46  ? -7  DG  I "O4'" 1 
ATOM 7601  C "C3'" . DG  I 5 77  ? 255.658 230.784 209.630 1.00 43.46  ? -7  DG  I "C3'" 1 
ATOM 7602  O "O3'" . DG  I 5 77  ? 254.564 231.533 210.077 1.00 43.46  ? -7  DG  I "O3'" 1 
ATOM 7603  C "C2'" . DG  I 5 77  ? 256.944 231.581 209.779 1.00 43.46  ? -7  DG  I "C2'" 1 
ATOM 7604  C "C1'" . DG  I 5 77  ? 257.132 231.451 211.268 1.00 43.46  ? -7  DG  I "C1'" 1 
ATOM 7605  N N9    . DG  I 5 77  ? 258.457 231.790 211.750 1.00 43.46  ? -7  DG  I N9    1 
ATOM 7606  C C8    . DG  I 5 77  ? 259.645 231.659 211.091 1.00 43.46  ? -7  DG  I C8    1 
ATOM 7607  N N7    . DG  I 5 77  ? 260.669 232.037 211.794 1.00 43.46  ? -7  DG  I N7    1 
ATOM 7608  C C5    . DG  I 5 77  ? 260.116 232.452 212.990 1.00 43.46  ? -7  DG  I C5    1 
ATOM 7609  C C6    . DG  I 5 77  ? 260.728 232.979 214.135 1.00 43.46  ? -7  DG  I C6    1 
ATOM 7610  O O6    . DG  I 5 77  ? 261.924 233.183 214.334 1.00 43.46  ? -7  DG  I O6    1 
ATOM 7611  N N1    . DG  I 5 77  ? 259.804 233.269 215.121 1.00 43.46  ? -7  DG  I N1    1 
ATOM 7612  C C2    . DG  I 5 77  ? 258.456 233.089 215.009 1.00 43.46  ? -7  DG  I C2    1 
ATOM 7613  N N2    . DG  I 5 77  ? 257.719 233.425 216.066 1.00 43.46  ? -7  DG  I N2    1 
ATOM 7614  N N3    . DG  I 5 77  ? 257.869 232.597 213.942 1.00 43.46  ? -7  DG  I N3    1 
ATOM 7615  C C4    . DG  I 5 77  ? 258.758 232.304 212.974 1.00 43.46  ? -7  DG  I C4    1 
ATOM 7616  P P     . DG  I 5 78  ? 253.389 231.956 209.078 1.00 43.95  ? -6  DG  I P     1 
ATOM 7617  O OP1   . DG  I 5 78  ? 252.599 230.753 208.762 1.00 43.95  ? -6  DG  I OP1   1 
ATOM 7618  O OP2   . DG  I 5 78  ? 254.003 232.750 207.996 1.00 43.95  ? -6  DG  I OP2   1 
ATOM 7619  O "O5'" . DG  I 5 78  ? 252.483 232.918 209.970 1.00 43.95  ? -6  DG  I "O5'" 1 
ATOM 7620  C "C5'" . DG  I 5 78  ? 252.236 232.601 211.341 1.00 43.95  ? -6  DG  I "C5'" 1 
ATOM 7621  C "C4'" . DG  I 5 78  ? 252.322 233.839 212.227 1.00 43.95  ? -6  DG  I "C4'" 1 
ATOM 7622  O "O4'" . DG  I 5 78  ? 253.705 234.104 212.564 1.00 43.95  ? -6  DG  I "O4'" 1 
ATOM 7623  C "C3'" . DG  I 5 78  ? 251.823 235.135 211.604 1.00 43.95  ? -6  DG  I "C3'" 1 
ATOM 7624  O "O3'" . DG  I 5 78  ? 251.443 236.012 212.625 1.00 43.95  ? -6  DG  I "O3'" 1 
ATOM 7625  C "C2'" . DG  I 5 78  ? 253.084 235.647 210.944 1.00 43.95  ? -6  DG  I "C2'" 1 
ATOM 7626  C "C1'" . DG  I 5 78  ? 254.064 235.371 212.059 1.00 43.95  ? -6  DG  I "C1'" 1 
ATOM 7627  N N9    . DG  I 5 78  ? 255.441 235.319 211.631 1.00 43.95  ? -6  DG  I N9    1 
ATOM 7628  C C8    . DG  I 5 78  ? 255.911 234.919 210.416 1.00 43.95  ? -6  DG  I C8    1 
ATOM 7629  N N7    . DG  I 5 78  ? 257.204 234.971 210.323 1.00 43.95  ? -6  DG  I N7    1 
ATOM 7630  C C5    . DG  I 5 78  ? 257.608 235.430 211.559 1.00 43.95  ? -6  DG  I C5    1 
ATOM 7631  C C6    . DG  I 5 78  ? 258.893 235.688 212.045 1.00 43.95  ? -6  DG  I C6    1 
ATOM 7632  O O6    . DG  I 5 78  ? 259.970 235.548 211.465 1.00 43.95  ? -6  DG  I O6    1 
ATOM 7633  N N1    . DG  I 5 78  ? 258.864 236.153 213.350 1.00 43.95  ? -6  DG  I N1    1 
ATOM 7634  C C2    . DG  I 5 78  ? 257.730 236.341 214.090 1.00 43.95  ? -6  DG  I C2    1 
ATOM 7635  N N2    . DG  I 5 78  ? 257.901 236.789 215.338 1.00 43.95  ? -6  DG  I N2    1 
ATOM 7636  N N3    . DG  I 5 78  ? 256.516 236.103 213.643 1.00 43.95  ? -6  DG  I N3    1 
ATOM 7637  C C4    . DG  I 5 78  ? 256.534 235.649 212.374 1.00 43.95  ? -6  DG  I C4    1 
ATOM 7638  P P     . DG  I 5 79  ? 249.907 236.194 213.039 1.00 43.49  ? -5  DG  I P     1 
ATOM 7639  O OP1   . DG  I 5 79  ? 249.405 234.914 213.566 1.00 43.49  ? -5  DG  I OP1   1 
ATOM 7640  O OP2   . DG  I 5 79  ? 249.217 236.843 211.908 1.00 43.49  ? -5  DG  I OP2   1 
ATOM 7641  O "O5'" . DG  I 5 79  ? 249.991 237.217 214.254 1.00 43.49  ? -5  DG  I "O5'" 1 
ATOM 7642  C "C5'" . DG  I 5 79  ? 250.996 237.045 215.244 1.00 43.49  ? -5  DG  I "C5'" 1 
ATOM 7643  C "C4'" . DG  I 5 79  ? 251.734 238.342 215.497 1.00 43.49  ? -5  DG  I "C4'" 1 
ATOM 7644  O "O4'" . DG  I 5 79  ? 252.989 238.346 214.769 1.00 43.49  ? -5  DG  I "O4'" 1 
ATOM 7645  C "C3'" . DG  I 5 79  ? 250.999 239.596 215.042 1.00 43.49  ? -5  DG  I "C3'" 1 
ATOM 7646  O "O3'" . DG  I 5 79  ? 251.327 240.660 215.892 1.00 43.49  ? -5  DG  I "O3'" 1 
ATOM 7647  C "C2'" . DG  I 5 79  ? 251.605 239.822 213.670 1.00 43.49  ? -5  DG  I "C2'" 1 
ATOM 7648  C "C1'" . DG  I 5 79  ? 253.047 239.513 213.988 1.00 43.49  ? -5  DG  I "C1'" 1 
ATOM 7649  N N9    . DG  I 5 79  ? 253.863 239.256 212.821 1.00 43.49  ? -5  DG  I N9    1 
ATOM 7650  C C8    . DG  I 5 79  ? 253.428 238.929 211.570 1.00 43.49  ? -5  DG  I C8    1 
ATOM 7651  N N7    . DG  I 5 79  ? 254.391 238.751 210.720 1.00 43.49  ? -5  DG  I N7    1 
ATOM 7652  C C5    . DG  I 5 79  ? 255.536 238.981 211.457 1.00 43.49  ? -5  DG  I C5    1 
ATOM 7653  C C6    . DG  I 5 79  ? 256.883 238.937 211.070 1.00 43.49  ? -5  DG  I C6    1 
ATOM 7654  O O6    . DG  I 5 79  ? 257.355 238.676 209.959 1.00 43.49  ? -5  DG  I O6    1 
ATOM 7655  N N1    . DG  I 5 79  ? 257.724 239.237 212.122 1.00 43.49  ? -5  DG  I N1    1 
ATOM 7656  C C2    . DG  I 5 79  ? 257.317 239.538 213.388 1.00 43.49  ? -5  DG  I C2    1 
ATOM 7657  N N2    . DG  I 5 79  ? 258.279 239.787 214.272 1.00 43.49  ? -5  DG  I N2    1 
ATOM 7658  N N3    . DG  I 5 79  ? 256.060 239.570 213.768 1.00 43.49  ? -5  DG  I N3    1 
ATOM 7659  C C4    . DG  I 5 79  ? 255.225 239.295 212.750 1.00 43.49  ? -5  DG  I C4    1 
ATOM 7660  P P     . DG  I 5 80  ? 250.427 241.020 217.167 1.00 41.00  ? -4  DG  I P     1 
ATOM 7661  O OP1   . DG  I 5 80  ? 250.068 239.776 217.869 1.00 41.00  ? -4  DG  I OP1   1 
ATOM 7662  O OP2   . DG  I 5 80  ? 249.377 241.953 216.723 1.00 41.00  ? -4  DG  I OP2   1 
ATOM 7663  O "O5'" . DG  I 5 80  ? 251.439 241.820 218.093 1.00 41.00  ? -4  DG  I "O5'" 1 
ATOM 7664  C "C5'" . DG  I 5 80  ? 252.611 241.190 218.521 1.00 41.00  ? -4  DG  I "C5'" 1 
ATOM 7665  C "C4'" . DG  I 5 80  ? 253.820 242.088 218.363 1.00 41.00  ? -4  DG  I "C4'" 1 
ATOM 7666  O "O4'" . DG  I 5 80  ? 254.398 241.927 217.049 1.00 41.00  ? -4  DG  I "O4'" 1 
ATOM 7667  C "C3'" . DG  I 5 80  ? 253.577 243.580 218.522 1.00 41.00  ? -4  DG  I "C3'" 1 
ATOM 7668  O "O3'" . DG  I 5 80  ? 254.725 244.136 219.076 1.00 41.00  ? -4  DG  I "O3'" 1 
ATOM 7669  C "C2'" . DG  I 5 80  ? 253.425 244.025 217.080 1.00 41.00  ? -4  DG  I "C2'" 1 
ATOM 7670  C "C1'" . DG  I 5 80  ? 254.508 243.189 216.441 1.00 41.00  ? -4  DG  I "C1'" 1 
ATOM 7671  N N9    . DG  I 5 80  ? 254.357 243.012 215.010 1.00 41.00  ? -4  DG  I N9    1 
ATOM 7672  C C8    . DG  I 5 80  ? 253.192 242.896 214.310 1.00 41.00  ? -4  DG  I C8    1 
ATOM 7673  N N7    . DG  I 5 80  ? 253.370 242.739 213.040 1.00 41.00  ? -4  DG  I N7    1 
ATOM 7674  C C5    . DG  I 5 80  ? 254.740 242.739 212.892 1.00 41.00  ? -4  DG  I C5    1 
ATOM 7675  C C6    . DG  I 5 80  ? 255.520 242.610 211.739 1.00 41.00  ? -4  DG  I C6    1 
ATOM 7676  O O6    . DG  I 5 80  ? 255.144 242.449 210.581 1.00 41.00  ? -4  DG  I O6    1 
ATOM 7677  N N1    . DG  I 5 80  ? 256.871 242.670 212.023 1.00 41.00  ? -4  DG  I N1    1 
ATOM 7678  C C2    . DG  I 5 80  ? 257.401 242.828 213.270 1.00 41.00  ? -4  DG  I C2    1 
ATOM 7679  N N2    . DG  I 5 80  ? 258.734 242.865 213.353 1.00 41.00  ? -4  DG  I N2    1 
ATOM 7680  N N3    . DG  I 5 80  ? 256.677 242.960 214.362 1.00 41.00  ? -4  DG  I N3    1 
ATOM 7681  C C4    . DG  I 5 80  ? 255.360 242.901 214.096 1.00 41.00  ? -4  DG  I C4    1 
ATOM 7682  P P     . DA  I 5 81  ? 254.678 245.483 219.929 1.00 39.16  ? -3  DA  I P     1 
ATOM 7683  O OP1   . DA  I 5 81  ? 254.428 245.084 221.318 1.00 39.16  ? -3  DA  I OP1   1 
ATOM 7684  O OP2   . DA  I 5 81  ? 253.780 246.442 219.276 1.00 39.16  ? -3  DA  I OP2   1 
ATOM 7685  O "O5'" . DA  I 5 81  ? 256.165 246.019 219.794 1.00 39.16  ? -3  DA  I "O5'" 1 
ATOM 7686  C "C5'" . DA  I 5 81  ? 257.197 245.106 219.468 1.00 39.16  ? -3  DA  I "C5'" 1 
ATOM 7687  C "C4'" . DA  I 5 81  ? 258.462 245.809 219.005 1.00 39.16  ? -3  DA  I "C4'" 1 
ATOM 7688  O "O4'" . DA  I 5 81  ? 258.595 245.702 217.571 1.00 39.16  ? -3  DA  I "O4'" 1 
ATOM 7689  C "C3'" . DA  I 5 81  ? 258.561 247.285 219.303 1.00 39.16  ? -3  DA  I "C3'" 1 
ATOM 7690  O "O3'" . DA  I 5 81  ? 259.926 247.618 219.420 1.00 39.16  ? -3  DA  I "O3'" 1 
ATOM 7691  C "C2'" . DA  I 5 81  ? 257.930 247.913 218.060 1.00 39.16  ? -3  DA  I "C2'" 1 
ATOM 7692  C "C1'" . DA  I 5 81  ? 258.364 246.954 216.955 1.00 39.16  ? -3  DA  I "C1'" 1 
ATOM 7693  N N9    . DA  I 5 81  ? 257.360 246.736 215.924 1.00 39.16  ? -3  DA  I N9    1 
ATOM 7694  C C8    . DA  I 5 81  ? 256.017 246.669 216.099 1.00 39.16  ? -3  DA  I C8    1 
ATOM 7695  N N7    . DA  I 5 81  ? 255.353 246.422 215.003 1.00 39.16  ? -3  DA  I N7    1 
ATOM 7696  C C5    . DA  I 5 81  ? 256.333 246.303 214.039 1.00 39.16  ? -3  DA  I C5    1 
ATOM 7697  C C6    . DA  I 5 81  ? 256.275 246.042 212.662 1.00 39.16  ? -3  DA  I C6    1 
ATOM 7698  N N6    . DA  I 5 81  ? 255.138 245.859 212.000 1.00 39.16  ? -3  DA  I N6    1 
ATOM 7699  N N1    . DA  I 5 81  ? 257.429 245.989 211.991 1.00 39.16  ? -3  DA  I N1    1 
ATOM 7700  C C2    . DA  I 5 81  ? 258.568 246.189 212.653 1.00 39.16  ? -3  DA  I C2    1 
ATOM 7701  N N3    . DA  I 5 81  ? 258.750 246.441 213.945 1.00 39.16  ? -3  DA  I N3    1 
ATOM 7702  C C4    . DA  I 5 81  ? 257.577 246.487 214.588 1.00 39.16  ? -3  DA  I C4    1 
ATOM 7703  P P     . DC  I 5 82  ? 260.391 249.100 219.798 1.00 42.04  ? -2  DC  I P     1 
ATOM 7704  O OP1   . DC  I 5 82  ? 261.635 248.964 220.572 1.00 42.04  ? -2  DC  I OP1   1 
ATOM 7705  O OP2   . DC  I 5 82  ? 259.247 249.844 220.356 1.00 42.04  ? -2  DC  I OP2   1 
ATOM 7706  O "O5'" . DC  I 5 82  ? 260.761 249.734 218.389 1.00 42.04  ? -2  DC  I "O5'" 1 
ATOM 7707  C "C5'" . DC  I 5 82  ? 261.595 249.015 217.500 1.00 42.04  ? -2  DC  I "C5'" 1 
ATOM 7708  C "C4'" . DC  I 5 82  ? 261.681 249.716 216.168 1.00 42.04  ? -2  DC  I "C4'" 1 
ATOM 7709  O "O4'" . DC  I 5 82  ? 260.581 249.300 215.315 1.00 42.04  ? -2  DC  I "O4'" 1 
ATOM 7710  C "C3'" . DC  I 5 82  ? 261.595 251.237 216.240 1.00 42.04  ? -2  DC  I "C3'" 1 
ATOM 7711  O "O3'" . DC  I 5 82  ? 262.478 251.772 215.318 1.00 42.04  ? -2  DC  I "O3'" 1 
ATOM 7712  C "C2'" . DC  I 5 82  ? 260.159 251.506 215.816 1.00 42.04  ? -2  DC  I "C2'" 1 
ATOM 7713  C "C1'" . DC  I 5 82  ? 260.006 250.447 214.752 1.00 42.04  ? -2  DC  I "C1'" 1 
ATOM 7714  N N1    . DC  I 5 82  ? 258.617 250.159 214.384 1.00 42.04  ? -2  DC  I N1    1 
ATOM 7715  C C2    . DC  I 5 82  ? 258.313 249.895 213.060 1.00 42.04  ? -2  DC  I C2    1 
ATOM 7716  O O2    . DC  I 5 82  ? 259.222 249.902 212.234 1.00 42.04  ? -2  DC  I O2    1 
ATOM 7717  N N3    . DC  I 5 82  ? 257.037 249.630 212.722 1.00 42.04  ? -2  DC  I N3    1 
ATOM 7718  C C4    . DC  I 5 82  ? 256.095 249.633 213.650 1.00 42.04  ? -2  DC  I C4    1 
ATOM 7719  N N4    . DC  I 5 82  ? 254.849 249.367 213.274 1.00 42.04  ? -2  DC  I N4    1 
ATOM 7720  C C5    . DC  I 5 82  ? 256.385 249.910 215.009 1.00 42.04  ? -2  DC  I C5    1 
ATOM 7721  C C6    . DC  I 5 82  ? 257.650 250.160 215.328 1.00 42.04  ? -2  DC  I C6    1 
ATOM 7722  P P     . DA  I 5 83  ? 263.295 253.110 215.634 1.00 45.27  ? -1  DA  I P     1 
ATOM 7723  O OP1   . DA  I 5 83  ? 264.490 252.722 216.404 1.00 45.27  ? -1  DA  I OP1   1 
ATOM 7724  O OP2   . DA  I 5 83  ? 262.364 254.127 216.165 1.00 45.27  ? -1  DA  I OP2   1 
ATOM 7725  O "O5'" . DA  I 5 83  ? 263.764 253.556 214.186 1.00 45.27  ? -1  DA  I "O5'" 1 
ATOM 7726  C "C5'" . DA  I 5 83  ? 263.941 252.565 213.196 1.00 45.27  ? -1  DA  I "C5'" 1 
ATOM 7727  C "C4'" . DA  I 5 83  ? 263.440 253.048 211.856 1.00 45.27  ? -1  DA  I "C4'" 1 
ATOM 7728  O "O4'" . DA  I 5 83  ? 262.089 252.575 211.629 1.00 45.27  ? -1  DA  I "O4'" 1 
ATOM 7729  C "C3'" . DA  I 5 83  ? 263.400 254.560 211.698 1.00 45.27  ? -1  DA  I "C3'" 1 
ATOM 7730  O "O3'" . DA  I 5 83  ? 263.952 254.904 210.449 1.00 45.27  ? -1  DA  I "O3'" 1 
ATOM 7731  C "C2'" . DA  I 5 83  ? 261.909 254.889 211.780 1.00 45.27  ? -1  DA  I "C2'" 1 
ATOM 7732  C "C1'" . DA  I 5 83  ? 261.280 253.640 211.195 1.00 45.27  ? -1  DA  I "C1'" 1 
ATOM 7733  N N9    . DA  I 5 83  ? 259.926 253.399 211.670 1.00 45.27  ? -1  DA  I N9    1 
ATOM 7734  C C8    . DA  I 5 83  ? 259.495 253.443 212.959 1.00 45.27  ? -1  DA  I C8    1 
ATOM 7735  N N7    . DA  I 5 83  ? 258.224 253.181 213.098 1.00 45.27  ? -1  DA  I N7    1 
ATOM 7736  C C5    . DA  I 5 83  ? 257.794 252.944 211.812 1.00 45.27  ? -1  DA  I C5    1 
ATOM 7737  C C6    . DA  I 5 83  ? 256.544 252.603 211.288 1.00 45.27  ? -1  DA  I C6    1 
ATOM 7738  N N6    . DA  I 5 83  ? 255.459 252.440 212.038 1.00 45.27  ? -1  DA  I N6    1 
ATOM 7739  N N1    . DA  I 5 83  ? 256.449 252.435 209.964 1.00 45.27  ? -1  DA  I N1    1 
ATOM 7740  C C2    . DA  I 5 83  ? 257.537 252.594 209.215 1.00 45.27  ? -1  DA  I C2    1 
ATOM 7741  N N3    . DA  I 5 83  ? 258.768 252.916 209.593 1.00 45.27  ? -1  DA  I N3    1 
ATOM 7742  C C4    . DA  I 5 83  ? 258.828 253.076 210.918 1.00 45.27  ? -1  DA  I C4    1 
ATOM 7743  P P     . DG  I 5 84  ? 264.214 256.436 210.059 1.00 47.31  ? 0   DG  I P     1 
ATOM 7744  O OP1   . DG  I 5 84  ? 265.561 256.503 209.462 1.00 47.31  ? 0   DG  I OP1   1 
ATOM 7745  O OP2   . DG  I 5 84  ? 263.875 257.295 211.213 1.00 47.31  ? 0   DG  I OP2   1 
ATOM 7746  O "O5'" . DG  I 5 84  ? 263.151 256.692 208.905 1.00 47.31  ? 0   DG  I "O5'" 1 
ATOM 7747  C "C5'" . DG  I 5 84  ? 262.927 255.689 207.939 1.00 47.31  ? 0   DG  I "C5'" 1 
ATOM 7748  C "C4'" . DG  I 5 84  ? 261.760 256.052 207.055 1.00 47.31  ? 0   DG  I "C4'" 1 
ATOM 7749  O "O4'" . DG  I 5 84  ? 260.521 255.608 207.662 1.00 47.31  ? 0   DG  I "O4'" 1 
ATOM 7750  C "C3'" . DG  I 5 84  ? 261.593 257.540 206.799 1.00 47.31  ? 0   DG  I "C3'" 1 
ATOM 7751  O "O3'" . DG  I 5 84  ? 261.208 257.726 205.464 1.00 47.31  ? 0   DG  I "O3'" 1 
ATOM 7752  C "C2'" . DG  I 5 84  ? 260.475 257.926 207.760 1.00 47.31  ? 0   DG  I "C2'" 1 
ATOM 7753  C "C1'" . DG  I 5 84  ? 259.616 256.682 207.712 1.00 47.31  ? 0   DG  I "C1'" 1 
ATOM 7754  N N9    . DG  I 5 84  ? 258.768 256.501 208.875 1.00 47.31  ? 0   DG  I N9    1 
ATOM 7755  C C8    . DG  I 5 84  ? 259.136 256.578 210.190 1.00 47.31  ? 0   DG  I C8    1 
ATOM 7756  N N7    . DG  I 5 84  ? 258.157 256.350 211.011 1.00 47.31  ? 0   DG  I N7    1 
ATOM 7757  C C5    . DG  I 5 84  ? 257.081 256.087 210.185 1.00 47.31  ? 0   DG  I C5    1 
ATOM 7758  C C6    . DG  I 5 84  ? 255.750 255.763 210.504 1.00 47.31  ? 0   DG  I C6    1 
ATOM 7759  O O6    . DG  I 5 84  ? 255.241 255.639 211.617 1.00 47.31  ? 0   DG  I O6    1 
ATOM 7760  N N1    . DG  I 5 84  ? 254.982 255.574 209.368 1.00 47.31  ? 0   DG  I N1    1 
ATOM 7761  C C2    . DG  I 5 84  ? 255.442 255.685 208.087 1.00 47.31  ? 0   DG  I C2    1 
ATOM 7762  N N2    . DG  I 5 84  ? 254.556 255.471 207.113 1.00 47.31  ? 0   DG  I N2    1 
ATOM 7763  N N3    . DG  I 5 84  ? 256.687 255.987 207.775 1.00 47.31  ? 0   DG  I N3    1 
ATOM 7764  C C4    . DG  I 5 84  ? 257.445 256.173 208.871 1.00 47.31  ? 0   DG  I C4    1 
ATOM 7765  P P     . DC  I 5 85  ? 261.440 259.133 204.737 1.00 47.69  ? 1   DC  I P     1 
ATOM 7766  O OP1   . DC  I 5 85  ? 262.271 258.867 203.546 1.00 47.69  ? 1   DC  I OP1   1 
ATOM 7767  O OP2   . DC  I 5 85  ? 261.873 260.121 205.745 1.00 47.69  ? 1   DC  I OP2   1 
ATOM 7768  O "O5'" . DC  I 5 85  ? 259.973 259.529 204.276 1.00 47.69  ? 1   DC  I "O5'" 1 
ATOM 7769  C "C5'" . DC  I 5 85  ? 259.048 258.504 203.989 1.00 47.69  ? 1   DC  I "C5'" 1 
ATOM 7770  C "C4'" . DC  I 5 85  ? 257.639 259.043 204.000 1.00 47.69  ? 1   DC  I "C4'" 1 
ATOM 7771  O "O4'" . DC  I 5 85  ? 256.990 258.695 205.246 1.00 47.69  ? 1   DC  I "O4'" 1 
ATOM 7772  C "C3'" . DC  I 5 85  ? 257.538 260.558 203.878 1.00 47.69  ? 1   DC  I "C3'" 1 
ATOM 7773  O "O3'" . DC  I 5 85  ? 256.520 260.872 202.971 1.00 47.69  ? 1   DC  I "O3'" 1 
ATOM 7774  C "C2'" . DC  I 5 85  ? 257.181 260.998 205.296 1.00 47.69  ? 1   DC  I "C2'" 1 
ATOM 7775  C "C1'" . DC  I 5 85  ? 256.339 259.829 205.752 1.00 47.69  ? 1   DC  I "C1'" 1 
ATOM 7776  N N1    . DC  I 5 85  ? 256.247 259.690 207.211 1.00 47.69  ? 1   DC  I N1    1 
ATOM 7777  C C2    . DC  I 5 85  ? 255.019 259.399 207.784 1.00 47.69  ? 1   DC  I C2    1 
ATOM 7778  O O2    . DC  I 5 85  ? 254.039 259.278 207.051 1.00 47.69  ? 1   DC  I O2    1 
ATOM 7779  N N3    . DC  I 5 85  ? 254.939 259.263 209.120 1.00 47.69  ? 1   DC  I N3    1 
ATOM 7780  C C4    . DC  I 5 85  ? 256.024 259.407 209.867 1.00 47.69  ? 1   DC  I C4    1 
ATOM 7781  N N4    . DC  I 5 85  ? 255.896 259.260 211.183 1.00 47.69  ? 1   DC  I N4    1 
ATOM 7782  C C5    . DC  I 5 85  ? 257.292 259.700 209.300 1.00 47.69  ? 1   DC  I C5    1 
ATOM 7783  C C6    . DC  I 5 85  ? 257.358 259.827 207.978 1.00 47.69  ? 1   DC  I C6    1 
ATOM 7784  P P     . DG  I 5 86  ? 256.442 262.323 202.299 1.00 46.40  ? 2   DG  I P     1 
ATOM 7785  O OP1   . DG  I 5 86  ? 256.729 262.150 200.863 1.00 46.40  ? 2   DG  I OP1   1 
ATOM 7786  O OP2   . DG  I 5 86  ? 257.243 263.275 203.097 1.00 46.40  ? 2   DG  I OP2   1 
ATOM 7787  O "O5'" . DG  I 5 86  ? 254.904 262.691 202.460 1.00 46.40  ? 2   DG  I "O5'" 1 
ATOM 7788  C "C5'" . DG  I 5 86  ? 253.938 261.664 202.347 1.00 46.40  ? 2   DG  I "C5'" 1 
ATOM 7789  C "C4'" . DG  I 5 86  ? 252.651 262.052 203.044 1.00 46.40  ? 2   DG  I "C4'" 1 
ATOM 7790  O "O4'" . DG  I 5 86  ? 252.735 261.722 204.454 1.00 46.40  ? 2   DG  I "O4'" 1 
ATOM 7791  C "C3'" . DG  I 5 86  ? 252.314 263.533 202.988 1.00 46.40  ? 2   DG  I "C3'" 1 
ATOM 7792  O "O3'" . DG  I 5 86  ? 250.924 263.685 202.905 1.00 46.40  ? 2   DG  I "O3'" 1 
ATOM 7793  C "C2'" . DG  I 5 86  ? 252.841 264.041 204.322 1.00 46.40  ? 2   DG  I "C2'" 1 
ATOM 7794  C "C1'" . DG  I 5 86  ? 252.482 262.876 205.219 1.00 46.40  ? 2   DG  I "C1'" 1 
ATOM 7795  N N9    . DG  I 5 86  ? 253.281 262.802 206.428 1.00 46.40  ? 2   DG  I N9    1 
ATOM 7796  C C8    . DG  I 5 86  ? 254.626 263.027 206.548 1.00 46.40  ? 2   DG  I C8    1 
ATOM 7797  N N7    . DG  I 5 86  ? 255.065 262.880 207.760 1.00 46.40  ? 2   DG  I N7    1 
ATOM 7798  C C5    . DG  I 5 86  ? 253.938 262.528 208.482 1.00 46.40  ? 2   DG  I C5    1 
ATOM 7799  C C6    . DG  I 5 86  ? 253.793 262.234 209.847 1.00 46.40  ? 2   DG  I C6    1 
ATOM 7800  O O6    . DG  I 5 86  ? 254.660 262.227 210.720 1.00 46.40  ? 2   DG  I O6    1 
ATOM 7801  N N1    . DG  I 5 86  ? 252.485 261.919 210.166 1.00 46.40  ? 2   DG  I N1    1 
ATOM 7802  C C2    . DG  I 5 86  ? 251.449 261.895 209.280 1.00 46.40  ? 2   DG  I C2    1 
ATOM 7803  N N2    . DG  I 5 86  ? 250.251 261.584 209.766 1.00 46.40  ? 2   DG  I N2    1 
ATOM 7804  N N3    . DG  I 5 86  ? 251.572 262.170 208.001 1.00 46.40  ? 2   DG  I N3    1 
ATOM 7805  C C4    . DG  I 5 86  ? 252.838 262.476 207.674 1.00 46.40  ? 2   DG  I C4    1 
ATOM 7806  P P     . DC  I 5 87  ? 250.299 264.978 202.199 1.00 46.08  ? 3   DC  I P     1 
ATOM 7807  O OP1   . DC  I 5 87  ? 249.867 264.569 200.850 1.00 46.08  ? 3   DC  I OP1   1 
ATOM 7808  O OP2   . DC  I 5 87  ? 251.261 266.087 202.368 1.00 46.08  ? 3   DC  I OP2   1 
ATOM 7809  O "O5'" . DC  I 5 87  ? 249.017 265.300 203.087 1.00 46.08  ? 3   DC  I "O5'" 1 
ATOM 7810  C "C5'" . DC  I 5 87  ? 248.385 264.260 203.815 1.00 46.08  ? 3   DC  I "C5'" 1 
ATOM 7811  C "C4'" . DC  I 5 87  ? 247.815 264.792 205.112 1.00 46.08  ? 3   DC  I "C4'" 1 
ATOM 7812  O "O4'" . DC  I 5 87  ? 248.761 264.572 206.193 1.00 46.08  ? 3   DC  I "O4'" 1 
ATOM 7813  C "C3'" . DC  I 5 87  ? 247.539 266.294 205.119 1.00 46.08  ? 3   DC  I "C3'" 1 
ATOM 7814  O "O3'" . DC  I 5 87  ? 246.425 266.549 205.927 1.00 46.08  ? 3   DC  I "O3'" 1 
ATOM 7815  C "C2'" . DC  I 5 87  ? 248.797 266.835 205.777 1.00 46.08  ? 3   DC  I "C2'" 1 
ATOM 7816  C "C1'" . DC  I 5 87  ? 248.963 265.794 206.856 1.00 46.08  ? 3   DC  I "C1'" 1 
ATOM 7817  N N1    . DC  I 5 87  ? 250.286 265.785 207.499 1.00 46.08  ? 3   DC  I N1    1 
ATOM 7818  C C2    . DC  I 5 87  ? 250.374 265.469 208.847 1.00 46.08  ? 3   DC  I C2    1 
ATOM 7819  O O2    . DC  I 5 87  ? 249.340 265.194 209.459 1.00 46.08  ? 3   DC  I O2    1 
ATOM 7820  N N3    . DC  I 5 87  ? 251.582 265.459 209.439 1.00 46.08  ? 3   DC  I N3    1 
ATOM 7821  C C4    . DC  I 5 87  ? 252.665 265.759 208.733 1.00 46.08  ? 3   DC  I C4    1 
ATOM 7822  N N4    . DC  I 5 87  ? 253.840 265.742 209.358 1.00 46.08  ? 3   DC  I N4    1 
ATOM 7823  C C5    . DC  I 5 87  ? 252.595 266.084 207.354 1.00 46.08  ? 3   DC  I C5    1 
ATOM 7824  C C6    . DC  I 5 87  ? 251.394 266.089 206.783 1.00 46.08  ? 3   DC  I C6    1 
ATOM 7825  P P     . DG  I 5 88  ? 245.052 267.081 205.296 1.00 45.58  ? 4   DG  I P     1 
ATOM 7826  O OP1   . DG  I 5 88  ? 244.347 265.930 204.700 1.00 45.58  ? 4   DG  I OP1   1 
ATOM 7827  O OP2   . DG  I 5 88  ? 245.360 268.271 204.481 1.00 45.58  ? 4   DG  I OP2   1 
ATOM 7828  O "O5'" . DG  I 5 88  ? 244.226 267.546 206.576 1.00 45.58  ? 4   DG  I "O5'" 1 
ATOM 7829  C "C5'" . DG  I 5 88  ? 244.064 266.654 207.665 1.00 45.58  ? 4   DG  I "C5'" 1 
ATOM 7830  C "C4'" . DG  I 5 88  ? 244.358 267.342 208.984 1.00 45.58  ? 4   DG  I "C4'" 1 
ATOM 7831  O "O4'" . DG  I 5 88  ? 245.789 267.347 209.236 1.00 45.58  ? 4   DG  I "O4'" 1 
ATOM 7832  C "C3'" . DG  I 5 88  ? 243.931 268.808 209.072 1.00 45.58  ? 4   DG  I "C3'" 1 
ATOM 7833  O "O3'" . DG  I 5 88  ? 243.538 269.083 210.389 1.00 45.58  ? 4   DG  I "O3'" 1 
ATOM 7834  C "C2'" . DG  I 5 88  ? 245.237 269.523 208.768 1.00 45.58  ? 4   DG  I "C2'" 1 
ATOM 7835  C "C1'" . DG  I 5 88  ? 246.161 268.654 209.582 1.00 45.58  ? 4   DG  I "C1'" 1 
ATOM 7836  N N9    . DG  I 5 88  ? 247.574 268.842 209.310 1.00 45.58  ? 4   DG  I N9    1 
ATOM 7837  C C8    . DG  I 5 88  ? 248.152 269.240 208.137 1.00 45.58  ? 4   DG  I C8    1 
ATOM 7838  N N7    . DG  I 5 88  ? 249.448 269.318 208.203 1.00 45.58  ? 4   DG  I N7    1 
ATOM 7839  C C5    . DG  I 5 88  ? 249.741 268.958 209.506 1.00 45.58  ? 4   DG  I C5    1 
ATOM 7840  C C6    . DG  I 5 88  ? 250.977 268.857 210.160 1.00 45.58  ? 4   DG  I C6    1 
ATOM 7841  O O6    . DG  I 5 88  ? 252.101 269.078 209.708 1.00 45.58  ? 4   DG  I O6    1 
ATOM 7842  N N1    . DG  I 5 88  ? 250.828 268.450 211.478 1.00 45.58  ? 4   DG  I N1    1 
ATOM 7843  C C2    . DG  I 5 88  ? 249.633 268.181 212.086 1.00 45.58  ? 4   DG  I C2    1 
ATOM 7844  N N2    . DG  I 5 88  ? 249.685 267.810 213.369 1.00 45.58  ? 4   DG  I N2    1 
ATOM 7845  N N3    . DG  I 5 88  ? 248.466 268.267 211.480 1.00 45.58  ? 4   DG  I N3    1 
ATOM 7846  C C4    . DG  I 5 88  ? 248.597 268.660 210.196 1.00 45.58  ? 4   DG  I C4    1 
ATOM 7847  P P     . DT  I 5 89  ? 242.007 269.358 210.763 1.00 46.56  ? 5   DT  I P     1 
ATOM 7848  O OP1   . DT  I 5 89  ? 241.188 268.253 210.225 1.00 46.56  ? 5   DT  I OP1   1 
ATOM 7849  O OP2   . DT  I 5 89  ? 241.714 270.750 210.376 1.00 46.56  ? 5   DT  I OP2   1 
ATOM 7850  O "O5'" . DT  I 5 89  ? 242.010 269.280 212.358 1.00 46.56  ? 5   DT  I "O5'" 1 
ATOM 7851  C "C5'" . DT  I 5 89  ? 242.890 268.373 213.019 1.00 46.56  ? 5   DT  I "C5'" 1 
ATOM 7852  C "C4'" . DT  I 5 89  ? 243.678 269.071 214.115 1.00 46.56  ? 5   DT  I "C4'" 1 
ATOM 7853  O "O4'" . DT  I 5 89  ? 244.995 269.429 213.624 1.00 46.56  ? 5   DT  I "O4'" 1 
ATOM 7854  C "C3'" . DT  I 5 89  ? 243.068 270.372 214.631 1.00 46.56  ? 5   DT  I "C3'" 1 
ATOM 7855  O "O3'" . DT  I 5 89  ? 243.377 270.525 216.015 1.00 46.56  ? 5   DT  I "O3'" 1 
ATOM 7856  C "C2'" . DT  I 5 89  ? 243.811 271.405 213.795 1.00 46.56  ? 5   DT  I "C2'" 1 
ATOM 7857  C "C1'" . DT  I 5 89  ? 245.199 270.803 213.845 1.00 46.56  ? 5   DT  I "C1'" 1 
ATOM 7858  N N1    . DT  I 5 89  ? 246.138 271.309 212.827 1.00 46.56  ? 5   DT  I N1    1 
ATOM 7859  C C2    . DT  I 5 89  ? 247.477 271.218 213.070 1.00 46.56  ? 5   DT  I C2    1 
ATOM 7860  O O2    . DT  I 5 89  ? 247.934 270.746 214.087 1.00 46.56  ? 5   DT  I O2    1 
ATOM 7861  N N3    . DT  I 5 89  ? 248.271 271.693 212.077 1.00 46.56  ? 5   DT  I N3    1 
ATOM 7862  C C4    . DT  I 5 89  ? 247.869 272.244 210.887 1.00 46.56  ? 5   DT  I C4    1 
ATOM 7863  O O4    . DT  I 5 89  ? 248.663 272.645 210.053 1.00 46.56  ? 5   DT  I O4    1 
ATOM 7864  C C5    . DT  I 5 89  ? 246.450 272.311 210.689 1.00 46.56  ? 5   DT  I C5    1 
ATOM 7865  C C7    . DT  I 5 89  ? 245.899 272.892 209.425 1.00 46.56  ? 5   DT  I C7    1 
ATOM 7866  C C6    . DT  I 5 89  ? 245.657 271.843 211.660 1.00 46.56  ? 5   DT  I C6    1 
ATOM 7867  P P     . DA  I 5 90  ? 242.507 269.793 217.152 1.00 44.73  ? 6   DA  I P     1 
ATOM 7868  O OP1   . DA  I 5 90  ? 242.223 268.400 216.755 1.00 44.73  ? 6   DA  I OP1   1 
ATOM 7869  O OP2   . DA  I 5 90  ? 241.407 270.713 217.496 1.00 44.73  ? 6   DA  I OP2   1 
ATOM 7870  O "O5'" . DA  I 5 90  ? 243.489 269.732 218.408 1.00 44.73  ? 6   DA  I "O5'" 1 
ATOM 7871  C "C5'" . DA  I 5 90  ? 244.817 269.263 218.251 1.00 44.73  ? 6   DA  I "C5'" 1 
ATOM 7872  C "C4'" . DA  I 5 90  ? 245.812 270.193 218.922 1.00 44.73  ? 6   DA  I "C4'" 1 
ATOM 7873  O "O4'" . DA  I 5 90  ? 246.470 271.018 217.930 1.00 44.73  ? 6   DA  I "O4'" 1 
ATOM 7874  C "C3'" . DA  I 5 90  ? 245.228 271.185 219.911 1.00 44.73  ? 6   DA  I "C3'" 1 
ATOM 7875  O "O3'" . DA  I 5 90  ? 246.247 271.576 220.772 1.00 44.73  ? 6   DA  I "O3'" 1 
ATOM 7876  C "C2'" . DA  I 5 90  ? 244.891 272.338 218.993 1.00 44.73  ? 6   DA  I "C2'" 1 
ATOM 7877  C "C1'" . DA  I 5 90  ? 246.173 272.373 218.194 1.00 44.73  ? 6   DA  I "C1'" 1 
ATOM 7878  N N9    . DA  I 5 90  ? 246.069 273.067 216.931 1.00 44.73  ? 6   DA  I N9    1 
ATOM 7879  C C8    . DA  I 5 90  ? 244.932 273.416 216.273 1.00 44.73  ? 6   DA  I C8    1 
ATOM 7880  N N7    . DA  I 5 90  ? 245.150 274.019 215.140 1.00 44.73  ? 6   DA  I N7    1 
ATOM 7881  C C5    . DA  I 5 90  ? 246.520 274.064 215.051 1.00 44.73  ? 6   DA  I C5    1 
ATOM 7882  C C6    . DA  I 5 90  ? 247.377 274.575 214.082 1.00 44.73  ? 6   DA  I C6    1 
ATOM 7883  N N6    . DA  I 5 90  ? 246.948 275.167 212.973 1.00 44.73  ? 6   DA  I N6    1 
ATOM 7884  N N1    . DA  I 5 90  ? 248.699 274.466 214.297 1.00 44.73  ? 6   DA  I N1    1 
ATOM 7885  C C2    . DA  I 5 90  ? 249.119 273.868 215.408 1.00 44.73  ? 6   DA  I C2    1 
ATOM 7886  N N3    . DA  I 5 90  ? 248.402 273.347 216.390 1.00 44.73  ? 6   DA  I N3    1 
ATOM 7887  C C4    . DA  I 5 90  ? 247.100 273.480 216.146 1.00 44.73  ? 6   DA  I C4    1 
ATOM 7888  P P     . DC  I 5 91  ? 246.147 271.358 222.350 1.00 41.75  ? 7   DC  I P     1 
ATOM 7889  O OP1   . DC  I 5 91  ? 246.039 269.908 222.600 1.00 41.75  ? 7   DC  I OP1   1 
ATOM 7890  O OP2   . DC  I 5 91  ? 245.140 272.305 222.860 1.00 41.75  ? 7   DC  I OP2   1 
ATOM 7891  O "O5'" . DC  I 5 91  ? 247.580 271.838 222.845 1.00 41.75  ? 7   DC  I "O5'" 1 
ATOM 7892  C "C5'" . DC  I 5 91  ? 248.731 271.324 222.220 1.00 41.75  ? 7   DC  I "C5'" 1 
ATOM 7893  C "C4'" . DC  I 5 91  ? 249.736 272.420 221.951 1.00 41.75  ? 7   DC  I "C4'" 1 
ATOM 7894  O "O4'" . DC  I 5 91  ? 249.413 273.098 220.713 1.00 41.75  ? 7   DC  I "O4'" 1 
ATOM 7895  C "C3'" . DC  I 5 91  ? 249.815 273.498 223.019 1.00 41.75  ? 7   DC  I "C3'" 1 
ATOM 7896  O "O3'" . DC  I 5 91  ? 251.159 273.783 223.268 1.00 41.75  ? 7   DC  I "O3'" 1 
ATOM 7897  C "C2'" . DC  I 5 91  ? 249.100 274.678 222.369 1.00 41.75  ? 7   DC  I "C2'" 1 
ATOM 7898  C "C1'" . DC  I 5 91  ? 249.459 274.485 220.915 1.00 41.75  ? 7   DC  I "C1'" 1 
ATOM 7899  N N1    . DC  I 5 91  ? 248.500 275.108 219.982 1.00 41.75  ? 7   DC  I N1    1 
ATOM 7900  C C2    . DC  I 5 91  ? 248.962 275.764 218.843 1.00 41.75  ? 7   DC  I C2    1 
ATOM 7901  O O2    . DC  I 5 91  ? 250.171 275.834 218.636 1.00 41.75  ? 7   DC  I O2    1 
ATOM 7902  N N3    . DC  I 5 91  ? 248.065 276.319 218.006 1.00 41.75  ? 7   DC  I N3    1 
ATOM 7903  C C4    . DC  I 5 91  ? 246.770 276.227 218.263 1.00 41.75  ? 7   DC  I C4    1 
ATOM 7904  N N4    . DC  I 5 91  ? 245.921 276.780 217.405 1.00 41.75  ? 7   DC  I N4    1 
ATOM 7905  C C5    . DC  I 5 91  ? 246.281 275.561 219.413 1.00 41.75  ? 7   DC  I C5    1 
ATOM 7906  C C6    . DC  I 5 91  ? 247.174 275.019 220.236 1.00 41.75  ? 7   DC  I C6    1 
ATOM 7907  P P     . DG  I 5 92  ? 251.605 274.660 224.526 1.00 41.78  ? 8   DG  I P     1 
ATOM 7908  O OP1   . DG  I 5 92  ? 252.280 273.777 225.484 1.00 41.78  ? 8   DG  I OP1   1 
ATOM 7909  O OP2   . DG  I 5 92  ? 250.487 275.504 224.960 1.00 41.78  ? 8   DG  I OP2   1 
ATOM 7910  O "O5'" . DG  I 5 92  ? 252.697 275.617 223.900 1.00 41.78  ? 8   DG  I "O5'" 1 
ATOM 7911  C "C5'" . DG  I 5 92  ? 253.488 275.160 222.827 1.00 41.78  ? 8   DG  I "C5'" 1 
ATOM 7912  C "C4'" . DG  I 5 92  ? 254.208 276.309 222.157 1.00 41.78  ? 8   DG  I "C4'" 1 
ATOM 7913  O "O4'" . DG  I 5 92  ? 253.370 276.871 221.126 1.00 41.78  ? 8   DG  I "O4'" 1 
ATOM 7914  C "C3'" . DG  I 5 92  ? 254.569 277.464 223.067 1.00 41.78  ? 8   DG  I "C3'" 1 
ATOM 7915  O "O3'" . DG  I 5 92  ? 255.763 278.051 222.625 1.00 41.78  ? 8   DG  I "O3'" 1 
ATOM 7916  C "C2'" . DG  I 5 92  ? 253.384 278.406 222.907 1.00 41.78  ? 8   DG  I "C2'" 1 
ATOM 7917  C "C1'" . DG  I 5 92  ? 253.000 278.189 221.457 1.00 41.78  ? 8   DG  I "C1'" 1 
ATOM 7918  N N9    . DG  I 5 92  ? 251.578 278.313 221.198 1.00 41.78  ? 8   DG  I N9    1 
ATOM 7919  C C8    . DG  I 5 92  ? 250.553 277.770 221.919 1.00 41.78  ? 8   DG  I C8    1 
ATOM 7920  N N7    . DG  I 5 92  ? 249.383 278.030 221.426 1.00 41.78  ? 8   DG  I N7    1 
ATOM 7921  C C5    . DG  I 5 92  ? 249.655 278.780 220.298 1.00 41.78  ? 8   DG  I C5    1 
ATOM 7922  C C6    . DG  I 5 92  ? 248.784 279.343 219.352 1.00 41.78  ? 8   DG  I C6    1 
ATOM 7923  O O6    . DG  I 5 92  ? 247.555 279.294 219.319 1.00 41.78  ? 8   DG  I O6    1 
ATOM 7924  N N1    . DG  I 5 92  ? 249.475 280.021 218.360 1.00 41.78  ? 8   DG  I N1    1 
ATOM 7925  C C2    . DG  I 5 92  ? 250.834 280.137 218.297 1.00 41.78  ? 8   DG  I C2    1 
ATOM 7926  N N2    . DG  I 5 92  ? 251.335 280.837 217.274 1.00 41.78  ? 8   DG  I N2    1 
ATOM 7927  N N3    . DG  I 5 92  ? 251.656 279.615 219.180 1.00 41.78  ? 8   DG  I N3    1 
ATOM 7928  C C4    . DG  I 5 92  ? 251.001 278.949 220.143 1.00 41.78  ? 8   DG  I C4    1 
ATOM 7929  P P     . DT  I 5 93  ? 256.520 279.121 223.540 1.00 44.01  ? 9   DT  I P     1 
ATOM 7930  O OP1   . DT  I 5 93  ? 257.947 278.780 223.548 1.00 44.01  ? 9   DT  I OP1   1 
ATOM 7931  O OP2   . DT  I 5 93  ? 255.798 279.222 224.818 1.00 44.01  ? 9   DT  I OP2   1 
ATOM 7932  O "O5'" . DT  I 5 93  ? 256.342 280.482 222.738 1.00 44.01  ? 9   DT  I "O5'" 1 
ATOM 7933  C "C5'" . DT  I 5 93  ? 256.518 280.494 221.335 1.00 44.01  ? 9   DT  I "C5'" 1 
ATOM 7934  C "C4'" . DT  I 5 93  ? 256.125 281.833 220.734 1.00 44.01  ? 9   DT  I "C4'" 1 
ATOM 7935  O "O4'" . DT  I 5 93  ? 254.719 281.843 220.392 1.00 44.01  ? 9   DT  I "O4'" 1 
ATOM 7936  C "C3'" . DT  I 5 93  ? 256.349 283.041 221.624 1.00 44.01  ? 9   DT  I "C3'" 1 
ATOM 7937  O "O3'" . DT  I 5 93  ? 256.919 284.063 220.850 1.00 44.01  ? 9   DT  I "O3'" 1 
ATOM 7938  C "C2'" . DT  I 5 93  ? 254.937 283.402 222.087 1.00 44.01  ? 9   DT  I "C2'" 1 
ATOM 7939  C "C1'" . DT  I 5 93  ? 254.117 283.019 220.876 1.00 44.01  ? 9   DT  I "C1'" 1 
ATOM 7940  N N1    . DT  I 5 93  ? 252.702 282.690 221.177 1.00 44.01  ? 9   DT  I N1    1 
ATOM 7941  C C2    . DT  I 5 93  ? 251.703 283.116 220.333 1.00 44.01  ? 9   DT  I C2    1 
ATOM 7942  O O2    . DT  I 5 93  ? 251.901 283.801 219.356 1.00 44.01  ? 9   DT  I O2    1 
ATOM 7943  N N3    . DT  I 5 93  ? 250.453 282.726 220.695 1.00 44.01  ? 9   DT  I N3    1 
ATOM 7944  C C4    . DT  I 5 93  ? 250.103 281.960 221.768 1.00 44.01  ? 9   DT  I C4    1 
ATOM 7945  O O4    . DT  I 5 93  ? 248.947 281.664 222.012 1.00 44.01  ? 9   DT  I O4    1 
ATOM 7946  C C5    . DT  I 5 93  ? 251.191 281.539 222.602 1.00 44.01  ? 9   DT  I C5    1 
ATOM 7947  C C7    . DT  I 5 93  ? 250.925 280.699 223.807 1.00 44.01  ? 9   DT  I C7    1 
ATOM 7948  C C6    . DT  I 5 93  ? 252.423 281.913 222.265 1.00 44.01  ? 9   DT  I C6    1 
ATOM 7949  P P     . DG  I 5 94  ? 257.580 285.346 221.540 1.00 44.61  ? 10  DG  I P     1 
ATOM 7950  O OP1   . DG  I 5 94  ? 258.783 285.682 220.766 1.00 44.61  ? 10  DG  I OP1   1 
ATOM 7951  O OP2   . DG  I 5 94  ? 257.655 285.140 222.995 1.00 44.61  ? 10  DG  I OP2   1 
ATOM 7952  O "O5'" . DG  I 5 94  ? 256.528 286.488 221.252 1.00 44.61  ? 10  DG  I "O5'" 1 
ATOM 7953  C "C5'" . DG  I 5 94  ? 256.212 286.800 219.921 1.00 44.61  ? 10  DG  I "C5'" 1 
ATOM 7954  C "C4'" . DG  I 5 94  ? 254.966 287.643 219.853 1.00 44.61  ? 10  DG  I "C4'" 1 
ATOM 7955  O "O4'" . DG  I 5 94  ? 253.808 286.834 220.172 1.00 44.61  ? 10  DG  I "O4'" 1 
ATOM 7956  C "C3'" . DG  I 5 94  ? 254.931 288.824 220.823 1.00 44.61  ? 10  DG  I "C3'" 1 
ATOM 7957  O "O3'" . DG  I 5 94  ? 254.407 289.939 220.153 1.00 44.61  ? 10  DG  I "O3'" 1 
ATOM 7958  C "C2'" . DG  I 5 94  ? 253.969 288.341 221.897 1.00 44.61  ? 10  DG  I "C2'" 1 
ATOM 7959  C "C1'" . DG  I 5 94  ? 252.997 287.566 221.045 1.00 44.61  ? 10  DG  I "C1'" 1 
ATOM 7960  N N9    . DG  I 5 94  ? 252.148 286.657 221.792 1.00 44.61  ? 10  DG  I N9    1 
ATOM 7961  C C8    . DG  I 5 94  ? 252.511 285.830 222.816 1.00 44.61  ? 10  DG  I C8    1 
ATOM 7962  N N7    . DG  I 5 94  ? 251.521 285.140 223.297 1.00 44.61  ? 10  DG  I N7    1 
ATOM 7963  C C5    . DG  I 5 94  ? 250.439 285.543 222.543 1.00 44.61  ? 10  DG  I C5    1 
ATOM 7964  C C6    . DG  I 5 94  ? 249.097 285.140 222.600 1.00 44.61  ? 10  DG  I C6    1 
ATOM 7965  O O6    . DG  I 5 94  ? 248.581 284.319 223.360 1.00 44.61  ? 10  DG  I O6    1 
ATOM 7966  N N1    . DG  I 5 94  ? 248.321 285.802 221.658 1.00 44.61  ? 10  DG  I N1    1 
ATOM 7967  C C2    . DG  I 5 94  ? 248.790 286.728 220.771 1.00 44.61  ? 10  DG  I C2    1 
ATOM 7968  N N2    . DG  I 5 94  ? 247.901 287.262 219.934 1.00 44.61  ? 10  DG  I N2    1 
ATOM 7969  N N3    . DG  I 5 94  ? 250.047 287.113 220.708 1.00 44.61  ? 10  DG  I N3    1 
ATOM 7970  C C4    . DG  I 5 94  ? 250.811 286.476 221.616 1.00 44.61  ? 10  DG  I C4    1 
ATOM 7971  P P     . DC  I 5 95  ? 254.739 291.429 220.637 1.00 45.28  ? 11  DC  I P     1 
ATOM 7972  O OP1   . DC  I 5 95  ? 255.989 291.824 219.964 1.00 45.28  ? 11  DC  I OP1   1 
ATOM 7973  O OP2   . DC  I 5 95  ? 254.641 291.499 222.107 1.00 45.28  ? 11  DC  I OP2   1 
ATOM 7974  O "O5'" . DC  I 5 95  ? 253.531 292.267 220.033 1.00 45.28  ? 11  DC  I "O5'" 1 
ATOM 7975  C "C5'" . DC  I 5 95  ? 252.537 291.599 219.282 1.00 45.28  ? 11  DC  I "C5'" 1 
ATOM 7976  C "C4'" . DC  I 5 95  ? 251.162 292.117 219.635 1.00 45.28  ? 11  DC  I "C4'" 1 
ATOM 7977  O "O4'" . DC  I 5 95  ? 250.385 291.068 220.269 1.00 45.28  ? 11  DC  I "O4'" 1 
ATOM 7978  C "C3'" . DC  I 5 95  ? 251.151 293.298 220.596 1.00 45.28  ? 11  DC  I "C3'" 1 
ATOM 7979  O "O3'" . DC  I 5 95  ? 250.207 294.250 220.151 1.00 45.28  ? 11  DC  I "O3'" 1 
ATOM 7980  C "C2'" . DC  I 5 95  ? 250.733 292.664 221.920 1.00 45.28  ? 11  DC  I "C2'" 1 
ATOM 7981  C "C1'" . DC  I 5 95  ? 249.807 291.560 221.451 1.00 45.28  ? 11  DC  I "C1'" 1 
ATOM 7982  N N1    . DC  I 5 95  ? 249.695 290.440 222.416 1.00 45.28  ? 11  DC  I N1    1 
ATOM 7983  C C2    . DC  I 5 95  ? 248.454 289.860 222.666 1.00 45.28  ? 11  DC  I C2    1 
ATOM 7984  O O2    . DC  I 5 95  ? 247.468 290.293 222.080 1.00 45.28  ? 11  DC  I O2    1 
ATOM 7985  N N3    . DC  I 5 95  ? 248.373 288.846 223.552 1.00 45.28  ? 11  DC  I N3    1 
ATOM 7986  C C4    . DC  I 5 95  ? 249.464 288.414 224.163 1.00 45.28  ? 11  DC  I C4    1 
ATOM 7987  N N4    . DC  I 5 95  ? 249.343 287.410 225.026 1.00 45.28  ? 11  DC  I N4    1 
ATOM 7988  C C5    . DC  I 5 95  ? 250.735 288.994 223.921 1.00 45.28  ? 11  DC  I C5    1 
ATOM 7989  C C6    . DC  I 5 95  ? 250.803 289.993 223.049 1.00 45.28  ? 11  DC  I C6    1 
ATOM 7990  P P     . DG  I 5 96  ? 250.198 295.740 220.745 1.00 45.03  ? 12  DG  I P     1 
ATOM 7991  O OP1   . DG  I 5 96  ? 250.418 296.663 219.615 1.00 45.03  ? 12  DG  I OP1   1 
ATOM 7992  O OP2   . DG  I 5 96  ? 251.082 295.791 221.925 1.00 45.03  ? 12  DG  I OP2   1 
ATOM 7993  O "O5'" . DG  I 5 96  ? 248.704 295.920 221.247 1.00 45.03  ? 12  DG  I "O5'" 1 
ATOM 7994  C "C5'" . DG  I 5 96  ? 247.642 295.739 220.341 1.00 45.03  ? 12  DG  I "C5'" 1 
ATOM 7995  C "C4'" . DG  I 5 96  ? 246.351 295.449 221.076 1.00 45.03  ? 12  DG  I "C4'" 1 
ATOM 7996  O "O4'" . DG  I 5 96  ? 246.487 294.213 221.823 1.00 45.03  ? 12  DG  I "O4'" 1 
ATOM 7997  C "C3'" . DG  I 5 96  ? 245.935 296.508 222.094 1.00 45.03  ? 12  DG  I "C3'" 1 
ATOM 7998  O "O3'" . DG  I 5 96  ? 244.527 296.630 222.086 1.00 45.03  ? 12  DG  I "O3'" 1 
ATOM 7999  C "C2'" . DG  I 5 96  ? 246.433 295.916 223.406 1.00 45.03  ? 12  DG  I "C2'" 1 
ATOM 8000  C "C1'" . DG  I 5 96  ? 246.151 294.448 223.168 1.00 45.03  ? 12  DG  I "C1'" 1 
ATOM 8001  N N9    . DG  I 5 96  ? 246.927 293.551 224.007 1.00 45.03  ? 12  DG  I N9    1 
ATOM 8002  C C8    . DG  I 5 96  ? 248.273 293.580 224.239 1.00 45.03  ? 12  DG  I C8    1 
ATOM 8003  N N7    . DG  I 5 96  ? 248.678 292.635 225.032 1.00 45.03  ? 12  DG  I N7    1 
ATOM 8004  C C5    . DG  I 5 96  ? 247.525 291.942 225.344 1.00 45.03  ? 12  DG  I C5    1 
ATOM 8005  C C6    . DG  I 5 96  ? 247.336 290.821 226.165 1.00 45.03  ? 12  DG  I C6    1 
ATOM 8006  O O6    . DG  I 5 96  ? 248.179 290.192 226.807 1.00 45.03  ? 12  DG  I O6    1 
ATOM 8007  N N1    . DG  I 5 96  ? 246.005 290.436 226.208 1.00 45.03  ? 12  DG  I N1    1 
ATOM 8008  C C2    . DG  I 5 96  ? 244.991 291.062 225.542 1.00 45.03  ? 12  DG  I C2    1 
ATOM 8009  N N2    . DG  I 5 96  ? 243.767 290.549 225.695 1.00 45.03  ? 12  DG  I N2    1 
ATOM 8010  N N3    . DG  I 5 96  ? 245.158 292.110 224.766 1.00 45.03  ? 12  DG  I N3    1 
ATOM 8011  C C4    . DG  I 5 96  ? 246.444 292.496 224.720 1.00 45.03  ? 12  DG  I C4    1 
ATOM 8012  P P     . DT  I 5 97  ? 243.800 297.818 222.883 1.00 44.98  ? 13  DT  I P     1 
ATOM 8013  O OP1   . DT  I 5 97  ? 242.912 298.477 221.907 1.00 44.98  ? 13  DT  I OP1   1 
ATOM 8014  O OP2   . DT  I 5 97  ? 244.812 298.611 223.611 1.00 44.98  ? 13  DT  I OP2   1 
ATOM 8015  O "O5'" . DT  I 5 97  ? 242.894 297.050 223.950 1.00 44.98  ? 13  DT  I "O5'" 1 
ATOM 8016  C "C5'" . DT  I 5 97  ? 242.098 295.958 223.527 1.00 44.98  ? 13  DT  I "C5'" 1 
ATOM 8017  C "C4'" . DT  I 5 97  ? 241.420 295.280 224.702 1.00 44.98  ? 13  DT  I "C4'" 1 
ATOM 8018  O "O4'" . DT  I 5 97  ? 242.350 294.387 225.356 1.00 44.98  ? 13  DT  I "O4'" 1 
ATOM 8019  C "C3'" . DT  I 5 97  ? 240.896 296.215 225.787 1.00 44.98  ? 13  DT  I "C3'" 1 
ATOM 8020  O "O3'" . DT  I 5 97  ? 239.621 295.758 226.217 1.00 44.98  ? 13  DT  I "O3'" 1 
ATOM 8021  C "C2'" . DT  I 5 97  ? 241.949 296.088 226.886 1.00 44.98  ? 13  DT  I "C2'" 1 
ATOM 8022  C "C1'" . DT  I 5 97  ? 242.357 294.639 226.737 1.00 44.98  ? 13  DT  I "C1'" 1 
ATOM 8023  N N1    . DT  I 5 97  ? 243.708 294.331 227.239 1.00 44.98  ? 13  DT  I N1    1 
ATOM 8024  C C2    . DT  I 5 97  ? 243.893 293.208 227.993 1.00 44.98  ? 13  DT  I C2    1 
ATOM 8025  O O2    . DT  I 5 97  ? 242.994 292.458 228.296 1.00 44.98  ? 13  DT  I O2    1 
ATOM 8026  N N3    . DT  I 5 97  ? 245.172 292.994 228.393 1.00 44.98  ? 13  DT  I N3    1 
ATOM 8027  C C4    . DT  I 5 97  ? 246.267 293.767 228.113 1.00 44.98  ? 13  DT  I C4    1 
ATOM 8028  O O4    . DT  I 5 97  ? 247.381 293.488 228.525 1.00 44.98  ? 13  DT  I O4    1 
ATOM 8029  C C5    . DT  I 5 97  ? 246.010 294.929 227.309 1.00 44.98  ? 13  DT  I C5    1 
ATOM 8030  C C7    . DT  I 5 97  ? 247.129 295.848 226.941 1.00 44.98  ? 13  DT  I C7    1 
ATOM 8031  C C6    . DT  I 5 97  ? 244.757 295.150 226.908 1.00 44.98  ? 13  DT  I C6    1 
ATOM 8032  P P     . DT  I 5 98  ? 238.753 296.595 227.276 1.00 44.40  ? 14  DT  I P     1 
ATOM 8033  O OP1   . DT  I 5 98  ? 237.418 296.778 226.684 1.00 44.40  ? 14  DT  I OP1   1 
ATOM 8034  O OP2   . DT  I 5 98  ? 239.518 297.775 227.730 1.00 44.40  ? 14  DT  I OP2   1 
ATOM 8035  O "O5'" . DT  I 5 98  ? 238.609 295.587 228.503 1.00 44.40  ? 14  DT  I "O5'" 1 
ATOM 8036  C "C5'" . DT  I 5 98  ? 238.430 294.211 228.243 1.00 44.40  ? 14  DT  I "C5'" 1 
ATOM 8037  C "C4'" . DT  I 5 98  ? 238.653 293.372 229.487 1.00 44.40  ? 14  DT  I "C4'" 1 
ATOM 8038  O "O4'" . DT  I 5 98  ? 240.069 293.237 229.756 1.00 44.40  ? 14  DT  I "O4'" 1 
ATOM 8039  C "C3'" . DT  I 5 98  ? 238.044 293.902 230.775 1.00 44.40  ? 14  DT  I "C3'" 1 
ATOM 8040  O "O3'" . DT  I 5 98  ? 237.670 292.797 231.539 1.00 44.40  ? 14  DT  I "O3'" 1 
ATOM 8041  C "C2'" . DT  I 5 98  ? 239.233 294.621 231.410 1.00 44.40  ? 14  DT  I "C2'" 1 
ATOM 8042  C "C1'" . DT  I 5 98  ? 240.330 293.633 231.080 1.00 44.40  ? 14  DT  I "C1'" 1 
ATOM 8043  N N1    . DT  I 5 98  ? 241.705 294.165 231.116 1.00 44.40  ? 14  DT  I N1    1 
ATOM 8044  C C2    . DT  I 5 98  ? 242.684 293.402 231.681 1.00 44.40  ? 14  DT  I C2    1 
ATOM 8045  O O2    . DT  I 5 98  ? 242.472 292.327 232.182 1.00 44.40  ? 14  DT  I O2    1 
ATOM 8046  N N3    . DT  I 5 98  ? 243.925 293.941 231.643 1.00 44.40  ? 14  DT  I N3    1 
ATOM 8047  C C4    . DT  I 5 98  ? 244.289 295.143 231.095 1.00 44.40  ? 14  DT  I C4    1 
ATOM 8048  O O4    . DT  I 5 98  ? 245.442 295.539 231.110 1.00 44.40  ? 14  DT  I O4    1 
ATOM 8049  C C5    . DT  I 5 98  ? 243.220 295.899 230.508 1.00 44.40  ? 14  DT  I C5    1 
ATOM 8050  C C7    . DT  I 5 98  ? 243.499 297.225 229.885 1.00 44.40  ? 14  DT  I C7    1 
ATOM 8051  C C6    . DT  I 5 98  ? 241.989 295.376 230.539 1.00 44.40  ? 14  DT  I C6    1 
ATOM 8052  P P     . DT  I 5 99  ? 236.423 292.840 232.539 1.00 43.50  ? 15  DT  I P     1 
ATOM 8053  O OP1   . DT  I 5 99  ? 235.247 292.337 231.805 1.00 43.50  ? 15  DT  I OP1   1 
ATOM 8054  O OP2   . DT  I 5 99  ? 236.380 294.165 233.186 1.00 43.50  ? 15  DT  I OP2   1 
ATOM 8055  O "O5'" . DT  I 5 99  ? 236.832 291.753 233.633 1.00 43.50  ? 15  DT  I "O5'" 1 
ATOM 8056  C "C5'" . DT  I 5 99  ? 238.043 291.011 233.470 1.00 43.50  ? 15  DT  I "C5'" 1 
ATOM 8057  C "C4'" . DT  I 5 99  ? 238.740 290.822 234.801 1.00 43.50  ? 15  DT  I "C4'" 1 
ATOM 8058  O "O4'" . DT  I 5 99  ? 240.061 291.417 234.757 1.00 43.50  ? 15  DT  I "O4'" 1 
ATOM 8059  C "C3'" . DT  I 5 99  ? 238.038 291.485 235.978 1.00 43.50  ? 15  DT  I "C3'" 1 
ATOM 8060  O "O3'" . DT  I 5 99  ? 238.270 290.753 237.150 1.00 43.50  ? 15  DT  I "O3'" 1 
ATOM 8061  C "C2'" . DT  I 5 99  ? 238.763 292.816 236.048 1.00 43.50  ? 15  DT  I "C2'" 1 
ATOM 8062  C "C1'" . DT  I 5 99  ? 240.177 292.337 235.810 1.00 43.50  ? 15  DT  I "C1'" 1 
ATOM 8063  N N1    . DT  I 5 99  ? 241.108 293.398 235.409 1.00 43.50  ? 15  DT  I N1    1 
ATOM 8064  C C2    . DT  I 5 99  ? 242.444 293.217 235.621 1.00 43.50  ? 15  DT  I C2    1 
ATOM 8065  O O2    . DT  I 5 99  ? 242.901 292.220 236.123 1.00 43.50  ? 15  DT  I O2    1 
ATOM 8066  N N3    . DT  I 5 99  ? 243.229 294.254 235.231 1.00 43.50  ? 15  DT  I N3    1 
ATOM 8067  C C4    . DT  I 5 99  ? 242.816 295.431 234.652 1.00 43.50  ? 15  DT  I C4    1 
ATOM 8068  O O4    . DT  I 5 99  ? 243.602 296.305 234.323 1.00 43.50  ? 15  DT  I O4    1 
ATOM 8069  C C5    . DT  I 5 99  ? 241.398 295.558 234.459 1.00 43.50  ? 15  DT  I C5    1 
ATOM 8070  C C7    . DT  I 5 99  ? 240.829 296.795 233.844 1.00 43.50  ? 15  DT  I C7    1 
ATOM 8071  C C6    . DT  I 5 99  ? 240.620 294.549 234.849 1.00 43.50  ? 15  DT  I C6    1 
ATOM 8072  P P     . DA  I 5 100 ? 237.656 289.288 237.375 1.00 42.09  ? 16  DA  I P     1 
ATOM 8073  O OP1   . DA  I 5 100 ? 237.176 288.671 236.129 1.00 42.09  ? 16  DA  I OP1   1 
ATOM 8074  O OP2   . DA  I 5 100 ? 236.717 289.403 238.500 1.00 42.09  ? 16  DA  I OP2   1 
ATOM 8075  O "O5'" . DA  I 5 100 ? 238.917 288.468 237.886 1.00 42.09  ? 16  DA  I "O5'" 1 
ATOM 8076  C "C5'" . DA  I 5 100 ? 239.069 288.243 239.249 1.00 42.09  ? 16  DA  I "C5'" 1 
ATOM 8077  C "C4'" . DA  I 5 100 ? 240.295 288.928 239.818 1.00 42.09  ? 16  DA  I "C4'" 1 
ATOM 8078  O "O4'" . DA  I 5 100 ? 240.609 290.156 239.109 1.00 42.09  ? 16  DA  I "O4'" 1 
ATOM 8079  C "C3'" . DA  I 5 100 ? 240.145 289.331 241.285 1.00 42.09  ? 16  DA  I "C3'" 1 
ATOM 8080  O "O3'" . DA  I 5 100 ? 241.269 288.921 241.982 1.00 42.09  ? 16  DA  I "O3'" 1 
ATOM 8081  C "C2'" . DA  I 5 100 ? 240.078 290.848 241.217 1.00 42.09  ? 16  DA  I "C2'" 1 
ATOM 8082  C "C1'" . DA  I 5 100 ? 241.027 291.085 240.077 1.00 42.09  ? 16  DA  I "C1'" 1 
ATOM 8083  N N9    . DA  I 5 100 ? 240.987 292.437 239.540 1.00 42.09  ? 16  DA  I N9    1 
ATOM 8084  C C8    . DA  I 5 100 ? 239.885 293.163 239.220 1.00 42.09  ? 16  DA  I C8    1 
ATOM 8085  N N7    . DA  I 5 100 ? 240.155 294.357 238.763 1.00 42.09  ? 16  DA  I N7    1 
ATOM 8086  C C5    . DA  I 5 100 ? 241.530 294.420 238.800 1.00 42.09  ? 16  DA  I C5    1 
ATOM 8087  C C6    . DA  I 5 100 ? 242.437 295.430 238.455 1.00 42.09  ? 16  DA  I C6    1 
ATOM 8088  N N6    . DA  I 5 100 ? 242.062 296.612 237.975 1.00 42.09  ? 16  DA  I N6    1 
ATOM 8089  N N1    . DA  I 5 100 ? 243.744 295.173 238.604 1.00 42.09  ? 16  DA  I N1    1 
ATOM 8090  C C2    . DA  I 5 100 ? 244.111 293.987 239.084 1.00 42.09  ? 16  DA  I C2    1 
ATOM 8091  N N3    . DA  I 5 100 ? 243.352 292.964 239.451 1.00 42.09  ? 16  DA  I N3    1 
ATOM 8092  C C4    . DA  I 5 100 ? 242.059 293.249 239.283 1.00 42.09  ? 16  DA  I C4    1 
ATOM 8093  P P     . DA  I 5 101 ? 241.280 287.517 242.740 1.00 41.19  ? 17  DA  I P     1 
ATOM 8094  O OP1   . DA  I 5 101 ? 240.765 286.476 241.833 1.00 41.19  ? 17  DA  I OP1   1 
ATOM 8095  O OP2   . DA  I 5 101 ? 240.630 287.743 244.043 1.00 41.19  ? 17  DA  I OP2   1 
ATOM 8096  O "O5'" . DA  I 5 101 ? 242.828 287.260 242.968 1.00 41.19  ? 17  DA  I "O5'" 1 
ATOM 8097  C "C5'" . DA  I 5 101 ? 243.699 287.260 241.863 1.00 41.19  ? 17  DA  I "C5'" 1 
ATOM 8098  C "C4'" . DA  I 5 101 ? 245.019 287.912 242.216 1.00 41.19  ? 17  DA  I "C4'" 1 
ATOM 8099  O "O4'" . DA  I 5 101 ? 244.991 289.316 241.863 1.00 41.19  ? 17  DA  I "O4'" 1 
ATOM 8100  C "C3'" . DA  I 5 101 ? 245.402 287.861 243.680 1.00 41.19  ? 17  DA  I "C3'" 1 
ATOM 8101  O "O3'" . DA  I 5 101 ? 246.804 287.730 243.773 1.00 41.19  ? 17  DA  I "O3'" 1 
ATOM 8102  C "C2'" . DA  I 5 101 ? 244.918 289.216 244.197 1.00 41.19  ? 17  DA  I "C2'" 1 
ATOM 8103  C "C1'" . DA  I 5 101 ? 245.205 290.114 243.007 1.00 41.19  ? 17  DA  I "C1'" 1 
ATOM 8104  N N9    . DA  I 5 101 ? 244.326 291.268 242.885 1.00 41.19  ? 17  DA  I N9    1 
ATOM 8105  C C8    . DA  I 5 101 ? 242.972 291.263 242.911 1.00 41.19  ? 17  DA  I C8    1 
ATOM 8106  N N7    . DA  I 5 101 ? 242.436 292.435 242.740 1.00 41.19  ? 17  DA  I N7    1 
ATOM 8107  C C5    . DA  I 5 101 ? 243.512 293.270 242.573 1.00 41.19  ? 17  DA  I C5    1 
ATOM 8108  C C6    . DA  I 5 101 ? 243.601 294.647 242.340 1.00 41.19  ? 17  DA  I C6    1 
ATOM 8109  N N6    . DA  I 5 101 ? 242.540 295.439 242.239 1.00 41.19  ? 17  DA  I N6    1 
ATOM 8110  N N1    . DA  I 5 101 ? 244.823 295.179 242.215 1.00 41.19  ? 17  DA  I N1    1 
ATOM 8111  C C2    . DA  I 5 101 ? 245.886 294.379 242.317 1.00 41.19  ? 17  DA  I C2    1 
ATOM 8112  N N3    . DA  I 5 101 ? 245.923 293.066 242.533 1.00 41.19  ? 17  DA  I N3    1 
ATOM 8113  C C4    . DA  I 5 101 ? 244.688 292.570 242.652 1.00 41.19  ? 17  DA  I C4    1 
ATOM 8114  P P     . DG  I 5 102 ? 247.500 287.260 245.133 1.00 43.52  ? 18  DG  I P     1 
ATOM 8115  O OP1   . DG  I 5 102 ? 248.460 286.200 244.815 1.00 43.52  ? 18  DG  I OP1   1 
ATOM 8116  O OP2   . DG  I 5 102 ? 246.458 287.022 246.139 1.00 43.52  ? 18  DG  I OP2   1 
ATOM 8117  O "O5'" . DG  I 5 102 ? 248.317 288.538 245.584 1.00 43.52  ? 18  DG  I "O5'" 1 
ATOM 8118  C "C5'" . DG  I 5 102 ? 249.100 289.223 244.644 1.00 43.52  ? 18  DG  I "C5'" 1 
ATOM 8119  C "C4'" . DG  I 5 102 ? 249.426 290.611 245.137 1.00 43.52  ? 18  DG  I "C4'" 1 
ATOM 8120  O "O4'" . DG  I 5 102 ? 248.323 291.500 244.865 1.00 43.52  ? 18  DG  I "O4'" 1 
ATOM 8121  C "C3'" . DG  I 5 102 ? 249.708 290.715 246.631 1.00 43.52  ? 18  DG  I "C3'" 1 
ATOM 8122  O "O3'" . DG  I 5 102 ? 250.897 291.432 246.814 1.00 43.52  ? 18  DG  I "O3'" 1 
ATOM 8123  C "C2'" . DG  I 5 102 ? 248.493 291.475 247.175 1.00 43.52  ? 18  DG  I "C2'" 1 
ATOM 8124  C "C1'" . DG  I 5 102 ? 248.094 292.312 245.982 1.00 43.52  ? 18  DG  I "C1'" 1 
ATOM 8125  N N9    . DG  I 5 102 ? 246.696 292.695 245.961 1.00 43.52  ? 18  DG  I N9    1 
ATOM 8126  C C8    . DG  I 5 102 ? 245.612 291.877 246.078 1.00 43.52  ? 18  DG  I C8    1 
ATOM 8127  N N7    . DG  I 5 102 ? 244.479 292.503 245.989 1.00 43.52  ? 18  DG  I N7    1 
ATOM 8128  C C5    . DG  I 5 102 ? 244.840 293.818 245.803 1.00 43.52  ? 18  DG  I C5    1 
ATOM 8129  C C6    . DG  I 5 102 ? 244.042 294.957 245.637 1.00 43.52  ? 18  DG  I C6    1 
ATOM 8130  O O6    . DG  I 5 102 ? 242.814 295.036 245.630 1.00 43.52  ? 18  DG  I O6    1 
ATOM 8131  N N1    . DG  I 5 102 ? 244.809 296.096 245.464 1.00 43.52  ? 18  DG  I N1    1 
ATOM 8132  C C2    . DG  I 5 102 ? 246.176 296.124 245.452 1.00 43.52  ? 18  DG  I C2    1 
ATOM 8133  N N2    . DG  I 5 102 ? 246.751 297.316 245.277 1.00 43.52  ? 18  DG  I N2    1 
ATOM 8134  N N3    . DG  I 5 102 ? 246.933 295.060 245.605 1.00 43.52  ? 18  DG  I N3    1 
ATOM 8135  C C4    . DG  I 5 102 ? 246.201 293.949 245.776 1.00 43.52  ? 18  DG  I C4    1 
ATOM 8136  P P     . DC  I 5 103 ? 251.632 291.476 248.237 1.00 47.80  ? 19  DC  I P     1 
ATOM 8137  O OP1   . DC  I 5 103 ? 252.944 290.834 248.054 1.00 47.80  ? 19  DC  I OP1   1 
ATOM 8138  O OP2   . DC  I 5 103 ? 250.723 290.976 249.285 1.00 47.80  ? 19  DC  I OP2   1 
ATOM 8139  O "O5'" . DC  I 5 103 ? 251.839 293.035 248.468 1.00 47.80  ? 19  DC  I "O5'" 1 
ATOM 8140  C "C5'" . DC  I 5 103 ? 251.274 293.942 247.545 1.00 47.80  ? 19  DC  I "C5'" 1 
ATOM 8141  C "C4'" . DC  I 5 103 ? 250.931 295.249 248.216 1.00 47.80  ? 19  DC  I "C4'" 1 
ATOM 8142  O "O4'" . DC  I 5 103 ? 249.530 295.546 248.008 1.00 47.80  ? 19  DC  I "O4'" 1 
ATOM 8143  C "C3'" . DC  I 5 103 ? 251.144 295.264 249.724 1.00 47.80  ? 19  DC  I "C3'" 1 
ATOM 8144  O "O3'" . DC  I 5 103 ? 251.638 296.520 250.116 1.00 47.80  ? 19  DC  I "O3'" 1 
ATOM 8145  C "C2'" . DC  I 5 103 ? 249.741 295.031 250.258 1.00 47.80  ? 19  DC  I "C2'" 1 
ATOM 8146  C "C1'" . DC  I 5 103 ? 248.924 295.802 249.247 1.00 47.80  ? 19  DC  I "C1'" 1 
ATOM 8147  N N1    . DC  I 5 103 ? 247.511 295.385 249.181 1.00 47.80  ? 19  DC  I N1    1 
ATOM 8148  C C2    . DC  I 5 103 ? 246.525 296.353 249.089 1.00 47.80  ? 19  DC  I C2    1 
ATOM 8149  O O2    . DC  I 5 103 ? 246.859 297.531 249.057 1.00 47.80  ? 19  DC  I O2    1 
ATOM 8150  N N3    . DC  I 5 103 ? 245.232 295.971 249.039 1.00 47.80  ? 19  DC  I N3    1 
ATOM 8151  C C4    . DC  I 5 103 ? 244.920 294.686 249.085 1.00 47.80  ? 19  DC  I C4    1 
ATOM 8152  N N4    . DC  I 5 103 ? 243.631 294.356 249.030 1.00 47.80  ? 19  DC  I N4    1 
ATOM 8153  C C5    . DC  I 5 103 ? 245.914 293.678 249.180 1.00 47.80  ? 19  DC  I C5    1 
ATOM 8154  C C6    . DC  I 5 103 ? 247.187 294.069 249.230 1.00 47.80  ? 19  DC  I C6    1 
ATOM 8155  P P     . DG  I 5 104 ? 252.728 296.626 251.286 1.00 50.79  ? 20  DG  I P     1 
ATOM 8156  O OP1   . DG  I 5 104 ? 253.984 297.125 250.690 1.00 50.79  ? 20  DG  I OP1   1 
ATOM 8157  O OP2   . DG  I 5 104 ? 252.713 295.356 252.037 1.00 50.79  ? 20  DG  I OP2   1 
ATOM 8158  O "O5'" . DG  I 5 104 ? 252.140 297.755 252.240 1.00 50.79  ? 20  DG  I "O5'" 1 
ATOM 8159  C "C5'" . DG  I 5 104 ? 251.768 299.005 251.697 1.00 50.79  ? 20  DG  I "C5'" 1 
ATOM 8160  C "C4'" . DG  I 5 104 ? 250.527 299.529 252.379 1.00 50.79  ? 20  DG  I "C4'" 1 
ATOM 8161  O "O4'" . DG  I 5 104 ? 249.369 298.975 251.740 1.00 50.79  ? 20  DG  I "O4'" 1 
ATOM 8162  C "C3'" . DG  I 5 104 ? 250.369 299.100 253.824 1.00 50.79  ? 20  DG  I "C3'" 1 
ATOM 8163  O "O3'" . DG  I 5 104 ? 251.112 299.959 254.748 1.00 50.79  ? 20  DG  I "O3'" 1 
ATOM 8164  C "C2'" . DG  I 5 104 ? 248.863 299.166 254.041 1.00 50.79  ? 20  DG  I "C2'" 1 
ATOM 8165  C "C1'" . DG  I 5 104 ? 248.285 299.093 252.626 1.00 50.79  ? 20  DG  I "C1'" 1 
ATOM 8166  N N9    . DG  I 5 104 ? 247.392 297.964 252.460 1.00 50.79  ? 20  DG  I N9    1 
ATOM 8167  C C8    . DG  I 5 104 ? 247.723 296.637 252.474 1.00 50.79  ? 20  DG  I C8    1 
ATOM 8168  N N7    . DG  I 5 104 ? 246.699 295.852 252.335 1.00 50.79  ? 20  DG  I N7    1 
ATOM 8169  C C5    . DG  I 5 104 ? 245.624 296.716 252.251 1.00 50.79  ? 20  DG  I C5    1 
ATOM 8170  C C6    . DG  I 5 104 ? 244.261 296.443 252.088 1.00 50.79  ? 20  DG  I C6    1 
ATOM 8171  O O6    . DG  I 5 104 ? 243.713 295.349 251.995 1.00 50.79  ? 20  DG  I O6    1 
ATOM 8172  N N1    . DG  I 5 104 ? 243.510 297.600 252.040 1.00 50.79  ? 20  DG  I N1    1 
ATOM 8173  C C2    . DG  I 5 104 ? 244.015 298.864 252.134 1.00 50.79  ? 20  DG  I C2    1 
ATOM 8174  N N2    . DG  I 5 104 ? 243.135 299.865 252.072 1.00 50.79  ? 20  DG  I N2    1 
ATOM 8175  N N3    . DG  I 5 104 ? 245.294 299.134 252.281 1.00 50.79  ? 20  DG  I N3    1 
ATOM 8176  C C4    . DG  I 5 104 ? 246.036 298.015 252.326 1.00 50.79  ? 20  DG  I C4    1 
ATOM 8177  P P     . DG  I 5 105 ? 250.949 301.566 254.811 1.00 52.38  ? 21  DG  I P     1 
ATOM 8178  O OP1   . DG  I 5 105 ? 251.379 302.195 253.546 1.00 52.38  ? 21  DG  I OP1   1 
ATOM 8179  O OP2   . DG  I 5 105 ? 251.626 301.961 256.060 1.00 52.38  ? 21  DG  I OP2   1 
ATOM 8180  O "O5'" . DG  I 5 105 ? 249.396 301.839 255.062 1.00 52.38  ? 21  DG  I "O5'" 1 
ATOM 8181  C "C5'" . DG  I 5 105 ? 248.868 301.780 256.376 1.00 52.38  ? 21  DG  I "C5'" 1 
ATOM 8182  C "C4'" . DG  I 5 105 ? 247.354 301.898 256.356 1.00 52.38  ? 21  DG  I "C4'" 1 
ATOM 8183  O "O4'" . DG  I 5 105 ? 246.805 300.827 255.573 1.00 52.38  ? 21  DG  I "O4'" 1 
ATOM 8184  C "C3'" . DG  I 5 105 ? 246.695 301.784 257.722 1.00 52.38  ? 21  DG  I "C3'" 1 
ATOM 8185  O "O3'" . DG  I 5 105 ? 246.293 303.062 258.178 1.00 52.38  ? 21  DG  I "O3'" 1 
ATOM 8186  C "C2'" . DG  I 5 105 ? 245.487 300.868 257.506 1.00 52.38  ? 21  DG  I "C2'" 1 
ATOM 8187  C "C1'" . DG  I 5 105 ? 245.510 300.548 256.021 1.00 52.38  ? 21  DG  I "C1'" 1 
ATOM 8188  N N9    . DG  I 5 105 ? 245.229 299.147 255.763 1.00 52.38  ? 21  DG  I N9    1 
ATOM 8189  C C8    . DG  I 5 105 ? 246.132 298.121 255.719 1.00 52.38  ? 21  DG  I C8    1 
ATOM 8190  N N7    . DG  I 5 105 ? 245.590 296.966 255.490 1.00 52.38  ? 21  DG  I N7    1 
ATOM 8191  C C5    . DG  I 5 105 ? 244.241 297.241 255.398 1.00 52.38  ? 21  DG  I C5    1 
ATOM 8192  C C6    . DG  I 5 105 ? 243.165 296.380 255.156 1.00 52.38  ? 21  DG  I C6    1 
ATOM 8193  O O6    . DG  I 5 105 ? 243.196 295.163 254.977 1.00 52.38  ? 21  DG  I O6    1 
ATOM 8194  N N1    . DG  I 5 105 ? 241.960 297.058 255.129 1.00 52.38  ? 21  DG  I N1    1 
ATOM 8195  C C2    . DG  I 5 105 ? 241.816 298.403 255.310 1.00 52.38  ? 21  DG  I C2    1 
ATOM 8196  N N2    . DG  I 5 105 ? 240.571 298.881 255.254 1.00 52.38  ? 21  DG  I N2    1 
ATOM 8197  N N3    . DG  I 5 105 ? 242.822 299.228 255.532 1.00 52.38  ? 21  DG  I N3    1 
ATOM 8198  C C4    . DG  I 5 105 ? 244.001 298.578 255.560 1.00 52.38  ? 21  DG  I C4    1 
ATOM 8199  P P     . DT  I 5 106 ? 245.820 303.257 259.699 1.00 51.95  ? 22  DT  I P     1 
ATOM 8200  O OP1   . DT  I 5 106 ? 245.799 304.710 259.965 1.00 51.95  ? 22  DT  I OP1   1 
ATOM 8201  O OP2   . DT  I 5 106 ? 246.636 302.356 260.541 1.00 51.95  ? 22  DT  I OP2   1 
ATOM 8202  O "O5'" . DT  I 5 106 ? 244.318 302.710 259.712 1.00 51.95  ? 22  DT  I "O5'" 1 
ATOM 8203  C "C5'" . DT  I 5 106 ? 243.345 303.288 258.856 1.00 51.95  ? 22  DT  I "C5'" 1 
ATOM 8204  C "C4'" . DT  I 5 106 ? 241.952 302.802 259.216 1.00 51.95  ? 22  DT  I "C4'" 1 
ATOM 8205  O "O4'" . DT  I 5 106 ? 241.712 301.506 258.612 1.00 51.95  ? 22  DT  I "O4'" 1 
ATOM 8206  C "C3'" . DT  I 5 106 ? 241.693 302.635 260.710 1.00 51.95  ? 22  DT  I "C3'" 1 
ATOM 8207  O "O3'" . DT  I 5 106 ? 240.418 303.160 261.040 1.00 51.95  ? 22  DT  I "O3'" 1 
ATOM 8208  C "C2'" . DT  I 5 106 ? 241.751 301.123 260.914 1.00 51.95  ? 22  DT  I "C2'" 1 
ATOM 8209  C "C1'" . DT  I 5 106 ? 241.239 300.606 259.583 1.00 51.95  ? 22  DT  I "C1'" 1 
ATOM 8210  N N1    . DT  I 5 106 ? 241.749 299.261 259.247 1.00 51.95  ? 22  DT  I N1    1 
ATOM 8211  C C2    . DT  I 5 106 ? 240.870 298.279 258.883 1.00 51.95  ? 22  DT  I C2    1 
ATOM 8212  O O2    . DT  I 5 106 ? 239.670 298.449 258.822 1.00 51.95  ? 22  DT  I O2    1 
ATOM 8213  N N3    . DT  I 5 106 ? 241.444 297.080 258.603 1.00 51.95  ? 22  DT  I N3    1 
ATOM 8214  C C4    . DT  I 5 106 ? 242.783 296.772 258.640 1.00 51.95  ? 22  DT  I C4    1 
ATOM 8215  O O4    . DT  I 5 106 ? 243.208 295.663 258.364 1.00 51.95  ? 22  DT  I O4    1 
ATOM 8216  C C5    . DT  I 5 106 ? 243.651 297.846 259.022 1.00 51.95  ? 22  DT  I C5    1 
ATOM 8217  C C7    . DT  I 5 106 ? 245.127 297.624 259.098 1.00 51.95  ? 22  DT  I C7    1 
ATOM 8218  C C6    . DT  I 5 106 ? 243.100 299.025 259.306 1.00 51.95  ? 22  DT  I C6    1 
ATOM 8219  P P     . DG  I 5 107 ? 239.912 303.157 262.563 1.00 49.31  ? 23  DG  I P     1 
ATOM 8220  O OP1   . DG  I 5 107 ? 238.978 304.290 262.725 1.00 49.31  ? 23  DG  I OP1   1 
ATOM 8221  O OP2   . DG  I 5 107 ? 241.090 303.021 263.443 1.00 49.31  ? 23  DG  I OP2   1 
ATOM 8222  O "O5'" . DG  I 5 107 ? 239.078 301.807 262.678 1.00 49.31  ? 23  DG  I "O5'" 1 
ATOM 8223  C "C5'" . DG  I 5 107 ? 238.013 301.568 261.786 1.00 49.31  ? 23  DG  I "C5'" 1 
ATOM 8224  C "C4'" . DG  I 5 107 ? 237.279 300.304 262.166 1.00 49.31  ? 23  DG  I "C4'" 1 
ATOM 8225  O "O4'" . DG  I 5 107 ? 237.949 299.150 261.594 1.00 49.31  ? 23  DG  I "O4'" 1 
ATOM 8226  C "C3'" . DG  I 5 107 ? 237.195 300.035 263.665 1.00 49.31  ? 23  DG  I "C3'" 1 
ATOM 8227  O "O3'" . DG  I 5 107 ? 235.926 299.506 263.957 1.00 49.31  ? 23  DG  I "O3'" 1 
ATOM 8228  C "C2'" . DG  I 5 107 ? 238.290 298.994 263.876 1.00 49.31  ? 23  DG  I "C2'" 1 
ATOM 8229  C "C1'" . DG  I 5 107 ? 238.140 298.192 262.602 1.00 49.31  ? 23  DG  I "C1'" 1 
ATOM 8230  N N9    . DG  I 5 107 ? 239.296 297.372 262.260 1.00 49.31  ? 23  DG  I N9    1 
ATOM 8231  C C8    . DG  I 5 107 ? 240.620 297.708 262.359 1.00 49.31  ? 23  DG  I C8    1 
ATOM 8232  N N7    . DG  I 5 107 ? 241.421 296.756 261.968 1.00 49.31  ? 23  DG  I N7    1 
ATOM 8233  C C5    . DG  I 5 107 ? 240.568 295.731 261.595 1.00 49.31  ? 23  DG  I C5    1 
ATOM 8234  C C6    . DG  I 5 107 ? 240.852 294.449 261.081 1.00 49.31  ? 23  DG  I C6    1 
ATOM 8235  O O6    . DG  I 5 107 ? 241.953 293.940 260.854 1.00 49.31  ? 23  DG  I O6    1 
ATOM 8236  N N1    . DG  I 5 107 ? 239.694 293.731 260.826 1.00 49.31  ? 23  DG  I N1    1 
ATOM 8237  C C2    . DG  I 5 107 ? 238.426 294.196 261.041 1.00 49.31  ? 23  DG  I C2    1 
ATOM 8238  N N2    . DG  I 5 107 ? 237.425 293.370 260.743 1.00 49.31  ? 23  DG  I N2    1 
ATOM 8239  N N3    . DG  I 5 107 ? 238.151 295.391 261.516 1.00 49.31  ? 23  DG  I N3    1 
ATOM 8240  C C4    . DG  I 5 107 ? 239.264 296.100 261.768 1.00 49.31  ? 23  DG  I C4    1 
ATOM 8241  P P     . DC  I 5 108 ? 235.321 299.575 265.440 1.00 47.76  ? 24  DC  I P     1 
ATOM 8242  O OP1   . DC  I 5 108 ? 234.490 300.792 265.525 1.00 47.76  ? 24  DC  I OP1   1 
ATOM 8243  O OP2   . DC  I 5 108 ? 236.413 299.334 266.404 1.00 47.76  ? 24  DC  I OP2   1 
ATOM 8244  O "O5'" . DC  I 5 108 ? 234.366 298.302 265.487 1.00 47.76  ? 24  DC  I "O5'" 1 
ATOM 8245  C "C5'" . DC  I 5 108 ? 234.095 297.602 264.293 1.00 47.76  ? 24  DC  I "C5'" 1 
ATOM 8246  C "C4'" . DC  I 5 108 ? 234.097 296.111 264.539 1.00 47.76  ? 24  DC  I "C4'" 1 
ATOM 8247  O "O4'" . DC  I 5 108 ? 235.359 295.536 264.112 1.00 47.76  ? 24  DC  I "O4'" 1 
ATOM 8248  C "C3'" . DC  I 5 108 ? 233.919 295.708 265.996 1.00 47.76  ? 24  DC  I "C3'" 1 
ATOM 8249  O "O3'" . DC  I 5 108 ? 232.988 294.659 266.065 1.00 47.76  ? 24  DC  I "O3'" 1 
ATOM 8250  C "C2'" . DC  I 5 108 ? 235.319 295.249 266.404 1.00 47.76  ? 24  DC  I "C2'" 1 
ATOM 8251  C "C1'" . DC  I 5 108 ? 235.816 294.655 265.103 1.00 47.76  ? 24  DC  I "C1'" 1 
ATOM 8252  N N1    . DC  I 5 108 ? 237.295 294.559 265.000 1.00 47.76  ? 24  DC  I N1    1 
ATOM 8253  C C2    . DC  I 5 108 ? 237.873 293.408 264.466 1.00 47.76  ? 24  DC  I C2    1 
ATOM 8254  O O2    . DC  I 5 108 ? 237.142 292.494 264.092 1.00 47.76  ? 24  DC  I O2    1 
ATOM 8255  N N3    . DC  I 5 108 ? 239.216 293.333 264.368 1.00 47.76  ? 24  DC  I N3    1 
ATOM 8256  C C4    . DC  I 5 108 ? 239.966 294.342 264.780 1.00 47.76  ? 24  DC  I C4    1 
ATOM 8257  N N4    . DC  I 5 108 ? 241.289 294.225 264.664 1.00 47.76  ? 24  DC  I N4    1 
ATOM 8258  C C5    . DC  I 5 108 ? 239.395 295.526 265.322 1.00 47.76  ? 24  DC  I C5    1 
ATOM 8259  C C6    . DC  I 5 108 ? 238.068 295.589 265.413 1.00 47.76  ? 24  DC  I C6    1 
ATOM 8260  P P     . DT  I 5 109 ? 232.090 294.450 267.373 1.00 46.01  ? 25  DT  I P     1 
ATOM 8261  O OP1   . DT  I 5 109 ? 230.693 294.759 267.014 1.00 46.01  ? 25  DT  I OP1   1 
ATOM 8262  O OP2   . DT  I 5 109 ? 232.748 295.152 268.491 1.00 46.01  ? 25  DT  I OP2   1 
ATOM 8263  O "O5'" . DT  I 5 109 ? 232.198 292.884 267.638 1.00 46.01  ? 25  DT  I "O5'" 1 
ATOM 8264  C "C5'" . DT  I 5 109 ? 232.160 291.986 266.541 1.00 46.01  ? 25  DT  I "C5'" 1 
ATOM 8265  C "C4'" . DT  I 5 109 ? 233.041 290.782 266.802 1.00 46.01  ? 25  DT  I "C4'" 1 
ATOM 8266  O "O4'" . DT  I 5 109 ? 234.432 291.135 266.590 1.00 46.01  ? 25  DT  I "O4'" 1 
ATOM 8267  C "C3'" . DT  I 5 109 ? 232.966 290.224 268.225 1.00 46.01  ? 25  DT  I "C3'" 1 
ATOM 8268  O "O3'" . DT  I 5 109 ? 232.972 288.819 268.179 1.00 46.01  ? 25  DT  I "O3'" 1 
ATOM 8269  C "C2'" . DT  I 5 109 ? 234.259 290.736 268.839 1.00 46.01  ? 25  DT  I "C2'" 1 
ATOM 8270  C "C1'" . DT  I 5 109 ? 235.176 290.604 267.647 1.00 46.01  ? 25  DT  I "C1'" 1 
ATOM 8271  N N1    . DT  I 5 109 ? 236.438 291.345 267.782 1.00 46.01  ? 25  DT  I N1    1 
ATOM 8272  C C2    . DT  I 5 109 ? 237.594 290.787 267.312 1.00 46.01  ? 25  DT  I C2    1 
ATOM 8273  O O2    . DT  I 5 109 ? 237.637 289.708 266.770 1.00 46.01  ? 25  DT  I O2    1 
ATOM 8274  N N3    . DT  I 5 109 ? 238.706 291.547 267.499 1.00 46.01  ? 25  DT  I N3    1 
ATOM 8275  C C4    . DT  I 5 109 ? 238.780 292.774 268.100 1.00 46.01  ? 25  DT  I C4    1 
ATOM 8276  O O4    . DT  I 5 109 ? 239.831 293.383 268.217 1.00 46.01  ? 25  DT  I O4    1 
ATOM 8277  C C5    . DT  I 5 109 ? 237.533 293.301 268.573 1.00 46.01  ? 25  DT  I C5    1 
ATOM 8278  C C7    . DT  I 5 109 ? 237.490 294.637 269.241 1.00 46.01  ? 25  DT  I C7    1 
ATOM 8279  C C6    . DT  I 5 109 ? 236.435 292.567 268.397 1.00 46.01  ? 25  DT  I C6    1 
ATOM 8280  P P     . DA  I 5 110 ? 231.607 287.984 268.095 1.00 43.77  ? 26  DA  I P     1 
ATOM 8281  O OP1   . DA  I 5 110 ? 230.758 288.607 267.066 1.00 43.77  ? 26  DA  I OP1   1 
ATOM 8282  O OP2   . DA  I 5 110 ? 231.090 287.800 269.463 1.00 43.77  ? 26  DA  I OP2   1 
ATOM 8283  O "O5'" . DA  I 5 110 ? 232.087 286.572 267.533 1.00 43.77  ? 26  DA  I "O5'" 1 
ATOM 8284  C "C5'" . DA  I 5 110 ? 232.682 286.511 266.250 1.00 43.77  ? 26  DA  I "C5'" 1 
ATOM 8285  C "C4'" . DA  I 5 110 ? 233.708 285.398 266.148 1.00 43.77  ? 26  DA  I "C4'" 1 
ATOM 8286  O "O4'" . DA  I 5 110 ? 235.023 285.881 266.497 1.00 43.77  ? 26  DA  I "O4'" 1 
ATOM 8287  C "C3'" . DA  I 5 110 ? 233.484 284.192 267.025 1.00 43.77  ? 26  DA  I "C3'" 1 
ATOM 8288  O "O3'" . DA  I 5 110 ? 234.050 283.093 266.371 1.00 43.77  ? 26  DA  I "O3'" 1 
ATOM 8289  C "C2'" . DA  I 5 110 ? 234.263 284.558 268.287 1.00 43.77  ? 26  DA  I "C2'" 1 
ATOM 8290  C "C1'" . DA  I 5 110 ? 235.465 285.285 267.702 1.00 43.77  ? 26  DA  I "C1'" 1 
ATOM 8291  N N9    . DA  I 5 110 ? 235.980 286.368 268.519 1.00 43.77  ? 26  DA  I N9    1 
ATOM 8292  C C8    . DA  I 5 110 ? 235.259 287.256 269.252 1.00 43.77  ? 26  DA  I C8    1 
ATOM 8293  N N7    . DA  I 5 110 ? 235.986 288.165 269.842 1.00 43.77  ? 26  DA  I N7    1 
ATOM 8294  C C5    . DA  I 5 110 ? 237.269 287.869 269.446 1.00 43.77  ? 26  DA  I C5    1 
ATOM 8295  C C6    . DA  I 5 110 ? 238.500 288.463 269.732 1.00 43.77  ? 26  DA  I C6    1 
ATOM 8296  N N6    . DA  I 5 110 ? 238.632 289.532 270.511 1.00 43.77  ? 26  DA  I N6    1 
ATOM 8297  N N1    . DA  I 5 110 ? 239.594 287.924 269.182 1.00 43.77  ? 26  DA  I N1    1 
ATOM 8298  C C2    . DA  I 5 110 ? 239.461 286.858 268.394 1.00 43.77  ? 26  DA  I C2    1 
ATOM 8299  N N3    . DA  I 5 110 ? 238.356 286.207 268.057 1.00 43.77  ? 26  DA  I N3    1 
ATOM 8300  C C4    . DA  I 5 110 ? 237.284 286.773 268.619 1.00 43.77  ? 26  DA  I C4    1 
ATOM 8301  P P     . DG  I 5 111 ? 233.731 281.600 266.837 1.00 42.90  ? 27  DG  I P     1 
ATOM 8302  O OP1   . DG  I 5 111 ? 233.378 280.849 265.622 1.00 42.90  ? 27  DG  I OP1   1 
ATOM 8303  O OP2   . DG  I 5 111 ? 232.802 281.640 267.981 1.00 42.90  ? 27  DG  I OP2   1 
ATOM 8304  O "O5'" . DG  I 5 111 ? 235.142 281.093 267.355 1.00 42.90  ? 27  DG  I "O5'" 1 
ATOM 8305  C "C5'" . DG  I 5 111 ? 236.300 281.475 266.665 1.00 42.90  ? 27  DG  I "C5'" 1 
ATOM 8306  C "C4'" . DG  I 5 111 ? 237.504 281.451 267.575 1.00 42.90  ? 27  DG  I "C4'" 1 
ATOM 8307  O "O4'" . DG  I 5 111 ? 237.553 282.661 268.368 1.00 42.90  ? 27  DG  I "O4'" 1 
ATOM 8308  C "C3'" . DG  I 5 111 ? 237.549 280.303 268.581 1.00 42.90  ? 27  DG  I "C3'" 1 
ATOM 8309  O "O3'" . DG  I 5 111 ? 238.872 279.887 268.709 1.00 42.90  ? 27  DG  I "O3'" 1 
ATOM 8310  C "C2'" . DG  I 5 111 ? 237.101 280.986 269.860 1.00 42.90  ? 27  DG  I "C2'" 1 
ATOM 8311  C "C1'" . DG  I 5 111 ? 237.823 282.296 269.690 1.00 42.90  ? 27  DG  I "C1'" 1 
ATOM 8312  N N9    . DG  I 5 111 ? 237.375 283.352 270.573 1.00 42.90  ? 27  DG  I N9    1 
ATOM 8313  C C8    . DG  I 5 111 ? 236.116 283.546 271.063 1.00 42.90  ? 27  DG  I C8    1 
ATOM 8314  N N7    . DG  I 5 111 ? 236.022 284.583 271.832 1.00 42.90  ? 27  DG  I N7    1 
ATOM 8315  C C5    . DG  I 5 111 ? 237.301 285.104 271.855 1.00 42.90  ? 27  DG  I C5    1 
ATOM 8316  C C6    . DG  I 5 111 ? 237.806 286.226 272.525 1.00 42.90  ? 27  DG  I C6    1 
ATOM 8317  O O6    . DG  I 5 111 ? 237.204 287.012 273.258 1.00 42.90  ? 27  DG  I O6    1 
ATOM 8318  N N1    . DG  I 5 111 ? 239.157 286.400 272.285 1.00 42.90  ? 27  DG  I N1    1 
ATOM 8319  C C2    . DG  I 5 111 ? 239.918 285.592 271.488 1.00 42.90  ? 27  DG  I C2    1 
ATOM 8320  N N2    . DG  I 5 111 ? 241.203 285.913 271.363 1.00 42.90  ? 27  DG  I N2    1 
ATOM 8321  N N3    . DG  I 5 111 ? 239.454 284.538 270.859 1.00 42.90  ? 27  DG  I N3    1 
ATOM 8322  C C4    . DG  I 5 111 ? 238.142 284.356 271.090 1.00 42.90  ? 27  DG  I C4    1 
ATOM 8323  P P     . DA  I 5 112 ? 239.304 278.380 268.409 1.00 43.07  ? 28  DA  I P     1 
ATOM 8324  O OP1   . DA  I 5 112 ? 238.923 278.050 267.030 1.00 43.07  ? 28  DA  I OP1   1 
ATOM 8325  O OP2   . DA  I 5 112 ? 238.810 277.548 269.513 1.00 43.07  ? 28  DA  I OP2   1 
ATOM 8326  O "O5'" . DA  I 5 112 ? 240.887 278.450 268.514 1.00 43.07  ? 28  DA  I "O5'" 1 
ATOM 8327  C "C5'" . DA  I 5 112 ? 241.568 279.523 267.913 1.00 43.07  ? 28  DA  I "C5'" 1 
ATOM 8328  C "C4'" . DA  I 5 112 ? 242.740 279.993 268.757 1.00 43.07  ? 28  DA  I "C4'" 1 
ATOM 8329  O "O4'" . DA  I 5 112 ? 242.315 281.010 269.692 1.00 43.07  ? 28  DA  I "O4'" 1 
ATOM 8330  C "C3'" . DA  I 5 112 ? 243.439 278.942 269.592 1.00 43.07  ? 28  DA  I "C3'" 1 
ATOM 8331  O "O3'" . DA  I 5 112 ? 244.800 279.301 269.664 1.00 43.07  ? 28  DA  I "O3'" 1 
ATOM 8332  C "C2'" . DA  I 5 112 ? 242.741 279.082 270.948 1.00 43.07  ? 28  DA  I "C2'" 1 
ATOM 8333  C "C1'" . DA  I 5 112 ? 242.541 280.585 271.021 1.00 43.07  ? 28  DA  I "C1'" 1 
ATOM 8334  N N9    . DA  I 5 112 ? 241.386 281.017 271.793 1.00 43.07  ? 28  DA  I N9    1 
ATOM 8335  C C8    . DA  I 5 112 ? 240.120 280.538 271.703 1.00 43.07  ? 28  DA  I C8    1 
ATOM 8336  N N7    . DA  I 5 112 ? 239.267 281.152 272.476 1.00 43.07  ? 28  DA  I N7    1 
ATOM 8337  C C5    . DA  I 5 112 ? 240.021 282.120 273.099 1.00 43.07  ? 28  DA  I C5    1 
ATOM 8338  C C6    . DA  I 5 112 ? 239.698 283.108 274.040 1.00 43.07  ? 28  DA  I C6    1 
ATOM 8339  N N6    . DA  I 5 112 ? 238.474 283.277 274.534 1.00 43.07  ? 28  DA  I N6    1 
ATOM 8340  N N1    . DA  I 5 112 ? 240.685 283.914 274.463 1.00 43.07  ? 28  DA  I N1    1 
ATOM 8341  C C2    . DA  I 5 112 ? 241.909 283.742 273.967 1.00 43.07  ? 28  DA  I C2    1 
ATOM 8342  N N3    . DA  I 5 112 ? 242.333 282.850 273.080 1.00 43.07  ? 28  DA  I N3    1 
ATOM 8343  C C4    . DA  I 5 112 ? 241.327 282.061 272.681 1.00 43.07  ? 28  DA  I C4    1 
ATOM 8344  P P     . DG  I 5 113 ? 245.909 278.291 270.221 1.00 47.00  ? 29  DG  I P     1 
ATOM 8345  O OP1   . DG  I 5 113 ? 247.125 278.543 269.424 1.00 47.00  ? 29  DG  I OP1   1 
ATOM 8346  O OP2   . DG  I 5 113 ? 245.335 276.937 270.303 1.00 47.00  ? 29  DG  I OP2   1 
ATOM 8347  O "O5'" . DG  I 5 113 ? 246.174 278.827 271.692 1.00 47.00  ? 29  DG  I "O5'" 1 
ATOM 8348  C "C5'" . DG  I 5 113 ? 246.504 280.185 271.875 1.00 47.00  ? 29  DG  I "C5'" 1 
ATOM 8349  C "C4'" . DG  I 5 113 ? 246.558 280.539 273.343 1.00 47.00  ? 29  DG  I "C4'" 1 
ATOM 8350  O "O4'" . DG  I 5 113 ? 245.247 280.947 273.802 1.00 47.00  ? 29  DG  I "O4'" 1 
ATOM 8351  C "C3'" . DG  I 5 113 ? 246.991 279.406 274.267 1.00 47.00  ? 29  DG  I "C3'" 1 
ATOM 8352  O "O3'" . DG  I 5 113 ? 247.852 279.929 275.244 1.00 47.00  ? 29  DG  I "O3'" 1 
ATOM 8353  C "C2'" . DG  I 5 113 ? 245.671 278.954 274.879 1.00 47.00  ? 29  DG  I "C2'" 1 
ATOM 8354  C "C1'" . DG  I 5 113 ? 244.966 280.282 275.003 1.00 47.00  ? 29  DG  I "C1'" 1 
ATOM 8355  N N9    . DG  I 5 113 ? 243.524 280.182 275.158 1.00 47.00  ? 29  DG  I N9    1 
ATOM 8356  C C8    . DG  I 5 113 ? 242.681 279.303 274.540 1.00 47.00  ? 29  DG  I C8    1 
ATOM 8357  N N7    . DG  I 5 113 ? 241.437 279.460 274.877 1.00 47.00  ? 29  DG  I N7    1 
ATOM 8358  C C5    . DG  I 5 113 ? 241.464 280.508 275.776 1.00 47.00  ? 29  DG  I C5    1 
ATOM 8359  C C6    . DG  I 5 113 ? 240.417 281.124 276.486 1.00 47.00  ? 29  DG  I C6    1 
ATOM 8360  O O6    . DG  I 5 113 ? 239.215 280.864 276.454 1.00 47.00  ? 29  DG  I O6    1 
ATOM 8361  N N1    . DG  I 5 113 ? 240.878 282.148 277.291 1.00 47.00  ? 29  DG  I N1    1 
ATOM 8362  C C2    . DG  I 5 113 ? 242.184 282.524 277.401 1.00 47.00  ? 29  DG  I C2    1 
ATOM 8363  N N2    . DG  I 5 113 ? 242.448 283.533 278.230 1.00 47.00  ? 29  DG  I N2    1 
ATOM 8364  N N3    . DG  I 5 113 ? 243.172 281.956 276.744 1.00 47.00  ? 29  DG  I N3    1 
ATOM 8365  C C4    . DG  I 5 113 ? 242.739 280.960 275.954 1.00 47.00  ? 29  DG  I C4    1 
ATOM 8366  P P     . DC  I 5 114 ? 248.848 278.980 276.065 1.00 51.32  ? 30  DC  I P     1 
ATOM 8367  O OP1   . DC  I 5 114 ? 250.209 279.307 275.600 1.00 51.32  ? 30  DC  I OP1   1 
ATOM 8368  O OP2   . DC  I 5 114 ? 248.364 277.587 275.989 1.00 51.32  ? 30  DC  I OP2   1 
ATOM 8369  O "O5'" . DC  I 5 114 ? 248.664 279.487 277.565 1.00 51.32  ? 30  DC  I "O5'" 1 
ATOM 8370  C "C5'" . DC  I 5 114 ? 248.593 280.879 277.822 1.00 51.32  ? 30  DC  I "C5'" 1 
ATOM 8371  C "C4'" . DC  I 5 114 ? 247.724 281.168 279.029 1.00 51.32  ? 30  DC  I "C4'" 1 
ATOM 8372  O "O4'" . DC  I 5 114 ? 246.333 281.016 278.682 1.00 51.32  ? 30  DC  I "O4'" 1 
ATOM 8373  C "C3'" . DC  I 5 114 ? 247.960 280.258 280.234 1.00 51.32  ? 30  DC  I "C3'" 1 
ATOM 8374  O "O3'" . DC  I 5 114 ? 248.425 281.030 281.327 1.00 51.32  ? 30  DC  I "O3'" 1 
ATOM 8375  C "C2'" . DC  I 5 114 ? 246.582 279.649 280.518 1.00 51.32  ? 30  DC  I "C2'" 1 
ATOM 8376  C "C1'" . DC  I 5 114 ? 245.642 280.610 279.825 1.00 51.32  ? 30  DC  I "C1'" 1 
ATOM 8377  N N1    . DC  I 5 114 ? 244.359 279.994 279.401 1.00 51.32  ? 30  DC  I N1    1 
ATOM 8378  C C2    . DC  I 5 114 ? 243.169 280.422 279.978 1.00 51.32  ? 30  DC  I C2    1 
ATOM 8379  O O2    . DC  I 5 114 ? 243.208 281.298 280.841 1.00 51.32  ? 30  DC  I O2    1 
ATOM 8380  N N3    . DC  I 5 114 ? 242.012 279.858 279.584 1.00 51.32  ? 30  DC  I N3    1 
ATOM 8381  C C4    . DC  I 5 114 ? 242.020 278.912 278.652 1.00 51.32  ? 30  DC  I C4    1 
ATOM 8382  N N4    . DC  I 5 114 ? 240.854 278.386 278.287 1.00 51.32  ? 30  DC  I N4    1 
ATOM 8383  C C5    . DC  I 5 114 ? 243.222 278.466 278.048 1.00 51.32  ? 30  DC  I C5    1 
ATOM 8384  C C6    . DC  I 5 114 ? 244.357 279.029 278.449 1.00 51.32  ? 30  DC  I C6    1 
ATOM 8385  P P     . DT  I 5 115 ? 248.938 280.324 282.676 1.00 54.34  ? 31  DT  I P     1 
ATOM 8386  O OP1   . DT  I 5 115 ? 250.346 280.727 282.870 1.00 54.34  ? 31  DT  I OP1   1 
ATOM 8387  O OP2   . DT  I 5 115 ? 248.593 278.888 282.649 1.00 54.34  ? 31  DT  I OP2   1 
ATOM 8388  O "O5'" . DT  I 5 115 ? 248.059 281.025 283.805 1.00 54.34  ? 31  DT  I "O5'" 1 
ATOM 8389  C "C5'" . DT  I 5 115 ? 246.835 281.642 283.456 1.00 54.34  ? 31  DT  I "C5'" 1 
ATOM 8390  C "C4'" . DT  I 5 115 ? 245.926 281.722 284.656 1.00 54.34  ? 31  DT  I "C4'" 1 
ATOM 8391  O "O4'" . DT  I 5 115 ? 244.591 281.298 284.281 1.00 54.34  ? 31  DT  I "O4'" 1 
ATOM 8392  C "C3'" . DT  I 5 115 ? 246.319 280.810 285.796 1.00 54.34  ? 31  DT  I "C3'" 1 
ATOM 8393  O "O3'" . DT  I 5 115 ? 245.805 281.330 286.989 1.00 54.34  ? 31  DT  I "O3'" 1 
ATOM 8394  C "C2'" . DT  I 5 115 ? 245.617 279.521 285.408 1.00 54.34  ? 31  DT  I "C2'" 1 
ATOM 8395  C "C1'" . DT  I 5 115 ? 244.293 280.066 284.905 1.00 54.34  ? 31  DT  I "C1'" 1 
ATOM 8396  N N1    . DT  I 5 115 ? 243.629 279.203 283.916 1.00 54.34  ? 31  DT  I N1    1 
ATOM 8397  C C2    . DT  I 5 115 ? 242.271 279.147 283.904 1.00 54.34  ? 31  DT  I C2    1 
ATOM 8398  O O2    . DT  I 5 115 ? 241.575 279.777 284.671 1.00 54.34  ? 31  DT  I O2    1 
ATOM 8399  N N3    . DT  I 5 115 ? 241.744 278.328 282.960 1.00 54.34  ? 31  DT  I N3    1 
ATOM 8400  C C4    . DT  I 5 115 ? 242.426 277.573 282.040 1.00 54.34  ? 31  DT  I C4    1 
ATOM 8401  O O4    . DT  I 5 115 ? 241.857 276.861 281.228 1.00 54.34  ? 31  DT  I O4    1 
ATOM 8402  C C5    . DT  I 5 115 ? 243.852 277.672 282.101 1.00 54.34  ? 31  DT  I C5    1 
ATOM 8403  C C7    . DT  I 5 115 ? 244.695 276.884 281.152 1.00 54.34  ? 31  DT  I C7    1 
ATOM 8404  C C6    . DT  I 5 115 ? 244.385 278.476 283.026 1.00 54.34  ? 31  DT  I C6    1 
ATOM 8405  P P     . DG  I 5 116 ? 246.397 280.865 288.401 1.00 54.52  ? 32  DG  I P     1 
ATOM 8406  O OP1   . DG  I 5 116 ? 246.986 282.064 289.031 1.00 54.52  ? 32  DG  I OP1   1 
ATOM 8407  O OP2   . DG  I 5 116 ? 247.210 279.647 288.198 1.00 54.52  ? 32  DG  I OP2   1 
ATOM 8408  O "O5'" . DG  I 5 116 ? 245.096 280.456 289.221 1.00 54.52  ? 32  DG  I "O5'" 1 
ATOM 8409  C "C5'" . DG  I 5 116 ? 243.992 281.337 289.255 1.00 54.52  ? 32  DG  I "C5'" 1 
ATOM 8410  C "C4'" . DG  I 5 116 ? 242.740 280.615 289.700 1.00 54.52  ? 32  DG  I "C4'" 1 
ATOM 8411  O "O4'" . DG  I 5 116 ? 242.174 279.876 288.587 1.00 54.52  ? 32  DG  I "O4'" 1 
ATOM 8412  C "C3'" . DG  I 5 116 ? 242.941 279.601 290.816 1.00 54.52  ? 32  DG  I "C3'" 1 
ATOM 8413  O "O3'" . DG  I 5 116 ? 241.815 279.633 291.673 1.00 54.52  ? 32  DG  I "O3'" 1 
ATOM 8414  C "C2'" . DG  I 5 116 ? 243.031 278.282 290.053 1.00 54.52  ? 32  DG  I "C2'" 1 
ATOM 8415  C "C1'" . DG  I 5 116 ? 242.028 278.522 288.943 1.00 54.52  ? 32  DG  I "C1'" 1 
ATOM 8416  N N9    . DG  I 5 116 ? 242.251 277.715 287.750 1.00 54.52  ? 32  DG  I N9    1 
ATOM 8417  C C8    . DG  I 5 116 ? 243.446 277.447 287.142 1.00 54.52  ? 32  DG  I C8    1 
ATOM 8418  N N7    . DG  I 5 116 ? 243.329 276.707 286.078 1.00 54.52  ? 32  DG  I N7    1 
ATOM 8419  C C5    . DG  I 5 116 ? 241.970 276.480 285.973 1.00 54.52  ? 32  DG  I C5    1 
ATOM 8420  C C6    . DG  I 5 116 ? 241.244 275.739 285.021 1.00 54.52  ? 32  DG  I C6    1 
ATOM 8421  O O6    . DG  I 5 116 ? 241.670 275.126 284.040 1.00 54.52  ? 32  DG  I O6    1 
ATOM 8422  N N1    . DG  I 5 116 ? 239.886 275.760 285.284 1.00 54.52  ? 32  DG  I N1    1 
ATOM 8423  C C2    . DG  I 5 116 ? 239.307 276.415 286.336 1.00 54.52  ? 32  DG  I C2    1 
ATOM 8424  N N2    . DG  I 5 116 ? 237.983 276.325 286.442 1.00 54.52  ? 32  DG  I N2    1 
ATOM 8425  N N3    . DG  I 5 116 ? 239.977 277.103 287.236 1.00 54.52  ? 32  DG  I N3    1 
ATOM 8426  C C4    . DG  I 5 116 ? 241.296 277.093 286.994 1.00 54.52  ? 32  DG  I C4    1 
ATOM 8427  P P     . DT  I 5 117 ? 241.881 279.013 293.150 1.00 54.09  ? 33  DT  I P     1 
ATOM 8428  O OP1   . DT  I 5 117 ? 241.617 280.116 294.094 1.00 54.09  ? 33  DT  I OP1   1 
ATOM 8429  O OP2   . DT  I 5 117 ? 243.123 278.222 293.270 1.00 54.09  ? 33  DT  I OP2   1 
ATOM 8430  O "O5'" . DT  I 5 117 ? 240.641 278.013 293.170 1.00 54.09  ? 33  DT  I "O5'" 1 
ATOM 8431  C "C5'" . DT  I 5 117 ? 240.166 277.498 291.947 1.00 54.09  ? 33  DT  I "C5'" 1 
ATOM 8432  C "C4'" . DT  I 5 117 ? 238.779 276.927 292.090 1.00 54.09  ? 33  DT  I "C4'" 1 
ATOM 8433  O "O4'" . DT  I 5 117 ? 238.448 276.213 290.881 1.00 54.09  ? 33  DT  I "O4'" 1 
ATOM 8434  C "C3'" . DT  I 5 117 ? 238.643 275.881 293.164 1.00 54.09  ? 33  DT  I "C3'" 1 
ATOM 8435  O "O3'" . DT  I 5 117 ? 237.270 275.652 293.410 1.00 54.09  ? 33  DT  I "O3'" 1 
ATOM 8436  C "C2'" . DT  I 5 117 ? 239.288 274.688 292.477 1.00 54.09  ? 33  DT  I "C2'" 1 
ATOM 8437  C "C1'" . DT  I 5 117 ? 238.739 274.838 291.059 1.00 54.09  ? 33  DT  I "C1'" 1 
ATOM 8438  N N1    . DT  I 5 117 ? 239.685 274.434 289.996 1.00 54.09  ? 33  DT  I N1    1 
ATOM 8439  C C2    . DT  I 5 117 ? 239.200 273.801 288.888 1.00 54.09  ? 33  DT  I C2    1 
ATOM 8440  O O2    . DT  I 5 117 ? 238.025 273.540 288.732 1.00 54.09  ? 33  DT  I O2    1 
ATOM 8441  N N3    . DT  I 5 117 ? 240.136 273.478 287.960 1.00 54.09  ? 33  DT  I N3    1 
ATOM 8442  C C4    . DT  I 5 117 ? 241.487 273.712 288.029 1.00 54.09  ? 33  DT  I C4    1 
ATOM 8443  O O4    . DT  I 5 117 ? 242.251 273.384 287.137 1.00 54.09  ? 33  DT  I O4    1 
ATOM 8444  C C5    . DT  I 5 117 ? 241.934 274.387 289.215 1.00 54.09  ? 33  DT  I C5    1 
ATOM 8445  C C7    . DT  I 5 117 ? 243.384 274.699 289.397 1.00 54.09  ? 33  DT  I C7    1 
ATOM 8446  C C6    . DT  I 5 117 ? 241.021 274.709 290.134 1.00 54.09  ? 33  DT  I C6    1 
ATOM 8447  P P     . DC  I 5 118 ? 236.800 274.878 294.731 1.00 53.30  ? 34  DC  I P     1 
ATOM 8448  O OP1   . DC  I 5 118 ? 235.615 275.582 295.258 1.00 53.30  ? 34  DC  I OP1   1 
ATOM 8449  O OP2   . DC  I 5 118 ? 237.994 274.672 295.577 1.00 53.30  ? 34  DC  I OP2   1 
ATOM 8450  O "O5'" . DC  I 5 118 ? 236.351 273.446 294.194 1.00 53.30  ? 34  DC  I "O5'" 1 
ATOM 8451  C "C5'" . DC  I 5 118 ? 235.480 273.341 293.081 1.00 53.30  ? 34  DC  I "C5'" 1 
ATOM 8452  C "C4'" . DC  I 5 118 ? 235.452 271.919 292.560 1.00 53.30  ? 34  DC  I "C4'" 1 
ATOM 8453  O "O4'" . DC  I 5 118 ? 236.538 271.717 291.616 1.00 53.30  ? 34  DC  I "O4'" 1 
ATOM 8454  C "C3'" . DC  I 5 118 ? 235.639 270.838 293.623 1.00 53.30  ? 34  DC  I "C3'" 1 
ATOM 8455  O "O3'" . DC  I 5 118 ? 234.929 269.691 293.235 1.00 53.30  ? 34  DC  I "O3'" 1 
ATOM 8456  C "C2'" . DC  I 5 118 ? 237.131 270.579 293.536 1.00 53.30  ? 34  DC  I "C2'" 1 
ATOM 8457  C "C1'" . DC  I 5 118 ? 237.284 270.601 292.034 1.00 53.30  ? 34  DC  I "C1'" 1 
ATOM 8458  N N1    . DC  I 5 118 ? 238.667 270.736 291.559 1.00 53.30  ? 34  DC  I N1    1 
ATOM 8459  C C2    . DC  I 5 118 ? 238.972 270.317 290.274 1.00 53.30  ? 34  DC  I C2    1 
ATOM 8460  O O2    . DC  I 5 118 ? 238.067 269.872 289.572 1.00 53.30  ? 34  DC  I O2    1 
ATOM 8461  N N3    . DC  I 5 118 ? 240.236 270.430 289.830 1.00 53.30  ? 34  DC  I N3    1 
ATOM 8462  C C4    . DC  I 5 118 ? 241.174 270.931 290.626 1.00 53.30  ? 34  DC  I C4    1 
ATOM 8463  N N4    . DC  I 5 118 ? 242.412 271.022 290.145 1.00 53.30  ? 34  DC  I N4    1 
ATOM 8464  C C5    . DC  I 5 118 ? 240.884 271.360 291.951 1.00 53.30  ? 34  DC  I C5    1 
ATOM 8465  C C6    . DC  I 5 118 ? 239.627 271.239 292.375 1.00 53.30  ? 34  DC  I C6    1 
ATOM 8466  P P     . DT  I 5 119 ? 233.739 269.116 294.137 1.00 52.30  ? 35  DT  I P     1 
ATOM 8467  O OP1   . DT  I 5 119 ? 232.886 270.255 294.532 1.00 52.30  ? 35  DT  I OP1   1 
ATOM 8468  O OP2   . DT  I 5 119 ? 234.345 268.256 295.174 1.00 52.30  ? 35  DT  I OP2   1 
ATOM 8469  O "O5'" . DT  I 5 119 ? 232.941 268.175 293.120 1.00 52.30  ? 35  DT  I "O5'" 1 
ATOM 8470  C "C5'" . DT  I 5 119 ? 232.997 268.441 291.714 1.00 52.30  ? 35  DT  I "C5'" 1 
ATOM 8471  C "C4'" . DT  I 5 119 ? 233.404 267.201 290.929 1.00 52.30  ? 35  DT  I "C4'" 1 
ATOM 8472  O "O4'" . DT  I 5 119 ? 234.810 267.280 290.563 1.00 52.30  ? 35  DT  I "O4'" 1 
ATOM 8473  C "C3'" . DT  I 5 119 ? 233.261 265.880 291.673 1.00 52.30  ? 35  DT  I "C3'" 1 
ATOM 8474  O "O3'" . DT  I 5 119 ? 233.002 264.851 290.742 1.00 52.30  ? 35  DT  I "O3'" 1 
ATOM 8475  C "C2'" . DT  I 5 119 ? 234.654 265.718 292.260 1.00 52.30  ? 35  DT  I "C2'" 1 
ATOM 8476  C "C1'" . DT  I 5 119 ? 235.467 266.133 291.053 1.00 52.30  ? 35  DT  I "C1'" 1 
ATOM 8477  N N1    . DT  I 5 119 ? 236.866 266.473 291.343 1.00 52.30  ? 35  DT  I N1    1 
ATOM 8478  C C2    . DT  I 5 119 ? 237.787 266.360 290.342 1.00 52.30  ? 35  DT  I C2    1 
ATOM 8479  O O2    . DT  I 5 119 ? 237.503 266.001 289.221 1.00 52.30  ? 35  DT  I O2    1 
ATOM 8480  N N3    . DT  I 5 119 ? 239.055 266.697 290.692 1.00 52.30  ? 35  DT  I N3    1 
ATOM 8481  C C4    . DT  I 5 119 ? 239.489 267.120 291.922 1.00 52.30  ? 35  DT  I C4    1 
ATOM 8482  O O4    . DT  I 5 119 ? 240.657 267.400 292.141 1.00 52.30  ? 35  DT  I O4    1 
ATOM 8483  C C5    . DT  I 5 119 ? 238.475 267.211 292.934 1.00 52.30  ? 35  DT  I C5    1 
ATOM 8484  C C7    . DT  I 5 119 ? 238.836 267.661 294.314 1.00 52.30  ? 35  DT  I C7    1 
ATOM 8485  C C6    . DT  I 5 119 ? 237.221 266.891 292.600 1.00 52.30  ? 35  DT  I C6    1 
ATOM 8486  P P     . DA  I 5 120 ? 231.507 264.520 290.265 1.00 50.97  ? 36  DA  I P     1 
ATOM 8487  O OP1   . DA  I 5 120 ? 230.899 265.744 289.708 1.00 50.97  ? 36  DA  I OP1   1 
ATOM 8488  O OP2   . DA  I 5 120 ? 230.852 263.807 291.379 1.00 50.97  ? 36  DA  I OP2   1 
ATOM 8489  O "O5'" . DA  I 5 120 ? 231.717 263.493 289.060 1.00 50.97  ? 36  DA  I "O5'" 1 
ATOM 8490  C "C5'" . DA  I 5 120 ? 232.500 263.869 287.929 1.00 50.97  ? 36  DA  I "C5'" 1 
ATOM 8491  C "C4'" . DA  I 5 120 ? 233.539 262.809 287.587 1.00 50.97  ? 36  DA  I "C4'" 1 
ATOM 8492  O "O4'" . DA  I 5 120 ? 234.762 263.056 288.328 1.00 50.97  ? 36  DA  I "O4'" 1 
ATOM 8493  C "C3'" . DA  I 5 120 ? 233.157 261.372 287.929 1.00 50.97  ? 36  DA  I "C3'" 1 
ATOM 8494  O "O3'" . DA  I 5 120 ? 233.835 260.496 287.058 1.00 50.97  ? 36  DA  I "O3'" 1 
ATOM 8495  C "C2'" . DA  I 5 120 ? 233.741 261.241 289.321 1.00 50.97  ? 36  DA  I "C2'" 1 
ATOM 8496  C "C1'" . DA  I 5 120 ? 235.077 261.898 289.064 1.00 50.97  ? 36  DA  I "C1'" 1 
ATOM 8497  N N9    . DA  I 5 120 ? 235.792 262.283 290.261 1.00 50.97  ? 36  DA  I N9    1 
ATOM 8498  C C8    . DA  I 5 120 ? 235.281 262.434 291.511 1.00 50.97  ? 36  DA  I C8    1 
ATOM 8499  N N7    . DA  I 5 120 ? 236.165 262.793 292.399 1.00 50.97  ? 36  DA  I N7    1 
ATOM 8500  C C5    . DA  I 5 120 ? 237.337 262.880 291.679 1.00 50.97  ? 36  DA  I C5    1 
ATOM 8501  C C6    . DA  I 5 120 ? 238.639 263.212 292.048 1.00 50.97  ? 36  DA  I C6    1 
ATOM 8502  N N6    . DA  I 5 120 ? 238.979 263.536 293.292 1.00 50.97  ? 36  DA  I N6    1 
ATOM 8503  N N1    . DA  I 5 120 ? 239.582 263.205 291.088 1.00 50.97  ? 36  DA  I N1    1 
ATOM 8504  C C2    . DA  I 5 120 ? 239.229 262.881 289.843 1.00 50.97  ? 36  DA  I C2    1 
ATOM 8505  N N3    . DA  I 5 120 ? 238.032 262.552 289.380 1.00 50.97  ? 36  DA  I N3    1 
ATOM 8506  C C4    . DA  I 5 120 ? 237.124 262.571 290.360 1.00 50.97  ? 36  DA  I C4    1 
ATOM 8507  P P     . DC  I 5 121 ? 233.206 260.051 285.654 1.00 49.30  ? 37  DC  I P     1 
ATOM 8508  O OP1   . DC  I 5 121 ? 232.683 261.245 284.964 1.00 49.30  ? 37  DC  I OP1   1 
ATOM 8509  O OP2   . DC  I 5 121 ? 232.318 258.902 285.918 1.00 49.30  ? 37  DC  I OP2   1 
ATOM 8510  O "O5'" . DC  I 5 121 ? 234.480 259.539 284.843 1.00 49.30  ? 37  DC  I "O5'" 1 
ATOM 8511  C "C5'" . DC  I 5 121 ? 235.568 260.421 284.619 1.00 49.30  ? 37  DC  I "C5'" 1 
ATOM 8512  C "C4'" . DC  I 5 121 ? 236.895 259.700 284.753 1.00 49.30  ? 37  DC  I "C4'" 1 
ATOM 8513  O "O4'" . DC  I 5 121 ? 237.440 259.900 286.081 1.00 49.30  ? 37  DC  I "O4'" 1 
ATOM 8514  C "C3'" . DC  I 5 121 ? 236.839 258.196 284.560 1.00 49.30  ? 37  DC  I "C3'" 1 
ATOM 8515  O "O3'" . DC  I 5 121 ? 238.028 257.783 283.967 1.00 49.30  ? 37  DC  I "O3'" 1 
ATOM 8516  C "C2'" . DC  I 5 121 ? 236.744 257.691 285.991 1.00 49.30  ? 37  DC  I "C2'" 1 
ATOM 8517  C "C1'" . DC  I 5 121 ? 237.694 258.649 286.674 1.00 49.30  ? 37  DC  I "C1'" 1 
ATOM 8518  N N1    . DC  I 5 121 ? 237.477 258.779 288.122 1.00 49.30  ? 37  DC  I N1    1 
ATOM 8519  C C2    . DC  I 5 121 ? 238.534 259.157 288.937 1.00 49.30  ? 37  DC  I C2    1 
ATOM 8520  O O2    . DC  I 5 121 ? 239.635 259.362 288.429 1.00 49.30  ? 37  DC  I O2    1 
ATOM 8521  N N3    . DC  I 5 121 ? 238.323 259.285 290.261 1.00 49.30  ? 37  DC  I N3    1 
ATOM 8522  C C4    . DC  I 5 121 ? 237.120 259.055 290.765 1.00 49.30  ? 37  DC  I C4    1 
ATOM 8523  N N4    . DC  I 5 121 ? 236.956 259.196 292.078 1.00 49.30  ? 37  DC  I N4    1 
ATOM 8524  C C5    . DC  I 5 121 ? 236.028 258.670 289.948 1.00 49.30  ? 37  DC  I C5    1 
ATOM 8525  C C6    . DC  I 5 121 ? 236.248 258.554 288.642 1.00 49.30  ? 37  DC  I C6    1 
ATOM 8526  P P     . DG  I 5 122 ? 238.055 256.515 282.995 1.00 46.60  ? 38  DG  I P     1 
ATOM 8527  O OP1   . DG  I 5 122 ? 237.698 256.988 281.648 1.00 46.60  ? 38  DG  I OP1   1 
ATOM 8528  O OP2   . DG  I 5 122 ? 237.275 255.432 283.621 1.00 46.60  ? 38  DG  I OP2   1 
ATOM 8529  O "O5'" . DG  I 5 122 ? 239.583 256.082 283.017 1.00 46.60  ? 38  DG  I "O5'" 1 
ATOM 8530  C "C5'" . DG  I 5 122 ? 240.589 257.064 283.093 1.00 46.60  ? 38  DG  I "C5'" 1 
ATOM 8531  C "C4'" . DG  I 5 122 ? 241.680 256.625 284.043 1.00 46.60  ? 38  DG  I "C4'" 1 
ATOM 8532  O "O4'" . DG  I 5 122 ? 241.277 256.901 285.407 1.00 46.60  ? 38  DG  I "O4'" 1 
ATOM 8533  C "C3'" . DG  I 5 122 ? 242.008 255.140 283.991 1.00 46.60  ? 38  DG  I "C3'" 1 
ATOM 8534  O "O3'" . DG  I 5 122 ? 243.400 254.966 284.046 1.00 46.60  ? 38  DG  I "O3'" 1 
ATOM 8535  C "C2'" . DG  I 5 122 ? 241.325 254.593 285.234 1.00 46.60  ? 38  DG  I "C2'" 1 
ATOM 8536  C "C1'" . DG  I 5 122 ? 241.460 255.753 286.191 1.00 46.60  ? 38  DG  I "C1'" 1 
ATOM 8537  N N9    . DG  I 5 122 ? 240.453 255.743 287.242 1.00 46.60  ? 38  DG  I N9    1 
ATOM 8538  C C8    . DG  I 5 122 ? 239.125 255.461 287.100 1.00 46.60  ? 38  DG  I C8    1 
ATOM 8539  N N7    . DG  I 5 122 ? 238.459 255.522 288.210 1.00 46.60  ? 38  DG  I N7    1 
ATOM 8540  C C5    . DG  I 5 122 ? 239.408 255.866 289.151 1.00 46.60  ? 38  DG  I C5    1 
ATOM 8541  C C6    . DG  I 5 122 ? 239.269 256.080 290.531 1.00 46.60  ? 38  DG  I C6    1 
ATOM 8542  O O6    . DG  I 5 122 ? 238.245 256.002 291.216 1.00 46.60  ? 38  DG  I O6    1 
ATOM 8543  N N1    . DG  I 5 122 ? 240.476 256.414 291.124 1.00 46.60  ? 38  DG  I N1    1 
ATOM 8544  C C2    . DG  I 5 122 ? 241.666 256.521 290.460 1.00 46.60  ? 38  DG  I C2    1 
ATOM 8545  N N2    . DG  I 5 122 ? 242.728 256.849 291.202 1.00 46.60  ? 38  DG  I N2    1 
ATOM 8546  N N3    . DG  I 5 122 ? 241.808 256.333 289.160 1.00 46.60  ? 38  DG  I N3    1 
ATOM 8547  C C4    . DG  I 5 122 ? 240.641 256.008 288.573 1.00 46.60  ? 38  DG  I C4    1 
ATOM 8548  P P     . DA  I 5 123 ? 244.070 253.538 283.767 1.00 46.62  ? 39  DA  I P     1 
ATOM 8549  O OP1   . DA  I 5 123 ? 244.754 253.595 282.470 1.00 46.62  ? 39  DA  I OP1   1 
ATOM 8550  O OP2   . DA  I 5 123 ? 243.108 252.461 284.037 1.00 46.62  ? 39  DA  I OP2   1 
ATOM 8551  O "O5'" . DA  I 5 123 ? 245.200 253.472 284.868 1.00 46.62  ? 39  DA  I "O5'" 1 
ATOM 8552  C "C5'" . DA  I 5 123 ? 245.868 254.654 285.242 1.00 46.62  ? 39  DA  I "C5'" 1 
ATOM 8553  C "C4'" . DA  I 5 123 ? 246.621 254.462 286.540 1.00 46.62  ? 39  DA  I "C4'" 1 
ATOM 8554  O "O4'" . DA  I 5 123 ? 245.733 254.656 287.662 1.00 46.62  ? 39  DA  I "O4'" 1 
ATOM 8555  C "C3'" . DA  I 5 123 ? 247.232 253.094 286.734 1.00 46.62  ? 39  DA  I "C3'" 1 
ATOM 8556  O "O3'" . DA  I 5 123 ? 248.406 253.225 287.482 1.00 46.62  ? 39  DA  I "O3'" 1 
ATOM 8557  C "C2'" . DA  I 5 123 ? 246.150 252.345 287.504 1.00 46.62  ? 39  DA  I "C2'" 1 
ATOM 8558  C "C1'" . DA  I 5 123 ? 245.551 253.445 288.364 1.00 46.62  ? 39  DA  I "C1'" 1 
ATOM 8559  N N9    . DA  I 5 123 ? 244.126 253.296 288.601 1.00 46.62  ? 39  DA  I N9    1 
ATOM 8560  C C8    . DA  I 5 123 ? 243.164 253.119 287.665 1.00 46.62  ? 39  DA  I C8    1 
ATOM 8561  N N7    . DA  I 5 123 ? 241.957 253.037 288.155 1.00 46.62  ? 39  DA  I N7    1 
ATOM 8562  C C5    . DA  I 5 123 ? 242.141 253.181 289.507 1.00 46.62  ? 39  DA  I C5    1 
ATOM 8563  C C6    . DA  I 5 123 ? 241.247 253.178 290.580 1.00 46.62  ? 39  DA  I C6    1 
ATOM 8564  N N6    . DA  I 5 123 ? 239.933 253.026 290.438 1.00 46.62  ? 39  DA  I N6    1 
ATOM 8565  N N1    . DA  I 5 123 ? 241.752 253.340 291.806 1.00 46.62  ? 39  DA  I N1    1 
ATOM 8566  C C2    . DA  I 5 123 ? 243.065 253.483 291.945 1.00 46.62  ? 39  DA  I C2    1 
ATOM 8567  N N3    . DA  I 5 123 ? 244.006 253.501 291.012 1.00 46.62  ? 39  DA  I N3    1 
ATOM 8568  C C4    . DA  I 5 123 ? 243.472 253.340 289.803 1.00 46.62  ? 39  DA  I C4    1 
ATOM 8569  P P     . DC  I 5 124 ? 249.423 251.999 287.620 1.00 49.80  ? 40  DC  I P     1 
ATOM 8570  O OP1   . DC  I 5 124 ? 250.785 252.566 287.607 1.00 49.80  ? 40  DC  I OP1   1 
ATOM 8571  O OP2   . DC  I 5 124 ? 249.055 250.967 286.634 1.00 49.80  ? 40  DC  I OP2   1 
ATOM 8572  O "O5'" . DC  I 5 124 ? 249.099 251.421 289.068 1.00 49.80  ? 40  DC  I "O5'" 1 
ATOM 8573  C "C5'" . DC  I 5 124 ? 248.759 252.310 290.117 1.00 49.80  ? 40  DC  I "C5'" 1 
ATOM 8574  C "C4'" . DC  I 5 124 ? 248.317 251.544 291.343 1.00 49.80  ? 40  DC  I "C4'" 1 
ATOM 8575  O "O4'" . DC  I 5 124 ? 246.875 251.582 291.458 1.00 49.80  ? 40  DC  I "O4'" 1 
ATOM 8576  C "C3'" . DC  I 5 124 ? 248.709 250.072 291.351 1.00 49.80  ? 40  DC  I "C3'" 1 
ATOM 8577  O "O3'" . DC  I 5 124 ? 249.238 249.748 292.618 1.00 49.80  ? 40  DC  I "O3'" 1 
ATOM 8578  C "C2'" . DC  I 5 124 ? 247.386 249.355 291.082 1.00 49.80  ? 40  DC  I "C2'" 1 
ATOM 8579  C "C1'" . DC  I 5 124 ? 246.392 250.293 291.728 1.00 49.80  ? 40  DC  I "C1'" 1 
ATOM 8580  N N1    . DC  I 5 124 ? 245.029 250.195 291.167 1.00 49.80  ? 40  DC  I N1    1 
ATOM 8581  C C2    . DC  I 5 124 ? 243.935 250.136 292.021 1.00 49.80  ? 40  DC  I C2    1 
ATOM 8582  O O2    . DC  I 5 124 ? 244.128 250.137 293.231 1.00 49.80  ? 40  DC  I O2    1 
ATOM 8583  N N3    . DC  I 5 124 ? 242.700 250.058 291.495 1.00 49.80  ? 40  DC  I N3    1 
ATOM 8584  C C4    . DC  I 5 124 ? 242.540 250.051 290.182 1.00 49.80  ? 40  DC  I C4    1 
ATOM 8585  N N4    . DC  I 5 124 ? 241.300 249.975 289.701 1.00 49.80  ? 40  DC  I N4    1 
ATOM 8586  C C5    . DC  I 5 124 ? 243.644 250.122 289.294 1.00 49.80  ? 40  DC  I C5    1 
ATOM 8587  C C6    . DC  I 5 124 ? 244.859 250.190 289.826 1.00 49.80  ? 40  DC  I C6    1 
ATOM 8588  P P     . DC  I 5 125 ? 249.987 248.353 292.882 1.00 51.59  ? 41  DC  I P     1 
ATOM 8589  O OP1   . DC  I 5 125 ? 251.438 248.622 292.853 1.00 51.59  ? 41  DC  I OP1   1 
ATOM 8590  O OP2   . DC  I 5 125 ? 249.427 247.290 292.022 1.00 51.59  ? 41  DC  I OP2   1 
ATOM 8591  O "O5'" . DC  I 5 125 ? 249.548 248.020 294.371 1.00 51.59  ? 41  DC  I "O5'" 1 
ATOM 8592  C "C5'" . DC  I 5 125 ? 248.398 248.651 294.906 1.00 51.59  ? 41  DC  I "C5'" 1 
ATOM 8593  C "C4'" . DC  I 5 125 ? 247.544 247.649 295.645 1.00 51.59  ? 41  DC  I "C4'" 1 
ATOM 8594  O "O4'" . DC  I 5 125 ? 246.184 247.698 295.142 1.00 51.59  ? 41  DC  I "O4'" 1 
ATOM 8595  C "C3'" . DC  I 5 125 ? 247.990 246.206 295.483 1.00 51.59  ? 41  DC  I "C3'" 1 
ATOM 8596  O "O3'" . DC  I 5 125 ? 247.744 245.511 296.676 1.00 51.59  ? 41  DC  I "O3'" 1 
ATOM 8597  C "C2'" . DC  I 5 125 ? 247.095 245.711 294.359 1.00 51.59  ? 41  DC  I "C2'" 1 
ATOM 8598  C "C1'" . DC  I 5 125 ? 245.802 246.416 294.704 1.00 51.59  ? 41  DC  I "C1'" 1 
ATOM 8599  N N1    . DC  I 5 125 ? 244.895 246.569 293.558 1.00 51.59  ? 41  DC  I N1    1 
ATOM 8600  C C2    . DC  I 5 125 ? 243.525 246.453 293.752 1.00 51.59  ? 41  DC  I C2    1 
ATOM 8601  O O2    . DC  I 5 125 ? 243.104 246.221 294.885 1.00 51.59  ? 41  DC  I O2    1 
ATOM 8602  N N3    . DC  I 5 125 ? 242.705 246.600 292.695 1.00 51.59  ? 41  DC  I N3    1 
ATOM 8603  C C4    . DC  I 5 125 ? 243.210 246.847 291.493 1.00 51.59  ? 41  DC  I C4    1 
ATOM 8604  N N4    . DC  I 5 125 ? 242.364 246.980 290.476 1.00 51.59  ? 41  DC  I N4    1 
ATOM 8605  C C5    . DC  I 5 125 ? 244.604 246.968 291.277 1.00 51.59  ? 41  DC  I C5    1 
ATOM 8606  C C6    . DC  I 5 125 ? 245.402 246.821 292.328 1.00 51.59  ? 41  DC  I C6    1 
ATOM 8607  P P     . DA  I 5 126 ? 248.563 244.180 297.026 1.00 51.92  ? 42  DA  I P     1 
ATOM 8608  O OP1   . DA  I 5 126 ? 249.527 244.535 298.087 1.00 51.92  ? 42  DA  I OP1   1 
ATOM 8609  O OP2   . DA  I 5 126 ? 249.044 243.575 295.766 1.00 51.92  ? 42  DA  I OP2   1 
ATOM 8610  O "O5'" . DA  I 5 126 ? 247.445 243.228 297.641 1.00 51.92  ? 42  DA  I "O5'" 1 
ATOM 8611  C "C5'" . DA  I 5 126 ? 246.387 243.800 298.383 1.00 51.92  ? 42  DA  I "C5'" 1 
ATOM 8612  C "C4'" . DA  I 5 126 ? 245.198 242.866 298.449 1.00 51.92  ? 42  DA  I "C4'" 1 
ATOM 8613  O "O4'" . DA  I 5 126 ? 244.280 243.163 297.368 1.00 51.92  ? 42  DA  I "O4'" 1 
ATOM 8614  C "C3'" . DA  I 5 126 ? 245.525 241.387 298.319 1.00 51.92  ? 42  DA  I "C3'" 1 
ATOM 8615  O "O3'" . DA  I 5 126 ? 244.616 240.648 299.104 1.00 51.92  ? 42  DA  I "O3'" 1 
ATOM 8616  C "C2'" . DA  I 5 126 ? 245.300 241.137 296.835 1.00 51.92  ? 42  DA  I "C2'" 1 
ATOM 8617  C "C1'" . DA  I 5 126 ? 244.087 242.010 296.586 1.00 51.92  ? 42  DA  I "C1'" 1 
ATOM 8618  N N9    . DA  I 5 126 ? 243.936 242.417 295.200 1.00 51.92  ? 42  DA  I N9    1 
ATOM 8619  C C8    . DA  I 5 126 ? 244.925 242.748 294.327 1.00 51.92  ? 42  DA  I C8    1 
ATOM 8620  N N7    . DA  I 5 126 ? 244.489 243.076 293.141 1.00 51.92  ? 42  DA  I N7    1 
ATOM 8621  C C5    . DA  I 5 126 ? 243.122 242.946 293.249 1.00 51.92  ? 42  DA  I C5    1 
ATOM 8622  C C6    . DA  I 5 126 ? 242.082 243.151 292.337 1.00 51.92  ? 42  DA  I C6    1 
ATOM 8623  N N6    . DA  I 5 126 ? 242.282 243.549 291.082 1.00 51.92  ? 42  DA  I N6    1 
ATOM 8624  N N1    . DA  I 5 126 ? 240.824 242.931 292.764 1.00 51.92  ? 42  DA  I N1    1 
ATOM 8625  C C2    . DA  I 5 126 ? 240.634 242.544 294.021 1.00 51.92  ? 42  DA  I C2    1 
ATOM 8626  N N3    . DA  I 5 126 ? 241.533 242.319 294.967 1.00 51.92  ? 42  DA  I N3    1 
ATOM 8627  C C4    . DA  I 5 126 ? 242.767 242.546 294.512 1.00 51.92  ? 42  DA  I C4    1 
ATOM 8628  P P     . DA  I 5 127 ? 244.866 239.094 299.411 1.00 52.08  ? 43  DA  I P     1 
ATOM 8629  O OP1   . DA  I 5 127 ? 244.936 238.960 300.879 1.00 52.08  ? 43  DA  I OP1   1 
ATOM 8630  O OP2   . DA  I 5 127 ? 245.973 238.595 298.569 1.00 52.08  ? 43  DA  I OP2   1 
ATOM 8631  O "O5'" . DA  I 5 127 ? 243.519 238.405 298.920 1.00 52.08  ? 43  DA  I "O5'" 1 
ATOM 8632  C "C5'" . DA  I 5 127 ? 242.278 238.923 299.352 1.00 52.08  ? 43  DA  I "C5'" 1 
ATOM 8633  C "C4'" . DA  I 5 127 ? 241.155 238.415 298.481 1.00 52.08  ? 43  DA  I "C4'" 1 
ATOM 8634  O "O4'" . DA  I 5 127 ? 241.210 239.063 297.190 1.00 52.08  ? 43  DA  I "O4'" 1 
ATOM 8635  C "C3'" . DA  I 5 127 ? 241.181 236.915 298.211 1.00 52.08  ? 43  DA  I "C3'" 1 
ATOM 8636  O "O3'" . DA  I 5 127 ? 239.882 236.383 298.417 1.00 52.08  ? 43  DA  I "O3'" 1 
ATOM 8637  C "C2'" . DA  I 5 127 ? 241.630 236.819 296.746 1.00 52.08  ? 43  DA  I "C2'" 1 
ATOM 8638  C "C1'" . DA  I 5 127 ? 241.072 238.105 296.170 1.00 52.08  ? 43  DA  I "C1'" 1 
ATOM 8639  N N9    . DA  I 5 127 ? 241.785 238.604 295.002 1.00 52.08  ? 43  DA  I N9    1 
ATOM 8640  C C8    . DA  I 5 127 ? 243.124 238.825 294.883 1.00 52.08  ? 43  DA  I C8    1 
ATOM 8641  N N7    . DA  I 5 127 ? 243.477 239.312 293.722 1.00 52.08  ? 43  DA  I N7    1 
ATOM 8642  C C5    . DA  I 5 127 ? 242.285 239.434 293.041 1.00 52.08  ? 43  DA  I C5    1 
ATOM 8643  C C6    . DA  I 5 127 ? 241.977 239.885 291.753 1.00 52.08  ? 43  DA  I C6    1 
ATOM 8644  N N6    . DA  I 5 127 ? 242.891 240.326 290.896 1.00 52.08  ? 43  DA  I N6    1 
ATOM 8645  N N1    . DA  I 5 127 ? 240.684 239.875 291.380 1.00 52.08  ? 43  DA  I N1    1 
ATOM 8646  C C2    . DA  I 5 127 ? 239.774 239.440 292.246 1.00 52.08  ? 43  DA  I C2    1 
ATOM 8647  N N3    . DA  I 5 127 ? 239.944 238.985 293.480 1.00 52.08  ? 43  DA  I N3    1 
ATOM 8648  C C4    . DA  I 5 127 ? 241.234 239.008 293.818 1.00 52.08  ? 43  DA  I C4    1 
ATOM 8649  P P     . DT  I 5 128 ? 239.575 234.833 298.148 1.00 52.20  ? 44  DT  I P     1 
ATOM 8650  O OP1   . DT  I 5 128 ? 238.533 234.409 299.103 1.00 52.20  ? 44  DT  I OP1   1 
ATOM 8651  O OP2   . DT  I 5 128 ? 240.855 234.102 298.077 1.00 52.20  ? 44  DT  I OP2   1 
ATOM 8652  O "O5'" . DT  I 5 128 ? 238.925 234.842 296.700 1.00 52.20  ? 44  DT  I "O5'" 1 
ATOM 8653  C "C5'" . DT  I 5 128 ? 237.920 235.789 296.391 1.00 52.20  ? 44  DT  I "C5'" 1 
ATOM 8654  C "C4'" . DT  I 5 128 ? 237.284 235.472 295.056 1.00 52.20  ? 44  DT  I "C4'" 1 
ATOM 8655  O "O4'" . DT  I 5 128 ? 238.061 236.066 293.990 1.00 52.20  ? 44  DT  I "O4'" 1 
ATOM 8656  C "C3'" . DT  I 5 128 ? 237.198 233.992 294.722 1.00 52.20  ? 44  DT  I "C3'" 1 
ATOM 8657  O "O3'" . DT  I 5 128 ? 236.031 233.767 293.972 1.00 52.20  ? 44  DT  I "O3'" 1 
ATOM 8658  C "C2'" . DT  I 5 128 ? 238.455 233.774 293.883 1.00 52.20  ? 44  DT  I "C2'" 1 
ATOM 8659  C "C1'" . DT  I 5 128 ? 238.476 235.063 293.091 1.00 52.20  ? 44  DT  I "C1'" 1 
ATOM 8660  N N1    . DT  I 5 128 ? 239.801 235.447 292.572 1.00 52.20  ? 44  DT  I N1    1 
ATOM 8661  C C2    . DT  I 5 128 ? 239.868 236.077 291.362 1.00 52.20  ? 44  DT  I C2    1 
ATOM 8662  O O2    . DT  I 5 128 ? 238.894 236.307 290.680 1.00 52.20  ? 44  DT  I O2    1 
ATOM 8663  N N3    . DT  I 5 128 ? 241.118 236.414 290.960 1.00 52.20  ? 44  DT  I N3    1 
ATOM 8664  C C4    . DT  I 5 128 ? 242.291 236.211 291.644 1.00 52.20  ? 44  DT  I C4    1 
ATOM 8665  O O4    . DT  I 5 128 ? 243.374 236.560 291.197 1.00 52.20  ? 44  DT  I O4    1 
ATOM 8666  C C5    . DT  I 5 128 ? 242.153 235.554 292.919 1.00 52.20  ? 44  DT  I C5    1 
ATOM 8667  C C7    . DT  I 5 128 ? 243.360 235.280 293.753 1.00 52.20  ? 44  DT  I C7    1 
ATOM 8668  C C6    . DT  I 5 128 ? 240.926 235.215 293.323 1.00 52.20  ? 44  DT  I C6    1 
ATOM 8669  P P     . DT  I 5 129 ? 235.362 232.313 293.925 1.00 50.69  ? 45  DT  I P     1 
ATOM 8670  O OP1   . DT  I 5 129 ? 234.038 232.420 294.568 1.00 50.69  ? 45  DT  I OP1   1 
ATOM 8671  O OP2   . DT  I 5 129 ? 236.361 231.340 294.414 1.00 50.69  ? 45  DT  I OP2   1 
ATOM 8672  O "O5'" . DT  I 5 129 ? 235.158 232.054 292.368 1.00 50.69  ? 45  DT  I "O5'" 1 
ATOM 8673  C "C5'" . DT  I 5 129 ? 234.752 233.116 291.529 1.00 50.69  ? 45  DT  I "C5'" 1 
ATOM 8674  C "C4'" . DT  I 5 129 ? 235.182 232.859 290.102 1.00 50.69  ? 45  DT  I "C4'" 1 
ATOM 8675  O "O4'" . DT  I 5 129 ? 236.559 233.279 289.925 1.00 50.69  ? 45  DT  I "O4'" 1 
ATOM 8676  C "C3'" . DT  I 5 129 ? 235.136 231.395 289.669 1.00 50.69  ? 45  DT  I "C3'" 1 
ATOM 8677  O "O3'" . DT  I 5 129 ? 234.691 231.317 288.336 1.00 50.69  ? 45  DT  I "O3'" 1 
ATOM 8678  C "C2'" . DT  I 5 129 ? 236.597 230.979 289.776 1.00 50.69  ? 45  DT  I "C2'" 1 
ATOM 8679  C "C1'" . DT  I 5 129 ? 237.262 232.246 289.292 1.00 50.69  ? 45  DT  I "C1'" 1 
ATOM 8680  N N1    . DT  I 5 129 ? 238.689 232.361 289.639 1.00 50.69  ? 45  DT  I N1    1 
ATOM 8681  C C2    . DT  I 5 129 ? 239.520 233.043 288.795 1.00 50.69  ? 45  DT  I C2    1 
ATOM 8682  O O2    . DT  I 5 129 ? 239.142 233.559 287.768 1.00 50.69  ? 45  DT  I O2    1 
ATOM 8683  N N3    . DT  I 5 129 ? 240.816 233.100 289.192 1.00 50.69  ? 45  DT  I N3    1 
ATOM 8684  C C4    . DT  I 5 129 ? 241.362 232.553 290.325 1.00 50.69  ? 45  DT  I C4    1 
ATOM 8685  O O4    . DT  I 5 129 ? 242.548 232.661 290.593 1.00 50.69  ? 45  DT  I O4    1 
ATOM 8686  C C5    . DT  I 5 129 ? 240.439 231.852 291.174 1.00 50.69  ? 45  DT  I C5    1 
ATOM 8687  C C7    . DT  I 5 129 ? 240.919 231.218 292.439 1.00 50.69  ? 45  DT  I C7    1 
ATOM 8688  C C6    . DT  I 5 129 ? 239.159 231.788 290.794 1.00 50.69  ? 45  DT  I C6    1 
ATOM 8689  P P     . DG  I 5 130 ? 233.142 231.080 288.001 1.00 48.87  ? 46  DG  I P     1 
ATOM 8690  O OP1   . DG  I 5 130 ? 232.358 232.156 288.632 1.00 48.87  ? 46  DG  I OP1   1 
ATOM 8691  O OP2   . DG  I 5 130 ? 232.846 229.664 288.298 1.00 48.87  ? 46  DG  I OP2   1 
ATOM 8692  O "O5'" . DG  I 5 130 ? 233.063 231.280 286.421 1.00 48.87  ? 46  DG  I "O5'" 1 
ATOM 8693  C "C5'" . DG  I 5 130 ? 233.302 232.559 285.848 1.00 48.87  ? 46  DG  I "C5'" 1 
ATOM 8694  C "C4'" . DG  I 5 130 ? 234.171 232.457 284.603 1.00 48.87  ? 46  DG  I "C4'" 1 
ATOM 8695  O "O4'" . DG  I 5 130 ? 235.558 232.298 284.986 1.00 48.87  ? 46  DG  I "O4'" 1 
ATOM 8696  C "C3'" . DG  I 5 130 ? 233.875 231.282 283.683 1.00 48.87  ? 46  DG  I "C3'" 1 
ATOM 8697  O "O3'" . DG  I 5 130 ? 234.247 231.623 282.366 1.00 48.87  ? 46  DG  I "O3'" 1 
ATOM 8698  C "C2'" . DG  I 5 130 ? 234.820 230.228 284.231 1.00 48.87  ? 46  DG  I "C2'" 1 
ATOM 8699  C "C1'" . DG  I 5 130 ? 236.048 231.082 284.467 1.00 48.87  ? 46  DG  I "C1'" 1 
ATOM 8700  N N9    . DG  I 5 130 ? 236.979 230.529 285.429 1.00 48.87  ? 46  DG  I N9    1 
ATOM 8701  C C8    . DG  I 5 130 ? 236.699 229.663 286.445 1.00 48.87  ? 46  DG  I C8    1 
ATOM 8702  N N7    . DG  I 5 130 ? 237.740 229.352 287.158 1.00 48.87  ? 46  DG  I N7    1 
ATOM 8703  C C5    . DG  I 5 130 ? 238.770 230.062 286.577 1.00 48.87  ? 46  DG  I C5    1 
ATOM 8704  C C6    . DG  I 5 130 ? 240.132 230.126 286.917 1.00 48.87  ? 46  DG  I C6    1 
ATOM 8705  O O6    . DG  I 5 130 ? 240.722 229.549 287.832 1.00 48.87  ? 46  DG  I O6    1 
ATOM 8706  N N1    . DG  I 5 130 ? 240.828 230.968 286.071 1.00 48.87  ? 46  DG  I N1    1 
ATOM 8707  C C2    . DG  I 5 130 ? 240.279 231.658 285.030 1.00 48.87  ? 46  DG  I C2    1 
ATOM 8708  N N2    . DG  I 5 130 ? 241.110 232.419 284.319 1.00 48.87  ? 46  DG  I N2    1 
ATOM 8709  N N3    . DG  I 5 130 ? 239.007 231.608 284.702 1.00 48.87  ? 46  DG  I N3    1 
ATOM 8710  C C4    . DG  I 5 130 ? 238.315 230.795 285.515 1.00 48.87  ? 46  DG  I C4    1 
ATOM 8711  P P     . DA  I 5 131 ? 233.181 232.179 281.306 1.00 47.37  ? 47  DA  I P     1 
ATOM 8712  O OP1   . DA  I 5 131 ? 232.220 233.039 282.016 1.00 47.37  ? 47  DA  I OP1   1 
ATOM 8713  O OP2   . DA  I 5 131 ? 232.690 231.031 280.524 1.00 47.37  ? 47  DA  I OP2   1 
ATOM 8714  O "O5'" . DA  I 5 131 ? 234.075 233.081 280.339 1.00 47.37  ? 47  DA  I "O5'" 1 
ATOM 8715  C "C5'" . DA  I 5 131 ? 235.042 233.945 280.899 1.00 47.37  ? 47  DA  I "C5'" 1 
ATOM 8716  C "C4'" . DA  I 5 131 ? 236.249 234.126 279.988 1.00 47.37  ? 47  DA  I "C4'" 1 
ATOM 8717  O "O4'" . DA  I 5 131 ? 237.374 233.349 280.463 1.00 47.37  ? 47  DA  I "O4'" 1 
ATOM 8718  C "C3'" . DA  I 5 131 ? 236.085 233.718 278.549 1.00 47.37  ? 47  DA  I "C3'" 1 
ATOM 8719  O "O3'" . DA  I 5 131 ? 236.991 234.500 277.788 1.00 47.37  ? 47  DA  I "O3'" 1 
ATOM 8720  C "C2'" . DA  I 5 131 ? 236.479 232.236 278.584 1.00 47.37  ? 47  DA  I "C2'" 1 
ATOM 8721  C "C1'" . DA  I 5 131 ? 237.581 232.215 279.639 1.00 47.37  ? 47  DA  I "C1'" 1 
ATOM 8722  N N9    . DA  I 5 131 ? 237.549 231.066 280.528 1.00 47.37  ? 47  DA  I N9    1 
ATOM 8723  C C8    . DA  I 5 131 ? 236.458 230.346 280.900 1.00 47.37  ? 47  DA  I C8    1 
ATOM 8724  N N7    . DA  I 5 131 ? 236.721 229.400 281.760 1.00 47.37  ? 47  DA  I N7    1 
ATOM 8725  C C5    . DA  I 5 131 ? 238.073 229.523 281.984 1.00 47.37  ? 47  DA  I C5    1 
ATOM 8726  C C6    . DA  I 5 131 ? 238.956 228.813 282.805 1.00 47.37  ? 47  DA  I C6    1 
ATOM 8727  N N6    . DA  I 5 131 ? 238.575 227.797 283.573 1.00 47.37  ? 47  DA  I N6    1 
ATOM 8728  N N1    . DA  I 5 131 ? 240.245 229.182 282.803 1.00 47.37  ? 47  DA  I N1    1 
ATOM 8729  C C2    . DA  I 5 131 ? 240.618 230.199 282.024 1.00 47.37  ? 47  DA  I C2    1 
ATOM 8730  N N3    . DA  I 5 131 ? 239.875 230.947 281.216 1.00 47.37  ? 47  DA  I N3    1 
ATOM 8731  C C4    . DA  I 5 131 ? 238.599 230.551 281.244 1.00 47.37  ? 47  DA  I C4    1 
ATOM 8732  P P     . DG  I 5 132 ? 237.215 234.260 276.223 1.00 46.39  ? 48  DG  I P     1 
ATOM 8733  O OP1   . DG  I 5 132 ? 237.428 235.591 275.638 1.00 46.39  ? 48  DG  I OP1   1 
ATOM 8734  O OP2   . DG  I 5 132 ? 236.163 233.379 275.684 1.00 46.39  ? 48  DG  I OP2   1 
ATOM 8735  O "O5'" . DG  I 5 132 ? 238.602 233.493 276.165 1.00 46.39  ? 48  DG  I "O5'" 1 
ATOM 8736  C "C5'" . DG  I 5 132 ? 239.767 234.120 276.642 1.00 46.39  ? 48  DG  I "C5'" 1 
ATOM 8737  C "C4'" . DG  I 5 132 ? 240.954 233.188 276.541 1.00 46.39  ? 48  DG  I "C4'" 1 
ATOM 8738  O "O4'" . DG  I 5 132 ? 240.788 232.082 277.458 1.00 46.39  ? 48  DG  I "O4'" 1 
ATOM 8739  C "C3'" . DG  I 5 132 ? 241.180 232.552 275.173 1.00 46.39  ? 48  DG  I "C3'" 1 
ATOM 8740  O "O3'" . DG  I 5 132 ? 242.557 232.387 274.987 1.00 46.39  ? 48  DG  I "O3'" 1 
ATOM 8741  C "C2'" . DG  I 5 132 ? 240.488 231.205 275.324 1.00 46.39  ? 48  DG  I "C2'" 1 
ATOM 8742  C "C1'" . DG  I 5 132 ? 240.861 230.867 276.749 1.00 46.39  ? 48  DG  I "C1'" 1 
ATOM 8743  N N9    . DG  I 5 132 ? 239.968 229.925 277.396 1.00 46.39  ? 48  DG  I N9    1 
ATOM 8744  C C8    . DG  I 5 132 ? 238.623 229.795 277.211 1.00 46.39  ? 48  DG  I C8    1 
ATOM 8745  N N7    . DG  I 5 132 ? 238.090 228.876 277.953 1.00 46.39  ? 48  DG  I N7    1 
ATOM 8746  C C5    . DG  I 5 132 ? 239.153 228.375 278.684 1.00 46.39  ? 48  DG  I C5    1 
ATOM 8747  C C6    . DG  I 5 132 ? 239.189 227.361 279.658 1.00 46.39  ? 48  DG  I C6    1 
ATOM 8748  O O6    . DG  I 5 132 ? 238.256 226.680 280.078 1.00 46.39  ? 48  DG  I O6    1 
ATOM 8749  N N1    . DG  I 5 132 ? 240.467 227.165 280.146 1.00 46.39  ? 48  DG  I N1    1 
ATOM 8750  C C2    . DG  I 5 132 ? 241.571 227.870 279.750 1.00 46.39  ? 48  DG  I C2    1 
ATOM 8751  N N2    . DG  I 5 132 ? 242.728 227.549 280.330 1.00 46.39  ? 48  DG  I N2    1 
ATOM 8752  N N3    . DG  I 5 132 ? 241.547 228.819 278.840 1.00 46.39  ? 48  DG  I N3    1 
ATOM 8753  C C4    . DG  I 5 132 ? 240.309 229.015 278.353 1.00 46.39  ? 48  DG  I C4    1 
ATOM 8754  P P     . DC  I 5 133 ? 243.191 232.225 273.529 1.00 47.90  ? 49  DC  I P     1 
ATOM 8755  O OP1   . DC  I 5 133 ? 243.720 233.537 273.133 1.00 47.90  ? 49  DC  I OP1   1 
ATOM 8756  O OP2   . DC  I 5 133 ? 242.239 231.514 272.665 1.00 47.90  ? 49  DC  I OP2   1 
ATOM 8757  O "O5'" . DC  I 5 133 ? 244.434 231.278 273.796 1.00 47.90  ? 49  DC  I "O5'" 1 
ATOM 8758  C "C5'" . DC  I 5 133 ? 245.084 231.324 275.055 1.00 47.90  ? 49  DC  I "C5'" 1 
ATOM 8759  C "C4'" . DC  I 5 133 ? 245.691 229.984 275.380 1.00 47.90  ? 49  DC  I "C4'" 1 
ATOM 8760  O "O4'" . DC  I 5 133 ? 244.759 229.207 276.170 1.00 47.90  ? 49  DC  I "O4'" 1 
ATOM 8761  C "C3'" . DC  I 5 133 ? 246.017 229.149 274.153 1.00 47.90  ? 49  DC  I "C3'" 1 
ATOM 8762  O "O3'" . DC  I 5 133 ? 247.320 228.649 274.239 1.00 47.90  ? 49  DC  I "O3'" 1 
ATOM 8763  C "C2'" . DC  I 5 133 ? 244.977 228.038 274.181 1.00 47.90  ? 49  DC  I "C2'" 1 
ATOM 8764  C "C1'" . DC  I 5 133 ? 244.671 227.907 275.655 1.00 47.90  ? 49  DC  I "C1'" 1 
ATOM 8765  N N1    . DC  I 5 133 ? 243.305 227.402 275.905 1.00 47.90  ? 49  DC  I N1    1 
ATOM 8766  C C2    . DC  I 5 133 ? 243.097 226.356 276.801 1.00 47.90  ? 49  DC  I C2    1 
ATOM 8767  O O2    . DC  I 5 133 ? 244.062 225.871 277.389 1.00 47.90  ? 49  DC  I O2    1 
ATOM 8768  N N3    . DC  I 5 133 ? 241.842 225.911 277.002 1.00 47.90  ? 49  DC  I N3    1 
ATOM 8769  C C4    . DC  I 5 133 ? 240.832 226.462 276.350 1.00 47.90  ? 49  DC  I C4    1 
ATOM 8770  N N4    . DC  I 5 133 ? 239.608 225.995 276.578 1.00 47.90  ? 49  DC  I N4    1 
ATOM 8771  C C5    . DC  I 5 133 ? 241.027 227.518 275.430 1.00 47.90  ? 49  DC  I C5    1 
ATOM 8772  C C6    . DC  I 5 133 ? 242.265 227.950 275.240 1.00 47.90  ? 49  DC  I C6    1 
ATOM 8773  P P     . DG  I 5 134 ? 248.040 228.066 272.934 1.00 52.50  ? 50  DG  I P     1 
ATOM 8774  O OP1   . DG  I 5 134 ? 249.236 228.884 272.682 1.00 52.50  ? 50  DG  I OP1   1 
ATOM 8775  O OP2   . DG  I 5 134 ? 247.036 227.900 271.869 1.00 52.50  ? 50  DG  I OP2   1 
ATOM 8776  O "O5'" . DG  I 5 134 ? 248.495 226.615 273.386 1.00 52.50  ? 50  DG  I "O5'" 1 
ATOM 8777  C "C5'" . DG  I 5 134 ? 249.115 226.434 274.640 1.00 52.50  ? 50  DG  I "C5'" 1 
ATOM 8778  C "C4'" . DG  I 5 134 ? 248.983 224.999 275.099 1.00 52.50  ? 50  DG  I "C4'" 1 
ATOM 8779  O "O4'" . DG  I 5 134 ? 247.614 224.735 275.497 1.00 52.50  ? 50  DG  I "O4'" 1 
ATOM 8780  C "C3'" . DG  I 5 134 ? 249.323 223.953 274.049 1.00 52.50  ? 50  DG  I "C3'" 1 
ATOM 8781  O "O3'" . DG  I 5 134 ? 249.957 222.863 274.676 1.00 52.50  ? 50  DG  I "O3'" 1 
ATOM 8782  C "C2'" . DG  I 5 134 ? 247.957 223.567 273.505 1.00 52.50  ? 50  DG  I "C2'" 1 
ATOM 8783  C "C1'" . DG  I 5 134 ? 247.097 223.660 274.751 1.00 52.50  ? 50  DG  I "C1'" 1 
ATOM 8784  N N9    . DG  I 5 134 ? 245.699 223.937 274.464 1.00 52.50  ? 50  DG  I N9    1 
ATOM 8785  C C8    . DG  I 5 134 ? 245.213 224.899 273.631 1.00 52.50  ? 50  DG  I C8    1 
ATOM 8786  N N7    . DG  I 5 134 ? 243.920 224.927 273.568 1.00 52.50  ? 50  DG  I N7    1 
ATOM 8787  C C5    . DG  I 5 134 ? 243.520 223.910 274.408 1.00 52.50  ? 50  DG  I C5    1 
ATOM 8788  C C6    . DG  I 5 134 ? 242.228 223.464 274.730 1.00 52.50  ? 50  DG  I C6    1 
ATOM 8789  O O6    . DG  I 5 134 ? 241.147 223.895 274.329 1.00 52.50  ? 50  DG  I O6    1 
ATOM 8790  N N1    . DG  I 5 134 ? 242.262 222.406 275.616 1.00 52.50  ? 50  DG  I N1    1 
ATOM 8791  C C2    . DG  I 5 134 ? 243.401 221.850 276.124 1.00 52.50  ? 50  DG  I C2    1 
ATOM 8792  N N2    . DG  I 5 134 ? 243.240 220.831 276.968 1.00 52.50  ? 50  DG  I N2    1 
ATOM 8793  N N3    . DG  I 5 134 ? 244.620 222.260 275.828 1.00 52.50  ? 50  DG  I N3    1 
ATOM 8794  C C4    . DG  I 5 134 ? 244.602 223.289 274.967 1.00 52.50  ? 50  DG  I C4    1 
ATOM 8795  P P     . DG  I 5 135 ? 250.757 221.769 273.820 1.00 54.79  ? 51  DG  I P     1 
ATOM 8796  O OP1   . DG  I 5 135 ? 252.029 221.542 274.525 1.00 54.79  ? 51  DG  I OP1   1 
ATOM 8797  O OP2   . DG  I 5 135 ? 250.766 222.167 272.400 1.00 54.79  ? 51  DG  I OP2   1 
ATOM 8798  O "O5'" . DG  I 5 135 ? 249.862 220.464 273.970 1.00 54.79  ? 51  DG  I "O5'" 1 
ATOM 8799  C "C5'" . DG  I 5 135 ? 249.450 220.053 275.252 1.00 54.79  ? 51  DG  I "C5'" 1 
ATOM 8800  C "C4'" . DG  I 5 135 ? 248.310 219.063 275.161 1.00 54.79  ? 51  DG  I "C4'" 1 
ATOM 8801  O "O4'" . DG  I 5 135 ? 247.068 219.762 274.901 1.00 54.79  ? 51  DG  I "O4'" 1 
ATOM 8802  C "C3'" . DG  I 5 135 ? 248.443 218.024 274.051 1.00 54.79  ? 51  DG  I "C3'" 1 
ATOM 8803  O "O3'" . DG  I 5 135 ? 248.022 216.768 274.540 1.00 54.79  ? 51  DG  I "O3'" 1 
ATOM 8804  C "C2'" . DG  I 5 135 ? 247.484 218.545 272.987 1.00 54.79  ? 51  DG  I "C2'" 1 
ATOM 8805  C "C1'" . DG  I 5 135 ? 246.391 219.097 273.868 1.00 54.79  ? 51  DG  I "C1'" 1 
ATOM 8806  N N9    . DG  I 5 135 ? 245.507 220.038 273.201 1.00 54.79  ? 51  DG  I N9    1 
ATOM 8807  C C8    . DG  I 5 135 ? 245.859 221.137 272.468 1.00 54.79  ? 51  DG  I C8    1 
ATOM 8808  N N7    . DG  I 5 135 ? 244.838 221.787 271.996 1.00 54.79  ? 51  DG  I N7    1 
ATOM 8809  C C5    . DG  I 5 135 ? 243.747 221.069 272.446 1.00 54.79  ? 51  DG  I C5    1 
ATOM 8810  C C6    . DG  I 5 135 ? 242.374 221.290 272.255 1.00 54.79  ? 51  DG  I C6    1 
ATOM 8811  O O6    . DG  I 5 135 ? 241.826 222.194 271.623 1.00 54.79  ? 51  DG  I O6    1 
ATOM 8812  N N1    . DG  I 5 135 ? 241.608 220.319 272.881 1.00 54.79  ? 51  DG  I N1    1 
ATOM 8813  C C2    . DG  I 5 135 ? 242.111 219.274 273.602 1.00 54.79  ? 51  DG  I C2    1 
ATOM 8814  N N2    . DG  I 5 135 ? 241.226 218.429 274.140 1.00 54.79  ? 51  DG  I N2    1 
ATOM 8815  N N3    . DG  I 5 135 ? 243.393 219.063 273.790 1.00 54.79  ? 51  DG  I N3    1 
ATOM 8816  C C4    . DG  I 5 135 ? 244.147 219.994 273.189 1.00 54.79  ? 51  DG  I C4    1 
ATOM 8817  P P     . DC  I 5 136 ? 248.604 215.415 273.910 1.00 56.00  ? 52  DC  I P     1 
ATOM 8818  O OP1   . DC  I 5 136 ? 249.796 215.058 274.701 1.00 56.00  ? 52  DC  I OP1   1 
ATOM 8819  O OP2   . DC  I 5 136 ? 248.716 215.595 272.447 1.00 56.00  ? 52  DC  I OP2   1 
ATOM 8820  O "O5'" . DC  I 5 136 ? 247.452 214.346 274.186 1.00 56.00  ? 52  DC  I "O5'" 1 
ATOM 8821  C "C5'" . DC  I 5 136 ? 246.166 214.787 274.585 1.00 56.00  ? 52  DC  I "C5'" 1 
ATOM 8822  C "C4'" . DC  I 5 136 ? 245.117 214.344 273.590 1.00 56.00  ? 52  DC  I "C4'" 1 
ATOM 8823  O "O4'" . DC  I 5 136 ? 244.336 215.481 273.196 1.00 56.00  ? 52  DC  I "O4'" 1 
ATOM 8824  C "C3'" . DC  I 5 136 ? 245.673 213.777 272.296 1.00 56.00  ? 52  DC  I "C3'" 1 
ATOM 8825  O "O3'" . DC  I 5 136 ? 245.741 212.333 272.362 1.00 56.00  ? 52  DC  I "O3'" 1 
ATOM 8826  C "C2'" . DC  I 5 136 ? 244.708 214.271 271.210 1.00 56.00  ? 52  DC  I "C2'" 1 
ATOM 8827  C "C1'" . DC  I 5 136 ? 243.776 215.238 271.935 1.00 56.00  ? 52  DC  I "C1'" 1 
ATOM 8828  N N1    . DC  I 5 136 ? 243.633 216.533 271.237 1.00 56.00  ? 52  DC  I N1    1 
ATOM 8829  C C2    . DC  I 5 136 ? 242.363 217.024 270.941 1.00 56.00  ? 52  DC  I C2    1 
ATOM 8830  O O2    . DC  I 5 136 ? 241.377 216.367 271.275 1.00 56.00  ? 52  DC  I O2    1 
ATOM 8831  N N3    . DC  I 5 136 ? 242.254 218.206 270.300 1.00 56.00  ? 52  DC  I N3    1 
ATOM 8832  C C4    . DC  I 5 136 ? 243.346 218.879 269.963 1.00 56.00  ? 52  DC  I C4    1 
ATOM 8833  N N4    . DC  I 5 136 ? 243.194 220.043 269.329 1.00 56.00  ? 52  DC  I N4    1 
ATOM 8834  C C5    . DC  I 5 136 ? 244.650 218.393 270.256 1.00 56.00  ? 52  DC  I C5    1 
ATOM 8835  C C6    . DC  I 5 136 ? 244.744 217.226 270.885 1.00 56.00  ? 52  DC  I C6    1 
ATOM 8836  P P     . DC  I 5 137 ? 244.455 211.399 272.102 1.00 56.32  ? 53  DC  I P     1 
ATOM 8837  O OP1   . DC  I 5 137 ? 243.270 211.968 272.771 1.00 56.32  ? 53  DC  I OP1   1 
ATOM 8838  O OP2   . DC  I 5 137 ? 244.868 210.020 272.419 1.00 56.32  ? 53  DC  I OP2   1 
ATOM 8839  O "O5'" . DC  I 5 137 ? 244.243 211.444 270.523 1.00 56.32  ? 53  DC  I "O5'" 1 
ATOM 8840  C "C5'" . DC  I 5 137 ? 243.369 210.530 269.896 1.00 56.32  ? 53  DC  I "C5'" 1 
ATOM 8841  C "C4'" . DC  I 5 137 ? 241.915 210.949 270.042 1.00 56.32  ? 53  DC  I "C4'" 1 
ATOM 8842  O "O4'" . DC  I 5 137 ? 241.802 212.396 270.021 1.00 56.32  ? 53  DC  I "O4'" 1 
ATOM 8843  C "C3'" . DC  I 5 137 ? 241.011 210.445 268.935 1.00 56.32  ? 53  DC  I "C3'" 1 
ATOM 8844  O "O3'" . DC  I 5 137 ? 239.749 210.100 269.461 1.00 56.32  ? 53  DC  I "O3'" 1 
ATOM 8845  C "C2'" . DC  I 5 137 ? 240.936 211.634 267.981 1.00 56.32  ? 53  DC  I "C2'" 1 
ATOM 8846  C "C1'" . DC  I 5 137 ? 241.009 212.815 268.926 1.00 56.32  ? 53  DC  I "C1'" 1 
ATOM 8847  N N1    . DC  I 5 137 ? 241.656 214.036 268.344 1.00 56.32  ? 53  DC  I N1    1 
ATOM 8848  C C2    . DC  I 5 137 ? 240.878 215.094 267.857 1.00 56.32  ? 53  DC  I C2    1 
ATOM 8849  O O2    . DC  I 5 137 ? 239.651 214.999 267.875 1.00 56.32  ? 53  DC  I O2    1 
ATOM 8850  N N3    . DC  I 5 137 ? 241.504 216.189 267.360 1.00 56.32  ? 53  DC  I N3    1 
ATOM 8851  C C4    . DC  I 5 137 ? 242.832 216.251 267.360 1.00 56.32  ? 53  DC  I C4    1 
ATOM 8852  N N4    . DC  I 5 137 ? 243.411 217.348 266.874 1.00 56.32  ? 53  DC  I N4    1 
ATOM 8853  C C5    . DC  I 5 137 ? 243.630 215.195 267.865 1.00 56.32  ? 53  DC  I C5    1 
ATOM 8854  C C6    . DC  I 5 137 ? 243.008 214.121 268.339 1.00 56.32  ? 53  DC  I C6    1 
ATOM 8855  P P     . DT  I 5 138 ? 238.593 209.568 268.486 1.00 56.72  ? 54  DT  I P     1 
ATOM 8856  O OP1   . DT  I 5 138 ? 237.619 208.807 269.294 1.00 56.72  ? 54  DT  I OP1   1 
ATOM 8857  O OP2   . DT  I 5 138 ? 239.251 208.915 267.335 1.00 56.72  ? 54  DT  I OP2   1 
ATOM 8858  O "O5'" . DT  I 5 138 ? 237.911 210.915 267.971 1.00 56.72  ? 54  DT  I "O5'" 1 
ATOM 8859  C "C5'" . DT  I 5 138 ? 236.549 210.940 267.635 1.00 56.72  ? 54  DT  I "C5'" 1 
ATOM 8860  C "C4'" . DT  I 5 138 ? 236.373 211.408 266.211 1.00 56.72  ? 54  DT  I "C4'" 1 
ATOM 8861  O "O4'" . DT  I 5 138 ? 237.308 212.489 265.929 1.00 56.72  ? 54  DT  I "O4'" 1 
ATOM 8862  C "C3'" . DT  I 5 138 ? 236.652 210.343 265.152 1.00 56.72  ? 54  DT  I "C3'" 1 
ATOM 8863  O "O3'" . DT  I 5 138 ? 235.724 210.481 264.103 1.00 56.72  ? 54  DT  I "O3'" 1 
ATOM 8864  C "C2'" . DT  I 5 138 ? 238.048 210.720 264.684 1.00 56.72  ? 54  DT  I "C2'" 1 
ATOM 8865  C "C1'" . DT  I 5 138 ? 237.901 212.221 264.690 1.00 56.72  ? 54  DT  I "C1'" 1 
ATOM 8866  N N1    . DT  I 5 138 ? 239.170 212.969 264.554 1.00 56.72  ? 54  DT  I N1    1 
ATOM 8867  C C2    . DT  I 5 138 ? 239.132 214.267 264.111 1.00 56.72  ? 54  DT  I C2    1 
ATOM 8868  O O2    . DT  I 5 138 ? 238.102 214.852 263.849 1.00 56.72  ? 54  DT  I O2    1 
ATOM 8869  N N3    . DT  I 5 138 ? 240.345 214.866 264.000 1.00 56.72  ? 54  DT  I N3    1 
ATOM 8870  C C4    . DT  I 5 138 ? 241.571 214.316 264.271 1.00 56.72  ? 54  DT  I C4    1 
ATOM 8871  O O4    . DT  I 5 138 ? 242.610 214.944 264.141 1.00 56.72  ? 54  DT  I O4    1 
ATOM 8872  C C5    . DT  I 5 138 ? 241.548 212.949 264.720 1.00 56.72  ? 54  DT  I C5    1 
ATOM 8873  C C7    . DT  I 5 138 ? 242.829 212.244 265.041 1.00 56.72  ? 54  DT  I C7    1 
ATOM 8874  C C6    . DT  I 5 138 ? 240.359 212.343 264.827 1.00 56.72  ? 54  DT  I C6    1 
ATOM 8875  P P     . DC  I 5 139 ? 234.381 209.605 264.086 1.00 57.23  ? 55  DC  I P     1 
ATOM 8876  O OP1   . DC  I 5 139 ? 233.693 209.814 265.375 1.00 57.23  ? 55  DC  I OP1   1 
ATOM 8877  O OP2   . DC  I 5 139 ? 234.753 208.239 263.663 1.00 57.23  ? 55  DC  I OP2   1 
ATOM 8878  O "O5'" . DC  I 5 139 ? 233.508 210.277 262.929 1.00 57.23  ? 55  DC  I "O5'" 1 
ATOM 8879  C "C5'" . DC  I 5 139 ? 232.944 211.570 263.127 1.00 57.23  ? 55  DC  I "C5'" 1 
ATOM 8880  C "C4'" . DC  I 5 139 ? 233.253 212.497 261.962 1.00 57.23  ? 55  DC  I "C4'" 1 
ATOM 8881  O "O4'" . DC  I 5 139 ? 234.665 212.841 261.965 1.00 57.23  ? 55  DC  I "O4'" 1 
ATOM 8882  C "C3'" . DC  I 5 139 ? 232.979 211.924 260.576 1.00 57.23  ? 55  DC  I "C3'" 1 
ATOM 8883  O "O3'" . DC  I 5 139 ? 232.558 212.964 259.716 1.00 57.23  ? 55  DC  I "O3'" 1 
ATOM 8884  C "C2'" . DC  I 5 139 ? 234.356 211.420 260.171 1.00 57.23  ? 55  DC  I "C2'" 1 
ATOM 8885  C "C1'" . DC  I 5 139 ? 235.199 212.557 260.694 1.00 57.23  ? 55  DC  I "C1'" 1 
ATOM 8886  N N1    . DC  I 5 139 ? 236.629 212.245 260.842 1.00 57.23  ? 55  DC  I N1    1 
ATOM 8887  C C2    . DC  I 5 139 ? 237.558 213.247 260.618 1.00 57.23  ? 55  DC  I C2    1 
ATOM 8888  O O2    . DC  I 5 139 ? 237.156 214.361 260.291 1.00 57.23  ? 55  DC  I O2    1 
ATOM 8889  N N3    . DC  I 5 139 ? 238.867 212.970 260.760 1.00 57.23  ? 55  DC  I N3    1 
ATOM 8890  C C4    . DC  I 5 139 ? 239.252 211.753 261.113 1.00 57.23  ? 55  DC  I C4    1 
ATOM 8891  N N4    . DC  I 5 139 ? 240.559 211.531 261.248 1.00 57.23  ? 55  DC  I N4    1 
ATOM 8892  C C5    . DC  I 5 139 ? 238.317 210.711 261.350 1.00 57.23  ? 55  DC  I C5    1 
ATOM 8893  C C6    . DC  I 5 139 ? 237.025 211.000 261.207 1.00 57.23  ? 55  DC  I C6    1 
ATOM 8894  P P     . DG  I 5 140 ? 231.004 213.171 259.380 1.00 57.55  ? 56  DG  I P     1 
ATOM 8895  O OP1   . DG  I 5 140 ? 230.329 213.563 260.632 1.00 57.55  ? 56  DG  I OP1   1 
ATOM 8896  O OP2   . DG  I 5 140 ? 230.548 211.980 258.639 1.00 57.55  ? 56  DG  I OP2   1 
ATOM 8897  O "O5'" . DG  I 5 140 ? 230.992 214.413 258.372 1.00 57.55  ? 56  DG  I "O5'" 1 
ATOM 8898  C "C5'" . DG  I 5 140 ? 231.556 215.664 258.767 1.00 57.55  ? 56  DG  I "C5'" 1 
ATOM 8899  C "C4'" . DG  I 5 140 ? 232.317 216.336 257.627 1.00 57.55  ? 56  DG  I "C4'" 1 
ATOM 8900  O "O4'" . DG  I 5 140 ? 233.681 215.856 257.596 1.00 57.55  ? 56  DG  I "O4'" 1 
ATOM 8901  C "C3'" . DG  I 5 140 ? 231.788 216.085 256.224 1.00 57.55  ? 56  DG  I "C3'" 1 
ATOM 8902  O "O3'" . DG  I 5 140 ? 232.202 217.138 255.386 1.00 57.55  ? 56  DG  I "O3'" 1 
ATOM 8903  C "C2'" . DG  I 5 140 ? 232.533 214.817 255.855 1.00 57.55  ? 56  DG  I "C2'" 1 
ATOM 8904  C "C1'" . DG  I 5 140 ? 233.908 215.172 256.381 1.00 57.55  ? 56  DG  I "C1'" 1 
ATOM 8905  N N9    . DG  I 5 140 ? 234.743 214.032 256.675 1.00 57.55  ? 56  DG  I N9    1 
ATOM 8906  C C8    . DG  I 5 140 ? 234.337 212.757 256.949 1.00 57.55  ? 56  DG  I C8    1 
ATOM 8907  N N7    . DG  I 5 140 ? 235.320 211.949 257.208 1.00 57.55  ? 56  DG  I N7    1 
ATOM 8908  C C5    . DG  I 5 140 ? 236.443 212.746 257.110 1.00 57.55  ? 56  DG  I C5    1 
ATOM 8909  C C6    . DG  I 5 140 ? 237.795 212.422 257.291 1.00 57.55  ? 56  DG  I C6    1 
ATOM 8910  O O6    . DG  I 5 140 ? 238.283 211.328 257.580 1.00 57.55  ? 56  DG  I O6    1 
ATOM 8911  N N1    . DG  I 5 140 ? 238.615 213.520 257.097 1.00 57.55  ? 56  DG  I N1    1 
ATOM 8912  C C2    . DG  I 5 140 ? 238.181 214.777 256.770 1.00 57.55  ? 56  DG  I C2    1 
ATOM 8913  N N2    . DG  I 5 140 ? 239.123 215.712 256.624 1.00 57.55  ? 56  DG  I N2    1 
ATOM 8914  N N3    . DG  I 5 140 ? 236.914 215.095 256.602 1.00 57.55  ? 56  DG  I N3    1 
ATOM 8915  C C4    . DG  I 5 140 ? 236.104 214.031 256.787 1.00 57.55  ? 56  DG  I C4    1 
ATOM 8916  P P     . DG  I 5 141 ? 231.245 218.383 255.066 1.00 57.35  ? 57  DG  I P     1 
ATOM 8917  O OP1   . DG  I 5 141 ? 230.756 218.926 256.346 1.00 57.35  ? 57  DG  I OP1   1 
ATOM 8918  O OP2   . DG  I 5 141 ? 230.306 217.969 254.011 1.00 57.35  ? 57  DG  I OP2   1 
ATOM 8919  O "O5'" . DG  I 5 141 ? 232.238 219.456 254.427 1.00 57.35  ? 57  DG  I "O5'" 1 
ATOM 8920  C "C5'" . DG  I 5 141 ? 233.167 220.130 255.251 1.00 57.35  ? 57  DG  I "C5'" 1 
ATOM 8921  C "C4'" . DG  I 5 141 ? 234.441 220.480 254.497 1.00 57.35  ? 57  DG  I "C4'" 1 
ATOM 8922  O "O4'" . DG  I 5 141 ? 235.336 219.344 254.471 1.00 57.35  ? 57  DG  I "O4'" 1 
ATOM 8923  C "C3'" . DG  I 5 141 ? 234.273 220.892 253.050 1.00 57.35  ? 57  DG  I "C3'" 1 
ATOM 8924  O "O3'" . DG  I 5 141 ? 235.320 221.780 252.720 1.00 57.35  ? 57  DG  I "O3'" 1 
ATOM 8925  C "C2'" . DG  I 5 141 ? 234.416 219.563 252.319 1.00 57.35  ? 57  DG  I "C2'" 1 
ATOM 8926  C "C1'" . DG  I 5 141 ? 235.487 218.869 253.147 1.00 57.35  ? 57  DG  I "C1'" 1 
ATOM 8927  N N9    . DG  I 5 141 ? 235.345 217.423 253.190 1.00 57.35  ? 57  DG  I N9    1 
ATOM 8928  C C8    . DG  I 5 141 ? 234.177 216.717 253.184 1.00 57.35  ? 57  DG  I C8    1 
ATOM 8929  N N7    . DG  I 5 141 ? 234.349 215.435 253.254 1.00 57.35  ? 57  DG  I N7    1 
ATOM 8930  C C5    . DG  I 5 141 ? 235.719 215.279 253.332 1.00 57.35  ? 57  DG  I C5    1 
ATOM 8931  C C6    . DG  I 5 141 ? 236.484 214.109 253.419 1.00 57.35  ? 57  DG  I C6    1 
ATOM 8932  O O6    . DG  I 5 141 ? 236.088 212.942 253.465 1.00 57.35  ? 57  DG  I O6    1 
ATOM 8933  N N1    . DG  I 5 141 ? 237.836 214.383 253.463 1.00 57.35  ? 57  DG  I N1    1 
ATOM 8934  C C2    . DG  I 5 141 ? 238.383 215.638 253.421 1.00 57.35  ? 57  DG  I C2    1 
ATOM 8935  N N2    . DG  I 5 141 ? 239.716 215.708 253.477 1.00 57.35  ? 57  DG  I N2    1 
ATOM 8936  N N3    . DG  I 5 141 ? 237.673 216.747 253.340 1.00 57.35  ? 57  DG  I N3    1 
ATOM 8937  C C4    . DG  I 5 141 ? 236.350 216.491 253.297 1.00 57.35  ? 57  DG  I C4    1 
ATOM 8938  P P     . DC  I 5 142 ? 235.314 222.600 251.345 1.00 58.52  ? 58  DC  I P     1 
ATOM 8939  O OP1   . DC  I 5 142 ? 235.320 224.029 251.684 1.00 58.52  ? 58  DC  I OP1   1 
ATOM 8940  O OP2   . DC  I 5 142 ? 234.260 222.071 250.463 1.00 58.52  ? 58  DC  I OP2   1 
ATOM 8941  O "O5'" . DC  I 5 142 ? 236.729 222.247 250.725 1.00 58.52  ? 58  DC  I "O5'" 1 
ATOM 8942  C "C5'" . DC  I 5 142 ? 237.823 222.063 251.588 1.00 58.52  ? 58  DC  I "C5'" 1 
ATOM 8943  C "C4'" . DC  I 5 142 ? 238.861 221.163 250.962 1.00 58.52  ? 58  DC  I "C4'" 1 
ATOM 8944  O "O4'" . DC  I 5 142 ? 238.500 219.774 251.156 1.00 58.52  ? 58  DC  I "O4'" 1 
ATOM 8945  C "C3'" . DC  I 5 142 ? 239.057 221.346 249.465 1.00 58.52  ? 58  DC  I "C3'" 1 
ATOM 8946  O "O3'" . DC  I 5 142 ? 240.430 221.341 249.195 1.00 58.52  ? 58  DC  I "O3'" 1 
ATOM 8947  C "C2'" . DC  I 5 142 ? 238.363 220.121 248.872 1.00 58.52  ? 58  DC  I "C2'" 1 
ATOM 8948  C "C1'" . DC  I 5 142 ? 238.637 219.084 249.940 1.00 58.52  ? 58  DC  I "C1'" 1 
ATOM 8949  N N1    . DC  I 5 142 ? 237.676 217.962 249.949 1.00 58.52  ? 58  DC  I N1    1 
ATOM 8950  C C2    . DC  I 5 142 ? 238.135 216.655 250.100 1.00 58.52  ? 58  DC  I C2    1 
ATOM 8951  O O2    . DC  I 5 142 ? 239.345 216.453 250.197 1.00 58.52  ? 58  DC  I O2    1 
ATOM 8952  N N3    . DC  I 5 142 ? 237.239 215.647 250.126 1.00 58.52  ? 58  DC  I N3    1 
ATOM 8953  C C4    . DC  I 5 142 ? 235.945 215.910 250.011 1.00 58.52  ? 58  DC  I C4    1 
ATOM 8954  N N4    . DC  I 5 142 ? 235.092 214.886 250.040 1.00 58.52  ? 58  DC  I N4    1 
ATOM 8955  C C5    . DC  I 5 142 ? 235.460 217.234 249.863 1.00 58.52  ? 58  DC  I C5    1 
ATOM 8956  C C6    . DC  I 5 142 ? 236.353 218.219 249.836 1.00 58.52  ? 58  DC  I C6    1 
ATOM 8957  P P     . DA  I 5 143 ? 241.006 221.915 247.817 1.00 65.54  ? 59  DA  I P     1 
ATOM 8958  O OP1   . DA  I 5 143 ? 241.665 223.196 248.121 1.00 65.54  ? 59  DA  I OP1   1 
ATOM 8959  O OP2   . DA  I 5 143 ? 239.956 221.851 246.780 1.00 65.54  ? 59  DA  I OP2   1 
ATOM 8960  O "O5'" . DA  I 5 143 ? 242.138 220.864 247.456 1.00 65.54  ? 59  DA  I "O5'" 1 
ATOM 8961  C "C5'" . DA  I 5 143 ? 242.870 220.249 248.501 1.00 65.54  ? 59  DA  I "C5'" 1 
ATOM 8962  C "C4'" . DA  I 5 143 ? 243.524 218.977 248.013 1.00 65.54  ? 59  DA  I "C4'" 1 
ATOM 8963  O "O4'" . DA  I 5 143 ? 242.625 217.858 248.205 1.00 65.54  ? 59  DA  I "O4'" 1 
ATOM 8964  C "C3'" . DA  I 5 143 ? 243.888 218.984 246.540 1.00 65.54  ? 59  DA  I "C3'" 1 
ATOM 8965  O "O3'" . DA  I 5 143 ? 245.122 218.327 246.350 1.00 65.54  ? 59  DA  I "O3'" 1 
ATOM 8966  C "C2'" . DA  I 5 143 ? 242.732 218.234 245.885 1.00 65.54  ? 59  DA  I "C2'" 1 
ATOM 8967  C "C1'" . DA  I 5 143 ? 242.327 217.249 246.969 1.00 65.54  ? 59  DA  I "C1'" 1 
ATOM 8968  N N9    . DA  I 5 143 ? 240.906 216.936 246.959 1.00 65.54  ? 59  DA  I N9    1 
ATOM 8969  C C8    . DA  I 5 143 ? 239.878 217.822 246.937 1.00 65.54  ? 59  DA  I C8    1 
ATOM 8970  N N7    . DA  I 5 143 ? 238.696 217.261 246.940 1.00 65.54  ? 59  DA  I N7    1 
ATOM 8971  C C5    . DA  I 5 143 ? 238.973 215.913 246.966 1.00 65.54  ? 59  DA  I C5    1 
ATOM 8972  C C6    . DA  I 5 143 ? 238.148 214.782 246.980 1.00 65.54  ? 59  DA  I C6    1 
ATOM 8973  N N6    . DA  I 5 143 ? 236.817 214.843 246.970 1.00 65.54  ? 59  DA  I N6    1 
ATOM 8974  N N1    . DA  I 5 143 ? 238.742 213.583 246.997 1.00 65.54  ? 59  DA  I N1    1 
ATOM 8975  C C2    . DA  I 5 143 ? 240.072 213.525 247.004 1.00 65.54  ? 59  DA  I C2    1 
ATOM 8976  N N3    . DA  I 5 143 ? 240.951 214.515 246.995 1.00 65.54  ? 59  DA  I N3    1 
ATOM 8977  C C4    . DA  I 5 143 ? 240.330 215.695 246.980 1.00 65.54  ? 59  DA  I C4    1 
ATOM 8978  P P     . DC  I 5 144 ? 245.834 218.351 244.914 1.00 71.33  ? 60  DC  I P     1 
ATOM 8979  O OP1   . DC  I 5 144 ? 247.281 218.567 245.127 1.00 71.33  ? 60  DC  I OP1   1 
ATOM 8980  O OP2   . DC  I 5 144 ? 245.066 219.267 244.041 1.00 71.33  ? 60  DC  I OP2   1 
ATOM 8981  O "O5'" . DC  I 5 144 ? 245.607 216.872 244.378 1.00 71.33  ? 60  DC  I "O5'" 1 
ATOM 8982  C "C5'" . DC  I 5 144 ? 245.548 215.796 245.298 1.00 71.33  ? 60  DC  I "C5'" 1 
ATOM 8983  C "C4'" . DC  I 5 144 ? 245.049 214.551 244.607 1.00 71.33  ? 60  DC  I "C4'" 1 
ATOM 8984  O "O4'" . DC  I 5 144 ? 243.627 214.389 244.858 1.00 71.33  ? 60  DC  I "O4'" 1 
ATOM 8985  C "C3'" . DC  I 5 144 ? 245.210 214.577 243.086 1.00 71.33  ? 60  DC  I "C3'" 1 
ATOM 8986  O "O3'" . DC  I 5 144 ? 245.671 213.324 242.625 1.00 71.33  ? 60  DC  I "O3'" 1 
ATOM 8987  C "C2'" . DC  I 5 144 ? 243.798 214.861 242.602 1.00 71.33  ? 60  DC  I "C2'" 1 
ATOM 8988  C "C1'" . DC  I 5 144 ? 242.989 214.113 243.639 1.00 71.33  ? 60  DC  I "C1'" 1 
ATOM 8989  N N1    . DC  I 5 144 ? 241.584 214.555 243.704 1.00 71.33  ? 60  DC  I N1    1 
ATOM 8990  C C2    . DC  I 5 144 ? 240.569 213.606 243.680 1.00 71.33  ? 60  DC  I C2    1 
ATOM 8991  O O2    . DC  I 5 144 ? 240.872 212.416 243.634 1.00 71.33  ? 60  DC  I O2    1 
ATOM 8992  N N3    . DC  I 5 144 ? 239.286 214.020 243.715 1.00 71.33  ? 60  DC  I N3    1 
ATOM 8993  C C4    . DC  I 5 144 ? 239.009 215.316 243.758 1.00 71.33  ? 60  DC  I C4    1 
ATOM 8994  N N4    . DC  I 5 144 ? 237.731 215.682 243.794 1.00 71.33  ? 60  DC  I N4    1 
ATOM 8995  C C5    . DC  I 5 144 ? 240.032 216.301 243.772 1.00 71.33  ? 60  DC  I C5    1 
ATOM 8996  C C6    . DC  I 5 144 ? 241.294 215.878 243.738 1.00 71.33  ? 60  DC  I C6    1 
ATOM 8997  P P     . DC  I 5 145 ? 246.416 213.209 241.208 1.00 77.20  ? 61  DC  I P     1 
ATOM 8998  O OP1   . DC  I 5 145 ? 247.836 213.542 241.437 1.00 77.20  ? 61  DC  I OP1   1 
ATOM 8999  O OP2   . DC  I 5 145 ? 245.636 213.959 240.199 1.00 77.20  ? 61  DC  I OP2   1 
ATOM 9000  O "O5'" . DC  I 5 145 ? 246.299 211.659 240.850 1.00 77.20  ? 61  DC  I "O5'" 1 
ATOM 9001  C "C5'" . DC  I 5 145 ? 245.415 210.832 241.581 1.00 77.20  ? 61  DC  I "C5'" 1 
ATOM 9002  C "C4'" . DC  I 5 145 ? 244.294 210.333 240.693 1.00 77.20  ? 61  DC  I "C4'" 1 
ATOM 9003  O "O4'" . DC  I 5 145 ? 243.092 211.055 240.990 1.00 77.20  ? 61  DC  I "O4'" 1 
ATOM 9004  C "C3'" . DC  I 5 145 ? 244.533 210.520 239.199 1.00 77.20  ? 61  DC  I "C3'" 1 
ATOM 9005  O "O3'" . DC  I 5 145 ? 244.840 209.264 238.610 1.00 77.20  ? 61  DC  I "O3'" 1 
ATOM 9006  C "C2'" . DC  I 5 145 ? 243.213 211.104 238.656 1.00 77.20  ? 61  DC  I "C2'" 1 
ATOM 9007  C "C1'" . DC  I 5 145 ? 242.275 211.063 239.854 1.00 77.20  ? 61  DC  I "C1'" 1 
ATOM 9008  N N1    . DC  I 5 145 ? 241.388 212.241 239.957 1.00 77.20  ? 61  DC  I N1    1 
ATOM 9009  C C2    . DC  I 5 145 ? 240.009 212.072 239.920 1.00 77.20  ? 61  DC  I C2    1 
ATOM 9010  O O2    . DC  I 5 145 ? 239.548 210.940 239.779 1.00 77.20  ? 61  DC  I O2    1 
ATOM 9011  N N3    . DC  I 5 145 ? 239.215 213.157 240.031 1.00 77.20  ? 61  DC  I N3    1 
ATOM 9012  C C4    . DC  I 5 145 ? 239.751 214.362 240.180 1.00 77.20  ? 61  DC  I C4    1 
ATOM 9013  N N4    . DC  I 5 145 ? 238.927 215.405 240.284 1.00 77.20  ? 61  DC  I N4    1 
ATOM 9014  C C5    . DC  I 5 145 ? 241.156 214.556 240.227 1.00 77.20  ? 61  DC  I C5    1 
ATOM 9015  C C6    . DC  I 5 145 ? 241.929 213.477 240.114 1.00 77.20  ? 61  DC  I C6    1 
ATOM 9016  P P     . DG  I 5 146 ? 245.104 209.140 237.031 1.00 81.21  ? 62  DG  I P     1 
ATOM 9017  O OP1   . DG  I 5 146 ? 246.017 207.996 236.832 1.00 81.21  ? 62  DG  I OP1   1 
ATOM 9018  O OP2   . DG  I 5 146 ? 245.465 210.473 236.503 1.00 81.21  ? 62  DG  I OP2   1 
ATOM 9019  O "O5'" . DG  I 5 146 ? 243.675 208.755 236.445 1.00 81.21  ? 62  DG  I "O5'" 1 
ATOM 9020  C "C5'" . DG  I 5 146 ? 242.861 207.822 237.136 1.00 81.21  ? 62  DG  I "C5'" 1 
ATOM 9021  C "C4'" . DG  I 5 146 ? 241.488 207.760 236.509 1.00 81.21  ? 62  DG  I "C4'" 1 
ATOM 9022  O "O4'" . DG  I 5 146 ? 240.676 208.860 236.994 1.00 81.21  ? 62  DG  I "O4'" 1 
ATOM 9023  C "C3'" . DG  I 5 146 ? 241.486 207.864 234.987 1.00 81.21  ? 62  DG  I "C3'" 1 
ATOM 9024  O "O3'" . DG  I 5 146 ? 240.628 206.884 234.444 1.00 81.21  ? 62  DG  I "O3'" 1 
ATOM 9025  C "C2'" . DG  I 5 146 ? 240.971 209.278 234.725 1.00 81.21  ? 62  DG  I "C2'" 1 
ATOM 9026  C "C1'" . DG  I 5 146 ? 240.047 209.490 235.907 1.00 81.21  ? 62  DG  I "C1'" 1 
ATOM 9027  N N9    . DG  I 5 146 ? 239.848 210.895 236.233 1.00 81.21  ? 62  DG  I N9    1 
ATOM 9028  C C8    . DG  I 5 146 ? 240.819 211.841 236.433 1.00 81.21  ? 62  DG  I C8    1 
ATOM 9029  N N7    . DG  I 5 146 ? 240.346 213.020 236.707 1.00 81.21  ? 62  DG  I N7    1 
ATOM 9030  C C5    . DG  I 5 146 ? 238.972 212.844 236.680 1.00 81.21  ? 62  DG  I C5    1 
ATOM 9031  C C6    . DG  I 5 146 ? 237.937 213.770 236.904 1.00 81.21  ? 62  DG  I C6    1 
ATOM 9032  O O6    . DG  I 5 146 ? 238.032 214.971 237.176 1.00 81.21  ? 62  DG  I O6    1 
ATOM 9033  N N1    . DG  I 5 146 ? 236.685 213.183 236.778 1.00 81.21  ? 62  DG  I N1    1 
ATOM 9034  C C2    . DG  I 5 146 ? 236.465 211.864 236.479 1.00 81.21  ? 62  DG  I C2    1 
ATOM 9035  N N2    . DG  I 5 146 ? 235.189 211.474 236.402 1.00 81.21  ? 62  DG  I N2    1 
ATOM 9036  N N3    . DG  I 5 146 ? 237.429 210.983 236.273 1.00 81.21  ? 62  DG  I N3    1 
ATOM 9037  C C4    . DG  I 5 146 ? 238.652 211.543 236.386 1.00 81.21  ? 62  DG  I C4    1 
ATOM 9038  P P     . DG  I 5 147 ? 240.712 206.507 232.887 1.00 82.42  ? 63  DG  I P     1 
ATOM 9039  O OP1   . DG  I 5 147 ? 240.922 205.047 232.798 1.00 82.42  ? 63  DG  I OP1   1 
ATOM 9040  O OP2   . DG  I 5 147 ? 241.672 207.426 232.238 1.00 82.42  ? 63  DG  I OP2   1 
ATOM 9041  O "O5'" . DG  I 5 147 ? 239.254 206.858 232.350 1.00 82.42  ? 63  DG  I "O5'" 1 
ATOM 9042  C "C5'" . DG  I 5 147 ? 238.131 206.657 233.197 1.00 82.42  ? 63  DG  I "C5'" 1 
ATOM 9043  C "C4'" . DG  I 5 147 ? 236.977 207.538 232.770 1.00 82.42  ? 63  DG  I "C4'" 1 
ATOM 9044  O "O4'" . DG  I 5 147 ? 237.099 208.848 233.383 1.00 82.42  ? 63  DG  I "O4'" 1 
ATOM 9045  C "C3'" . DG  I 5 147 ? 236.883 207.778 231.263 1.00 82.42  ? 63  DG  I "C3'" 1 
ATOM 9046  O "O3'" . DG  I 5 147 ? 235.564 207.522 230.827 1.00 82.42  ? 63  DG  I "O3'" 1 
ATOM 9047  C "C2'" . DG  I 5 147 ? 237.254 209.255 231.110 1.00 82.42  ? 63  DG  I "C2'" 1 
ATOM 9048  C "C1'" . DG  I 5 147 ? 236.770 209.821 232.429 1.00 82.42  ? 63  DG  I "C1'" 1 
ATOM 9049  N N9    . DG  I 5 147 ? 237.401 211.084 232.799 1.00 82.42  ? 63  DG  I N9    1 
ATOM 9050  C C8    . DG  I 5 147 ? 238.743 211.350 232.889 1.00 82.42  ? 63  DG  I C8    1 
ATOM 9051  N N7    . DG  I 5 147 ? 239.004 212.577 233.244 1.00 82.42  ? 63  DG  I N7    1 
ATOM 9052  C C5    . DG  I 5 147 ? 237.754 213.156 233.399 1.00 82.42  ? 63  DG  I C5    1 
ATOM 9053  C C6    . DG  I 5 147 ? 237.400 214.469 233.777 1.00 82.42  ? 63  DG  I C6    1 
ATOM 9054  O O6    . DG  I 5 147 ? 238.147 215.411 234.060 1.00 82.42  ? 63  DG  I O6    1 
ATOM 9055  N N1    . DG  I 5 147 ? 236.021 214.638 233.815 1.00 82.42  ? 63  DG  I N1    1 
ATOM 9056  C C2    . DG  I 5 147 ? 235.104 213.660 233.522 1.00 82.42  ? 63  DG  I C2    1 
ATOM 9057  N N2    . DG  I 5 147 ? 233.812 214.001 233.606 1.00 82.42  ? 63  DG  I N2    1 
ATOM 9058  N N3    . DG  I 5 147 ? 235.425 212.430 233.172 1.00 82.42  ? 63  DG  I N3    1 
ATOM 9059  C C4    . DG  I 5 147 ? 236.761 212.250 233.132 1.00 82.42  ? 63  DG  I C4    1 
ATOM 9060  P P     . DG  I 5 148 ? 235.250 207.312 229.267 1.00 82.19  ? 64  DG  I P     1 
ATOM 9061  O OP1   . DG  I 5 148 ? 234.598 205.993 229.117 1.00 82.19  ? 64  DG  I OP1   1 
ATOM 9062  O OP2   . DG  I 5 148 ? 236.472 207.624 228.497 1.00 82.19  ? 64  DG  I OP2   1 
ATOM 9063  O "O5'" . DG  I 5 148 ? 234.165 208.437 228.960 1.00 82.19  ? 64  DG  I "O5'" 1 
ATOM 9064  C "C5'" . DG  I 5 148 ? 232.958 208.444 229.689 1.00 82.19  ? 64  DG  I "C5'" 1 
ATOM 9065  C "C4'" . DG  I 5 148 ? 232.344 209.827 229.708 1.00 82.19  ? 64  DG  I "C4'" 1 
ATOM 9066  O "O4'" . DG  I 5 148 ? 233.266 210.763 230.320 1.00 82.19  ? 64  DG  I "O4'" 1 
ATOM 9067  C "C3'" . DG  I 5 148 ? 232.011 210.407 228.333 1.00 82.19  ? 64  DG  I "C3'" 1 
ATOM 9068  O "O3'" . DG  I 5 148 ? 230.776 211.086 228.402 1.00 82.19  ? 64  DG  I "O3'" 1 
ATOM 9069  C "C2'" . DG  I 5 148 ? 233.160 211.379 228.095 1.00 82.19  ? 64  DG  I "C2'" 1 
ATOM 9070  C "C1'" . DG  I 5 148 ? 233.361 211.898 229.500 1.00 82.19  ? 64  DG  I "C1'" 1 
ATOM 9071  N N9    . DG  I 5 148 ? 234.649 212.531 229.716 1.00 82.19  ? 64  DG  I N9    1 
ATOM 9072  C C8    . DG  I 5 148 ? 235.888 211.978 229.535 1.00 82.19  ? 64  DG  I C8    1 
ATOM 9073  N N7    . DG  I 5 148 ? 236.862 212.796 229.811 1.00 82.19  ? 64  DG  I N7    1 
ATOM 9074  C C5    . DG  I 5 148 ? 236.221 213.960 230.195 1.00 82.19  ? 64  DG  I C5    1 
ATOM 9075  C C6    . DG  I 5 148 ? 236.755 215.193 230.610 1.00 82.19  ? 64  DG  I C6    1 
ATOM 9076  O O6    . DG  I 5 148 ? 237.940 215.512 230.723 1.00 82.19  ? 64  DG  I O6    1 
ATOM 9077  N N1    . DG  I 5 148 ? 235.756 216.108 230.916 1.00 82.19  ? 64  DG  I N1    1 
ATOM 9078  C C2    . DG  I 5 148 ? 234.411 215.858 230.832 1.00 82.19  ? 64  DG  I C2    1 
ATOM 9079  N N2    . DG  I 5 148 ? 233.592 216.864 231.158 1.00 82.19  ? 64  DG  I N2    1 
ATOM 9080  N N3    . DG  I 5 148 ? 233.900 214.707 230.441 1.00 82.19  ? 64  DG  I N3    1 
ATOM 9081  C C4    . DG  I 5 148 ? 234.861 213.809 230.141 1.00 82.19  ? 64  DG  I C4    1 
ATOM 9082  P P     . DA  I 5 149 ? 229.971 211.458 227.065 1.00 80.74  ? 65  DA  I P     1 
ATOM 9083  O OP1   . DA  I 5 149 ? 228.700 210.704 227.099 1.00 80.74  ? 65  DA  I OP1   1 
ATOM 9084  O OP2   . DA  I 5 149 ? 230.881 211.312 225.910 1.00 80.74  ? 65  DA  I OP2   1 
ATOM 9085  O "O5'" . DA  I 5 149 ? 229.652 213.011 227.244 1.00 80.74  ? 65  DA  I "O5'" 1 
ATOM 9086  C "C5'" . DA  I 5 149 ? 229.114 213.479 228.469 1.00 80.74  ? 65  DA  I "C5'" 1 
ATOM 9087  C "C4'" . DA  I 5 149 ? 229.065 214.995 228.496 1.00 80.74  ? 65  DA  I "C4'" 1 
ATOM 9088  O "O4'" . DA  I 5 149 ? 230.374 215.529 228.821 1.00 80.74  ? 65  DA  I "O4'" 1 
ATOM 9089  C "C3'" . DA  I 5 149 ? 228.647 215.654 227.189 1.00 80.74  ? 65  DA  I "C3'" 1 
ATOM 9090  O "O3'" . DA  I 5 149 ? 227.817 216.769 227.476 1.00 80.74  ? 65  DA  I "O3'" 1 
ATOM 9091  C "C2'" . DA  I 5 149 ? 229.981 216.067 226.564 1.00 80.74  ? 65  DA  I "C2'" 1 
ATOM 9092  C "C1'" . DA  I 5 149 ? 230.831 216.377 227.788 1.00 80.74  ? 65  DA  I "C1'" 1 
ATOM 9093  N N9    . DA  I 5 149 ? 232.253 216.114 227.603 1.00 80.74  ? 65  DA  I N9    1 
ATOM 9094  C C8    . DA  I 5 149 ? 232.821 214.965 227.134 1.00 80.74  ? 65  DA  I C8    1 
ATOM 9095  N N7    . DA  I 5 149 ? 234.128 215.001 227.094 1.00 80.74  ? 65  DA  I N7    1 
ATOM 9096  C C5    . DA  I 5 149 ? 234.439 216.257 227.581 1.00 80.74  ? 65  DA  I C5    1 
ATOM 9097  C C6    . DA  I 5 149 ? 235.662 216.911 227.791 1.00 80.74  ? 65  DA  I C6    1 
ATOM 9098  N N6    . DA  I 5 149 ? 236.844 216.355 227.522 1.00 80.74  ? 65  DA  I N6    1 
ATOM 9099  N N1    . DA  I 5 149 ? 235.626 218.160 228.284 1.00 80.74  ? 65  DA  I N1    1 
ATOM 9100  C C2    . DA  I 5 149 ? 234.442 218.710 228.554 1.00 80.74  ? 65  DA  I C2    1 
ATOM 9101  N N3    . DA  I 5 149 ? 233.225 218.195 228.397 1.00 80.74  ? 65  DA  I N3    1 
ATOM 9102  C C4    . DA  I 5 149 ? 233.297 216.955 227.900 1.00 80.74  ? 65  DA  I C4    1 
ATOM 9103  P P     . DT  I 5 150 ? 227.340 217.766 226.314 1.00 79.92  ? 66  DT  I P     1 
ATOM 9104  O OP1   . DT  I 5 150 ? 226.033 218.322 226.727 1.00 79.92  ? 66  DT  I OP1   1 
ATOM 9105  O OP2   . DT  I 5 150 ? 227.463 217.073 225.013 1.00 79.92  ? 66  DT  I OP2   1 
ATOM 9106  O "O5'" . DT  I 5 150 ? 228.417 218.941 226.376 1.00 79.92  ? 66  DT  I "O5'" 1 
ATOM 9107  C "C5'" . DT  I 5 150 ? 228.882 219.395 227.639 1.00 79.92  ? 66  DT  I "C5'" 1 
ATOM 9108  C "C4'" . DT  I 5 150 ? 229.556 220.749 227.519 1.00 79.92  ? 66  DT  I "C4'" 1 
ATOM 9109  O "O4'" . DT  I 5 150 ? 230.994 220.582 227.411 1.00 79.92  ? 66  DT  I "O4'" 1 
ATOM 9110  C "C3'" . DT  I 5 150 ? 229.149 221.573 226.310 1.00 79.92  ? 66  DT  I "C3'" 1 
ATOM 9111  O "O3'" . DT  I 5 150 ? 229.221 222.943 226.650 1.00 79.92  ? 66  DT  I "O3'" 1 
ATOM 9112  C "C2'" . DT  I 5 150 ? 230.211 221.184 225.285 1.00 79.92  ? 66  DT  I "C2'" 1 
ATOM 9113  C "C1'" . DT  I 5 150 ? 231.445 221.065 226.162 1.00 79.92  ? 66  DT  I "C1'" 1 
ATOM 9114  N N1    . DT  I 5 150 ? 232.455 220.111 225.652 1.00 79.92  ? 66  DT  I N1    1 
ATOM 9115  C C2    . DT  I 5 150 ? 233.783 220.405 225.804 1.00 79.92  ? 66  DT  I C2    1 
ATOM 9116  O O2    . DT  I 5 150 ? 234.182 221.427 226.326 1.00 79.92  ? 66  DT  I O2    1 
ATOM 9117  N N3    . DT  I 5 150 ? 234.636 219.456 225.324 1.00 79.92  ? 66  DT  I N3    1 
ATOM 9118  C C4    . DT  I 5 150 ? 234.304 218.268 224.720 1.00 79.92  ? 66  DT  I C4    1 
ATOM 9119  O O4    . DT  I 5 150 ? 235.150 217.480 224.319 1.00 79.92  ? 66  DT  I O4    1 
ATOM 9120  C C5    . DT  I 5 150 ? 232.895 218.014 224.594 1.00 79.92  ? 66  DT  I C5    1 
ATOM 9121  C C7    . DT  I 5 150 ? 232.415 216.751 223.949 1.00 79.92  ? 66  DT  I C7    1 
ATOM 9122  C C6    . DT  I 5 150 ? 232.045 218.937 225.063 1.00 79.92  ? 66  DT  I C6    1 
ATOM 9123  P P     . DT  I 5 151 ? 228.773 224.083 225.614 1.00 77.98  ? 67  DT  I P     1 
ATOM 9124  O OP1   . DT  I 5 151 ? 227.743 224.907 226.281 1.00 77.98  ? 67  DT  I OP1   1 
ATOM 9125  O OP2   . DT  I 5 151 ? 228.465 223.462 224.308 1.00 77.98  ? 67  DT  I OP2   1 
ATOM 9126  O "O5'" . DT  I 5 151 ? 230.094 224.961 225.473 1.00 77.98  ? 67  DT  I "O5'" 1 
ATOM 9127  C "C5'" . DT  I 5 151 ? 230.959 225.094 226.594 1.00 77.98  ? 67  DT  I "C5'" 1 
ATOM 9128  C "C4'" . DT  I 5 151 ? 232.306 225.655 226.183 1.00 77.98  ? 67  DT  I "C4'" 1 
ATOM 9129  O "O4'" . DT  I 5 151 ? 233.179 224.590 225.721 1.00 77.98  ? 67  DT  I "O4'" 1 
ATOM 9130  C "C3'" . DT  I 5 151 ? 232.267 226.679 225.060 1.00 77.98  ? 67  DT  I "C3'" 1 
ATOM 9131  O "O3'" . DT  I 5 151 ? 233.199 227.690 225.356 1.00 77.98  ? 67  DT  I "O3'" 1 
ATOM 9132  C "C2'" . DT  I 5 151 ? 232.681 225.855 223.834 1.00 77.98  ? 67  DT  I "C2'" 1 
ATOM 9133  C "C1'" . DT  I 5 151 ? 233.703 224.921 224.453 1.00 77.98  ? 67  DT  I "C1'" 1 
ATOM 9134  N N1    . DT  I 5 151 ? 233.933 223.641 223.706 1.00 77.98  ? 67  DT  I N1    1 
ATOM 9135  C C2    . DT  I 5 151 ? 235.218 223.202 223.508 1.00 77.98  ? 67  DT  I C2    1 
ATOM 9136  O O2    . DT  I 5 151 ? 236.198 223.819 223.875 1.00 77.98  ? 67  DT  I O2    1 
ATOM 9137  N N3    . DT  I 5 151 ? 235.320 222.010 222.847 1.00 77.98  ? 67  DT  I N3    1 
ATOM 9138  C C4    . DT  I 5 151 ? 234.292 221.222 222.389 1.00 77.98  ? 67  DT  I C4    1 
ATOM 9139  O O4    . DT  I 5 151 ? 234.485 220.164 221.804 1.00 77.98  ? 67  DT  I O4    1 
ATOM 9140  C C5    . DT  I 5 151 ? 232.972 221.730 222.635 1.00 77.98  ? 67  DT  I C5    1 
ATOM 9141  C C7    . DT  I 5 151 ? 231.778 220.957 222.172 1.00 77.98  ? 67  DT  I C7    1 
ATOM 9142  C C6    . DT  I 5 151 ? 232.855 222.900 223.282 1.00 77.98  ? 67  DT  I C6    1 
ATOM 9143  P P     . DC  I 5 152 ? 233.200 229.074 224.550 1.00 76.07  ? 68  DC  I P     1 
ATOM 9144  O OP1   . DC  I 5 152 ? 233.072 230.162 225.539 1.00 76.07  ? 68  DC  I OP1   1 
ATOM 9145  O OP2   . DC  I 5 152 ? 232.242 228.971 223.429 1.00 76.07  ? 68  DC  I OP2   1 
ATOM 9146  O "O5'" . DC  I 5 152 ? 234.673 229.128 223.952 1.00 76.07  ? 68  DC  I "O5'" 1 
ATOM 9147  C "C5'" . DC  I 5 152 ? 235.761 228.700 224.752 1.00 76.07  ? 68  DC  I "C5'" 1 
ATOM 9148  C "C4'" . DC  I 5 152 ? 236.997 228.501 223.908 1.00 76.07  ? 68  DC  I "C4'" 1 
ATOM 9149  O "O4'" . DC  I 5 152 ? 236.995 227.168 223.335 1.00 76.07  ? 68  DC  I "O4'" 1 
ATOM 9150  C "C3'" . DC  I 5 152 ? 237.129 229.464 222.740 1.00 76.07  ? 68  DC  I "C3'" 1 
ATOM 9151  O "O3'" . DC  I 5 152 ? 238.472 229.827 222.600 1.00 76.07  ? 68  DC  I "O3'" 1 
ATOM 9152  C "C2'" . DC  I 5 152 ? 236.645 228.630 221.558 1.00 76.07  ? 68  DC  I "C2'" 1 
ATOM 9153  C "C1'" . DC  I 5 152 ? 237.149 227.253 221.938 1.00 76.07  ? 68  DC  I "C1'" 1 
ATOM 9154  N N1    . DC  I 5 152 ? 236.391 226.123 221.324 1.00 76.07  ? 68  DC  I N1    1 
ATOM 9155  C C2    . DC  I 5 152 ? 237.090 225.037 220.808 1.00 76.07  ? 68  DC  I C2    1 
ATOM 9156  O O2    . DC  I 5 152 ? 238.317 225.046 220.852 1.00 76.07  ? 68  DC  I O2    1 
ATOM 9157  N N3    . DC  I 5 152 ? 236.403 224.005 220.272 1.00 76.07  ? 68  DC  I N3    1 
ATOM 9158  C C4    . DC  I 5 152 ? 235.075 224.031 220.245 1.00 76.07  ? 68  DC  I C4    1 
ATOM 9159  N N4    . DC  I 5 152 ? 234.443 222.987 219.700 1.00 76.07  ? 68  DC  I N4    1 
ATOM 9160  C C5    . DC  I 5 152 ? 234.339 225.128 220.768 1.00 76.07  ? 68  DC  I C5    1 
ATOM 9161  C C6    . DC  I 5 152 ? 235.032 226.142 221.301 1.00 76.07  ? 68  DC  I C6    1 
ATOM 9162  P P     . DT  I 5 153 ? 238.879 231.186 221.859 1.00 72.47  ? 69  DT  I P     1 
ATOM 9163  O OP1   . DT  I 5 153 ? 239.445 232.089 222.882 1.00 72.47  ? 69  DT  I OP1   1 
ATOM 9164  O OP2   . DT  I 5 153 ? 237.744 231.624 221.023 1.00 72.47  ? 69  DT  I OP2   1 
ATOM 9165  O "O5'" . DT  I 5 153 ? 240.053 230.717 220.896 1.00 72.47  ? 69  DT  I "O5'" 1 
ATOM 9166  C "C5'" . DT  I 5 153 ? 240.915 229.686 221.328 1.00 72.47  ? 69  DT  I "C5'" 1 
ATOM 9167  C "C4'" . DT  I 5 153 ? 241.518 228.961 220.150 1.00 72.47  ? 69  DT  I "C4'" 1 
ATOM 9168  O "O4'" . DT  I 5 153 ? 240.649 227.886 219.722 1.00 72.47  ? 69  DT  I "O4'" 1 
ATOM 9169  C "C3'" . DT  I 5 153 ? 241.760 229.818 218.918 1.00 72.47  ? 69  DT  I "C3'" 1 
ATOM 9170  O "O3'" . DT  I 5 153 ? 243.003 229.475 218.403 1.00 72.47  ? 69  DT  I "O3'" 1 
ATOM 9171  C "C2'" . DT  I 5 153 ? 240.626 229.394 217.979 1.00 72.47  ? 69  DT  I "C2'" 1 
ATOM 9172  C "C1'" . DT  I 5 153 ? 240.522 227.928 218.323 1.00 72.47  ? 69  DT  I "C1'" 1 
ATOM 9173  N N1    . DT  I 5 153 ? 239.233 227.282 217.974 1.00 72.47  ? 69  DT  I N1    1 
ATOM 9174  C C2    . DT  I 5 153 ? 239.253 226.043 217.392 1.00 72.47  ? 69  DT  I C2    1 
ATOM 9175  O O2    . DT  I 5 153 ? 240.275 225.460 217.109 1.00 72.47  ? 69  DT  I O2    1 
ATOM 9176  N N3    . DT  I 5 153 ? 238.026 225.507 217.152 1.00 72.47  ? 69  DT  I N3    1 
ATOM 9177  C C4    . DT  I 5 153 ? 236.805 226.070 217.427 1.00 72.47  ? 69  DT  I C4    1 
ATOM 9178  O O4    . DT  I 5 153 ? 235.753 225.508 217.171 1.00 72.47  ? 69  DT  I O4    1 
ATOM 9179  C C5    . DT  I 5 153 ? 236.851 227.362 218.049 1.00 72.47  ? 69  DT  I C5    1 
ATOM 9180  C C7    . DT  I 5 153 ? 235.577 228.067 218.390 1.00 72.47  ? 69  DT  I C7    1 
ATOM 9181  C C6    . DT  I 5 153 ? 238.050 227.900 218.299 1.00 72.47  ? 69  DT  I C6    1 
ATOM 9182  P P     . DC  I 5 154 ? 243.808 230.483 217.469 1.00 73.06  ? 70  DC  I P     1 
ATOM 9183  O OP1   . DC  I 5 154 ? 245.142 230.643 218.070 1.00 73.06  ? 70  DC  I OP1   1 
ATOM 9184  O OP2   . DC  I 5 154 ? 242.963 231.663 217.225 1.00 73.06  ? 70  DC  I OP2   1 
ATOM 9185  O "O5'" . DC  I 5 154 ? 243.950 229.665 216.118 1.00 73.06  ? 70  DC  I "O5'" 1 
ATOM 9186  C "C5'" . DC  I 5 154 ? 244.120 228.266 216.171 1.00 73.06  ? 70  DC  I "C5'" 1 
ATOM 9187  C "C4'" . DC  I 5 154 ? 243.803 227.641 214.833 1.00 73.06  ? 70  DC  I "C4'" 1 
ATOM 9188  O "O4'" . DC  I 5 154 ? 242.449 227.122 214.836 1.00 73.06  ? 70  DC  I "O4'" 1 
ATOM 9189  C "C3'" . DC  I 5 154 ? 243.876 228.595 213.648 1.00 73.06  ? 70  DC  I "C3'" 1 
ATOM 9190  O "O3'" . DC  I 5 154 ? 244.431 227.928 212.560 1.00 73.06  ? 70  DC  I "O3'" 1 
ATOM 9191  C "C2'" . DC  I 5 154 ? 242.414 228.925 213.393 1.00 73.06  ? 70  DC  I "C2'" 1 
ATOM 9192  C "C1'" . DC  I 5 154 ? 241.781 227.588 213.693 1.00 73.06  ? 70  DC  I "C1'" 1 
ATOM 9193  N N1    . DC  I 5 154 ? 240.344 227.664 213.989 1.00 73.06  ? 70  DC  I N1    1 
ATOM 9194  C C2    . DC  I 5 154 ? 239.526 226.595 213.650 1.00 73.06  ? 70  DC  I C2    1 
ATOM 9195  O O2    . DC  I 5 154 ? 240.034 225.608 213.112 1.00 73.06  ? 70  DC  I O2    1 
ATOM 9196  N N3    . DC  I 5 154 ? 238.210 226.668 213.925 1.00 73.06  ? 70  DC  I N3    1 
ATOM 9197  C C4    . DC  I 5 154 ? 237.714 227.756 214.502 1.00 73.06  ? 70  DC  I C4    1 
ATOM 9198  N N4    . DC  I 5 154 ? 236.407 227.786 214.757 1.00 73.06  ? 70  DC  I N4    1 
ATOM 9199  C C5    . DC  I 5 154 ? 238.535 228.861 214.856 1.00 73.06  ? 70  DC  I C5    1 
ATOM 9200  C C6    . DC  I 5 154 ? 239.832 228.773 214.580 1.00 73.06  ? 70  DC  I C6    1 
ATOM 9201  P P     . DC  I 5 155 ? 245.482 228.673 211.612 1.00 86.06  ? 71  DC  I P     1 
ATOM 9202  O OP1   . DC  I 5 155 ? 246.816 228.538 212.223 1.00 86.06  ? 71  DC  I OP1   1 
ATOM 9203  O OP2   . DC  I 5 155 ? 244.930 230.009 211.310 1.00 86.06  ? 71  DC  I OP2   1 
ATOM 9204  O "O5'" . DC  I 5 155 ? 245.453 227.792 210.289 1.00 86.06  ? 71  DC  I "O5'" 1 
ATOM 9205  C "C5'" . DC  I 5 155 ? 245.355 226.381 210.393 1.00 86.06  ? 71  DC  I "C5'" 1 
ATOM 9206  C "C4'" . DC  I 5 155 ? 244.381 225.829 209.372 1.00 86.06  ? 71  DC  I "C4'" 1 
ATOM 9207  O "O4'" . DC  I 5 155 ? 243.021 226.024 209.834 1.00 86.06  ? 71  DC  I "O4'" 1 
ATOM 9208  C "C3'" . DC  I 5 155 ? 244.440 226.489 207.997 1.00 86.06  ? 71  DC  I "C3'" 1 
ATOM 9209  O "O3'" . DC  I 5 155 ? 244.139 225.533 207.016 1.00 86.06  ? 71  DC  I "O3'" 1 
ATOM 9210  C "C2'" . DC  I 5 155 ? 243.323 227.511 208.091 1.00 86.06  ? 71  DC  I "C2'" 1 
ATOM 9211  C "C1'" . DC  I 5 155 ? 242.297 226.684 208.827 1.00 86.06  ? 71  DC  I "C1'" 1 
ATOM 9212  N N1    . DC  I 5 155 ? 241.232 227.476 209.448 1.00 86.06  ? 71  DC  I N1    1 
ATOM 9213  C C2    . DC  I 5 155 ? 239.948 226.960 209.486 1.00 86.06  ? 71  DC  I C2    1 
ATOM 9214  O O2    . DC  I 5 155 ? 239.748 225.846 209.001 1.00 86.06  ? 71  DC  I O2    1 
ATOM 9215  N N3    . DC  I 5 155 ? 238.967 227.691 210.050 1.00 86.06  ? 71  DC  I N3    1 
ATOM 9216  C C4    . DC  I 5 155 ? 239.240 228.886 210.559 1.00 86.06  ? 71  DC  I C4    1 
ATOM 9217  N N4    . DC  I 5 155 ? 238.241 229.576 211.105 1.00 86.06  ? 71  DC  I N4    1 
ATOM 9218  C C5    . DC  I 5 155 ? 240.548 229.434 210.522 1.00 86.06  ? 71  DC  I C5    1 
ATOM 9219  C C6    . DC  I 5 155 ? 241.506 228.699 209.959 1.00 86.06  ? 71  DC  I C6    1 
ATOM 9220  P P     . DA  I 5 156 ? 245.287 224.938 206.072 1.00 99.29  ? 72  DA  I P     1 
ATOM 9221  O OP1   . DA  I 5 156 ? 246.252 224.221 206.933 1.00 99.29  ? 72  DA  I OP1   1 
ATOM 9222  O OP2   . DA  I 5 156 ? 245.752 226.033 205.193 1.00 99.29  ? 72  DA  I OP2   1 
ATOM 9223  O "O5'" . DA  I 5 156 ? 244.499 223.869 205.187 1.00 99.29  ? 72  DA  I "O5'" 1 
ATOM 9224  C "C5'" . DA  I 5 156 ? 243.517 223.039 205.801 1.00 99.29  ? 72  DA  I "C5'" 1 
ATOM 9225  C "C4'" . DA  I 5 156 ? 242.245 223.005 204.976 1.00 99.29  ? 72  DA  I "C4'" 1 
ATOM 9226  O "O4'" . DA  I 5 156 ? 241.234 223.842 205.593 1.00 99.29  ? 72  DA  I "O4'" 1 
ATOM 9227  C "C3'" . DA  I 5 156 ? 242.401 223.493 203.537 1.00 99.29  ? 72  DA  I "C3'" 1 
ATOM 9228  O "O3'" . DA  I 5 156 ? 241.837 222.541 202.646 1.00 99.29  ? 72  DA  I "O3'" 1 
ATOM 9229  C "C2'" . DA  I 5 156 ? 241.645 224.824 203.512 1.00 99.29  ? 72  DA  I "C2'" 1 
ATOM 9230  C "C1'" . DA  I 5 156 ? 240.622 224.659 204.622 1.00 99.29  ? 72  DA  I "C1'" 1 
ATOM 9231  N N9    . DA  I 5 156 ? 240.282 225.926 205.254 1.00 99.29  ? 72  DA  I N9    1 
ATOM 9232  C C8    . DA  I 5 156 ? 241.142 226.947 205.529 1.00 99.29  ? 72  DA  I C8    1 
ATOM 9233  N N7    . DA  I 5 156 ? 240.577 227.975 206.102 1.00 99.29  ? 72  DA  I N7    1 
ATOM 9234  C C5    . DA  I 5 156 ? 239.252 227.605 206.214 1.00 99.29  ? 72  DA  I C5    1 
ATOM 9235  C C6    . DA  I 5 156 ? 238.135 228.268 206.738 1.00 99.29  ? 72  DA  I C6    1 
ATOM 9236  N N6    . DA  I 5 156 ? 238.195 229.487 207.271 1.00 99.29  ? 72  DA  I N6    1 
ATOM 9237  N N1    . DA  I 5 156 ? 236.953 227.630 206.700 1.00 99.29  ? 72  DA  I N1    1 
ATOM 9238  C C2    . DA  I 5 156 ? 236.899 226.404 206.168 1.00 99.29  ? 72  DA  I C2    1 
ATOM 9239  N N3    . DA  I 5 156 ? 237.886 225.678 205.640 1.00 99.29  ? 72  DA  I N3    1 
ATOM 9240  C C4    . DA  I 5 156 ? 239.048 226.345 205.694 1.00 99.29  ? 72  DA  I C4    1 
ATOM 9241  P P     . DG  I 5 157 ? 241.898 222.757 201.055 1.00 109.84 ? 73  DG  I P     1 
ATOM 9242  O OP1   . DG  I 5 157 ? 242.455 221.515 200.477 1.00 109.84 ? 73  DG  I OP1   1 
ATOM 9243  O OP2   . DG  I 5 157 ? 242.543 224.050 200.737 1.00 109.84 ? 73  DG  I OP2   1 
ATOM 9244  O "O5'" . DG  I 5 157 ? 240.361 222.861 200.652 1.00 109.84 ? 73  DG  I "O5'" 1 
ATOM 9245  C "C5'" . DG  I 5 157 ? 239.424 221.989 201.263 1.00 109.84 ? 73  DG  I "C5'" 1 
ATOM 9246  C "C4'" . DG  I 5 157 ? 238.056 222.633 201.324 1.00 109.84 ? 73  DG  I "C4'" 1 
ATOM 9247  O "O4'" . DG  I 5 157 ? 238.107 223.816 202.167 1.00 109.84 ? 73  DG  I "O4'" 1 
ATOM 9248  C "C3'" . DG  I 5 157 ? 237.508 223.107 199.974 1.00 109.84 ? 73  DG  I "C3'" 1 
ATOM 9249  O "O3'" . DG  I 5 157 ? 236.132 222.777 199.879 1.00 109.84 ? 73  DG  I "O3'" 1 
ATOM 9250  C "C2'" . DG  I 5 157 ? 237.710 224.617 200.040 1.00 109.84 ? 73  DG  I "C2'" 1 
ATOM 9251  C "C1'" . DG  I 5 157 ? 237.439 224.860 201.507 1.00 109.84 ? 73  DG  I "C1'" 1 
ATOM 9252  N N9    . DG  I 5 157 ? 237.941 226.135 201.998 1.00 109.84 ? 73  DG  I N9    1 
ATOM 9253  C C8    . DG  I 5 157 ? 239.227 226.605 201.922 1.00 109.84 ? 73  DG  I C8    1 
ATOM 9254  N N7    . DG  I 5 157 ? 239.377 227.787 202.444 1.00 109.84 ? 73  DG  I N7    1 
ATOM 9255  C C5    . DG  I 5 157 ? 238.108 228.124 202.890 1.00 109.84 ? 73  DG  I C5    1 
ATOM 9256  C C6    . DG  I 5 157 ? 237.656 229.289 203.541 1.00 109.84 ? 73  DG  I C6    1 
ATOM 9257  O O6    . DG  I 5 157 ? 238.308 230.286 203.865 1.00 109.84 ? 73  DG  I O6    1 
ATOM 9258  N N1    . DG  I 5 157 ? 236.300 229.227 203.825 1.00 109.84 ? 73  DG  I N1    1 
ATOM 9259  C C2    . DG  I 5 157 ? 235.481 228.172 203.519 1.00 109.84 ? 73  DG  I C2    1 
ATOM 9260  N N2    . DG  I 5 157 ? 234.194 228.295 203.871 1.00 109.84 ? 73  DG  I N2    1 
ATOM 9261  N N3    . DG  I 5 157 ? 235.891 227.071 202.905 1.00 109.84 ? 73  DG  I N3    1 
ATOM 9262  C C4    . DG  I 5 157 ? 237.213 227.118 202.623 1.00 109.84 ? 73  DG  I C4    1 
ATOM 9263  P P     . DG  I 5 158 ? 235.379 222.810 198.461 1.00 118.43 ? 74  DG  I P     1 
ATOM 9264  O OP1   . DG  I 5 158 ? 235.057 221.411 198.109 1.00 118.43 ? 74  DG  I OP1   1 
ATOM 9265  O OP2   . DG  I 5 158 ? 236.155 223.645 197.518 1.00 118.43 ? 74  DG  I OP2   1 
ATOM 9266  O "O5'" . DG  I 5 158 ? 234.024 223.591 198.775 1.00 118.43 ? 74  DG  I "O5'" 1 
ATOM 9267  C "C5'" . DG  I 5 158 ? 233.133 223.104 199.769 1.00 118.43 ? 74  DG  I "C5'" 1 
ATOM 9268  C "C4'" . DG  I 5 158 ? 231.991 224.081 199.996 1.00 118.43 ? 74  DG  I "C4'" 1 
ATOM 9269  O "O4'" . DG  I 5 158 ? 232.497 225.282 200.631 1.00 118.43 ? 74  DG  I "O4'" 1 
ATOM 9270  C "C3'" . DG  I 5 158 ? 231.280 224.548 198.735 1.00 118.43 ? 74  DG  I "C3'" 1 
ATOM 9271  O "O3'" . DG  I 5 158 ? 229.906 224.786 199.006 1.00 118.43 ? 74  DG  I "O3'" 1 
ATOM 9272  C "C2'" . DG  I 5 158 ? 232.016 225.836 198.373 1.00 118.43 ? 74  DG  I "C2'" 1 
ATOM 9273  C "C1'" . DG  I 5 158 ? 232.461 226.373 199.732 1.00 118.43 ? 74  DG  I "C1'" 1 
ATOM 9274  N N9    . DG  I 5 158 ? 233.791 226.976 199.701 1.00 118.43 ? 74  DG  I N9    1 
ATOM 9275  C C8    . DG  I 5 158 ? 234.928 226.431 199.166 1.00 118.43 ? 74  DG  I C8    1 
ATOM 9276  N N7    . DG  I 5 158 ? 235.973 227.193 199.280 1.00 118.43 ? 74  DG  I N7    1 
ATOM 9277  C C5    . DG  I 5 158 ? 235.503 228.316 199.939 1.00 118.43 ? 74  DG  I C5    1 
ATOM 9278  C C6    . DG  I 5 158 ? 236.185 229.480 200.340 1.00 118.43 ? 74  DG  I C6    1 
ATOM 9279  O O6    . DG  I 5 158 ? 237.379 229.755 200.182 1.00 118.43 ? 74  DG  I O6    1 
ATOM 9280  N N1    . DG  I 5 158 ? 235.339 230.378 200.976 1.00 118.43 ? 74  DG  I N1    1 
ATOM 9281  C C2    . DG  I 5 158 ? 233.999 230.173 201.201 1.00 118.43 ? 74  DG  I C2    1 
ATOM 9282  N N2    . DG  I 5 158 ? 233.343 231.154 201.834 1.00 118.43 ? 74  DG  I N2    1 
ATOM 9283  N N3    . DG  I 5 158 ? 233.345 229.083 200.829 1.00 118.43 ? 74  DG  I N3    1 
ATOM 9284  C C4    . DG  I 5 158 ? 234.160 228.199 200.207 1.00 118.43 ? 74  DG  I C4    1 
ATOM 9285  P P     . DG  I 5 159 ? 228.917 225.225 197.819 1.00 123.86 ? 75  DG  I P     1 
ATOM 9286  O OP1   . DG  I 5 159 ? 227.600 224.593 198.060 1.00 123.86 ? 75  DG  I OP1   1 
ATOM 9287  O OP2   . DG  I 5 159 ? 229.618 224.992 196.537 1.00 123.86 ? 75  DG  I OP2   1 
ATOM 9288  O "O5'" . DG  I 5 159 ? 228.762 226.801 198.023 1.00 123.86 ? 75  DG  I "O5'" 1 
ATOM 9289  C "C5'" . DG  I 5 159 ? 228.246 227.300 199.244 1.00 123.86 ? 75  DG  I "C5'" 1 
ATOM 9290  C "C4'" . DG  I 5 159 ? 228.393 228.807 199.319 1.00 123.86 ? 75  DG  I "C4'" 1 
ATOM 9291  O "O4'" . DG  I 5 159 ? 229.801 229.161 199.357 1.00 123.86 ? 75  DG  I "O4'" 1 
ATOM 9292  C "C3'" . DG  I 5 159 ? 227.794 229.580 198.142 1.00 123.86 ? 75  DG  I "C3'" 1 
ATOM 9293  O "O3'" . DG  I 5 159 ? 227.148 230.747 198.626 1.00 123.86 ? 75  DG  I "O3'" 1 
ATOM 9294  C "C2'" . DG  I 5 159 ? 229.024 229.931 197.310 1.00 123.86 ? 75  DG  I "C2'" 1 
ATOM 9295  C "C1'" . DG  I 5 159 ? 230.046 230.168 198.407 1.00 123.86 ? 75  DG  I "C1'" 1 
ATOM 9296  N N9    . DG  I 5 159 ? 231.434 230.062 197.967 1.00 123.86 ? 75  DG  I N9    1 
ATOM 9297  C C8    . DG  I 5 159 ? 232.015 229.009 197.305 1.00 123.86 ? 75  DG  I C8    1 
ATOM 9298  N N7    . DG  I 5 159 ? 233.279 229.190 197.051 1.00 123.86 ? 75  DG  I N7    1 
ATOM 9299  C C5    . DG  I 5 159 ? 233.558 230.442 197.582 1.00 123.86 ? 75  DG  I C5    1 
ATOM 9300  C C6    . DG  I 5 159 ? 234.766 231.173 197.604 1.00 123.86 ? 75  DG  I C6    1 
ATOM 9301  O O6    . DG  I 5 159 ? 235.868 230.846 197.147 1.00 123.86 ? 75  DG  I O6    1 
ATOM 9302  N N1    . DG  I 5 159 ? 234.615 232.402 198.239 1.00 123.86 ? 75  DG  I N1    1 
ATOM 9303  C C2    . DG  I 5 159 ? 233.441 232.865 198.783 1.00 123.86 ? 75  DG  I C2    1 
ATOM 9304  N N2    . DG  I 5 159 ? 233.489 234.076 199.355 1.00 123.86 ? 75  DG  I N2    1 
ATOM 9305  N N3    . DG  I 5 159 ? 232.301 232.191 198.767 1.00 123.86 ? 75  DG  I N3    1 
ATOM 9306  C C4    . DG  I 5 159 ? 232.433 230.991 198.152 1.00 123.86 ? 75  DG  I C4    1 
ATOM 9307  P P     . DC  I 5 160 ? 225.916 231.392 197.826 1.00 125.37 ? 76  DC  I P     1 
ATOM 9308  O OP1   . DC  I 5 160 ? 224.689 231.111 198.604 1.00 125.37 ? 76  DC  I OP1   1 
ATOM 9309  O OP2   . DC  I 5 160 ? 226.007 230.964 196.412 1.00 125.37 ? 76  DC  I OP2   1 
ATOM 9310  O "O5'" . DC  I 5 160 ? 226.217 232.961 197.880 1.00 125.37 ? 76  DC  I "O5'" 1 
ATOM 9311  C "C5'" . DC  I 5 160 ? 226.483 233.590 199.128 1.00 125.37 ? 76  DC  I "C5'" 1 
ATOM 9312  C "C4'" . DC  I 5 160 ? 227.143 234.943 198.924 1.00 125.37 ? 76  DC  I "C4'" 1 
ATOM 9313  O "O4'" . DC  I 5 160 ? 228.561 234.760 198.667 1.00 125.37 ? 76  DC  I "O4'" 1 
ATOM 9314  C "C3'" . DC  I 5 160 ? 226.597 235.760 197.757 1.00 125.37 ? 76  DC  I "C3'" 1 
ATOM 9315  O "O3'" . DC  I 5 160 ? 226.524 237.130 198.115 1.00 125.37 ? 76  DC  I "O3'" 1 
ATOM 9316  C "C2'" . DC  I 5 160 ? 227.625 235.519 196.652 1.00 125.37 ? 76  DC  I "C2'" 1 
ATOM 9317  C "C1'" . DC  I 5 160 ? 228.915 235.374 197.448 1.00 125.37 ? 76  DC  I "C1'" 1 
ATOM 9318  N N1    . DC  I 5 160 ? 229.934 234.521 196.771 1.00 125.37 ? 76  DC  I N1    1 
ATOM 9319  C C2    . DC  I 5 160 ? 231.259 234.965 196.671 1.00 125.37 ? 76  DC  I C2    1 
ATOM 9320  O O2    . DC  I 5 160 ? 231.566 236.061 197.152 1.00 125.37 ? 76  DC  I O2    1 
ATOM 9321  N N3    . DC  I 5 160 ? 232.169 234.176 196.048 1.00 125.37 ? 76  DC  I N3    1 
ATOM 9322  C C4    . DC  I 5 160 ? 231.796 232.999 195.542 1.00 125.37 ? 76  DC  I C4    1 
ATOM 9323  N N4    . DC  I 5 160 ? 232.726 232.252 194.938 1.00 125.37 ? 76  DC  I N4    1 
ATOM 9324  C C5    . DC  I 5 160 ? 230.456 232.534 195.634 1.00 125.37 ? 76  DC  I C5    1 
ATOM 9325  C C6    . DC  I 5 160 ? 229.566 233.318 196.250 1.00 125.37 ? 76  DC  I C6    1 
ATOM 9326  P P     . DG  J 6 8   ? 243.514 234.856 192.168 1.00 126.37 ? -76 DG  J P     1 
ATOM 9327  O OP1   . DG  J 6 8   ? 244.968 235.126 192.231 1.00 126.37 ? -76 DG  J OP1   1 
ATOM 9328  O OP2   . DG  J 6 8   ? 243.008 233.469 192.252 1.00 126.37 ? -76 DG  J OP2   1 
ATOM 9329  O "O5'" . DG  J 6 8   ? 242.777 235.714 193.300 1.00 126.37 ? -76 DG  J "O5'" 1 
ATOM 9330  C "C5'" . DG  J 6 8   ? 242.806 237.132 193.243 1.00 126.37 ? -76 DG  J "C5'" 1 
ATOM 9331  C "C4'" . DG  J 6 8   ? 241.919 237.735 194.314 1.00 126.37 ? -76 DG  J "C4'" 1 
ATOM 9332  O "O4'" . DG  J 6 8   ? 240.549 237.293 194.121 1.00 126.37 ? -76 DG  J "O4'" 1 
ATOM 9333  C "C3'" . DG  J 6 8   ? 242.285 237.356 195.750 1.00 126.37 ? -76 DG  J "C3'" 1 
ATOM 9334  O "O3'" . DG  J 6 8   ? 242.106 238.481 196.600 1.00 126.37 ? -76 DG  J "O3'" 1 
ATOM 9335  C "C2'" . DG  J 6 8   ? 241.290 236.243 196.072 1.00 126.37 ? -76 DG  J "C2'" 1 
ATOM 9336  C "C1'" . DG  J 6 8   ? 240.063 236.717 195.315 1.00 126.37 ? -76 DG  J "C1'" 1 
ATOM 9337  N N9    . DG  J 6 8   ? 239.133 235.647 194.964 1.00 126.37 ? -76 DG  J N9    1 
ATOM 9338  C C8    . DG  J 6 8   ? 239.421 234.491 194.279 1.00 126.37 ? -76 DG  J C8    1 
ATOM 9339  N N7    . DG  J 6 8   ? 238.384 233.721 194.101 1.00 126.37 ? -76 DG  J N7    1 
ATOM 9340  C C5    . DG  J 6 8   ? 237.339 234.413 194.700 1.00 126.37 ? -76 DG  J C5    1 
ATOM 9341  C C6    . DG  J 6 8   ? 235.969 234.072 194.821 1.00 126.37 ? -76 DG  J C6    1 
ATOM 9342  O O6    . DG  J 6 8   ? 235.390 233.057 194.411 1.00 126.37 ? -76 DG  J O6    1 
ATOM 9343  N N1    . DG  J 6 8   ? 235.254 235.052 195.501 1.00 126.37 ? -76 DG  J N1    1 
ATOM 9344  C C2    . DG  J 6 8   ? 235.792 236.215 196.001 1.00 126.37 ? -76 DG  J C2    1 
ATOM 9345  N N2    . DG  J 6 8   ? 234.940 237.041 196.628 1.00 126.37 ? -76 DG  J N2    1 
ATOM 9346  N N3    . DG  J 6 8   ? 237.071 236.547 195.895 1.00 126.37 ? -76 DG  J N3    1 
ATOM 9347  C C4    . DG  J 6 8   ? 237.783 235.601 195.234 1.00 126.37 ? -76 DG  J C4    1 
ATOM 9348  P P     . DC  J 6 9   ? 242.775 238.514 198.061 1.00 125.02 ? -75 DC  J P     1 
ATOM 9349  O OP1   . DC  J 6 9   ? 243.671 239.689 198.120 1.00 125.02 ? -75 DC  J OP1   1 
ATOM 9350  O OP2   . DC  J 6 9   ? 243.306 237.165 198.354 1.00 125.02 ? -75 DC  J OP2   1 
ATOM 9351  O "O5'" . DC  J 6 9   ? 241.534 238.758 199.036 1.00 125.02 ? -75 DC  J "O5'" 1 
ATOM 9352  C "C5'" . DC  J 6 9   ? 240.488 239.636 198.641 1.00 125.02 ? -75 DC  J "C5'" 1 
ATOM 9353  C "C4'" . DC  J 6 9   ? 239.259 239.436 199.505 1.00 125.02 ? -75 DC  J "C4'" 1 
ATOM 9354  O "O4'" . DC  J 6 9   ? 238.417 238.398 198.931 1.00 125.02 ? -75 DC  J "O4'" 1 
ATOM 9355  C "C3'" . DC  J 6 9   ? 239.536 239.005 200.943 1.00 125.02 ? -75 DC  J "C3'" 1 
ATOM 9356  O "O3'" . DC  J 6 9   ? 238.613 239.650 201.807 1.00 125.02 ? -75 DC  J "O3'" 1 
ATOM 9357  C "C2'" . DC  J 6 9   ? 239.299 237.495 200.889 1.00 125.02 ? -75 DC  J "C2'" 1 
ATOM 9358  C "C1'" . DC  J 6 9   ? 238.144 237.418 199.905 1.00 125.02 ? -75 DC  J "C1'" 1 
ATOM 9359  N N1    . DC  J 6 9   ? 238.017 236.099 199.217 1.00 125.02 ? -75 DC  J N1    1 
ATOM 9360  C C2    . DC  J 6 9   ? 236.754 235.514 199.064 1.00 125.02 ? -75 DC  J C2    1 
ATOM 9361  O O2    . DC  J 6 9   ? 235.761 236.097 199.511 1.00 125.02 ? -75 DC  J O2    1 
ATOM 9362  N N3    . DC  J 6 9   ? 236.656 234.321 198.425 1.00 125.02 ? -75 DC  J N3    1 
ATOM 9363  C C4    . DC  J 6 9   ? 237.751 233.725 197.956 1.00 125.02 ? -75 DC  J C4    1 
ATOM 9364  N N4    . DC  J 6 9   ? 237.606 232.550 197.336 1.00 125.02 ? -75 DC  J N4    1 
ATOM 9365  C C5    . DC  J 6 9   ? 239.044 234.306 198.102 1.00 125.02 ? -75 DC  J C5    1 
ATOM 9366  C C6    . DC  J 6 9   ? 239.129 235.482 198.730 1.00 125.02 ? -75 DC  J C6    1 
ATOM 9367  P P     . DC  J 6 10  ? 238.776 239.574 203.403 1.00 120.66 ? -74 DC  J P     1 
ATOM 9368  O OP1   . DC  J 6 10  ? 238.789 240.972 203.893 1.00 120.66 ? -74 DC  J OP1   1 
ATOM 9369  O OP2   . DC  J 6 10  ? 239.904 238.676 203.736 1.00 120.66 ? -74 DC  J OP2   1 
ATOM 9370  O "O5'" . DC  J 6 10  ? 237.426 238.860 203.882 1.00 120.66 ? -74 DC  J "O5'" 1 
ATOM 9371  C "C5'" . DC  J 6 10  ? 236.168 239.318 203.389 1.00 120.66 ? -74 DC  J "C5'" 1 
ATOM 9372  C "C4'" . DC  J 6 10  ? 235.083 238.265 203.568 1.00 120.66 ? -74 DC  J "C4'" 1 
ATOM 9373  O "O4'" . DC  J 6 10  ? 235.318 237.148 202.666 1.00 120.66 ? -74 DC  J "O4'" 1 
ATOM 9374  C "C3'" . DC  J 6 10  ? 234.977 237.654 204.966 1.00 120.66 ? -74 DC  J "C3'" 1 
ATOM 9375  O "O3'" . DC  J 6 10  ? 233.606 237.440 205.290 1.00 120.66 ? -74 DC  J "O3'" 1 
ATOM 9376  C "C2'" . DC  J 6 10  ? 235.715 236.331 204.802 1.00 120.66 ? -74 DC  J "C2'" 1 
ATOM 9377  C "C1'" . DC  J 6 10  ? 235.279 235.944 203.403 1.00 120.66 ? -74 DC  J "C1'" 1 
ATOM 9378  N N1    . DC  J 6 10  ? 236.173 234.959 202.745 1.00 120.66 ? -74 DC  J N1    1 
ATOM 9379  C C2    . DC  J 6 10  ? 235.628 233.824 202.142 1.00 120.66 ? -74 DC  J C2    1 
ATOM 9380  O O2    . DC  J 6 10  ? 234.407 233.653 202.172 1.00 120.66 ? -74 DC  J O2    1 
ATOM 9381  N N3    . DC  J 6 10  ? 236.457 232.942 201.538 1.00 120.66 ? -74 DC  J N3    1 
ATOM 9382  C C4    . DC  J 6 10  ? 237.770 233.162 201.527 1.00 120.66 ? -74 DC  J C4    1 
ATOM 9383  N N4    . DC  J 6 10  ? 238.551 232.265 200.922 1.00 120.66 ? -74 DC  J N4    1 
ATOM 9384  C C5    . DC  J 6 10  ? 238.343 234.314 202.137 1.00 120.66 ? -74 DC  J C5    1 
ATOM 9385  C C6    . DC  J 6 10  ? 237.515 235.176 202.727 1.00 120.66 ? -74 DC  J C6    1 
ATOM 9386  P P     . DC  J 6 11  ? 233.150 237.249 206.819 1.00 111.73 ? -73 DC  J P     1 
ATOM 9387  O OP1   . DC  J 6 11  ? 232.323 238.419 207.191 1.00 111.73 ? -73 DC  J OP1   1 
ATOM 9388  O OP2   . DC  J 6 11  ? 234.358 236.932 207.608 1.00 111.73 ? -73 DC  J OP2   1 
ATOM 9389  O "O5'" . DC  J 6 11  ? 232.233 235.934 206.788 1.00 111.73 ? -73 DC  J "O5'" 1 
ATOM 9390  C "C5'" . DC  J 6 11  ? 231.095 235.871 205.933 1.00 111.73 ? -73 DC  J "C5'" 1 
ATOM 9391  C "C4'" . DC  J 6 11  ? 230.470 234.479 205.932 1.00 111.73 ? -73 DC  J "C4'" 1 
ATOM 9392  O "O4'" . DC  J 6 11  ? 231.378 233.525 205.329 1.00 111.73 ? -73 DC  J "O4'" 1 
ATOM 9393  C "C3'" . DC  J 6 11  ? 230.127 233.907 207.299 1.00 111.73 ? -73 DC  J "C3'" 1 
ATOM 9394  O "O3'" . DC  J 6 11  ? 229.006 233.049 207.184 1.00 111.73 ? -73 DC  J "O3'" 1 
ATOM 9395  C "C2'" . DC  J 6 11  ? 231.387 233.126 207.660 1.00 111.73 ? -73 DC  J "C2'" 1 
ATOM 9396  C "C1'" . DC  J 6 11  ? 231.841 232.602 206.301 1.00 111.73 ? -73 DC  J "C1'" 1 
ATOM 9397  N N1    . DC  J 6 11  ? 233.312 232.518 206.157 1.00 111.73 ? -73 DC  J N1    1 
ATOM 9398  C C2    . DC  J 6 11  ? 233.879 231.455 205.451 1.00 111.73 ? -73 DC  J C2    1 
ATOM 9399  O O2    . DC  J 6 11  ? 233.143 230.587 204.978 1.00 111.73 ? -73 DC  J O2    1 
ATOM 9400  N N3    . DC  J 6 11  ? 235.224 231.410 205.309 1.00 111.73 ? -73 DC  J N3    1 
ATOM 9401  C C4    . DC  J 6 11  ? 235.980 232.369 205.834 1.00 111.73 ? -73 DC  J C4    1 
ATOM 9402  N N4    . DC  J 6 11  ? 237.301 232.285 205.672 1.00 111.73 ? -73 DC  J N4    1 
ATOM 9403  C C5    . DC  J 6 11  ? 235.417 233.458 206.555 1.00 111.73 ? -73 DC  J C5    1 
ATOM 9404  C C6    . DC  J 6 11  ? 234.094 233.497 206.683 1.00 111.73 ? -73 DC  J C6    1 
ATOM 9405  P P     . DT  J 6 12  ? 227.913 232.983 208.358 1.00 102.87 ? -72 DT  J P     1 
ATOM 9406  O OP1   . DT  J 6 12  ? 226.621 233.437 207.795 1.00 102.87 ? -72 DT  J OP1   1 
ATOM 9407  O OP2   . DT  J 6 12  ? 228.485 233.654 209.545 1.00 102.87 ? -72 DT  J OP2   1 
ATOM 9408  O "O5'" . DT  J 6 12  ? 227.811 231.425 208.685 1.00 102.87 ? -72 DT  J "O5'" 1 
ATOM 9409  C "C5'" . DT  J 6 12  ? 228.995 230.668 208.860 1.00 102.87 ? -72 DT  J "C5'" 1 
ATOM 9410  C "C4'" . DT  J 6 12  ? 228.945 229.393 208.041 1.00 102.87 ? -72 DT  J "C4'" 1 
ATOM 9411  O "O4'" . DT  J 6 12  ? 230.201 229.223 207.337 1.00 102.87 ? -72 DT  J "O4'" 1 
ATOM 9412  C "C3'" . DT  J 6 12  ? 228.792 228.124 208.851 1.00 102.87 ? -72 DT  J "C3'" 1 
ATOM 9413  O "O3'" . DT  J 6 12  ? 228.290 227.091 208.019 1.00 102.87 ? -72 DT  J "O3'" 1 
ATOM 9414  C "C2'" . DT  J 6 12  ? 230.232 227.857 209.257 1.00 102.87 ? -72 DT  J "C2'" 1 
ATOM 9415  C "C1'" . DT  J 6 12  ? 230.978 228.224 207.981 1.00 102.87 ? -72 DT  J "C1'" 1 
ATOM 9416  N N1    . DT  J 6 12  ? 232.343 228.784 208.209 1.00 102.87 ? -72 DT  J N1    1 
ATOM 9417  C C2    . DT  J 6 12  ? 233.437 228.142 207.675 1.00 102.87 ? -72 DT  J C2    1 
ATOM 9418  O O2    . DT  J 6 12  ? 233.360 227.113 207.030 1.00 102.87 ? -72 DT  J O2    1 
ATOM 9419  N N3    . DT  J 6 12  ? 234.636 228.754 207.927 1.00 102.87 ? -72 DT  J N3    1 
ATOM 9420  C C4    . DT  J 6 12  ? 234.842 229.917 208.643 1.00 102.87 ? -72 DT  J C4    1 
ATOM 9421  O O4    . DT  J 6 12  ? 235.955 230.390 208.820 1.00 102.87 ? -72 DT  J O4    1 
ATOM 9422  C C5    . DT  J 6 12  ? 233.657 230.538 209.168 1.00 102.87 ? -72 DT  J C5    1 
ATOM 9423  C C7    . DT  J 6 12  ? 233.763 231.804 209.960 1.00 102.87 ? -72 DT  J C7    1 
ATOM 9424  C C6    . DT  J 6 12  ? 232.478 229.951 208.927 1.00 102.87 ? -72 DT  J C6    1 
ATOM 9425  P P     . DG  J 6 13  ? 227.621 225.780 208.660 1.00 92.35  ? -71 DG  J P     1 
ATOM 9426  O OP1   . DG  J 6 13  ? 226.670 225.252 207.657 1.00 92.35  ? -71 DG  J OP1   1 
ATOM 9427  O OP2   . DG  J 6 13  ? 227.143 226.106 210.020 1.00 92.35  ? -71 DG  J OP2   1 
ATOM 9428  O "O5'" . DG  J 6 13  ? 228.841 224.761 208.796 1.00 92.35  ? -71 DG  J "O5'" 1 
ATOM 9429  C "C5'" . DG  J 6 13  ? 229.499 224.294 207.631 1.00 92.35  ? -71 DG  J "C5'" 1 
ATOM 9430  C "C4'" . DG  J 6 13  ? 230.623 223.336 207.982 1.00 92.35  ? -71 DG  J "C4'" 1 
ATOM 9431  O "O4'" . DG  J 6 13  ? 231.830 224.079 208.288 1.00 92.35  ? -71 DG  J "O4'" 1 
ATOM 9432  C "C3'" . DG  J 6 13  ? 230.372 222.451 209.193 1.00 92.35  ? -71 DG  J "C3'" 1 
ATOM 9433  O "O3'" . DG  J 6 13  ? 231.008 221.212 208.992 1.00 92.35  ? -71 DG  J "O3'" 1 
ATOM 9434  C "C2'" . DG  J 6 13  ? 231.044 223.234 210.312 1.00 92.35  ? -71 DG  J "C2'" 1 
ATOM 9435  C "C1'" . DG  J 6 13  ? 232.272 223.744 209.587 1.00 92.35  ? -71 DG  J "C1'" 1 
ATOM 9436  N N9    . DG  J 6 13  ? 232.848 224.935 210.171 1.00 92.35  ? -71 DG  J N9    1 
ATOM 9437  C C8    . DG  J 6 13  ? 232.199 225.916 210.868 1.00 92.35  ? -71 DG  J C8    1 
ATOM 9438  N N7    . DG  J 6 13  ? 232.980 226.885 211.245 1.00 92.35  ? -71 DG  J N7    1 
ATOM 9439  C C5    . DG  J 6 13  ? 234.224 226.514 210.768 1.00 92.35  ? -71 DG  J C5    1 
ATOM 9440  C C6    . DG  J 6 13  ? 235.466 227.160 210.874 1.00 92.35  ? -71 DG  J C6    1 
ATOM 9441  O O6    . DG  J 6 13  ? 235.725 228.234 211.428 1.00 92.35  ? -71 DG  J O6    1 
ATOM 9442  N N1    . DG  J 6 13  ? 236.471 226.440 210.245 1.00 92.35  ? -71 DG  J N1    1 
ATOM 9443  C C2    . DG  J 6 13  ? 236.296 225.243 209.602 1.00 92.35  ? -71 DG  J C2    1 
ATOM 9444  N N2    . DG  J 6 13  ? 237.379 224.690 209.055 1.00 92.35  ? -71 DG  J N2    1 
ATOM 9445  N N3    . DG  J 6 13  ? 235.137 224.628 209.498 1.00 92.35  ? -71 DG  J N3    1 
ATOM 9446  C C4    . DG  J 6 13  ? 234.152 225.319 210.100 1.00 92.35  ? -71 DG  J C4    1 
ATOM 9447  P P     . DG  J 6 14  ? 230.136 219.881 208.798 1.00 85.09  ? -70 DG  J P     1 
ATOM 9448  O OP1   . DG  J 6 14  ? 230.670 219.178 207.611 1.00 85.09  ? -70 DG  J OP1   1 
ATOM 9449  O OP2   . DG  J 6 14  ? 228.709 220.267 208.859 1.00 85.09  ? -70 DG  J OP2   1 
ATOM 9450  O "O5'" . DG  J 6 14  ? 230.460 219.030 210.107 1.00 85.09  ? -70 DG  J "O5'" 1 
ATOM 9451  C "C5'" . DG  J 6 14  ? 231.537 219.418 210.944 1.00 85.09  ? -70 DG  J "C5'" 1 
ATOM 9452  C "C4'" . DG  J 6 14  ? 232.861 218.939 210.378 1.00 85.09  ? -70 DG  J "C4'" 1 
ATOM 9453  O "O4'" . DG  J 6 14  ? 233.766 220.057 210.254 1.00 85.09  ? -70 DG  J "O4'" 1 
ATOM 9454  C "C3'" . DG  J 6 14  ? 233.603 217.965 211.258 1.00 85.09  ? -70 DG  J "C3'" 1 
ATOM 9455  O "O3'" . DG  J 6 14  ? 234.563 217.277 210.492 1.00 85.09  ? -70 DG  J "O3'" 1 
ATOM 9456  C "C2'" . DG  J 6 14  ? 234.260 218.904 212.263 1.00 85.09  ? -70 DG  J "C2'" 1 
ATOM 9457  C "C1'" . DG  J 6 14  ? 234.606 220.114 211.396 1.00 85.09  ? -70 DG  J "C1'" 1 
ATOM 9458  N N9    . DG  J 6 14  ? 234.371 221.392 212.057 1.00 85.09  ? -70 DG  J N9    1 
ATOM 9459  C C8    . DG  J 6 14  ? 233.177 221.866 212.530 1.00 85.09  ? -70 DG  J C8    1 
ATOM 9460  N N7    . DG  J 6 14  ? 233.259 223.049 213.060 1.00 85.09  ? -70 DG  J N7    1 
ATOM 9461  C C5    . DG  J 6 14  ? 234.595 223.385 212.927 1.00 85.09  ? -70 DG  J C5    1 
ATOM 9462  C C6    . DG  J 6 14  ? 235.276 224.550 213.319 1.00 85.09  ? -70 DG  J C6    1 
ATOM 9463  O O6    . DG  J 6 14  ? 234.817 225.550 213.883 1.00 85.09  ? -70 DG  J O6    1 
ATOM 9464  N N1    . DG  J 6 14  ? 236.621 224.488 213.001 1.00 85.09  ? -70 DG  J N1    1 
ATOM 9465  C C2    . DG  J 6 14  ? 237.234 223.432 212.378 1.00 85.09  ? -70 DG  J C2    1 
ATOM 9466  N N2    . DG  J 6 14  ? 238.542 223.554 212.149 1.00 85.09  ? -70 DG  J N2    1 
ATOM 9467  N N3    . DG  J 6 14  ? 236.609 222.331 212.002 1.00 85.09  ? -70 DG  J N3    1 
ATOM 9468  C C4    . DG  J 6 14  ? 235.293 222.377 212.308 1.00 85.09  ? -70 DG  J C4    1 
ATOM 9469  P P     . DA  J 6 15  ? 235.391 216.068 211.141 1.00 79.29  ? -69 DA  J P     1 
ATOM 9470  O OP1   . DA  J 6 15  ? 235.528 215.005 210.122 1.00 79.29  ? -69 DA  J OP1   1 
ATOM 9471  O OP2   . DA  J 6 15  ? 234.784 215.759 212.453 1.00 79.29  ? -69 DA  J OP2   1 
ATOM 9472  O "O5'" . DA  J 6 15  ? 236.832 216.691 211.417 1.00 79.29  ? -69 DA  J "O5'" 1 
ATOM 9473  C "C5'" . DA  J 6 15  ? 237.816 215.893 212.028 1.00 79.29  ? -69 DA  J "C5'" 1 
ATOM 9474  C "C4'" . DA  J 6 15  ? 239.104 216.659 212.229 1.00 79.29  ? -69 DA  J "C4'" 1 
ATOM 9475  O "O4'" . DA  J 6 15  ? 238.817 218.065 212.441 1.00 79.29  ? -69 DA  J "O4'" 1 
ATOM 9476  C "C3'" . DA  J 6 15  ? 239.904 216.218 213.437 1.00 79.29  ? -69 DA  J "C3'" 1 
ATOM 9477  O "O3'" . DA  J 6 15  ? 241.275 216.397 213.190 1.00 79.29  ? -69 DA  J "O3'" 1 
ATOM 9478  C "C2'" . DA  J 6 15  ? 239.393 217.153 214.527 1.00 79.29  ? -69 DA  J "C2'" 1 
ATOM 9479  C "C1'" . DA  J 6 15  ? 239.191 218.446 213.754 1.00 79.29  ? -69 DA  J "C1'" 1 
ATOM 9480  N N9    . DA  J 6 15  ? 238.134 219.306 214.287 1.00 79.29  ? -69 DA  J N9    1 
ATOM 9481  C C8    . DA  J 6 15  ? 236.808 219.008 214.380 1.00 79.29  ? -69 DA  J C8    1 
ATOM 9482  N N7    . DA  J 6 15  ? 236.081 219.976 214.878 1.00 79.29  ? -69 DA  J N7    1 
ATOM 9483  C C5    . DA  J 6 15  ? 236.992 220.984 215.125 1.00 79.29  ? -69 DA  J C5    1 
ATOM 9484  C C6    . DA  J 6 15  ? 236.849 222.277 215.652 1.00 79.29  ? -69 DA  J C6    1 
ATOM 9485  N N6    . DA  J 6 15  ? 235.679 222.781 216.044 1.00 79.29  ? -69 DA  J N6    1 
ATOM 9486  N N1    . DA  J 6 15  ? 237.957 223.031 215.766 1.00 79.29  ? -69 DA  J N1    1 
ATOM 9487  C C2    . DA  J 6 15  ? 239.126 222.520 215.372 1.00 79.29  ? -69 DA  J C2    1 
ATOM 9488  N N3    . DA  J 6 15  ? 239.384 221.319 214.864 1.00 79.29  ? -69 DA  J N3    1 
ATOM 9489  C C4    . DA  J 6 15  ? 238.263 220.593 214.763 1.00 79.29  ? -69 DA  J C4    1 
ATOM 9490  P P     . DG  J 6 16  ? 242.349 215.418 213.868 1.00 75.23  ? -68 DG  J P     1 
ATOM 9491  O OP1   . DG  J 6 16  ? 243.424 215.174 212.884 1.00 75.23  ? -68 DG  J OP1   1 
ATOM 9492  O OP2   . DG  J 6 16  ? 241.616 214.287 214.467 1.00 75.23  ? -68 DG  J OP2   1 
ATOM 9493  O "O5'" . DG  J 6 16  ? 242.944 216.294 215.055 1.00 75.23  ? -68 DG  J "O5'" 1 
ATOM 9494  C "C5'" . DG  J 6 16  ? 243.336 217.628 214.804 1.00 75.23  ? -68 DG  J "C5'" 1 
ATOM 9495  C "C4'" . DG  J 6 16  ? 243.362 218.419 216.088 1.00 75.23  ? -68 DG  J "C4'" 1 
ATOM 9496  O "O4'" . DG  J 6 16  ? 242.074 219.044 216.311 1.00 75.23  ? -68 DG  J "O4'" 1 
ATOM 9497  C "C3'" . DG  J 6 16  ? 243.655 217.595 217.340 1.00 75.23  ? -68 DG  J "C3'" 1 
ATOM 9498  O "O3'" . DG  J 6 16  ? 244.636 218.252 218.088 1.00 75.23  ? -68 DG  J "O3'" 1 
ATOM 9499  C "C2'" . DG  J 6 16  ? 242.312 217.574 218.074 1.00 75.23  ? -68 DG  J "C2'" 1 
ATOM 9500  C "C1'" . DG  J 6 16  ? 241.754 218.922 217.669 1.00 75.23  ? -68 DG  J "C1'" 1 
ATOM 9501  N N9    . DG  J 6 16  ? 240.310 219.061 217.827 1.00 75.23  ? -68 DG  J N9    1 
ATOM 9502  C C8    . DG  J 6 16  ? 239.348 218.112 217.612 1.00 75.23  ? -68 DG  J C8    1 
ATOM 9503  N N7    . DG  J 6 16  ? 238.137 218.543 217.832 1.00 75.23  ? -68 DG  J N7    1 
ATOM 9504  C C5    . DG  J 6 16  ? 238.314 219.860 218.221 1.00 75.23  ? -68 DG  J C5    1 
ATOM 9505  C C6    . DG  J 6 16  ? 237.368 220.841 218.583 1.00 75.23  ? -68 DG  J C6    1 
ATOM 9506  O O6    . DG  J 6 16  ? 236.139 220.743 218.647 1.00 75.23  ? -68 DG  J O6    1 
ATOM 9507  N N1    . DG  J 6 16  ? 237.980 222.045 218.904 1.00 75.23  ? -68 DG  J N1    1 
ATOM 9508  C C2    . DG  J 6 16  ? 239.329 222.270 218.871 1.00 75.23  ? -68 DG  J C2    1 
ATOM 9509  N N2    . DG  J 6 16  ? 239.736 223.495 219.211 1.00 75.23  ? -68 DG  J N2    1 
ATOM 9510  N N3    . DG  J 6 16  ? 240.219 221.365 218.529 1.00 75.23  ? -68 DG  J N3    1 
ATOM 9511  C C4    . DG  J 6 16  ? 239.645 220.189 218.218 1.00 75.23  ? -68 DG  J C4    1 
ATOM 9512  P P     . DA  J 6 17  ? 245.622 217.435 219.049 1.00 71.88  ? -67 DA  J P     1 
ATOM 9513  O OP1   . DA  J 6 17  ? 246.903 217.257 218.336 1.00 71.88  ? -67 DA  J OP1   1 
ATOM 9514  O OP2   . DA  J 6 17  ? 244.884 216.264 219.576 1.00 71.88  ? -67 DA  J OP2   1 
ATOM 9515  O "O5'" . DA  J 6 17  ? 245.873 218.464 220.234 1.00 71.88  ? -67 DA  J "O5'" 1 
ATOM 9516  C "C5'" . DA  J 6 17  ? 245.904 219.849 219.944 1.00 71.88  ? -67 DA  J "C5'" 1 
ATOM 9517  C "C4'" . DA  J 6 17  ? 245.097 220.625 220.957 1.00 71.88  ? -67 DA  J "C4'" 1 
ATOM 9518  O "O4'" . DA  J 6 17  ? 243.692 220.479 220.686 1.00 71.88  ? -67 DA  J "O4'" 1 
ATOM 9519  C "C3'" . DA  J 6 17  ? 245.299 220.183 222.400 1.00 71.88  ? -67 DA  J "C3'" 1 
ATOM 9520  O "O3'" . DA  J 6 17  ? 245.944 221.215 223.108 1.00 71.88  ? -67 DA  J "O3'" 1 
ATOM 9521  C "C2'" . DA  J 6 17  ? 243.879 219.914 222.928 1.00 71.88  ? -67 DA  J "C2'" 1 
ATOM 9522  C "C1'" . DA  J 6 17  ? 242.996 220.583 221.893 1.00 71.88  ? -67 DA  J "C1'" 1 
ATOM 9523  N N9    . DA  J 6 17  ? 241.699 219.946 221.726 1.00 71.88  ? -67 DA  J N9    1 
ATOM 9524  C C8    . DA  J 6 17  ? 241.456 218.658 221.355 1.00 71.88  ? -67 DA  J C8    1 
ATOM 9525  N N7    . DA  J 6 17  ? 240.184 218.362 221.279 1.00 71.88  ? -67 DA  J N7    1 
ATOM 9526  C C5    . DA  J 6 17  ? 239.551 219.538 221.620 1.00 71.88  ? -67 DA  J C5    1 
ATOM 9527  C C6    . DA  J 6 17  ? 238.197 219.884 221.733 1.00 71.88  ? -67 DA  J C6    1 
ATOM 9528  N N6    . DA  J 6 17  ? 237.202 219.031 221.496 1.00 71.88  ? -67 DA  J N6    1 
ATOM 9529  N N1    . DA  J 6 17  ? 237.902 221.145 222.103 1.00 71.88  ? -67 DA  J N1    1 
ATOM 9530  C C2    . DA  J 6 17  ? 238.901 221.993 222.345 1.00 71.88  ? -67 DA  J C2    1 
ATOM 9531  N N3    . DA  J 6 17  ? 240.211 221.782 222.272 1.00 71.88  ? -67 DA  J N3    1 
ATOM 9532  C C4    . DA  J 6 17  ? 240.470 220.523 221.900 1.00 71.88  ? -67 DA  J C4    1 
ATOM 9533  P P     . DA  J 6 18  ? 246.408 221.005 224.626 1.00 71.25  ? -66 DA  J P     1 
ATOM 9534  O OP1   . DA  J 6 18  ? 247.797 221.492 224.730 1.00 71.25  ? -66 DA  J OP1   1 
ATOM 9535  O OP2   . DA  J 6 18  ? 246.086 219.625 225.042 1.00 71.25  ? -66 DA  J OP2   1 
ATOM 9536  O "O5'" . DA  J 6 18  ? 245.454 221.996 225.421 1.00 71.25  ? -66 DA  J "O5'" 1 
ATOM 9537  C "C5'" . DA  J 6 18  ? 244.797 223.030 224.720 1.00 71.25  ? -66 DA  J "C5'" 1 
ATOM 9538  C "C4'" . DA  J 6 18  ? 243.677 223.604 225.550 1.00 71.25  ? -66 DA  J "C4'" 1 
ATOM 9539  O "O4'" . DA  J 6 18  ? 242.423 222.992 225.160 1.00 71.25  ? -66 DA  J "O4'" 1 
ATOM 9540  C "C3'" . DA  J 6 18  ? 243.826 223.374 227.047 1.00 71.25  ? -66 DA  J "C3'" 1 
ATOM 9541  O "O3'" . DA  J 6 18  ? 243.491 224.552 227.748 1.00 71.25  ? -66 DA  J "O3'" 1 
ATOM 9542  C "C2'" . DA  J 6 18  ? 242.847 222.240 227.336 1.00 71.25  ? -66 DA  J "C2'" 1 
ATOM 9543  C "C1'" . DA  J 6 18  ? 241.772 222.460 226.288 1.00 71.25  ? -66 DA  J "C1'" 1 
ATOM 9544  N N9    . DA  J 6 18  ? 241.111 221.228 225.889 1.00 71.25  ? -66 DA  J N9    1 
ATOM 9545  C C8    . DA  J 6 18  ? 241.704 220.034 225.615 1.00 71.25  ? -66 DA  J C8    1 
ATOM 9546  N N7    . DA  J 6 18  ? 240.863 219.093 225.285 1.00 71.25  ? -66 DA  J N7    1 
ATOM 9547  C C5    . DA  J 6 18  ? 239.633 219.710 225.354 1.00 71.25  ? -66 DA  J C5    1 
ATOM 9548  C C6    . DA  J 6 18  ? 238.333 219.249 225.119 1.00 71.25  ? -66 DA  J C6    1 
ATOM 9549  N N6    . DA  J 6 18  ? 238.054 217.998 224.751 1.00 71.25  ? -66 DA  J N6    1 
ATOM 9550  N N1    . DA  J 6 18  ? 237.324 220.123 225.277 1.00 71.25  ? -66 DA  J N1    1 
ATOM 9551  C C2    . DA  J 6 18  ? 237.608 221.372 225.646 1.00 71.25  ? -66 DA  J C2    1 
ATOM 9552  N N3    . DA  J 6 18  ? 238.790 221.921 225.889 1.00 71.25  ? -66 DA  J N3    1 
ATOM 9553  C C4    . DA  J 6 18  ? 239.768 221.025 225.731 1.00 71.25  ? -66 DA  J C4    1 
ATOM 9554  P P     . DT  J 6 19  ? 243.755 224.661 229.328 1.00 74.36  ? -65 DT  J P     1 
ATOM 9555  O OP1   . DT  J 6 19  ? 244.544 225.877 229.590 1.00 74.36  ? -65 DT  J OP1   1 
ATOM 9556  O OP2   . DT  J 6 19  ? 244.261 223.365 229.822 1.00 74.36  ? -65 DT  J OP2   1 
ATOM 9557  O "O5'" . DT  J 6 19  ? 242.296 224.883 229.910 1.00 74.36  ? -65 DT  J "O5'" 1 
ATOM 9558  C "C5'" . DT  J 6 19  ? 241.330 225.546 229.122 1.00 74.36  ? -65 DT  J "C5'" 1 
ATOM 9559  C "C4'" . DT  J 6 19  ? 239.939 225.148 229.558 1.00 74.36  ? -65 DT  J "C4'" 1 
ATOM 9560  O "O4'" . DT  J 6 19  ? 239.566 223.912 228.913 1.00 74.36  ? -65 DT  J "O4'" 1 
ATOM 9561  C "C3'" . DT  J 6 19  ? 239.796 224.906 231.062 1.00 74.36  ? -65 DT  J "C3'" 1 
ATOM 9562  O "O3'" . DT  J 6 19  ? 238.903 225.861 231.629 1.00 74.36  ? -65 DT  J "O3'" 1 
ATOM 9563  C "C2'" . DT  J 6 19  ? 239.255 223.473 231.175 1.00 74.36  ? -65 DT  J "C2'" 1 
ATOM 9564  C "C1'" . DT  J 6 19  ? 238.741 223.181 229.775 1.00 74.36  ? -65 DT  J "C1'" 1 
ATOM 9565  N N1    . DT  J 6 19  ? 238.836 221.741 229.410 1.00 74.36  ? -65 DT  J N1    1 
ATOM 9566  C C2    . DT  J 6 19  ? 237.694 221.043 229.116 1.00 74.36  ? -65 DT  J C2    1 
ATOM 9567  O O2    . DT  J 6 19  ? 236.589 221.540 229.126 1.00 74.36  ? -65 DT  J O2    1 
ATOM 9568  N N3    . DT  J 6 19  ? 237.894 219.730 228.806 1.00 74.36  ? -65 DT  J N3    1 
ATOM 9569  C C4    . DT  J 6 19  ? 239.092 219.061 228.759 1.00 74.36  ? -65 DT  J C4    1 
ATOM 9570  O O4    . DT  J 6 19  ? 239.168 217.879 228.465 1.00 74.36  ? -65 DT  J O4    1 
ATOM 9571  C C5    . DT  J 6 19  ? 240.251 219.848 229.077 1.00 74.36  ? -65 DT  J C5    1 
ATOM 9572  C C7    . DT  J 6 19  ? 241.611 219.224 229.059 1.00 74.36  ? -65 DT  J C7    1 
ATOM 9573  C C6    . DT  J 6 19  ? 240.069 221.134 229.387 1.00 74.36  ? -65 DT  J C6    1 
ATOM 9574  P P     . DC  J 6 20  ? 238.479 225.765 233.176 1.00 78.50  ? -64 DC  J P     1 
ATOM 9575  O OP1   . DC  J 6 20  ? 238.160 227.132 233.634 1.00 78.50  ? -64 DC  J OP1   1 
ATOM 9576  O OP2   . DC  J 6 20  ? 239.509 224.986 233.898 1.00 78.50  ? -64 DC  J OP2   1 
ATOM 9577  O "O5'" . DC  J 6 20  ? 237.127 224.915 233.138 1.00 78.50  ? -64 DC  J "O5'" 1 
ATOM 9578  C "C5'" . DC  J 6 20  ? 236.146 225.219 232.159 1.00 78.50  ? -64 DC  J "C5'" 1 
ATOM 9579  C "C4'" . DC  J 6 20  ? 234.991 224.238 232.213 1.00 78.50  ? -64 DC  J "C4'" 1 
ATOM 9580  O "O4'" . DC  J 6 20  ? 235.400 222.954 231.672 1.00 78.50  ? -64 DC  J "O4'" 1 
ATOM 9581  C "C3'" . DC  J 6 20  ? 234.445 223.957 233.609 1.00 78.50  ? -64 DC  J "C3'" 1 
ATOM 9582  O "O3'" . DC  J 6 20  ? 233.033 223.929 233.569 1.00 78.50  ? -64 DC  J "O3'" 1 
ATOM 9583  C "C2'" . DC  J 6 20  ? 235.024 222.586 233.938 1.00 78.50  ? -64 DC  J "C2'" 1 
ATOM 9584  C "C1'" . DC  J 6 20  ? 235.049 221.930 232.571 1.00 78.50  ? -64 DC  J "C1'" 1 
ATOM 9585  N N1    . DC  J 6 20  ? 236.056 220.847 232.459 1.00 78.50  ? -64 DC  J N1    1 
ATOM 9586  C C2    . DC  J 6 20  ? 235.651 219.553 232.140 1.00 78.50  ? -64 DC  J C2    1 
ATOM 9587  O O2    . DC  J 6 20  ? 234.456 219.330 231.955 1.00 78.50  ? -64 DC  J O2    1 
ATOM 9588  N N3    . DC  J 6 20  ? 236.586 218.580 232.044 1.00 78.50  ? -64 DC  J N3    1 
ATOM 9589  C C4    . DC  J 6 20  ? 237.869 218.869 232.246 1.00 78.50  ? -64 DC  J C4    1 
ATOM 9590  N N4    . DC  J 6 20  ? 238.758 217.881 232.140 1.00 78.50  ? -64 DC  J N4    1 
ATOM 9591  C C5    . DC  J 6 20  ? 238.297 220.181 232.579 1.00 78.50  ? -64 DC  J C5    1 
ATOM 9592  C C6    . DC  J 6 20  ? 237.365 221.127 232.675 1.00 78.50  ? -64 DC  J C6    1 
ATOM 9593  P P     . DC  J 6 21  ? 232.184 223.899 234.930 1.00 81.11  ? -63 DC  J P     1 
ATOM 9594  O OP1   . DC  J 6 21  ? 231.067 224.855 234.771 1.00 81.11  ? -63 DC  J OP1   1 
ATOM 9595  O OP2   . DC  J 6 21  ? 233.119 224.030 236.066 1.00 81.11  ? -63 DC  J OP2   1 
ATOM 9596  O "O5'" . DC  J 6 21  ? 231.589 222.421 234.965 1.00 81.11  ? -63 DC  J "O5'" 1 
ATOM 9597  C "C5'" . DC  J 6 21  ? 230.872 221.933 233.853 1.00 81.11  ? -63 DC  J "C5'" 1 
ATOM 9598  C "C4'" . DC  J 6 21  ? 230.430 220.503 234.080 1.00 81.11  ? -63 DC  J "C4'" 1 
ATOM 9599  O "O4'" . DC  J 6 21  ? 231.537 219.599 233.838 1.00 81.11  ? -63 DC  J "O4'" 1 
ATOM 9600  C "C3'" . DC  J 6 21  ? 229.936 220.190 235.486 1.00 81.11  ? -63 DC  J "C3'" 1 
ATOM 9601  O "O3'" . DC  J 6 21  ? 228.881 219.249 235.399 1.00 81.11  ? -63 DC  J "O3'" 1 
ATOM 9602  C "C2'" . DC  J 6 21  ? 231.176 219.590 236.145 1.00 81.11  ? -63 DC  J "C2'" 1 
ATOM 9603  C "C1'" . DC  J 6 21  ? 231.765 218.808 234.985 1.00 81.11  ? -63 DC  J "C1'" 1 
ATOM 9604  N N1    . DC  J 6 21  ? 233.220 218.569 235.092 1.00 81.11  ? -63 DC  J N1    1 
ATOM 9605  C C2    . DC  J 6 21  ? 233.722 217.287 234.892 1.00 81.11  ? -63 DC  J C2    1 
ATOM 9606  O O2    . DC  J 6 21  ? 232.933 216.369 234.655 1.00 81.11  ? -63 DC  J O2    1 
ATOM 9607  N N3    . DC  J 6 21  ? 235.055 217.082 234.981 1.00 81.11  ? -63 DC  J N3    1 
ATOM 9608  C C4    . DC  J 6 21  ? 235.867 218.103 235.244 1.00 81.11  ? -63 DC  J C4    1 
ATOM 9609  N N4    . DC  J 6 21  ? 237.176 217.859 235.318 1.00 81.11  ? -63 DC  J N4    1 
ATOM 9610  C C5    . DC  J 6 21  ? 235.374 219.420 235.442 1.00 81.11  ? -63 DC  J C5    1 
ATOM 9611  C C6    . DC  J 6 21  ? 234.057 219.607 235.352 1.00 81.11  ? -63 DC  J C6    1 
ATOM 9612  P P     . DC  J 6 22  ? 227.887 218.998 236.632 1.00 80.55  ? -62 DC  J P     1 
ATOM 9613  O OP1   . DC  J 6 22  ? 226.542 219.431 236.203 1.00 80.55  ? -62 DC  J OP1   1 
ATOM 9614  O OP2   . DC  J 6 22  ? 228.489 219.570 237.855 1.00 80.55  ? -62 DC  J OP2   1 
ATOM 9615  O "O5'" . DC  J 6 22  ? 227.900 217.412 236.775 1.00 80.55  ? -62 DC  J "O5'" 1 
ATOM 9616  C "C5'" . DC  J 6 22  ? 229.085 216.711 236.448 1.00 80.55  ? -62 DC  J "C5'" 1 
ATOM 9617  C "C4'" . DC  J 6 22  ? 228.915 215.222 236.629 1.00 80.55  ? -62 DC  J "C4'" 1 
ATOM 9618  O "O4'" . DC  J 6 22  ? 230.193 214.579 236.427 1.00 80.55  ? -62 DC  J "O4'" 1 
ATOM 9619  C "C3'" . DC  J 6 22  ? 228.487 214.797 238.016 1.00 80.55  ? -62 DC  J "C3'" 1 
ATOM 9620  O "O3'" . DC  J 6 22  ? 227.889 213.510 237.962 1.00 80.55  ? -62 DC  J "O3'" 1 
ATOM 9621  C "C2'" . DC  J 6 22  ? 229.816 214.764 238.758 1.00 80.55  ? -62 DC  J "C2'" 1 
ATOM 9622  C "C1'" . DC  J 6 22  ? 230.777 214.271 237.677 1.00 80.55  ? -62 DC  J "C1'" 1 
ATOM 9623  N N1    . DC  J 6 22  ? 232.111 214.914 237.746 1.00 80.55  ? -62 DC  J N1    1 
ATOM 9624  C C2    . DC  J 6 22  ? 233.257 214.137 237.614 1.00 80.55  ? -62 DC  J C2    1 
ATOM 9625  O O2    . DC  J 6 22  ? 233.140 212.924 237.439 1.00 80.55  ? -62 DC  J O2    1 
ATOM 9626  N N3    . DC  J 6 22  ? 234.466 214.734 237.691 1.00 80.55  ? -62 DC  J N3    1 
ATOM 9627  C C4    . DC  J 6 22  ? 234.547 216.045 237.891 1.00 80.55  ? -62 DC  J C4    1 
ATOM 9628  N N4    . DC  J 6 22  ? 235.761 216.593 237.959 1.00 80.55  ? -62 DC  J N4    1 
ATOM 9629  C C5    . DC  J 6 22  ? 233.389 216.856 238.033 1.00 80.55  ? -62 DC  J C5    1 
ATOM 9630  C C6    . DC  J 6 22  ? 232.203 216.254 237.954 1.00 80.55  ? -62 DC  J C6    1 
ATOM 9631  P P     . DG  J 6 23  ? 227.210 212.881 239.273 1.00 77.94  ? -61 DG  J P     1 
ATOM 9632  O OP1   . DG  J 6 23  ? 225.997 212.150 238.846 1.00 77.94  ? -61 DG  J OP1   1 
ATOM 9633  O OP2   . DG  J 6 23  ? 227.115 213.950 240.289 1.00 77.94  ? -61 DG  J OP2   1 
ATOM 9634  O "O5'" . DG  J 6 23  ? 228.284 211.816 239.780 1.00 77.94  ? -61 DG  J "O5'" 1 
ATOM 9635  C "C5'" . DG  J 6 23  ? 228.761 210.822 238.893 1.00 77.94  ? -61 DG  J "C5'" 1 
ATOM 9636  C "C4'" . DG  J 6 23  ? 229.888 210.033 239.529 1.00 77.94  ? -61 DG  J "C4'" 1 
ATOM 9637  O "O4'" . DG  J 6 23  ? 231.142 210.744 239.356 1.00 77.94  ? -61 DG  J "O4'" 1 
ATOM 9638  C "C3'" . DG  J 6 23  ? 229.741 209.797 241.033 1.00 77.94  ? -61 DG  J "C3'" 1 
ATOM 9639  O "O3'" . DG  J 6 23  ? 230.139 208.482 241.343 1.00 77.94  ? -61 DG  J "O3'" 1 
ATOM 9640  C "C2'" . DG  J 6 23  ? 230.699 210.818 241.632 1.00 77.94  ? -61 DG  J "C2'" 1 
ATOM 9641  C "C1'" . DG  J 6 23  ? 231.802 210.811 240.594 1.00 77.94  ? -61 DG  J "C1'" 1 
ATOM 9642  N N9    . DG  J 6 23  ? 232.629 212.004 240.620 1.00 77.94  ? -61 DG  J N9    1 
ATOM 9643  C C8    . DG  J 6 23  ? 232.208 213.303 240.691 1.00 77.94  ? -61 DG  J C8    1 
ATOM 9644  N N7    . DG  J 6 23  ? 233.183 214.161 240.703 1.00 77.94  ? -61 DG  J N7    1 
ATOM 9645  C C5    . DG  J 6 23  ? 234.320 213.377 240.638 1.00 77.94  ? -61 DG  J C5    1 
ATOM 9646  C C6    . DG  J 6 23  ? 235.677 213.749 240.620 1.00 77.94  ? -61 DG  J C6    1 
ATOM 9647  O O6    . DG  J 6 23  ? 236.155 214.883 240.654 1.00 77.94  ? -61 DG  J O6    1 
ATOM 9648  N N1    . DG  J 6 23  ? 236.510 212.645 240.555 1.00 77.94  ? -61 DG  J N1    1 
ATOM 9649  C C2    . DG  J 6 23  ? 236.083 211.344 240.507 1.00 77.94  ? -61 DG  J C2    1 
ATOM 9650  N N2    . DG  J 6 23  ? 237.031 210.405 240.445 1.00 77.94  ? -61 DG  J N2    1 
ATOM 9651  N N3    . DG  J 6 23  ? 234.813 210.984 240.524 1.00 77.94  ? -61 DG  J N3    1 
ATOM 9652  C C4    . DG  J 6 23  ? 233.994 212.049 240.592 1.00 77.94  ? -61 DG  J C4    1 
ATOM 9653  P P     . DG  J 6 24  ? 229.681 207.791 242.718 1.00 74.62  ? -60 DG  J P     1 
ATOM 9654  O OP1   . DG  J 6 24  ? 228.611 206.825 242.392 1.00 74.62  ? -60 DG  J OP1   1 
ATOM 9655  O OP2   . DG  J 6 24  ? 229.436 208.842 243.727 1.00 74.62  ? -60 DG  J OP2   1 
ATOM 9656  O "O5'" . DG  J 6 24  ? 230.979 206.981 243.166 1.00 74.62  ? -60 DG  J "O5'" 1 
ATOM 9657  C "C5'" . DG  J 6 24  ? 231.754 206.315 242.189 1.00 74.62  ? -60 DG  J "C5'" 1 
ATOM 9658  C "C4'" . DG  J 6 24  ? 233.182 206.133 242.662 1.00 74.62  ? -60 DG  J "C4'" 1 
ATOM 9659  O "O4'" . DG  J 6 24  ? 233.920 207.371 242.492 1.00 74.62  ? -60 DG  J "O4'" 1 
ATOM 9660  C "C3'" . DG  J 6 24  ? 233.334 205.751 244.129 1.00 74.62  ? -60 DG  J "C3'" 1 
ATOM 9661  O "O3'" . DG  J 6 24  ? 234.406 204.834 244.261 1.00 74.62  ? -60 DG  J "O3'" 1 
ATOM 9662  C "C2'" . DG  J 6 24  ? 233.648 207.092 244.792 1.00 74.62  ? -60 DG  J "C2'" 1 
ATOM 9663  C "C1'" . DG  J 6 24  ? 234.491 207.761 243.722 1.00 74.62  ? -60 DG  J "C1'" 1 
ATOM 9664  N N9    . DG  J 6 24  ? 234.485 209.220 243.773 1.00 74.62  ? -60 DG  J N9    1 
ATOM 9665  C C8    . DG  J 6 24  ? 233.390 210.041 243.783 1.00 74.62  ? -60 DG  J C8    1 
ATOM 9666  N N7    . DG  J 6 24  ? 233.692 211.306 243.800 1.00 74.62  ? -60 DG  J N7    1 
ATOM 9667  C C5    . DG  J 6 24  ? 235.074 211.324 243.791 1.00 74.62  ? -60 DG  J C5    1 
ATOM 9668  C C6    . DG  J 6 24  ? 235.966 212.414 243.800 1.00 74.62  ? -60 DG  J C6    1 
ATOM 9669  O O6    . DG  J 6 24  ? 235.701 213.616 243.816 1.00 74.62  ? -60 DG  J O6    1 
ATOM 9670  N N1    . DG  J 6 24  ? 237.286 211.996 243.782 1.00 74.62  ? -60 DG  J N1    1 
ATOM 9671  C C2    . DG  J 6 24  ? 237.691 210.691 243.758 1.00 74.62  ? -60 DG  J C2    1 
ATOM 9672  N N2    . DG  J 6 24  ? 239.008 210.474 243.741 1.00 74.62  ? -60 DG  J N2    1 
ATOM 9673  N N3    . DG  J 6 24  ? 236.865 209.661 243.749 1.00 74.62  ? -60 DG  J N3    1 
ATOM 9674  C C4    . DG  J 6 24  ? 235.577 210.051 243.765 1.00 74.62  ? -60 DG  J C4    1 
ATOM 9675  P P     . DT  J 6 25  ? 234.627 204.012 245.623 1.00 70.64  ? -59 DT  J P     1 
ATOM 9676  O OP1   . DT  J 6 25  ? 234.538 202.573 245.297 1.00 70.64  ? -59 DT  J OP1   1 
ATOM 9677  O OP2   . DT  J 6 25  ? 233.751 204.580 246.668 1.00 70.64  ? -59 DT  J OP2   1 
ATOM 9678  O "O5'" . DT  J 6 25  ? 236.139 204.344 246.002 1.00 70.64  ? -59 DT  J "O5'" 1 
ATOM 9679  C "C5'" . DT  J 6 25  ? 236.700 205.576 245.597 1.00 70.64  ? -59 DT  J "C5'" 1 
ATOM 9680  C "C4'" . DT  J 6 25  ? 238.139 205.676 246.034 1.00 70.64  ? -59 DT  J "C4'" 1 
ATOM 9681  O "O4'" . DT  J 6 25  ? 238.570 207.053 245.940 1.00 70.64  ? -59 DT  J "O4'" 1 
ATOM 9682  C "C3'" . DT  J 6 25  ? 238.379 205.298 247.474 1.00 70.64  ? -59 DT  J "C3'" 1 
ATOM 9683  O "O3'" . DT  J 6 25  ? 239.736 204.944 247.641 1.00 70.64  ? -59 DT  J "O3'" 1 
ATOM 9684  C "C2'" . DT  J 6 25  ? 238.035 206.596 248.198 1.00 70.64  ? -59 DT  J "C2'" 1 
ATOM 9685  C "C1'" . DT  J 6 25  ? 238.557 207.650 247.223 1.00 70.64  ? -59 DT  J "C1'" 1 
ATOM 9686  N N1    . DT  J 6 25  ? 237.721 208.880 247.151 1.00 70.64  ? -59 DT  J N1    1 
ATOM 9687  C C2    . DT  J 6 25  ? 238.339 210.093 247.025 1.00 70.64  ? -59 DT  J C2    1 
ATOM 9688  O O2    . DT  J 6 25  ? 239.545 210.224 246.980 1.00 70.64  ? -59 DT  J O2    1 
ATOM 9689  N N3    . DT  J 6 25  ? 237.496 211.161 246.965 1.00 70.64  ? -59 DT  J N3    1 
ATOM 9690  C C4    . DT  J 6 25  ? 236.120 211.139 247.001 1.00 70.64  ? -59 DT  J C4    1 
ATOM 9691  O O4    . DT  J 6 25  ? 235.449 212.159 246.939 1.00 70.64  ? -59 DT  J O4    1 
ATOM 9692  C C5    . DT  J 6 25  ? 235.530 209.837 247.129 1.00 70.64  ? -59 DT  J C5    1 
ATOM 9693  C C7    . DT  J 6 25  ? 234.042 209.692 247.188 1.00 70.64  ? -59 DT  J C7    1 
ATOM 9694  C C6    . DT  J 6 25  ? 236.350 208.778 247.197 1.00 70.64  ? -59 DT  J C6    1 
ATOM 9695  P P     . DG  J 6 26  ? 240.215 204.173 248.962 1.00 64.81  ? -58 DG  J P     1 
ATOM 9696  O OP1   . DG  J 6 26  ? 241.195 203.142 248.555 1.00 64.81  ? -58 DG  J OP1   1 
ATOM 9697  O OP2   . DG  J 6 26  ? 239.007 203.796 249.726 1.00 64.81  ? -58 DG  J OP2   1 
ATOM 9698  O "O5'" . DG  J 6 26  ? 240.992 205.298 249.776 1.00 64.81  ? -58 DG  J "O5'" 1 
ATOM 9699  C "C5'" . DG  J 6 26  ? 241.894 206.148 249.094 1.00 64.81  ? -58 DG  J "C5'" 1 
ATOM 9700  C "C4'" . DG  J 6 26  ? 242.323 207.306 249.970 1.00 64.81  ? -58 DG  J "C4'" 1 
ATOM 9701  O "O4'" . DG  J 6 26  ? 241.406 208.417 249.803 1.00 64.81  ? -58 DG  J "O4'" 1 
ATOM 9702  C "C3'" . DG  J 6 26  ? 242.346 207.026 251.469 1.00 64.81  ? -58 DG  J "C3'" 1 
ATOM 9703  O "O3'" . DG  J 6 26  ? 243.352 207.817 252.049 1.00 64.81  ? -58 DG  J "O3'" 1 
ATOM 9704  C "C2'" . DG  J 6 26  ? 240.975 207.530 251.893 1.00 64.81  ? -58 DG  J "C2'" 1 
ATOM 9705  C "C1'" . DG  J 6 26  ? 240.924 208.797 251.069 1.00 64.81  ? -58 DG  J "C1'" 1 
ATOM 9706  N N9    . DG  J 6 26  ? 239.600 209.366 250.911 1.00 64.81  ? -58 DG  J N9    1 
ATOM 9707  C C8    . DG  J 6 26  ? 238.400 208.715 250.987 1.00 64.81  ? -58 DG  J C8    1 
ATOM 9708  N N7    . DG  J 6 26  ? 237.378 209.497 250.797 1.00 64.81  ? -58 DG  J N7    1 
ATOM 9709  C C5    . DG  J 6 26  ? 237.944 210.743 250.580 1.00 64.81  ? -58 DG  J C5    1 
ATOM 9710  C C6    . DG  J 6 26  ? 237.334 211.983 250.317 1.00 64.81  ? -58 DG  J C6    1 
ATOM 9711  O O6    . DG  J 6 26  ? 236.132 212.234 250.219 1.00 64.81  ? -58 DG  J O6    1 
ATOM 9712  N N1    . DG  J 6 26  ? 238.269 212.995 250.160 1.00 64.81  ? -58 DG  J N1    1 
ATOM 9713  C C2    . DG  J 6 26  ? 239.623 212.829 250.250 1.00 64.81  ? -58 DG  J C2    1 
ATOM 9714  N N2    . DG  J 6 26  ? 240.370 213.922 250.076 1.00 64.81  ? -58 DG  J N2    1 
ATOM 9715  N N3    . DG  J 6 26  ? 240.209 211.670 250.494 1.00 64.81  ? -58 DG  J N3    1 
ATOM 9716  C C4    . DG  J 6 26  ? 239.308 210.676 250.649 1.00 64.81  ? -58 DG  J C4    1 
ATOM 9717  P P     . DC  J 6 27  ? 244.401 207.201 253.091 1.00 61.41  ? -57 DC  J P     1 
ATOM 9718  O OP1   . DC  J 6 27  ? 245.222 206.209 252.365 1.00 61.41  ? -57 DC  J OP1   1 
ATOM 9719  O OP2   . DC  J 6 27  ? 243.661 206.803 254.309 1.00 61.41  ? -57 DC  J OP2   1 
ATOM 9720  O "O5'" . DC  J 6 27  ? 245.310 208.461 253.459 1.00 61.41  ? -57 DC  J "O5'" 1 
ATOM 9721  C "C5'" . DC  J 6 27  ? 245.430 209.532 252.528 1.00 61.41  ? -57 DC  J "C5'" 1 
ATOM 9722  C "C4'" . DC  J 6 27  ? 245.118 210.870 253.181 1.00 61.41  ? -57 DC  J "C4'" 1 
ATOM 9723  O "O4'" . DC  J 6 27  ? 243.714 211.199 253.003 1.00 61.41  ? -57 DC  J "O4'" 1 
ATOM 9724  C "C3'" . DC  J 6 27  ? 245.368 210.937 254.685 1.00 61.41  ? -57 DC  J "C3'" 1 
ATOM 9725  O "O3'" . DC  J 6 27  ? 245.891 212.197 255.011 1.00 61.41  ? -57 DC  J "O3'" 1 
ATOM 9726  C "C2'" . DC  J 6 27  ? 243.964 210.781 255.249 1.00 61.41  ? -57 DC  J "C2'" 1 
ATOM 9727  C "C1'" . DC  J 6 27  ? 243.191 211.600 254.243 1.00 61.41  ? -57 DC  J "C1'" 1 
ATOM 9728  N N1    . DC  J 6 27  ? 241.743 211.345 254.245 1.00 61.41  ? -57 DC  J N1    1 
ATOM 9729  C C2    . DC  J 6 27  ? 240.871 212.338 253.813 1.00 61.41  ? -57 DC  J C2    1 
ATOM 9730  O O2    . DC  J 6 27  ? 241.325 213.421 253.442 1.00 61.41  ? -57 DC  J O2    1 
ATOM 9731  N N3    . DC  J 6 27  ? 239.547 212.089 253.813 1.00 61.41  ? -57 DC  J N3    1 
ATOM 9732  C C4    . DC  J 6 27  ? 239.094 210.913 254.222 1.00 61.41  ? -57 DC  J C4    1 
ATOM 9733  N N4    . DC  J 6 27  ? 237.778 210.711 254.202 1.00 61.41  ? -57 DC  J N4    1 
ATOM 9734  C C5    . DC  J 6 27  ? 239.968 209.885 254.661 1.00 61.41  ? -57 DC  J C5    1 
ATOM 9735  C C6    . DC  J 6 27  ? 241.272 210.142 254.658 1.00 61.41  ? -57 DC  J C6    1 
ATOM 9736  P P     . DC  J 6 28  ? 247.474 212.429 255.087 1.00 57.53  ? -56 DC  J P     1 
ATOM 9737  O OP1   . DC  J 6 28  ? 248.015 212.286 253.722 1.00 57.53  ? -56 DC  J OP1   1 
ATOM 9738  O OP2   . DC  J 6 28  ? 247.997 211.591 256.187 1.00 57.53  ? -56 DC  J OP2   1 
ATOM 9739  O "O5'" . DC  J 6 28  ? 247.603 213.960 255.518 1.00 57.53  ? -56 DC  J "O5'" 1 
ATOM 9740  C "C5'" . DC  J 6 28  ? 246.901 214.963 254.793 1.00 57.53  ? -56 DC  J "C5'" 1 
ATOM 9741  C "C4'" . DC  J 6 28  ? 246.024 215.795 255.714 1.00 57.53  ? -56 DC  J "C4'" 1 
ATOM 9742  O "O4'" . DC  J 6 28  ? 244.735 215.147 255.897 1.00 57.53  ? -56 DC  J "O4'" 1 
ATOM 9743  C "C3'" . DC  J 6 28  ? 246.574 216.014 257.124 1.00 57.53  ? -56 DC  J "C3'" 1 
ATOM 9744  O "O3'" . DC  J 6 28  ? 246.224 217.296 257.559 1.00 57.53  ? -56 DC  J "O3'" 1 
ATOM 9745  C "C2'" . DC  J 6 28  ? 245.813 214.973 257.923 1.00 57.53  ? -56 DC  J "C2'" 1 
ATOM 9746  C "C1'" . DC  J 6 28  ? 244.456 215.111 257.273 1.00 57.53  ? -56 DC  J "C1'" 1 
ATOM 9747  N N1    . DC  J 6 28  ? 243.541 213.994 257.559 1.00 57.53  ? -56 DC  J N1    1 
ATOM 9748  C C2    . DC  J 6 28  ? 242.187 214.120 257.263 1.00 57.53  ? -56 DC  J C2    1 
ATOM 9749  O O2    . DC  J 6 28  ? 241.780 215.161 256.747 1.00 57.53  ? -56 DC  J O2    1 
ATOM 9750  N N3    . DC  J 6 28  ? 241.363 213.093 257.539 1.00 57.53  ? -56 DC  J N3    1 
ATOM 9751  C C4    . DC  J 6 28  ? 241.843 211.988 258.086 1.00 57.53  ? -56 DC  J C4    1 
ATOM 9752  N N4    . DC  J 6 28  ? 240.993 210.998 258.342 1.00 57.53  ? -56 DC  J N4    1 
ATOM 9753  C C5    . DC  J 6 28  ? 243.217 211.846 258.405 1.00 57.53  ? -56 DC  J C5    1 
ATOM 9754  C C6    . DC  J 6 28  ? 244.022 212.864 258.127 1.00 57.53  ? -56 DC  J C6    1 
ATOM 9755  P P     . DG  J 6 29  ? 247.267 218.504 257.463 1.00 53.92  ? -55 DG  J P     1 
ATOM 9756  O OP1   . DG  J 6 29  ? 247.843 218.482 256.104 1.00 53.92  ? -55 DG  J OP1   1 
ATOM 9757  O OP2   . DG  J 6 29  ? 248.145 218.416 258.646 1.00 53.92  ? -55 DG  J OP2   1 
ATOM 9758  O "O5'" . DG  J 6 29  ? 246.350 219.802 257.623 1.00 53.92  ? -55 DG  J "O5'" 1 
ATOM 9759  C "C5'" . DG  J 6 29  ? 245.342 220.082 256.660 1.00 53.92  ? -55 DG  J "C5'" 1 
ATOM 9760  C "C4'" . DG  J 6 29  ? 244.011 220.416 257.319 1.00 53.92  ? -55 DG  J "C4'" 1 
ATOM 9761  O "O4'" . DG  J 6 29  ? 243.372 219.205 257.786 1.00 53.92  ? -55 DG  J "O4'" 1 
ATOM 9762  C "C3'" . DG  J 6 29  ? 244.072 221.331 258.537 1.00 53.92  ? -55 DG  J "C3'" 1 
ATOM 9763  O "O3'" . DG  J 6 29  ? 242.884 222.079 258.587 1.00 53.92  ? -55 DG  J "O3'" 1 
ATOM 9764  C "C2'" . DG  J 6 29  ? 244.110 220.330 259.677 1.00 53.92  ? -55 DG  J "C2'" 1 
ATOM 9765  C "C1'" . DG  J 6 29  ? 243.101 219.328 259.164 1.00 53.92  ? -55 DG  J "C1'" 1 
ATOM 9766  N N9    . DG  J 6 29  ? 243.208 218.013 259.763 1.00 53.92  ? -55 DG  J N9    1 
ATOM 9767  C C8    . DG  J 6 29  ? 244.338 217.398 260.224 1.00 53.92  ? -55 DG  J C8    1 
ATOM 9768  N N7    . DG  J 6 29  ? 244.118 216.212 260.702 1.00 53.92  ? -55 DG  J N7    1 
ATOM 9769  C C5    . DG  J 6 29  ? 242.759 216.034 260.538 1.00 53.92  ? -55 DG  J C5    1 
ATOM 9770  C C6    . DG  J 6 29  ? 241.945 214.940 260.862 1.00 53.92  ? -55 DG  J C6    1 
ATOM 9771  O O6    . DG  J 6 29  ? 242.269 213.872 261.381 1.00 53.92  ? -55 DG  J O6    1 
ATOM 9772  N N1    . DG  J 6 29  ? 240.623 215.172 260.534 1.00 53.92  ? -55 DG  J N1    1 
ATOM 9773  C C2    . DG  J 6 29  ? 240.153 216.312 259.951 1.00 53.92  ? -55 DG  J C2    1 
ATOM 9774  N N2    . DG  J 6 29  ? 238.846 216.360 259.700 1.00 53.92  ? -55 DG  J N2    1 
ATOM 9775  N N3    . DG  J 6 29  ? 240.905 217.342 259.643 1.00 53.92  ? -55 DG  J N3    1 
ATOM 9776  C C4    . DG  J 6 29  ? 242.191 217.131 259.958 1.00 53.92  ? -55 DG  J C4    1 
ATOM 9777  P P     . DA  J 6 30  ? 242.875 223.589 259.116 1.00 49.70  ? -54 DA  J P     1 
ATOM 9778  O OP1   . DA  J 6 30  ? 243.260 224.436 257.974 1.00 49.70  ? -54 DA  J OP1   1 
ATOM 9779  O OP2   . DA  J 6 30  ? 243.624 223.660 260.382 1.00 49.70  ? -54 DA  J OP2   1 
ATOM 9780  O "O5'" . DA  J 6 30  ? 241.345 223.831 259.454 1.00 49.70  ? -54 DA  J "O5'" 1 
ATOM 9781  C "C5'" . DA  J 6 30  ? 240.391 223.619 258.459 1.00 49.70  ? -54 DA  J "C5'" 1 
ATOM 9782  C "C4'" . DA  J 6 30  ? 239.088 223.088 259.030 1.00 49.70  ? -54 DA  J "C4'" 1 
ATOM 9783  O "O4'" . DA  J 6 30  ? 239.283 221.791 259.632 1.00 49.70  ? -54 DA  J "O4'" 1 
ATOM 9784  C "C3'" . DA  J 6 30  ? 238.436 223.931 260.099 1.00 49.70  ? -54 DA  J "C3'" 1 
ATOM 9785  O "O3'" . DA  J 6 30  ? 237.059 223.747 260.002 1.00 49.70  ? -54 DA  J "O3'" 1 
ATOM 9786  C "C2'" . DA  J 6 30  ? 238.986 223.322 261.382 1.00 49.70  ? -54 DA  J "C2'" 1 
ATOM 9787  C "C1'" . DA  J 6 30  ? 239.015 221.849 261.018 1.00 49.70  ? -54 DA  J "C1'" 1 
ATOM 9788  N N9    . DA  J 6 30  ? 240.067 221.096 261.660 1.00 49.70  ? -54 DA  J N9    1 
ATOM 9789  C C8    . DA  J 6 30  ? 241.375 221.448 261.768 1.00 49.70  ? -54 DA  J C8    1 
ATOM 9790  N N7    . DA  J 6 30  ? 242.116 220.546 262.347 1.00 49.70  ? -54 DA  J N7    1 
ATOM 9791  C C5    . DA  J 6 30  ? 241.234 219.527 262.620 1.00 49.70  ? -54 DA  J C5    1 
ATOM 9792  C C6    . DA  J 6 30  ? 241.401 218.284 263.222 1.00 49.70  ? -54 DA  J C6    1 
ATOM 9793  N N6    . DA  J 6 30  ? 242.571 217.852 263.686 1.00 49.70  ? -54 DA  J N6    1 
ATOM 9794  N N1    . DA  J 6 30  ? 240.318 217.499 263.341 1.00 49.70  ? -54 DA  J N1    1 
ATOM 9795  C C2    . DA  J 6 30  ? 239.151 217.942 262.880 1.00 49.70  ? -54 DA  J C2    1 
ATOM 9796  N N3    . DA  J 6 30  ? 238.875 219.089 262.285 1.00 49.70  ? -54 DA  J N3    1 
ATOM 9797  C C4    . DA  J 6 30  ? 239.971 219.842 262.185 1.00 49.70  ? -54 DA  J C4    1 
ATOM 9798  P P     . DG  J 6 31  ? 236.049 224.741 260.732 1.00 50.79  ? -53 DG  J P     1 
ATOM 9799  O OP1   . DG  J 6 31  ? 234.865 224.813 259.866 1.00 50.79  ? -53 DG  J OP1   1 
ATOM 9800  O OP2   . DG  J 6 31  ? 236.784 225.946 261.152 1.00 50.79  ? -53 DG  J OP2   1 
ATOM 9801  O "O5'" . DG  J 6 31  ? 235.599 223.921 262.007 1.00 50.79  ? -53 DG  J "O5'" 1 
ATOM 9802  C "C5'" . DG  J 6 31  ? 235.011 222.661 261.823 1.00 50.79  ? -53 DG  J "C5'" 1 
ATOM 9803  C "C4'" . DG  J 6 31  ? 234.769 221.998 263.149 1.00 50.79  ? -53 DG  J "C4'" 1 
ATOM 9804  O "O4'" . DG  J 6 31  ? 235.946 221.255 263.544 1.00 50.79  ? -53 DG  J "O4'" 1 
ATOM 9805  C "C3'" . DG  J 6 31  ? 234.471 222.956 264.294 1.00 50.79  ? -53 DG  J "C3'" 1 
ATOM 9806  O "O3'" . DG  J 6 31  ? 233.466 222.397 265.085 1.00 50.79  ? -53 DG  J "O3'" 1 
ATOM 9807  C "C2'" . DG  J 6 31  ? 235.798 223.002 265.041 1.00 50.79  ? -53 DG  J "C2'" 1 
ATOM 9808  C "C1'" . DG  J 6 31  ? 236.251 221.570 264.873 1.00 50.79  ? -53 DG  J "C1'" 1 
ATOM 9809  N N9    . DG  J 6 31  ? 237.671 221.372 265.084 1.00 50.79  ? -53 DG  J N9    1 
ATOM 9810  C C8    . DG  J 6 31  ? 238.675 222.270 264.853 1.00 50.79  ? -53 DG  J C8    1 
ATOM 9811  N N7    . DG  J 6 31  ? 239.852 221.811 265.140 1.00 50.79  ? -53 DG  J N7    1 
ATOM 9812  C C5    . DG  J 6 31  ? 239.610 220.528 265.601 1.00 50.79  ? -53 DG  J C5    1 
ATOM 9813  C C6    . DG  J 6 31  ? 240.505 219.548 266.060 1.00 50.79  ? -53 DG  J C6    1 
ATOM 9814  O O6    . DG  J 6 31  ? 241.730 219.619 266.149 1.00 50.79  ? -53 DG  J O6    1 
ATOM 9815  N N1    . DG  J 6 31  ? 239.848 218.385 266.428 1.00 50.79  ? -53 DG  J N1    1 
ATOM 9816  C C2    . DG  J 6 31  ? 238.500 218.197 266.362 1.00 50.79  ? -53 DG  J C2    1 
ATOM 9817  N N2    . DG  J 6 31  ? 238.042 217.008 266.768 1.00 50.79  ? -53 DG  J N2    1 
ATOM 9818  N N3    . DG  J 6 31  ? 237.649 219.111 265.939 1.00 50.79  ? -53 DG  J N3    1 
ATOM 9819  C C4    . DG  J 6 31  ? 238.275 220.245 265.573 1.00 50.79  ? -53 DG  J C4    1 
ATOM 9820  P P     . DG  J 6 32  ? 232.520 223.307 266.001 1.00 53.49  ? -52 DG  J P     1 
ATOM 9821  O OP1   . DG  J 6 32  ? 231.306 223.601 265.215 1.00 53.49  ? -52 DG  J OP1   1 
ATOM 9822  O OP2   . DG  J 6 32  ? 233.316 224.408 266.580 1.00 53.49  ? -52 DG  J OP2   1 
ATOM 9823  O "O5'" . DG  J 6 32  ? 232.136 222.311 267.181 1.00 53.49  ? -52 DG  J "O5'" 1 
ATOM 9824  C "C5'" . DG  J 6 32  ? 232.018 220.928 266.902 1.00 53.49  ? -52 DG  J "C5'" 1 
ATOM 9825  C "C4'" . DG  J 6 32  ? 232.649 220.100 267.999 1.00 53.49  ? -52 DG  J "C4'" 1 
ATOM 9826  O "O4'" . DG  J 6 32  ? 234.081 220.064 267.823 1.00 53.49  ? -52 DG  J "O4'" 1 
ATOM 9827  C "C3'" . DG  J 6 32  ? 232.405 220.618 269.414 1.00 53.49  ? -52 DG  J "C3'" 1 
ATOM 9828  O "O3'" . DG  J 6 32  ? 231.758 219.617 270.182 1.00 53.49  ? -52 DG  J "O3'" 1 
ATOM 9829  C "C2'" . DG  J 6 32  ? 233.807 220.928 269.949 1.00 53.49  ? -52 DG  J "C2'" 1 
ATOM 9830  C "C1'" . DG  J 6 32  ? 234.686 220.051 269.082 1.00 53.49  ? -52 DG  J "C1'" 1 
ATOM 9831  N N9    . DG  J 6 32  ? 236.040 220.559 268.940 1.00 53.49  ? -52 DG  J N9    1 
ATOM 9832  C C8    . DG  J 6 32  ? 236.413 221.761 268.408 1.00 53.49  ? -52 DG  J C8    1 
ATOM 9833  N N7    . DG  J 6 32  ? 237.696 221.951 268.409 1.00 53.49  ? -52 DG  J N7    1 
ATOM 9834  C C5    . DG  J 6 32  ? 238.204 220.801 268.980 1.00 53.49  ? -52 DG  J C5    1 
ATOM 9835  C C6    . DG  J 6 32  ? 239.534 220.439 269.240 1.00 53.49  ? -52 DG  J C6    1 
ATOM 9836  O O6    . DG  J 6 32  ? 240.556 221.087 269.012 1.00 53.49  ? -52 DG  J O6    1 
ATOM 9837  N N1    . DG  J 6 32  ? 239.622 219.187 269.823 1.00 53.49  ? -52 DG  J N1    1 
ATOM 9838  C C2    . DG  J 6 32  ? 238.554 218.386 270.120 1.00 53.49  ? -52 DG  J C2    1 
ATOM 9839  N N2    . DG  J 6 32  ? 238.831 217.209 270.683 1.00 53.49  ? -52 DG  J N2    1 
ATOM 9840  N N3    . DG  J 6 32  ? 237.297 218.715 269.877 1.00 53.49  ? -52 DG  J N3    1 
ATOM 9841  C C4    . DG  J 6 32  ? 237.200 219.931 269.302 1.00 53.49  ? -52 DG  J C4    1 
ATOM 9842  P P     . DC  J 6 33  ? 231.248 219.940 271.667 1.00 54.96  ? -51 DC  J P     1 
ATOM 9843  O OP1   . DC  J 6 33  ? 229.949 219.261 271.833 1.00 54.96  ? -51 DC  J OP1   1 
ATOM 9844  O OP2   . DC  J 6 33  ? 231.350 221.398 271.887 1.00 54.96  ? -51 DC  J OP2   1 
ATOM 9845  O "O5'" . DC  J 6 33  ? 232.329 219.226 272.598 1.00 54.96  ? -51 DC  J "O5'" 1 
ATOM 9846  C "C5'" . DC  J 6 33  ? 232.743 217.904 272.301 1.00 54.96  ? -51 DC  J "C5'" 1 
ATOM 9847  C "C4'" . DC  J 6 33  ? 233.890 217.483 273.198 1.00 54.96  ? -51 DC  J "C4'" 1 
ATOM 9848  O "O4'" . DC  J 6 33  ? 235.136 218.019 272.694 1.00 54.96  ? -51 DC  J "O4'" 1 
ATOM 9849  C "C3'" . DC  J 6 33  ? 233.777 217.949 274.644 1.00 54.96  ? -51 DC  J "C3'" 1 
ATOM 9850  O "O3'" . DC  J 6 33  ? 234.064 216.866 275.502 1.00 54.96  ? -51 DC  J "O3'" 1 
ATOM 9851  C "C2'" . DC  J 6 33  ? 234.831 219.049 274.746 1.00 54.96  ? -51 DC  J "C2'" 1 
ATOM 9852  C "C1'" . DC  J 6 33  ? 235.870 218.572 273.754 1.00 54.96  ? -51 DC  J "C1'" 1 
ATOM 9853  N N1    . DC  J 6 33  ? 236.696 219.657 273.209 1.00 54.96  ? -51 DC  J N1    1 
ATOM 9854  C C2    . DC  J 6 33  ? 238.080 219.604 273.333 1.00 54.96  ? -51 DC  J C2    1 
ATOM 9855  O O2    . DC  J 6 33  ? 238.592 218.647 273.906 1.00 54.96  ? -51 DC  J O2    1 
ATOM 9856  N N3    . DC  J 6 33  ? 238.818 220.606 272.815 1.00 54.96  ? -51 DC  J N3    1 
ATOM 9857  C C4    . DC  J 6 33  ? 238.224 221.620 272.205 1.00 54.96  ? -51 DC  J C4    1 
ATOM 9858  N N4    . DC  J 6 33  ? 238.990 222.591 271.708 1.00 54.96  ? -51 DC  J N4    1 
ATOM 9859  C C5    . DC  J 6 33  ? 236.813 221.689 272.069 1.00 54.96  ? -51 DC  J C5    1 
ATOM 9860  C C6    . DC  J 6 33  ? 236.097 220.694 272.575 1.00 54.96  ? -51 DC  J C6    1 
ATOM 9861  P P     . DC  J 6 34  ? 233.720 216.943 277.068 1.00 54.78  ? -50 DC  J P     1 
ATOM 9862  O OP1   . DC  J 6 34  ? 232.676 215.938 277.342 1.00 54.78  ? -50 DC  J OP1   1 
ATOM 9863  O OP2   . DC  J 6 34  ? 233.508 218.350 277.466 1.00 54.78  ? -50 DC  J OP2   1 
ATOM 9864  O "O5'" . DC  J 6 34  ? 235.073 216.462 277.742 1.00 54.78  ? -50 DC  J "O5'" 1 
ATOM 9865  C "C5'" . DC  J 6 34  ? 236.292 216.750 277.105 1.00 54.78  ? -50 DC  J "C5'" 1 
ATOM 9866  C "C4'" . DC  J 6 34  ? 237.443 216.487 278.035 1.00 54.78  ? -50 DC  J "C4'" 1 
ATOM 9867  O "O4'" . DC  J 6 34  ? 238.571 217.300 277.653 1.00 54.78  ? -50 DC  J "O4'" 1 
ATOM 9868  C "C3'" . DC  J 6 34  ? 237.177 216.851 279.470 1.00 54.78  ? -50 DC  J "C3'" 1 
ATOM 9869  O "O3'" . DC  J 6 34  ? 238.042 216.097 280.292 1.00 54.78  ? -50 DC  J "O3'" 1 
ATOM 9870  C "C2'" . DC  J 6 34  ? 237.505 218.344 279.490 1.00 54.78  ? -50 DC  J "C2'" 1 
ATOM 9871  C "C1'" . DC  J 6 34  ? 238.651 218.440 278.486 1.00 54.78  ? -50 DC  J "C1'" 1 
ATOM 9872  N N1    . DC  J 6 34  ? 238.594 219.633 277.609 1.00 54.78  ? -50 DC  J N1    1 
ATOM 9873  C C2    . DC  J 6 34  ? 239.777 220.244 277.228 1.00 54.78  ? -50 DC  J C2    1 
ATOM 9874  O O2    . DC  J 6 34  ? 240.838 219.788 277.653 1.00 54.78  ? -50 DC  J O2    1 
ATOM 9875  N N3    . DC  J 6 34  ? 239.730 221.317 276.418 1.00 54.78  ? -50 DC  J N3    1 
ATOM 9876  C C4    . DC  J 6 34  ? 238.560 221.769 275.985 1.00 54.78  ? -50 DC  J C4    1 
ATOM 9877  N N4    . DC  J 6 34  ? 238.562 222.833 275.189 1.00 54.78  ? -50 DC  J N4    1 
ATOM 9878  C C5    . DC  J 6 34  ? 237.334 221.156 276.360 1.00 54.78  ? -50 DC  J C5    1 
ATOM 9879  C C6    . DC  J 6 34  ? 237.398 220.095 277.161 1.00 54.78  ? -50 DC  J C6    1 
ATOM 9880  P P     . DG  J 6 35  ? 238.132 216.376 281.865 1.00 53.81  ? -49 DG  J P     1 
ATOM 9881  O OP1   . DG  J 6 35  ? 238.430 215.086 282.518 1.00 53.81  ? -49 DG  J OP1   1 
ATOM 9882  O OP2   . DG  J 6 35  ? 236.956 217.163 282.291 1.00 53.81  ? -49 DG  J OP2   1 
ATOM 9883  O "O5'" . DG  J 6 35  ? 239.406 217.309 281.983 1.00 53.81  ? -49 DG  J "O5'" 1 
ATOM 9884  C "C5'" . DG  J 6 35  ? 239.846 217.710 283.236 1.00 53.81  ? -49 DG  J "C5'" 1 
ATOM 9885  C "C4'" . DG  J 6 35  ? 241.325 217.982 283.205 1.00 53.81  ? -49 DG  J "C4'" 1 
ATOM 9886  O "O4'" . DG  J 6 35  ? 241.649 218.726 282.008 1.00 53.81  ? -49 DG  J "O4'" 1 
ATOM 9887  C "C3'" . DG  J 6 35  ? 241.813 218.840 284.343 1.00 53.81  ? -49 DG  J "C3'" 1 
ATOM 9888  O "O3'" . DG  J 6 35  ? 243.190 218.622 284.550 1.00 53.81  ? -49 DG  J "O3'" 1 
ATOM 9889  C "C2'" . DG  J 6 35  ? 241.528 220.241 283.816 1.00 53.81  ? -49 DG  J "C2'" 1 
ATOM 9890  C "C1'" . DG  J 6 35  ? 241.820 220.091 282.325 1.00 53.81  ? -49 DG  J "C1'" 1 
ATOM 9891  N N9    . DG  J 6 35  ? 240.935 220.874 281.468 1.00 53.81  ? -49 DG  J N9    1 
ATOM 9892  C C8    . DG  J 6 35  ? 239.570 220.788 281.387 1.00 53.81  ? -49 DG  J C8    1 
ATOM 9893  N N7    . DG  J 6 35  ? 239.051 221.609 280.525 1.00 53.81  ? -49 DG  J N7    1 
ATOM 9894  C C5    . DG  J 6 35  ? 240.144 222.277 279.996 1.00 53.81  ? -49 DG  J C5    1 
ATOM 9895  C C6    . DG  J 6 35  ? 240.202 223.283 279.017 1.00 53.81  ? -49 DG  J C6    1 
ATOM 9896  O O6    . DG  J 6 35  ? 239.270 223.798 278.404 1.00 53.81  ? -49 DG  J O6    1 
ATOM 9897  N N1    . DG  J 6 35  ? 241.503 223.688 278.772 1.00 53.81  ? -49 DG  J N1    1 
ATOM 9898  C C2    . DG  J 6 35  ? 242.608 223.185 279.397 1.00 53.81  ? -49 DG  J C2    1 
ATOM 9899  N N2    . DG  J 6 35  ? 243.785 223.692 279.030 1.00 53.81  ? -49 DG  J N2    1 
ATOM 9900  N N3    . DG  J 6 35  ? 242.568 222.240 280.314 1.00 53.81  ? -49 DG  J N3    1 
ATOM 9901  C C4    . DG  J 6 35  ? 241.306 221.837 280.564 1.00 53.81  ? -49 DG  J C4    1 
ATOM 9902  P P     . DC  J 6 36  ? 243.855 219.031 285.948 1.00 53.88  ? -48 DC  J P     1 
ATOM 9903  O OP1   . DC  J 6 36  ? 244.975 218.107 286.225 1.00 53.88  ? -48 DC  J OP1   1 
ATOM 9904  O OP2   . DC  J 6 36  ? 242.751 219.178 286.918 1.00 53.88  ? -48 DC  J OP2   1 
ATOM 9905  O "O5'" . DC  J 6 36  ? 244.446 220.481 285.666 1.00 53.88  ? -48 DC  J "O5'" 1 
ATOM 9906  C "C5'" . DC  J 6 36  ? 245.006 220.773 284.406 1.00 53.88  ? -48 DC  J "C5'" 1 
ATOM 9907  C "C4'" . DC  J 6 36  ? 245.248 222.257 284.266 1.00 53.88  ? -48 DC  J "C4'" 1 
ATOM 9908  O "O4'" . DC  J 6 36  ? 244.229 222.841 283.417 1.00 53.88  ? -48 DC  J "O4'" 1 
ATOM 9909  C "C3'" . DC  J 6 36  ? 245.187 223.041 285.572 1.00 53.88  ? -48 DC  J "C3'" 1 
ATOM 9910  O "O3'" . DC  J 6 36  ? 246.103 224.091 285.512 1.00 53.88  ? -48 DC  J "O3'" 1 
ATOM 9911  C "C2'" . DC  J 6 36  ? 243.762 223.576 285.556 1.00 53.88  ? -48 DC  J "C2'" 1 
ATOM 9912  C "C1'" . DC  J 6 36  ? 243.648 223.929 284.091 1.00 53.88  ? -48 DC  J "C1'" 1 
ATOM 9913  N N1    . DC  J 6 36  ? 242.269 224.100 283.602 1.00 53.88  ? -48 DC  J N1    1 
ATOM 9914  C C2    . DC  J 6 36  ? 242.058 224.819 282.437 1.00 53.88  ? -48 DC  J C2    1 
ATOM 9915  O O2    . DC  J 6 36  ? 243.026 225.299 281.852 1.00 53.88  ? -48 DC  J O2    1 
ATOM 9916  N N3    . DC  J 6 36  ? 240.805 224.980 281.983 1.00 53.88  ? -48 DC  J N3    1 
ATOM 9917  C C4    . DC  J 6 36  ? 239.787 224.453 282.647 1.00 53.88  ? -48 DC  J C4    1 
ATOM 9918  N N4    . DC  J 6 36  ? 238.563 224.636 282.153 1.00 53.88  ? -48 DC  J N4    1 
ATOM 9919  C C5    . DC  J 6 36  ? 239.978 223.707 283.842 1.00 53.88  ? -48 DC  J C5    1 
ATOM 9920  C C6    . DC  J 6 36  ? 241.227 223.564 284.282 1.00 53.88  ? -48 DC  J C6    1 
ATOM 9921  P P     . DT  J 6 37  ? 247.405 224.092 286.442 1.00 52.02  ? -47 DT  J P     1 
ATOM 9922  O OP1   . DT  J 6 37  ? 248.197 222.893 286.106 1.00 52.02  ? -47 DT  J OP1   1 
ATOM 9923  O OP2   . DT  J 6 37  ? 246.957 224.307 287.832 1.00 52.02  ? -47 DT  J OP2   1 
ATOM 9924  O "O5'" . DT  J 6 37  ? 248.189 225.395 285.957 1.00 52.02  ? -47 DT  J "O5'" 1 
ATOM 9925  C "C5'" . DT  J 6 37  ? 248.159 225.764 284.584 1.00 52.02  ? -47 DT  J "C5'" 1 
ATOM 9926  C "C4'" . DT  J 6 37  ? 247.835 227.239 284.415 1.00 52.02  ? -47 DT  J "C4'" 1 
ATOM 9927  O "O4'" . DT  J 6 37  ? 246.432 227.399 284.078 1.00 52.02  ? -47 DT  J "O4'" 1 
ATOM 9928  C "C3'" . DT  J 6 37  ? 248.049 228.104 285.652 1.00 52.02  ? -47 DT  J "C3'" 1 
ATOM 9929  O "O3'" . DT  J 6 37  ? 248.373 229.416 285.248 1.00 52.02  ? -47 DT  J "O3'" 1 
ATOM 9930  C "C2'" . DT  J 6 37  ? 246.660 228.084 286.271 1.00 52.02  ? -47 DT  J "C2'" 1 
ATOM 9931  C "C1'" . DT  J 6 37  ? 245.838 228.264 285.015 1.00 52.02  ? -47 DT  J "C1'" 1 
ATOM 9932  N N1    . DT  J 6 37  ? 244.422 227.900 285.153 1.00 52.02  ? -47 DT  J N1    1 
ATOM 9933  C C2    . DT  J 6 37  ? 243.552 228.252 284.161 1.00 52.02  ? -47 DT  J C2    1 
ATOM 9934  O O2    . DT  J 6 37  ? 243.890 228.861 283.169 1.00 52.02  ? -47 DT  J O2    1 
ATOM 9935  N N3    . DT  J 6 37  ? 242.263 227.869 284.370 1.00 52.02  ? -47 DT  J N3    1 
ATOM 9936  C C4    . DT  J 6 37  ? 241.769 227.177 285.449 1.00 52.02  ? -47 DT  J C4    1 
ATOM 9937  O O4    . DT  J 6 37  ? 240.591 226.873 285.547 1.00 52.02  ? -47 DT  J O4    1 
ATOM 9938  C C5    . DT  J 6 37  ? 242.734 226.840 286.457 1.00 52.02  ? -47 DT  J C5    1 
ATOM 9939  C C7    . DT  J 6 37  ? 242.310 226.090 287.681 1.00 52.02  ? -47 DT  J C7    1 
ATOM 9940  C C6    . DT  J 6 37  ? 244.003 227.210 286.262 1.00 52.02  ? -47 DT  J C6    1 
ATOM 9941  P P     . DC  J 6 38  ? 249.884 229.851 284.933 1.00 49.62  ? -46 DC  J P     1 
ATOM 9942  O OP1   . DC  J 6 38  ? 250.498 228.851 284.039 1.00 49.62  ? -46 DC  J OP1   1 
ATOM 9943  O OP2   . DC  J 6 38  ? 250.518 230.195 286.219 1.00 49.62  ? -46 DC  J OP2   1 
ATOM 9944  O "O5'" . DC  J 6 38  ? 249.707 231.204 284.109 1.00 49.62  ? -46 DC  J "O5'" 1 
ATOM 9945  C "C5'" . DC  J 6 38  ? 248.855 231.227 282.973 1.00 49.62  ? -46 DC  J "C5'" 1 
ATOM 9946  C "C4'" . DC  J 6 38  ? 247.898 232.408 283.014 1.00 49.62  ? -46 DC  J "C4'" 1 
ATOM 9947  O "O4'" . DC  J 6 38  ? 246.650 232.010 283.635 1.00 49.62  ? -46 DC  J "O4'" 1 
ATOM 9948  C "C3'" . DC  J 6 38  ? 248.371 233.617 283.811 1.00 49.62  ? -46 DC  J "C3'" 1 
ATOM 9949  O "O3'" . DC  J 6 38  ? 247.805 234.780 283.256 1.00 49.62  ? -46 DC  J "O3'" 1 
ATOM 9950  C "C2'" . DC  J 6 38  ? 247.756 233.340 285.168 1.00 49.62  ? -46 DC  J "C2'" 1 
ATOM 9951  C "C1'" . DC  J 6 38  ? 246.394 232.865 284.721 1.00 49.62  ? -46 DC  J "C1'" 1 
ATOM 9952  N N1    . DC  J 6 38  ? 245.651 232.121 285.742 1.00 49.62  ? -46 DC  J N1    1 
ATOM 9953  C C2    . DC  J 6 38  ? 244.319 231.812 285.518 1.00 49.62  ? -46 DC  J C2    1 
ATOM 9954  O O2    . DC  J 6 38  ? 243.793 232.161 284.467 1.00 49.62  ? -46 DC  J O2    1 
ATOM 9955  N N3    . DC  J 6 38  ? 243.639 231.128 286.457 1.00 49.62  ? -46 DC  J N3    1 
ATOM 9956  C C4    . DC  J 6 38  ? 244.242 230.765 287.579 1.00 49.62  ? -46 DC  J C4    1 
ATOM 9957  N N4    . DC  J 6 38  ? 243.526 230.090 288.477 1.00 49.62  ? -46 DC  J N4    1 
ATOM 9958  C C5    . DC  J 6 38  ? 245.603 231.075 287.831 1.00 49.62  ? -46 DC  J C5    1 
ATOM 9959  C C6    . DC  J 6 38  ? 246.265 231.749 286.892 1.00 49.62  ? -46 DC  J C6    1 
ATOM 9960  P P     . DA  J 6 39  ? 248.624 235.690 282.223 1.00 47.17  ? -45 DA  J P     1 
ATOM 9961  O OP1   . DA  J 6 39  ? 249.151 234.822 281.154 1.00 47.17  ? -45 DA  J OP1   1 
ATOM 9962  O OP2   . DA  J 6 39  ? 249.531 236.538 283.020 1.00 47.17  ? -45 DA  J OP2   1 
ATOM 9963  O "O5'" . DA  J 6 39  ? 247.504 236.634 281.594 1.00 47.17  ? -45 DA  J "O5'" 1 
ATOM 9964  C "C5'" . DA  J 6 39  ? 246.461 236.071 280.819 1.00 47.17  ? -45 DA  J "C5'" 1 
ATOM 9965  C "C4'" . DA  J 6 39  ? 245.102 236.589 281.252 1.00 47.17  ? -45 DA  J "C4'" 1 
ATOM 9966  O "O4'" . DA  J 6 39  ? 244.685 235.928 282.468 1.00 47.17  ? -45 DA  J "O4'" 1 
ATOM 9967  C "C3'" . DA  J 6 39  ? 245.023 238.080 281.558 1.00 47.17  ? -45 DA  J "C3'" 1 
ATOM 9968  O "O3'" . DA  J 6 39  ? 243.749 238.525 281.229 1.00 47.17  ? -45 DA  J "O3'" 1 
ATOM 9969  C "C2'" . DA  J 6 39  ? 245.200 238.099 283.064 1.00 47.17  ? -45 DA  J "C2'" 1 
ATOM 9970  C "C1'" . DA  J 6 39  ? 244.353 236.903 283.425 1.00 47.17  ? -45 DA  J "C1'" 1 
ATOM 9971  N N9    . DA  J 6 39  ? 244.625 236.360 284.738 1.00 47.17  ? -45 DA  J N9    1 
ATOM 9972  C C8    . DA  J 6 39  ? 245.807 236.380 285.405 1.00 47.17  ? -45 DA  J C8    1 
ATOM 9973  N N7    . DA  J 6 39  ? 245.761 235.795 286.570 1.00 47.17  ? -45 DA  J N7    1 
ATOM 9974  C C5    . DA  J 6 39  ? 244.458 235.355 286.667 1.00 47.17  ? -45 DA  J C5    1 
ATOM 9975  C C6    . DA  J 6 39  ? 243.769 234.660 287.664 1.00 47.17  ? -45 DA  J C6    1 
ATOM 9976  N N6    . DA  J 6 39  ? 244.331 234.269 288.805 1.00 47.17  ? -45 DA  J N6    1 
ATOM 9977  N N1    . DA  J 6 39  ? 242.477 234.377 287.445 1.00 47.17  ? -45 DA  J N1    1 
ATOM 9978  C C2    . DA  J 6 39  ? 241.916 234.774 286.305 1.00 47.17  ? -45 DA  J C2    1 
ATOM 9979  N N3    . DA  J 6 39  ? 242.463 235.426 285.295 1.00 47.17  ? -45 DA  J N3    1 
ATOM 9980  C C4    . DA  J 6 39  ? 243.747 235.693 285.544 1.00 47.17  ? -45 DA  J C4    1 
ATOM 9981  P P     . DA  J 6 40  ? 243.530 239.880 280.414 1.00 45.16  ? -44 DA  J P     1 
ATOM 9982  O OP1   . DA  J 6 40  ? 243.800 239.563 279.003 1.00 45.16  ? -44 DA  J OP1   1 
ATOM 9983  O OP2   . DA  J 6 40  ? 244.258 240.968 281.086 1.00 45.16  ? -44 DA  J OP2   1 
ATOM 9984  O "O5'" . DA  J 6 40  ? 241.976 240.153 280.607 1.00 45.16  ? -44 DA  J "O5'" 1 
ATOM 9985  C "C5'" . DA  J 6 40  ? 241.061 239.113 280.364 1.00 45.16  ? -44 DA  J "C5'" 1 
ATOM 9986  C "C4'" . DA  J 6 40  ? 239.956 239.098 281.399 1.00 45.16  ? -44 DA  J "C4'" 1 
ATOM 9987  O "O4'" . DA  J 6 40  ? 240.433 238.504 282.632 1.00 45.16  ? -44 DA  J "O4'" 1 
ATOM 9988  C "C3'" . DA  J 6 40  ? 239.390 240.462 281.771 1.00 45.16  ? -44 DA  J "C3'" 1 
ATOM 9989  O "O3'" . DA  J 6 40  ? 237.989 240.372 281.825 1.00 45.16  ? -44 DA  J "O3'" 1 
ATOM 9990  C "C2'" . DA  J 6 40  ? 239.992 240.722 283.146 1.00 45.16  ? -44 DA  J "C2'" 1 
ATOM 9991  C "C1'" . DA  J 6 40  ? 240.070 239.320 283.717 1.00 45.16  ? -44 DA  J "C1'" 1 
ATOM 9992  N N9    . DA  J 6 40  ? 241.082 239.162 284.755 1.00 45.16  ? -44 DA  J N9    1 
ATOM 9993  C C8    . DA  J 6 40  ? 242.370 239.586 284.705 1.00 45.16  ? -44 DA  J C8    1 
ATOM 9994  N N7    . DA  J 6 40  ? 243.062 239.301 285.773 1.00 45.16  ? -44 DA  J N7    1 
ATOM 9995  C C5    . DA  J 6 40  ? 242.169 238.625 286.576 1.00 45.16  ? -44 DA  J C5    1 
ATOM 9996  C C6    . DA  J 6 40  ? 242.295 238.058 287.847 1.00 45.16  ? -44 DA  J C6    1 
ATOM 9997  N N6    . DA  J 6 40  ? 243.428 238.080 288.547 1.00 45.16  ? -44 DA  J N6    1 
ATOM 9998  N N1    . DA  J 6 40  ? 241.217 237.458 288.370 1.00 45.16  ? -44 DA  J N1    1 
ATOM 9999  C C2    . DA  J 6 40  ? 240.086 237.440 287.667 1.00 45.16  ? -44 DA  J C2    1 
ATOM 10000 N N3    . DA  J 6 40  ? 239.848 237.941 286.462 1.00 45.16  ? -44 DA  J N3    1 
ATOM 10001 C C4    . DA  J 6 40  ? 240.944 238.526 285.966 1.00 45.16  ? -44 DA  J C4    1 
ATOM 10002 P P     . DT  J 6 41  ? 237.077 241.681 281.968 1.00 45.48  ? -43 DT  J P     1 
ATOM 10003 O OP1   . DT  J 6 41  ? 236.070 241.636 280.900 1.00 45.48  ? -43 DT  J OP1   1 
ATOM 10004 O OP2   . DT  J 6 41  ? 237.936 242.863 282.101 1.00 45.48  ? -43 DT  J OP2   1 
ATOM 10005 O "O5'" . DT  J 6 41  ? 236.339 241.453 283.356 1.00 45.48  ? -43 DT  J "O5'" 1 
ATOM 10006 C "C5'" . DT  J 6 41  ? 235.760 240.197 283.639 1.00 45.48  ? -43 DT  J "C5'" 1 
ATOM 10007 C "C4'" . DT  J 6 41  ? 235.332 240.103 285.091 1.00 45.48  ? -43 DT  J "C4'" 1 
ATOM 10008 O "O4'" . DT  J 6 41  ? 236.480 239.834 285.933 1.00 45.48  ? -43 DT  J "O4'" 1 
ATOM 10009 C "C3'" . DT  J 6 41  ? 234.673 241.351 285.663 1.00 45.48  ? -43 DT  J "C3'" 1 
ATOM 10010 O "O3'" . DT  J 6 41  ? 233.581 240.963 286.466 1.00 45.48  ? -43 DT  J "O3'" 1 
ATOM 10011 C "C2'" . DT  J 6 41  ? 235.789 241.968 286.493 1.00 45.48  ? -43 DT  J "C2'" 1 
ATOM 10012 C "C1'" . DT  J 6 41  ? 236.489 240.733 287.012 1.00 45.48  ? -43 DT  J "C1'" 1 
ATOM 10013 N N1    . DT  J 6 41  ? 237.905 240.956 287.424 1.00 45.48  ? -43 DT  J N1    1 
ATOM 10014 C C2    . DT  J 6 41  ? 238.333 240.495 288.644 1.00 45.48  ? -43 DT  J C2    1 
ATOM 10015 O O2    . DT  J 6 41  ? 237.613 239.916 289.424 1.00 45.48  ? -43 DT  J O2    1 
ATOM 10016 N N3    . DT  J 6 41  ? 239.648 240.731 288.914 1.00 45.48  ? -43 DT  J N3    1 
ATOM 10017 C C4    . DT  J 6 41  ? 240.555 241.375 288.115 1.00 45.48  ? -43 DT  J C4    1 
ATOM 10018 O O4    . DT  J 6 41  ? 241.717 241.546 288.447 1.00 45.48  ? -43 DT  J O4    1 
ATOM 10019 C C5    . DT  J 6 41  ? 240.048 241.830 286.855 1.00 45.48  ? -43 DT  J C5    1 
ATOM 10020 C C7    . DT  J 6 41  ? 240.954 242.546 285.907 1.00 45.48  ? -43 DT  J C7    1 
ATOM 10021 C C6    . DT  J 6 41  ? 238.762 241.603 286.570 1.00 45.48  ? -43 DT  J C6    1 
ATOM 10022 P P     . DT  J 6 42  ? 232.496 242.030 286.968 1.00 48.98  ? -42 DT  J P     1 
ATOM 10023 O OP1   . DT  J 6 42  ? 231.210 241.681 286.345 1.00 48.98  ? -42 DT  J OP1   1 
ATOM 10024 O OP2   . DT  J 6 42  ? 233.041 243.385 286.801 1.00 48.98  ? -42 DT  J OP2   1 
ATOM 10025 O "O5'" . DT  J 6 42  ? 232.394 241.733 288.526 1.00 48.98  ? -42 DT  J "O5'" 1 
ATOM 10026 C "C5'" . DT  J 6 42  ? 233.546 241.321 289.222 1.00 48.98  ? -42 DT  J "C5'" 1 
ATOM 10027 C "C4'" . DT  J 6 42  ? 233.338 241.402 290.715 1.00 48.98  ? -42 DT  J "C4'" 1 
ATOM 10028 O "O4'" . DT  J 6 42  ? 234.621 241.427 291.371 1.00 48.98  ? -42 DT  J "O4'" 1 
ATOM 10029 C "C3'" . DT  J 6 42  ? 232.635 242.646 291.196 1.00 48.98  ? -42 DT  J "C3'" 1 
ATOM 10030 O "O3'" . DT  J 6 42  ? 232.037 242.381 292.445 1.00 48.98  ? -42 DT  J "O3'" 1 
ATOM 10031 C "C2'" . DT  J 6 42  ? 233.788 243.634 291.318 1.00 48.98  ? -42 DT  J "C2'" 1 
ATOM 10032 C "C1'" . DT  J 6 42  ? 234.930 242.740 291.786 1.00 48.98  ? -42 DT  J "C1'" 1 
ATOM 10033 N N1    . DT  J 6 42  ? 236.253 243.098 291.218 1.00 48.98  ? -42 DT  J N1    1 
ATOM 10034 C C2    . DT  J 6 42  ? 237.381 242.910 291.973 1.00 48.98  ? -42 DT  J C2    1 
ATOM 10035 O O2    . DT  J 6 42  ? 237.364 242.479 293.102 1.00 48.98  ? -42 DT  J O2    1 
ATOM 10036 N N3    . DT  J 6 42  ? 238.539 243.265 291.360 1.00 48.98  ? -42 DT  J N3    1 
ATOM 10037 C C4    . DT  J 6 42  ? 238.691 243.769 290.100 1.00 48.98  ? -42 DT  J C4    1 
ATOM 10038 O O4    . DT  J 6 42  ? 239.784 244.051 289.638 1.00 48.98  ? -42 DT  J O4    1 
ATOM 10039 C C5    . DT  J 6 42  ? 237.478 243.934 289.356 1.00 48.98  ? -42 DT  J C5    1 
ATOM 10040 C C7    . DT  J 6 42  ? 237.529 244.487 287.969 1.00 48.98  ? -42 DT  J C7    1 
ATOM 10041 C C6    . DT  J 6 42  ? 236.328 243.598 289.943 1.00 48.98  ? -42 DT  J C6    1 
ATOM 10042 P P     . DG  J 6 43  ? 231.044 243.441 293.121 1.00 50.98  ? -41 DG  J P     1 
ATOM 10043 O OP1   . DG  J 6 43  ? 230.027 242.681 293.869 1.00 50.98  ? -41 DG  J OP1   1 
ATOM 10044 O OP2   . DG  J 6 43  ? 230.622 244.418 292.102 1.00 50.98  ? -41 DG  J OP2   1 
ATOM 10045 O "O5'" . DG  J 6 43  ? 231.971 244.184 294.173 1.00 50.98  ? -41 DG  J "O5'" 1 
ATOM 10046 C "C5'" . DG  J 6 43  ? 232.731 243.421 295.083 1.00 50.98  ? -41 DG  J "C5'" 1 
ATOM 10047 C "C4'" . DG  J 6 43  ? 233.703 244.300 295.836 1.00 50.98  ? -41 DG  J "C4'" 1 
ATOM 10048 O "O4'" . DG  J 6 43  ? 234.937 244.418 295.088 1.00 50.98  ? -41 DG  J "O4'" 1 
ATOM 10049 C "C3'" . DG  J 6 43  ? 233.224 245.731 296.079 1.00 50.98  ? -41 DG  J "C3'" 1 
ATOM 10050 O "O3'" . DG  J 6 43  ? 233.633 246.144 297.366 1.00 50.98  ? -41 DG  J "O3'" 1 
ATOM 10051 C "C2'" . DG  J 6 43  ? 233.964 246.508 295.003 1.00 50.98  ? -41 DG  J "C2'" 1 
ATOM 10052 C "C1'" . DG  J 6 43  ? 235.283 245.774 295.017 1.00 50.98  ? -41 DG  J "C1'" 1 
ATOM 10053 N N9    . DG  J 6 43  ? 236.090 246.000 293.837 1.00 50.98  ? -41 DG  J N9    1 
ATOM 10054 C C8    . DG  J 6 43  ? 235.651 246.215 292.562 1.00 50.98  ? -41 DG  J C8    1 
ATOM 10055 N N7    . DG  J 6 43  ? 236.613 246.406 291.714 1.00 50.98  ? -41 DG  J N7    1 
ATOM 10056 C C5    . DG  J 6 43  ? 237.756 246.319 292.483 1.00 50.98  ? -41 DG  J C5    1 
ATOM 10057 C C6    . DG  J 6 43  ? 239.103 246.444 292.114 1.00 50.98  ? -41 DG  J C6    1 
ATOM 10058 O O6    . DG  J 6 43  ? 239.567 246.660 290.995 1.00 50.98  ? -41 DG  J O6    1 
ATOM 10059 N N1    . DG  J 6 43  ? 239.945 246.287 293.199 1.00 50.98  ? -41 DG  J N1    1 
ATOM 10060 C C2    . DG  J 6 43  ? 239.533 246.046 294.480 1.00 50.98  ? -41 DG  J C2    1 
ATOM 10061 N N2    . DG  J 6 43  ? 240.485 245.927 295.403 1.00 50.98  ? -41 DG  J N2    1 
ATOM 10062 N N3    . DG  J 6 43  ? 238.274 245.928 294.835 1.00 50.98  ? -41 DG  J N3    1 
ATOM 10063 C C4    . DG  J 6 43  ? 237.446 246.073 293.788 1.00 50.98  ? -41 DG  J C4    1 
ATOM 10064 P P     . DG  J 6 44  ? 232.615 246.913 298.336 1.00 52.30  ? -40 DG  J P     1 
ATOM 10065 O OP1   . DG  J 6 44  ? 232.480 246.090 299.555 1.00 52.30  ? -40 DG  J OP1   1 
ATOM 10066 O OP2   . DG  J 6 44  ? 231.424 247.280 297.546 1.00 52.30  ? -40 DG  J OP2   1 
ATOM 10067 O "O5'" . DG  J 6 44  ? 233.389 248.254 298.708 1.00 52.30  ? -40 DG  J "O5'" 1 
ATOM 10068 C "C5'" . DG  J 6 44  ? 234.419 248.721 297.861 1.00 52.30  ? -40 DG  J "C5'" 1 
ATOM 10069 C "C4'" . DG  J 6 44  ? 235.718 248.882 298.623 1.00 52.30  ? -40 DG  J "C4'" 1 
ATOM 10070 O "O4'" . DG  J 6 44  ? 236.824 248.558 297.743 1.00 52.30  ? -40 DG  J "O4'" 1 
ATOM 10071 C "C3'" . DG  J 6 44  ? 235.993 250.299 299.075 1.00 52.30  ? -40 DG  J "C3'" 1 
ATOM 10072 O "O3'" . DG  J 6 44  ? 236.935 250.312 300.134 1.00 52.30  ? -40 DG  J "O3'" 1 
ATOM 10073 C "C2'" . DG  J 6 44  ? 236.578 250.898 297.814 1.00 52.30  ? -40 DG  J "C2'" 1 
ATOM 10074 C "C1'" . DG  J 6 44  ? 237.440 249.751 297.301 1.00 52.30  ? -40 DG  J "C1'" 1 
ATOM 10075 N N9    . DG  J 6 44  ? 237.539 249.726 295.849 1.00 52.30  ? -40 DG  J N9    1 
ATOM 10076 C C8    . DG  J 6 44  ? 236.510 249.638 294.946 1.00 52.30  ? -40 DG  J C8    1 
ATOM 10077 N N7    . DG  J 6 44  ? 236.906 249.658 293.709 1.00 52.30  ? -40 DG  J N7    1 
ATOM 10078 C C5    . DG  J 6 44  ? 238.283 249.777 293.800 1.00 52.30  ? -40 DG  J C5    1 
ATOM 10079 C C6    . DG  J 6 44  ? 239.253 249.850 292.787 1.00 52.30  ? -40 DG  J C6    1 
ATOM 10080 O O6    . DG  J 6 44  ? 239.086 249.822 291.569 1.00 52.30  ? -40 DG  J O6    1 
ATOM 10081 N N1    . DG  J 6 44  ? 240.534 249.961 293.308 1.00 52.30  ? -40 DG  J N1    1 
ATOM 10082 C C2    . DG  J 6 44  ? 240.834 249.997 294.641 1.00 52.30  ? -40 DG  J C2    1 
ATOM 10083 N N2    . DG  J 6 44  ? 242.123 250.111 294.964 1.00 52.30  ? -40 DG  J N2    1 
ATOM 10084 N N3    . DG  J 6 44  ? 239.931 249.931 295.599 1.00 52.30  ? -40 DG  J N3    1 
ATOM 10085 C C4    . DG  J 6 44  ? 238.684 249.820 295.107 1.00 52.30  ? -40 DG  J C4    1 
ATOM 10086 P P     . DT  J 6 45  ? 237.108 251.630 301.036 1.00 52.56  ? -39 DT  J P     1 
ATOM 10087 O OP1   . DT  J 6 45  ? 236.760 251.254 302.424 1.00 52.56  ? -39 DT  J OP1   1 
ATOM 10088 O OP2   . DT  J 6 45  ? 236.384 252.733 300.367 1.00 52.56  ? -39 DT  J OP2   1 
ATOM 10089 O "O5'" . DT  J 6 45  ? 238.670 251.959 300.942 1.00 52.56  ? -39 DT  J "O5'" 1 
ATOM 10090 C "C5'" . DT  J 6 45  ? 239.345 251.771 299.713 1.00 52.56  ? -39 DT  J "C5'" 1 
ATOM 10091 C "C4'" . DT  J 6 45  ? 240.648 252.537 299.669 1.00 52.56  ? -39 DT  J "C4'" 1 
ATOM 10092 O "O4'" . DT  J 6 45  ? 241.145 252.533 298.307 1.00 52.56  ? -39 DT  J "O4'" 1 
ATOM 10093 C "C3'" . DT  J 6 45  ? 240.532 254.002 300.018 1.00 52.56  ? -39 DT  J "C3'" 1 
ATOM 10094 O "O3'" . DT  J 6 45  ? 241.809 254.505 300.363 1.00 52.56  ? -39 DT  J "O3'" 1 
ATOM 10095 C "C2'" . DT  J 6 45  ? 240.051 254.584 298.700 1.00 52.56  ? -39 DT  J "C2'" 1 
ATOM 10096 C "C1'" . DT  J 6 45  ? 240.891 253.793 297.708 1.00 52.56  ? -39 DT  J "C1'" 1 
ATOM 10097 N N1    . DT  J 6 45  ? 240.215 253.575 296.410 1.00 52.56  ? -39 DT  J N1    1 
ATOM 10098 C C2    . DT  J 6 45  ? 240.970 253.445 295.280 1.00 52.56  ? -39 DT  J C2    1 
ATOM 10099 O O2    . DT  J 6 45  ? 242.181 253.489 295.282 1.00 52.56  ? -39 DT  J O2    1 
ATOM 10100 N N3    . DT  J 6 45  ? 240.259 253.267 294.139 1.00 52.56  ? -39 DT  J N3    1 
ATOM 10101 C C4    . DT  J 6 45  ? 238.893 253.201 294.013 1.00 52.56  ? -39 DT  J C4    1 
ATOM 10102 O O4    . DT  J 6 45  ? 238.345 253.029 292.938 1.00 52.56  ? -39 DT  J O4    1 
ATOM 10103 C C5    . DT  J 6 45  ? 238.156 253.340 295.235 1.00 52.56  ? -39 DT  J C5    1 
ATOM 10104 C C7    . DT  J 6 45  ? 236.663 253.289 295.219 1.00 52.56  ? -39 DT  J C7    1 
ATOM 10105 C C6    . DT  J 6 45  ? 238.844 253.522 296.363 1.00 52.56  ? -39 DT  J C6    1 
ATOM 10106 P P     . DC  J 6 46  ? 241.971 256.008 300.899 1.00 51.79  ? -38 DC  J P     1 
ATOM 10107 O OP1   . DC  J 6 46  ? 242.920 255.957 302.030 1.00 51.79  ? -38 DC  J OP1   1 
ATOM 10108 O OP2   . DC  J 6 46  ? 240.622 256.573 301.094 1.00 51.79  ? -38 DC  J OP2   1 
ATOM 10109 O "O5'" . DC  J 6 46  ? 242.668 256.776 299.680 1.00 51.79  ? -38 DC  J "O5'" 1 
ATOM 10110 C "C5'" . DC  J 6 46  ? 243.922 256.320 299.187 1.00 51.79  ? -38 DC  J "C5'" 1 
ATOM 10111 C "C4'" . DC  J 6 46  ? 244.318 257.037 297.904 1.00 51.79  ? -38 DC  J "C4'" 1 
ATOM 10112 O "O4'" . DC  J 6 46  ? 243.477 256.601 296.801 1.00 51.79  ? -38 DC  J "O4'" 1 
ATOM 10113 C "C3'" . DC  J 6 46  ? 244.200 258.557 297.932 1.00 51.79  ? -38 DC  J "C3'" 1 
ATOM 10114 O "O3'" . DC  J 6 46  ? 245.250 259.110 297.169 1.00 51.79  ? -38 DC  J "O3'" 1 
ATOM 10115 C "C2'" . DC  J 6 46  ? 242.867 258.782 297.232 1.00 51.79  ? -38 DC  J "C2'" 1 
ATOM 10116 C "C1'" . DC  J 6 46  ? 242.980 257.740 296.142 1.00 51.79  ? -38 DC  J "C1'" 1 
ATOM 10117 N N1    . DC  J 6 46  ? 241.700 257.397 295.494 1.00 51.79  ? -38 DC  J N1    1 
ATOM 10118 C C2    . DC  J 6 46  ? 241.690 257.048 294.147 1.00 51.79  ? -38 DC  J C2    1 
ATOM 10119 O O2    . DC  J 6 46  ? 242.751 257.032 293.524 1.00 51.79  ? -38 DC  J O2    1 
ATOM 10120 N N3    . DC  J 6 46  ? 240.518 256.727 293.562 1.00 51.79  ? -38 DC  J N3    1 
ATOM 10121 C C4    . DC  J 6 46  ? 239.397 256.755 294.269 1.00 51.79  ? -38 DC  J C4    1 
ATOM 10122 N N4    . DC  J 6 46  ? 238.264 256.441 293.649 1.00 51.79  ? -38 DC  J N4    1 
ATOM 10123 C C5    . DC  J 6 46  ? 239.385 257.115 295.646 1.00 51.79  ? -38 DC  J C5    1 
ATOM 10124 C C6    . DC  J 6 46  ? 240.550 257.424 296.212 1.00 51.79  ? -38 DC  J C6    1 
ATOM 10125 P P     . DG  J 6 47  ? 246.515 259.798 297.873 1.00 50.60  ? -37 DG  J P     1 
ATOM 10126 O OP1   . DG  J 6 47  ? 247.461 258.724 298.237 1.00 50.60  ? -37 DG  J OP1   1 
ATOM 10127 O OP2   . DG  J 6 47  ? 246.007 260.730 298.901 1.00 50.60  ? -37 DG  J OP2   1 
ATOM 10128 O "O5'" . DG  J 6 47  ? 247.176 260.646 296.691 1.00 50.60  ? -37 DG  J "O5'" 1 
ATOM 10129 C "C5'" . DG  J 6 47  ? 247.575 259.992 295.492 1.00 50.60  ? -37 DG  J "C5'" 1 
ATOM 10130 C "C4'" . DG  J 6 47  ? 247.106 260.752 294.265 1.00 50.60  ? -37 DG  J "C4'" 1 
ATOM 10131 O "O4'" . DG  J 6 47  ? 245.737 260.380 293.941 1.00 50.60  ? -37 DG  J "O4'" 1 
ATOM 10132 C "C3'" . DG  J 6 47  ? 247.091 262.274 294.401 1.00 50.60  ? -37 DG  J "C3'" 1 
ATOM 10133 O "O3'" . DG  J 6 47  ? 247.396 262.846 293.162 1.00 50.60  ? -37 DG  J "O3'" 1 
ATOM 10134 C "C2'" . DG  J 6 47  ? 245.633 262.532 294.734 1.00 50.60  ? -37 DG  J "C2'" 1 
ATOM 10135 C "C1'" . DG  J 6 47  ? 244.996 261.558 293.774 1.00 50.60  ? -37 DG  J "C1'" 1 
ATOM 10136 N N9    . DG  J 6 47  ? 243.594 261.292 294.037 1.00 50.60  ? -37 DG  J N9    1 
ATOM 10137 C C8    . DG  J 6 47  ? 242.921 261.497 295.205 1.00 50.60  ? -37 DG  J C8    1 
ATOM 10138 N N7    . DG  J 6 47  ? 241.665 261.175 295.140 1.00 50.60  ? -37 DG  J N7    1 
ATOM 10139 C C5    . DG  J 6 47  ? 241.496 260.739 293.839 1.00 50.60  ? -37 DG  J C5    1 
ATOM 10140 C C6    . DG  J 6 47  ? 240.346 260.259 293.189 1.00 50.60  ? -37 DG  J C6    1 
ATOM 10141 O O6    . DG  J 6 47  ? 239.211 260.127 293.646 1.00 50.60  ? -37 DG  J O6    1 
ATOM 10142 N N1    . DG  J 6 47  ? 240.606 259.917 291.874 1.00 50.60  ? -37 DG  J N1    1 
ATOM 10143 C C2    . DG  J 6 47  ? 241.822 260.023 291.266 1.00 50.60  ? -37 DG  J C2    1 
ATOM 10144 N N2    . DG  J 6 47  ? 241.880 259.652 289.988 1.00 50.60  ? -37 DG  J N2    1 
ATOM 10145 N N3    . DG  J 6 47  ? 242.910 260.470 291.864 1.00 50.60  ? -37 DG  J N3    1 
ATOM 10146 C C4    . DG  J 6 47  ? 242.672 260.803 293.149 1.00 50.60  ? -37 DG  J C4    1 
ATOM 10147 P P     . DT  J 6 48  ? 248.871 263.362 292.813 1.00 49.50  ? -36 DT  J P     1 
ATOM 10148 O OP1   . DT  J 6 48  ? 249.821 262.262 293.069 1.00 49.50  ? -36 DT  J OP1   1 
ATOM 10149 O OP2   . DT  J 6 48  ? 249.059 264.661 293.485 1.00 49.50  ? -36 DT  J OP2   1 
ATOM 10150 O "O5'" . DT  J 6 48  ? 248.790 263.613 291.238 1.00 49.50  ? -36 DT  J "O5'" 1 
ATOM 10151 C "C5'" . DT  J 6 48  ? 248.396 262.552 290.381 1.00 49.50  ? -36 DT  J "C5'" 1 
ATOM 10152 C "C4'" . DT  J 6 48  ? 247.372 263.006 289.353 1.00 49.50  ? -36 DT  J "C4'" 1 
ATOM 10153 O "O4'" . DT  J 6 48  ? 246.030 262.860 289.884 1.00 49.50  ? -36 DT  J "O4'" 1 
ATOM 10154 C "C3'" . DT  J 6 48  ? 247.481 264.461 288.904 1.00 49.50  ? -36 DT  J "C3'" 1 
ATOM 10155 O "O3'" . DT  J 6 48  ? 247.115 264.556 287.552 1.00 49.50  ? -36 DT  J "O3'" 1 
ATOM 10156 C "C2'" . DT  J 6 48  ? 246.424 265.124 289.762 1.00 49.50  ? -36 DT  J "C2'" 1 
ATOM 10157 C "C1'" . DT  J 6 48  ? 245.344 264.069 289.688 1.00 49.50  ? -36 DT  J "C1'" 1 
ATOM 10158 N N1    . DT  J 6 48  ? 244.316 264.208 290.723 1.00 49.50  ? -36 DT  J N1    1 
ATOM 10159 C C2    . DT  J 6 48  ? 243.050 263.752 290.480 1.00 49.50  ? -36 DT  J C2    1 
ATOM 10160 O O2    . DT  J 6 48  ? 242.723 263.208 289.447 1.00 49.50  ? -36 DT  J O2    1 
ATOM 10161 N N3    . DT  J 6 48  ? 242.176 263.940 291.503 1.00 49.50  ? -36 DT  J N3    1 
ATOM 10162 C C4    . DT  J 6 48  ? 242.429 264.531 292.712 1.00 49.50  ? -36 DT  J C4    1 
ATOM 10163 O O4    . DT  J 6 48  ? 241.572 264.656 293.571 1.00 49.50  ? -36 DT  J O4    1 
ATOM 10164 C C5    . DT  J 6 48  ? 243.769 265.000 292.900 1.00 49.50  ? -36 DT  J C5    1 
ATOM 10165 C C7    . DT  J 6 48  ? 244.156 265.668 294.184 1.00 49.50  ? -36 DT  J C7    1 
ATOM 10166 C C6    . DT  J 6 48  ? 244.639 264.822 291.906 1.00 49.50  ? -36 DT  J C6    1 
ATOM 10167 P P     . DA  J 6 49  ? 248.200 264.456 286.378 1.00 47.14  ? -35 DA  J P     1 
ATOM 10168 O OP1   . DA  J 6 49  ? 249.110 263.339 286.684 1.00 47.14  ? -35 DA  J OP1   1 
ATOM 10169 O OP2   . DA  J 6 49  ? 248.749 265.805 286.160 1.00 47.14  ? -35 DA  J OP2   1 
ATOM 10170 O "O5'" . DA  J 6 49  ? 247.320 264.063 285.108 1.00 47.14  ? -35 DA  J "O5'" 1 
ATOM 10171 C "C5'" . DA  J 6 49  ? 246.556 262.880 285.140 1.00 47.14  ? -35 DA  J "C5'" 1 
ATOM 10172 C "C4'" . DA  J 6 49  ? 245.300 262.983 284.289 1.00 47.14  ? -35 DA  J "C4'" 1 
ATOM 10173 O "O4'" . DA  J 6 49  ? 244.181 263.432 285.082 1.00 47.14  ? -35 DA  J "O4'" 1 
ATOM 10174 C "C3'" . DA  J 6 49  ? 245.353 263.917 283.103 1.00 47.14  ? -35 DA  J "C3'" 1 
ATOM 10175 O "O3'" . DA  J 6 49  ? 244.493 263.393 282.107 1.00 47.14  ? -35 DA  J "O3'" 1 
ATOM 10176 C "C2'" . DA  J 6 49  ? 244.825 265.227 283.689 1.00 47.14  ? -35 DA  J "C2'" 1 
ATOM 10177 C "C1'" . DA  J 6 49  ? 243.802 264.744 284.713 1.00 47.14  ? -35 DA  J "C1'" 1 
ATOM 10178 N N9    . DA  J 6 49  ? 243.779 265.518 285.943 1.00 47.14  ? -35 DA  J N9    1 
ATOM 10179 C C8    . DA  J 6 49  ? 244.819 266.180 286.509 1.00 47.14  ? -35 DA  J C8    1 
ATOM 10180 N N7    . DA  J 6 49  ? 244.521 266.754 287.640 1.00 47.14  ? -35 DA  J N7    1 
ATOM 10181 C C5    . DA  J 6 49  ? 243.199 266.426 287.839 1.00 47.14  ? -35 DA  J C5    1 
ATOM 10182 C C6    . DA  J 6 49  ? 242.299 266.735 288.863 1.00 47.14  ? -35 DA  J C6    1 
ATOM 10183 N N6    . DA  J 6 49  ? 242.626 267.467 289.922 1.00 47.14  ? -35 DA  J N6    1 
ATOM 10184 N N1    . DA  J 6 49  ? 241.052 266.253 288.763 1.00 47.14  ? -35 DA  J N1    1 
ATOM 10185 C C2    . DA  J 6 49  ? 240.731 265.520 287.702 1.00 47.14  ? -35 DA  J C2    1 
ATOM 10186 N N3    . DA  J 6 49  ? 241.494 265.163 286.677 1.00 47.14  ? -35 DA  J N3    1 
ATOM 10187 C C4    . DA  J 6 49  ? 242.728 265.660 286.808 1.00 47.14  ? -35 DA  J C4    1 
ATOM 10188 P P     . DG  J 6 50  ? 244.259 264.137 280.710 1.00 47.22  ? -34 DG  J P     1 
ATOM 10189 O OP1   . DG  J 6 50  ? 244.069 263.089 279.701 1.00 47.22  ? -34 DG  J OP1   1 
ATOM 10190 O OP2   . DG  J 6 50  ? 245.274 265.182 280.517 1.00 47.22  ? -34 DG  J OP2   1 
ATOM 10191 O "O5'" . DG  J 6 50  ? 242.850 264.827 280.900 1.00 47.22  ? -34 DG  J "O5'" 1 
ATOM 10192 C "C5'" . DG  J 6 50  ? 241.771 264.059 281.377 1.00 47.22  ? -34 DG  J "C5'" 1 
ATOM 10193 C "C4'" . DG  J 6 50  ? 240.589 264.936 281.723 1.00 47.22  ? -34 DG  J "C4'" 1 
ATOM 10194 O "O4'" . DG  J 6 50  ? 240.832 265.628 282.972 1.00 47.22  ? -34 DG  J "O4'" 1 
ATOM 10195 C "C3'" . DG  J 6 50  ? 240.263 266.028 280.712 1.00 47.22  ? -34 DG  J "C3'" 1 
ATOM 10196 O "O3'" . DG  J 6 50  ? 238.877 266.211 280.702 1.00 47.22  ? -34 DG  J "O3'" 1 
ATOM 10197 C "C2'" . DG  J 6 50  ? 240.953 267.238 281.321 1.00 47.22  ? -34 DG  J "C2'" 1 
ATOM 10198 C "C1'" . DG  J 6 50  ? 240.620 267.002 282.775 1.00 47.22  ? -34 DG  J "C1'" 1 
ATOM 10199 N N9    . DG  J 6 50  ? 241.439 267.742 283.719 1.00 47.22  ? -34 DG  J N9    1 
ATOM 10200 C C8    . DG  J 6 50  ? 242.755 268.087 283.597 1.00 47.22  ? -34 DG  J C8    1 
ATOM 10201 N N7    . DG  J 6 50  ? 243.211 268.740 284.624 1.00 47.22  ? -34 DG  J N7    1 
ATOM 10202 C C5    . DG  J 6 50  ? 242.124 268.827 285.475 1.00 47.22  ? -34 DG  J C5    1 
ATOM 10203 C C6    . DG  J 6 50  ? 242.008 269.419 286.745 1.00 47.22  ? -34 DG  J C6    1 
ATOM 10204 O O6    . DG  J 6 50  ? 242.872 270.015 287.392 1.00 47.22  ? -34 DG  J O6    1 
ATOM 10205 N N1    . DG  J 6 50  ? 240.732 269.277 287.260 1.00 47.22  ? -34 DG  J N1    1 
ATOM 10206 C C2    . DG  J 6 50  ? 239.702 268.642 286.626 1.00 47.22  ? -34 DG  J C2    1 
ATOM 10207 N N2    . DG  J 6 50  ? 238.538 268.599 287.269 1.00 47.22  ? -34 DG  J N2    1 
ATOM 10208 N N3    . DG  J 6 50  ? 239.800 268.085 285.443 1.00 47.22  ? -34 DG  J N3    1 
ATOM 10209 C C4    . DG  J 6 50  ? 241.035 268.209 284.932 1.00 47.22  ? -34 DG  J C4    1 
ATOM 10210 P P     . DA  J 6 51  ? 238.091 266.538 279.347 1.00 49.66  ? -33 DA  J P     1 
ATOM 10211 O OP1   . DA  J 6 51  ? 238.041 265.302 278.549 1.00 49.66  ? -33 DA  J OP1   1 
ATOM 10212 O OP2   . DA  J 6 51  ? 238.653 267.777 278.776 1.00 49.66  ? -33 DA  J OP2   1 
ATOM 10213 O "O5'" . DA  J 6 51  ? 236.624 266.867 279.866 1.00 49.66  ? -33 DA  J "O5'" 1 
ATOM 10214 C "C5'" . DA  J 6 51  ? 236.190 266.333 281.106 1.00 49.66  ? -33 DA  J "C5'" 1 
ATOM 10215 C "C4'" . DA  J 6 51  ? 235.337 267.332 281.863 1.00 49.66  ? -33 DA  J "C4'" 1 
ATOM 10216 O "O4'" . DA  J 6 51  ? 236.142 268.023 282.849 1.00 49.66  ? -33 DA  J "O4'" 1 
ATOM 10217 C "C3'" . DA  J 6 51  ? 234.701 268.416 281.013 1.00 49.66  ? -33 DA  J "C3'" 1 
ATOM 10218 O "O3'" . DA  J 6 51  ? 233.423 268.721 281.536 1.00 49.66  ? -33 DA  J "O3'" 1 
ATOM 10219 C "C2'" . DA  J 6 51  ? 235.673 269.582 281.170 1.00 49.66  ? -33 DA  J "C2'" 1 
ATOM 10220 C "C1'" . DA  J 6 51  ? 236.116 269.415 282.610 1.00 49.66  ? -33 DA  J "C1'" 1 
ATOM 10221 N N9    . DA  J 6 51  ? 237.450 269.929 282.881 1.00 49.66  ? -33 DA  J N9    1 
ATOM 10222 C C8    . DA  J 6 51  ? 238.560 269.750 282.120 1.00 49.66  ? -33 DA  J C8    1 
ATOM 10223 N N7    . DA  J 6 51  ? 239.634 270.300 282.616 1.00 49.66  ? -33 DA  J N7    1 
ATOM 10224 C C5    . DA  J 6 51  ? 239.199 270.874 283.790 1.00 49.66  ? -33 DA  J C5    1 
ATOM 10225 C C6    . DA  J 6 51  ? 239.862 271.605 284.781 1.00 49.66  ? -33 DA  J C6    1 
ATOM 10226 N N6    . DA  J 6 51  ? 241.159 271.897 284.732 1.00 49.66  ? -33 DA  J N6    1 
ATOM 10227 N N1    . DA  J 6 51  ? 239.139 272.036 285.824 1.00 49.66  ? -33 DA  J N1    1 
ATOM 10228 C C2    . DA  J 6 51  ? 237.840 271.744 285.870 1.00 49.66  ? -33 DA  J C2    1 
ATOM 10229 N N3    . DA  J 6 51  ? 237.108 271.061 285.001 1.00 49.66  ? -33 DA  J N3    1 
ATOM 10230 C C4    . DA  J 6 51  ? 237.856 270.648 283.974 1.00 49.66  ? -33 DA  J C4    1 
ATOM 10231 P P     . DC  J 6 52  ? 232.409 269.656 280.720 1.00 52.52  ? -32 DC  J P     1 
ATOM 10232 O OP1   . DC  J 6 52  ? 231.054 269.101 280.899 1.00 52.52  ? -32 DC  J OP1   1 
ATOM 10233 O OP2   . DC  J 6 52  ? 232.956 269.858 279.361 1.00 52.52  ? -32 DC  J OP2   1 
ATOM 10234 O "O5'" . DC  J 6 52  ? 232.485 271.042 281.499 1.00 52.52  ? -32 DC  J "O5'" 1 
ATOM 10235 C "C5'" . DC  J 6 52  ? 232.382 271.049 282.909 1.00 52.52  ? -32 DC  J "C5'" 1 
ATOM 10236 C "C4'" . DC  J 6 52  ? 232.706 272.418 283.460 1.00 52.52  ? -32 DC  J "C4'" 1 
ATOM 10237 O "O4'" . DC  J 6 52  ? 234.133 272.550 283.638 1.00 52.52  ? -32 DC  J "O4'" 1 
ATOM 10238 C "C3'" . DC  J 6 52  ? 232.281 273.583 282.567 1.00 52.52  ? -32 DC  J "C3'" 1 
ATOM 10239 O "O3'" . DC  J 6 52  ? 231.583 274.526 283.339 1.00 52.52  ? -32 DC  J "O3'" 1 
ATOM 10240 C "C2'" . DC  J 6 52  ? 233.607 274.148 282.061 1.00 52.52  ? -32 DC  J "C2'" 1 
ATOM 10241 C "C1'" . DC  J 6 52  ? 234.514 273.833 283.229 1.00 52.52  ? -32 DC  J "C1'" 1 
ATOM 10242 N N1    . DC  J 6 52  ? 235.949 273.812 282.894 1.00 52.52  ? -32 DC  J N1    1 
ATOM 10243 C C2    . DC  J 6 52  ? 236.843 274.451 283.737 1.00 52.52  ? -32 DC  J C2    1 
ATOM 10244 O O2    . DC  J 6 52  ? 236.405 275.014 284.736 1.00 52.52  ? -32 DC  J O2    1 
ATOM 10245 N N3    . DC  J 6 52  ? 238.156 274.433 283.434 1.00 52.52  ? -32 DC  J N3    1 
ATOM 10246 C C4    . DC  J 6 52  ? 238.574 273.803 282.340 1.00 52.52  ? -32 DC  J C4    1 
ATOM 10247 N N4    . DC  J 6 52  ? 239.880 273.806 282.080 1.00 52.52  ? -32 DC  J N4    1 
ATOM 10248 C C5    . DC  J 6 52  ? 237.673 273.146 281.465 1.00 52.52  ? -32 DC  J C5    1 
ATOM 10249 C C6    . DC  J 6 52  ? 236.379 273.174 281.779 1.00 52.52  ? -32 DC  J C6    1 
ATOM 10250 P P     . DA  J 6 53  ? 230.416 275.407 282.686 1.00 53.54  ? -31 DA  J P     1 
ATOM 10251 O OP1   . DA  J 6 53  ? 229.124 274.788 283.053 1.00 53.54  ? -31 DA  J OP1   1 
ATOM 10252 O OP2   . DA  J 6 53  ? 230.749 275.620 281.262 1.00 53.54  ? -31 DA  J OP2   1 
ATOM 10253 O "O5'" . DA  J 6 53  ? 230.558 276.798 283.444 1.00 53.54  ? -31 DA  J "O5'" 1 
ATOM 10254 C "C5'" . DA  J 6 53  ? 231.080 276.823 284.759 1.00 53.54  ? -31 DA  J "C5'" 1 
ATOM 10255 C "C4'" . DA  J 6 53  ? 232.025 277.993 284.933 1.00 53.54  ? -31 DA  J "C4'" 1 
ATOM 10256 O "O4'" . DA  J 6 53  ? 233.360 277.594 284.573 1.00 53.54  ? -31 DA  J "O4'" 1 
ATOM 10257 C "C3'" . DA  J 6 53  ? 231.690 279.212 284.080 1.00 53.54  ? -31 DA  J "C3'" 1 
ATOM 10258 O "O3'" . DA  J 6 53  ? 231.396 280.309 284.926 1.00 53.54  ? -31 DA  J "O3'" 1 
ATOM 10259 C "C2'" . DA  J 6 53  ? 232.945 279.454 283.227 1.00 53.54  ? -31 DA  J "C2'" 1 
ATOM 10260 C "C1'" . DA  J 6 53  ? 234.021 278.665 283.957 1.00 53.54  ? -31 DA  J "C1'" 1 
ATOM 10261 N N9    . DA  J 6 53  ? 235.032 278.098 283.072 1.00 53.54  ? -31 DA  J N9    1 
ATOM 10262 C C8    . DA  J 6 53  ? 234.817 277.303 281.990 1.00 53.54  ? -31 DA  J C8    1 
ATOM 10263 N N7    . DA  J 6 53  ? 235.911 276.917 281.392 1.00 53.54  ? -31 DA  J N7    1 
ATOM 10264 C C5    . DA  J 6 53  ? 236.914 277.500 282.136 1.00 53.54  ? -31 DA  J C5    1 
ATOM 10265 C C6    . DA  J 6 53  ? 238.306 277.475 282.016 1.00 53.54  ? -31 DA  J C6    1 
ATOM 10266 N N6    . DA  J 6 53  ? 238.943 276.808 281.056 1.00 53.54  ? -31 DA  J N6    1 
ATOM 10267 N N1    . DA  J 6 53  ? 239.020 278.155 282.923 1.00 53.54  ? -31 DA  J N1    1 
ATOM 10268 C C2    . DA  J 6 53  ? 238.375 278.815 283.882 1.00 53.54  ? -31 DA  J C2    1 
ATOM 10269 N N3    . DA  J 6 53  ? 237.071 278.911 284.096 1.00 53.54  ? -31 DA  J N3    1 
ATOM 10270 C C4    . DA  J 6 53  ? 236.391 278.225 283.179 1.00 53.54  ? -31 DA  J C4    1 
ATOM 10271 P P     . DG  J 6 54  ? 231.032 281.742 284.307 1.00 52.49  ? -30 DG  J P     1 
ATOM 10272 O OP1   . DG  J 6 54  ? 230.144 282.424 285.270 1.00 52.49  ? -30 DG  J OP1   1 
ATOM 10273 O OP2   . DG  J 6 54  ? 230.602 281.556 282.904 1.00 52.49  ? -30 DG  J OP2   1 
ATOM 10274 O "O5'" . DG  J 6 54  ? 232.431 282.506 284.307 1.00 52.49  ? -30 DG  J "O5'" 1 
ATOM 10275 C "C5'" . DG  J 6 54  ? 233.214 282.518 285.480 1.00 52.49  ? -30 DG  J "C5'" 1 
ATOM 10276 C "C4'" . DG  J 6 54  ? 234.499 283.285 285.255 1.00 52.49  ? -30 DG  J "C4'" 1 
ATOM 10277 O "O4'" . DG  J 6 54  ? 235.440 282.451 284.535 1.00 52.49  ? -30 DG  J "O4'" 1 
ATOM 10278 C "C3'" . DG  J 6 54  ? 234.337 284.560 284.433 1.00 52.49  ? -30 DG  J "C3'" 1 
ATOM 10279 O "O3'" . DG  J 6 54  ? 235.054 285.613 285.040 1.00 52.49  ? -30 DG  J "O3'" 1 
ATOM 10280 C "C2'" . DG  J 6 54  ? 234.919 284.184 283.072 1.00 52.49  ? -30 DG  J "C2'" 1 
ATOM 10281 C "C1'" . DG  J 6 54  ? 235.977 283.170 283.456 1.00 52.49  ? -30 DG  J "C1'" 1 
ATOM 10282 N N9    . DG  J 6 54  ? 236.284 282.231 282.391 1.00 52.49  ? -30 DG  J N9    1 
ATOM 10283 C C8    . DG  J 6 54  ? 235.391 281.541 281.621 1.00 52.49  ? -30 DG  J C8    1 
ATOM 10284 N N7    . DG  J 6 54  ? 235.957 280.766 280.745 1.00 52.49  ? -30 DG  J N7    1 
ATOM 10285 C C5    . DG  J 6 54  ? 237.311 280.956 280.950 1.00 52.49  ? -30 DG  J C5    1 
ATOM 10286 C C6    . DG  J 6 54  ? 238.415 280.388 280.294 1.00 52.49  ? -30 DG  J C6    1 
ATOM 10287 O O6    . DG  J 6 54  ? 238.417 279.571 279.374 1.00 52.49  ? -30 DG  J O6    1 
ATOM 10288 N N1    . DG  J 6 54  ? 239.610 280.853 280.807 1.00 52.49  ? -30 DG  J N1    1 
ATOM 10289 C C2    . DG  J 6 54  ? 239.725 281.755 281.824 1.00 52.49  ? -30 DG  J C2    1 
ATOM 10290 N N2    . DG  J 6 54  ? 240.964 282.084 282.186 1.00 52.49  ? -30 DG  J N2    1 
ATOM 10291 N N3    . DG  J 6 54  ? 238.699 282.296 282.449 1.00 52.49  ? -30 DG  J N3    1 
ATOM 10292 C C4    . DG  J 6 54  ? 237.527 281.855 281.959 1.00 52.49  ? -30 DG  J C4    1 
ATOM 10293 P P     . DC  J 6 55  ? 234.885 287.119 284.513 1.00 50.82  ? -29 DC  J P     1 
ATOM 10294 O OP1   . DC  J 6 55  ? 234.768 287.992 285.698 1.00 50.82  ? -29 DC  J OP1   1 
ATOM 10295 O OP2   . DC  J 6 55  ? 233.840 287.146 283.469 1.00 50.82  ? -29 DC  J OP2   1 
ATOM 10296 O "O5'" . DC  J 6 55  ? 236.273 287.412 283.798 1.00 50.82  ? -29 DC  J "O5'" 1 
ATOM 10297 C "C5'" . DC  J 6 55  ? 237.470 287.027 284.426 1.00 50.82  ? -29 DC  J "C5'" 1 
ATOM 10298 C "C4'" . DC  J 6 55  ? 238.627 287.105 283.458 1.00 50.82  ? -29 DC  J "C4'" 1 
ATOM 10299 O "O4'" . DC  J 6 55  ? 238.638 285.934 282.605 1.00 50.82  ? -29 DC  J "O4'" 1 
ATOM 10300 C "C3'" . DC  J 6 55  ? 238.604 288.314 282.523 1.00 50.82  ? -29 DC  J "C3'" 1 
ATOM 10301 O "O3'" . DC  J 6 55  ? 239.860 288.965 282.576 1.00 50.82  ? -29 DC  J "O3'" 1 
ATOM 10302 C "C2'" . DC  J 6 55  ? 238.344 287.696 281.148 1.00 50.82  ? -29 DC  J "C2'" 1 
ATOM 10303 C "C1'" . DC  J 6 55  ? 238.973 286.329 281.307 1.00 50.82  ? -29 DC  J "C1'" 1 
ATOM 10304 N N1    . DC  J 6 55  ? 238.464 285.307 280.354 1.00 50.82  ? -29 DC  J N1    1 
ATOM 10305 C C2    . DC  J 6 55  ? 239.371 284.520 279.654 1.00 50.82  ? -29 DC  J C2    1 
ATOM 10306 O O2    . DC  J 6 55  ? 240.573 284.695 279.840 1.00 50.82  ? -29 DC  J O2    1 
ATOM 10307 N N3    . DC  J 6 55  ? 238.906 283.594 278.792 1.00 50.82  ? -29 DC  J N3    1 
ATOM 10308 C C4    . DC  J 6 55  ? 237.598 283.437 278.626 1.00 50.82  ? -29 DC  J C4    1 
ATOM 10309 N N4    . DC  J 6 55  ? 237.185 282.508 277.764 1.00 50.82  ? -29 DC  J N4    1 
ATOM 10310 C C5    . DC  J 6 55  ? 236.654 284.229 279.331 1.00 50.82  ? -29 DC  J C5    1 
ATOM 10311 C C6    . DC  J 6 55  ? 237.127 285.144 280.177 1.00 50.82  ? -29 DC  J C6    1 
ATOM 10312 P P     . DT  J 6 56  ? 240.059 290.430 281.954 1.00 48.84  ? -28 DT  J P     1 
ATOM 10313 O OP1   . DT  J 6 56  ? 240.540 291.300 283.045 1.00 48.84  ? -28 DT  J OP1   1 
ATOM 10314 O OP2   . DT  J 6 56  ? 238.850 290.795 281.188 1.00 48.84  ? -28 DT  J OP2   1 
ATOM 10315 O "O5'" . DT  J 6 56  ? 241.258 290.226 280.926 1.00 48.84  ? -28 DT  J "O5'" 1 
ATOM 10316 C "C5'" . DT  J 6 56  ? 242.378 289.453 281.315 1.00 48.84  ? -28 DT  J "C5'" 1 
ATOM 10317 C "C4'" . DT  J 6 56  ? 243.274 289.149 280.133 1.00 48.84  ? -28 DT  J "C4'" 1 
ATOM 10318 O "O4'" . DT  J 6 56  ? 242.731 288.045 279.367 1.00 48.84  ? -28 DT  J "O4'" 1 
ATOM 10319 C "C3'" . DT  J 6 56  ? 243.462 290.291 279.151 1.00 48.84  ? -28 DT  J "C3'" 1 
ATOM 10320 O "O3'" . DT  J 6 56  ? 244.796 290.283 278.701 1.00 48.84  ? -28 DT  J "O3'" 1 
ATOM 10321 C "C2'" . DT  J 6 56  ? 242.481 289.939 278.031 1.00 48.84  ? -28 DT  J "C2'" 1 
ATOM 10322 C "C1'" . DT  J 6 56  ? 242.578 288.427 278.018 1.00 48.84  ? -28 DT  J "C1'" 1 
ATOM 10323 N N1    . DT  J 6 56  ? 241.376 287.729 277.484 1.00 48.84  ? -28 DT  J N1    1 
ATOM 10324 C C2    . DT  J 6 56  ? 241.548 286.627 276.689 1.00 48.84  ? -28 DT  J C2    1 
ATOM 10325 O O2    . DT  J 6 56  ? 242.637 286.200 276.375 1.00 48.84  ? -28 DT  J O2    1 
ATOM 10326 N N3    . DT  J 6 56  ? 240.396 286.039 276.269 1.00 48.84  ? -28 DT  J N3    1 
ATOM 10327 C C4    . DT  J 6 56  ? 239.114 286.425 276.560 1.00 48.84  ? -28 DT  J C4    1 
ATOM 10328 O O4    . DT  J 6 56  ? 238.141 285.827 276.129 1.00 48.84  ? -28 DT  J O4    1 
ATOM 10329 C C5    . DT  J 6 56  ? 238.995 287.581 277.401 1.00 48.84  ? -28 DT  J C5    1 
ATOM 10330 C C7    . DT  J 6 56  ? 237.642 288.095 277.773 1.00 48.84  ? -28 DT  J C7    1 
ATOM 10331 C C6    . DT  J 6 56  ? 240.119 288.173 277.822 1.00 48.84  ? -28 DT  J C6    1 
ATOM 10332 P P     . DC  J 6 57  ? 245.486 291.618 278.150 1.00 47.41  ? -27 DC  J P     1 
ATOM 10333 O OP1   . DC  J 6 57  ? 246.720 291.841 278.928 1.00 47.41  ? -27 DC  J OP1   1 
ATOM 10334 O OP2   . DC  J 6 57  ? 244.452 292.669 278.055 1.00 47.41  ? -27 DC  J OP2   1 
ATOM 10335 O "O5'" . DC  J 6 57  ? 245.920 291.214 276.676 1.00 47.41  ? -27 DC  J "O5'" 1 
ATOM 10336 C "C5'" . DC  J 6 57  ? 246.188 289.855 276.370 1.00 47.41  ? -27 DC  J "C5'" 1 
ATOM 10337 C "C4'" . DC  J 6 57  ? 245.919 289.585 274.911 1.00 47.41  ? -27 DC  J "C4'" 1 
ATOM 10338 O "O4'" . DC  J 6 57  ? 244.578 289.053 274.753 1.00 47.41  ? -27 DC  J "O4'" 1 
ATOM 10339 C "C3'" . DC  J 6 57  ? 245.967 290.821 274.017 1.00 47.41  ? -27 DC  J "C3'" 1 
ATOM 10340 O "O3'" . DC  J 6 57  ? 246.425 290.451 272.747 1.00 47.41  ? -27 DC  J "O3'" 1 
ATOM 10341 C "C2'" . DC  J 6 57  ? 244.499 291.202 273.951 1.00 47.41  ? -27 DC  J "C2'" 1 
ATOM 10342 C "C1'" . DC  J 6 57  ? 243.917 289.822 273.787 1.00 47.41  ? -27 DC  J "C1'" 1 
ATOM 10343 N N1    . DC  J 6 57  ? 242.467 289.731 274.000 1.00 47.41  ? -27 DC  J N1    1 
ATOM 10344 C C2    . DC  J 6 57  ? 241.784 288.649 273.473 1.00 47.41  ? -27 DC  J C2    1 
ATOM 10345 O O2    . DC  J 6 57  ? 242.421 287.796 272.860 1.00 47.41  ? -27 DC  J O2    1 
ATOM 10346 N N3    . DC  J 6 57  ? 240.454 288.561 273.652 1.00 47.41  ? -27 DC  J N3    1 
ATOM 10347 C C4    . DC  J 6 57  ? 239.814 289.507 274.327 1.00 47.41  ? -27 DC  J C4    1 
ATOM 10348 N N4    . DC  J 6 57  ? 238.495 289.379 274.483 1.00 47.41  ? -27 DC  J N4    1 
ATOM 10349 C C5    . DC  J 6 57  ? 240.494 290.630 274.867 1.00 47.41  ? -27 DC  J C5    1 
ATOM 10350 C C6    . DC  J 6 57  ? 241.812 290.702 274.678 1.00 47.41  ? -27 DC  J C6    1 
ATOM 10351 P P     . DT  J 6 58  ? 247.966 290.609 272.347 1.00 45.38  ? -26 DT  J P     1 
ATOM 10352 O OP1   . DT  J 6 58  ? 248.783 290.336 273.544 1.00 45.38  ? -26 DT  J OP1   1 
ATOM 10353 O OP2   . DT  J 6 58  ? 248.099 291.887 271.624 1.00 45.38  ? -26 DT  J OP2   1 
ATOM 10354 O "O5'" . DT  J 6 58  ? 248.189 289.429 271.301 1.00 45.38  ? -26 DT  J "O5'" 1 
ATOM 10355 C "C5'" . DT  J 6 58  ? 248.030 288.091 271.725 1.00 45.38  ? -26 DT  J "C5'" 1 
ATOM 10356 C "C4'" . DT  J 6 58  ? 247.502 287.204 270.612 1.00 45.38  ? -26 DT  J "C4'" 1 
ATOM 10357 O "O4'" . DT  J 6 58  ? 246.057 287.261 270.560 1.00 45.38  ? -26 DT  J "O4'" 1 
ATOM 10358 C "C3'" . DT  J 6 58  ? 247.976 287.534 269.212 1.00 45.38  ? -26 DT  J "C3'" 1 
ATOM 10359 O "O3'" . DT  J 6 58  ? 248.087 286.328 268.500 1.00 45.38  ? -26 DT  J "O3'" 1 
ATOM 10360 C "C2'" . DT  J 6 58  ? 246.835 288.401 268.676 1.00 45.38  ? -26 DT  J "C2'" 1 
ATOM 10361 C "C1'" . DT  J 6 58  ? 245.632 287.709 269.289 1.00 45.38  ? -26 DT  J "C1'" 1 
ATOM 10362 N N1    . DT  J 6 58  ? 244.454 288.578 269.520 1.00 45.38  ? -26 DT  J N1    1 
ATOM 10363 C C2    . DT  J 6 58  ? 243.201 288.046 269.373 1.00 45.38  ? -26 DT  J C2    1 
ATOM 10364 O O2    . DT  J 6 58  ? 243.001 286.907 269.016 1.00 45.38  ? -26 DT  J O2    1 
ATOM 10365 N N3    . DT  J 6 58  ? 242.183 288.899 269.655 1.00 45.38  ? -26 DT  J N3    1 
ATOM 10366 C C4    . DT  J 6 58  ? 242.285 290.201 270.076 1.00 45.38  ? -26 DT  J C4    1 
ATOM 10367 O O4    . DT  J 6 58  ? 241.306 290.887 270.300 1.00 45.38  ? -26 DT  J O4    1 
ATOM 10368 C C5    . DT  J 6 58  ? 243.620 290.697 270.226 1.00 45.38  ? -26 DT  J C5    1 
ATOM 10369 C C7    . DT  J 6 58  ? 243.845 292.106 270.667 1.00 45.38  ? -26 DT  J C7    1 
ATOM 10370 C C6    . DT  J 6 58  ? 244.634 289.869 269.954 1.00 45.38  ? -26 DT  J C6    1 
ATOM 10371 P P     . DA  J 6 59  ? 248.987 286.221 267.182 1.00 43.75  ? -25 DA  J P     1 
ATOM 10372 O OP1   . DA  J 6 59  ? 249.773 284.982 267.300 1.00 43.75  ? -25 DA  J OP1   1 
ATOM 10373 O OP2   . DA  J 6 59  ? 249.664 287.516 266.963 1.00 43.75  ? -25 DA  J OP2   1 
ATOM 10374 O "O5'" . DA  J 6 59  ? 247.910 285.998 266.036 1.00 43.75  ? -25 DA  J "O5'" 1 
ATOM 10375 C "C5'" . DA  J 6 59  ? 246.931 284.990 266.195 1.00 43.75  ? -25 DA  J "C5'" 1 
ATOM 10376 C "C4'" . DA  J 6 59  ? 245.701 285.299 265.377 1.00 43.75  ? -25 DA  J "C4'" 1 
ATOM 10377 O "O4'" . DA  J 6 59  ? 244.967 286.389 265.991 1.00 43.75  ? -25 DA  J "O4'" 1 
ATOM 10378 C "C3'" . DA  J 6 59  ? 245.979 285.749 263.941 1.00 43.75  ? -25 DA  J "C3'" 1 
ATOM 10379 O "O3'" . DA  J 6 59  ? 244.998 285.214 263.089 1.00 43.75  ? -25 DA  J "O3'" 1 
ATOM 10380 C "C2'" . DA  J 6 59  ? 245.825 287.252 264.041 1.00 43.75  ? -25 DA  J "C2'" 1 
ATOM 10381 C "C1'" . DA  J 6 59  ? 244.648 287.303 264.982 1.00 43.75  ? -25 DA  J "C1'" 1 
ATOM 10382 N N9    . DA  J 6 59  ? 244.397 288.610 265.551 1.00 43.75  ? -25 DA  J N9    1 
ATOM 10383 C C8    . DA  J 6 59  ? 245.302 289.591 265.800 1.00 43.75  ? -25 DA  J C8    1 
ATOM 10384 N N7    . DA  J 6 59  ? 244.771 290.678 266.289 1.00 43.75  ? -25 DA  J N7    1 
ATOM 10385 C C5    . DA  J 6 59  ? 243.426 290.385 266.353 1.00 43.75  ? -25 DA  J C5    1 
ATOM 10386 C C6    . DA  J 6 59  ? 242.320 291.119 266.791 1.00 43.75  ? -25 DA  J C6    1 
ATOM 10387 N N6    . DA  J 6 59  ? 242.409 292.361 267.258 1.00 43.75  ? -25 DA  J N6    1 
ATOM 10388 N N1    . DA  J 6 59  ? 241.113 290.528 266.722 1.00 43.75  ? -25 DA  J N1    1 
ATOM 10389 C C2    . DA  J 6 59  ? 241.035 289.291 266.246 1.00 43.75  ? -25 DA  J C2    1 
ATOM 10390 N N3    . DA  J 6 59  ? 242.004 288.502 265.820 1.00 43.75  ? -25 DA  J N3    1 
ATOM 10391 C C4    . DA  J 6 59  ? 243.184 289.116 265.901 1.00 43.75  ? -25 DA  J C4    1 
ATOM 10392 P P     . DG  J 6 60  ? 245.335 283.974 262.137 1.00 42.67  ? -24 DG  J P     1 
ATOM 10393 O OP1   . DG  J 6 60  ? 245.980 282.944 262.961 1.00 42.67  ? -24 DG  J OP1   1 
ATOM 10394 O OP2   . DG  J 6 60  ? 246.008 284.482 260.932 1.00 42.67  ? -24 DG  J OP2   1 
ATOM 10395 O "O5'" . DG  J 6 60  ? 243.903 283.446 261.702 1.00 42.67  ? -24 DG  J "O5'" 1 
ATOM 10396 C "C5'" . DG  J 6 60  ? 242.884 283.317 262.661 1.00 42.67  ? -24 DG  J "C5'" 1 
ATOM 10397 C "C4'" . DG  J 6 60  ? 241.615 283.989 262.184 1.00 42.67  ? -24 DG  J "C4'" 1 
ATOM 10398 O "O4'" . DG  J 6 60  ? 241.545 285.332 262.712 1.00 42.67  ? -24 DG  J "O4'" 1 
ATOM 10399 C "C3'" . DG  J 6 60  ? 241.477 284.126 260.671 1.00 42.67  ? -24 DG  J "C3'" 1 
ATOM 10400 O "O3'" . DG  J 6 60  ? 240.157 283.824 260.301 1.00 42.67  ? -24 DG  J "O3'" 1 
ATOM 10401 C "C2'" . DG  J 6 60  ? 241.794 285.596 260.430 1.00 42.67  ? -24 DG  J "C2'" 1 
ATOM 10402 C "C1'" . DG  J 6 60  ? 241.219 286.221 261.675 1.00 42.67  ? -24 DG  J "C1'" 1 
ATOM 10403 N N9    . DG  J 6 60  ? 241.790 287.512 262.007 1.00 42.67  ? -24 DG  J N9    1 
ATOM 10404 C C8    . DG  J 6 60  ? 243.104 287.876 261.944 1.00 42.67  ? -24 DG  J C8    1 
ATOM 10405 N N7    . DG  J 6 60  ? 243.320 289.096 262.335 1.00 42.67  ? -24 DG  J N7    1 
ATOM 10406 C C5    . DG  J 6 60  ? 242.067 289.561 262.689 1.00 42.67  ? -24 DG  J C5    1 
ATOM 10407 C C6    . DG  J 6 60  ? 241.672 290.818 263.174 1.00 42.67  ? -24 DG  J C6    1 
ATOM 10408 O O6    . DG  J 6 60  ? 242.375 291.802 263.412 1.00 42.67  ? -24 DG  J O6    1 
ATOM 10409 N N1    . DG  J 6 60  ? 240.306 290.873 263.400 1.00 42.67  ? -24 DG  J N1    1 
ATOM 10410 C C2    . DG  J 6 60  ? 239.436 289.845 263.175 1.00 42.67  ? -24 DG  J C2    1 
ATOM 10411 N N2    . DG  J 6 60  ? 238.151 290.077 263.451 1.00 42.67  ? -24 DG  J N2    1 
ATOM 10412 N N3    . DG  J 6 60  ? 239.796 288.663 262.722 1.00 42.67  ? -24 DG  J N3    1 
ATOM 10413 C C4    . DG  J 6 60  ? 241.120 288.596 262.496 1.00 42.67  ? -24 DG  J C4    1 
ATOM 10414 P P     . DC  J 6 61  ? 239.750 283.666 258.761 1.00 43.81  ? -23 DC  J P     1 
ATOM 10415 O OP1   . DC  J 6 61  ? 239.162 282.336 258.599 1.00 43.81  ? -23 DC  J OP1   1 
ATOM 10416 O OP2   . DC  J 6 61  ? 240.879 284.080 257.913 1.00 43.81  ? -23 DC  J OP2   1 
ATOM 10417 O "O5'" . DC  J 6 61  ? 238.590 284.723 258.582 1.00 43.81  ? -23 DC  J "O5'" 1 
ATOM 10418 C "C5'" . DC  J 6 61  ? 237.636 284.877 259.598 1.00 43.81  ? -23 DC  J "C5'" 1 
ATOM 10419 C "C4'" . DC  J 6 61  ? 236.869 286.161 259.405 1.00 43.81  ? -23 DC  J "C4'" 1 
ATOM 10420 O "O4'" . DC  J 6 61  ? 237.639 287.270 259.924 1.00 43.81  ? -23 DC  J "O4'" 1 
ATOM 10421 C "C3'" . DC  J 6 61  ? 236.551 286.505 257.954 1.00 43.81  ? -23 DC  J "C3'" 1 
ATOM 10422 O "O3'" . DC  J 6 61  ? 235.223 286.950 257.873 1.00 43.81  ? -23 DC  J "O3'" 1 
ATOM 10423 C "C2'" . DC  J 6 61  ? 237.541 287.623 257.635 1.00 43.81  ? -23 DC  J "C2'" 1 
ATOM 10424 C "C1'" . DC  J 6 61  ? 237.661 288.305 258.978 1.00 43.81  ? -23 DC  J "C1'" 1 
ATOM 10425 N N1    . DC  J 6 61  ? 238.916 289.073 259.158 1.00 43.81  ? -23 DC  J N1    1 
ATOM 10426 C C2    . DC  J 6 61  ? 238.856 290.342 259.714 1.00 43.81  ? -23 DC  J C2    1 
ATOM 10427 O O2    . DC  J 6 61  ? 237.760 290.785 260.046 1.00 43.81  ? -23 DC  J O2    1 
ATOM 10428 N N3    . DC  J 6 61  ? 239.995 291.041 259.882 1.00 43.81  ? -23 DC  J N3    1 
ATOM 10429 C C4    . DC  J 6 61  ? 241.155 290.515 259.518 1.00 43.81  ? -23 DC  J C4    1 
ATOM 10430 N N4    . DC  J 6 61  ? 242.253 291.245 259.700 1.00 43.81  ? -23 DC  J N4    1 
ATOM 10431 C C5    . DC  J 6 61  ? 241.241 289.221 258.937 1.00 43.81  ? -23 DC  J C5    1 
ATOM 10432 C C6    . DC  J 6 61  ? 240.105 288.539 258.780 1.00 43.81  ? -23 DC  J C6    1 
ATOM 10433 P P     . DA  J 6 62  ? 234.448 286.982 256.472 1.00 48.47  ? -22 DA  J P     1 
ATOM 10434 O OP1   . DA  J 6 62  ? 233.426 285.919 256.507 1.00 48.47  ? -22 DA  J OP1   1 
ATOM 10435 O OP2   . DA  J 6 62  ? 235.432 287.034 255.375 1