data_6X70
# 
_entry.id   6X70 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6X70         
WWPDB D_1000249477 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6X70 
_pdbx_database_status.recvd_initial_deposition_date   2020-05-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Weaver, T.M.'      1 ? 
'Freudenthal, B.D.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                25494 
_citation.page_last                 25504 
_citation.title                     'Visualizing Rev1 catalyze protein-template DNA synthesis.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.2010484117 
_citation.pdbx_database_id_PubMed   32999062 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Weaver, T.M.'      1 0000-0002-5138-7140 
primary 'Cortez, L.M.'      2 0000-0002-4225-3810 
primary 'Khoang, T.H.'      3 ?                   
primary 'Washington, M.T.'  4 ?                   
primary 'Agarwal, P.K.'     5 0000-0002-3848-9492 
primary 'Freudenthal, B.D.' 6 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6X70 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     62.212 
_cell.length_a_esd                 ? 
_cell.length_b                     73.916 
_cell.length_b_esd                 ? 
_cell.length_c                     117.617 
_cell.length_c_esd                 ? 
_cell.volume                       540857.328 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6X70 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*GP*GP*GP*TP*GP*TP*GP*GP*TP*AP*G)-3')
;
3814.474  1   ?       ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*CP*GP*CP*TP*AP*CP*CP*AP*CP*AP*CP*CP*CP*C)-3')
;
5037.278  1   ?       ? ? ? 
3 polymer     man 'DNA repair protein REV1'                                           50320.887 1   2.7.7.- ? ? ? 
4 non-polymer nat 'MAGNESIUM ION'                                                     24.305    1   ?       ? ? ? 
5 water       nat water                                                               18.015    463 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Reversionless protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DG)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DT)(DA)(DG)' GGGGTGTGGTAG P ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DC)(DG)(DC)(DT)(DA)(DC)(DC)(DA)(DC)(DA)(DC)(DC)(DC)(DC)' CATCGCTACCACACCCC T ? 
3 'polypeptide(L)'        no no 
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDVGPDNNQLK
;
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDVGPDNNQLK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DT  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DG  n 
1 10  DT  n 
1 11  DA  n 
1 12  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DC  n 
2 5   DG  n 
2 6   DC  n 
2 7   DT  n 
2 8   DA  n 
2 9   DC  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
2 14  DC  n 
2 15  DC  n 
2 16  DC  n 
2 17  DC  n 
3 1   LYS n 
3 2   ARG n 
3 3   ILE n 
3 4   VAL n 
3 5   ALA n 
3 6   CYS n 
3 7   ASP n 
3 8   ASP n 
3 9   PRO n 
3 10  ASP n 
3 11  PHE n 
3 12  LEU n 
3 13  THR n 
3 14  SER n 
3 15  TYR n 
3 16  PHE n 
3 17  ALA n 
3 18  HIS n 
3 19  SER n 
3 20  ARG n 
3 21  LEU n 
3 22  HIS n 
3 23  HIS n 
3 24  LEU n 
3 25  SER n 
3 26  ALA n 
3 27  TRP n 
3 28  LYS n 
3 29  ALA n 
3 30  ASN n 
3 31  LEU n 
3 32  LYS n 
3 33  ASP n 
3 34  LYS n 
3 35  PHE n 
3 36  LEU n 
3 37  ASN n 
3 38  GLU n 
3 39  ASN n 
3 40  ILE n 
3 41  HIS n 
3 42  LYS n 
3 43  TYR n 
3 44  THR n 
3 45  LYS n 
3 46  ILE n 
3 47  THR n 
3 48  ASP n 
3 49  LYS n 
3 50  ASP n 
3 51  THR n 
3 52  TYR n 
3 53  ILE n 
3 54  ILE n 
3 55  PHE n 
3 56  HIS n 
3 57  ILE n 
3 58  ASP n 
3 59  PHE n 
3 60  ASP n 
3 61  CYS n 
3 62  PHE n 
3 63  PHE n 
3 64  ALA n 
3 65  THR n 
3 66  VAL n 
3 67  ALA n 
3 68  TYR n 
3 69  LEU n 
3 70  CYS n 
3 71  ARG n 
3 72  SER n 
3 73  SER n 
3 74  SER n 
3 75  PHE n 
3 76  SER n 
3 77  ALA n 
3 78  CYS n 
3 79  ASP n 
3 80  PHE n 
3 81  LYS n 
3 82  ARG n 
3 83  ASP n 
3 84  PRO n 
3 85  ILE n 
3 86  VAL n 
3 87  VAL n 
3 88  CYS n 
3 89  HIS n 
3 90  GLY n 
3 91  THR n 
3 92  LYS n 
3 93  ASN n 
3 94  SER n 
3 95  ASP n 
3 96  ILE n 
3 97  ALA n 
3 98  SER n 
3 99  CYS n 
3 100 ASN n 
3 101 TYR n 
3 102 VAL n 
3 103 ALA n 
3 104 ARG n 
3 105 SER n 
3 106 TYR n 
3 107 GLY n 
3 108 ILE n 
3 109 LYS n 
3 110 ASN n 
3 111 GLY n 
3 112 MET n 
3 113 TRP n 
3 114 VAL n 
3 115 SER n 
3 116 GLN n 
3 117 ALA n 
3 118 GLU n 
3 119 LYS n 
3 120 MET n 
3 121 LEU n 
3 122 PRO n 
3 123 ASN n 
3 124 GLY n 
3 125 ILE n 
3 126 LYS n 
3 127 LEU n 
3 128 ILE n 
3 129 SER n 
3 130 LEU n 
3 131 PRO n 
3 132 TYR n 
3 133 THR n 
3 134 PHE n 
3 135 GLU n 
3 136 GLN n 
3 137 PHE n 
3 138 GLN n 
3 139 LEU n 
3 140 LYS n 
3 141 SER n 
3 142 GLU n 
3 143 ALA n 
3 144 PHE n 
3 145 TYR n 
3 146 SER n 
3 147 THR n 
3 148 LEU n 
3 149 LYS n 
3 150 ARG n 
3 151 LEU n 
3 152 ASN n 
3 153 ILE n 
3 154 PHE n 
3 155 ASN n 
3 156 LEU n 
3 157 ILE n 
3 158 LEU n 
3 159 PRO n 
3 160 ILE n 
3 161 SER n 
3 162 ILE n 
3 163 ASP n 
3 164 GLU n 
3 165 ALA n 
3 166 VAL n 
3 167 CYS n 
3 168 VAL n 
3 169 ARG n 
3 170 ILE n 
3 171 ILE n 
3 172 PRO n 
3 173 ASP n 
3 174 ASN n 
3 175 ILE n 
3 176 HIS n 
3 177 ASN n 
3 178 THR n 
3 179 ASN n 
3 180 THR n 
3 181 LEU n 
3 182 ASN n 
3 183 ALA n 
3 184 ARG n 
3 185 LEU n 
3 186 CYS n 
3 187 GLU n 
3 188 GLU n 
3 189 ILE n 
3 190 ARG n 
3 191 GLN n 
3 192 GLU n 
3 193 ILE n 
3 194 PHE n 
3 195 GLN n 
3 196 GLY n 
3 197 THR n 
3 198 ASN n 
3 199 GLY n 
3 200 CYS n 
3 201 THR n 
3 202 VAL n 
3 203 SER n 
3 204 ILE n 
3 205 GLY n 
3 206 CYS n 
3 207 SER n 
3 208 ASP n 
3 209 SER n 
3 210 LEU n 
3 211 VAL n 
3 212 LEU n 
3 213 ALA n 
3 214 ARG n 
3 215 LEU n 
3 216 ALA n 
3 217 LEU n 
3 218 LYS n 
3 219 MET n 
3 220 ALA n 
3 221 LYS n 
3 222 PRO n 
3 223 ASN n 
3 224 GLY n 
3 225 TYR n 
3 226 ASN n 
3 227 ILE n 
3 228 THR n 
3 229 PHE n 
3 230 LYS n 
3 231 SER n 
3 232 ASN n 
3 233 LEU n 
3 234 SER n 
3 235 GLU n 
3 236 GLU n 
3 237 PHE n 
3 238 TRP n 
3 239 SER n 
3 240 SER n 
3 241 PHE n 
3 242 LYS n 
3 243 LEU n 
3 244 ASP n 
3 245 ASP n 
3 246 LEU n 
3 247 PRO n 
3 248 GLY n 
3 249 VAL n 
3 250 GLY n 
3 251 HIS n 
3 252 SER n 
3 253 THR n 
3 254 LEU n 
3 255 SER n 
3 256 ARG n 
3 257 LEU n 
3 258 GLU n 
3 259 SER n 
3 260 THR n 
3 261 PHE n 
3 262 ASP n 
3 263 SER n 
3 264 PRO n 
3 265 HIS n 
3 266 SER n 
3 267 LEU n 
3 268 ASN n 
3 269 ASP n 
3 270 LEU n 
3 271 ARG n 
3 272 LYS n 
3 273 ARG n 
3 274 TYR n 
3 275 THR n 
3 276 LEU n 
3 277 ASP n 
3 278 ALA n 
3 279 LEU n 
3 280 LYS n 
3 281 ALA n 
3 282 SER n 
3 283 VAL n 
3 284 GLY n 
3 285 SER n 
3 286 LYS n 
3 287 LEU n 
3 288 GLY n 
3 289 MET n 
3 290 LYS n 
3 291 ILE n 
3 292 HIS n 
3 293 LEU n 
3 294 ALA n 
3 295 LEU n 
3 296 GLN n 
3 297 GLY n 
3 298 GLN n 
3 299 ASP n 
3 300 ASP n 
3 301 GLU n 
3 302 GLU n 
3 303 SER n 
3 304 LEU n 
3 305 LYS n 
3 306 ILE n 
3 307 LEU n 
3 308 TYR n 
3 309 ASP n 
3 310 PRO n 
3 311 LYS n 
3 312 GLU n 
3 313 VAL n 
3 314 LEU n 
3 315 GLN n 
3 316 ARG n 
3 317 LYS n 
3 318 SER n 
3 319 LEU n 
3 320 SER n 
3 321 ILE n 
3 322 ASP n 
3 323 ILE n 
3 324 ASN n 
3 325 TRP n 
3 326 GLY n 
3 327 ILE n 
3 328 ARG n 
3 329 PHE n 
3 330 LYS n 
3 331 ASN n 
3 332 ILE n 
3 333 THR n 
3 334 GLN n 
3 335 VAL n 
3 336 ASP n 
3 337 LEU n 
3 338 PHE n 
3 339 ILE n 
3 340 GLU n 
3 341 ARG n 
3 342 GLY n 
3 343 CYS n 
3 344 GLN n 
3 345 TYR n 
3 346 LEU n 
3 347 LEU n 
3 348 GLU n 
3 349 LYS n 
3 350 LEU n 
3 351 ASN n 
3 352 GLU n 
3 353 ILE n 
3 354 ASN n 
3 355 LYS n 
3 356 THR n 
3 357 THR n 
3 358 SER n 
3 359 GLN n 
3 360 ILE n 
3 361 THR n 
3 362 LEU n 
3 363 LYS n 
3 364 LEU n 
3 365 MET n 
3 366 ARG n 
3 367 ARG n 
3 368 CYS n 
3 369 LYS n 
3 370 ASP n 
3 371 ALA n 
3 372 PRO n 
3 373 ILE n 
3 374 GLU n 
3 375 PRO n 
3 376 PRO n 
3 377 LYS n 
3 378 TYR n 
3 379 MET n 
3 380 GLY n 
3 381 MET n 
3 382 GLY n 
3 383 ARG n 
3 384 CYS n 
3 385 ASP n 
3 386 SER n 
3 387 PHE n 
3 388 SER n 
3 389 ARG n 
3 390 SER n 
3 391 SER n 
3 392 ARG n 
3 393 LEU n 
3 394 GLY n 
3 395 ILE n 
3 396 PRO n 
3 397 THR n 
3 398 ASN n 
3 399 GLU n 
3 400 PHE n 
3 401 GLY n 
3 402 ILE n 
3 403 ILE n 
3 404 ALA n 
3 405 THR n 
3 406 GLU n 
3 407 MET n 
3 408 LYS n 
3 409 SER n 
3 410 LEU n 
3 411 TYR n 
3 412 ARG n 
3 413 THR n 
3 414 LEU n 
3 415 GLY n 
3 416 CYS n 
3 417 PRO n 
3 418 PRO n 
3 419 MET n 
3 420 GLU n 
3 421 LEU n 
3 422 ARG n 
3 423 GLY n 
3 424 LEU n 
3 425 ALA n 
3 426 LEU n 
3 427 GLN n 
3 428 PHE n 
3 429 ASN n 
3 430 LYS n 
3 431 LEU n 
3 432 VAL n 
3 433 ASP n 
3 434 VAL n 
3 435 GLY n 
3 436 PRO n 
3 437 ASP n 
3 438 ASN n 
3 439 ASN n 
3 440 GLN n 
3 441 LEU n 
3 442 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   442 
_entity_src_gen.gene_src_common_name               
;Baker's yeast
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'REV1, YOR346W, O6339' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 12 'synthetic construct' ? 32630 ? 
2 1 sample 1 17 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6X70       6X70   ? 1 ? 1   
2 PDB 6X70       6X70   ? 2 ? 1   
3 UNP REV1_YEAST P12689 ? 3 
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDVGPDNNQLK
;
305 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6X70 P 1 ? 12  ? 6X70   1   ? 12  ? 1   12  
2 2 6X70 T 1 ? 17  ? 6X70   1   ? 17  ? 1   17  
3 3 6X70 A 1 ? 442 ? P12689 305 ? 746 ? 305 746 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6X70 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.30 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15-23% PEG3350 and 200 mM ammonium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 R 200K-A' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-04-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            21.69 
_reflns.entry_id                         6X70 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.05 
_reflns.d_resolution_low                 25 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60116 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.1 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.147 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.05 
_reflns_shell.d_res_low                   2.4069 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           24230 
_reflns_shell.percent_possible_all        97 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.473 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.644 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               26.15 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6X70 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.05 
_refine.ls_d_res_low                             22.49 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     60116 
_refine.ls_number_reflns_R_free                  3562 
_refine.ls_number_reflns_R_work                  56554 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.10 
_refine.ls_percent_reflns_R_free                 5.93 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2130 
_refine.ls_R_factor_R_free                       0.2614 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2099 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5WM1 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.1073 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2642 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        22.49 
_refine_hist.number_atoms_solvent             463 
_refine_hist.number_atoms_total               4491 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        3455 
_refine_hist.pdbx_number_atoms_nucleic_acid   572 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0082  ? 4209 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9517  ? 5818 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0550  ? 654  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0059  ? 651  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 21.0448 ? 1614 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.05 2.08  . . 149 2286 91.34 . . . 0.2745 . 0.2692 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.08 2.10  . . 142 2384 96.38 . . . 0.3281 . 0.2514 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.10 2.14  . . 149 2419 96.61 . . . 0.2853 . 0.2531 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.14 2.17  . . 156 2374 96.56 . . . 0.3123 . 0.2563 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.17 2.21  . . 151 2387 96.14 . . . 0.3605 . 0.2406 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.21 2.24  . . 144 2385 95.87 . . . 0.3294 . 0.2319 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.24 2.28  . . 147 2365 95.59 . . . 0.2628 . 0.2456 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.28 2.33  . . 150 2368 95.31 . . . 0.2651 . 0.2271 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.33 2.38  . . 153 2391 95.17 . . . 0.3099 . 0.2342 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.38 2.43  . . 147 2291 94.28 . . . 0.2996 . 0.2427 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.43 2.48  . . 157 2375 93.85 . . . 0.2825 . 0.2497 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.48 2.55  . . 145 2291 92.87 . . . 0.3183 . 0.2462 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.55 2.61  . . 144 2297 92.67 . . . 0.3245 . 0.2450 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.61 2.69  . . 145 2246 91.36 . . . 0.3038 . 0.2471 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.69 2.78  . . 133 2192 88.10 . . . 0.3685 . 0.2577 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.78 2.88  . . 126 2092 84.30 . . . 0.3273 . 0.2854 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.88 2.99  . . 137 2095 84.64 . . . 0.4395 . 0.3311 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.99 3.13  . . 143 2181 87.60 . . . 0.2978 . 0.2512 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.13 3.29  . . 136 2262 90.56 . . . 0.2672 . 0.2056 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.29 3.50  . . 136 2217 89.20 . . . 0.2530 . 0.1853 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.50 3.77  . . 135 2149 87.11 . . . 0.2263 . 0.1654 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.77 4.14  . . 135 2152 86.11 . . . 0.1785 . 0.1648 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.14 4.74  . . 131 2077 83.57 . . . 0.1908 . 0.1599 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.74 5.95  . . 129 2097 84.93 . . . 0.2128 . 0.1664 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.95 22.49 . . 142 2181 87.66 . . . 0.1639 . 0.1513 . . . . . . . . . . . 
# 
_struct.entry_id                     6X70 
_struct.title                        'Rev1-DNA Binary Complex' 
_struct.pdbx_descriptor              'DNA repair protein REV1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6X70 
_struct_keywords.text            'DNA polymerase, REPLICATION, REPLICATION-DNA complex' 
_struct_keywords.pdbx_keywords   REPLICATION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP C 10  ? SER C 19  ? ASP A 314 SER A 323 1 ? 10 
HELX_P HELX_P2  AA2 SER C 19  ? ASN C 39  ? SER A 323 ASN A 343 1 ? 21 
HELX_P HELX_P3  AA3 CYS C 61  ? CYS C 70  ? CYS A 365 CYS A 374 1 ? 10 
HELX_P HELX_P4  AA4 SER C 72  ? SER C 76  ? SER A 376 SER A 380 5 ? 5  
HELX_P HELX_P5  AA5 ASN C 100 ? SER C 105 ? ASN A 404 SER A 409 1 ? 6  
HELX_P HELX_P6  AA6 TRP C 113 ? MET C 120 ? TRP A 417 MET A 424 1 ? 8  
HELX_P HELX_P7  AA7 THR C 133 ? LEU C 151 ? THR A 437 LEU A 455 1 ? 19 
HELX_P HELX_P8  AA8 THR C 178 ? THR C 197 ? THR A 482 THR A 501 1 ? 20 
HELX_P HELX_P9  AA9 SER C 209 ? LYS C 221 ? SER A 513 LYS A 525 1 ? 13 
HELX_P HELX_P10 AB1 PHE C 229 ? LEU C 233 ? PHE A 533 LEU A 537 5 ? 5  
HELX_P HELX_P11 AB2 SER C 234 ? SER C 239 ? SER A 538 SER A 543 1 ? 6  
HELX_P HELX_P12 AB3 SER C 240 ? PHE C 241 ? SER A 544 PHE A 545 5 ? 2  
HELX_P HELX_P13 AB4 LYS C 242 ? LEU C 246 ? LYS A 546 LEU A 550 5 ? 5  
HELX_P HELX_P14 AB5 GLY C 250 ? PHE C 261 ? GLY A 554 PHE A 565 1 ? 12 
HELX_P HELX_P15 AB6 SER C 266 ? TYR C 274 ? SER A 570 TYR A 578 1 ? 9  
HELX_P HELX_P16 AB7 THR C 275 ? GLY C 284 ? THR A 579 GLY A 588 1 ? 10 
HELX_P HELX_P17 AB8 GLY C 284 ? GLN C 296 ? GLY A 588 GLN A 600 1 ? 13 
HELX_P HELX_P18 AB9 ASP C 300 ? ASP C 309 ? ASP A 604 ASP A 613 1 ? 10 
HELX_P HELX_P19 AC1 ASP C 309 ? GLN C 315 ? ASP A 613 GLN A 619 1 ? 7  
HELX_P HELX_P20 AC2 ASN C 331 ? ILE C 353 ? ASN A 635 ILE A 657 1 ? 23 
HELX_P HELX_P21 AC3 GLU C 399 ? GLY C 415 ? GLU A 703 GLY A 719 1 ? 17 
HELX_P HELX_P22 AC4 PRO C 417 ? MET C 419 ? PRO A 721 MET A 723 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A DA 11 OP1 ? ? ? 1_555 D MG  .   MG ? ? P DA 11  P MG  801 1_555 ? ? ? ? ? ? ?            2.616 ? ? 
metalc2  metalc ? ? D MG .  MG  ? ? ? 1_555 E HOH .   O  ? ? P MG 801 P HOH 916 1_555 ? ? ? ? ? ? ?            2.132 ? ? 
metalc3  metalc ? ? D MG .  MG  ? ? ? 1_555 C ASP 244 O  ? ? P MG 801 A ASP 548 1_555 ? ? ? ? ? ? ?            2.378 ? ? 
metalc4  metalc ? ? D MG .  MG  ? ? ? 1_555 C VAL 249 O  ? ? P MG 801 A VAL 553 1_555 ? ? ? ? ? ? ?            2.419 ? ? 
metalc5  metalc ? ? D MG .  MG  ? ? ? 1_555 G HOH .   O  ? ? P MG 801 A HOH 907 1_555 ? ? ? ? ? ? ?            2.147 ? ? 
hydrog1  hydrog ? ? A DG 1  N1  ? ? ? 1_555 B DC  17  N3 ? ? P DG 1   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? A DG 1  N2  ? ? ? 1_555 B DC  17  O2 ? ? P DG 1   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? A DG 1  O6  ? ? ? 1_555 B DC  17  N4 ? ? P DG 1   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? A DG 2  N1  ? ? ? 1_555 B DC  16  N3 ? ? P DG 2   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? A DG 2  N2  ? ? ? 1_555 B DC  16  O2 ? ? P DG 2   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? A DG 2  O6  ? ? ? 1_555 B DC  16  N4 ? ? P DG 2   T DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? A DG 3  N1  ? ? ? 1_555 B DC  15  N3 ? ? P DG 3   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? A DG 3  N2  ? ? ? 1_555 B DC  15  O2 ? ? P DG 3   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? A DG 3  O6  ? ? ? 1_555 B DC  15  N4 ? ? P DG 3   T DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? A DG 4  N1  ? ? ? 1_555 B DC  14  N3 ? ? P DG 4   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? A DG 4  N2  ? ? ? 1_555 B DC  14  O2 ? ? P DG 4   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? A DG 4  O6  ? ? ? 1_555 B DC  14  N4 ? ? P DG 4   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? A DT 5  N3  ? ? ? 1_555 B DA  13  N1 ? ? P DT 5   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? A DT 5  O4  ? ? ? 1_555 B DA  13  N6 ? ? P DT 5   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? A DG 6  N1  ? ? ? 1_555 B DC  12  N3 ? ? P DG 6   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? A DG 6  N2  ? ? ? 1_555 B DC  12  O2 ? ? P DG 6   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? A DG 6  O6  ? ? ? 1_555 B DC  12  N4 ? ? P DG 6   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? A DT 7  N3  ? ? ? 1_555 B DA  11  N1 ? ? P DT 7   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? A DT 7  O4  ? ? ? 1_555 B DA  11  N6 ? ? P DT 7   T DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? A DG 8  N1  ? ? ? 1_555 B DC  10  N3 ? ? P DG 8   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? A DG 8  N2  ? ? ? 1_555 B DC  10  O2 ? ? P DG 8   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? A DG 8  O6  ? ? ? 1_555 B DC  10  N4 ? ? P DG 8   T DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? A DG 9  N1  ? ? ? 1_555 B DC  9   N3 ? ? P DG 9   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? A DG 9  N2  ? ? ? 1_555 B DC  9   O2 ? ? P DG 9   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? A DG 9  O6  ? ? ? 1_555 B DC  9   N4 ? ? P DG 9   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? A DT 10 N3  ? ? ? 1_555 B DA  8   N1 ? ? P DT 10  T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? A DT 10 O4  ? ? ? 1_555 B DA  8   N6 ? ? P DT 10  T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? A DA 11 N1  ? ? ? 1_555 B DT  7   N3 ? ? P DA 11  T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? A DA 11 N6  ? ? ? 1_555 B DT  7   O4 ? ? P DA 11  T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? A DG 12 N1  ? ? ? 1_555 B DC  6   N3 ? ? P DG 12  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ? ? A DG 12 N2  ? ? ? 1_555 B DC  6   O2 ? ? P DG 12  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ? ? A DG 12 O6  ? ? ? 1_555 B DC  6   N4 ? ? P DG 12  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           221 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            525 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    222 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     526 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU C 156 ? SER C 161 ? LEU A 460 SER A 465 
AA1 2 GLU C 164 ? ILE C 171 ? GLU A 468 ILE A 475 
AA1 3 THR C 51  ? PHE C 59  ? THR A 355 PHE A 363 
AA1 4 VAL C 202 ? SER C 207 ? VAL A 506 SER A 511 
AA1 5 TYR C 225 ? ILE C 227 ? TYR A 529 ILE A 531 
AA2 1 SER C 98  ? CYS C 99  ? SER A 402 CYS A 403 
AA2 2 ILE C 85  ? VAL C 87  ? ILE A 389 VAL A 391 
AA2 3 ILE C 128 ? LEU C 130 ? ILE A 432 LEU A 434 
AA3 1 LEU C 319 ? ILE C 323 ? LEU A 623 ILE A 627 
AA3 2 LEU C 421 ? ASP C 433 ? LEU A 725 ASP A 737 
AA3 3 LYS C 355 ? ARG C 367 ? LYS A 659 ARG A 671 
AA3 4 CYS C 384 ? THR C 397 ? CYS A 688 THR A 701 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU C 156 ? N LEU A 460 O VAL C 168 ? O VAL A 472 
AA1 2 3 O CYS C 167 ? O CYS A 471 N PHE C 55  ? N PHE A 359 
AA1 3 4 N HIS C 56  ? N HIS A 360 O GLY C 205 ? O GLY A 509 
AA1 4 5 N ILE C 204 ? N ILE A 508 O ASN C 226 ? O ASN A 530 
AA2 1 2 O SER C 98  ? O SER A 402 N VAL C 87  ? N VAL A 391 
AA2 2 3 N VAL C 86  ? N VAL A 390 O LEU C 130 ? O LEU A 434 
AA3 1 2 N LEU C 319 ? N LEU A 623 O PHE C 428 ? O PHE A 732 
AA3 2 3 O ALA C 425 ? O ALA A 729 N LYS C 363 ? N LYS A 667 
AA3 3 4 N SER C 358 ? N SER A 662 O LEU C 393 ? O LEU A 697 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    P 
_struct_site.pdbx_auth_comp_id    MG 
_struct_site.pdbx_auth_seq_id     801 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue MG P 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ASP C 244 ? ASP A 548 . ? 1_555 ? 
2 AC1 6 LEU C 246 ? LEU A 550 . ? 1_555 ? 
3 AC1 6 VAL C 249 ? VAL A 553 . ? 1_555 ? 
4 AC1 6 HOH G .   ? HOH A 907 . ? 1_555 ? 
5 AC1 6 DA  A 11  ? DA  P 11  . ? 1_555 ? 
6 AC1 6 HOH E .   ? HOH P 916 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6X70 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.016074 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013529 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008502 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153 2.53737 ? ? 2.59044  63.03566 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882 3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 13.12900  69.17700  39.58700  1.000 52.69798 ? 1    DG  P "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 12.70300  69.89100  40.73100  1.000 57.76071 ? 1    DG  P "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 13.51500  71.15600  40.90200  1.000 58.67833 ? 1    DG  P "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 14.82600  70.81700  41.42100  1.000 53.69224 ? 1    DG  P "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 13.80600  71.91500  39.61300  1.000 60.30076 ? 1    DG  P "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 12.72900  72.78400  39.27500  1.000 61.29683 ? 1    DG  P "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 15.05600  72.68600  40.00300  1.000 47.30670 ? 1    DG  P "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 15.80900  71.60500  40.76500  1.000 47.61147 ? 1    DG  P "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 16.60600  70.74500  39.89300  1.000 46.41581 ? 1    DG  P N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 16.30500  69.47200  39.46500  1.000 44.25151 ? 1    DG  P C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 17.22300  68.95300  38.69000  1.000 41.66905 ? 1    DG  P N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 18.18700  69.95000  38.59200  1.000 33.21570 ? 1    DG  P C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 19.41200  69.96800  37.88600  1.000 34.20267 ? 1    DG  P C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 19.90200  69.07500  37.17900  1.000 35.36450 ? 1    DG  P O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 20.08800  71.17900  38.05700  1.000 33.23807 ? 1    DG  P N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 19.63200  72.23400  38.82500  1.000 38.18025 ? 1    DG  P C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 20.41700  73.31600  38.88600  1.000 30.20370 ? 1    DG  P N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 18.48600  72.22400  39.49100  1.000 36.97266 ? 1    DG  P N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 17.81800  71.05800  39.32500  1.000 40.55072 ? 1    DG  P C4    1 
ATOM   20   P  P     . DG  A 1 2   ? 12.44600  73.14600  37.73100  1.000 50.88018 ? 2    DG  P P     1 
ATOM   21   O  OP1   . DG  A 1 2   ? 11.23900  74.00700  37.70200  1.000 59.20922 ? 2    DG  P OP1   1 
ATOM   22   O  OP2   . DG  A 1 2   ? 12.47500  71.87800  36.96800  1.000 59.77147 ? 2    DG  P OP2   1 
ATOM   23   O  "O5'" . DG  A 1 2   ? 13.73400  74.00400  37.27900  1.000 60.64336 ? 2    DG  P "O5'" 1 
ATOM   24   C  "C5'" . DG  A 1 2   ? 13.86500  75.38100  37.66600  1.000 52.32824 ? 2    DG  P "C5'" 1 
ATOM   25   C  "C4'" . DG  A 1 2   ? 15.28500  75.89200  37.43800  1.000 59.42009 ? 2    DG  P "C4'" 1 
ATOM   26   O  "O4'" . DG  A 1 2   ? 16.24600  74.88500  37.85600  1.000 56.15046 ? 2    DG  P "O4'" 1 
ATOM   27   C  "C3'" . DG  A 1 2   ? 15.65900  76.19000  35.99500  1.000 50.01179 ? 2    DG  P "C3'" 1 
ATOM   28   O  "O3'" . DG  A 1 2   ? 15.21300  77.48600  35.62100  1.000 63.85655 ? 2    DG  P "O3'" 1 
ATOM   29   C  "C2'" . DG  A 1 2   ? 17.17700  76.13100  36.06600  1.000 52.27105 ? 2    DG  P "C2'" 1 
ATOM   30   C  "C1'" . DG  A 1 2   ? 17.39500  74.96000  37.02900  1.000 51.21872 ? 2    DG  P "C1'" 1 
ATOM   31   N  N9    . DG  A 1 2   ? 17.57200  73.68000  36.35100  1.000 44.06801 ? 2    DG  P N9    1 
ATOM   32   C  C8    . DG  A 1 2   ? 16.65200  72.66300  36.22700  1.000 43.14154 ? 2    DG  P C8    1 
ATOM   33   N  N7    . DG  A 1 2   ? 17.10400  71.63500  35.55400  1.000 40.59063 ? 2    DG  P N7    1 
ATOM   34   C  C5    . DG  A 1 2   ? 18.40400  71.99700  35.21600  1.000 39.62838 ? 2    DG  P C5    1 
ATOM   35   C  C6    . DG  A 1 2   ? 19.39400  71.28900  34.48700  1.000 32.17816 ? 2    DG  P C6    1 
ATOM   36   O  O6    . DG  A 1 2   ? 19.32100  70.16300  33.98600  1.000 38.22158 ? 2    DG  P O6    1 
ATOM   37   N  N1    . DG  A 1 2   ? 20.56800  72.02300  34.36700  1.000 32.38900 ? 2    DG  P N1    1 
ATOM   38   C  C2    . DG  A 1 2   ? 20.77300  73.27700  34.89000  1.000 38.08347 ? 2    DG  P C2    1 
ATOM   39   N  N2    . DG  A 1 2   ? 21.98200  73.82500  34.67600  1.000 36.03455 ? 2    DG  P N2    1 
ATOM   40   N  N3    . DG  A 1 2   ? 19.85500  73.95300  35.57400  1.000 42.94430 ? 2    DG  P N3    1 
ATOM   41   C  C4    . DG  A 1 2   ? 18.70200  73.25200  35.69900  1.000 39.01859 ? 2    DG  P C4    1 
ATOM   42   P  P     . DG  A 1 3   ? 14.86600  77.81700  34.08300  1.000 73.58660 ? 3    DG  P P     1 
ATOM   43   O  OP1   . DG  A 1 3   ? 14.61500  79.27500  34.02500  1.000 76.14033 ? 3    DG  P OP1   1 
ATOM   44   O  OP2   . DG  A 1 3   ? 13.84000  76.87000  33.58200  1.000 62.50171 ? 3    DG  P OP2   1 
ATOM   45   O  "O5'" . DG  A 1 3   ? 16.23400  77.53200  33.30500  1.000 67.46103 ? 3    DG  P "O5'" 1 
ATOM   46   C  "C5'" . DG  A 1 3   ? 17.21200  78.54900  33.24200  1.000 58.86686 ? 3    DG  P "C5'" 1 
ATOM   47   C  "C4'" . DG  A 1 3   ? 18.52700  78.02100  32.71300  1.000 60.94839 ? 3    DG  P "C4'" 1 
ATOM   48   O  "O4'" . DG  A 1 3   ? 18.84300  76.74400  33.31800  1.000 57.28817 ? 3    DG  P "O4'" 1 
ATOM   49   C  "C3'" . DG  A 1 3   ? 18.56600  77.70600  31.23800  1.000 56.49897 ? 3    DG  P "C3'" 1 
ATOM   50   O  "O3'" . DG  A 1 3   ? 18.63000  78.90100  30.46200  1.000 59.86979 ? 3    DG  P "O3'" 1 
ATOM   51   C  "C2'" . DG  A 1 3   ? 19.86600  76.91200  31.18400  1.000 49.78533 ? 3    DG  P "C2'" 1 
ATOM   52   C  "C1'" . DG  A 1 3   ? 19.73600  76.05200  32.45000  1.000 45.37771 ? 3    DG  P "C1'" 1 
ATOM   53   N  N9    . DG  A 1 3   ? 19.20700  74.71800  32.17300  1.000 37.75393 ? 3    DG  P N9    1 
ATOM   54   C  C8    . DG  A 1 3   ? 17.95600  74.22600  32.48600  1.000 44.60426 ? 3    DG  P C8    1 
ATOM   55   N  N7    . DG  A 1 3   ? 17.76700  72.99300  32.09100  1.000 40.25810 ? 3    DG  P N7    1 
ATOM   56   C  C5    . DG  A 1 3   ? 18.96800  72.64600  31.46800  1.000 33.99448 ? 3    DG  P C5    1 
ATOM   57   C  C6    . DG  A 1 3   ? 19.35900  71.43400  30.84700  1.000 29.53621 ? 3    DG  P C6    1 
ATOM   58   O  O6    . DG  A 1 3   ? 18.70500  70.39500  30.71700  1.000 30.61660 ? 3    DG  P O6    1 
ATOM   59   N  N1    . DG  A 1 3   ? 20.65800  71.50600  30.34200  1.000 34.36228 ? 3    DG  P N1    1 
ATOM   60   C  C2    . DG  A 1 3   ? 21.47700  72.61600  30.42200  1.000 36.34408 ? 3    DG  P C2    1 
ATOM   61   N  N2    . DG  A 1 3   ? 22.69700  72.49700  29.87600  1.000 29.07505 ? 3    DG  P N2    1 
ATOM   62   N  N3    . DG  A 1 3   ? 21.12800  73.75700  31.01200  1.000 38.10014 ? 3    DG  P N3    1 
ATOM   63   C  C4    . DG  A 1 3   ? 19.86100  73.69900  31.50900  1.000 39.03985 ? 3    DG  P C4    1 
ATOM   64   P  P     . DG  A 1 4   ? 18.18200  78.88000  28.91400  1.000 52.65342 ? 4    DG  P P     1 
ATOM   65   O  OP1   . DG  A 1 4   ? 18.36900  80.24700  28.37700  1.000 48.64347 ? 4    DG  P OP1   1 
ATOM   66   O  OP2   . DG  A 1 4   ? 16.84400  78.24500  28.80900  1.000 47.22794 ? 4    DG  P OP2   1 
ATOM   67   O  "O5'" . DG  A 1 4   ? 19.27300  77.93400  28.22800  1.000 43.37885 ? 4    DG  P "O5'" 1 
ATOM   68   C  "C5'" . DG  A 1 4   ? 20.61900  78.38200  28.11700  1.000 40.31082 ? 4    DG  P "C5'" 1 
ATOM   69   C  "C4'" . DG  A 1 4   ? 21.51400  77.28600  27.58300  1.000 39.08077 ? 4    DG  P "C4'" 1 
ATOM   70   O  "O4'" . DG  A 1 4   ? 21.28500  76.06700  28.31200  1.000 35.74433 ? 4    DG  P "O4'" 1 
ATOM   71   C  "C3'" . DG  A 1 4   ? 21.27800  76.90500  26.13400  1.000 34.19599 ? 4    DG  P "C3'" 1 
ATOM   72   O  "O3'" . DG  A 1 4   ? 21.96800  77.81900  25.28500  1.000 33.68326 ? 4    DG  P "O3'" 1 
ATOM   73   C  "C2'" . DG  A 1 4   ? 21.89100  75.49800  26.07400  1.000 31.20357 ? 4    DG  P "C2'" 1 
ATOM   74   C  "C1'" . DG  A 1 4   ? 21.66600  74.96600  27.49900  1.000 37.87611 ? 4    DG  P "C1'" 1 
ATOM   75   N  N9    . DG  A 1 4   ? 20.61200  73.96600  27.58100  1.000 35.75309 ? 4    DG  P N9    1 
ATOM   76   C  C8    . DG  A 1 4   ? 19.36100  74.13900  28.11900  1.000 34.43848 ? 4    DG  P C8    1 
ATOM   77   N  N7    . DG  A 1 4   ? 18.61100  73.07700  28.05200  1.000 28.98351 ? 4    DG  P N7    1 
ATOM   78   C  C5    . DG  A 1 4   ? 19.41500  72.14300  27.43300  1.000 30.05205 ? 4    DG  P C5    1 
ATOM   79   C  C6    . DG  A 1 4   ? 19.13300  70.82000  27.11000  1.000 27.16487 ? 4    DG  P C6    1 
ATOM   80   O  O6    . DG  A 1 4   ? 18.08100  70.20300  27.31700  1.000 35.20452 ? 4    DG  P O6    1 
ATOM   81   N  N1    . DG  A 1 4   ? 20.21000  70.20100  26.47600  1.000 31.35334 ? 4    DG  P N1    1 
ATOM   82   C  C2    . DG  A 1 4   ? 21.42500  70.80200  26.21100  1.000 33.19374 ? 4    DG  P C2    1 
ATOM   83   N  N2    . DG  A 1 4   ? 22.33600  70.04100  25.60200  1.000 28.79689 ? 4    DG  P N2    1 
ATOM   84   N  N3    . DG  A 1 4   ? 21.71300  72.06400  26.51800  1.000 31.16867 ? 4    DG  P N3    1 
ATOM   85   C  C4    . DG  A 1 4   ? 20.65600  72.67200  27.12800  1.000 30.43832 ? 4    DG  P C4    1 
ATOM   86   P  P     . DT  A 1 5   ? 21.48000  78.07200  23.77500  1.000 32.11332 ? 5    DT  P P     1 
ATOM   87   O  OP1   . DT  A 1 5   ? 22.21000  79.23600  23.23700  1.000 27.51521 ? 5    DT  P OP1   1 
ATOM   88   O  OP2   . DT  A 1 5   ? 20.00200  78.05500  23.75100  1.000 31.99539 ? 5    DT  P OP2   1 
ATOM   89   O  "O5'" . DT  A 1 5   ? 21.99200  76.77800  23.00500  1.000 31.49709 ? 5    DT  P "O5'" 1 
ATOM   90   C  "C5'" . DT  A 1 5   ? 23.36500  76.43700  23.04700  1.000 30.91792 ? 5    DT  P "C5'" 1 
ATOM   91   C  "C4'" . DT  A 1 5   ? 23.62400  75.26700  22.13400  1.000 28.66103 ? 5    DT  P "C4'" 1 
ATOM   92   O  "O4'" . DT  A 1 5   ? 23.03600  74.07400  22.71300  1.000 28.37100 ? 5    DT  P "O4'" 1 
ATOM   93   C  "C3'" . DT  A 1 5   ? 23.02100  75.43700  20.74700  1.000 30.26901 ? 5    DT  P "C3'" 1 
ATOM   94   O  "O3'" . DT  A 1 5   ? 23.96500  75.14000  19.76700  1.000 26.86564 ? 5    DT  P "O3'" 1 
ATOM   95   C  "C2'" . DT  A 1 5   ? 21.84400  74.46700  20.70900  1.000 30.56556 ? 5    DT  P "C2'" 1 
ATOM   96   C  "C1'" . DT  A 1 5   ? 22.17500  73.44600  21.79200  1.000 31.55380 ? 5    DT  P "C1'" 1 
ATOM   97   N  N1    . DT  A 1 5   ? 20.94000  72.97400  22.52300  1.000 30.78916 ? 5    DT  P N1    1 
ATOM   98   C  C2    . DT  A 1 5   ? 20.60600  71.64100  22.49600  1.000 28.41086 ? 5    DT  P C2    1 
ATOM   99   O  O2    . DT  A 1 5   ? 21.28000  70.80700  21.93900  1.000 30.96477 ? 5    DT  P O2    1 
ATOM   100  N  N3    . DT  A 1 5   ? 19.45800  71.31900  23.16900  1.000 23.61748 ? 5    DT  P N3    1 
ATOM   101  C  C4    . DT  A 1 5   ? 18.62700  72.18200  23.84500  1.000 25.38506 ? 5    DT  P C4    1 
ATOM   102  O  O4    . DT  A 1 5   ? 17.61000  71.79900  24.42200  1.000 32.22274 ? 5    DT  P O4    1 
ATOM   103  C  C5    . DT  A 1 5   ? 19.02300  73.57400  23.81400  1.000 32.22350 ? 5    DT  P C5    1 
ATOM   104  C  C7    . DT  A 1 5   ? 18.19200  74.61500  24.50600  1.000 27.35018 ? 5    DT  P C7    1 
ATOM   105  C  C6    . DT  A 1 5   ? 20.14600  73.89600  23.16400  1.000 28.28064 ? 5    DT  P C6    1 
ATOM   106  P  P     . DG  A 1 6   ? 23.62900  75.39800  18.21600  1.000 31.26771 ? 6    DG  P P     1 
ATOM   107  O  OP1   . DG  A 1 6   ? 24.93500  75.75100  17.59900  1.000 32.33566 ? 6    DG  P OP1   1 
ATOM   108  O  OP2   . DG  A 1 6   ? 22.44500  76.26600  18.06600  1.000 21.88612 ? 6    DG  P OP2   1 
ATOM   109  O  "O5'" . DG  A 1 6   ? 23.22600  73.95300  17.68600  1.000 23.36893 ? 6    DG  P "O5'" 1 
ATOM   110  C  "C5'" . DG  A 1 6   ? 24.22800  72.99500  17.54300  1.000 25.83208 ? 6    DG  P "C5'" 1 
ATOM   111  C  "C4'" . DG  A 1 6   ? 23.64600  71.65500  17.18000  1.000 28.99820 ? 6    DG  P "C4'" 1 
ATOM   112  O  "O4'" . DG  A 1 6   ? 22.62100  71.29700  18.13300  1.000 27.41607 ? 6    DG  P "O4'" 1 
ATOM   113  C  "C3'" . DG  A 1 6   ? 23.00100  71.59300  15.80200  1.000 34.84387 ? 6    DG  P "C3'" 1 
ATOM   114  O  "O3'" . DG  A 1 6   ? 23.40700  70.39400  15.17000  1.000 41.10319 ? 6    DG  P "O3'" 1 
ATOM   115  C  "C2'" . DG  A 1 6   ? 21.49900  71.61800  16.10700  1.000 28.70786 ? 6    DG  P "C2'" 1 
ATOM   116  C  "C1'" . DG  A 1 6   ? 21.45200  70.91300  17.45900  1.000 31.53922 ? 6    DG  P "C1'" 1 
ATOM   117  N  N9    . DG  A 1 6   ? 20.32500  71.29600  18.30200  1.000 29.02333 ? 6    DG  P N9    1 
ATOM   118  C  C8    . DG  A 1 6   ? 20.00300  72.56200  18.72500  1.000 29.16559 ? 6    DG  P C8    1 
ATOM   119  N  N7    . DG  A 1 6   ? 18.94500  72.60000  19.49800  1.000 31.02519 ? 6    DG  P N7    1 
ATOM   120  C  C5    . DG  A 1 6   ? 18.54700  71.26600  19.60600  1.000 31.13706 ? 6    DG  P C5    1 
ATOM   121  C  C6    . DG  A 1 6   ? 17.46300  70.68000  20.31500  1.000 27.62029 ? 6    DG  P C6    1 
ATOM   122  O  O6    . DG  A 1 6   ? 16.60800  71.23700  21.02100  1.000 28.40491 ? 6    DG  P O6    1 
ATOM   123  N  N1    . DG  A 1 6   ? 17.43000  69.29900  20.15600  1.000 24.50319 ? 6    DG  P N1    1 
ATOM   124  C  C2    . DG  A 1 6   ? 18.31800  68.57200  19.40300  1.000 34.22135 ? 6    DG  P C2    1 
ATOM   125  N  N2    . DG  A 1 6   ? 18.11700  67.24200  19.36600  1.000 34.94232 ? 6    DG  P N2    1 
ATOM   126  N  N3    . DG  A 1 6   ? 19.33900  69.10300  18.73900  1.000 33.88275 ? 6    DG  P N3    1 
ATOM   127  C  C4    . DG  A 1 6   ? 19.39100  70.45100  18.88100  1.000 32.94988 ? 6    DG  P C4    1 
ATOM   128  P  P     . DT  A 1 7   ? 23.11100  70.14100  13.61800  1.000 38.81053 ? 7    DT  P P     1 
ATOM   129  O  OP1   . DT  A 1 7   ? 24.23400  69.34100  13.08200  1.000 35.96712 ? 7    DT  P OP1   1 
ATOM   130  O  OP2   . DT  A 1 7   ? 22.74900  71.43700  12.99400  1.000 41.64028 ? 7    DT  P OP2   1 
ATOM   131  O  "O5'" . DT  A 1 7   ? 21.84700  69.19500  13.66900  1.000 36.10772 ? 7    DT  P "O5'" 1 
ATOM   132  C  "C5'" . DT  A 1 7   ? 21.94400  67.96800  14.35200  1.000 35.81360 ? 7    DT  P "C5'" 1 
ATOM   133  C  "C4'" . DT  A 1 7   ? 20.58000  67.33500  14.51300  1.000 38.93885 ? 7    DT  P "C4'" 1 
ATOM   134  O  "O4'" . DT  A 1 7   ? 19.78900  68.11200  15.42300  1.000 36.29121 ? 7    DT  P "O4'" 1 
ATOM   135  C  "C3'" . DT  A 1 7   ? 19.75100  67.22500  13.22500  1.000 44.36335 ? 7    DT  P "C3'" 1 
ATOM   136  O  "O3'" . DT  A 1 7   ? 19.59100  65.84400  12.89300  1.000 43.02065 ? 7    DT  P "O3'" 1 
ATOM   137  C  "C2'" . DT  A 1 7   ? 18.40400  67.90200  13.57300  1.000 37.28503 ? 7    DT  P "C2'" 1 
ATOM   138  C  "C1'" . DT  A 1 7   ? 18.44300  67.92700  15.09100  1.000 37.83177 ? 7    DT  P "C1'" 1 
ATOM   139  N  N1    . DT  A 1 7   ? 17.69400  69.02300  15.70500  1.000 38.36657 ? 7    DT  P N1    1 
ATOM   140  C  C2    . DT  A 1 7   ? 16.71600  68.72000  16.62200  1.000 35.68094 ? 7    DT  P C2    1 
ATOM   141  O  O2    . DT  A 1 7   ? 16.41400  67.57200  16.91600  1.000 39.74777 ? 7    DT  P O2    1 
ATOM   142  N  N3    . DT  A 1 7   ? 16.09100  69.80900  17.17600  1.000 30.84014 ? 7    DT  P N3    1 
ATOM   143  C  C4    . DT  A 1 7   ? 16.35100  71.14200  16.91400  1.000 28.80602 ? 7    DT  P C4    1 
ATOM   144  O  O4    . DT  A 1 7   ? 15.73600  72.04900  17.46500  1.000 29.53758 ? 7    DT  P O4    1 
ATOM   145  C  C5    . DT  A 1 7   ? 17.40500  71.39100  15.94500  1.000 39.84057 ? 7    DT  P C5    1 
ATOM   146  C  C7    . DT  A 1 7   ? 17.78200  72.80300  15.57500  1.000 39.16428 ? 7    DT  P C7    1 
ATOM   147  C  C6    . DT  A 1 7   ? 18.02500  70.32700  15.40200  1.000 34.83906 ? 7    DT  P C6    1 
ATOM   148  P  P     . DG  A 1 8   ? 18.94900  65.39200  11.49200  1.000 50.49410 ? 8    DG  P P     1 
ATOM   149  O  OP1   . DG  A 1 8   ? 19.40900  64.00300  11.26800  1.000 55.03063 ? 8    DG  P OP1   1 
ATOM   150  O  OP2   . DG  A 1 8   ? 19.19100  66.41700  10.44500  1.000 32.49512 ? 8    DG  P OP2   1 
ATOM   151  O  "O5'" . DG  A 1 8   ? 17.39500  65.34200  11.82400  1.000 43.40169 ? 8    DG  P "O5'" 1 
ATOM   152  C  "C5'" . DG  A 1 8   ? 16.97800  64.67700  12.99000  1.000 39.46484 ? 8    DG  P "C5'" 1 
ATOM   153  C  "C4'" . DG  A 1 8   ? 15.50200  64.88200  13.21800  1.000 42.90253 ? 8    DG  P "C4'" 1 
ATOM   154  O  "O4'" . DG  A 1 8   ? 15.27900  66.12400  13.93500  1.000 34.86321 ? 8    DG  P "O4'" 1 
ATOM   155  C  "C3'" . DG  A 1 8   ? 14.64900  64.95900  11.94600  1.000 40.75569 ? 8    DG  P "C3'" 1 
ATOM   156  O  "O3'" . DG  A 1 8   ? 13.52200  64.09900  12.10800  1.000 46.48830 ? 8    DG  P "O3'" 1 
ATOM   157  C  "C2'" . DG  A 1 8   ? 14.23500  66.43900  11.90600  1.000 41.97465 ? 8    DG  P "C2'" 1 
ATOM   158  C  "C1'" . DG  A 1 8   ? 14.14300  66.73500  13.39300  1.000 37.95350 ? 8    DG  P "C1'" 1 
ATOM   159  N  N9    . DG  A 1 8   ? 14.13100  68.15800  13.74700  1.000 35.44952 ? 8    DG  P N9    1 
ATOM   160  C  C8    . DG  A 1 8   ? 14.97800  69.14800  13.28900  1.000 32.36340 ? 8    DG  P C8    1 
ATOM   161  N  N7    . DG  A 1 8   ? 14.71700  70.32800  13.79000  1.000 28.88938 ? 8    DG  P N7    1 
ATOM   162  C  C5    . DG  A 1 8   ? 13.62200  70.10800  14.63300  1.000 34.22589 ? 8    DG  P C5    1 
ATOM   163  C  C6    . DG  A 1 8   ? 12.89000  71.01500  15.45200  1.000 32.77202 ? 8    DG  P C6    1 
ATOM   164  O  O6    . DG  A 1 8   ? 13.06600  72.24000  15.60300  1.000 35.11442 ? 8    DG  P O6    1 
ATOM   165  N  N1    . DG  A 1 8   ? 11.86200  70.36500  16.14600  1.000 28.79290 ? 8    DG  P N1    1 
ATOM   166  C  C2    . DG  A 1 8   ? 11.58000  69.02000  16.05200  1.000 27.35295 ? 8    DG  P C2    1 
ATOM   167  N  N2    . DG  A 1 8   ? 10.55300  68.57200  16.78400  1.000 32.70615 ? 8    DG  P N2    1 
ATOM   168  N  N3    . DG  A 1 8   ? 12.25500  68.17100  15.29200  1.000 33.35940 ? 8    DG  P N3    1 
ATOM   169  C  C4    . DG  A 1 8   ? 13.25800  68.77700  14.61800  1.000 28.26078 ? 8    DG  P C4    1 
ATOM   170  P  P     . DG  A 1 9   ? 12.76800  63.42900  10.85200  1.000 42.05881 ? 9    DG  P P     1 
ATOM   171  O  OP1   . DG  A 1 9   ? 13.36000  62.10000  10.60700  1.000 49.02976 ? 9    DG  P OP1   1 
ATOM   172  O  OP2   . DG  A 1 9   ? 12.71700  64.40400  9.74700   1.000 45.05593 ? 9    DG  P OP2   1 
ATOM   173  O  "O5'" . DG  A 1 9   ? 11.27400  63.22000  11.40200  1.000 40.79101 ? 9    DG  P "O5'" 1 
ATOM   174  C  "C5'" . DG  A 1 9   ? 11.06500  62.86500  12.77600  1.000 30.65639 ? 9    DG  P "C5'" 1 
ATOM   175  C  "C4'" . DG  A 1 9   ? 9.74200   63.41900  13.30000  1.000 35.45344 ? 9    DG  P "C4'" 1 
ATOM   176  O  "O4'" . DG  A 1 9   ? 9.92700   64.76800  13.80000  1.000 29.67504 ? 9    DG  P "O4'" 1 
ATOM   177  C  "C3'" . DG  A 1 9   ? 8.60000   63.47400  12.28100  1.000 32.01143 ? 9    DG  P "C3'" 1 
ATOM   178  O  "O3'" . DG  A 1 9   ? 7.45800   62.83400  12.81700  1.000 26.39484 ? 9    DG  P "O3'" 1 
ATOM   179  C  "C2'" . DG  A 1 9   ? 8.36300   64.97400  12.05800  1.000 26.00064 ? 9    DG  P "C2'" 1 
ATOM   180  C  "C1'" . DG  A 1 9   ? 8.89600   65.61100  13.33700  1.000 30.28991 ? 9    DG  P "C1'" 1 
ATOM   181  N  N9    . DG  A 1 9   ? 9.48900   66.92400  13.10400  1.000 28.82925 ? 9    DG  P N9    1 
ATOM   182  C  C8    . DG  A 1 9   ? 10.59100  67.18800  12.32700  1.000 32.47065 ? 9    DG  P C8    1 
ATOM   183  N  N7    . DG  A 1 9   ? 10.92800  68.44300  12.30500  1.000 26.10260 ? 9    DG  P N7    1 
ATOM   184  C  C5    . DG  A 1 9   ? 9.98900   69.05700  13.11100  1.000 28.03756 ? 9    DG  P C5    1 
ATOM   185  C  C6    . DG  A 1 9   ? 9.85900   70.41400  13.45700  1.000 23.83607 ? 9    DG  P C6    1 
ATOM   186  O  O6    . DG  A 1 9   ? 10.56700  71.36600  13.09000  1.000 23.19102 ? 9    DG  P O6    1 
ATOM   187  N  N1    . DG  A 1 9   ? 8.79400   70.62700  14.31900  1.000 20.01344 ? 9    DG  P N1    1 
ATOM   188  C  C2    . DG  A 1 9   ? 7.93900   69.65100  14.77900  1.000 26.52509 ? 9    DG  P C2    1 
ATOM   189  N  N2    . DG  A 1 9   ? 6.95000   70.06800  15.60300  1.000 22.80460 ? 9    DG  P N2    1 
ATOM   190  N  N3    . DG  A 1 9   ? 8.05000   68.35900  14.46200  1.000 24.05060 ? 9    DG  P N3    1 
ATOM   191  C  C4    . DG  A 1 9   ? 9.09600   68.13800  13.62400  1.000 25.46745 ? 9    DG  P C4    1 
ATOM   192  P  P     . DT  A 1 10  ? 6.16500   62.54000  11.90600  1.000 31.01895 ? 10   DT  P P     1 
ATOM   193  O  OP1   . DT  A 1 10  ? 5.35900   61.47800  12.56400  1.000 27.28067 ? 10   DT  P OP1   1 
ATOM   194  O  OP2   . DT  A 1 10  ? 6.61200   62.41200  10.50300  1.000 32.18341 ? 10   DT  P OP2   1 
ATOM   195  O  "O5'" . DT  A 1 10  ? 5.30500   63.84900  12.06800  1.000 26.01898 ? 10   DT  P "O5'" 1 
ATOM   196  C  "C5'" . DT  A 1 10  ? 4.86600   64.20800  13.33900  1.000 30.14864 ? 10   DT  P "C5'" 1 
ATOM   197  C  "C4'" . DT  A 1 10  ? 4.08300   65.48800  13.25700  1.000 33.05449 ? 10   DT  P "C4'" 1 
ATOM   198  O  "O4'" . DT  A 1 10  ? 4.99200   66.58600  13.07100  1.000 32.46423 ? 10   DT  P "O4'" 1 
ATOM   199  C  "C3'" . DT  A 1 10  ? 3.11000   65.54600  12.08100  1.000 28.22390 ? 10   DT  P "C3'" 1 
ATOM   200  O  "O3'" . DT  A 1 10  ? 1.80400   65.50400  12.57800  1.000 32.06653 ? 10   DT  P "O3'" 1 
ATOM   201  C  "C2'" . DT  A 1 10  ? 3.43600   66.88200  11.35700  1.000 26.88151 ? 10   DT  P "C2'" 1 
ATOM   202  C  "C1'" . DT  A 1 10  ? 4.32800   67.60100  12.36400  1.000 29.98586 ? 10   DT  P "C1'" 1 
ATOM   203  N  N1    . DT  A 1 10  ? 5.37700   68.46100  11.77300  1.000 23.41671 ? 10   DT  P N1    1 
ATOM   204  C  C2    . DT  A 1 10  ? 5.45100   69.78000  12.14900  1.000 29.59261 ? 10   DT  P C2    1 
ATOM   205  O  O2    . DT  A 1 10  ? 4.65000   70.30900  12.91800  1.000 27.13761 ? 10   DT  P O2    1 
ATOM   206  N  N3    . DT  A 1 10  ? 6.48600   70.47100  11.58400  1.000 23.44802 ? 10   DT  P N3    1 
ATOM   207  C  C4    . DT  A 1 10  ? 7.43500   69.98500  10.71200  1.000 23.17223 ? 10   DT  P C4    1 
ATOM   208  O  O4    . DT  A 1 10  ? 8.32300   70.68400  10.24900  1.000 23.31678 ? 10   DT  P O4    1 
ATOM   209  C  C5    . DT  A 1 10  ? 7.30800   68.59500  10.37700  1.000 29.39836 ? 10   DT  P C5    1 
ATOM   210  C  C7    . DT  A 1 10  ? 8.29500   67.95600  9.43800   1.000 21.71535 ? 10   DT  P C7    1 
ATOM   211  C  C6    . DT  A 1 10  ? 6.30300   67.90700  10.92900  1.000 19.50333 ? 10   DT  P C6    1 
ATOM   212  P  P     . DA  A 1 11  ? 0.55500   65.63900  11.58800  1.000 34.73007 ? 11   DA  P P     1 
ATOM   213  O  OP1   . DA  A 1 11  ? -0.59300  64.99500  12.26400  1.000 33.64704 ? 11   DA  P OP1   1 
ATOM   214  O  OP2   . DA  A 1 11  ? 0.99400   65.26700  10.21600  1.000 32.22469 ? 11   DA  P OP2   1 
ATOM   215  O  "O5'" . DA  A 1 11  ? 0.27300   67.18800  11.57100  1.000 30.42327 ? 11   DA  P "O5'" 1 
ATOM   216  C  "C5'" . DA  A 1 11  ? 0.40600   67.94200  12.76500  1.000 31.78545 ? 11   DA  P "C5'" 1 
ATOM   217  C  "C4'" . DA  A 1 11  ? -0.15300  69.30400  12.50200  1.000 36.03189 ? 11   DA  P "C4'" 1 
ATOM   218  O  "O4'" . DA  A 1 11  ? 0.90600   70.19200  12.06900  1.000 27.06244 ? 11   DA  P "O4'" 1 
ATOM   219  C  "C3'" . DA  A 1 11  ? -1.20600  69.27100  11.41100  1.000 34.71856 ? 11   DA  P "C3'" 1 
ATOM   220  O  "O3'" . DA  A 1 11  ? -2.44000  69.75400  11.93400  1.000 47.26465 ? 11   DA  P "O3'" 1 
ATOM   221  C  "C2'" . DA  A 1 11  ? -0.64700  70.11500  10.25000  1.000 34.58180 ? 11   DA  P "C2'" 1 
ATOM   222  C  "C1'" . DA  A 1 11  ? 0.64300   70.74500  10.79900  1.000 27.55896 ? 11   DA  P "C1'" 1 
ATOM   223  N  N9    . DA  A 1 11  ? 1.82500   70.50300  9.97000   1.000 28.29378 ? 11   DA  P N9    1 
ATOM   224  C  C8    . DA  A 1 11  ? 2.07200   69.40900  9.17600   1.000 27.98965 ? 11   DA  P C8    1 
ATOM   225  N  N7    . DA  A 1 11  ? 3.23100   69.45500  8.55000   1.000 25.96622 ? 11   DA  P N7    1 
ATOM   226  C  C5    . DA  A 1 11  ? 3.79900   70.65200  8.98000   1.000 26.24970 ? 11   DA  P C5    1 
ATOM   227  C  C6    . DA  A 1 11  ? 5.03800   71.28800  8.68800   1.000 23.27419 ? 11   DA  P C6    1 
ATOM   228  N  N6    . DA  A 1 11  ? 5.96300   70.77500  7.86900   1.000 23.46052 ? 11   DA  P N6    1 
ATOM   229  N  N1    . DA  A 1 11  ? 5.28300   72.47700  9.27300   1.000 24.47797 ? 11   DA  P N1    1 
ATOM   230  C  C2    . DA  A 1 11  ? 4.35700   72.99400  10.10200  1.000 26.02631 ? 11   DA  P C2    1 
ATOM   231  N  N3    . DA  A 1 11  ? 3.16500   72.49400  10.45900  1.000 29.84744 ? 11   DA  P N3    1 
ATOM   232  C  C4    . DA  A 1 11  ? 2.94200   71.31200  9.85200   1.000 27.82329 ? 11   DA  P C4    1 
ATOM   233  P  P     . DG  A 1 12  ? -3.83100  69.42500  11.25100  1.000 39.62972 ? 12   DG  P P     1 
ATOM   234  O  OP1   . DG  A 1 12  ? -4.84900  69.42800  12.35800  1.000 46.10828 ? 12   DG  P OP1   1 
ATOM   235  O  OP2   . DG  A 1 12  ? -3.72000  68.23300  10.44500  1.000 44.34818 ? 12   DG  P OP2   1 
ATOM   236  O  "O5'" . DG  A 1 12  ? -3.93100  70.64500  10.26700  1.000 42.50474 ? 12   DG  P "O5'" 1 
ATOM   237  C  "C5'" . DG  A 1 12  ? -3.46100  71.91600  10.73300  1.000 40.33261 ? 12   DG  P "C5'" 1 
ATOM   238  C  "C4'" . DG  A 1 12  ? -3.24900  72.84800  9.56700   1.000 35.52624 ? 12   DG  P "C4'" 1 
ATOM   239  O  "O4'" . DG  A 1 12  ? -1.85300  72.81600  9.11600   1.000 35.10848 ? 12   DG  P "O4'" 1 
ATOM   240  C  "C3'" . DG  A 1 12  ? -4.10300  72.54400  8.34200   1.000 31.37699 ? 12   DG  P "C3'" 1 
ATOM   241  O  "O3'" . DG  A 1 12  ? -4.49500  73.77500  7.79100   1.000 41.21333 ? 12   DG  P "O3'" 1 
ATOM   242  C  "C2'" . DG  A 1 12  ? -3.12200  71.91000  7.39200   1.000 36.89997 ? 12   DG  P "C2'" 1 
ATOM   243  C  "C1'" . DG  A 1 12  ? -1.86100  72.69100  7.73100   1.000 39.57725 ? 12   DG  P "C1'" 1 
ATOM   244  N  N9    . DG  A 1 12  ? -0.61300  72.07500  7.31600   1.000 37.29157 ? 12   DG  P N9    1 
ATOM   245  C  C8    . DG  A 1 12  ? -0.48000  70.84900  6.72300   1.000 34.97765 ? 12   DG  P C8    1 
ATOM   246  N  N7    . DG  A 1 12  ? 0.72500   70.62100  6.28500   1.000 33.55467 ? 12   DG  P N7    1 
ATOM   247  C  C5    . DG  A 1 12  ? 1.41200   71.79400  6.54200   1.000 35.50413 ? 12   DG  P C5    1 
ATOM   248  C  C6    . DG  A 1 12  ? 2.74400   72.16700  6.22500   1.000 24.13910 ? 12   DG  P C6    1 
ATOM   249  O  O6    . DG  A 1 12  ? 3.62700   71.47700  5.74200   1.000 26.78835 ? 12   DG  P O6    1 
ATOM   250  N  N1    . DG  A 1 12  ? 3.05400   73.42000  6.73000   1.000 22.58240 ? 12   DG  P N1    1 
ATOM   251  C  C2    . DG  A 1 12  ? 2.16200   74.26600  7.33100   1.000 33.27680 ? 12   DG  P C2    1 
ATOM   252  N  N2    . DG  A 1 12  ? 2.64300   75.45700  7.69800   1.000 28.24730 ? 12   DG  P N2    1 
ATOM   253  N  N3    . DG  A 1 12  ? 0.90200   73.95200  7.58900   1.000 30.26994 ? 12   DG  P N3    1 
ATOM   254  C  C4    . DG  A 1 12  ? 0.59200   72.71300  7.15700   1.000 35.25999 ? 12   DG  P C4    1 
ATOM   255  O  "O3'" . DC  B 2 1   ? 5.22900   76.37000  -18.44800 1.000 67.85850 ? 1    DC  T "O3'" 1 
ATOM   256  P  P     . DA  B 2 2   ? 5.20700   75.49200  -17.08300 1.000 84.64078 ? 2    DA  T P     1 
ATOM   257  O  OP1   . DA  B 2 2   ? 4.41800   74.26600  -17.32300 1.000 61.51955 ? 2    DA  T OP1   1 
ATOM   258  O  OP2   . DA  B 2 2   ? 4.79000   76.36400  -15.99700 1.000 50.02942 ? 2    DA  T OP2   1 
ATOM   259  O  "O5'" . DA  B 2 2   ? 6.74400   75.07100  -16.95800 1.000 48.57709 ? 2    DA  T "O5'" 1 
ATOM   260  C  "C5'" . DA  B 2 2   ? 7.33200   73.92300  -17.57200 1.000 34.80613 ? 2    DA  T "C5'" 1 
ATOM   261  C  "C4'" . DA  B 2 2   ? 8.50400   73.41300  -16.75900 1.000 29.56265 ? 2    DA  T "C4'" 1 
ATOM   262  O  "O4'" . DA  B 2 2   ? 9.71900   74.07500  -17.14900 1.000 27.73659 ? 2    DA  T "O4'" 1 
ATOM   263  C  "C3'" . DA  B 2 2   ? 8.40400   73.57400  -15.24000 1.000 21.91630 ? 2    DA  T "C3'" 1 
ATOM   264  O  "O3'" . DA  B 2 2   ? 8.95700   72.47100  -14.51200 1.000 25.65178 ? 2    DA  T "O3'" 1 
ATOM   265  C  "C2'" . DA  B 2 2   ? 9.22700   74.81000  -14.98200 1.000 25.38067 ? 2    DA  T "C2'" 1 
ATOM   266  C  "C1'" . DA  B 2 2   ? 10.28900  74.73800  -16.06200 1.000 26.63577 ? 2    DA  T "C1'" 1 
ATOM   267  N  N9    . DA  B 2 2   ? 10.77800  76.02800  -16.51900 1.000 28.43306 ? 2    DA  T N9    1 
ATOM   268  C  C8    . DA  B 2 2   ? 12.03000  76.54100  -16.27500 1.000 29.80435 ? 2    DA  T C8    1 
ATOM   269  N  N7    . DA  B 2 2   ? 12.20700  77.74600  -16.74400 1.000 29.08292 ? 2    DA  T N7    1 
ATOM   270  C  C5    . DA  B 2 2   ? 10.99900  78.05300  -17.33900 1.000 22.45413 ? 2    DA  T C5    1 
ATOM   271  C  C6    . DA  B 2 2   ? 10.54200  79.19300  -18.01200 1.000 30.97562 ? 2    DA  T C6    1 
ATOM   272  N  N6    . DA  B 2 2   ? 11.28700  80.27300  -18.22100 1.000 26.90342 ? 2    DA  T N6    1 
ATOM   273  N  N1    . DA  B 2 2   ? 9.26800   79.19400  -18.44500 1.000 33.46368 ? 2    DA  T N1    1 
ATOM   274  C  C2    . DA  B 2 2   ? 8.51800   78.11300  -18.22500 1.000 32.00739 ? 2    DA  T C2    1 
ATOM   275  N  N3    . DA  B 2 2   ? 8.84000   76.97700  -17.62500 1.000 28.44253 ? 2    DA  T N3    1 
ATOM   276  C  C4    . DA  B 2 2   ? 10.10600  77.01700  -17.18700 1.000 26.69895 ? 2    DA  T C4    1 
ATOM   277  P  P     . DT  B 2 3   ? 8.06000   71.52900  -13.56600 1.000 23.62195 ? 3    DT  T P     1 
ATOM   278  O  OP1   . DT  B 2 3   ? 8.83600   70.33400  -13.33900 1.000 25.14828 ? 3    DT  T OP1   1 
ATOM   279  O  OP2   . DT  B 2 3   ? 6.71500   71.50100  -14.20700 1.000 21.84100 ? 3    DT  T OP2   1 
ATOM   280  O  "O5'" . DT  B 2 3   ? 7.94800   72.40500  -12.25600 1.000 20.30181 ? 3    DT  T "O5'" 1 
ATOM   281  C  "C5'" . DT  B 2 3   ? 9.08000   72.60300  -11.43600 1.000 16.51307 ? 3    DT  T "C5'" 1 
ATOM   282  C  "C4'" . DT  B 2 3   ? 8.99400   73.94100  -10.73200 1.000 18.08563 ? 3    DT  T "C4'" 1 
ATOM   283  O  "O4'" . DT  B 2 3   ? 9.20200   74.97900  -11.70200 1.000 17.18339 ? 3    DT  T "O4'" 1 
ATOM   284  C  "C3'" . DT  B 2 3   ? 7.63700   74.26600  -10.11100 1.000 16.08401 ? 3    DT  T "C3'" 1 
ATOM   285  O  "O3'" . DT  B 2 3   ? 7.55000   73.71400  -8.79200  1.000 15.58052 ? 3    DT  T "O3'" 1 
ATOM   286  C  "C2'" . DT  B 2 3   ? 7.62400   75.80400  -10.10900 1.000 14.28998 ? 3    DT  T "C2'" 1 
ATOM   287  C  "C1'" . DT  B 2 3   ? 8.61400   76.16700  -11.23700 1.000 15.45770 ? 3    DT  T "C1'" 1 
ATOM   288  N  N1    . DT  B 2 3   ? 8.01900   76.86200  -12.40200 1.000 24.09635 ? 3    DT  T N1    1 
ATOM   289  C  C2    . DT  B 2 3   ? 6.89000   76.35200  -13.02300 1.000 25.30073 ? 3    DT  T C2    1 
ATOM   290  O  O2    . DT  B 2 3   ? 6.31000   75.34300  -12.66400 1.000 16.27325 ? 3    DT  T O2    1 
ATOM   291  N  N3    . DT  B 2 3   ? 6.46200   77.07600  -14.09900 1.000 27.07955 ? 3    DT  T N3    1 
ATOM   292  C  C4    . DT  B 2 3   ? 7.02800   78.22000  -14.61700 1.000 30.16181 ? 3    DT  T C4    1 
ATOM   293  O  O4    . DT  B 2 3   ? 6.55600   78.80100  -15.59100 1.000 35.23140 ? 3    DT  T O4    1 
ATOM   294  C  C5    . DT  B 2 3   ? 8.21300   78.68200  -13.94100 1.000 26.65769 ? 3    DT  T C5    1 
ATOM   295  C  C7    . DT  B 2 3   ? 8.91800   79.91600  -14.41500 1.000 29.99177 ? 3    DT  T C7    1 
ATOM   296  C  C6    . DT  B 2 3   ? 8.65200   77.98500  -12.88700 1.000 23.28262 ? 3    DT  T C6    1 
ATOM   297  P  P     . DC  B 2 4   ? 6.24300   73.94400  -7.87400  1.000 15.35050 ? 4    DC  T P     1 
ATOM   298  O  OP1   . DC  B 2 4   ? 6.17400   72.80900  -6.93400  1.000 13.79140 ? 4    DC  T OP1   1 
ATOM   299  O  OP2   . DC  B 2 4   ? 5.09400   74.22100  -8.73000  1.000 11.73962 ? 4    DC  T OP2   1 
ATOM   300  O  "O5'" . DC  B 2 4   ? 6.57800   75.29200  -7.09900  1.000 16.68736 ? 4    DC  T "O5'" 1 
ATOM   301  C  "C5'" . DC  B 2 4   ? 7.73500   75.38300  -6.27400  1.000 16.38955 ? 4    DC  T "C5'" 1 
ATOM   302  C  "C4'" . DC  B 2 4   ? 7.97600   76.83600  -5.89600  1.000 12.47915 ? 4    DC  T "C4'" 1 
ATOM   303  O  "O4'" . DC  B 2 4   ? 8.24800   77.56600  -7.08100  1.000 14.54641 ? 4    DC  T "O4'" 1 
ATOM   304  C  "C3'" . DC  B 2 4   ? 6.78800   77.55900  -5.29600  1.000 9.56488  ? 4    DC  T "C3'" 1 
ATOM   305  O  "O3'" . DC  B 2 4   ? 6.83800   77.47700  -3.90200  1.000 10.77159 ? 4    DC  T "O3'" 1 
ATOM   306  C  "C2'" . DC  B 2 4   ? 6.93200   79.01400  -5.75300  1.000 11.47136 ? 4    DC  T "C2'" 1 
ATOM   307  C  "C1'" . DC  B 2 4   ? 8.03000   78.93500  -6.81200  1.000 13.92496 ? 4    DC  T "C1'" 1 
ATOM   308  N  N1    . DC  B 2 4   ? 7.70700   79.59000  -8.08600  1.000 16.35937 ? 4    DC  T N1    1 
ATOM   309  C  C2    . DC  B 2 4   ? 8.33500   80.78300  -8.40500  1.000 16.86927 ? 4    DC  T C2    1 
ATOM   310  O  O2    . DC  B 2 4   ? 9.11000   81.28200  -7.57700  1.000 18.19771 ? 4    DC  T O2    1 
ATOM   311  N  N3    . DC  B 2 4   ? 8.07100   81.36500  -9.60400  1.000 19.19221 ? 4    DC  T N3    1 
ATOM   312  C  C4    . DC  B 2 4   ? 7.20700   80.78200  -10.44800 1.000 22.02008 ? 4    DC  T C4    1 
ATOM   313  N  N4    . DC  B 2 4   ? 6.95700   81.38800  -11.60600 1.000 22.68752 ? 4    DC  T N4    1 
ATOM   314  C  C5    . DC  B 2 4   ? 6.56200   79.55000  -10.13500 1.000 14.88223 ? 4    DC  T C5    1 
ATOM   315  C  C6    . DC  B 2 4   ? 6.84600   78.99100  -8.96200  1.000 20.95489 ? 4    DC  T C6    1 
ATOM   316  P  P     . DG  B 2 5   ? 5.98900   76.35700  -3.13600  1.000 17.00142 ? 5    DG  T P     1 
ATOM   317  O  OP1   . DG  B 2 5   ? 4.92400   75.86800  -4.05000  1.000 18.75289 ? 5    DG  T OP1   1 
ATOM   318  O  OP2   . DG  B 2 5   ? 5.68000   76.93500  -1.80300  1.000 12.18236 ? 5    DG  T OP2   1 
ATOM   319  O  "O5'" . DG  B 2 5   ? 7.02400   75.14700  -2.97300  1.000 16.76443 ? 5    DG  T "O5'" 1 
ATOM   320  C  "C5'" . DG  B 2 5   ? 8.33300   75.41800  -2.45400  1.000 17.45388 ? 5    DG  T "C5'" 1 
ATOM   321  C  "C4'" . DG  B 2 5   ? 8.76500   74.30700  -1.54100  1.000 15.97776 ? 5    DG  T "C4'" 1 
ATOM   322  O  "O4'" . DG  B 2 5   ? 9.21100   73.19600  -2.33500  1.000 18.25252 ? 5    DG  T "O4'" 1 
ATOM   323  C  "C3'" . DG  B 2 5   ? 9.95200   74.62000  -0.64700  1.000 17.42850 ? 5    DG  T "C3'" 1 
ATOM   324  O  "O3'" . DG  B 2 5   ? 9.50000   75.29700  0.49900   1.000 20.95444 ? 5    DG  T "O3'" 1 
ATOM   325  C  "C2'" . DG  B 2 5   ? 10.47400  73.21500  -0.30400  1.000 14.72506 ? 5    DG  T "C2'" 1 
ATOM   326  C  "C1'" . DG  B 2 5   ? 10.03700  72.37700  -1.52100  1.000 17.05708 ? 5    DG  T "C1'" 1 
ATOM   327  N  N9    . DG  B 2 5   ? 11.14200  71.88100  -2.32700  1.000 18.02755 ? 5    DG  T N9    1 
ATOM   328  C  C8    . DG  B 2 5   ? 12.21800  72.60500  -2.79100  1.000 21.86639 ? 5    DG  T C8    1 
ATOM   329  N  N7    . DG  B 2 5   ? 13.06800  71.89100  -3.48800  1.000 19.66000 ? 5    DG  T N7    1 
ATOM   330  C  C5    . DG  B 2 5   ? 12.50600  70.61200  -3.50000  1.000 19.21871 ? 5    DG  T C5    1 
ATOM   331  C  C6    . DG  B 2 5   ? 12.97500  69.41100  -4.09800  1.000 19.79983 ? 5    DG  T C6    1 
ATOM   332  O  O6    . DG  B 2 5   ? 14.00000  69.23800  -4.77600  1.000 19.41914 ? 5    DG  T O6    1 
ATOM   333  N  N1    . DG  B 2 5   ? 12.11300  68.34200  -3.86400  1.000 20.22945 ? 5    DG  T N1    1 
ATOM   334  C  C2    . DG  B 2 5   ? 10.94500  68.40600  -3.14500  1.000 20.86368 ? 5    DG  T C2    1 
ATOM   335  N  N2    . DG  B 2 5   ? 10.26200  67.24300  -3.02400  1.000 20.63809 ? 5    DG  T N2    1 
ATOM   336  N  N3    . DG  B 2 5   ? 10.48500  69.52500  -2.57000  1.000 19.03857 ? 5    DG  T N3    1 
ATOM   337  C  C4    . DG  B 2 5   ? 11.32100  70.58700  -2.78900  1.000 18.20178 ? 5    DG  T C4    1 
ATOM   338  P  P     . DC  B 2 6   ? 10.48600  76.25400  1.33200   1.000 17.45699 ? 6    DC  T P     1 
ATOM   339  O  OP1   . DC  B 2 6   ? 11.24100  77.08800  0.36200   1.000 14.35236 ? 6    DC  T OP1   1 
ATOM   340  O  OP2   . DC  B 2 6   ? 11.17700  75.44100  2.34100   1.000 15.71527 ? 6    DC  T OP2   1 
ATOM   341  O  "O5'" . DC  B 2 6   ? 9.49400   77.18300  2.15400   1.000 18.58105 ? 6    DC  T "O5'" 1 
ATOM   342  C  "C5'" . DC  B 2 6   ? 8.66700   78.08700  1.47100   1.000 14.86657 ? 6    DC  T "C5'" 1 
ATOM   343  C  "C4'" . DC  B 2 6   ? 7.74100   78.77700  2.43400   1.000 16.22069 ? 6    DC  T "C4'" 1 
ATOM   344  O  "O4'" . DC  B 2 6   ? 6.76000   77.84400  2.93100   1.000 15.32655 ? 6    DC  T "O4'" 1 
ATOM   345  C  "C3'" . DC  B 2 6   ? 8.38500   79.38400  3.66000   1.000 12.89441 ? 6    DC  T "C3'" 1 
ATOM   346  O  "O3'" . DC  B 2 6   ? 7.62000   80.51800  4.02400   1.000 18.95856 ? 6    DC  T "O3'" 1 
ATOM   347  C  "C2'" . DC  B 2 6   ? 8.26500   78.27000  4.70300   1.000 14.93195 ? 6    DC  T "C2'" 1 
ATOM   348  C  "C1'" . DC  B 2 6   ? 6.91700   77.65400  4.32600   1.000 18.22932 ? 6    DC  T "C1'" 1 
ATOM   349  N  N1    . DC  B 2 6   ? 6.78700   76.20300  4.54300   1.000 12.81682 ? 6    DC  T N1    1 
ATOM   350  C  C2    . DC  B 2 6   ? 5.67200   75.71700  5.21100   1.000 16.85185 ? 6    DC  T C2    1 
ATOM   351  O  O2    . DC  B 2 6   ? 4.87900   76.51000  5.68800   1.000 19.40375 ? 6    DC  T O2    1 
ATOM   352  N  N3    . DC  B 2 6   ? 5.51100   74.39000  5.34700   1.000 16.50999 ? 6    DC  T N3    1 
ATOM   353  C  C4    . DC  B 2 6   ? 6.39800   73.55900  4.82300   1.000 14.48195 ? 6    DC  T C4    1 
ATOM   354  N  N4    . DC  B 2 6   ? 6.19000   72.26300  4.98100   1.000 15.12165 ? 6    DC  T N4    1 
ATOM   355  C  C5    . DC  B 2 6   ? 7.54300   74.02900  4.11500   1.000 17.60736 ? 6    DC  T C5    1 
ATOM   356  C  C6    . DC  B 2 6   ? 7.68100   75.35200  3.98000   1.000 15.62442 ? 6    DC  T C6    1 
ATOM   357  P  P     . DT  B 2 7   ? 8.19600   81.68200  4.94000   1.000 20.67501 ? 7    DT  T P     1 
ATOM   358  O  OP1   . DT  B 2 7   ? 7.41500   82.83300  4.74900   1.000 15.91223 ? 7    DT  T OP1   1 
ATOM   359  O  OP2   . DT  B 2 7   ? 9.61200   81.73200  4.77600   1.000 15.64692 ? 7    DT  T OP2   1 
ATOM   360  O  "O5'" . DT  B 2 7   ? 7.96800   81.13500  6.40000   1.000 18.55312 ? 7    DT  T "O5'" 1 
ATOM   361  C  "C5'" . DT  B 2 7   ? 6.68700   81.19000  7.00600   1.000 26.06564 ? 7    DT  T "C5'" 1 
ATOM   362  C  "C4'" . DT  B 2 7   ? 6.57100   80.31300  8.23100   1.000 23.41557 ? 7    DT  T "C4'" 1 
ATOM   363  O  "O4'" . DT  B 2 7   ? 6.60000   78.92900  7.86600   1.000 20.07150 ? 7    DT  T "O4'" 1 
ATOM   364  C  "C3'" . DT  B 2 7   ? 7.64500   80.48800  9.31000   1.000 23.29265 ? 7    DT  T "C3'" 1 
ATOM   365  O  "O3'" . DT  B 2 7   ? 7.03200   80.61500  10.58500  1.000 21.90576 ? 7    DT  T "O3'" 1 
ATOM   366  C  "C2'" . DT  B 2 7   ? 8.38200   79.16600  9.25300   1.000 24.42417 ? 7    DT  T "C2'" 1 
ATOM   367  C  "C1'" . DT  B 2 7   ? 7.23500   78.26400  8.90800   1.000 20.73071 ? 7    DT  T "C1'" 1 
ATOM   368  N  N1    . DT  B 2 7   ? 7.51000   76.87400  8.47800   1.000 20.92333 ? 7    DT  T N1    1 
ATOM   369  C  C2    . DT  B 2 7   ? 6.61000   75.91200  8.86700   1.000 21.22112 ? 7    DT  T C2    1 
ATOM   370  O  O2    . DT  B 2 7   ? 5.61600   76.16000  9.50200   1.000 21.75583 ? 7    DT  T O2    1 
ATOM   371  N  N3    . DT  B 2 7   ? 6.91300   74.64800  8.46200   1.000 20.68512 ? 7    DT  T N3    1 
ATOM   372  C  C4    . DT  B 2 7   ? 8.00700   74.24900  7.74100   1.000 16.34313 ? 7    DT  T C4    1 
ATOM   373  O  O4    . DT  B 2 7   ? 8.15100   73.08000  7.46100   1.000 22.30210 ? 7    DT  T O4    1 
ATOM   374  C  C5    . DT  B 2 7   ? 8.91900   75.30100  7.37500   1.000 20.23119 ? 7    DT  T C5    1 
ATOM   375  C  C7    . DT  B 2 7   ? 10.12100  74.95900  6.55600   1.000 24.91426 ? 7    DT  T C7    1 
ATOM   376  C  C6    . DT  B 2 7   ? 8.62400   76.54800  7.75000   1.000 15.64337 ? 7    DT  T C6    1 
ATOM   377  P  P     . DA  B 2 8   ? 7.57000   81.53800  11.70900  1.000 25.09385 ? 8    DA  T P     1 
ATOM   378  O  OP1   . DA  B 2 8   ? 7.23900   82.93600  11.35200  1.000 24.01213 ? 8    DA  T OP1   1 
ATOM   379  O  OP2   . DA  B 2 8   ? 8.91300   81.06600  12.11400  1.000 23.53430 ? 8    DA  T OP2   1 
ATOM   380  O  "O5'" . DA  B 2 8   ? 6.61700   81.20200  12.93200  1.000 26.33543 ? 8    DA  T "O5'" 1 
ATOM   381  C  "C5'" . DA  B 2 8   ? 5.25500   81.02100  12.69600  1.000 19.59178 ? 8    DA  T "C5'" 1 
ATOM   382  C  "C4'" . DA  B 2 8   ? 4.70500   80.03600  13.68100  1.000 18.89060 ? 8    DA  T "C4'" 1 
ATOM   383  O  "O4'" . DA  B 2 8   ? 4.92500   78.68700  13.21100  1.000 18.74530 ? 8    DA  T "O4'" 1 
ATOM   384  C  "C3'" . DA  B 2 8   ? 5.33600   80.11800  15.05600  1.000 24.71636 ? 8    DA  T "C3'" 1 
ATOM   385  O  "O3'" . DA  B 2 8   ? 4.32500   79.88800  15.98800  1.000 29.28257 ? 8    DA  T "O3'" 1 
ATOM   386  C  "C2'" . DA  B 2 8   ? 6.38600   79.00200  15.03500  1.000 20.20141 ? 8    DA  T "C2'" 1 
ATOM   387  C  "C1'" . DA  B 2 8   ? 5.70600   77.96000  14.14000  1.000 20.11219 ? 8    DA  T "C1'" 1 
ATOM   388  N  N9    . DA  B 2 8   ? 6.63400   77.13100  13.37700  1.000 18.12840 ? 8    DA  T N9    1 
ATOM   389  C  C8    . DA  B 2 8   ? 7.81300   77.52400  12.79500  1.000 23.93699 ? 8    DA  T C8    1 
ATOM   390  N  N7    . DA  B 2 8   ? 8.45300   76.54800  12.16600  1.000 20.05315 ? 8    DA  T N7    1 
ATOM   391  C  C5    . DA  B 2 8   ? 7.62800   75.44300  12.34400  1.000 20.64391 ? 8    DA  T C5    1 
ATOM   392  C  C6    . DA  B 2 8   ? 7.72400   74.10000  11.91100  1.000 23.19151 ? 8    DA  T C6    1 
ATOM   393  N  N6    . DA  B 2 8   ? 8.74600   73.62000  11.17600  1.000 15.84970 ? 8    DA  T N6    1 
ATOM   394  N  N1    . DA  B 2 8   ? 6.73100   73.26000  12.27500  1.000 23.75420 ? 8    DA  T N1    1 
ATOM   395  C  C2    . DA  B 2 8   ? 5.71000   73.73500  13.00500  1.000 22.80273 ? 8    DA  T C2    1 
ATOM   396  N  N3    . DA  B 2 8   ? 5.50800   74.96500  13.45900  1.000 20.18670 ? 8    DA  T N3    1 
ATOM   397  C  C4    . DA  B 2 8   ? 6.50400   75.78400  13.08700  1.000 20.43123 ? 8    DA  T C4    1 
ATOM   398  P  P     . DC  B 2 9   ? 4.56100   80.10900  17.55500  1.000 27.76891 ? 9    DC  T P     1 
ATOM   399  O  OP1   . DC  B 2 9   ? 3.20700   80.51800  18.02800  1.000 26.70066 ? 9    DC  T OP1   1 
ATOM   400  O  OP2   . DC  B 2 9   ? 5.74200   80.93600  17.82700  1.000 24.82941 ? 9    DC  T OP2   1 
ATOM   401  O  "O5'" . DC  B 2 9   ? 4.81300   78.62400  18.04300  1.000 23.69966 ? 9    DC  T "O5'" 1 
ATOM   402  C  "C5'" . DC  B 2 9   ? 3.84400   77.65700  17.73800  1.000 28.61188 ? 9    DC  T "C5'" 1 
ATOM   403  C  "C4'" . DC  B 2 9   ? 4.32600   76.29500  18.13500  1.000 26.78118 ? 9    DC  T "C4'" 1 
ATOM   404  O  "O4'" . DC  B 2 9   ? 5.13400   75.75000  17.08300  1.000 27.82742 ? 9    DC  T "O4'" 1 
ATOM   405  C  "C3'" . DC  B 2 9   ? 5.19500   76.28900  19.39500  1.000 37.29165 ? 9    DC  T "C3'" 1 
ATOM   406  O  "O3'" . DC  B 2 9   ? 4.55200   75.54200  20.37500  1.000 39.10429 ? 9    DC  T "O3'" 1 
ATOM   407  C  "C2'" . DC  B 2 9   ? 6.51600   75.64600  18.94900  1.000 34.68955 ? 9    DC  T "C2'" 1 
ATOM   408  C  "C1'" . DC  B 2 9   ? 6.11800   74.94000  17.66800  1.000 32.72990 ? 9    DC  T "C1'" 1 
ATOM   409  N  N1    . DC  B 2 9   ? 7.24200   74.77400  16.71700  1.000 28.27263 ? 9    DC  T N1    1 
ATOM   410  C  C2    . DC  B 2 9   ? 7.38700   73.55900  16.04200  1.000 26.95517 ? 9    DC  T C2    1 
ATOM   411  O  O2    . DC  B 2 9   ? 6.56300   72.65900  16.23800  1.000 26.72179 ? 9    DC  T O2    1 
ATOM   412  N  N3    . DC  B 2 9   ? 8.42400   73.40700  15.18000  1.000 24.87159 ? 9    DC  T N3    1 
ATOM   413  C  C4    . DC  B 2 9   ? 9.29800   74.39500  15.00000  1.000 20.93574 ? 9    DC  T C4    1 
ATOM   414  N  N4    . DC  B 2 9   ? 10.29500  74.18600  14.14300  1.000 20.84682 ? 9    DC  T N4    1 
ATOM   415  C  C5    . DC  B 2 9   ? 9.18200   75.64300  15.68700  1.000 18.53511 ? 9    DC  T C5    1 
ATOM   416  C  C6    . DC  B 2 9   ? 8.14800   75.78900  16.53500  1.000 26.32731 ? 9    DC  T C6    1 
ATOM   417  P  P     . DC  B 2 10  ? 5.16200   75.37900  21.84600  1.000 39.98594 ? 10   DC  T P     1 
ATOM   418  O  OP1   . DC  B 2 10  ? 4.16000   76.01700  22.72500  1.000 47.27835 ? 10   DC  T OP1   1 
ATOM   419  O  OP2   . DC  B 2 10  ? 6.58400   75.76100  21.92800  1.000 45.19483 ? 10   DC  T OP2   1 
ATOM   420  O  "O5'" . DC  B 2 10  ? 5.10100   73.81100  22.03200  1.000 47.03555 ? 10   DC  T "O5'" 1 
ATOM   421  C  "C5'" . DC  B 2 10  ? 4.32800   73.06000  21.11500  1.000 36.70179 ? 10   DC  T "C5'" 1 
ATOM   422  C  "C4'" . DC  B 2 10  ? 4.90200   71.68100  20.94700  1.000 39.17565 ? 10   DC  T "C4'" 1 
ATOM   423  O  "O4'" . DC  B 2 10  ? 5.86500   71.68000  19.86700  1.000 43.72779 ? 10   DC  T "O4'" 1 
ATOM   424  C  "C3'" . DC  B 2 10  ? 5.62700   71.16200  22.18100  1.000 46.69877 ? 10   DC  T "C3'" 1 
ATOM   425  O  "O3'" . DC  B 2 10  ? 5.12300   69.89100  22.53100  1.000 63.16671 ? 10   DC  T "O3'" 1 
ATOM   426  C  "C2'" . DC  B 2 10  ? 7.09500   71.10400  21.76800  1.000 40.14222 ? 10   DC  T "C2'" 1 
ATOM   427  C  "C1'" . DC  B 2 10  ? 7.01100   70.97000  20.25800  1.000 39.40789 ? 10   DC  T "C1'" 1 
ATOM   428  N  N1    . DC  B 2 10  ? 8.15400   71.57400  19.57100  1.000 35.35822 ? 10   DC  T N1    1 
ATOM   429  C  C2    . DC  B 2 10  ? 8.83900   70.83900  18.60600  1.000 31.52481 ? 10   DC  T C2    1 
ATOM   430  O  O2    . DC  B 2 10  ? 8.47200   69.68600  18.35900  1.000 40.73854 ? 10   DC  T O2    1 
ATOM   431  N  N3    . DC  B 2 10  ? 9.89200   71.41000  17.97200  1.000 32.83131 ? 10   DC  T N3    1 
ATOM   432  C  C4    . DC  B 2 10  ? 10.24900  72.66300  18.26300  1.000 27.38232 ? 10   DC  T C4    1 
ATOM   433  N  N4    . DC  B 2 10  ? 11.29100  73.18000  17.60600  1.000 31.10582 ? 10   DC  T N4    1 
ATOM   434  C  C5    . DC  B 2 10  ? 9.56000   73.43400  19.24500  1.000 27.34813 ? 10   DC  T C5    1 
ATOM   435  C  C6    . DC  B 2 10  ? 8.52600   72.85500  19.86900  1.000 34.57764 ? 10   DC  T C6    1 
ATOM   436  P  P     . DA  B 2 11  ? 5.63000   69.17000  23.87100  1.000 59.65277 ? 11   DA  T P     1 
ATOM   437  O  OP1   . DA  B 2 11  ? 4.47800   68.41200  24.40700  1.000 42.30738 ? 11   DA  T OP1   1 
ATOM   438  O  OP2   . DA  B 2 11  ? 6.37200   70.15100  24.69800  1.000 64.89395 ? 11   DA  T OP2   1 
ATOM   439  O  "O5'" . DA  B 2 11  ? 6.73500   68.16000  23.34800  1.000 53.92796 ? 11   DA  T "O5'" 1 
ATOM   440  C  "C5'" . DA  B 2 11  ? 6.41200   67.22800  22.34700  1.000 45.29119 ? 11   DA  T "C5'" 1 
ATOM   441  C  "C4'" . DA  B 2 11  ? 7.63400   66.43200  22.03300  1.000 44.20961 ? 11   DA  T "C4'" 1 
ATOM   442  O  "O4'" . DA  B 2 11  ? 8.52200   67.24800  21.23200  1.000 42.80260 ? 11   DA  T "O4'" 1 
ATOM   443  C  "C3'" . DA  B 2 11  ? 8.41800   66.02800  23.28000  1.000 48.25222 ? 11   DA  T "C3'" 1 
ATOM   444  O  "O3'" . DA  B 2 11  ? 8.63700   64.62200  23.27300  1.000 47.93693 ? 11   DA  T "O3'" 1 
ATOM   445  C  "C2'" . DA  B 2 11  ? 9.72400   66.84300  23.19200  1.000 45.58959 ? 11   DA  T "C2'" 1 
ATOM   446  C  "C1'" . DA  B 2 11  ? 9.84100   67.12000  21.69600  1.000 42.09384 ? 11   DA  T "C1'" 1 
ATOM   447  N  N9    . DA  B 2 11  ? 10.57600  68.35300  21.35800  1.000 35.84416 ? 11   DA  T N9    1 
ATOM   448  C  C8    . DA  B 2 11  ? 10.37600  69.60900  21.87900  1.000 34.87597 ? 11   DA  T C8    1 
ATOM   449  N  N7    . DA  B 2 11  ? 11.17600  70.52600  21.37700  1.000 33.23261 ? 11   DA  T N7    1 
ATOM   450  C  C5    . DA  B 2 11  ? 11.94900  69.83000  20.45000  1.000 32.94293 ? 11   DA  T C5    1 
ATOM   451  C  C6    . DA  B 2 11  ? 12.99000  70.23000  19.57100  1.000 30.15423 ? 11   DA  T C6    1 
ATOM   452  N  N6    . DA  B 2 11  ? 13.44700  71.49000  19.48400  1.000 32.99838 ? 11   DA  T N6    1 
ATOM   453  N  N1    . DA  B 2 11  ? 13.55600  69.28100  18.79800  1.000 28.23883 ? 11   DA  T N1    1 
ATOM   454  C  C2    . DA  B 2 11  ? 13.09800  68.03100  18.87700  1.000 30.58625 ? 11   DA  T C2    1 
ATOM   455  N  N3    . DA  B 2 11  ? 12.13100  67.53400  19.65000  1.000 31.51944 ? 11   DA  T N3    1 
ATOM   456  C  C4    . DA  B 2 11  ? 11.58700  68.49400  20.41900  1.000 34.30873 ? 11   DA  T C4    1 
ATOM   457  P  P     . DC  B 2 12  ? 9.19200   63.86700  24.58200  1.000 56.48407 ? 12   DC  T P     1 
ATOM   458  O  OP1   . DC  B 2 12  ? 8.38000   62.64400  24.75400  1.000 46.80802 ? 12   DC  T OP1   1 
ATOM   459  O  OP2   . DC  B 2 12  ? 9.23500   64.81100  25.72100  1.000 50.48694 ? 12   DC  T OP2   1 
ATOM   460  O  "O5'" . DC  B 2 12  ? 10.68100  63.48000  24.14400  1.000 34.98005 ? 12   DC  T "O5'" 1 
ATOM   461  C  "C5'" . DC  B 2 12  ? 10.88900  62.83300  22.89000  1.000 42.42291 ? 12   DC  T "C5'" 1 
ATOM   462  C  "C4'" . DC  B 2 12  ? 12.26200  63.14500  22.31100  1.000 37.62239 ? 12   DC  T "C4'" 1 
ATOM   463  O  "O4'" . DC  B 2 12  ? 12.39900  64.55700  22.06900  1.000 46.23838 ? 12   DC  T "O4'" 1 
ATOM   464  C  "C3'" . DC  B 2 12  ? 13.44600  62.79900  23.20100  1.000 47.16665 ? 12   DC  T "C3'" 1 
ATOM   465  O  "O3'" . DC  B 2 12  ? 13.95700  61.53600  22.84900  1.000 54.34177 ? 12   DC  T "O3'" 1 
ATOM   466  C  "C2'" . DC  B 2 12  ? 14.48400  63.91200  22.92100  1.000 50.74771 ? 12   DC  T "C2'" 1 
ATOM   467  C  "C1'" . DC  B 2 12  ? 13.77400  64.82800  21.92500  1.000 45.81529 ? 12   DC  T "C1'" 1 
ATOM   468  N  N1    . DC  B 2 12  ? 14.01000  66.28000  22.17400  1.000 36.01261 ? 12   DC  T N1    1 
ATOM   469  C  C2    . DC  B 2 12  ? 15.06300  66.95000  21.51900  1.000 36.34878 ? 12   DC  T C2    1 
ATOM   470  O  O2    . DC  B 2 12  ? 15.79600  66.32500  20.73000  1.000 34.32066 ? 12   DC  T O2    1 
ATOM   471  N  N3    . DC  B 2 12  ? 15.25000  68.27100  21.76700  1.000 29.92213 ? 12   DC  T N3    1 
ATOM   472  C  C4    . DC  B 2 12  ? 14.46300  68.90700  22.62400  1.000 30.57818 ? 12   DC  T C4    1 
ATOM   473  N  N4    . DC  B 2 12  ? 14.68900  70.20700  22.83100  1.000 40.08507 ? 12   DC  T N4    1 
ATOM   474  C  C5    . DC  B 2 12  ? 13.39800  68.24500  23.30400  1.000 42.61892 ? 12   DC  T C5    1 
ATOM   475  C  C6    . DC  B 2 12  ? 13.21000  66.94400  23.05100  1.000 38.70451 ? 12   DC  T C6    1 
ATOM   476  P  P     . DA  B 2 13  ? 14.84000  60.72800  23.91800  1.000 60.23702 ? 13   DA  T P     1 
ATOM   477  O  OP1   . DA  B 2 13  ? 14.54000  59.28700  23.77200  1.000 56.98251 ? 13   DA  T OP1   1 
ATOM   478  O  OP2   . DA  B 2 13  ? 14.64100  61.41700  25.21800  1.000 41.43904 ? 13   DA  T OP2   1 
ATOM   479  O  "O5'" . DA  B 2 13  ? 16.35300  61.00100  23.47000  1.000 48.83560 ? 13   DA  T "O5'" 1 
ATOM   480  C  "C5'" . DA  B 2 13  ? 16.75700  60.82500  22.12500  1.000 44.46798 ? 13   DA  T "C5'" 1 
ATOM   481  C  "C4'" . DA  B 2 13  ? 18.18300  61.31700  21.94800  1.000 56.56122 ? 13   DA  T "C4'" 1 
ATOM   482  O  "O4'" . DA  B 2 13  ? 18.19900  62.77300  21.93300  1.000 53.83144 ? 13   DA  T "O4'" 1 
ATOM   483  C  "C3'" . DA  B 2 13  ? 19.13300  60.90600  23.06900  1.000 51.52554 ? 13   DA  T "C3'" 1 
ATOM   484  O  "O3'" . DA  B 2 13  ? 20.42600  60.66300  22.55500  1.000 59.11440 ? 13   DA  T "O3'" 1 
ATOM   485  C  "C2'" . DA  B 2 13  ? 19.12400  62.12000  23.98800  1.000 50.75720 ? 13   DA  T "C2'" 1 
ATOM   486  C  "C1'" . DA  B 2 13  ? 19.01000  63.25800  22.98700  1.000 48.85050 ? 13   DA  T "C1'" 1 
ATOM   487  N  N9    . DA  B 2 13  ? 18.38600  64.44900  23.55100  1.000 38.05916 ? 13   DA  T N9    1 
ATOM   488  C  C8    . DA  B 2 13  ? 17.40200  64.48600  24.50000  1.000 47.28053 ? 13   DA  T C8    1 
ATOM   489  N  N7    . DA  B 2 13  ? 17.01700  65.70200  24.82700  1.000 44.80204 ? 13   DA  T N7    1 
ATOM   490  C  C5    . DA  B 2 13  ? 17.81600  66.52600  24.04300  1.000 40.84437 ? 13   DA  T C5    1 
ATOM   491  C  C6    . DA  B 2 13  ? 17.90600  67.93200  23.92900  1.000 31.02595 ? 13   DA  T C6    1 
ATOM   492  N  N6    . DA  B 2 13  ? 17.14700  68.77800  24.64100  1.000 31.67424 ? 13   DA  T N6    1 
ATOM   493  N  N1    . DA  B 2 13  ? 18.80800  68.43000  23.06100  1.000 26.85144 ? 13   DA  T N1    1 
ATOM   494  C  C2    . DA  B 2 13  ? 19.57200  67.57500  22.35400  1.000 30.92012 ? 13   DA  T C2    1 
ATOM   495  N  N3    . DA  B 2 13  ? 19.57800  66.23800  22.37400  1.000 36.61196 ? 13   DA  T N3    1 
ATOM   496  C  C4    . DA  B 2 13  ? 18.67200  65.77000  23.25300  1.000 41.67557 ? 13   DA  T C4    1 
ATOM   497  P  P     . DC  B 2 14  ? 21.54200  59.99900  23.50100  1.000 59.17006 ? 14   DC  T P     1 
ATOM   498  O  OP1   . DC  B 2 14  ? 22.46100  59.22400  22.63400  1.000 60.22798 ? 14   DC  T OP1   1 
ATOM   499  O  OP2   . DC  B 2 14  ? 20.84600  59.39100  24.65900  1.000 58.50124 ? 14   DC  T OP2   1 
ATOM   500  O  "O5'" . DC  B 2 14  ? 22.33000  61.24100  24.10700  1.000 60.73833 ? 14   DC  T "O5'" 1 
ATOM   501  C  "C5'" . DC  B 2 14  ? 22.88400  62.20200  23.24600  1.000 61.13187 ? 14   DC  T "C5'" 1 
ATOM   502  C  "C4'" . DC  B 2 14  ? 23.28000  63.44200  24.02300  1.000 62.46289 ? 14   DC  T "C4'" 1 
ATOM   503  O  "O4'" . DC  B 2 14  ? 22.11600  64.24400  24.31100  1.000 44.51759 ? 14   DC  T "O4'" 1 
ATOM   504  C  "C3'" . DC  B 2 14  ? 23.94800  63.18600  25.38600  1.000 54.60024 ? 14   DC  T "C3'" 1 
ATOM   505  O  "O3'" . DC  B 2 14  ? 25.32300  63.57200  25.32700  1.000 63.19183 ? 14   DC  T "O3'" 1 
ATOM   506  C  "C2'" . DC  B 2 14  ? 23.15100  64.06900  26.36600  1.000 46.66475 ? 14   DC  T "C2'" 1 
ATOM   507  C  "C1'" . DC  B 2 14  ? 22.44500  65.02500  25.41700  1.000 47.64796 ? 14   DC  T "C1'" 1 
ATOM   508  N  N1    . DC  B 2 14  ? 21.21900  65.64500  25.97400  1.000 46.31611 ? 14   DC  T N1    1 
ATOM   509  C  C2    . DC  B 2 14  ? 21.00800  67.01100  25.78600  1.000 39.77632 ? 14   DC  T C2    1 
ATOM   510  O  O2    . DC  B 2 14  ? 21.84000  67.66500  25.14100  1.000 41.59360 ? 14   DC  T O2    1 
ATOM   511  N  N3    . DC  B 2 14  ? 19.89600  67.58100  26.30600  1.000 39.37999 ? 14   DC  T N3    1 
ATOM   512  C  C4    . DC  B 2 14  ? 19.02300  66.84300  26.99800  1.000 37.72224 ? 14   DC  T C4    1 
ATOM   513  N  N4    . DC  B 2 14  ? 17.93800  67.45900  27.49600  1.000 29.94387 ? 14   DC  T N4    1 
ATOM   514  C  C5    . DC  B 2 14  ? 19.22200  65.44200  27.20400  1.000 39.78243 ? 14   DC  T C5    1 
ATOM   515  C  C6    . DC  B 2 14  ? 20.32800  64.89000  26.68300  1.000 41.90592 ? 14   DC  T C6    1 
ATOM   516  P  P     . DC  B 2 15  ? 26.28100  63.41900  26.61100  1.000 70.77798 ? 15   DC  T P     1 
ATOM   517  O  OP1   . DC  B 2 15  ? 27.62300  63.12200  26.05500  1.000 62.84237 ? 15   DC  T OP1   1 
ATOM   518  O  OP2   . DC  B 2 15  ? 25.65200  62.50800  27.59500  1.000 53.83419 ? 15   DC  T OP2   1 
ATOM   519  O  "O5'" . DC  B 2 15  ? 26.30100  64.88600  27.26400  1.000 57.95137 ? 15   DC  T "O5'" 1 
ATOM   520  C  "C5'" . DC  B 2 15  ? 27.10200  65.88800  26.67100  1.000 52.12310 ? 15   DC  T "C5'" 1 
ATOM   521  C  "C4'" . DC  B 2 15  ? 26.80400  67.26200  27.23500  1.000 45.65273 ? 15   DC  T "C4'" 1 
ATOM   522  O  "O4'" . DC  B 2 15  ? 25.44100  67.62700  26.95600  1.000 40.16494 ? 15   DC  T "O4'" 1 
ATOM   523  C  "C3'" . DC  B 2 15  ? 26.89600  67.40200  28.74000  1.000 44.32280 ? 15   DC  T "C3'" 1 
ATOM   524  O  "O3'" . DC  B 2 15  ? 28.26000  67.49200  29.16600  1.000 49.13610 ? 15   DC  T "O3'" 1 
ATOM   525  C  "C2'" . DC  B 2 15  ? 26.17000  68.72300  28.93200  1.000 39.05892 ? 15   DC  T "C2'" 1 
ATOM   526  C  "C1'" . DC  B 2 15  ? 25.06200  68.63600  27.87500  1.000 42.00685 ? 15   DC  T "C1'" 1 
ATOM   527  N  N1    . DC  B 2 15  ? 23.74700  68.29600  28.45700  1.000 41.75824 ? 15   DC  T N1    1 
ATOM   528  C  C2    . DC  B 2 15  ? 22.89900  69.32700  28.85000  1.000 36.40224 ? 15   DC  T C2    1 
ATOM   529  O  O2    . DC  B 2 15  ? 23.26500  70.49500  28.68400  1.000 36.95868 ? 15   DC  T O2    1 
ATOM   530  N  N3    . DC  B 2 15  ? 21.69700  69.01800  29.39200  1.000 39.01180 ? 15   DC  T N3    1 
ATOM   531  C  C4    . DC  B 2 15  ? 21.34500  67.74200  29.54800  1.000 33.93852 ? 15   DC  T C4    1 
ATOM   532  N  N4    . DC  B 2 15  ? 20.15200  67.49000  30.08500  1.000 33.68820 ? 15   DC  T N4    1 
ATOM   533  C  C5    . DC  B 2 15  ? 22.20200  66.67100  29.15900  1.000 43.10747 ? 15   DC  T C5    1 
ATOM   534  C  C6    . DC  B 2 15  ? 23.38700  66.98900  28.62500  1.000 40.94872 ? 15   DC  T C6    1 
ATOM   535  P  P     . DC  B 2 16  ? 28.62800  67.39600  30.73300  1.000 48.43339 ? 16   DC  T P     1 
ATOM   536  O  OP1   . DC  B 2 16  ? 30.09300  67.20600  30.86100  1.000 55.87483 ? 16   DC  T OP1   1 
ATOM   537  O  OP2   . DC  B 2 16  ? 27.69000  66.42000  31.32600  1.000 48.11067 ? 16   DC  T OP2   1 
ATOM   538  O  "O5'" . DC  B 2 16  ? 28.26000  68.83800  31.31600  1.000 37.70619 ? 16   DC  T "O5'" 1 
ATOM   539  C  "C5'" . DC  B 2 16  ? 28.83200  70.00100  30.73500  1.000 42.82909 ? 16   DC  T "C5'" 1 
ATOM   540  C  "C4'" . DC  B 2 16  ? 28.21400  71.24600  31.32600  1.000 41.62017 ? 16   DC  T "C4'" 1 
ATOM   541  O  "O4'" . DC  B 2 16  ? 26.84200  71.36600  30.88800  1.000 43.23554 ? 16   DC  T "O4'" 1 
ATOM   542  C  "C3'" . DC  B 2 16  ? 28.13100  71.25100  32.83600  1.000 50.76419 ? 16   DC  T "C3'" 1 
ATOM   543  O  "O3'" . DC  B 2 16  ? 29.37500  71.69300  33.38200  1.000 63.34433 ? 16   DC  T "O3'" 1 
ATOM   544  C  "C2'" . DC  B 2 16  ? 27.01200  72.26100  33.08300  1.000 46.31851 ? 16   DC  T "C2'" 1 
ATOM   545  C  "C1'" . DC  B 2 16  ? 26.08500  72.03400  31.88500  1.000 37.35547 ? 16   DC  T "C1'" 1 
ATOM   546  N  N1    . DC  B 2 16  ? 24.88600  71.21500  32.21000  1.000 39.60342 ? 16   DC  T N1    1 
ATOM   547  C  C2    . DC  B 2 16  ? 23.77200  71.82900  32.80300  1.000 37.27650 ? 16   DC  T C2    1 
ATOM   548  O  O2    . DC  B 2 16  ? 23.80900  73.04100  33.04800  1.000 43.98138 ? 16   DC  T O2    1 
ATOM   549  N  N3    . DC  B 2 16  ? 22.68300  71.07800  33.09500  1.000 29.16236 ? 16   DC  T N3    1 
ATOM   550  C  C4    . DC  B 2 16  ? 22.67200  69.77000  32.81800  1.000 30.41561 ? 16   DC  T C4    1 
ATOM   551  N  N4    . DC  B 2 16  ? 21.56300  69.07400  33.12600  1.000 31.67612 ? 16   DC  T N4    1 
ATOM   552  C  C5    . DC  B 2 16  ? 23.79800  69.11900  32.21200  1.000 35.55899 ? 16   DC  T C5    1 
ATOM   553  C  C6    . DC  B 2 16  ? 24.87400  69.87600  31.92800  1.000 36.95088 ? 16   DC  T C6    1 
ATOM   554  P  P     . DC  B 2 17  ? 29.80400  71.30900  34.88500  1.000 72.14372 ? 17   DC  T P     1 
ATOM   555  O  OP1   . DC  B 2 17  ? 31.16700  71.86600  35.05500  1.000 72.29832 ? 17   DC  T OP1   1 
ATOM   556  O  OP2   . DC  B 2 17  ? 29.56800  69.86400  35.12300  1.000 45.35911 ? 17   DC  T OP2   1 
ATOM   557  O  "O5'" . DC  B 2 17  ? 28.81900  72.18000  35.79000  1.000 53.20150 ? 17   DC  T "O5'" 1 
ATOM   558  C  "C5'" . DC  B 2 17  ? 28.94000  73.58600  35.75500  1.000 48.75851 ? 17   DC  T "C5'" 1 
ATOM   559  C  "C4'" . DC  B 2 17  ? 27.65800  74.25100  36.19100  1.000 51.43892 ? 17   DC  T "C4'" 1 
ATOM   560  O  "O4'" . DC  B 2 17  ? 26.52100  73.44900  35.77700  1.000 56.64640 ? 17   DC  T "O4'" 1 
ATOM   561  C  "C3'" . DC  B 2 17  ? 27.51100  74.44400  37.70200  1.000 60.95482 ? 17   DC  T "C3'" 1 
ATOM   562  O  "O3'" . DC  B 2 17  ? 27.08800  75.78000  37.97600  1.000 66.84873 ? 17   DC  T "O3'" 1 
ATOM   563  C  "C2'" . DC  B 2 17  ? 26.43300  73.43000  38.08200  1.000 52.62852 ? 17   DC  T "C2'" 1 
ATOM   564  C  "C1'" . DC  B 2 17  ? 25.58900  73.41900  36.82400  1.000 43.96345 ? 17   DC  T "C1'" 1 
ATOM   565  N  N1    . DC  B 2 17  ? 24.74800  72.19900  36.68100  1.000 41.72830 ? 17   DC  T N1    1 
ATOM   566  C  C2    . DC  B 2 17  ? 23.41500  72.21700  37.12300  1.000 36.39635 ? 17   DC  T C2    1 
ATOM   567  O  O2    . DC  B 2 17  ? 22.95600  73.25700  37.61500  1.000 41.04846 ? 17   DC  T O2    1 
ATOM   568  N  N3    . DC  B 2 17  ? 22.66400  71.09400  36.99000  1.000 37.03609 ? 17   DC  T N3    1 
ATOM   569  C  C4    . DC  B 2 17  ? 23.19800  69.99000  36.44800  1.000 37.25762 ? 17   DC  T C4    1 
ATOM   570  N  N4    . DC  B 2 17  ? 22.42000  68.90500  36.33200  1.000 32.58478 ? 17   DC  T N4    1 
ATOM   571  C  C5    . DC  B 2 17  ? 24.55400  69.95200  35.99800  1.000 42.80521 ? 17   DC  T C5    1 
ATOM   572  C  C6    . DC  B 2 17  ? 25.28400  71.06700  36.13400  1.000 49.07998 ? 17   DC  T C6    1 
ATOM   573  N  N     . ILE C 3 3   ? 11.64400  86.15700  -15.19800 1.000 40.56340 ? 307  ILE A N     1 
ATOM   574  C  CA    . ILE C 3 3   ? 12.42700  85.12100  -14.51500 1.000 47.09366 ? 307  ILE A CA    1 
ATOM   575  C  C     . ILE C 3 3   ? 13.46900  85.76000  -13.58400 1.000 34.68646 ? 307  ILE A C     1 
ATOM   576  O  O     . ILE C 3 3   ? 14.34900  86.49600  -14.02500 1.000 38.42384 ? 307  ILE A O     1 
ATOM   577  C  CB    . ILE C 3 3   ? 13.10500  84.16000  -15.52000 1.000 53.67989 ? 307  ILE A CB    1 
ATOM   578  C  CG1   . ILE C 3 3   ? 12.10000  83.14800  -16.09200 1.000 41.63093 ? 307  ILE A CG1   1 
ATOM   579  C  CG2   . ILE C 3 3   ? 14.26200  83.42400  -14.85600 1.000 43.54000 ? 307  ILE A CG2   1 
ATOM   580  C  CD1   . ILE C 3 3   ? 10.97900  83.76200  -16.92600 1.000 40.26530 ? 307  ILE A CD1   1 
ATOM   581  N  N     . VAL C 3 4   ? 13.36300  85.45700  -12.29300 1.000 32.49962 ? 308  VAL A N     1 
ATOM   582  C  CA    . VAL C 3 4   ? 14.05800  86.18500  -11.23400 1.000 30.78475 ? 308  VAL A CA    1 
ATOM   583  C  C     . VAL C 3 4   ? 15.01300  85.22700  -10.54100 1.000 23.90388 ? 308  VAL A C     1 
ATOM   584  O  O     . VAL C 3 4   ? 14.57700  84.29100  -9.85900  1.000 20.07832 ? 308  VAL A O     1 
ATOM   585  C  CB    . VAL C 3 4   ? 13.07100  86.78400  -10.23100 1.000 30.86435 ? 308  VAL A CB    1 
ATOM   586  C  CG1   . VAL C 3 4   ? 12.42000  88.01000  -10.83100 1.000 39.92971 ? 308  VAL A CG1   1 
ATOM   587  C  CG2   . VAL C 3 4   ? 12.00900  85.75300  -9.89500  1.000 37.39391 ? 308  VAL A CG2   1 
ATOM   588  N  N     . ALA C 3 5   ? 16.31000  85.45900  -10.70800 1.000 19.59626 ? 309  ALA A N     1 
ATOM   589  C  CA    . ALA C 3 5   ? 17.31300  84.59700  -10.10000 1.000 20.88385 ? 309  ALA A CA    1 
ATOM   590  C  C     . ALA C 3 5   ? 17.52000  84.99200  -8.64400  1.000 20.31093 ? 309  ALA A C     1 
ATOM   591  O  O     . ALA C 3 5   ? 17.14600  86.08600  -8.21700  1.000 21.43630 ? 309  ALA A O     1 
ATOM   592  C  CB    . ALA C 3 5   ? 18.62500  84.67300  -10.87300 1.000 16.71597 ? 309  ALA A CB    1 
ATOM   593  N  N     . CYS C 3 6   ? 18.09700  84.07300  -7.86800  1.000 19.54927 ? 310  CYS A N     1 
ATOM   594  C  CA    . CYS C 3 6   ? 18.20800  84.28400  -6.42900  1.000 13.76283 ? 310  CYS A CA    1 
ATOM   595  C  C     . CYS C 3 6   ? 19.23600  85.35200  -6.06200  1.000 14.21588 ? 310  CYS A C     1 
ATOM   596  O  O     . CYS C 3 6   ? 19.25800  85.80500  -4.91700  1.000 13.63558 ? 310  CYS A O     1 
ATOM   597  C  CB    . CYS C 3 6   ? 18.54300  82.96600  -5.74100  1.000 13.54348 ? 310  CYS A CB    1 
ATOM   598  S  SG    . CYS C 3 6   ? 20.14900  82.26100  -6.32300  1.000 19.43927 ? 310  CYS A SG    1 
ATOM   599  N  N     . ASP C 3 7   ? 20.10800  85.74200  -6.97400  1.000 15.01467 ? 311  ASP A N     1 
ATOM   600  C  CA    . ASP C 3 7   ? 20.98100  86.88400  -6.73100  1.000 15.40788 ? 311  ASP A CA    1 
ATOM   601  C  C     . ASP C 3 7   ? 20.34100  88.20000  -7.16100  1.000 18.76267 ? 311  ASP A C     1 
ATOM   602  O  O     . ASP C 3 7   ? 20.96900  89.25100  -7.03500  1.000 19.45950 ? 311  ASP A O     1 
ATOM   603  C  CB    . ASP C 3 7   ? 22.32700  86.69600  -7.44900  1.000 23.95690 ? 311  ASP A CB    1 
ATOM   604  C  CG    . ASP C 3 7   ? 22.20700  86.81300  -8.97900  1.000 30.36932 ? 311  ASP A CG    1 
ATOM   605  O  OD1   . ASP C 3 7   ? 21.19100  86.34900  -9.53500  1.000 21.50780 ? 311  ASP A OD1   1 
ATOM   606  O  OD2   . ASP C 3 7   ? 23.12400  87.37500  -9.62700  1.000 31.35048 ? 311  ASP A OD2   1 
ATOM   607  N  N     . ASP C 3 8   ? 19.11200  88.16600  -7.65700  1.000 16.83019 ? 312  ASP A N     1 
ATOM   608  C  CA    . ASP C 3 8   ? 18.40000  89.38100  -8.03600  1.000 19.31456 ? 312  ASP A CA    1 
ATOM   609  C  C     . ASP C 3 8   ? 17.74200  89.99000  -6.80400  1.000 14.78005 ? 312  ASP A C     1 
ATOM   610  O  O     . ASP C 3 8   ? 17.11200  89.27100  -6.02600  1.000 15.03321 ? 312  ASP A O     1 
ATOM   611  C  CB    . ASP C 3 8   ? 17.34600  89.07400  -9.09300  1.000 18.19931 ? 312  ASP A CB    1 
ATOM   612  C  CG    . ASP C 3 8   ? 16.74100  90.32500  -9.70800  1.000 19.89863 ? 312  ASP A CG    1 
ATOM   613  O  OD1   . ASP C 3 8   ? 15.95500  91.04200  -9.02700  1.000 19.42627 ? 312  ASP A OD1   1 
ATOM   614  O  OD2   . ASP C 3 8   ? 17.05600  90.58900  -10.87900 1.000 26.51237 ? 312  ASP A OD2   1 
ATOM   615  N  N     . PRO C 3 9   ? 17.87000  91.29500  -6.58400  1.000 15.43041 ? 313  PRO A N     1 
ATOM   616  C  CA    . PRO C 3 9   ? 17.23800  91.89100  -5.39500  1.000 15.76178 ? 313  PRO A CA    1 
ATOM   617  C  C     . PRO C 3 9   ? 15.72800  91.63400  -5.29200  1.000 16.32749 ? 313  PRO A C     1 
ATOM   618  O  O     . PRO C 3 9   ? 15.17800  91.74900  -4.19400  1.000 17.09710 ? 313  PRO A O     1 
ATOM   619  C  CB    . PRO C 3 9   ? 17.55200  93.38600  -5.55300  1.000 16.65787 ? 313  PRO A CB    1 
ATOM   620  C  CG    . PRO C 3 9   ? 18.82200  93.41600  -6.35500  1.000 18.58017 ? 313  PRO A CG    1 
ATOM   621  C  CD    . PRO C 3 9   ? 18.70300  92.26300  -7.32500  1.000 18.32445 ? 313  PRO A CD    1 
ATOM   622  N  N     . ASP C 3 10  ? 15.04600  91.28600  -6.38400  1.000 16.24597 ? 314  ASP A N     1 
ATOM   623  C  CA    . ASP C 3 10  ? 13.60800  91.03600  -6.34800  1.000 20.40064 ? 314  ASP A CA    1 
ATOM   624  C  C     . ASP C 3 10  ? 13.23900  89.58600  -6.04400  1.000 18.53984 ? 314  ASP A C     1 
ATOM   625  O  O     . ASP C 3 10  ? 12.04600  89.27000  -6.04000  1.000 12.00322 ? 314  ASP A O     1 
ATOM   626  C  CB    . ASP C 3 10  ? 12.95200  91.40000  -7.68400  1.000 20.99745 ? 314  ASP A CB    1 
ATOM   627  C  CG    . ASP C 3 10  ? 12.95100  92.89100  -7.97300  1.000 19.21134 ? 314  ASP A CG    1 
ATOM   628  O  OD1   . ASP C 3 10  ? 12.93300  93.70800  -7.03700  1.000 16.59157 ? 314  ASP A OD1   1 
ATOM   629  O  OD2   . ASP C 3 10  ? 12.95100  93.23500  -9.17200  1.000 17.94118 ? 314  ASP A OD2   1 
ATOM   630  N  N     . PHE C 3 11  ? 14.21800  88.69900  -5.80800  1.000 16.58205 ? 315  PHE A N     1 
ATOM   631  C  CA    . PHE C 3 11  ? 13.92700  87.26700  -5.74300  1.000 17.77365 ? 315  PHE A CA    1 
ATOM   632  C  C     . PHE C 3 11  ? 12.94500  86.94100  -4.62000  1.000 20.50377 ? 315  PHE A C     1 
ATOM   633  O  O     . PHE C 3 11  ? 11.95200  86.23000  -4.83500  1.000 21.64620 ? 315  PHE A O     1 
ATOM   634  C  CB    . PHE C 3 11  ? 15.21800  86.46000  -5.56300  1.000 16.31229 ? 315  PHE A CB    1 
ATOM   635  C  CG    . PHE C 3 11  ? 14.98000  85.00100  -5.31800  1.000 17.70214 ? 315  PHE A CG    1 
ATOM   636  C  CD1   . PHE C 3 11  ? 14.74600  84.13700  -6.37900  1.000 20.93185 ? 315  PHE A CD1   1 
ATOM   637  C  CD2   . PHE C 3 11  ? 14.98200  84.48600  -4.02900  1.000 25.45614 ? 315  PHE A CD2   1 
ATOM   638  C  CE1   . PHE C 3 11  ? 14.53100  82.78200  -6.16400  1.000 23.02526 ? 315  PHE A CE1   1 
ATOM   639  C  CE2   . PHE C 3 11  ? 14.76100  83.12200  -3.80200  1.000 20.90676 ? 315  PHE A CE2   1 
ATOM   640  C  CZ    . PHE C 3 11  ? 14.53900  82.27100  -4.87700  1.000 16.97158 ? 315  PHE A CZ    1 
ATOM   641  N  N     . LEU C 3 12  ? 13.22800  87.42200  -3.40400  1.000 15.36318 ? 316  LEU A N     1 
ATOM   642  C  CA    . LEU C 3 12  ? 12.36900  87.12600  -2.26100  1.000 20.95043 ? 316  LEU A CA    1 
ATOM   643  C  C     . LEU C 3 12  ? 10.91500  87.51600  -2.53900  1.000 21.40737 ? 316  LEU A C     1 
ATOM   644  O  O     . LEU C 3 12  ? 9.98200   86.75300  -2.24300  1.000 13.45612 ? 316  LEU A O     1 
ATOM   645  C  CB    . LEU C 3 12  ? 12.90300  87.86100  -1.02700  1.000 25.25809 ? 316  LEU A CB    1 
ATOM   646  C  CG    . LEU C 3 12  ? 12.90800  87.22400  0.36500   1.000 30.80953 ? 316  LEU A CG    1 
ATOM   647  C  CD1   . LEU C 3 12  ? 13.47100  85.79600  0.37500   1.000 18.75499 ? 316  LEU A CD1   1 
ATOM   648  C  CD2   . LEU C 3 12  ? 13.71300  88.10600  1.29800   1.000 18.48077 ? 316  LEU A CD2   1 
ATOM   649  N  N     . THR C 3 13  ? 10.70700  88.69200  -3.13400  1.000 22.44556 ? 317  THR A N     1 
ATOM   650  C  CA    . THR C 3 13  ? 9.35100   89.15300  -3.42800  1.000 22.03893 ? 317  THR A CA    1 
ATOM   651  C  C     . THR C 3 13  ? 8.65900   88.24500  -4.44100  1.000 17.70712 ? 317  THR A C     1 
ATOM   652  O  O     . THR C 3 13  ? 7.47300   87.93200  -4.29300  1.000 16.41346 ? 317  THR A O     1 
ATOM   653  C  CB    . THR C 3 13  ? 9.39500   90.59100  -3.95400  1.000 21.64280 ? 317  THR A CB    1 
ATOM   654  O  OG1   . THR C 3 13  ? 10.05300  91.42700  -3.00000  1.000 21.80277 ? 317  THR A OG1   1 
ATOM   655  C  CG2   . THR C 3 13  ? 7.98600   91.11200  -4.20300  1.000 22.65880 ? 317  THR A CG2   1 
ATOM   656  N  N     . SER C 3 14  ? 9.37700   87.82800  -5.48400  1.000 17.32371 ? 318  SER A N     1 
ATOM   657  C  CA    . SER C 3 14  ? 8.78200   86.95700  -6.49700  1.000 17.07913 ? 318  SER A CA    1 
ATOM   658  C  C     . SER C 3 14  ? 8.51600   85.56300  -5.95800  1.000 18.88419 ? 318  SER A C     1 
ATOM   659  O  O     . SER C 3 14  ? 7.46600   84.96200  -6.24600  1.000 18.94288 ? 318  SER A O     1 
ATOM   660  C  CB    . SER C 3 14  ? 9.68900   86.87000  -7.72100  1.000 16.24006 ? 318  SER A CB    1 
ATOM   661  O  OG    . SER C 3 14  ? 9.12200   86.02500  -8.70800  1.000 16.96373 ? 318  SER A OG    1 
ATOM   662  N  N     . TYR C 3 15  ? 9.47000   85.02000  -5.21100  1.000 15.98530 ? 319  TYR A N     1 
ATOM   663  C  CA    . TYR C 3 15  ? 9.29500   83.69000  -4.64700  1.000 17.18374 ? 319  TYR A CA    1 
ATOM   664  C  C     . TYR C 3 15  ? 8.07600   83.64100  -3.73300  1.000 17.16413 ? 319  TYR A C     1 
ATOM   665  O  O     . TYR C 3 15  ? 7.18400   82.79800  -3.90600  1.000 17.09291 ? 319  TYR A O     1 
ATOM   666  C  CB    . TYR C 3 15  ? 10.55300  83.27800  -3.88500  1.000 16.97526 ? 319  TYR A CB    1 
ATOM   667  C  CG    . TYR C 3 15  ? 10.44900  81.89700  -3.30800  1.000 16.36715 ? 319  TYR A CG    1 
ATOM   668  C  CD1   . TYR C 3 15  ? 10.09000  80.82900  -4.11500  1.000 13.96823 ? 319  TYR A CD1   1 
ATOM   669  C  CD2   . TYR C 3 15  ? 10.70100  81.65700  -1.96100  1.000 18.71740 ? 319  TYR A CD2   1 
ATOM   670  C  CE1   . TYR C 3 15  ? 9.98300   79.55900  -3.61200  1.000 12.18066 ? 319  TYR A CE1   1 
ATOM   671  C  CE2   . TYR C 3 15  ? 10.59700  80.37700  -1.43600  1.000 17.07871 ? 319  TYR A CE2   1 
ATOM   672  C  CZ    . TYR C 3 15  ? 10.22900  79.32900  -2.28000  1.000 16.15330 ? 319  TYR A CZ    1 
ATOM   673  O  OH    . TYR C 3 15  ? 10.13400  78.04300  -1.80800  1.000 17.39579 ? 319  TYR A OH    1 
ATOM   674  N  N     . PHE C 3 16  ? 8.02800   84.55100  -2.75100  1.000 15.65721 ? 320  PHE A N     1 
ATOM   675  C  CA    . PHE C 3 16  ? 6.91200   84.63000  -1.81700  1.000 15.97860 ? 320  PHE A CA    1 
ATOM   676  C  C     . PHE C 3 16  ? 5.57900   84.93200  -2.52100  1.000 18.18623 ? 320  PHE A C     1 
ATOM   677  O  O     . PHE C 3 16  ? 4.53000   84.44100  -2.09100  1.000 13.70633 ? 320  PHE A O     1 
ATOM   678  C  CB    . PHE C 3 16  ? 7.24100   85.68300  -0.74300  1.000 17.75768 ? 320  PHE A CB    1 
ATOM   679  C  CG    . PHE C 3 16  ? 8.16600   85.17700  0.37100   1.000 16.21990 ? 320  PHE A CG    1 
ATOM   680  C  CD1   . PHE C 3 16  ? 8.57900   83.85000  0.41600   1.000 19.43782 ? 320  PHE A CD1   1 
ATOM   681  C  CD2   . PHE C 3 16  ? 8.60800   86.02800  1.37000   1.000 17.76861 ? 320  PHE A CD2   1 
ATOM   682  C  CE1   . PHE C 3 16  ? 9.42000   83.38300  1.44200   1.000 15.14885 ? 320  PHE A CE1   1 
ATOM   683  C  CE2   . PHE C 3 16  ? 9.46600   85.57000  2.38800   1.000 20.06628 ? 320  PHE A CE2   1 
ATOM   684  C  CZ    . PHE C 3 16  ? 9.86100   84.24800  2.42200   1.000 18.37956 ? 320  PHE A CZ    1 
ATOM   685  N  N     . ALA C 3 17  ? 5.58500   85.72700  -3.60100  1.000 17.65835 ? 321  ALA A N     1 
ATOM   686  C  CA    . ALA C 3 17  ? 4.33200   85.96600  -4.32300  1.000 20.04307 ? 321  ALA A CA    1 
ATOM   687  C  C     . ALA C 3 17  ? 3.80900   84.69500  -4.99400  1.000 19.91033 ? 321  ALA A C     1 
ATOM   688  O  O     . ALA C 3 17  ? 2.58700   84.52800  -5.13300  1.000 17.83117 ? 321  ALA A O     1 
ATOM   689  C  CB    . ALA C 3 17  ? 4.50500   87.07600  -5.36800  1.000 15.78361 ? 321  ALA A CB    1 
ATOM   690  N  N     . HIS C 3 18  ? 4.71100   83.79200  -5.40600  1.000 15.26773 ? 322  HIS A N     1 
ATOM   691  C  CA    . HIS C 3 18  ? 4.33900   82.55300  -6.08200  1.000 17.91976 ? 322  HIS A CA    1 
ATOM   692  C  C     . HIS C 3 18  ? 4.15000   81.37700  -5.15000  1.000 15.14501 ? 322  HIS A C     1 
ATOM   693  O  O     . HIS C 3 18  ? 3.52400   80.39100  -5.55600  1.000 17.41969 ? 322  HIS A O     1 
ATOM   694  C  CB    . HIS C 3 18  ? 5.41400   82.12200  -7.08700  1.000 19.11360 ? 322  HIS A CB    1 
ATOM   695  C  CG    . HIS C 3 18  ? 5.42200   82.91700  -8.34700  1.000 20.21525 ? 322  HIS A CG    1 
ATOM   696  N  ND1   . HIS C 3 18  ? 6.12400   84.09400  -8.46700  1.000 16.41039 ? 322  HIS A ND1   1 
ATOM   697  C  CD2   . HIS C 3 18  ? 4.82200   82.70300  -9.54200  1.000 19.41107 ? 322  HIS A CD2   1 
ATOM   698  C  CE1   . HIS C 3 18  ? 5.95300   84.57600  -9.68600  1.000 20.47229 ? 322  HIS A CE1   1 
ATOM   699  N  NE2   . HIS C 3 18  ? 5.17000   83.75100  -10.35900 1.000 19.78392 ? 322  HIS A NE2   1 
ATOM   700  N  N     . SER C 3 19  ? 4.73200   81.41800  -3.95600  1.000 10.39809 ? 323  SER A N     1 
ATOM   701  C  CA    . SER C 3 19  ? 4.77500   80.25600  -3.06900  1.000 14.73531 ? 323  SER A CA    1 
ATOM   702  C  C     . SER C 3 19  ? 3.46700   80.08200  -2.31000  1.000 16.03594 ? 323  SER A C     1 
ATOM   703  O  O     . SER C 3 19  ? 3.16800   80.86900  -1.41600  1.000 14.74296 ? 323  SER A O     1 
ATOM   704  C  CB    . SER C 3 19  ? 5.90600   80.39200  -2.06500  1.000 10.86432 ? 323  SER A CB    1 
ATOM   705  O  OG    . SER C 3 19  ? 5.75800   79.40600  -1.07900  1.000 13.33601 ? 323  SER A OG    1 
ATOM   706  N  N     . ARG C 3 20  ? 2.73300   79.00300  -2.59800  1.000 16.76235 ? 324  ARG A N     1 
ATOM   707  C  CA    . ARG C 3 20  ? 1.50600   78.75100  -1.84800  1.000 15.68499 ? 324  ARG A CA    1 
ATOM   708  C  C     . ARG C 3 20  ? 1.79200   78.42400  -0.38700  1.000 17.37971 ? 324  ARG A C     1 
ATOM   709  O  O     . ARG C 3 20  ? 0.96500   78.72400  0.48000   1.000 14.66585 ? 324  ARG A O     1 
ATOM   710  C  CB    . ARG C 3 20  ? 0.70200   77.61400  -2.47700  1.000 18.23523 ? 324  ARG A CB    1 
ATOM   711  C  CG    . ARG C 3 20  ? 1.01700   76.23000  -1.87200  1.000 15.74132 ? 324  ARG A CG    1 
ATOM   712  C  CD    . ARG C 3 20  ? 1.87500   75.39900  -2.79200  1.000 17.18364 ? 324  ARG A CD    1 
ATOM   713  N  NE    . ARG C 3 20  ? 2.01600   74.01900  -2.32300  1.000 25.41167 ? 324  ARG A NE    1 
ATOM   714  C  CZ    . ARG C 3 20  ? 3.06800   73.24000  -2.57600  1.000 19.28004 ? 324  ARG A CZ    1 
ATOM   715  N  NH1   . ARG C 3 20  ? 4.07800   73.68600  -3.31000  1.000 25.58397 ? 324  ARG A NH1   1 
ATOM   716  N  NH2   . ARG C 3 20  ? 3.08900   71.99700  -2.10500  1.000 28.94371 ? 324  ARG A NH2   1 
ATOM   717  N  N     . LEU C 3 21  ? 2.95000   77.82300  -0.08400  1.000 14.68696 ? 325  LEU A N     1 
ATOM   718  C  CA    . LEU C 3 21  ? 3.25500   77.54200  1.31500   1.000 15.49116 ? 325  LEU A CA    1 
ATOM   719  C  C     . LEU C 3 21  ? 3.57200   78.82100  2.07000   1.000 17.05885 ? 325  LEU A C     1 
ATOM   720  O  O     . LEU C 3 21  ? 3.16000   78.97700  3.22800   1.000 16.70731 ? 325  LEU A O     1 
ATOM   721  C  CB    . LEU C 3 21  ? 4.41600   76.56100  1.45400   1.000 10.64841 ? 325  LEU A CB    1 
ATOM   722  C  CG    . LEU C 3 21  ? 4.25300   75.22400  0.75000   1.000 17.80170 ? 325  LEU A CG    1 
ATOM   723  C  CD1   . LEU C 3 21  ? 5.57600   74.43900  0.79000   1.000 19.36943 ? 325  LEU A CD1   1 
ATOM   724  C  CD2   . LEU C 3 21  ? 3.11200   74.44200  1.37900   1.000 19.43721 ? 325  LEU A CD2   1 
ATOM   725  N  N     . HIS C 3 22  ? 4.31900   79.73600  1.44400   1.000 15.27961 ? 326  HIS A N     1 
ATOM   726  C  CA    . HIS C 3 22  ? 4.49900   81.05300  2.04200   1.000 12.17985 ? 326  HIS A CA    1 
ATOM   727  C  C     . HIS C 3 22  ? 3.15300   81.74300  2.25200   1.000 15.42040 ? 326  HIS A C     1 
ATOM   728  O  O     . HIS C 3 22  ? 2.88800   82.29200  3.32600   1.000 14.87099 ? 326  HIS A O     1 
ATOM   729  C  CB    . HIS C 3 22  ? 5.38900   81.94900  1.18900   1.000 10.75077 ? 326  HIS A CB    1 
ATOM   730  C  CG    . HIS C 3 22  ? 5.31800   83.38900  1.60500   1.000 13.79235 ? 326  HIS A CG    1 
ATOM   731  N  ND1   . HIS C 3 22  ? 5.90500   83.85300  2.76400   1.000 14.87411 ? 326  HIS A ND1   1 
ATOM   732  C  CD2   . HIS C 3 22  ? 4.64900   84.44200  1.07800   1.000 15.49154 ? 326  HIS A CD2   1 
ATOM   733  C  CE1   . HIS C 3 22  ? 5.62900   85.13800  2.91400   1.000 12.74904 ? 326  HIS A CE1   1 
ATOM   734  N  NE2   . HIS C 3 22  ? 4.88200   85.52600  1.89500   1.000 16.25435 ? 326  HIS A NE2   1 
ATOM   735  N  N     . HIS C 3 23  ? 2.30900   81.77000  1.21700   1.000 10.32739 ? 327  HIS A N     1 
ATOM   736  C  CA    . HIS C 3 23  ? 0.99600   82.39600  1.36300   1.000 14.62954 ? 327  HIS A CA    1 
ATOM   737  C  C     . HIS C 3 23  ? 0.21200   81.80400  2.53300   1.000 12.75615 ? 327  HIS A C     1 
ATOM   738  O  O     . HIS C 3 23  ? -0.35200  82.54200  3.34700   1.000 14.15142 ? 327  HIS A O     1 
ATOM   739  C  CB    . HIS C 3 23  ? 0.21400   82.25900  0.06000   1.000 18.68756 ? 327  HIS A CB    1 
ATOM   740  C  CG    . HIS C 3 23  ? 0.60100   83.26600  -0.97600  1.000 19.04823 ? 327  HIS A CG    1 
ATOM   741  N  ND1   . HIS C 3 23  ? 0.28200   84.60100  -0.86600  1.000 25.70573 ? 327  HIS A ND1   1 
ATOM   742  C  CD2   . HIS C 3 23  ? 1.29000   83.13900  -2.13500  1.000 18.37272 ? 327  HIS A CD2   1 
ATOM   743  C  CE1   . HIS C 3 23  ? 0.75200   85.25300  -1.91600  1.000 25.73470 ? 327  HIS A CE1   1 
ATOM   744  N  NE2   . HIS C 3 23  ? 1.36700   84.39000  -2.70200  1.000 18.42512 ? 327  HIS A NE2   1 
ATOM   745  N  N     . LEU C 3 24  ? 0.21300   80.47700  2.66600   1.000 15.51715 ? 328  LEU A N     1 
ATOM   746  C  CA    . LEU C 3 24  ? -0.55800  79.84800  3.73500   1.000 15.13501 ? 328  LEU A CA    1 
ATOM   747  C  C     . LEU C 3 24  ? -0.04400  80.26500  5.10100   1.000 17.23939 ? 328  LEU A C     1 
ATOM   748  O  O     . LEU C 3 24  ? -0.83200  80.52000  6.01600   1.000 17.79311 ? 328  LEU A O     1 
ATOM   749  C  CB    . LEU C 3 24  ? -0.51100  78.32700  3.59600   1.000 16.31355 ? 328  LEU A CB    1 
ATOM   750  C  CG    . LEU C 3 24  ? -1.41900  77.71800  2.51100   1.000 19.75215 ? 328  LEU A CG    1 
ATOM   751  C  CD1   . LEU C 3 24  ? -1.04100  76.24600  2.25700   1.000 20.44981 ? 328  LEU A CD1   1 
ATOM   752  C  CD2   . LEU C 3 24  ? -2.91400  77.83200  2.86700   1.000 17.78154 ? 328  LEU A CD2   1 
ATOM   753  N  N     . SER C 3 25  ? 1.28100   80.32700  5.25800   1.000 17.56117 ? 329  SER A N     1 
ATOM   754  C  CA    . SER C 3 25  ? 1.87800   80.72000  6.53000   1.000 17.02316 ? 329  SER A CA    1 
ATOM   755  C  C     . SER C 3 25  ? 1.54500   82.16400  6.87300   1.000 14.77243 ? 329  SER A C     1 
ATOM   756  O  O     . SER C 3 25  ? 1.15600   82.47000  8.00700   1.000 16.30460 ? 329  SER A O     1 
ATOM   757  C  CB    . SER C 3 25  ? 3.39700   80.52600  6.47100   1.000 18.11013 ? 329  SER A CB    1 
ATOM   758  O  OG    . SER C 3 25  ? 3.72900   79.15200  6.40700   1.000 24.51497 ? 329  SER A OG    1 
ATOM   759  N  N     . ALA C 3 26  ? 1.70800   83.07300  5.90600   1.000 16.42112 ? 330  ALA A N     1 
ATOM   760  C  CA    . ALA C 3 26  ? 1.45500   84.48500  6.18600   1.000 13.54688 ? 330  ALA A CA    1 
ATOM   761  C  C     . ALA C 3 26  ? -0.02300  84.74100  6.48800   1.000 16.53099 ? 330  ALA A C     1 
ATOM   762  O  O     . ALA C 3 26  ? -0.35100  85.48000  7.42100   1.000 18.23062 ? 330  ALA A O     1 
ATOM   763  C  CB    . ALA C 3 26  ? 1.91500   85.35200  5.01900   1.000 10.34043 ? 330  ALA A CB    1 
ATOM   764  N  N     . TRP C 3 27  ? -0.89600  84.06800  5.73100   1.000 19.78011 ? 331  TRP A N     1 
ATOM   765  C  CA    . TRP C 3 27  ? -2.36400  84.17200  5.94600   1.000 13.51906 ? 331  TRP A CA    1 
ATOM   766  C  C     . TRP C 3 27  ? -2.68300  83.67500  7.36100   1.000 14.92634 ? 331  TRP A C     1 
ATOM   767  O  O     . TRP C 3 27  ? -3.52500  84.30400  8.03300   1.000 21.04489 ? 331  TRP A O     1 
ATOM   768  C  CB    . TRP C 3 27  ? -3.12300  83.37200  4.88000   1.000 13.70204 ? 331  TRP A CB    1 
ATOM   769  C  CG    . TRP C 3 27  ? -3.15200  84.02700  3.53300   1.000 17.43409 ? 331  TRP A CG    1 
ATOM   770  C  CD1   . TRP C 3 27  ? -3.13300  85.36600  3.26900   1.000 17.68553 ? 331  TRP A CD1   1 
ATOM   771  C  CD2   . TRP C 3 27  ? -3.20400  83.36900  2.25500   1.000 19.60256 ? 331  TRP A CD2   1 
ATOM   772  N  NE1   . TRP C 3 27  ? -3.17100  85.58600  1.91900   1.000 22.48180 ? 331  TRP A NE1   1 
ATOM   773  C  CE2   . TRP C 3 27  ? -3.21500  84.38000  1.27100   1.000 19.29366 ? 331  TRP A CE2   1 
ATOM   774  C  CE3   . TRP C 3 27  ? -3.24400  82.03100  1.84700   1.000 18.09946 ? 331  TRP A CE3   1 
ATOM   775  C  CZ2   . TRP C 3 27  ? -3.26300  84.09000  -0.09200  1.000 24.01798 ? 331  TRP A CZ2   1 
ATOM   776  C  CZ3   . TRP C 3 27  ? -3.29100  81.74600  0.50000   1.000 21.12639 ? 331  TRP A CZ3   1 
ATOM   777  C  CH2   . TRP C 3 27  ? -3.30000  82.76400  -0.45400  1.000 19.54249 ? 331  TRP A CH2   1 
ATOM   778  N  N     . LYS C 3 28  ? -2.02900  82.58700  7.78400   1.000 19.66379 ? 332  LYS A N     1 
ATOM   779  C  CA    . LYS C 3 28  ? -2.22600  82.03700  9.12200   1.000 17.48028 ? 332  LYS A CA    1 
ATOM   780  C  C     . LYS C 3 28  ? -1.75900  83.01600  10.19900  1.000 18.35116 ? 332  LYS A C     1 
ATOM   781  O  O     . LYS C 3 28  ? -2.48400  83.29200  11.16200  1.000 18.23959 ? 332  LYS A O     1 
ATOM   782  C  CB    . LYS C 3 28  ? -1.49900  80.69500  9.24000   1.000 15.83681 ? 332  LYS A CB    1 
ATOM   783  C  CG    . LYS C 3 28  ? -1.50800  80.10700  10.64600  1.000 19.90082 ? 332  LYS A CG    1 
ATOM   784  C  CD    . LYS C 3 28  ? -0.93100  78.69000  10.68900  1.000 22.16036 ? 332  LYS A CD    1 
ATOM   785  C  CE    . LYS C 3 28  ? 0.48500   78.62200  10.13200  1.000 27.14137 ? 332  LYS A CE    1 
ATOM   786  N  NZ    . LYS C 3 28  ? 1.28800   77.52800  10.77300  1.000 31.98221 ? 332  LYS A NZ    1 
ATOM   787  N  N     . ALA C 3 29  ? -0.55600  83.56700  10.04100  1.000 18.13080 ? 333  ALA A N     1 
ATOM   788  C  CA    . ALA C 3 29  ? -0.04800  84.52700  11.01700  1.000 22.38062 ? 333  ALA A CA    1 
ATOM   789  C  C     . ALA C 3 29  ? -0.94000  85.75600  11.08700  1.000 16.18372 ? 333  ALA A C     1 
ATOM   790  O  O     . ALA C 3 29  ? -1.17300  86.30500  12.16900  1.000 14.86432 ? 333  ALA A O     1 
ATOM   791  C  CB    . ALA C 3 29  ? 1.38100   84.94100  10.65600  1.000 14.82097 ? 333  ALA A CB    1 
ATOM   792  N  N     A ASN C 3 30  ? -1.42000  86.22400  9.93400   0.850 16.52628 ? 334  ASN A N     1 
ATOM   793  N  N     B ASN C 3 30  ? -1.42700  86.21500  9.93100   0.150 17.02170 ? 334  ASN A N     1 
ATOM   794  C  CA    A ASN C 3 30  ? -2.28500  87.39800  9.91000   0.850 17.90611 ? 334  ASN A CA    1 
ATOM   795  C  CA    B ASN C 3 30  ? -2.29700  87.38500  9.89300   0.150 17.78786 ? 334  ASN A CA    1 
ATOM   796  C  C     A ASN C 3 30  ? -3.59700  87.14600  10.65700  0.850 18.48899 ? 334  ASN A C     1 
ATOM   797  C  C     B ASN C 3 30  ? -3.58900  87.13800  10.66200  0.150 18.28552 ? 334  ASN A C     1 
ATOM   798  O  O     A ASN C 3 30  ? -4.09700  88.03000  11.36200  0.850 17.50779 ? 334  ASN A O     1 
ATOM   799  O  O     B ASN C 3 30  ? -4.07300  88.02200  11.38000  0.150 17.43627 ? 334  ASN A O     1 
ATOM   800  C  CB    A ASN C 3 30  ? -2.55200  87.81100  8.46100   0.850 18.57110 ? 334  ASN A CB    1 
ATOM   801  C  CB    B ASN C 3 30  ? -2.59600  87.75400  8.44100   0.150 18.52969 ? 334  ASN A CB    1 
ATOM   802  C  CG    A ASN C 3 30  ? -1.31500  88.39400  7.77700   0.850 20.13813 ? 334  ASN A CG    1 
ATOM   803  C  CG    B ASN C 3 30  ? -3.28400  89.09400  8.30800   0.150 19.04942 ? 334  ASN A CG    1 
ATOM   804  O  OD1   A ASN C 3 30  ? -0.26500  88.55900  8.39700   0.850 21.40032 ? 334  ASN A OD1   1 
ATOM   805  O  OD1   B ASN C 3 30  ? -3.36500  89.86500  9.26600   0.150 19.12788 ? 334  ASN A OD1   1 
ATOM   806  N  ND2   A ASN C 3 30  ? -1.44000  88.70900  6.50200   0.850 16.93132 ? 334  ASN A ND2   1 
ATOM   807  N  ND2   B ASN C 3 30  ? -3.79200  89.37900  7.11300   0.150 20.97878 ? 334  ASN A ND2   1 
ATOM   808  N  N     . LEU C 3 31  ? -4.16100  85.94100  10.52600  1.000 16.27853 ? 335  LEU A N     1 
ATOM   809  C  CA    . LEU C 3 31  ? -5.38800  85.62400  11.24100  1.000 18.19294 ? 335  LEU A CA    1 
ATOM   810  C  C     . LEU C 3 31  ? -5.14600  85.57600  12.74600  1.000 19.92410 ? 335  LEU A C     1 
ATOM   811  O  O     . LEU C 3 31  ? -6.00900  85.97800  13.53800  1.000 20.08293 ? 335  LEU A O     1 
ATOM   812  C  CB    . LEU C 3 31  ? -5.95100  84.28700  10.73600  1.000 17.05450 ? 335  LEU A CB    1 
ATOM   813  C  CG    . LEU C 3 31  ? -6.58300  84.27200  9.33400   1.000 19.47834 ? 335  LEU A CG    1 
ATOM   814  C  CD1   . LEU C 3 31  ? -6.66500  82.84400  8.80500   1.000 22.12320 ? 335  LEU A CD1   1 
ATOM   815  C  CD2   . LEU C 3 31  ? -7.96900  84.91100  9.36200   1.000 12.97839 ? 335  LEU A CD2   1 
ATOM   816  N  N     . LYS C 3 32  ? -3.98500  85.06900  13.16000  1.000 15.99270 ? 336  LYS A N     1 
ATOM   817  C  CA    . LYS C 3 32  ? -3.68600  84.99100  14.58300  1.000 19.60607 ? 336  LYS A CA    1 
ATOM   818  C  C     . LYS C 3 32  ? -3.47600  86.38100  15.17500  1.000 21.77002 ? 336  LYS A C     1 
ATOM   819  O  O     . LYS C 3 32  ? -3.96500  86.67300  16.27400  1.000 19.03528 ? 336  LYS A O     1 
ATOM   820  C  CB    . LYS C 3 32  ? -2.46500  84.10400  14.81000  1.000 19.52907 ? 336  LYS A CB    1 
ATOM   821  C  CG    . LYS C 3 32  ? -2.72000  82.59200  14.60000  1.000 22.22923 ? 336  LYS A CG    1 
ATOM   822  C  CD    . LYS C 3 32  ? -1.49600  81.77800  14.97500  1.000 21.70643 ? 336  LYS A CD    1 
ATOM   823  C  CE    . LYS C 3 32  ? -1.51800  80.39100  14.34700  1.000 31.59656 ? 336  LYS A CE    1 
ATOM   824  N  NZ    . LYS C 3 32  ? -0.16900  79.74900  14.35600  1.000 34.93765 ? 336  LYS A NZ    1 
ATOM   825  N  N     . ASP C 3 33  ? -2.77100  87.26300  14.45500  1.000 15.79657 ? 337  ASP A N     1 
ATOM   826  C  CA    . ASP C 3 33  ? -2.62600  88.63700  14.93900  1.000 21.17419 ? 337  ASP A CA    1 
ATOM   827  C  C     . ASP C 3 33  ? -3.97600  89.34800  14.98400  1.000 21.00619 ? 337  ASP A C     1 
ATOM   828  O  O     . ASP C 3 33  ? -4.26900  90.08700  15.93300  1.000 20.27457 ? 337  ASP A O     1 
ATOM   829  C  CB    . ASP C 3 33  ? -1.63500  89.41800  14.06400  1.000 31.70092 ? 337  ASP A CB    1 
ATOM   830  C  CG    . ASP C 3 33  ? -0.71500  90.34500  14.88600  1.000 44.75626 ? 337  ASP A CG    1 
ATOM   831  O  OD1   . ASP C 3 33  ? -0.33300  91.43200  14.38900  1.000 42.74836 ? 337  ASP A OD1   1 
ATOM   832  O  OD2   . ASP C 3 33  ? -0.36200  89.98100  16.03000  1.000 44.96843 ? 337  ASP A OD2   1 
ATOM   833  N  N     . LYS C 3 34  ? -4.81300  89.12600  13.97100  1.000 20.27087 ? 338  LYS A N     1 
ATOM   834  C  CA    . LYS C 3 34  ? -6.12400  89.75900  13.94100  1.000 19.59788 ? 338  LYS A CA    1 
ATOM   835  C  C     . LYS C 3 34  ? -6.94400  89.34800  15.15100  1.000 21.68363 ? 338  LYS A C     1 
ATOM   836  O  O     . LYS C 3 34  ? -7.56400  90.19200  15.81100  1.000 24.42503 ? 338  LYS A O     1 
ATOM   837  C  CB    . LYS C 3 34  ? -6.83100  89.39600  12.63700  1.000 19.26124 ? 338  LYS A CB    1 
ATOM   838  C  CG    . LYS C 3 34  ? -8.18700  90.04500  12.44800  1.000 29.84462 ? 338  LYS A CG    1 
ATOM   839  C  CD    . LYS C 3 34  ? -8.84000  89.50700  11.18500  1.000 25.70401 ? 338  LYS A CD    1 
ATOM   840  C  CE    . LYS C 3 34  ? -9.95400  90.39200  10.70600  1.000 29.41094 ? 338  LYS A CE    1 
ATOM   841  N  NZ    . LYS C 3 34  ? -11.24400 89.76900  11.01400  1.000 32.97559 ? 338  LYS A NZ    1 
ATOM   842  N  N     . PHE C 3 35  ? -6.92700  88.05400  15.47500  1.000 20.93895 ? 339  PHE A N     1 
ATOM   843  C  CA    . PHE C 3 35  ? -7.59800  87.56700  16.67000  1.000 18.02011 ? 339  PHE A CA    1 
ATOM   844  C  C     . PHE C 3 35  ? -7.08000  88.28100  17.91300  1.000 22.34090 ? 339  PHE A C     1 
ATOM   845  O  O     . PHE C 3 35  ? -7.85900  88.70400  18.77200  1.000 23.14581 ? 339  PHE A O     1 
ATOM   846  C  CB    . PHE C 3 35  ? -7.39200  86.05600  16.77400  1.000 17.31410 ? 339  PHE A CB    1 
ATOM   847  C  CG    . PHE C 3 35  ? -8.01100  85.43100  17.99400  1.000 18.89911 ? 339  PHE A CG    1 
ATOM   848  C  CD1   . PHE C 3 35  ? -7.33700  85.42500  19.21100  1.000 18.58060 ? 339  PHE A CD1   1 
ATOM   849  C  CD2   . PHE C 3 35  ? -9.25000  84.80300  17.91100  1.000 18.15232 ? 339  PHE A CD2   1 
ATOM   850  C  CE1   . PHE C 3 35  ? -7.90200  84.84100  20.33900  1.000 20.80306 ? 339  PHE A CE1   1 
ATOM   851  C  CE2   . PHE C 3 35  ? -9.81800  84.20800  19.02900  1.000 19.50969 ? 339  PHE A CE2   1 
ATOM   852  C  CZ    . PHE C 3 35  ? -9.15100  84.23000  20.24200  1.000 24.73215 ? 339  PHE A CZ    1 
ATOM   853  N  N     . LEU C 3 36  ? -5.76000  88.42100  18.02700  1.000 19.43056 ? 340  LEU A N     1 
ATOM   854  C  CA    . LEU C 3 36  ? -5.20200  89.07800  19.20200  1.000 20.17858 ? 340  LEU A CA    1 
ATOM   855  C  C     . LEU C 3 36  ? -5.67000  90.52100  19.28200  1.000 25.11120 ? 340  LEU A C     1 
ATOM   856  O  O     . LEU C 3 36  ? -6.08400  90.99100  20.34200  1.000 29.60006 ? 340  LEU A O     1 
ATOM   857  C  CB    . LEU C 3 36  ? -3.67900  89.00700  19.16400  1.000 24.86290 ? 340  LEU A CB    1 
ATOM   858  C  CG    . LEU C 3 36  ? -3.14100  87.58700  19.24900  1.000 26.58315 ? 340  LEU A CG    1 
ATOM   859  C  CD1   . LEU C 3 36  ? -1.64900  87.61100  19.01700  1.000 26.77410 ? 340  LEU A CD1   1 
ATOM   860  C  CD2   . LEU C 3 36  ? -3.48500  86.98400  20.60000  1.000 31.30346 ? 340  LEU A CD2   1 
ATOM   861  N  N     . ASN C 3 37  ? -5.63100  91.23500  18.16000  1.000 23.28663 ? 341  ASN A N     1 
ATOM   862  C  CA    . ASN C 3 37  ? -5.99100  92.64500  18.16900  1.000 32.15554 ? 341  ASN A CA    1 
ATOM   863  C  C     . ASN C 3 37  ? -7.47700  92.86300  18.41400  1.000 35.13043 ? 341  ASN A C     1 
ATOM   864  O  O     . ASN C 3 37  ? -7.87200  93.96400  18.81100  1.000 44.36843 ? 341  ASN A O     1 
ATOM   865  C  CB    . ASN C 3 37  ? -5.56000  93.29400  16.85800  1.000 26.56583 ? 341  ASN A CB    1 
ATOM   866  C  CG    . ASN C 3 37  ? -4.05700  93.52700  16.79900  1.000 40.58122 ? 341  ASN A CG    1 
ATOM   867  O  OD1   . ASN C 3 37  ? -3.54400  94.47700  17.38900  1.000 47.07437 ? 341  ASN A OD1   1 
ATOM   868  N  ND2   . ASN C 3 37  ? -3.34300  92.64100  16.10700  1.000 31.69314 ? 341  ASN A ND2   1 
ATOM   869  N  N     . GLU C 3 38  ? -8.29900  91.84200  18.19400  1.000 33.42656 ? 342  GLU A N     1 
ATOM   870  C  CA    . GLU C 3 38  ? -9.72100  91.93100  18.48200  1.000 34.69982 ? 342  GLU A CA    1 
ATOM   871  C  C     . GLU C 3 38  ? -10.05600 91.51900  19.90400  1.000 31.40001 ? 342  GLU A C     1 
ATOM   872  O  O     . GLU C 3 38  ? -11.09800 91.92600  20.42200  1.000 36.79822 ? 342  GLU A O     1 
ATOM   873  C  CB    . GLU C 3 38  ? -10.51700 91.06100  17.50600  1.000 22.31625 ? 342  GLU A CB    1 
ATOM   874  C  CG    . GLU C 3 38  ? -10.68100 91.68400  16.14700  1.000 29.03040 ? 342  GLU A CG    1 
ATOM   875  C  CD    . GLU C 3 38  ? -11.33700 90.74800  15.13900  1.000 31.88628 ? 342  GLU A CD    1 
ATOM   876  O  OE1   . GLU C 3 38  ? -11.60800 91.19900  14.00700  1.000 33.18894 ? 342  GLU A OE1   1 
ATOM   877  O  OE2   . GLU C 3 38  ? -11.57800 89.56300  15.47000  1.000 35.00541 ? 342  GLU A OE2   1 
ATOM   878  N  N     . ASN C 3 39  ? -9.20000  90.73200  20.55000  1.000 30.86265 ? 343  ASN A N     1 
ATOM   879  C  CA    . ASN C 3 39  ? -9.46900  90.26000  21.90000  1.000 40.60422 ? 343  ASN A CA    1 
ATOM   880  C  C     . ASN C 3 39  ? -8.56300  90.91600  22.93600  1.000 43.71096 ? 343  ASN A C     1 
ATOM   881  O  O     . ASN C 3 39  ? -8.43500  90.40600  24.05500  1.000 45.60254 ? 343  ASN A O     1 
ATOM   882  C  CB    . ASN C 3 39  ? -9.35500  88.73700  21.95300  1.000 36.92037 ? 343  ASN A CB    1 
ATOM   883  C  CG    . ASN C 3 39  ? -10.51600 88.04300  21.24400  1.000 39.80421 ? 343  ASN A CG    1 
ATOM   884  O  OD1   . ASN C 3 39  ? -11.44000 87.54300  21.89500  1.000 46.64471 ? 343  ASN A OD1   1 
ATOM   885  N  ND2   . ASN C 3 39  ? -10.47400 88.01200  19.90500  1.000 28.04660 ? 343  ASN A ND2   1 
ATOM   886  N  N     . ILE C 3 40  ? -7.95900  92.05800  22.59300  1.000 38.74134 ? 344  ILE A N     1 
ATOM   887  C  CA    . ILE C 3 40  ? -7.08800  92.76900  23.52200  1.000 52.45271 ? 344  ILE A CA    1 
ATOM   888  C  C     . ILE C 3 40  ? -7.81500  93.17300  24.79100  1.000 54.76725 ? 344  ILE A C     1 
ATOM   889  O  O     . ILE C 3 40  ? -7.17100  93.48900  25.79800  1.000 60.60097 ? 344  ILE A O     1 
ATOM   890  C  CB    . ILE C 3 40  ? -6.48200  94.01700  22.85300  1.000 56.37501 ? 344  ILE A CB    1 
ATOM   891  C  CG1   . ILE C 3 40  ? -7.59300  94.92600  22.31600  1.000 56.31191 ? 344  ILE A CG1   1 
ATOM   892  C  CG2   . ILE C 3 40  ? -5.50200  93.62200  21.77100  1.000 43.35326 ? 344  ILE A CG2   1 
ATOM   893  C  CD1   . ILE C 3 40  ? -7.08300  96.14000  21.58100  1.000 47.76763 ? 344  ILE A CD1   1 
ATOM   894  N  N     . HIS C 3 41  ? -9.14400  93.18900  24.76600  1.000 56.67029 ? 345  HIS A N     1 
ATOM   895  C  CA    . HIS C 3 41  ? -9.95200  93.54000  25.92500  1.000 66.36932 ? 345  HIS A CA    1 
ATOM   896  C  C     . HIS C 3 41  ? -10.83500 92.40300  26.41400  1.000 66.33366 ? 345  HIS A C     1 
ATOM   897  O  O     . HIS C 3 41  ? -11.02000 92.25400  27.62500  1.000 78.86426 ? 345  HIS A O     1 
ATOM   898  C  CB    . HIS C 3 41  ? -10.81600 94.76600  25.59900  1.000 64.55795 ? 345  HIS A CB    1 
ATOM   899  C  CG    . HIS C 3 41  ? -10.02100 95.96100  25.17100  1.000 73.08767 ? 345  HIS A CG    1 
ATOM   900  N  ND1   . HIS C 3 41  ? -10.35700 96.72500  24.07400  1.000 74.59772 ? 345  HIS A ND1   1 
ATOM   901  C  CD2   . HIS C 3 41  ? -8.90400  96.52400  25.69300  1.000 68.29521 ? 345  HIS A CD2   1 
ATOM   902  C  CE1   . HIS C 3 41  ? -9.48200  97.70600  23.93700  1.000 65.98626 ? 345  HIS A CE1   1 
ATOM   903  N  NE2   . HIS C 3 41  ? -8.59100  97.60800  24.90800  1.000 62.23598 ? 345  HIS A NE2   1 
ATOM   904  N  N     . LYS C 3 42  ? -11.36900 91.58300  25.51100  1.000 61.80303 ? 346  LYS A N     1 
ATOM   905  C  CA    . LYS C 3 42  ? -12.29200 90.52400  25.90000  1.000 57.88902 ? 346  LYS A CA    1 
ATOM   906  C  C     . LYS C 3 42  ? -11.60400 89.44800  26.73200  1.000 70.14521 ? 346  LYS A C     1 
ATOM   907  O  O     . LYS C 3 42  ? -10.41000 89.17200  26.58200  1.000 64.44080 ? 346  LYS A O     1 
ATOM   908  C  CB    . LYS C 3 42  ? -12.91400 89.87000  24.66700  1.000 58.40937 ? 346  LYS A CB    1 
ATOM   909  C  CG    . LYS C 3 42  ? -13.66300 90.81600  23.74600  1.000 65.08816 ? 346  LYS A CG    1 
ATOM   910  C  CD    . LYS C 3 42  ? -14.96400 90.17500  23.27500  1.000 60.02679 ? 346  LYS A CD    1 
ATOM   911  C  CE    . LYS C 3 42  ? -15.94600 91.20200  22.72700  1.000 54.44301 ? 346  LYS A CE    1 
ATOM   912  N  NZ    . LYS C 3 42  ? -15.43600 91.87000  21.50000  1.000 52.96011 ? 346  LYS A NZ    1 
ATOM   913  N  N     . TYR C 3 43  ? -12.38300 88.83600  27.62100  1.000 74.42413 ? 347  TYR A N     1 
ATOM   914  C  CA    . TYR C 3 43  ? -12.00300 87.56400  28.21900  1.000 79.77904 ? 347  TYR A CA    1 
ATOM   915  C  C     . TYR C 3 43  ? -13.03600 86.52200  27.82400  1.000 82.09058 ? 347  TYR A C     1 
ATOM   916  O  O     . TYR C 3 43  ? -13.57200 85.80400  28.67600  1.000 78.00941 ? 347  TYR A O     1 
ATOM   917  C  CB    . TYR C 3 43  ? -11.85900 87.68300  29.73700  1.000 64.68125 ? 347  TYR A CB    1 
ATOM   918  N  N     . THR C 3 44  ? -13.31300 86.44200  26.50500  1.000 82.83809 ? 348  THR A N     1 
ATOM   919  C  CA    . THR C 3 44  ? -14.23100 85.51700  25.83500  1.000 76.70642 ? 348  THR A CA    1 
ATOM   920  C  C     . THR C 3 44  ? -13.78800 84.03600  25.94900  1.000 78.79073 ? 348  THR A C     1 
ATOM   921  O  O     . THR C 3 44  ? -14.39400 83.19300  25.25300  1.000 63.27940 ? 348  THR A O     1 
ATOM   922  C  CB    . THR C 3 44  ? -14.38000 85.91100  24.36300  1.000 57.87063 ? 348  THR A CB    1 
ATOM   923  N  N     . LYS C 3 45  ? -12.79500 83.79800  26.81400  1.000 81.62643 ? 349  LYS A N     1 
ATOM   924  C  CA    . LYS C 3 45  ? -12.19100 82.49100  27.04100  1.000 58.69460 ? 349  LYS A CA    1 
ATOM   925  C  C     . LYS C 3 45  ? -13.22500 81.45800  27.47000  1.000 48.68369 ? 349  LYS A C     1 
ATOM   926  O  O     . LYS C 3 45  ? -14.29100 81.77700  28.00300  1.000 47.43446 ? 349  LYS A O     1 
ATOM   927  C  CB    . LYS C 3 45  ? -11.15500 82.55800  28.15800  1.000 48.09751 ? 349  LYS A CB    1 
ATOM   928  N  N     . ILE C 3 46  ? -12.86800 80.20900  27.27000  1.000 49.79711 ? 350  ILE A N     1 
ATOM   929  C  CA    . ILE C 3 46  ? -13.56400 79.07800  27.86200  1.000 38.48074 ? 350  ILE A CA    1 
ATOM   930  C  C     . ILE C 3 46  ? -12.96800 78.83600  29.23500  1.000 39.20735 ? 350  ILE A C     1 
ATOM   931  O  O     . ILE C 3 46  ? -11.74900 78.92100  29.41600  1.000 34.12351 ? 350  ILE A O     1 
ATOM   932  C  CB    . ILE C 3 46  ? -13.42200 77.82700  26.98200  1.000 36.17254 ? 350  ILE A CB    1 
ATOM   933  C  CG1   . ILE C 3 46  ? -13.92600 78.09600  25.55500  1.000 32.44218 ? 350  ILE A CG1   1 
ATOM   934  C  CG2   . ILE C 3 46  ? -14.10200 76.63900  27.65400  1.000 29.91884 ? 350  ILE A CG2   1 
ATOM   935  C  CD1   . ILE C 3 46  ? -15.18300 78.90800  25.48400  1.000 32.14478 ? 350  ILE A CD1   1 
ATOM   936  N  N     . THR C 3 47  ? -13.81500 78.53300  30.20900  1.000 37.38931 ? 351  THR A N     1 
ATOM   937  C  CA    . THR C 3 47  ? -13.34000 78.24900  31.55200  1.000 35.37720 ? 351  THR A CA    1 
ATOM   938  C  C     . THR C 3 47  ? -13.69400 76.82100  31.93600  1.000 34.92138 ? 351  THR A C     1 
ATOM   939  O  O     . THR C 3 47  ? -14.41300 76.11400  31.22400  1.000 33.92798 ? 351  THR A O     1 
ATOM   940  C  CB    . THR C 3 47  ? -13.92400 79.24000  32.56800  1.000 41.89280 ? 351  THR A CB    1 
ATOM   941  O  OG1   . THR C 3 47  ? -15.31800 78.96000  32.75900  1.000 44.38456 ? 351  THR A OG1   1 
ATOM   942  C  CG2   . THR C 3 47  ? -13.74100 80.68300  32.08100  1.000 39.22473 ? 351  THR A CG2   1 
ATOM   943  N  N     . ASP C 3 48  ? -13.15400 76.40300  33.08000  1.000 37.65653 ? 352  ASP A N     1 
ATOM   944  C  CA    . ASP C 3 48  ? -13.43900 75.07400  33.61900  1.000 38.35344 ? 352  ASP A CA    1 
ATOM   945  C  C     . ASP C 3 48  ? -14.92900 74.85800  33.86600  1.000 31.69625 ? 352  ASP A C     1 
ATOM   946  O  O     . ASP C 3 48  ? -15.40800 73.72000  33.81700  1.000 28.07786 ? 352  ASP A O     1 
ATOM   947  C  CB    . ASP C 3 48  ? -12.65700 74.87200  34.91600  1.000 38.37310 ? 352  ASP A CB    1 
ATOM   948  C  CG    . ASP C 3 48  ? -12.92300 75.97500  35.93100  1.000 47.02865 ? 352  ASP A CG    1 
ATOM   949  O  OD1   . ASP C 3 48  ? -13.60300 75.71400  36.94800  1.000 55.44864 ? 352  ASP A OD1   1 
ATOM   950  O  OD2   . ASP C 3 48  ? -12.44100 77.10900  35.71200  1.000 51.06081 ? 352  ASP A OD2   1 
ATOM   951  N  N     . LYS C 3 49  ? -15.67200 75.92100  34.15300  1.000 28.16865 ? 353  LYS A N     1 
ATOM   952  C  CA    . LYS C 3 49  ? -17.08600 75.76500  34.45400  1.000 34.26751 ? 353  LYS A CA    1 
ATOM   953  C  C     . LYS C 3 49  ? -17.91800 75.52400  33.20700  1.000 35.05082 ? 353  LYS A C     1 
ATOM   954  O  O     . LYS C 3 49  ? -19.06700 75.08600  33.32100  1.000 33.79454 ? 353  LYS A O     1 
ATOM   955  C  CB    . LYS C 3 49  ? -17.60500 77.00200  35.19500  1.000 36.11008 ? 353  LYS A CB    1 
ATOM   956  N  N     . ASP C 3 50  ? -17.35800 75.77100  32.02800  1.000 32.26454 ? 354  ASP A N     1 
ATOM   957  C  CA    . ASP C 3 50  ? -18.11200 75.72800  30.78400  1.000 28.83318 ? 354  ASP A CA    1 
ATOM   958  C  C     . ASP C 3 50  ? -18.14200 74.31600  30.21700  1.000 28.01518 ? 354  ASP A C     1 
ATOM   959  O  O     . ASP C 3 50  ? -17.09400 73.69600  30.01500  1.000 26.95300 ? 354  ASP A O     1 
ATOM   960  C  CB    . ASP C 3 50  ? -17.49600 76.68100  29.75600  1.000 28.66930 ? 354  ASP A CB    1 
ATOM   961  C  CG    . ASP C 3 50  ? -17.60500 78.14300  30.17400  1.000 30.39687 ? 354  ASP A CG    1 
ATOM   962  O  OD1   . ASP C 3 50  ? -18.62800 78.50400  30.78900  1.000 29.94979 ? 354  ASP A OD1   1 
ATOM   963  O  OD2   . ASP C 3 50  ? -16.66700 78.92400  29.89800  1.000 33.61219 ? 354  ASP A OD2   1 
ATOM   964  N  N     . THR C 3 51  ? -19.34100 73.82100  29.93200  1.000 28.83294 ? 355  THR A N     1 
ATOM   965  C  CA    . THR C 3 51  ? -19.49200 72.67300  29.05000  1.000 28.56332 ? 355  THR A CA    1 
ATOM   966  C  C     . THR C 3 51  ? -19.61800 73.20800  27.62800  1.000 22.88007 ? 355  THR A C     1 
ATOM   967  O  O     . THR C 3 51  ? -20.29700 74.20900  27.39500  1.000 22.50789 ? 355  THR A O     1 
ATOM   968  C  CB    . THR C 3 51  ? -20.72100 71.83700  29.42900  1.000 30.29432 ? 355  THR A CB    1 
ATOM   969  O  OG1   . THR C 3 51  ? -20.62200 71.42400  30.79800  1.000 31.25196 ? 355  THR A OG1   1 
ATOM   970  C  CG2   . THR C 3 51  ? -20.82400 70.59500  28.53800  1.000 28.41359 ? 355  THR A CG2   1 
ATOM   971  N  N     . TYR C 3 52  ? -18.94500 72.55800  26.67800  1.000 19.55965 ? 356  TYR A N     1 
ATOM   972  C  CA    . TYR C 3 52  ? -18.84900 73.12200  25.33700  1.000 23.26216 ? 356  TYR A CA    1 
ATOM   973  C  C     . TYR C 3 52  ? -18.92500 72.03700  24.27400  1.000 17.54113 ? 356  TYR A C     1 
ATOM   974  O  O     . TYR C 3 52  ? -18.59300 70.87200  24.50300  1.000 22.30085 ? 356  TYR A O     1 
ATOM   975  C  CB    . TYR C 3 52  ? -17.54800 73.92700  25.15600  1.000 20.58684 ? 356  TYR A CB    1 
ATOM   976  C  CG    . TYR C 3 52  ? -16.30500 73.12800  25.50700  1.000 24.75203 ? 356  TYR A CG    1 
ATOM   977  C  CD1   . TYR C 3 52  ? -15.73100 72.26200  24.58200  1.000 20.65113 ? 356  TYR A CD1   1 
ATOM   978  C  CD2   . TYR C 3 52  ? -15.70800 73.23600  26.76600  1.000 22.86269 ? 356  TYR A CD2   1 
ATOM   979  C  CE1   . TYR C 3 52  ? -14.60300 71.52800  24.89300  1.000 25.02835 ? 356  TYR A CE1   1 
ATOM   980  C  CE2   . TYR C 3 52  ? -14.57500 72.50100  27.08800  1.000 25.24960 ? 356  TYR A CE2   1 
ATOM   981  C  CZ    . TYR C 3 52  ? -14.02700 71.64400  26.14300  1.000 27.58609 ? 356  TYR A CZ    1 
ATOM   982  O  OH    . TYR C 3 52  ? -12.90300 70.89400  26.42700  1.000 25.18098 ? 356  TYR A OH    1 
ATOM   983  N  N     . ILE C 3 53  ? -19.33900 72.45900  23.08500  1.000 23.29283 ? 357  ILE A N     1 
ATOM   984  C  CA    . ILE C 3 53  ? -19.33700 71.62900  21.89200  1.000 22.84233 ? 357  ILE A CA    1 
ATOM   985  C  C     . ILE C 3 53  ? -18.41100 72.27000  20.86800  1.000 18.51099 ? 357  ILE A C     1 
ATOM   986  O  O     . ILE C 3 53  ? -18.38100 73.49700  20.72500  1.000 14.58709 ? 357  ILE A O     1 
ATOM   987  C  CB    . ILE C 3 53  ? -20.75400 71.45100  21.30900  1.000 20.23186 ? 357  ILE A CB    1 
ATOM   988  C  CG1   . ILE C 3 53  ? -21.64800 70.72900  22.31700  1.000 28.75302 ? 357  ILE A CG1   1 
ATOM   989  C  CG2   . ILE C 3 53  ? -20.69100 70.66000  20.02800  1.000 21.79655 ? 357  ILE A CG2   1 
ATOM   990  C  CD1   . ILE C 3 53  ? -23.13000 70.81000  21.99700  1.000 28.56704 ? 357  ILE A CD1   1 
ATOM   991  N  N     . ILE C 3 54  ? -17.64200 71.42900  20.17700  1.000 23.88661 ? 358  ILE A N     1 
ATOM   992  C  CA    . ILE C 3 54  ? -16.66900 71.85400  19.18400  1.000 15.88718 ? 358  ILE A CA    1 
ATOM   993  C  C     . ILE C 3 54  ? -17.27000 71.68000  17.80600  1.000 17.52329 ? 358  ILE A C     1 
ATOM   994  O  O     . ILE C 3 54  ? -17.69000 70.57400  17.45300  1.000 16.48561 ? 358  ILE A O     1 
ATOM   995  C  CB    . ILE C 3 54  ? -15.38200 71.03000  19.27800  1.000 15.33085 ? 358  ILE A CB    1 
ATOM   996  C  CG1   . ILE C 3 54  ? -14.75200 71.15800  20.66200  1.000 18.94539 ? 358  ILE A CG1   1 
ATOM   997  C  CG2   . ILE C 3 54  ? -14.40600 71.49500  18.18100  1.000 19.19156 ? 358  ILE A CG2   1 
ATOM   998  C  CD1   . ILE C 3 54  ? -14.42700 72.58400  21.02800  1.000 22.25363 ? 358  ILE A CD1   1 
ATOM   999  N  N     . PHE C 3 55  ? -17.27700 72.74400  17.00800  1.000 13.06834 ? 359  PHE A N     1 
ATOM   1000 C  CA    . PHE C 3 55  ? -17.58800 72.64300  15.58400  1.000 15.86247 ? 359  PHE A CA    1 
ATOM   1001 C  C     . PHE C 3 55  ? -16.31300 72.94400  14.81700  1.000 19.03631 ? 359  PHE A C     1 
ATOM   1002 O  O     . PHE C 3 55  ? -15.86600 74.09600  14.78300  1.000 21.34430 ? 359  PHE A O     1 
ATOM   1003 C  CB    . PHE C 3 55  ? -18.70800 73.60300  15.17900  1.000 19.00890 ? 359  PHE A CB    1 
ATOM   1004 C  CG    . PHE C 3 55  ? -20.06200 73.22200  15.70900  1.000 19.25826 ? 359  PHE A CG    1 
ATOM   1005 C  CD1   . PHE C 3 55  ? -20.38500 73.43000  17.03500  1.000 21.50310 ? 359  PHE A CD1   1 
ATOM   1006 C  CD2   . PHE C 3 55  ? -21.02300 72.67200  14.87400  1.000 16.47802 ? 359  PHE A CD2   1 
ATOM   1007 C  CE1   . PHE C 3 55  ? -21.64600 73.08400  17.51600  1.000 20.92638 ? 359  PHE A CE1   1 
ATOM   1008 C  CE2   . PHE C 3 55  ? -22.26200 72.33000  15.35800  1.000 19.22997 ? 359  PHE A CE2   1 
ATOM   1009 C  CZ    . PHE C 3 55  ? -22.57400 72.53500  16.67900  1.000 14.04479 ? 359  PHE A CZ    1 
ATOM   1010 N  N     . HIS C 3 56  ? -15.72100 71.91700  14.21100  1.000 15.72381 ? 360  HIS A N     1 
ATOM   1011 C  CA    . HIS C 3 56  ? -14.45900 72.05800  13.48900  1.000 18.31204 ? 360  HIS A CA    1 
ATOM   1012 C  C     . HIS C 3 56  ? -14.74300 72.09900  11.99400  1.000 14.92473 ? 360  HIS A C     1 
ATOM   1013 O  O     . HIS C 3 56  ? -15.20000 71.10800  11.42200  1.000 11.89430 ? 360  HIS A O     1 
ATOM   1014 C  CB    . HIS C 3 56  ? -13.51400 70.90900  13.82200  1.000 16.89895 ? 360  HIS A CB    1 
ATOM   1015 C  CG    . HIS C 3 56  ? -12.10900 71.14200  13.38100  1.000 16.96095 ? 360  HIS A CG    1 
ATOM   1016 N  ND1   . HIS C 3 56  ? -11.02400 70.67400  14.09000  1.000 21.69745 ? 360  HIS A ND1   1 
ATOM   1017 C  CD2   . HIS C 3 56  ? -11.60400 71.79100  12.30300  1.000 17.02532 ? 360  HIS A CD2   1 
ATOM   1018 C  CE1   . HIS C 3 56  ? -9.91200  71.03100  13.47200  1.000 18.68386 ? 360  HIS A CE1   1 
ATOM   1019 N  NE2   . HIS C 3 56  ? -10.23500 71.71000  12.38600  1.000 13.62428 ? 360  HIS A NE2   1 
ATOM   1020 N  N     . ILE C 3 57  ? -14.44600 73.23100  11.36100  1.000 12.04541 ? 361  ILE A N     1 
ATOM   1021 C  CA    . ILE C 3 57  ? -14.95800 73.54800  10.03200  1.000 13.72272 ? 361  ILE A CA    1 
ATOM   1022 C  C     . ILE C 3 57  ? -13.80000 73.70600  9.05400   1.000 16.57976 ? 361  ILE A C     1 
ATOM   1023 O  O     . ILE C 3 57  ? -12.77300 74.30100  9.38600   1.000 15.30950 ? 361  ILE A O     1 
ATOM   1024 C  CB    . ILE C 3 57  ? -15.82200 74.82700  10.07900  1.000 16.37883 ? 361  ILE A CB    1 
ATOM   1025 C  CG1   . ILE C 3 57  ? -16.96600 74.63000  11.07600  1.000 17.23160 ? 361  ILE A CG1   1 
ATOM   1026 C  CG2   . ILE C 3 57  ? -16.34200 75.17700  8.67900   1.000 14.89208 ? 361  ILE A CG2   1 
ATOM   1027 C  CD1   . ILE C 3 57  ? -17.71900 75.90600  11.45800  1.000 17.02553 ? 361  ILE A CD1   1 
ATOM   1028 N  N     . ASP C 3 58  ? -13.97300 73.18900  7.83800   1.000 17.35861 ? 362  ASP A N     1 
ATOM   1029 C  CA    . ASP C 3 58  ? -12.90200 73.23100  6.85000   1.000 14.31983 ? 362  ASP A CA    1 
ATOM   1030 C  C     . ASP C 3 58  ? -13.46600 73.20300  5.43200   1.000 13.87613 ? 362  ASP A C     1 
ATOM   1031 O  O     . ASP C 3 58  ? -14.31200 72.35700  5.12200   1.000 16.21766 ? 362  ASP A O     1 
ATOM   1032 C  CB    . ASP C 3 58  ? -11.96800 72.03700  7.06400   1.000 14.09001 ? 362  ASP A CB    1 
ATOM   1033 C  CG    . ASP C 3 58  ? -10.77100 72.08100  6.16700   1.000 22.61169 ? 362  ASP A CG    1 
ATOM   1034 O  OD1   . ASP C 3 58  ? -10.24600 73.18500  5.96600   1.000 23.24490 ? 362  ASP A OD1   1 
ATOM   1035 O  OD2   . ASP C 3 58  ? -10.35700 71.02200  5.66200   1.000 28.73199 ? 362  ASP A OD2   1 
ATOM   1036 N  N     . PHE C 3 59  ? -12.97500 74.08200  4.56300   1.000 16.38112 ? 363  PHE A N     1 
ATOM   1037 C  CA    . PHE C 3 59  ? -13.37600 74.02600  3.16000   1.000 17.36612 ? 363  PHE A CA    1 
ATOM   1038 C  C     . PHE C 3 59  ? -12.97500 72.69100  2.54400   1.000 20.52771 ? 363  PHE A C     1 
ATOM   1039 O  O     . PHE C 3 59  ? -11.88700 72.17200  2.81600   1.000 17.58289 ? 363  PHE A O     1 
ATOM   1040 C  CB    . PHE C 3 59  ? -12.70500 75.12900  2.34600   1.000 16.67499 ? 363  PHE A CB    1 
ATOM   1041 C  CG    . PHE C 3 59  ? -13.29800 76.48400  2.51100   1.000 15.98688 ? 363  PHE A CG    1 
ATOM   1042 C  CD1   . PHE C 3 59  ? -13.08200 77.20800  3.67500   1.000 15.61275 ? 363  PHE A CD1   1 
ATOM   1043 C  CD2   . PHE C 3 59  ? -14.00000 77.07200  1.46900   1.000 15.23868 ? 363  PHE A CD2   1 
ATOM   1044 C  CE1   . PHE C 3 59  ? -13.57200 78.48200  3.81600   1.000 17.89063 ? 363  PHE A CE1   1 
ATOM   1045 C  CE2   . PHE C 3 59  ? -14.50700 78.35300  1.59500   1.000 21.74613 ? 363  PHE A CE2   1 
ATOM   1046 C  CZ    . PHE C 3 59  ? -14.29700 79.06100  2.77300   1.000 29.64534 ? 363  PHE A CZ    1 
ATOM   1047 N  N     . ASP C 3 60  ? -13.81600 72.21700  1.64600   1.000 18.91048 ? 364  ASP A N     1 
ATOM   1048 C  CA    . ASP C 3 60  ? -13.47400 71.02100  0.85900   1.000 15.38346 ? 364  ASP A CA    1 
ATOM   1049 C  C     . ASP C 3 60  ? -12.54800 71.45000  -0.28400  1.000 16.80990 ? 364  ASP A C     1 
ATOM   1050 O  O     . ASP C 3 60  ? -12.95900 72.32000  -0.98900  1.000 16.40078 ? 364  ASP A O     1 
ATOM   1051 C  CB    . ASP C 3 60  ? -14.72700 70.43900  0.23300   1.000 13.84846 ? 364  ASP A CB    1 
ATOM   1052 C  CG    . ASP C 3 60  ? -15.72000 69.92500  1.24600   1.000 18.86567 ? 364  ASP A CG    1 
ATOM   1053 O  OD1   . ASP C 3 60  ? -15.32900 69.13200  2.08200   1.000 18.91867 ? 364  ASP A OD1   1 
ATOM   1054 O  OD2   . ASP C 3 60  ? -16.81500 70.39200  1.21500   1.000 20.04240 ? 364  ASP A OD2   1 
ATOM   1055 N  N     . CYS C 3 61  ? -11.38700 70.80400  -0.42200  1.000 15.90828 ? 365  CYS A N     1 
ATOM   1056 C  CA    . CYS C 3 61  ? -10.39400 70.93300  -1.49000  1.000 15.95164 ? 365  CYS A CA    1 
ATOM   1057 C  C     . CYS C 3 61  ? -10.32800 72.40400  -1.89100  1.000 14.13444 ? 365  CYS A C     1 
ATOM   1058 O  O     . CYS C 3 61  ? -10.75100 72.79600  -2.98700  1.000 16.15037 ? 365  CYS A O     1 
ATOM   1059 C  CB    . CYS C 3 61  ? -10.55600 70.03100  -2.71600  1.000 15.31987 ? 365  CYS A CB    1 
ATOM   1060 S  SG    . CYS C 3 61  ? -12.22800 70.00200  -3.40700  1.000 23.80988 ? 365  CYS A SG    1 
ATOM   1061 N  N     . PHE C 3 62  ? -9.79500  73.21200  -0.97800  1.000 12.74832 ? 366  PHE A N     1 
ATOM   1062 C  CA    . PHE C 3 62  ? -10.05600 74.64900  -0.96300  1.000 13.45927 ? 366  PHE A CA    1 
ATOM   1063 C  C     . PHE C 3 62  ? -9.52800  75.34100  -2.20900  1.000 15.29217 ? 366  PHE A C     1 
ATOM   1064 O  O     . PHE C 3 62  ? -10.29600 75.96300  -2.95700  1.000 14.87464 ? 366  PHE A O     1 
ATOM   1065 C  CB    . PHE C 3 62  ? -9.43900  75.24800  0.29400   1.000 16.05964 ? 366  PHE A CB    1 
ATOM   1066 C  CG    . PHE C 3 62  ? -9.52100  76.74400  0.36600   1.000 15.37015 ? 366  PHE A CG    1 
ATOM   1067 C  CD1   . PHE C 3 62  ? -10.74600 77.39200  0.37900   1.000 16.63068 ? 366  PHE A CD1   1 
ATOM   1068 C  CD2   . PHE C 3 62  ? -8.36300  77.49700  0.46100   1.000 18.15125 ? 366  PHE A CD2   1 
ATOM   1069 C  CE1   . PHE C 3 62  ? -10.81700 78.77300  0.46700   1.000 18.89036 ? 366  PHE A CE1   1 
ATOM   1070 C  CE2   . PHE C 3 62  ? -8.42100  78.88500  0.55200   1.000 21.93801 ? 366  PHE A CE2   1 
ATOM   1071 C  CZ    . PHE C 3 62  ? -9.64500  79.52300  0.55100   1.000 16.19087 ? 366  PHE A CZ    1 
ATOM   1072 N  N     . PHE C 3 63  ? -8.21100  75.25500  -2.45200  1.000 11.86011 ? 367  PHE A N     1 
ATOM   1073 C  CA    . PHE C 3 63  ? -7.65400  75.91800  -3.63500  1.000 11.97220 ? 367  PHE A CA    1 
ATOM   1074 C  C     . PHE C 3 63  ? -8.32500  75.44900  -4.92000  1.000 11.40828 ? 367  PHE A C     1 
ATOM   1075 O  O     . PHE C 3 63  ? -8.58500  76.25500  -5.82600  1.000 12.59818 ? 367  PHE A O     1 
ATOM   1076 C  CB    . PHE C 3 63  ? -6.14000  75.68700  -3.74100  1.000 16.03904 ? 367  PHE A CB    1 
ATOM   1077 C  CG    . PHE C 3 63  ? -5.32600  76.45000  -2.74700  1.000 14.31169 ? 367  PHE A CG    1 
ATOM   1078 C  CD1   . PHE C 3 63  ? -5.88000  77.46600  -1.98900  1.000 14.64102 ? 367  PHE A CD1   1 
ATOM   1079 C  CD2   . PHE C 3 63  ? -3.98500  76.13100  -2.55500  1.000 20.65805 ? 367  PHE A CD2   1 
ATOM   1080 C  CE1   . PHE C 3 63  ? -5.11400  78.16600  -1.06500  1.000 15.48715 ? 367  PHE A CE1   1 
ATOM   1081 C  CE2   . PHE C 3 63  ? -3.21400  76.81500  -1.61700  1.000 19.90005 ? 367  PHE A CE2   1 
ATOM   1082 C  CZ    . PHE C 3 63  ? -3.78300  77.83700  -0.87300  1.000 17.54693 ? 367  PHE A CZ    1 
ATOM   1083 N  N     . ALA C 3 64  ? -8.60200  74.15000  -5.03800  1.000 13.43233 ? 368  ALA A N     1 
ATOM   1084 C  CA    . ALA C 3 64  ? -9.19600  73.66600  -6.28400  1.000 14.45233 ? 368  ALA A CA    1 
ATOM   1085 C  C     . ALA C 3 64  ? -10.59900 74.22000  -6.47400  1.000 12.81352 ? 368  ALA A C     1 
ATOM   1086 O  O     . ALA C 3 64  ? -10.97100 74.61200  -7.58400  1.000 15.67316 ? 368  ALA A O     1 
ATOM   1087 C  CB    . ALA C 3 64  ? -9.20200  72.13600  -6.31300  1.000 11.98455 ? 368  ALA A CB    1 
ATOM   1088 N  N     . THR C 3 65  ? -11.38400 74.27000  -5.40000  1.000 16.86749 ? 369  THR A N     1 
ATOM   1089 C  CA    . THR C 3 65  ? -12.72200 74.85200  -5.47500  1.000 13.89121 ? 369  THR A CA    1 
ATOM   1090 C  C     . THR C 3 65  ? -12.66800 76.32300  -5.87800  1.000 16.48453 ? 369  THR A C     1 
ATOM   1091 O  O     . THR C 3 65  ? -13.38900 76.76200  -6.78600  1.000 15.50816 ? 369  THR A O     1 
ATOM   1092 C  CB    . THR C 3 65  ? -13.43000 74.70900  -4.12800  1.000 17.69563 ? 369  THR A CB    1 
ATOM   1093 O  OG1   . THR C 3 65  ? -13.59400 73.32000  -3.82500  1.000 15.11254 ? 369  THR A OG1   1 
ATOM   1094 C  CG2   . THR C 3 65  ? -14.82300 75.40700  -4.15200  1.000 12.84538 ? 369  THR A CG2   1 
ATOM   1095 N  N     . VAL C 3 66  ? -11.83500 77.11000  -5.18900  1.000 15.84860 ? 370  VAL A N     1 
ATOM   1096 C  CA    . VAL C 3 66  ? -11.77600 78.53500  -5.48500  1.000 14.93849 ? 370  VAL A CA    1 
ATOM   1097 C  C     . VAL C 3 66  ? -11.18600 78.76600  -6.87100  1.000 18.51662 ? 370  VAL A C     1 
ATOM   1098 O  O     . VAL C 3 66  ? -11.69700 79.59100  -7.64100  1.000 16.75289 ? 370  VAL A O     1 
ATOM   1099 C  CB    . VAL C 3 66  ? -10.99500 79.29800  -4.39900  1.000 13.57986 ? 370  VAL A CB    1 
ATOM   1100 C  CG1   . VAL C 3 66  ? -11.01400 80.80300  -4.71800  1.000 13.46909 ? 370  VAL A CG1   1 
ATOM   1101 C  CG2   . VAL C 3 66  ? -11.60100 79.05300  -3.02100  1.000 15.22948 ? 370  VAL A CG2   1 
ATOM   1102 N  N     . ALA C 3 67  ? -10.11000 78.04200  -7.21800  1.000 17.62856 ? 371  ALA A N     1 
ATOM   1103 C  CA    . ALA C 3 67  ? -9.52600  78.18800  -8.55300  1.000 15.86914 ? 371  ALA A CA    1 
ATOM   1104 C  C     . ALA C 3 67  ? -10.54400 77.86400  -9.63100  1.000 21.00176 ? 371  ALA A C     1 
ATOM   1105 O  O     . ALA C 3 67  ? -10.52000 78.44700  -10.72100 1.000 22.83733 ? 371  ALA A O     1 
ATOM   1106 C  CB    . ALA C 3 67  ? -8.30500  77.28100  -8.72000  1.000 12.89289 ? 371  ALA A CB    1 
ATOM   1107 N  N     . TYR C 3 68  ? -11.44700 76.93600  -9.35000  1.000 17.59785 ? 372  TYR A N     1 
ATOM   1108 C  CA    . TYR C 3 68  ? -12.46700 76.62100  -10.33800 1.000 21.42730 ? 372  TYR A CA    1 
ATOM   1109 C  C     . TYR C 3 68  ? -13.51400 77.72900  -10.40100 1.000 19.20312 ? 372  TYR A C     1 
ATOM   1110 O  O     . TYR C 3 68  ? -13.83800 78.22300  -11.48700 1.000 17.73278 ? 372  TYR A O     1 
ATOM   1111 C  CB    . TYR C 3 68  ? -13.10000 75.27000  -10.01700 1.000 13.65710 ? 372  TYR A CB    1 
ATOM   1112 C  CG    . TYR C 3 68  ? -14.23700 74.94400  -10.94500 1.000 21.90374 ? 372  TYR A CG    1 
ATOM   1113 C  CD1   . TYR C 3 68  ? -13.99100 74.41200  -12.20400 1.000 16.57827 ? 372  TYR A CD1   1 
ATOM   1114 C  CD2   . TYR C 3 68  ? -15.55900 75.20000  -10.57600 1.000 19.51647 ? 372  TYR A CD2   1 
ATOM   1115 C  CE1   . TYR C 3 68  ? -15.02700 74.12700  -13.06900 1.000 25.60357 ? 372  TYR A CE1   1 
ATOM   1116 C  CE2   . TYR C 3 68  ? -16.61600 74.91700  -11.44900 1.000 20.93320 ? 372  TYR A CE2   1 
ATOM   1117 C  CZ    . TYR C 3 68  ? -16.33700 74.37500  -12.68800 1.000 23.13798 ? 372  TYR A CZ    1 
ATOM   1118 O  OH    . TYR C 3 68  ? -17.35700 74.07700  -13.56300 1.000 29.13665 ? 372  TYR A OH    1 
ATOM   1119 N  N     . LEU C 3 69  ? -14.03100 78.15500  -9.23900  1.000 19.31721 ? 373  LEU A N     1 
ATOM   1120 C  CA    . LEU C 3 69  ? -15.07600 79.18000  -9.22800  1.000 18.37562 ? 373  LEU A CA    1 
ATOM   1121 C  C     . LEU C 3 69  ? -14.60700 80.47000  -9.88600  1.000 19.94725 ? 373  LEU A C     1 
ATOM   1122 O  O     . LEU C 3 69  ? -15.40500 81.16700  -10.52700 1.000 16.92430 ? 373  LEU A O     1 
ATOM   1123 C  CB    . LEU C 3 69  ? -15.55400 79.44300  -7.79600  1.000 16.75335 ? 373  LEU A CB    1 
ATOM   1124 C  CG    . LEU C 3 69  ? -16.35300 78.28300  -7.19000  1.000 15.23824 ? 373  LEU A CG    1 
ATOM   1125 C  CD1   . LEU C 3 69  ? -16.64200 78.51700  -5.70400  1.000 17.83996 ? 373  LEU A CD1   1 
ATOM   1126 C  CD2   . LEU C 3 69  ? -17.64700 78.10400  -7.95400  1.000 19.59216 ? 373  LEU A CD2   1 
ATOM   1127 N  N     . CYS C 3 70  ? -13.31200 80.78200  -9.79900  1.000 16.34102 ? 374  CYS A N     1 
ATOM   1128 C  CA    A CYS C 3 70  ? -12.72200 81.98900  -10.36200 0.860 19.48202 ? 374  CYS A CA    1 
ATOM   1129 C  CA    B CYS C 3 70  ? -12.81700 82.00000  -10.43200 0.140 19.47642 ? 374  CYS A CA    1 
ATOM   1130 C  C     . CYS C 3 70  ? -11.87000 81.71200  -11.59600 1.000 18.52751 ? 374  CYS A C     1 
ATOM   1131 O  O     . CYS C 3 70  ? -11.00800 82.53000  -11.93100 1.000 18.78912 ? 374  CYS A O     1 
ATOM   1132 C  CB    A CYS C 3 70  ? -11.87200 82.70500  -9.30900  0.860 19.41991 ? 374  CYS A CB    1 
ATOM   1133 C  CB    B CYS C 3 70  ? -12.15900 82.91000  -9.40000  0.140 19.63036 ? 374  CYS A CB    1 
ATOM   1134 S  SG    A CYS C 3 70  ? -12.63300 82.87300  -7.67800  0.860 19.12585 ? 374  CYS A SG    1 
ATOM   1135 S  SG    B CYS C 3 70  ? -10.63900 82.28100  -8.72800  0.140 17.97310 ? 374  CYS A SG    1 
ATOM   1136 N  N     . ARG C 3 71  ? -12.06100 80.57500  -12.26200 1.000 20.26572 ? 375  ARG A N     1 
ATOM   1137 C  CA    . ARG C 3 71  ? -11.19100 80.23300  -13.38300 1.000 17.78500 ? 375  ARG A CA    1 
ATOM   1138 C  C     . ARG C 3 71  ? -11.37200 81.22100  -14.53200 1.000 23.61742 ? 375  ARG A C     1 
ATOM   1139 O  O     . ARG C 3 71  ? -12.42600 81.84000  -14.68700 1.000 18.01348 ? 375  ARG A O     1 
ATOM   1140 C  CB    . ARG C 3 71  ? -11.46700 78.81600  -13.87200 1.000 16.86276 ? 375  ARG A CB    1 
ATOM   1141 C  CG    . ARG C 3 71  ? -12.83700 78.62600  -14.52300 1.000 18.56477 ? 375  ARG A CG    1 
ATOM   1142 C  CD    . ARG C 3 71  ? -13.18500 77.14500  -14.59100 1.000 22.69797 ? 375  ARG A CD    1 
ATOM   1143 N  NE    . ARG C 3 71  ? -14.45700 76.88800  -15.25500 1.000 27.92694 ? 375  ARG A NE    1 
ATOM   1144 C  CZ    . ARG C 3 71  ? -15.65100 77.09700  -14.70900 1.000 30.79048 ? 375  ARG A CZ    1 
ATOM   1145 N  NH1   . ARG C 3 71  ? -15.75800 77.57700  -13.46800 1.000 24.69894 ? 375  ARG A NH1   1 
ATOM   1146 N  NH2   . ARG C 3 71  ? -16.74500 76.82300  -15.40500 1.000 31.51790 ? 375  ARG A NH2   1 
ATOM   1147 N  N     . SER C 3 72  ? -10.32900 81.35800  -15.34300 1.000 21.80355 ? 376  SER A N     1 
ATOM   1148 C  CA    . SER C 3 72  ? -10.39500 82.21500  -16.51500 1.000 29.13972 ? 376  SER A CA    1 
ATOM   1149 C  C     . SER C 3 72  ? -11.24500 81.55500  -17.60400 1.000 31.19612 ? 376  SER A C     1 
ATOM   1150 O  O     . SER C 3 72  ? -11.59500 80.36900  -17.52700 1.000 24.25569 ? 376  SER A O     1 
ATOM   1151 C  CB    . SER C 3 72  ? -8.99500  82.49600  -17.05500 1.000 27.10591 ? 376  SER A CB    1 
ATOM   1152 O  OG    . SER C 3 72  ? -8.49300  81.35900  -17.73500 1.000 26.56351 ? 376  SER A OG    1 
ATOM   1153 N  N     . SER C 3 73  ? -11.56200 82.34200  -18.64400 1.000 26.00168 ? 377  SER A N     1 
ATOM   1154 C  CA    . SER C 3 73  ? -12.41900 81.87500  -19.73100 1.000 28.68291 ? 377  SER A CA    1 
ATOM   1155 C  C     . SER C 3 73  ? -11.78300 80.74800  -20.54300 1.000 29.23349 ? 377  SER A C     1 
ATOM   1156 O  O     . SER C 3 73  ? -12.51400 79.97400  -21.17400 1.000 35.67828 ? 377  SER A O     1 
ATOM   1157 C  CB    . SER C 3 73  ? -12.78200 83.04000  -20.66200 1.000 40.57766 ? 377  SER A CB    1 
ATOM   1158 O  OG    . SER C 3 73  ? -11.66700 83.45400  -21.44000 1.000 43.07070 ? 377  SER A OG    1 
ATOM   1159 N  N     . SER C 3 74  ? -10.44700 80.63400  -20.53100 1.000 25.43611 ? 378  SER A N     1 
ATOM   1160 C  CA    . SER C 3 74  ? -9.76900  79.49800  -21.15400 1.000 32.46524 ? 378  SER A CA    1 
ATOM   1161 C  C     . SER C 3 74  ? -10.21300 78.16200  -20.56400 1.000 29.17405 ? 378  SER A C     1 
ATOM   1162 O  O     . SER C 3 74  ? -10.08100 77.12900  -21.22800 1.000 28.71690 ? 378  SER A O     1 
ATOM   1163 C  CB    . SER C 3 74  ? -8.25100  79.62400  -20.99200 1.000 29.35774 ? 378  SER A CB    1 
ATOM   1164 O  OG    . SER C 3 74  ? -7.83800  80.97000  -21.07000 1.000 44.05660 ? 378  SER A OG    1 
ATOM   1165 N  N     . PHE C 3 75  ? -10.72400 78.16000  -19.33000 1.000 27.81892 ? 379  PHE A N     1 
ATOM   1166 C  CA    . PHE C 3 75  ? -11.19600 76.96000  -18.64600 1.000 26.07794 ? 379  PHE A CA    1 
ATOM   1167 C  C     . PHE C 3 75  ? -12.70900 76.96700  -18.44100 1.000 24.88939 ? 379  PHE A C     1 
ATOM   1168 O  O     . PHE C 3 75  ? -13.22200 76.24400  -17.57800 1.000 25.88428 ? 379  PHE A O     1 
ATOM   1169 C  CB    . PHE C 3 75  ? -10.47700 76.81500  -17.30500 1.000 26.65564 ? 379  PHE A CB    1 
ATOM   1170 C  CG    . PHE C 3 75  ? -8.97600  76.87500  -17.41500 1.000 27.64321 ? 379  PHE A CG    1 
ATOM   1171 C  CD1   . PHE C 3 75  ? -8.24400  75.72600  -17.66900 1.000 25.86896 ? 379  PHE A CD1   1 
ATOM   1172 C  CD2   . PHE C 3 75  ? -8.30300  78.08100  -17.28400 1.000 26.30542 ? 379  PHE A CD2   1 
ATOM   1173 C  CE1   . PHE C 3 75  ? -6.87200  75.77900  -17.77900 1.000 32.70215 ? 379  PHE A CE1   1 
ATOM   1174 C  CE2   . PHE C 3 75  ? -6.93000  78.13900  -17.39300 1.000 29.42840 ? 379  PHE A CE2   1 
ATOM   1175 C  CZ    . PHE C 3 75  ? -6.21100  76.98700  -17.63500 1.000 28.71224 ? 379  PHE A CZ    1 
ATOM   1176 N  N     . SER C 3 76  ? -13.42600 77.76800  -19.23000 1.000 29.81713 ? 380  SER A N     1 
ATOM   1177 C  CA    . SER C 3 76  ? -14.86800 77.92100  -19.06500 1.000 29.68233 ? 380  SER A CA    1 
ATOM   1178 C  C     . SER C 3 76  ? -15.60100 76.58300  -19.08300 1.000 24.06766 ? 380  SER A C     1 
ATOM   1179 O  O     . SER C 3 76  ? -16.50900 76.35300  -18.27700 1.000 23.59581 ? 380  SER A O     1 
ATOM   1180 C  CB    . SER C 3 76  ? -15.40100 78.83500  -20.16600 1.000 32.50385 ? 380  SER A CB    1 
ATOM   1181 O  OG    . SER C 3 76  ? -15.40500 80.18800  -19.74300 1.000 45.47935 ? 380  SER A OG    1 
ATOM   1182 N  N     . ALA C 3 77  ? -15.21100 75.68100  -19.97700 1.000 24.50586 ? 381  ALA A N     1 
ATOM   1183 C  CA    . ALA C 3 77  ? -15.94800 74.43200  -20.15300 1.000 25.22275 ? 381  ALA A CA    1 
ATOM   1184 C  C     . ALA C 3 77  ? -15.57700 73.34800  -19.14700 1.000 26.63781 ? 381  ALA A C     1 
ATOM   1185 O  O     . ALA C 3 77  ? -16.19000 72.27700  -19.15400 1.000 31.96136 ? 381  ALA A O     1 
ATOM   1186 C  CB    . ALA C 3 77  ? -15.73100 73.89200  -21.56900 1.000 32.44419 ? 381  ALA A CB    1 
ATOM   1187 N  N     . CYS C 3 78  ? -14.59100 73.58000  -18.29700 1.000 25.19270 ? 382  CYS A N     1 
ATOM   1188 C  CA    . CYS C 3 78  ? -14.20000 72.57800  -17.32100 1.000 25.48994 ? 382  CYS A CA    1 
ATOM   1189 C  C     . CYS C 3 78  ? -15.31300 72.37000  -16.28800 1.000 24.01173 ? 382  CYS A C     1 
ATOM   1190 O  O     . CYS C 3 78  ? -15.97700 73.32000  -15.86700 1.000 26.37853 ? 382  CYS A O     1 
ATOM   1191 C  CB    . CYS C 3 78  ? -12.87800 73.02400  -16.69500 1.000 31.12536 ? 382  CYS A CB    1 
ATOM   1192 S  SG    . CYS C 3 78  ? -12.48200 72.46100  -15.07600 1.000 42.37090 ? 382  CYS A SG    1 
ATOM   1193 N  N     . ASP C 3 79  ? -15.53200 71.11400  -15.89400 1.000 22.01415 ? 383  ASP A N     1 
ATOM   1194 C  CA    . ASP C 3 79  ? -16.68800 70.72100  -15.08600 1.000 26.99770 ? 383  ASP A CA    1 
ATOM   1195 C  C     . ASP C 3 79  ? -16.22500 70.14200  -13.75000 1.000 22.39550 ? 383  ASP A C     1 
ATOM   1196 O  O     . ASP C 3 79  ? -15.68800 69.03200  -13.70500 1.000 22.52308 ? 383  ASP A O     1 
ATOM   1197 C  CB    . ASP C 3 79  ? -17.55000 69.70600  -15.85000 1.000 28.52667 ? 383  ASP A CB    1 
ATOM   1198 C  CG    . ASP C 3 79  ? -18.87100 69.40100  -15.14300 1.000 33.24442 ? 383  ASP A CG    1 
ATOM   1199 O  OD1   . ASP C 3 79  ? -18.86300 69.03400  -13.94400 1.000 32.46072 ? 383  ASP A OD1   1 
ATOM   1200 O  OD2   . ASP C 3 79  ? -19.92500 69.51400  -15.79600 1.000 44.41076 ? 383  ASP A OD2   1 
ATOM   1201 N  N     . PHE C 3 80  ? -16.48700 70.86300  -12.65200 1.000 22.57200 ? 384  PHE A N     1 
ATOM   1202 C  CA    . PHE C 3 80  ? -15.91000 70.49400  -11.35500 1.000 21.59342 ? 384  PHE A CA    1 
ATOM   1203 C  C     . PHE C 3 80  ? -16.39500 69.14600  -10.84200 1.000 23.98717 ? 384  PHE A C     1 
ATOM   1204 O  O     . PHE C 3 80  ? -15.71500 68.52700  -10.01600 1.000 18.99142 ? 384  PHE A O     1 
ATOM   1205 C  CB    . PHE C 3 80  ? -16.23200 71.56000  -10.30400 1.000 19.72626 ? 384  PHE A CB    1 
ATOM   1206 C  CG    . PHE C 3 80  ? -15.42200 71.42400  -9.03500  1.000 20.35485 ? 384  PHE A CG    1 
ATOM   1207 C  CD1   . PHE C 3 80  ? -14.04700 71.65900  -9.03600  1.000 21.48111 ? 384  PHE A CD1   1 
ATOM   1208 C  CD2   . PHE C 3 80  ? -16.03200 71.05600  -7.84500  1.000 20.41954 ? 384  PHE A CD2   1 
ATOM   1209 C  CE1   . PHE C 3 80  ? -13.31200 71.55100  -7.86100  1.000 22.51060 ? 384  PHE A CE1   1 
ATOM   1210 C  CE2   . PHE C 3 80  ? -15.29400 70.92900  -6.67100  1.000 19.87551 ? 384  PHE A CE2   1 
ATOM   1211 C  CZ    . PHE C 3 80  ? -13.93700 71.17700  -6.67900  1.000 19.29967 ? 384  PHE A CZ    1 
ATOM   1212 N  N     . LYS C 3 81  ? -17.56300 68.69300  -11.28500 1.000 25.87613 ? 385  LYS A N     1 
ATOM   1213 C  CA    . LYS C 3 81  ? -18.10000 67.41500  -10.85000 1.000 24.34578 ? 385  LYS A CA    1 
ATOM   1214 C  C     . LYS C 3 81  ? -17.66300 66.24400  -11.72400 1.000 25.60758 ? 385  LYS A C     1 
ATOM   1215 O  O     . LYS C 3 81  ? -17.78900 65.08700  -11.29200 1.000 16.64519 ? 385  LYS A O     1 
ATOM   1216 C  CB    . LYS C 3 81  ? -19.63100 67.48700  -10.82100 1.000 29.07125 ? 385  LYS A CB    1 
ATOM   1217 C  CG    . LYS C 3 81  ? -20.17700 68.59200  -9.94600  1.000 30.31685 ? 385  LYS A CG    1 
ATOM   1218 C  CD    . LYS C 3 81  ? -21.58500 68.98300  -10.36100 1.000 39.57289 ? 385  LYS A CD    1 
ATOM   1219 C  CE    . LYS C 3 81  ? -21.56000 70.07500  -11.41700 1.000 49.30036 ? 385  LYS A CE    1 
ATOM   1220 N  NZ    . LYS C 3 81  ? -22.42900 69.76900  -12.59800 1.000 54.27220 ? 385  LYS A NZ    1 
ATOM   1221 N  N     . ARG C 3 82  ? -17.14600 66.50900  -12.92900 1.000 21.89293 ? 386  ARG A N     1 
ATOM   1222 C  CA    . ARG C 3 82  ? -16.82500 65.45900  -13.89400 1.000 26.68597 ? 386  ARG A CA    1 
ATOM   1223 C  C     . ARG C 3 82  ? -15.34700 65.28000  -14.14600 1.000 28.63665 ? 386  ARG A C     1 
ATOM   1224 O  O     . ARG C 3 82  ? -14.91700 64.16700  -14.46200 1.000 26.89648 ? 386  ARG A O     1 
ATOM   1225 C  CB    . ARG C 3 82  ? -17.46000 65.74800  -15.26100 1.000 26.75048 ? 386  ARG A CB    1 
ATOM   1226 C  CG    . ARG C 3 82  ? -18.90400 66.13900  -15.25600 1.000 37.78621 ? 386  ARG A CG    1 
ATOM   1227 C  CD    . ARG C 3 82  ? -19.73800 65.10500  -14.56500 1.000 41.47978 ? 386  ARG A CD    1 
ATOM   1228 N  NE    . ARG C 3 82  ? -20.06600 63.94900  -15.40400 1.000 49.30477 ? 386  ARG A NE    1 
ATOM   1229 C  CZ    . ARG C 3 82  ? -20.76600 63.98700  -16.53600 1.000 52.05584 ? 386  ARG A CZ    1 
ATOM   1230 N  NH1   . ARG C 3 82  ? -21.23100 65.13800  -17.01000 1.000 48.98275 ? 386  ARG A NH1   1 
ATOM   1231 N  NH2   . ARG C 3 82  ? -21.01300 62.85300  -17.19200 1.000 41.38551 ? 386  ARG A NH2   1 
ATOM   1232 N  N     . ASP C 3 83  ? -14.58200 66.36100  -14.08600 1.000 23.31623 ? 387  ASP A N     1 
ATOM   1233 C  CA    . ASP C 3 83  ? -13.19500 66.42100  -14.50200 1.000 26.05011 ? 387  ASP A CA    1 
ATOM   1234 C  C     . ASP C 3 83  ? -12.25800 66.33700  -13.30300 1.000 24.39890 ? 387  ASP A C     1 
ATOM   1235 O  O     . ASP C 3 83  ? -12.57400 66.84700  -12.21800 1.000 20.96730 ? 387  ASP A O     1 
ATOM   1236 C  CB    . ASP C 3 83  ? -12.92300 67.71900  -15.26600 1.000 29.40120 ? 387  ASP A CB    1 
ATOM   1237 C  CG    . ASP C 3 83  ? -13.81200 67.88200  -16.49900 1.000 28.60016 ? 387  ASP A CG    1 
ATOM   1238 O  OD1   . ASP C 3 83  ? -14.37300 66.87600  -16.96700 1.000 33.95161 ? 387  ASP A OD1   1 
ATOM   1239 O  OD2   . ASP C 3 83  ? -13.92300 69.02100  -17.01400 1.000 30.01217 ? 387  ASP A OD2   1 
ATOM   1240 N  N     . PRO C 3 84  ? -11.12300 65.66300  -13.48900 1.000 19.30448 ? 388  PRO A N     1 
ATOM   1241 C  CA    . PRO C 3 84  ? -10.05700 65.68100  -12.48200 1.000 22.37875 ? 388  PRO A CA    1 
ATOM   1242 C  C     . PRO C 3 84  ? -9.30200  67.00100  -12.56900 1.000 20.34575 ? 388  PRO A C     1 
ATOM   1243 O  O     . PRO C 3 84  ? -8.73800  67.33900  -13.61200 1.000 19.16029 ? 388  PRO A O     1 
ATOM   1244 C  CB    . PRO C 3 84  ? -9.17500  64.49600  -12.88500 1.000 20.50714 ? 388  PRO A CB    1 
ATOM   1245 C  CG    . PRO C 3 84  ? -9.38000  64.36500  -14.34000 1.000 15.04417 ? 388  PRO A CG    1 
ATOM   1246 C  CD    . PRO C 3 84  ? -10.78800 64.79300  -14.63200 1.000 20.11088 ? 388  PRO A CD    1 
ATOM   1247 N  N     . ILE C 3 85  ? -9.30500  67.75100  -11.46700 1.000 23.11493 ? 389  ILE A N     1 
ATOM   1248 C  CA    . ILE C 3 85  ? -8.81200  69.12300  -11.41900 1.000 21.04632 ? 389  ILE A CA    1 
ATOM   1249 C  C     . ILE C 3 85  ? -7.74400  69.23300  -10.33600 1.000 22.36267 ? 389  ILE A C     1 
ATOM   1250 O  O     . ILE C 3 85  ? -7.96200  68.79600  -9.20000  1.000 24.13647 ? 389  ILE A O     1 
ATOM   1251 C  CB    . ILE C 3 85  ? -9.96600  70.10100  -11.14400 1.000 19.85847 ? 389  ILE A CB    1 
ATOM   1252 C  CG1   . ILE C 3 85  ? -10.95100 70.09100  -12.31700 1.000 24.29097 ? 389  ILE A CG1   1 
ATOM   1253 C  CG2   . ILE C 3 85  ? -9.41600  71.50000  -10.82500 1.000 19.27727 ? 389  ILE A CG2   1 
ATOM   1254 C  CD1   . ILE C 3 85  ? -12.28200 70.78300  -12.01000 1.000 24.43211 ? 389  ILE A CD1   1 
ATOM   1255 N  N     . VAL C 3 86  ? -6.59700  69.82200  -10.68700 1.000 18.62463 ? 390  VAL A N     1 
ATOM   1256 C  CA    . VAL C 3 86  ? -5.53900  70.15500  -9.74000  1.000 17.74761 ? 390  VAL A CA    1 
ATOM   1257 C  C     . VAL C 3 86  ? -5.22400  71.64300  -9.88200  1.000 22.11167 ? 390  VAL A C     1 
ATOM   1258 O  O     . VAL C 3 86  ? -5.50000  72.26700  -10.91300 1.000 17.74901 ? 390  VAL A O     1 
ATOM   1259 C  CB    . VAL C 3 86  ? -4.24200  69.33500  -9.95000  1.000 18.80732 ? 390  VAL A CB    1 
ATOM   1260 C  CG1   . VAL C 3 86  ? -4.47000  67.85100  -9.66400  1.000 21.04854 ? 390  VAL A CG1   1 
ATOM   1261 C  CG2   . VAL C 3 86  ? -3.70600  69.54900  -11.35500 1.000 22.21715 ? 390  VAL A CG2   1 
ATOM   1262 N  N     . VAL C 3 87  ? -4.64300  72.20500  -8.82000  1.000 14.22395 ? 391  VAL A N     1 
ATOM   1263 C  CA    . VAL C 3 87  ? -4.02600  73.52800  -8.84000  1.000 12.63472 ? 391  VAL A CA    1 
ATOM   1264 C  C     . VAL C 3 87  ? -2.52200  73.34300  -8.72000  1.000 13.23872 ? 391  VAL A C     1 
ATOM   1265 O  O     . VAL C 3 87  ? -2.04700  72.67600  -7.79100  1.000 13.56369 ? 391  VAL A O     1 
ATOM   1266 C  CB    . VAL C 3 87  ? -4.54900  74.41100  -7.69600  1.000 15.71145 ? 391  VAL A CB    1 
ATOM   1267 C  CG1   . VAL C 3 87  ? -3.78800  75.74700  -7.64100  1.000 14.27478 ? 391  VAL A CG1   1 
ATOM   1268 C  CG2   . VAL C 3 87  ? -6.06900  74.59300  -7.79900  1.000 13.37533 ? 391  VAL A CG2   1 
ATOM   1269 N  N     . CYS C 3 88  ? -1.77600  73.94100  -9.64200  1.000 15.85816 ? 392  CYS A N     1 
ATOM   1270 C  CA    . CYS C 3 88  ? -0.31800  73.90900  -9.59600  1.000 16.55720 ? 392  CYS A CA    1 
ATOM   1271 C  C     . CYS C 3 88  ? 0.23300   74.94900  -10.56900 1.000 13.75500 ? 392  CYS A C     1 
ATOM   1272 O  O     . CYS C 3 88  ? -0.50400  75.52800  -11.37200 1.000 17.84329 ? 392  CYS A O     1 
ATOM   1273 C  CB    . CYS C 3 88  ? 0.20800   72.51800  -9.92800  1.000 16.15612 ? 392  CYS A CB    1 
ATOM   1274 S  SG    . CYS C 3 88  ? -0.42800  71.95400  -11.50100 1.000 22.09096 ? 392  CYS A SG    1 
ATOM   1275 N  N     . HIS C 3 89  ? 1.54500   75.19400  -10.46600 1.000 15.80363 ? 393  HIS A N     1 
ATOM   1276 C  CA    . HIS C 3 89  ? 2.25200   76.11700  -11.36200 1.000 17.85916 ? 393  HIS A CA    1 
ATOM   1277 C  C     . HIS C 3 89  ? 2.61300   75.47900  -12.70300 1.000 20.77343 ? 393  HIS A C     1 
ATOM   1278 O  O     . HIS C 3 89  ? 2.50400   76.12700  -13.75100 1.000 16.87642 ? 393  HIS A O     1 
ATOM   1279 C  CB    . HIS C 3 89  ? 3.55500   76.60500  -10.71100 1.000 20.03509 ? 393  HIS A CB    1 
ATOM   1280 C  CG    . HIS C 3 89  ? 3.34900   77.51800  -9.55200  1.000 12.98781 ? 393  HIS A CG    1 
ATOM   1281 N  ND1   . HIS C 3 89  ? 2.85600   78.79300  -9.69900  1.000 11.54081 ? 393  HIS A ND1   1 
ATOM   1282 C  CD2   . HIS C 3 89  ? 3.58000   77.34800  -8.22900  1.000 16.38585 ? 393  HIS A CD2   1 
ATOM   1283 C  CE1   . HIS C 3 89  ? 2.76700   79.36700  -8.51100  1.000 13.29698 ? 393  HIS A CE1   1 
ATOM   1284 N  NE2   . HIS C 3 89  ? 3.19600   78.51100  -7.60000  1.000 16.60751 ? 393  HIS A NE2   1 
ATOM   1285 N  N     . GLY C 3 90  ? 3.10000   74.23700  -12.68700 1.000 21.61104 ? 394  GLY A N     1 
ATOM   1286 C  CA    . GLY C 3 90  ? 3.72200   73.67500  -13.87700 1.000 24.47072 ? 394  GLY A CA    1 
ATOM   1287 C  C     . GLY C 3 90  ? 3.13900   72.38500  -14.42400 1.000 29.72677 ? 394  GLY A C     1 
ATOM   1288 O  O     . GLY C 3 90  ? 1.95700   72.08600  -14.20600 1.000 24.52574 ? 394  GLY A O     1 
ATOM   1289 N  N     . THR C 3 91  ? 3.97400   71.60700  -15.13900 1.000 23.48066 ? 395  THR A N     1 
ATOM   1290 C  CA    . THR C 3 91  ? 3.52700   70.42400  -15.86500 1.000 22.76696 ? 395  THR A CA    1 
ATOM   1291 C  C     . THR C 3 91  ? 4.21700   69.13400  -15.45500 1.000 25.97862 ? 395  THR A C     1 
ATOM   1292 O  O     . THR C 3 91  ? 3.75700   68.05700  -15.85400 1.000 26.88988 ? 395  THR A O     1 
ATOM   1293 C  CB    . THR C 3 91  ? 3.73900   70.59900  -17.37200 1.000 25.19708 ? 395  THR A CB    1 
ATOM   1294 O  OG1   . THR C 3 91  ? 5.09600   70.98600  -17.61800 1.000 25.48032 ? 395  THR A OG1   1 
ATOM   1295 C  CG2   . THR C 3 91  ? 2.80500   71.64400  -17.92100 1.000 29.61194 ? 395  THR A CG2   1 
ATOM   1296 N  N     . LYS C 3 92  ? 5.29900   69.20000  -14.68200 1.000 25.37262 ? 396  LYS A N     1 
ATOM   1297 C  CA    . LYS C 3 92  ? 6.07700   68.00300  -14.42400 1.000 22.87166 ? 396  LYS A CA    1 
ATOM   1298 C  C     . LYS C 3 92  ? 6.34000   67.80700  -12.93700 1.000 25.14621 ? 396  LYS A C     1 
ATOM   1299 O  O     . LYS C 3 92  ? 5.53400   67.19800  -12.23000 1.000 21.53809 ? 396  LYS A O     1 
ATOM   1300 C  CB    . LYS C 3 92  ? 7.40100   68.06300  -15.19400 1.000 25.67487 ? 396  LYS A CB    1 
ATOM   1301 C  CG    . LYS C 3 92  ? 7.31100   67.56600  -16.62800 1.000 31.79533 ? 396  LYS A CG    1 
ATOM   1302 C  CD    . LYS C 3 92  ? 8.68100   67.08200  -17.17200 1.000 48.60967 ? 396  LYS A CD    1 
ATOM   1303 C  CE    . LYS C 3 92  ? 9.60000   66.46600  -16.09000 1.000 40.59968 ? 396  LYS A CE    1 
ATOM   1304 N  NZ    . LYS C 3 92  ? 8.98600   65.34200  -15.31000 1.000 42.97652 ? 396  LYS A NZ    1 
ATOM   1305 N  N     . ASN C 3 93  ? 7.49200   68.26200  -12.45600 1.000 21.97120 ? 397  ASN A N     1 
ATOM   1306 C  CA    . ASN C 3 93  ? 7.78000   68.12100  -11.03300 1.000 20.94821 ? 397  ASN A CA    1 
ATOM   1307 C  C     . ASN C 3 93  ? 7.26700   69.32700  -10.25600 1.000 16.88660 ? 397  ASN A C     1 
ATOM   1308 O  O     . ASN C 3 93  ? 7.98700   69.98400  -9.50900  1.000 19.89670 ? 397  ASN A O     1 
ATOM   1309 C  CB    . ASN C 3 93  ? 9.26900   67.89400  -10.82100 1.000 20.23726 ? 397  ASN A CB    1 
ATOM   1310 C  CG    . ASN C 3 93  ? 9.80500   66.73100  -11.65600 1.000 24.05252 ? 397  ASN A CG    1 
ATOM   1311 O  OD1   . ASN C 3 93  ? 9.09200   65.76600  -11.92600 1.000 16.41815 ? 397  ASN A OD1   1 
ATOM   1312 N  ND2   . ASN C 3 93  ? 11.06300  66.82200  -12.06400 1.000 29.81590 ? 397  ASN A ND2   1 
ATOM   1313 N  N     . SER C 3 94  ? 5.97800   69.59400  -10.43200 1.000 19.81187 ? 398  SER A N     1 
ATOM   1314 C  CA    . SER C 3 94  ? 5.30100   70.72200  -9.81200  1.000 17.48136 ? 398  SER A CA    1 
ATOM   1315 C  C     . SER C 3 94  ? 4.27400   70.17800  -8.82600  1.000 17.41448 ? 398  SER A C     1 
ATOM   1316 O  O     . SER C 3 94  ? 3.52800   69.24800  -9.15800  1.000 22.46521 ? 398  SER A O     1 
ATOM   1317 C  CB    . SER C 3 94  ? 4.63700   71.59300  -10.88300 1.000 14.87165 ? 398  SER A CB    1 
ATOM   1318 O  OG    . SER C 3 94  ? 3.81200   72.60000  -10.32400 1.000 16.76005 ? 398  SER A OG    1 
ATOM   1319 N  N     . ASP C 3 95  ? 4.26000   70.72500  -7.60600  1.000 18.78179 ? 399  ASP A N     1 
ATOM   1320 C  CA    . ASP C 3 95  ? 3.36000   70.21700  -6.57200  1.000 17.02364 ? 399  ASP A CA    1 
ATOM   1321 C  C     . ASP C 3 95  ? 1.89900   70.44300  -6.94500  1.000 17.35612 ? 399  ASP A C     1 
ATOM   1322 O  O     . ASP C 3 95  ? 1.51200   71.52100  -7.40200  1.000 15.52571 ? 399  ASP A O     1 
ATOM   1323 C  CB    . ASP C 3 95  ? 3.61900   70.90100  -5.23200  1.000 20.11211 ? 399  ASP A CB    1 
ATOM   1324 C  CG    . ASP C 3 95  ? 4.93000   70.48100  -4.57300  1.000 24.42667 ? 399  ASP A CG    1 
ATOM   1325 O  OD1   . ASP C 3 95  ? 5.61900   69.57200  -5.07400  1.000 23.60466 ? 399  ASP A OD1   1 
ATOM   1326 O  OD2   . ASP C 3 95  ? 5.27200   71.09100  -3.53300  1.000 23.59214 ? 399  ASP A OD2   1 
ATOM   1327 N  N     . ILE C 3 96  ? 1.07300   69.43100  -6.70600  1.000 18.93836 ? 400  ILE A N     1 
ATOM   1328 C  CA    . ILE C 3 96  ? -0.37600  69.60800  -6.73000  1.000 20.03525 ? 400  ILE A CA    1 
ATOM   1329 C  C     . ILE C 3 96  ? -0.78100  70.23700  -5.40000  1.000 16.53365 ? 400  ILE A C     1 
ATOM   1330 O  O     . ILE C 3 96  ? -0.69000  69.59600  -4.34800  1.000 17.46048 ? 400  ILE A O     1 
ATOM   1331 C  CB    . ILE C 3 96  ? -1.10200  68.27900  -6.96800  1.000 14.32776 ? 400  ILE A CB    1 
ATOM   1332 C  CG1   . ILE C 3 96  ? -0.88000  67.82900  -8.40900  1.000 18.40624 ? 400  ILE A CG1   1 
ATOM   1333 C  CG2   . ILE C 3 96  ? -2.59200  68.38200  -6.64100  1.000 18.78081 ? 400  ILE A CG2   1 
ATOM   1334 C  CD1   . ILE C 3 96  ? -1.09800  66.37400  -8.59300  1.000 17.78672 ? 400  ILE A CD1   1 
ATOM   1335 N  N     . ALA C 3 97  ? -1.22000  71.49900  -5.43800  1.000 12.91623 ? 401  ALA A N     1 
ATOM   1336 C  CA    . ALA C 3 97  ? -1.54800  72.18900  -4.18500  1.000 18.96642 ? 401  ALA A CA    1 
ATOM   1337 C  C     . ALA C 3 97  ? -2.90900  71.77500  -3.63300  1.000 15.71840 ? 401  ALA A C     1 
ATOM   1338 O  O     . ALA C 3 97  ? -3.12200  71.81100  -2.41500  1.000 17.78378 ? 401  ALA A O     1 
ATOM   1339 C  CB    . ALA C 3 97  ? -1.52400  73.71000  -4.37900  1.000 17.93197 ? 401  ALA A CB    1 
ATOM   1340 N  N     . SER C 3 98  ? -3.83300  71.40500  -4.50900  1.000 15.73207 ? 402  SER A N     1 
ATOM   1341 C  CA    . SER C 3 98  ? -5.16400  70.94700  -4.14400  1.000 13.50890 ? 402  SER A CA    1 
ATOM   1342 C  C     . SER C 3 98  ? -5.67900  70.12000  -5.31600  1.000 17.37678 ? 402  SER A C     1 
ATOM   1343 O  O     . SER C 3 98  ? -5.28100  70.34500  -6.46600  1.000 14.80220 ? 402  SER A O     1 
ATOM   1344 C  CB    . SER C 3 98  ? -6.08800  72.14000  -3.84000  1.000 14.44751 ? 402  SER A CB    1 
ATOM   1345 O  OG    . SER C 3 98  ? -7.34400  71.73400  -3.30700  1.000 19.16423 ? 402  SER A OG    1 
ATOM   1346 N  N     . CYS C 3 99  ? -6.53200  69.13900  -5.02200  1.000 14.05004 ? 403  CYS A N     1 
ATOM   1347 C  CA    . CYS C 3 99  ? -7.15200  68.35600  -6.08200  1.000 14.52673 ? 403  CYS A CA    1 
ATOM   1348 C  C     . CYS C 3 99  ? -8.62100  68.12000  -5.73500  1.000 15.70278 ? 403  CYS A C     1 
ATOM   1349 O  O     . CYS C 3 99  ? -8.98900  68.01800  -4.56500  1.000 15.42013 ? 403  CYS A O     1 
ATOM   1350 C  CB    . CYS C 3 99  ? -6.41500  67.02900  -6.31000  1.000 13.28956 ? 403  CYS A CB    1 
ATOM   1351 S  SG    . CYS C 3 99  ? -6.02700  66.10600  -4.82600  1.000 20.80496 ? 403  CYS A SG    1 
ATOM   1352 N  N     . ASN C 3 100 ? -9.46900  68.09200  -6.75200  1.000 17.03311 ? 404  ASN A N     1 
ATOM   1353 C  CA    . ASN C 3 100 ? -10.88200 67.90500  -6.47200  1.000 21.80878 ? 404  ASN A CA    1 
ATOM   1354 C  C     . ASN C 3 100 ? -11.16300 66.41800  -6.26700  1.000 24.40848 ? 404  ASN A C     1 
ATOM   1355 O  O     . ASN C 3 100 ? -10.28600 65.56900  -6.43400  1.000 23.55982 ? 404  ASN A O     1 
ATOM   1356 C  CB    . ASN C 3 100 ? -11.73600 68.51200  -7.58400  1.000 16.92743 ? 404  ASN A CB    1 
ATOM   1357 C  CG    . ASN C 3 100 ? -11.71900 67.69200  -8.85700  1.000 20.87453 ? 404  ASN A CG    1 
ATOM   1358 O  OD1   . ASN C 3 100 ? -10.79800 66.91600  -9.09300  1.000 15.83720 ? 404  ASN A OD1   1 
ATOM   1359 N  ND2   . ASN C 3 100 ? -12.74200 67.87400  -9.69400  1.000 16.28088 ? 404  ASN A ND2   1 
ATOM   1360 N  N     . TYR C 3 101 ? -12.39600 66.09600  -5.87100  1.000 23.14687 ? 405  TYR A N     1 
ATOM   1361 C  CA    . TYR C 3 101 ? -12.65200 64.71000  -5.50700  1.000 23.93798 ? 405  TYR A CA    1 
ATOM   1362 C  C     . TYR C 3 101 ? -12.76200 63.79500  -6.71700  1.000 19.64529 ? 405  TYR A C     1 
ATOM   1363 O  O     . TYR C 3 101 ? -12.57700 62.58700  -6.56900  1.000 20.71562 ? 405  TYR A O     1 
ATOM   1364 C  CB    . TYR C 3 101 ? -13.88600 64.60400  -4.60200  1.000 18.50842 ? 405  TYR A CB    1 
ATOM   1365 C  CG    . TYR C 3 101 ? -13.47600 64.82400  -3.15300  1.000 20.42044 ? 405  TYR A CG    1 
ATOM   1366 C  CD1   . TYR C 3 101 ? -13.27200 66.10600  -2.66200  1.000 20.90175 ? 405  TYR A CD1   1 
ATOM   1367 C  CD2   . TYR C 3 101 ? -13.23400 63.74700  -2.29800  1.000 22.38434 ? 405  TYR A CD2   1 
ATOM   1368 C  CE1   . TYR C 3 101 ? -12.87600 66.31800  -1.36500  1.000 22.45888 ? 405  TYR A CE1   1 
ATOM   1369 C  CE2   . TYR C 3 101 ? -12.83400 63.95100  -0.98900  1.000 23.69208 ? 405  TYR A CE2   1 
ATOM   1370 C  CZ    . TYR C 3 101 ? -12.65300 65.24300  -0.52900  1.000 25.11817 ? 405  TYR A CZ    1 
ATOM   1371 O  OH    . TYR C 3 101 ? -12.25100 65.47000  0.76900   1.000 23.37529 ? 405  TYR A OH    1 
ATOM   1372 N  N     . VAL C 3 102 ? -13.01500 64.33700  -7.90700  1.000 19.10042 ? 406  VAL A N     1 
ATOM   1373 C  CA    . VAL C 3 102 ? -12.80800 63.56100  -9.12500  1.000 17.15292 ? 406  VAL A CA    1 
ATOM   1374 C  C     . VAL C 3 102 ? -11.36500 63.06300  -9.19700  1.000 26.67539 ? 406  VAL A C     1 
ATOM   1375 O  O     . VAL C 3 102 ? -11.10900 61.86400  -9.35300  1.000 21.66860 ? 406  VAL A O     1 
ATOM   1376 C  CB    . VAL C 3 102 ? -13.16400 64.39200  -10.36400 1.000 21.42858 ? 406  VAL A CB    1 
ATOM   1377 C  CG1   . VAL C 3 102 ? -12.97900 63.53900  -11.62000 1.000 27.70001 ? 406  VAL A CG1   1 
ATOM   1378 C  CG2   . VAL C 3 102 ? -14.59400 64.95500  -10.24500 1.000 28.42894 ? 406  VAL A CG2   1 
ATOM   1379 N  N     . ALA C 3 103 ? -10.40200 63.98700  -9.10600  1.000 21.47427 ? 407  ALA A N     1 
ATOM   1380 C  CA    . ALA C 3 103 ? -8.99300  63.60200  -9.09700  1.000 23.50409 ? 407  ALA A CA    1 
ATOM   1381 C  C     . ALA C 3 103 ? -8.70400  62.58800  -8.00100  1.000 22.68051 ? 407  ALA A C     1 
ATOM   1382 O  O     . ALA C 3 103 ? -8.03300  61.57400  -8.22800  1.000 21.48418 ? 407  ALA A O     1 
ATOM   1383 C  CB    . ALA C 3 103 ? -8.10700  64.84200  -8.91600  1.000 20.30158 ? 407  ALA A CB    1 
ATOM   1384 N  N     . ARG C 3 104 ? -9.19600  62.84900  -6.79400  1.000 21.38802 ? 408  ARG A N     1 
ATOM   1385 C  CA    . ARG C 3 104 ? -8.84700  61.97000  -5.68700  1.000 25.34039 ? 408  ARG A CA    1 
ATOM   1386 C  C     . ARG C 3 104 ? -9.37200  60.56100  -5.90800  1.000 27.47875 ? 408  ARG A C     1 
ATOM   1387 O  O     . ARG C 3 104 ? -8.80500  59.59600  -5.38200  1.000 26.93089 ? 408  ARG A O     1 
ATOM   1388 C  CB    . ARG C 3 104 ? -9.38600  62.53900  -4.38400  1.000 25.95502 ? 408  ARG A CB    1 
ATOM   1389 C  CG    . ARG C 3 104 ? -8.67500  63.80200  -3.96900  1.000 24.70980 ? 408  ARG A CG    1 
ATOM   1390 C  CD    . ARG C 3 104 ? -9.11400  64.23500  -2.60700  1.000 26.07688 ? 408  ARG A CD    1 
ATOM   1391 N  NE    . ARG C 3 104 ? -8.90500  65.66900  -2.42600  1.000 34.05360 ? 408  ARG A NE    1 
ATOM   1392 C  CZ    . ARG C 3 104 ? -9.04500  66.30100  -1.26900  1.000 33.50778 ? 408  ARG A CZ    1 
ATOM   1393 N  NH1   . ARG C 3 104 ? -9.40200  65.62300  -0.18000  1.000 29.69935 ? 408  ARG A NH1   1 
ATOM   1394 N  NH2   . ARG C 3 104 ? -8.83000  67.60900  -1.20400  1.000 34.99800 ? 408  ARG A NH2   1 
ATOM   1395 N  N     . SER C 3 105 ? -10.44900 60.42400  -6.68100  1.000 23.84546 ? 409  SER A N     1 
ATOM   1396 C  CA    . SER C 3 105 ? -11.03200 59.11300  -6.92100  1.000 27.29269 ? 409  SER A CA    1 
ATOM   1397 C  C     . SER C 3 105 ? -10.07100 58.20300  -7.66600  1.000 28.12474 ? 409  SER A C     1 
ATOM   1398 O  O     . SER C 3 105 ? -10.26700 56.98400  -7.67800  1.000 29.26577 ? 409  SER A O     1 
ATOM   1399 C  CB    . SER C 3 105 ? -12.33200 59.27000  -7.70500  1.000 19.00070 ? 409  SER A CB    1 
ATOM   1400 O  OG    . SER C 3 105 ? -12.05200 59.46400  -9.07600  1.000 21.20518 ? 409  SER A OG    1 
ATOM   1401 N  N     . TYR C 3 106 ? -9.04800  58.77600  -8.29100  1.000 29.37166 ? 410  TYR A N     1 
ATOM   1402 C  CA    . TYR C 3 106 ? -8.01100  58.03700  -8.99000  1.000 27.09692 ? 410  TYR A CA    1 
ATOM   1403 C  C     . TYR C 3 106 ? -6.75900  57.84900  -8.15200  1.000 28.34941 ? 410  TYR A C     1 
ATOM   1404 O  O     . TYR C 3 106 ? -5.74500  57.39200  -8.68200  1.000 32.98416 ? 410  TYR A O     1 
ATOM   1405 C  CB    . TYR C 3 106 ? -7.63200  58.75700  -10.27600 1.000 30.03086 ? 410  TYR A CB    1 
ATOM   1406 C  CG    . TYR C 3 106 ? -8.74100  58.88200  -11.27800 1.000 29.82636 ? 410  TYR A CG    1 
ATOM   1407 C  CD1   . TYR C 3 106 ? -9.21200  57.76800  -11.95600 1.000 33.48395 ? 410  TYR A CD1   1 
ATOM   1408 C  CD2   . TYR C 3 106 ? -9.30400  60.12000  -11.57000 1.000 30.24699 ? 410  TYR A CD2   1 
ATOM   1409 C  CE1   . TYR C 3 106 ? -10.21500 57.87200  -12.89600 1.000 29.53925 ? 410  TYR A CE1   1 
ATOM   1410 C  CE2   . TYR C 3 106 ? -10.31700 60.23600  -12.51800 1.000 32.58086 ? 410  TYR A CE2   1 
ATOM   1411 C  CZ    . TYR C 3 106 ? -10.76400 59.10100  -13.17400 1.000 35.77459 ? 410  TYR A CZ    1 
ATOM   1412 O  OH    . TYR C 3 106 ? -11.76200 59.18800  -14.11700 1.000 41.57704 ? 410  TYR A OH    1 
ATOM   1413 N  N     . GLY C 3 107 ? -6.79300  58.21400  -6.87400  1.000 24.10134 ? 411  GLY A N     1 
ATOM   1414 C  CA    . GLY C 3 107 ? -5.62600  58.09600  -6.02400  1.000 26.73323 ? 411  GLY A CA    1 
ATOM   1415 C  C     . GLY C 3 107 ? -4.68600  59.28200  -6.04100  1.000 27.97116 ? 411  GLY A C     1 
ATOM   1416 O  O     . GLY C 3 107 ? -3.59500  59.19600  -5.46800  1.000 23.12939 ? 411  GLY A O     1 
ATOM   1417 N  N     . ILE C 3 108 ? -5.06200  60.37800  -6.70100  1.000 32.47093 ? 412  ILE A N     1 
ATOM   1418 C  CA    . ILE C 3 108 ? -4.28700  61.60900  -6.63000  1.000 26.50143 ? 412  ILE A CA    1 
ATOM   1419 C  C     . ILE C 3 108 ? -4.44800  62.21700  -5.24500  1.000 27.51271 ? 412  ILE A C     1 
ATOM   1420 O  O     . ILE C 3 108 ? -5.52400  62.15000  -4.63400  1.000 27.87296 ? 412  ILE A O     1 
ATOM   1421 C  CB    . ILE C 3 108 ? -4.73800  62.57300  -7.73800  1.000 22.79063 ? 412  ILE A CB    1 
ATOM   1422 C  CG1   . ILE C 3 108 ? -4.36500  61.98800  -9.10700  1.000 20.54979 ? 412  ILE A CG1   1 
ATOM   1423 C  CG2   . ILE C 3 108 ? -4.13800  63.97800  -7.54300  1.000 18.23611 ? 412  ILE A CG2   1 
ATOM   1424 C  CD1   . ILE C 3 108 ? -4.97400  62.71200  -10.28100 1.000 15.11197 ? 412  ILE A CD1   1 
ATOM   1425 N  N     . LYS C 3 109 ? -3.36900  62.78200  -4.71900  1.000 25.23622 ? 413  LYS A N     1 
ATOM   1426 C  CA    . LYS C 3 109 ? -3.42200  63.43700  -3.42300  1.000 23.37880 ? 413  LYS A CA    1 
ATOM   1427 C  C     . LYS C 3 109 ? -2.62600  64.72700  -3.48000  1.000 21.45242 ? 413  LYS A C     1 
ATOM   1428 O  O     . LYS C 3 109 ? -1.78200  64.93100  -4.35500  1.000 25.23568 ? 413  LYS A O     1 
ATOM   1429 C  CB    . LYS C 3 109 ? -2.88300  62.55700  -2.29000  1.000 26.11454 ? 413  LYS A CB    1 
ATOM   1430 C  CG    . LYS C 3 109 ? -3.23100  61.08600  -2.40000  1.000 35.29800 ? 413  LYS A CG    1 
ATOM   1431 C  CD    . LYS C 3 109 ? -2.42400  60.25500  -1.42700  1.000 40.06535 ? 413  LYS A CD    1 
ATOM   1432 C  CE    . LYS C 3 109 ? -3.29300  59.15600  -0.82500  1.000 53.17527 ? 413  LYS A CE    1 
ATOM   1433 N  NZ    . LYS C 3 109 ? -4.32200  58.66900  -1.79200  1.000 47.85381 ? 413  LYS A NZ    1 
ATOM   1434 N  N     . ASN C 3 110 ? -2.90600  65.59100  -2.51800  1.000 17.98863 ? 414  ASN A N     1 
ATOM   1435 C  CA    . ASN C 3 110 ? -2.16900  66.83300  -2.38200  1.000 23.87792 ? 414  ASN A CA    1 
ATOM   1436 C  C     . ASN C 3 110 ? -0.68600  66.55100  -2.17200  1.000 19.41928 ? 414  ASN A C     1 
ATOM   1437 O  O     . ASN C 3 110 ? -0.30900  65.58800  -1.50300  1.000 21.06760 ? 414  ASN A O     1 
ATOM   1438 C  CB    . ASN C 3 110 ? -2.74200  67.62200  -1.21400  1.000 21.62157 ? 414  ASN A CB    1 
ATOM   1439 C  CG    . ASN C 3 110 ? -4.10700  68.21800  -1.53600  1.000 22.14838 ? 414  ASN A CG    1 
ATOM   1440 O  OD1   . ASN C 3 110 ? -4.67000  67.96500  -2.59900  1.000 24.52593 ? 414  ASN A OD1   1 
ATOM   1441 N  ND2   . ASN C 3 110 ? -4.64200  69.01300  -0.61600  1.000 32.72810 ? 414  ASN A ND2   1 
ATOM   1442 N  N     . GLY C 3 111 ? 0.16200   67.39000  -2.75900  1.000 21.52622 ? 415  GLY A N     1 
ATOM   1443 C  CA    . GLY C 3 111 ? 1.60500   67.22600  -2.63100  1.000 21.51866 ? 415  GLY A CA    1 
ATOM   1444 C  C     . GLY C 3 111 ? 2.22100   66.30800  -3.66500  1.000 28.04411 ? 415  GLY A C     1 
ATOM   1445 O  O     . GLY C 3 111 ? 3.45200   66.29000  -3.80800  1.000 22.84999 ? 415  GLY A O     1 
ATOM   1446 N  N     A MET C 3 112 ? 1.39900   65.53600  -4.37300  0.530 21.98775 ? 416  MET A N     1 
ATOM   1447 N  N     B MET C 3 112 ? 1.41000   65.53100  -4.37600  0.470 22.00104 ? 416  MET A N     1 
ATOM   1448 C  CA    A MET C 3 112 ? 1.84200   64.79600  -5.54400  0.530 27.07556 ? 416  MET A CA    1 
ATOM   1449 C  CA    B MET C 3 112 ? 1.92300   64.75300  -5.49100  0.470 27.05401 ? 416  MET A CA    1 
ATOM   1450 C  C     A MET C 3 112 ? 2.41900   65.74500  -6.59100  0.530 25.53542 ? 416  MET A C     1 
ATOM   1451 C  C     B MET C 3 112 ? 2.37100   65.68200  -6.61800  0.470 25.52737 ? 416  MET A C     1 
ATOM   1452 O  O     A MET C 3 112 ? 1.99400   66.89700  -6.71900  0.530 21.58746 ? 416  MET A O     1 
ATOM   1453 O  O     B MET C 3 112 ? 1.82200   66.77100  -6.81500  0.470 21.62750 ? 416  MET A O     1 
ATOM   1454 C  CB    A MET C 3 112 ? 0.66200   64.02400  -6.13800  0.530 24.84252 ? 416  MET A CB    1 
ATOM   1455 C  CB    B MET C 3 112 ? 0.85500   63.77800  -5.99300  0.470 25.09575 ? 416  MET A CB    1 
ATOM   1456 C  CG    A MET C 3 112 ? 1.00400   62.70400  -6.79700  0.530 28.05358 ? 416  MET A CG    1 
ATOM   1457 C  CG    B MET C 3 112 ? 0.54500   62.63700  -5.02100  0.470 24.62433 ? 416  MET A CG    1 
ATOM   1458 S  SD    A MET C 3 112 ? -0.44800  61.62900  -6.91800  0.530 24.29306 ? 416  MET A SD    1 
ATOM   1459 S  SD    B MET C 3 112 ? -0.36700  61.25300  -5.75500  0.470 26.59316 ? 416  MET A SD    1 
ATOM   1460 C  CE    A MET C 3 112 ? -0.35600  60.74500  -5.36000  0.530 27.03057 ? 416  MET A CE    1 
ATOM   1461 C  CE    B MET C 3 112 ? -0.61000  61.83600  -7.43000  0.470 25.02748 ? 416  MET A CE    1 
ATOM   1462 N  N     . TRP C 3 113 ? 3.40300   65.25500  -7.34200  1.000 26.29816 ? 417  TRP A N     1 
ATOM   1463 C  CA    . TRP C 3 113 ? 3.84400   65.97100  -8.52600  1.000 21.06673 ? 417  TRP A CA    1 
ATOM   1464 C  C     . TRP C 3 113 ? 2.89000   65.65800  -9.68100  1.000 22.76726 ? 417  TRP A C     1 
ATOM   1465 O  O     . TRP C 3 113 ? 2.31600   64.56900  -9.76200  1.000 23.40017 ? 417  TRP A O     1 
ATOM   1466 C  CB    . TRP C 3 113 ? 5.28100   65.58800  -8.89700  1.000 20.40122 ? 417  TRP A CB    1 
ATOM   1467 C  CG    . TRP C 3 113 ? 6.33200   66.22700  -8.03800  1.000 28.51147 ? 417  TRP A CG    1 
ATOM   1468 C  CD1   . TRP C 3 113 ? 6.14200   67.20000  -7.10300  1.000 24.51480 ? 417  TRP A CD1   1 
ATOM   1469 C  CD2   . TRP C 3 113 ? 7.74500   65.94500  -8.04300  1.000 23.32253 ? 417  TRP A CD2   1 
ATOM   1470 N  NE1   . TRP C 3 113 ? 7.33900   67.53500  -6.52000  1.000 19.26244 ? 417  TRP A NE1   1 
ATOM   1471 C  CE2   . TRP C 3 113 ? 8.33900   66.78400  -7.07700  1.000 20.85661 ? 417  TRP A CE2   1 
ATOM   1472 C  CE3   . TRP C 3 113 ? 8.56100   65.06000  -8.76500  1.000 23.67175 ? 417  TRP A CE3   1 
ATOM   1473 C  CZ2   . TRP C 3 113 ? 9.72200   66.77600  -6.81100  1.000 22.06436 ? 417  TRP A CZ2   1 
ATOM   1474 C  CZ3   . TRP C 3 113 ? 9.93900   65.04300  -8.49800  1.000 23.23777 ? 417  TRP A CZ3   1 
ATOM   1475 C  CH2   . TRP C 3 113 ? 10.50200  65.90400  -7.52800  1.000 21.35460 ? 417  TRP A CH2   1 
ATOM   1476 N  N     . VAL C 3 114 ? 2.70300   66.64600  -10.55700 1.000 21.42658 ? 418  VAL A N     1 
ATOM   1477 C  CA    . VAL C 3 114 ? 1.81500   66.50100  -11.70300 1.000 22.73861 ? 418  VAL A CA    1 
ATOM   1478 C  C     . VAL C 3 114 ? 2.21300   65.29000  -12.53300 1.000 30.04997 ? 418  VAL A C     1 
ATOM   1479 O  O     . VAL C 3 114 ? 1.35800   64.54000  -13.02900 1.000 28.61366 ? 418  VAL A O     1 
ATOM   1480 C  CB    . VAL C 3 114 ? 1.85000   67.78700  -12.54900 1.000 23.57594 ? 418  VAL A CB    1 
ATOM   1481 C  CG1   . VAL C 3 114 ? 1.04600   67.61400  -13.84800 1.000 25.71501 ? 418  VAL A CG1   1 
ATOM   1482 C  CG2   . VAL C 3 114 ? 1.36900   68.97000  -11.73000 1.000 25.41826 ? 418  VAL A CG2   1 
ATOM   1483 N  N     . SER C 3 115 ? 3.52000   65.09700  -12.70800 1.000 23.35162 ? 419  SER A N     1 
ATOM   1484 C  CA    . SER C 3 115 ? 4.03900   63.94100  -13.42500 1.000 26.09429 ? 419  SER A CA    1 
ATOM   1485 C  C     . SER C 3 115 ? 3.49300   62.63100  -12.86500 1.000 25.43122 ? 419  SER A C     1 
ATOM   1486 O  O     . SER C 3 115 ? 3.03800   61.76600  -13.62100 1.000 31.04462 ? 419  SER A O     1 
ATOM   1487 C  CB    . SER C 3 115 ? 5.57300   63.98200  -13.39000 1.000 26.62619 ? 419  SER A CB    1 
ATOM   1488 O  OG    . SER C 3 115 ? 6.06900   63.73100  -12.08300 1.000 31.88367 ? 419  SER A OG    1 
ATOM   1489 N  N     . GLN C 3 116 ? 3.52200   62.46300  -11.54400 1.000 23.38246 ? 420  GLN A N     1 
ATOM   1490 C  CA    . GLN C 3 116 ? 2.98700   61.22800  -10.97900 1.000 26.80147 ? 420  GLN A CA    1 
ATOM   1491 C  C     . GLN C 3 116 ? 1.46400   61.17000  -11.11300 1.000 30.17853 ? 420  GLN A C     1 
ATOM   1492 O  O     . GLN C 3 116 ? 0.90000   60.09800  -11.36700 1.000 31.70263 ? 420  GLN A O     1 
ATOM   1493 C  CB    . GLN C 3 116 ? 3.40700   61.07100  -9.51100  1.000 31.58728 ? 420  GLN A CB    1 
ATOM   1494 C  CG    . GLN C 3 116 ? 2.48700   60.11500  -8.73800  1.000 34.54103 ? 420  GLN A CG    1 
ATOM   1495 C  CD    . GLN C 3 116 ? 2.82400   59.95100  -7.25200  1.000 43.47260 ? 420  GLN A CD    1 
ATOM   1496 O  OE1   . GLN C 3 116 ? 3.62400   60.70100  -6.68000  1.000 42.29598 ? 420  GLN A OE1   1 
ATOM   1497 N  NE2   . GLN C 3 116 ? 2.19000   58.96600  -6.61800  1.000 45.46732 ? 420  GLN A NE2   1 
ATOM   1498 N  N     . ALA C 3 117 ? 0.77500   62.31000  -10.96500 1.000 28.05070 ? 421  ALA A N     1 
ATOM   1499 C  CA    . ALA C 3 117 ? -0.69000  62.29300  -11.02500 1.000 26.61248 ? 421  ALA A CA    1 
ATOM   1500 C  C     . ALA C 3 117 ? -1.20000  61.85600  -12.39600 1.000 26.93048 ? 421  ALA A C     1 
ATOM   1501 O  O     . ALA C 3 117 ? -2.23200  61.18500  -12.49600 1.000 30.78130 ? 421  ALA A O     1 
ATOM   1502 C  CB    . ALA C 3 117 ? -1.25000  63.66800  -10.67300 1.000 24.39521 ? 421  ALA A CB    1 
ATOM   1503 N  N     . GLU C 3 118 ? -0.49800  62.23300  -13.46200 1.000 30.21818 ? 422  GLU A N     1 
ATOM   1504 C  CA    . GLU C 3 118 ? -0.95400  61.92100  -14.81400 1.000 29.41614 ? 422  GLU A CA    1 
ATOM   1505 C  C     . GLU C 3 118 ? -0.94400  60.42600  -15.09600 1.000 30.85136 ? 422  GLU A C     1 
ATOM   1506 O  O     . GLU C 3 118 ? -1.73200  59.94900  -15.92100 1.000 43.40273 ? 422  GLU A O     1 
ATOM   1507 C  CB    . GLU C 3 118 ? -0.08000  62.64300  -15.83800 1.000 33.48298 ? 422  GLU A CB    1 
ATOM   1508 C  CG    . GLU C 3 118 ? -0.29400  64.13000  -15.86400 1.000 35.83833 ? 422  GLU A CG    1 
ATOM   1509 C  CD    . GLU C 3 118 ? 0.64500   64.82600  -16.81800 1.000 31.78993 ? 422  GLU A CD    1 
ATOM   1510 O  OE1   . GLU C 3 118 ? 1.81100   64.39000  -16.93800 1.000 29.94780 ? 422  GLU A OE1   1 
ATOM   1511 O  OE2   . GLU C 3 118 ? 0.21300   65.81100  -17.44500 1.000 35.39254 ? 422  GLU A OE2   1 
ATOM   1512 N  N     . LYS C 3 119 ? -0.06100  59.67300  -14.44000 1.000 37.74571 ? 423  LYS A N     1 
ATOM   1513 C  CA    . LYS C 3 119 ? -0.00500  58.23000  -14.64700 1.000 38.41371 ? 423  LYS A CA    1 
ATOM   1514 C  C     . LYS C 3 119 ? -1.18200  57.51200  -14.00400 1.000 37.38706 ? 423  LYS A C     1 
ATOM   1515 O  O     . LYS C 3 119 ? -1.49000  56.37700  -14.38700 1.000 35.39221 ? 423  LYS A O     1 
ATOM   1516 C  CB    . LYS C 3 119 ? 1.30900   57.67500  -14.09500 1.000 34.43584 ? 423  LYS A CB    1 
ATOM   1517 C  CG    . LYS C 3 119 ? 2.54300   58.22400  -14.80400 1.000 28.86239 ? 423  LYS A CG    1 
ATOM   1518 C  CD    . LYS C 3 119 ? 3.81300   58.00300  -13.99300 1.000 28.70871 ? 423  LYS A CD    1 
ATOM   1519 C  CE    . LYS C 3 119 ? 3.90400   56.59700  -13.38100 1.000 37.02493 ? 423  LYS A CE    1 
ATOM   1520 N  NZ    . LYS C 3 119 ? 5.28300   55.98800  -13.47500 1.000 36.45967 ? 423  LYS A NZ    1 
ATOM   1521 N  N     . MET C 3 120 ? -1.84500  58.15100  -13.04100 1.000 29.00072 ? 424  MET A N     1 
ATOM   1522 C  CA    . MET C 3 120 ? -2.94600  57.54500  -12.31300 1.000 33.27793 ? 424  MET A CA    1 
ATOM   1523 C  C     . MET C 3 120 ? -4.25500  57.59900  -13.07800 1.000 39.39744 ? 424  MET A C     1 
ATOM   1524 O  O     . MET C 3 120 ? -5.20300  56.90000  -12.70000 1.000 41.56235 ? 424  MET A O     1 
ATOM   1525 C  CB    . MET C 3 120 ? -3.10500  58.23700  -10.96300 1.000 36.16509 ? 424  MET A CB    1 
ATOM   1526 C  CG    . MET C 3 120 ? -1.77400  58.52600  -10.28000 1.000 26.52335 ? 424  MET A CG    1 
ATOM   1527 S  SD    . MET C 3 120 ? -1.87600  58.46000  -8.47800  1.000 39.52322 ? 424  MET A SD    1 
ATOM   1528 C  CE    . MET C 3 120 ? -2.31300  56.74200  -8.21200  1.000 35.47772 ? 424  MET A CE    1 
ATOM   1529 N  N     . LEU C 3 121 ? -4.32800  58.40100  -14.13300 1.000 32.23118 ? 425  LEU A N     1 
ATOM   1530 C  CA    . LEU C 3 121 ? -5.55700  58.48100  -14.90300 1.000 35.90873 ? 425  LEU A CA    1 
ATOM   1531 C  C     . LEU C 3 121 ? -5.59400  57.36200  -15.93900 1.000 39.39490 ? 425  LEU A C     1 
ATOM   1532 O  O     . LEU C 3 121 ? -4.55300  56.99400  -16.48900 1.000 34.02077 ? 425  LEU A O     1 
ATOM   1533 C  CB    . LEU C 3 121 ? -5.66800  59.84000  -15.60000 1.000 39.82128 ? 425  LEU A CB    1 
ATOM   1534 C  CG    . LEU C 3 121 ? -5.70300  61.07400  -14.68300 1.000 34.39872 ? 425  LEU A CG    1 
ATOM   1535 C  CD1   . LEU C 3 121 ? -5.60400  62.35600  -15.48200 1.000 29.67983 ? 425  LEU A CD1   1 
ATOM   1536 C  CD2   . LEU C 3 121 ? -6.94800  61.08400  -13.83000 1.000 33.12024 ? 425  LEU A CD2   1 
ATOM   1537 N  N     . PRO C 3 122 ? -6.76700  56.79600  -16.21300 1.000 44.22596 ? 426  PRO A N     1 
ATOM   1538 C  CA    . PRO C 3 122 ? -6.87500  55.82700  -17.30500 1.000 34.27117 ? 426  PRO A CA    1 
ATOM   1539 C  C     . PRO C 3 122 ? -6.83200  56.54100  -18.64400 1.000 44.67957 ? 426  PRO A C     1 
ATOM   1540 O  O     . PRO C 3 122 ? -7.02900  57.75700  -18.73800 1.000 43.19568 ? 426  PRO A O     1 
ATOM   1541 C  CB    . PRO C 3 122 ? -8.24000  55.17700  -17.06500 1.000 44.37670 ? 426  PRO A CB    1 
ATOM   1542 C  CG    . PRO C 3 122 ? -9.05100  56.28000  -16.47300 1.000 35.39453 ? 426  PRO A CG    1 
ATOM   1543 C  CD    . PRO C 3 122 ? -8.07600  57.05300  -15.58300 1.000 40.38138 ? 426  PRO A CD    1 
ATOM   1544 N  N     . ASN C 3 123 ? -6.57900  55.75800  -19.69000 1.000 44.32757 ? 427  ASN A N     1 
ATOM   1545 C  CA    . ASN C 3 123 ? -6.50100  56.30900  -21.03500 1.000 43.06663 ? 427  ASN A CA    1 
ATOM   1546 C  C     . ASN C 3 123 ? -7.78400  57.05200  -21.38600 1.000 39.73217 ? 427  ASN A C     1 
ATOM   1547 O  O     . ASN C 3 123 ? -8.89100  56.61500  -21.05100 1.000 34.96912 ? 427  ASN A O     1 
ATOM   1548 C  CB    . ASN C 3 123 ? -6.23600  55.19600  -22.05200 1.000 47.62054 ? 427  ASN A CB    1 
ATOM   1549 C  CG    . ASN C 3 123 ? -4.75300  54.88900  -22.21200 1.000 61.00015 ? 427  ASN A CG    1 
ATOM   1550 O  OD1   . ASN C 3 123 ? -3.96900  55.73900  -22.64500 1.000 53.84208 ? 427  ASN A OD1   1 
ATOM   1551 N  ND2   . ASN C 3 123 ? -4.36300  53.66500  -21.86400 1.000 75.16901 ? 427  ASN A ND2   1 
ATOM   1552 N  N     . GLY C 3 124 ? -7.62300  58.20000  -22.04500 1.000 36.57512 ? 428  GLY A N     1 
ATOM   1553 C  CA    . GLY C 3 124 ? -8.73700  59.01600  -22.47000 1.000 37.89192 ? 428  GLY A CA    1 
ATOM   1554 C  C     . GLY C 3 124 ? -9.16900  60.08000  -21.48700 1.000 45.42332 ? 428  GLY A C     1 
ATOM   1555 O  O     . GLY C 3 124 ? -9.92800  60.98000  -21.87000 1.000 45.68073 ? 428  GLY A O     1 
ATOM   1556 N  N     . ILE C 3 125 ? -8.72200  60.01100  -20.23600 1.000 43.02612 ? 429  ILE A N     1 
ATOM   1557 C  CA    . ILE C 3 125 ? -9.12200  60.96300  -19.20900 1.000 40.88327 ? 429  ILE A CA    1 
ATOM   1558 C  C     . ILE C 3 125 ? -8.01400  61.99400  -19.05400 1.000 41.00835 ? 429  ILE A C     1 
ATOM   1559 O  O     . ILE C 3 125 ? -6.83700  61.64500  -18.88400 1.000 33.34520 ? 429  ILE A O     1 
ATOM   1560 C  CB    . ILE C 3 125 ? -9.42800  60.25700  -17.87900 1.000 39.67795 ? 429  ILE A CB    1 
ATOM   1561 C  CG1   . ILE C 3 125 ? -10.43700 59.12800  -18.10600 1.000 41.54496 ? 429  ILE A CG1   1 
ATOM   1562 C  CG2   . ILE C 3 125 ? -9.95900  61.25700  -16.85500 1.000 41.29334 ? 429  ILE A CG2   1 
ATOM   1563 C  CD1   . ILE C 3 125 ? -11.61900 59.51600  -18.96700 1.000 40.41318 ? 429  ILE A CD1   1 
ATOM   1564 N  N     . LYS C 3 126 ? -8.38400  63.26400  -19.13000 1.000 44.82821 ? 430  LYS A N     1 
ATOM   1565 C  CA    . LYS C 3 126 ? -7.41700  64.34500  -19.15400 1.000 35.01259 ? 430  LYS A CA    1 
ATOM   1566 C  C     . LYS C 3 126 ? -7.42700  65.09200  -17.83200 1.000 35.15306 ? 430  LYS A C     1 
ATOM   1567 O  O     . LYS C 3 126 ? -8.49000  65.33300  -17.24900 1.000 31.52724 ? 430  LYS A O     1 
ATOM   1568 C  CB    . LYS C 3 126 ? -7.70600  65.30700  -20.30600 1.000 39.94878 ? 430  LYS A CB    1 
ATOM   1569 C  CG    . LYS C 3 126 ? -7.62700  64.69300  -21.71000 1.000 51.09906 ? 430  LYS A CG    1 
ATOM   1570 C  CD    . LYS C 3 126 ? -6.55400  63.59700  -21.90300 1.000 45.53178 ? 430  LYS A CD    1 
ATOM   1571 C  CE    . LYS C 3 126 ? -5.13500  64.02700  -21.47700 1.000 43.27227 ? 430  LYS A CE    1 
ATOM   1572 N  NZ    . LYS C 3 126 ? -4.61500  65.23600  -22.16600 1.000 51.62376 ? 430  LYS A NZ    1 
ATOM   1573 N  N     . LEU C 3 127 ? -6.23600  65.45700  -17.37000 1.000 28.75525 ? 431  LEU A N     1 
ATOM   1574 C  CA    . LEU C 3 127 ? -6.07900  66.19600  -16.12900 1.000 26.60496 ? 431  LEU A CA    1 
ATOM   1575 C  C     . LEU C 3 127 ? -6.17100  67.68900  -16.41200 1.000 22.59410 ? 431  LEU A C     1 
ATOM   1576 O  O     . LEU C 3 127 ? -5.43400  68.20500  -17.25400 1.000 26.39252 ? 431  LEU A O     1 
ATOM   1577 C  CB    . LEU C 3 127 ? -4.73300  65.86100  -15.48700 1.000 27.20117 ? 431  LEU A CB    1 
ATOM   1578 C  CG    . LEU C 3 127 ? -4.51300  66.42200  -14.08700 1.000 25.51877 ? 431  LEU A CG    1 
ATOM   1579 C  CD1   . LEU C 3 127 ? -5.42600  65.71700  -13.08400 1.000 13.51714 ? 431  LEU A CD1   1 
ATOM   1580 C  CD2   . LEU C 3 127 ? -3.03300  66.27300  -13.70300 1.000 30.94406 ? 431  LEU A CD2   1 
ATOM   1581 N  N     . ILE C 3 128 ? -7.07300  68.37600  -15.71900 1.000 17.82328 ? 432  ILE A N     1 
ATOM   1582 C  CA    . ILE C 3 128 ? -7.18100  69.83000  -15.82600 1.000 21.81625 ? 432  ILE A CA    1 
ATOM   1583 C  C     . ILE C 3 128 ? -6.29800  70.48500  -14.76800 1.000 26.17401 ? 432  ILE A C     1 
ATOM   1584 O  O     . ILE C 3 128 ? -6.44200  70.21200  -13.56700 1.000 25.57383 ? 432  ILE A O     1 
ATOM   1585 C  CB    . ILE C 3 128 ? -8.63300  70.28700  -15.66400 1.000 22.11897 ? 432  ILE A CB    1 
ATOM   1586 C  CG1   . ILE C 3 128 ? -9.48800  69.69800  -16.78100 1.000 28.01252 ? 432  ILE A CG1   1 
ATOM   1587 C  CG2   . ILE C 3 128 ? -8.68200  71.80600  -15.64900 1.000 24.55610 ? 432  ILE A CG2   1 
ATOM   1588 C  CD1   . ILE C 3 128 ? -8.97200  70.04300  -18.16500 1.000 31.71424 ? 432  ILE A CD1   1 
ATOM   1589 N  N     . SER C 3 129 ? -5.40700  71.37400  -15.20300 1.000 20.01121 ? 433  SER A N     1 
ATOM   1590 C  CA    . SER C 3 129 ? -4.47900  72.07600  -14.31800 1.000 22.54125 ? 433  SER A CA    1 
ATOM   1591 C  C     . SER C 3 129 ? -4.87100  73.55100  -14.27300 1.000 20.42132 ? 433  SER A C     1 
ATOM   1592 O  O     . SER C 3 129 ? -4.76300  74.25600  -15.28100 1.000 18.29139 ? 433  SER A O     1 
ATOM   1593 C  CB    . SER C 3 129 ? -3.03300  71.90500  -14.79500 1.000 23.14702 ? 433  SER A CB    1 
ATOM   1594 O  OG    . SER C 3 129 ? -2.49500  70.66000  -14.37900 1.000 22.80509 ? 433  SER A OG    1 
ATOM   1595 N  N     . LEU C 3 130 ? -5.34900  74.02900  -13.06300 1.000 17.28400 ? 434  LEU A N     1 
ATOM   1596 C  CA    . LEU C 3 130 ? -5.74500  75.42900  -12.92900 1.000 21.09116 ? 434  LEU A CA    1 
ATOM   1597 C  C     . LEU C 3 130 ? -4.63300  76.24300  -12.26400 1.000 23.68110 ? 434  LEU A C     1 
ATOM   1598 O  O     . LEU C 3 130 ? -3.86400  75.71400  -11.45700 1.000 16.76993 ? 434  LEU A O     1 
ATOM   1599 C  CB    . LEU C 3 130 ? -7.03700  75.55900  -12.11100 1.000 17.57338 ? 434  LEU A CB    1 
ATOM   1600 C  CG    . LEU C 3 130 ? -8.25800  74.83200  -12.71000 1.000 15.76280 ? 434  LEU A CG    1 
ATOM   1601 C  CD1   . LEU C 3 130 ? -9.45000  74.91600  -11.76300 1.000 16.46300 ? 434  LEU A CD1   1 
ATOM   1602 C  CD2   . LEU C 3 130 ? -8.62900  75.38700  -14.08600 1.000 16.59306 ? 434  LEU A CD2   1 
ATOM   1603 N  N     . PRO C 3 131 ? -4.49500  77.51700  -12.61200 1.000 21.35391 ? 435  PRO A N     1 
ATOM   1604 C  CA    . PRO C 3 131 ? -3.51700  78.36400  -11.93800 1.000 17.68871 ? 435  PRO A CA    1 
ATOM   1605 C  C     . PRO C 3 131 ? -4.01900  78.80300  -10.56800 1.000 20.69083 ? 435  PRO A C     1 
ATOM   1606 O  O     . PRO C 3 131 ? -5.21400  78.75200  -10.26200 1.000 17.57161 ? 435  PRO A O     1 
ATOM   1607 C  CB    . PRO C 3 131 ? -3.37500  79.54900  -12.89500 1.000 22.70325 ? 435  PRO A CB    1 
ATOM   1608 C  CG    . PRO C 3 131 ? -4.70400  79.64500  -13.52200 1.000 23.96318 ? 435  PRO A CG    1 
ATOM   1609 C  CD    . PRO C 3 131 ? -5.11400  78.21100  -13.75100 1.000 22.86229 ? 435  PRO A CD    1 
ATOM   1610 N  N     . TYR C 3 132 ? -3.06600  79.19400  -9.72400  1.000 18.36068 ? 436  TYR A N     1 
ATOM   1611 C  CA    . TYR C 3 132 ? -3.41000  79.73400  -8.42000  1.000 14.76172 ? 436  TYR A CA    1 
ATOM   1612 C  C     . TYR C 3 132 ? -4.17200  81.03900  -8.57600  1.000 21.65959 ? 436  TYR A C     1 
ATOM   1613 O  O     . TYR C 3 132 ? -3.96800  81.79600  -9.52800  1.000 26.31675 ? 436  TYR A O     1 
ATOM   1614 C  CB    . TYR C 3 132 ? -2.16800  79.99000  -7.59200  1.000 12.72400 ? 436  TYR A CB    1 
ATOM   1615 C  CG    . TYR C 3 132 ? -1.41200  78.75300  -7.17400  1.000 14.71210 ? 436  TYR A CG    1 
ATOM   1616 C  CD1   . TYR C 3 132 ? -0.36600  78.26400  -7.95900  1.000 16.96033 ? 436  TYR A CD1   1 
ATOM   1617 C  CD2   . TYR C 3 132 ? -1.70400  78.10000  -5.98000  1.000 14.10477 ? 436  TYR A CD2   1 
ATOM   1618 C  CE1   . TYR C 3 132 ? 0.36100   77.14700  -7.58300  1.000 14.12874 ? 436  TYR A CE1   1 
ATOM   1619 C  CE2   . TYR C 3 132 ? -0.97400  76.95900  -5.58700  1.000 13.75180 ? 436  TYR A CE2   1 
ATOM   1620 C  CZ    . TYR C 3 132 ? 0.06600   76.50600  -6.39900  1.000 11.81460 ? 436  TYR A CZ    1 
ATOM   1621 O  OH    . TYR C 3 132 ? 0.81000   75.39700  -6.05200  1.000 13.68779 ? 436  TYR A OH    1 
ATOM   1622 N  N     . THR C 3 133 ? -5.06700  81.29800  -7.63100  1.000 12.49881 ? 437  THR A N     1 
ATOM   1623 C  CA    . THR C 3 133 ? -5.82100  82.54400  -7.58700  1.000 15.98038 ? 437  THR A CA    1 
ATOM   1624 C  C     . THR C 3 133 ? -5.71300  83.06500  -6.15500  1.000 15.89126 ? 437  THR A C     1 
ATOM   1625 O  O     . THR C 3 133 ? -6.67700  83.01300  -5.38800  1.000 14.01860 ? 437  THR A O     1 
ATOM   1626 C  CB    . THR C 3 133 ? -7.27900  82.32600  -8.00500  1.000 16.53082 ? 437  THR A CB    1 
ATOM   1627 O  OG1   . THR C 3 133 ? -7.95600  81.62300  -6.97400  1.000 18.80186 ? 437  THR A OG1   1 
ATOM   1628 C  CG2   . THR C 3 133 ? -7.34900  81.43600  -9.23800  1.000 25.31950 ? 437  THR A CG2   1 
ATOM   1629 N  N     . PHE C 3 134 ? -4.51800  83.55100  -5.80600  1.000 18.78314 ? 438  PHE A N     1 
ATOM   1630 C  CA    . PHE C 3 134 ? -4.16900  83.79700  -4.40800  1.000 16.01814 ? 438  PHE A CA    1 
ATOM   1631 C  C     . PHE C 3 134 ? -5.03300  84.87600  -3.76300  1.000 12.06636 ? 438  PHE A C     1 
ATOM   1632 O  O     . PHE C 3 134 ? -5.47000  84.72900  -2.61300  1.000 12.75522 ? 438  PHE A O     1 
ATOM   1633 C  CB    . PHE C 3 134 ? -2.70300  84.19200  -4.31400  1.000 15.53394 ? 438  PHE A CB    1 
ATOM   1634 C  CG    . PHE C 3 134 ? -1.75400  83.02600  -4.45000  1.000 15.96360 ? 438  PHE A CG    1 
ATOM   1635 C  CD1   . PHE C 3 134 ? -1.85300  81.94000  -3.60000  1.000 15.15978 ? 438  PHE A CD1   1 
ATOM   1636 C  CD2   . PHE C 3 134 ? -0.76800  83.02200  -5.42900  1.000 16.99637 ? 438  PHE A CD2   1 
ATOM   1637 C  CE1   . PHE C 3 134 ? -0.98900  80.85400  -3.71100  1.000 17.75986 ? 438  PHE A CE1   1 
ATOM   1638 C  CE2   . PHE C 3 134 ? 0.12200   81.95000  -5.54000  1.000 18.57821 ? 438  PHE A CE2   1 
ATOM   1639 C  CZ    . PHE C 3 134 ? 0.01000   80.86200  -4.68000  1.000 16.83118 ? 438  PHE A CZ    1 
ATOM   1640 N  N     . GLU C 3 135 ? -5.26200  85.98200  -4.46200  1.000 13.52751 ? 439  GLU A N     1 
ATOM   1641 C  CA    . GLU C 3 135 ? -6.07400  87.05000  -3.88000  1.000 17.19993 ? 439  GLU A CA    1 
ATOM   1642 C  C     . GLU C 3 135 ? -7.50300  86.58200  -3.63900  1.000 13.31427 ? 439  GLU A C     1 
ATOM   1643 O  O     . GLU C 3 135 ? -8.11800  86.93000  -2.62000  1.000 14.23083 ? 439  GLU A O     1 
ATOM   1644 C  CB    . GLU C 3 135 ? -6.06200  88.29000  -4.77900  1.000 14.34459 ? 439  GLU A CB    1 
ATOM   1645 C  CG    . GLU C 3 135 ? -4.72900  89.00100  -4.83900  1.000 20.22677 ? 439  GLU A CG    1 
ATOM   1646 C  CD    . GLU C 3 135 ? -3.66500  88.18700  -5.55900  1.000 27.73578 ? 439  GLU A CD    1 
ATOM   1647 O  OE1   . GLU C 3 135 ? -3.96500  87.61200  -6.63700  1.000 28.84762 ? 439  GLU A OE1   1 
ATOM   1648 O  OE2   . GLU C 3 135 ? -2.53600  88.09900  -5.03200  1.000 34.83601 ? 439  GLU A OE2   1 
ATOM   1649 N  N     . GLN C 3 136 ? -8.05600  85.80600  -4.56900  1.000 12.83273 ? 440  GLN A N     1 
ATOM   1650 C  CA    . GLN C 3 136 ? -9.41200  85.31700  -4.36800  1.000 14.92900 ? 440  GLN A CA    1 
ATOM   1651 C  C     . GLN C 3 136 ? -9.45700  84.22800  -3.31000  1.000 14.95293 ? 440  GLN A C     1 
ATOM   1652 O  O     . GLN C 3 136 ? -10.45100 84.13200  -2.58100  1.000 12.12478 ? 440  GLN A O     1 
ATOM   1653 C  CB    . GLN C 3 136 ? -10.00000 84.84000  -5.68600  1.000 16.40733 ? 440  GLN A CB    1 
ATOM   1654 C  CG    . GLN C 3 136 ? -10.61100 85.98900  -6.46100  1.000 20.46388 ? 440  GLN A CG    1 
ATOM   1655 C  CD    . GLN C 3 136 ? -10.63400 85.73100  -7.93100  1.000 28.81006 ? 440  GLN A CD    1 
ATOM   1656 O  OE1   . GLN C 3 136 ? -11.68200 85.85500  -8.56600  1.000 29.79577 ? 440  GLN A OE1   1 
ATOM   1657 N  NE2   . GLN C 3 136 ? -9.48500  85.34600  -8.49200  1.000 25.47105 ? 440  GLN A NE2   1 
ATOM   1658 N  N     . PHE C 3 137 ? -8.38300  83.43700  -3.17700  1.000 16.52223 ? 441  PHE A N     1 
ATOM   1659 C  CA    . PHE C 3 137 ? -8.27600  82.53300  -2.03400  1.000 11.47752 ? 441  PHE A CA    1 
ATOM   1660 C  C     . PHE C 3 137 ? -8.54000  83.29100  -0.74500  1.000 13.93326 ? 441  PHE A C     1 
ATOM   1661 O  O     . PHE C 3 137 ? -9.32800  82.85300  0.10700   1.000 15.06633 ? 441  PHE A O     1 
ATOM   1662 C  CB    . PHE C 3 137 ? -6.89400  81.88600  -1.97900  1.000 15.20292 ? 441  PHE A CB    1 
ATOM   1663 C  CG    . PHE C 3 137 ? -6.62500  80.90900  -3.08700  1.000 14.79466 ? 441  PHE A CG    1 
ATOM   1664 C  CD1   . PHE C 3 137 ? -7.67100  80.25200  -3.72900  1.000 13.73371 ? 441  PHE A CD1   1 
ATOM   1665 C  CD2   . PHE C 3 137 ? -5.32600  80.62500  -3.47100  1.000 10.60405 ? 441  PHE A CD2   1 
ATOM   1666 C  CE1   . PHE C 3 137 ? -7.41800  79.34300  -4.76100  1.000 16.04487 ? 441  PHE A CE1   1 
ATOM   1667 C  CE2   . PHE C 3 137 ? -5.07000  79.70300  -4.49700  1.000 11.61148 ? 441  PHE A CE2   1 
ATOM   1668 C  CZ    . PHE C 3 137 ? -6.12400  79.06900  -5.14100  1.000 13.82532 ? 441  PHE A CZ    1 
ATOM   1669 N  N     . GLN C 3 138 ? -7.91700  84.46400  -0.61700  1.000 12.77367 ? 442  GLN A N     1 
ATOM   1670 C  CA    . GLN C 3 138 ? -8.04000  85.28700  0.58700   1.000 16.32044 ? 442  GLN A CA    1 
ATOM   1671 C  C     . GLN C 3 138 ? -9.43800  85.89700  0.73600   1.000 12.29330 ? 442  GLN A C     1 
ATOM   1672 O  O     . GLN C 3 138 ? -9.98000  85.95900  1.84800   1.000 12.79219 ? 442  GLN A O     1 
ATOM   1673 C  CB    . GLN C 3 138 ? -6.97300  86.38600  0.54800   1.000 17.33125 ? 442  GLN A CB    1 
ATOM   1674 C  CG    . GLN C 3 138 ? -6.49300  86.86100  1.89800   1.000 22.27112 ? 442  GLN A CG    1 
ATOM   1675 C  CD    . GLN C 3 138 ? -7.50900  87.75700  2.59000   1.000 19.22319 ? 442  GLN A CD    1 
ATOM   1676 O  OE1   . GLN C 3 138 ? -7.92200  87.50100  3.73800   1.000 20.29857 ? 442  GLN A OE1   1 
ATOM   1677 N  NE2   . GLN C 3 138 ? -7.92300  88.81200  1.89700   1.000 19.04993 ? 442  GLN A NE2   1 
ATOM   1678 N  N     . LEU C 3 139 ? -10.03600 86.36100  -0.36200  1.000 12.65573 ? 443  LEU A N     1 
ATOM   1679 C  CA    . LEU C 3 139 ? -11.37500 86.94200  -0.27400  1.000 13.63426 ? 443  LEU A CA    1 
ATOM   1680 C  C     . LEU C 3 139 ? -12.39600 85.90400  0.17700   1.000 12.89643 ? 443  LEU A C     1 
ATOM   1681 O  O     . LEU C 3 139 ? -13.23900 86.19800  1.03000   1.000 16.58448 ? 443  LEU A O     1 
ATOM   1682 C  CB    . LEU C 3 139 ? -11.79300 87.56200  -1.61400  1.000 9.42368  ? 443  LEU A CB    1 
ATOM   1683 C  CG    . LEU C 3 139 ? -11.01100 88.82100  -1.99300  1.000 12.05741 ? 443  LEU A CG    1 
ATOM   1684 C  CD1   . LEU C 3 139 ? -11.30600 89.30500  -3.43000  1.000 12.50048 ? 443  LEU A CD1   1 
ATOM   1685 C  CD2   . LEU C 3 139 ? -11.27100 89.93300  -0.98800  1.000 13.62073 ? 443  LEU A CD2   1 
ATOM   1686 N  N     . LYS C 3 140 ? -12.32700 84.68200  -0.37400  1.000 12.52164 ? 444  LYS A N     1 
ATOM   1687 C  CA    . LYS C 3 140 ? -13.19800 83.60500  0.08400   1.000 14.09578 ? 444  LYS A CA    1 
ATOM   1688 C  C     . LYS C 3 140 ? -12.99900 83.33200  1.56700   1.000 13.00069 ? 444  LYS A C     1 
ATOM   1689 O  O     . LYS C 3 140 ? -13.95200 82.96200  2.25700   1.000 12.22025 ? 444  LYS A O     1 
ATOM   1690 C  CB    . LYS C 3 140 ? -12.95100 82.32500  -0.72500  1.000 13.66373 ? 444  LYS A CB    1 
ATOM   1691 C  CG    . LYS C 3 140 ? -13.27100 82.44000  -2.21900  1.000 13.52486 ? 444  LYS A CG    1 
ATOM   1692 C  CD    . LYS C 3 140 ? -14.71900 82.78500  -2.44700  1.000 19.37914 ? 444  LYS A CD    1 
ATOM   1693 C  CE    . LYS C 3 140 ? -15.00300 83.04400  -3.92800  1.000 20.67854 ? 444  LYS A CE    1 
ATOM   1694 N  NZ    . LYS C 3 140 ? -16.30300 83.73500  -4.10700  1.000 22.75793 ? 444  LYS A NZ    1 
ATOM   1695 N  N     . SER C 3 141 ? -11.77300 83.51300  2.06600   1.000 12.05985 ? 445  SER A N     1 
ATOM   1696 C  CA    . SER C 3 141 ? -11.48600 83.31400  3.48600   1.000 15.88780 ? 445  SER A CA    1 
ATOM   1697 C  C     . SER C 3 141 ? -12.12200 84.40100  4.33700   1.000 11.70917 ? 445  SER A C     1 
ATOM   1698 O  O     . SER C 3 141 ? -12.60400 84.13400  5.44600   1.000 10.36939 ? 445  SER A O     1 
ATOM   1699 C  CB    . SER C 3 141 ? -9.96900  83.29800  3.71000   1.000 17.44746 ? 445  SER A CB    1 
ATOM   1700 O  OG    . SER C 3 141 ? -9.62800  83.23200  5.09200   1.000 14.81692 ? 445  SER A OG    1 
ATOM   1701 N  N     . GLU C 3 142 ? -12.10300 85.64000  3.84000   1.000 11.15028 ? 446  GLU A N     1 
ATOM   1702 C  CA    . GLU C 3 142 ? -12.81600 86.72200  4.50200   1.000 14.80760 ? 446  GLU A CA    1 
ATOM   1703 C  C     . GLU C 3 142 ? -14.30200 86.40600  4.60100   1.000 11.77028 ? 446  GLU A C     1 
ATOM   1704 O  O     . GLU C 3 142 ? -14.91400 86.60400  5.64800   1.000 12.89504 ? 446  GLU A O     1 
ATOM   1705 C  CB    . GLU C 3 142 ? -12.58900 88.04000  3.75800   1.000 10.58817 ? 446  GLU A CB    1 
ATOM   1706 C  CG    . GLU C 3 142 ? -11.24800 88.66000  4.05400   1.000 15.77814 ? 446  GLU A CG    1 
ATOM   1707 C  CD    . GLU C 3 142 ? -10.99200 90.00500  3.35900   1.000 21.41999 ? 446  GLU A CD    1 
ATOM   1708 O  OE1   . GLU C 3 142 ? -11.91200 90.57300  2.72200   1.000 14.03980 ? 446  GLU A OE1   1 
ATOM   1709 O  OE2   . GLU C 3 142 ? -9.84200  90.49500  3.46700   1.000 18.83916 ? 446  GLU A OE2   1 
ATOM   1710 N  N     . ALA C 3 143 ? -14.90300 85.91900  3.51600   1.000 10.94888 ? 447  ALA A N     1 
ATOM   1711 C  CA    . ALA C 3 143 ? -16.32900 85.62900  3.56500   1.000 12.78952 ? 447  ALA A CA    1 
ATOM   1712 C  C     . ALA C 3 143 ? -16.59900 84.51600  4.56500   1.000 15.45851 ? 447  ALA A C     1 
ATOM   1713 O  O     . ALA C 3 143 ? -17.55200 84.58400  5.34600   1.000 16.47332 ? 447  ALA A O     1 
ATOM   1714 C  CB    . ALA C 3 143 ? -16.83900 85.25400  2.17100   1.000 13.48870 ? 447  ALA A CB    1 
ATOM   1715 N  N     . PHE C 3 144 ? -15.73200 83.50300  4.57700   1.000 14.51823 ? 448  PHE A N     1 
ATOM   1716 C  CA    . PHE C 3 144 ? -15.79200 82.43800  5.56700   1.000 16.59770 ? 448  PHE A CA    1 
ATOM   1717 C  C     . PHE C 3 144 ? -15.88200 82.99900  6.98300   1.000 14.29748 ? 448  PHE A C     1 
ATOM   1718 O  O     . PHE C 3 144 ? -16.86600 82.77800  7.69200   1.000 16.92984 ? 448  PHE A O     1 
ATOM   1719 C  CB    . PHE C 3 144 ? -14.55200 81.54800  5.39800   1.000 17.11068 ? 448  PHE A CB    1 
ATOM   1720 C  CG    . PHE C 3 144 ? -14.44200 80.42700  6.40700   1.000 12.72233 ? 448  PHE A CG    1 
ATOM   1721 C  CD1   . PHE C 3 144 ? -15.49600 79.55300  6.61800   1.000 14.61907 ? 448  PHE A CD1   1 
ATOM   1722 C  CD2   . PHE C 3 144 ? -13.26700 80.23600  7.11100   1.000 16.07022 ? 448  PHE A CD2   1 
ATOM   1723 C  CE1   . PHE C 3 144 ? -15.38400 78.51800  7.52200   1.000 18.28567 ? 448  PHE A CE1   1 
ATOM   1724 C  CE2   . PHE C 3 144 ? -13.14400 79.20500  8.00900   1.000 12.94797 ? 448  PHE A CE2   1 
ATOM   1725 C  CZ    . PHE C 3 144 ? -14.19900 78.34300  8.21400   1.000 19.94271 ? 448  PHE A CZ    1 
ATOM   1726 N  N     . TYR C 3 145 ? -14.86400 83.75400  7.40500   1.000 13.43695 ? 449  TYR A N     1 
ATOM   1727 C  CA    . TYR C 3 145 ? -14.81100 84.20300  8.79500   1.000 14.70583 ? 449  TYR A CA    1 
ATOM   1728 C  C     . TYR C 3 145 ? -15.89500 85.21900  9.09700   1.000 16.28795 ? 449  TYR A C     1 
ATOM   1729 O  O     . TYR C 3 145 ? -16.43200 85.22400  10.21100  1.000 12.93926 ? 449  TYR A O     1 
ATOM   1730 C  CB    . TYR C 3 145 ? -13.43100 84.78300  9.12400   1.000 14.23279 ? 449  TYR A CB    1 
ATOM   1731 C  CG    . TYR C 3 145 ? -12.42400 83.69600  9.39100   1.000 13.30877 ? 449  TYR A CG    1 
ATOM   1732 C  CD1   . TYR C 3 145 ? -12.35100 83.08800  10.65000  1.000 11.93833 ? 449  TYR A CD1   1 
ATOM   1733 C  CD2   . TYR C 3 145 ? -11.55600 83.25500  8.37900   1.000 13.87466 ? 449  TYR A CD2   1 
ATOM   1734 C  CE1   . TYR C 3 145 ? -11.43000 82.07000  10.90100  1.000 15.02692 ? 449  TYR A CE1   1 
ATOM   1735 C  CE2   . TYR C 3 145 ? -10.63000 82.23300  8.62000   1.000 12.38654 ? 449  TYR A CE2   1 
ATOM   1736 C  CZ    . TYR C 3 145 ? -10.57300 81.64900  9.88400   1.000 14.30249 ? 449  TYR A CZ    1 
ATOM   1737 O  OH    . TYR C 3 145 ? -9.66700  80.64600  10.13200  1.000 13.71016 ? 449  TYR A OH    1 
ATOM   1738 N  N     . SER C 3 146 ? -16.23800 86.06600  8.11800   1.000 16.34905 ? 450  SER A N     1 
ATOM   1739 C  CA    . SER C 3 146 ? -17.36600 86.98300  8.28600   1.000 19.29689 ? 450  SER A CA    1 
ATOM   1740 C  C     . SER C 3 146 ? -18.65300 86.22700  8.54500   1.000 17.66578 ? 450  SER A C     1 
ATOM   1741 O  O     . SER C 3 146 ? -19.46000 86.61900  9.39900   1.000 17.44253 ? 450  SER A O     1 
ATOM   1742 C  CB    . SER C 3 146 ? -17.52200 87.87500  7.04900   1.000 17.82345 ? 450  SER A CB    1 
ATOM   1743 O  OG    . SER C 3 146 ? -18.70000 88.66300  7.16900   1.000 20.57592 ? 450  SER A OG    1 
ATOM   1744 N  N     . THR C 3 147 ? -18.86200 85.14700  7.80000   1.000 20.65377 ? 451  THR A N     1 
ATOM   1745 C  CA    . THR C 3 147 ? -20.07500 84.36400  7.96400   1.000 19.04440 ? 451  THR A CA    1 
ATOM   1746 C  C     . THR C 3 147 ? -20.13200 83.71000  9.34100   1.000 20.86549 ? 451  THR A C     1 
ATOM   1747 O  O     . THR C 3 147 ? -21.19100 83.70100  9.97800   1.000 21.66944 ? 451  THR A O     1 
ATOM   1748 C  CB    . THR C 3 147 ? -20.18000 83.32800  6.84000   1.000 18.22210 ? 451  THR A CB    1 
ATOM   1749 O  OG1   . THR C 3 147 ? -20.37800 84.01400  5.59200   1.000 16.44890 ? 451  THR A OG1   1 
ATOM   1750 C  CG2   . THR C 3 147 ? -21.33800 82.37700  7.07900   1.000 17.85613 ? 451  THR A CG2   1 
ATOM   1751 N  N     . LEU C 3 148 ? -19.00000 83.18600  9.83100   1.000 18.26272 ? 452  LEU A N     1 
ATOM   1752 C  CA    . LEU C 3 148 ? -19.00800 82.50400  11.12400  1.000 19.08580 ? 452  LEU A CA    1 
ATOM   1753 C  C     . LEU C 3 148 ? -19.36900 83.46000  12.25200  1.000 21.10401 ? 452  LEU A C     1 
ATOM   1754 O  O     . LEU C 3 148 ? -20.08700 83.08100  13.18500  1.000 23.72290 ? 452  LEU A O     1 
ATOM   1755 C  CB    . LEU C 3 148 ? -17.64900 81.85200  11.40000  1.000 18.43691 ? 452  LEU A CB    1 
ATOM   1756 C  CG    . LEU C 3 148 ? -17.15700 80.77800  10.43200  1.000 18.30102 ? 452  LEU A CG    1 
ATOM   1757 C  CD1   . LEU C 3 148 ? -15.67700 80.56200  10.63100  1.000 19.77783 ? 452  LEU A CD1   1 
ATOM   1758 C  CD2   . LEU C 3 148 ? -17.90700 79.46800  10.65200  1.000 21.12888 ? 452  LEU A CD2   1 
ATOM   1759 N  N     . LYS C 3 149 ? -18.87700 84.70500  12.18100  1.000 14.31668 ? 453  LYS A N     1 
ATOM   1760 C  CA    . LYS C 3 149 ? -19.18400 85.70400  13.20000  1.000 19.12483 ? 453  LYS A CA    1 
ATOM   1761 C  C     . LYS C 3 149 ? -20.64000 86.15300  13.12600  1.000 20.66737 ? 453  LYS A C     1 
ATOM   1762 O  O     . LYS C 3 149 ? -21.28100 86.36700  14.15800  1.000 17.76005 ? 453  LYS A O     1 
ATOM   1763 C  CB    . LYS C 3 149 ? -18.26000 86.91800  13.05000  1.000 25.16149 ? 453  LYS A CB    1 
ATOM   1764 C  CG    . LYS C 3 149 ? -18.49400 88.02700  14.08900  1.000 25.49655 ? 453  LYS A CG    1 
ATOM   1765 C  CD    . LYS C 3 149 ? -18.07300 89.42000  13.57100  1.000 27.49265 ? 453  LYS A CD    1 
ATOM   1766 C  CE    . LYS C 3 149 ? -16.74300 89.38600  12.81800  1.000 28.92327 ? 453  LYS A CE    1 
ATOM   1767 N  NZ    . LYS C 3 149 ? -15.92200 90.64500  12.96400  1.000 22.63253 ? 453  LYS A NZ    1 
ATOM   1768 N  N     . ARG C 3 150 ? -21.16700 86.33000  11.91400  1.000 21.41421 ? 454  ARG A N     1 
ATOM   1769 C  CA    . ARG C 3 150 ? -22.53200 86.82800  11.76900  1.000 24.07955 ? 454  ARG A CA    1 
ATOM   1770 C  C     . ARG C 3 150 ? -23.56900 85.83100  12.27800  1.000 25.38511 ? 454  ARG A C     1 
ATOM   1771 O  O     . ARG C 3 150 ? -24.64300 86.24100  12.71900  1.000 25.50458 ? 454  ARG A O     1 
ATOM   1772 C  CB    . ARG C 3 150 ? -22.80000 87.16600  10.31100  1.000 22.41329 ? 454  ARG A CB    1 
ATOM   1773 C  CG    . ARG C 3 150 ? -23.89000 88.19300  10.12200  1.000 38.73146 ? 454  ARG A CG    1 
ATOM   1774 C  CD    . ARG C 3 150 ? -24.25800 88.29100  8.67100   1.000 32.28908 ? 454  ARG A CD    1 
ATOM   1775 N  NE    . ARG C 3 150 ? -24.73800 87.00300  8.18800   1.000 38.03082 ? 454  ARG A NE    1 
ATOM   1776 C  CZ    . ARG C 3 150 ? -24.19600 86.33800  7.17600   1.000 29.29816 ? 454  ARG A CZ    1 
ATOM   1777 N  NH1   . ARG C 3 150 ? -23.14900 86.84500  6.54500   1.000 32.06543 ? 454  ARG A NH1   1 
ATOM   1778 N  NH2   . ARG C 3 150 ? -24.70000 85.16600  6.79800   1.000 38.38514 ? 454  ARG A NH2   1 
ATOM   1779 N  N     . LEU C 3 151 ? -23.26700 84.53000  12.22000  1.000 19.01192 ? 455  LEU A N     1 
ATOM   1780 C  CA    . LEU C 3 151 ? -24.19400 83.50800  12.69600  1.000 23.43840 ? 455  LEU A CA    1 
ATOM   1781 C  C     . LEU C 3 151 ? -24.50500 83.66200  14.17800  1.000 19.52759 ? 455  LEU A C     1 
ATOM   1782 O  O     . LEU C 3 151 ? -25.58300 83.25700  14.62500  1.000 25.54252 ? 455  LEU A O     1 
ATOM   1783 C  CB    . LEU C 3 151 ? -23.61500 82.11500  12.42200  1.000 22.77880 ? 455  LEU A CB    1 
ATOM   1784 C  CG    . LEU C 3 151 ? -23.50700 81.72600  10.94100  1.000 24.46866 ? 455  LEU A CG    1 
ATOM   1785 C  CD1   . LEU C 3 151 ? -22.99300 80.28400  10.76500  1.000 28.78485 ? 455  LEU A CD1   1 
ATOM   1786 C  CD2   . LEU C 3 151 ? -24.84600 81.93400  10.23000  1.000 23.24442 ? 455  LEU A CD2   1 
ATOM   1787 N  N     . ASN C 3 152 ? -23.57900 84.23600  14.94400  1.000 20.63100 ? 456  ASN A N     1 
ATOM   1788 C  CA    . ASN C 3 152 ? -23.73100 84.47200  16.37900  1.000 26.90340 ? 456  ASN A CA    1 
ATOM   1789 C  C     . ASN C 3 152 ? -24.17800 83.20800  17.12000  1.000 34.07282 ? 456  ASN A C     1 
ATOM   1790 O  O     . ASN C 3 152 ? -25.07700 83.22000  17.96800  1.000 31.07676 ? 456  ASN A O     1 
ATOM   1791 C  CB    . ASN C 3 152 ? -24.68300 85.64000  16.64000  1.000 36.33011 ? 456  ASN A CB    1 
ATOM   1792 C  CG    . ASN C 3 152 ? -24.52000 86.22100  18.03300  1.000 45.07313 ? 456  ASN A CG    1 
ATOM   1793 O  OD1   . ASN C 3 152 ? -23.40700 86.31400  18.55700  1.000 50.16183 ? 456  ASN A OD1   1 
ATOM   1794 N  ND2   . ASN C 3 152 ? -25.63100 86.61800  18.64100  1.000 52.73861 ? 456  ASN A ND2   1 
ATOM   1795 N  N     . ILE C 3 153 ? -23.52600 82.10000  16.79100  1.000 27.15210 ? 457  ILE A N     1 
ATOM   1796 C  CA    . ILE C 3 153 ? -23.78100 80.82400  17.44600  1.000 20.66564 ? 457  ILE A CA    1 
ATOM   1797 C  C     . ILE C 3 153 ? -22.57500 80.30800  18.20900  1.000 24.32024 ? 457  ILE A C     1 
ATOM   1798 O  O     . ILE C 3 153 ? -22.70900 79.31500  18.94200  1.000 22.46877 ? 457  ILE A O     1 
ATOM   1799 C  CB    . ILE C 3 153 ? -24.26100 79.76500  16.43100  1.000 21.43742 ? 457  ILE A CB    1 
ATOM   1800 C  CG1   . ILE C 3 153 ? -23.19800 79.57900  15.34400  1.000 20.93091 ? 457  ILE A CG1   1 
ATOM   1801 C  CG2   . ILE C 3 153 ? -25.61500 80.16400  15.84900  1.000 22.88986 ? 457  ILE A CG2   1 
ATOM   1802 C  CD1   . ILE C 3 153 ? -23.72500 78.96800  14.05100  1.000 20.09755 ? 457  ILE A CD1   1 
ATOM   1803 N  N     . PHE C 3 154 ? -21.41400 80.94900  18.07200  1.000 18.62940 ? 458  PHE A N     1 
ATOM   1804 C  CA    . PHE C 3 154 ? -20.17600 80.51100  18.69600  1.000 21.51371 ? 458  PHE A CA    1 
ATOM   1805 C  C     . PHE C 3 154 ? -19.72500 81.50300  19.75700  1.000 21.13443 ? 458  PHE A C     1 
ATOM   1806 O  O     . PHE C 3 154 ? -19.75000 82.72100  19.54200  1.000 20.95600 ? 458  PHE A O     1 
ATOM   1807 C  CB    . PHE C 3 154 ? -19.07400 80.35100  17.64900  1.000 19.17180 ? 458  PHE A CB    1 
ATOM   1808 C  CG    . PHE C 3 154 ? -19.40900 79.37200  16.59500  1.000 15.04794 ? 458  PHE A CG    1 
ATOM   1809 C  CD1   . PHE C 3 154 ? -19.77600 78.07400  16.93900  1.000 19.38180 ? 458  PHE A CD1   1 
ATOM   1810 C  CD2   . PHE C 3 154 ? -19.39800 79.73600  15.26200  1.000 17.02319 ? 458  PHE A CD2   1 
ATOM   1811 C  CE1   . PHE C 3 154 ? -20.11200 77.14400  15.96100  1.000 14.33932 ? 458  PHE A CE1   1 
ATOM   1812 C  CE2   . PHE C 3 154 ? -19.72700 78.80400  14.26500  1.000 15.04676 ? 458  PHE A CE2   1 
ATOM   1813 C  CZ    . PHE C 3 154 ? -20.08100 77.51500  14.62100  1.000 19.61691 ? 458  PHE A CZ    1 
ATOM   1814 N  N     . ASN C 3 155 ? -19.29100 80.97000  20.89700  1.000 16.65358 ? 459  ASN A N     1 
ATOM   1815 C  CA    . ASN C 3 155 ? -18.68300 81.81000  21.92000  1.000 21.16905 ? 459  ASN A CA    1 
ATOM   1816 C  C     . ASN C 3 155 ? -17.22400 82.10700  21.61500  1.000 23.41540 ? 459  ASN A C     1 
ATOM   1817 O  O     . ASN C 3 155 ? -16.70000 83.13700  22.05400  1.000 24.10224 ? 459  ASN A O     1 
ATOM   1818 C  CB    . ASN C 3 155 ? -18.79900 81.13300  23.28500  1.000 23.77761 ? 459  ASN A CB    1 
ATOM   1819 C  CG    . ASN C 3 155 ? -20.23800 80.77700  23.63400  1.000 27.39302 ? 459  ASN A CG    1 
ATOM   1820 O  OD1   . ASN C 3 155 ? -20.73300 79.70900  23.27300  1.000 25.58364 ? 459  ASN A OD1   1 
ATOM   1821 N  ND2   . ASN C 3 155 ? -20.91500 81.67700  24.33400  1.000 27.11358 ? 459  ASN A ND2   1 
ATOM   1822 N  N     . LEU C 3 156 ? -16.55900 81.23000  20.87000  1.000 17.29504 ? 460  LEU A N     1 
ATOM   1823 C  CA    . LEU C 3 156 ? -15.14800 81.40400  20.55000  1.000 19.25325 ? 460  LEU A CA    1 
ATOM   1824 C  C     . LEU C 3 156 ? -14.89300 80.85700  19.15100  1.000 20.02539 ? 460  LEU A C     1 
ATOM   1825 O  O     . LEU C 3 156 ? -15.36700 79.76700  18.81100  1.000 18.73748 ? 460  LEU A O     1 
ATOM   1826 C  CB    . LEU C 3 156 ? -14.26900 80.70400  21.59200  1.000 23.18504 ? 460  LEU A CB    1 
ATOM   1827 C  CG    . LEU C 3 156 ? -12.75400 80.59900  21.38200  1.000 23.13435 ? 460  LEU A CG    1 
ATOM   1828 C  CD1   . LEU C 3 156 ? -12.06500 81.95000  21.51300  1.000 15.94604 ? 460  LEU A CD1   1 
ATOM   1829 C  CD2   . LEU C 3 156 ? -12.18000 79.61400  22.38200  1.000 25.10223 ? 460  LEU A CD2   1 
ATOM   1830 N  N     . ILE C 3 157 ? -14.17800 81.63800  18.34400  1.000 19.04294 ? 461  ILE A N     1 
ATOM   1831 C  CA    . ILE C 3 157 ? -13.86700 81.32100  16.95100  1.000 19.49296 ? 461  ILE A CA    1 
ATOM   1832 C  C     . ILE C 3 157 ? -12.34600 81.34400  16.81500  1.000 20.96807 ? 461  ILE A C     1 
ATOM   1833 O  O     . ILE C 3 157 ? -11.72800 82.41600  16.88400  1.000 19.25132 ? 461  ILE A O     1 
ATOM   1834 C  CB    . ILE C 3 157 ? -14.52300 82.31700  15.97900  1.000 19.72652 ? 461  ILE A CB    1 
ATOM   1835 C  CG1   . ILE C 3 157 ? -16.05600 82.19900  16.02300  1.000 21.33966 ? 461  ILE A CG1   1 
ATOM   1836 C  CG2   . ILE C 3 157 ? -14.00700 82.11000  14.56400  1.000 18.74957 ? 461  ILE A CG2   1 
ATOM   1837 C  CD1   . ILE C 3 157 ? -16.77700 83.20600  15.15200  1.000 22.35690 ? 461  ILE A CD1   1 
ATOM   1838 N  N     . LEU C 3 158 ? -11.74100 80.17200  16.61500  1.000 18.25723 ? 462  LEU A N     1 
ATOM   1839 C  CA    . LEU C 3 158 ? -10.28400 80.04700  16.58100  1.000 20.90142 ? 462  LEU A CA    1 
ATOM   1840 C  C     . LEU C 3 158 ? -9.80300  79.80400  15.15400  1.000 16.83573 ? 462  LEU A C     1 
ATOM   1841 O  O     . LEU C 3 158 ? -10.10300 78.74300  14.58100  1.000 19.51012 ? 462  LEU A O     1 
ATOM   1842 C  CB    . LEU C 3 158 ? -9.83100  78.90000  17.48800  1.000 14.55911 ? 462  LEU A CB    1 
ATOM   1843 C  CG    . LEU C 3 158 ? -10.04600 79.04300  18.99100  1.000 20.09982 ? 462  LEU A CG    1 
ATOM   1844 C  CD1   . LEU C 3 158 ? -9.84000  77.71100  19.68100  1.000 18.05328 ? 462  LEU A CD1   1 
ATOM   1845 C  CD2   . LEU C 3 158 ? -9.11500  80.09200  19.58000  1.000 21.76597 ? 462  LEU A CD2   1 
ATOM   1846 N  N     . PRO C 3 159 ? -9.07100  80.73000  14.53500  1.000 17.79224 ? 463  PRO A N     1 
ATOM   1847 C  CA    . PRO C 3 159 ? -8.53300  80.47100  13.18600  1.000 17.82340 ? 463  PRO A CA    1 
ATOM   1848 C  C     . PRO C 3 159 ? -7.45600  79.39400  13.23000  1.000 22.55746 ? 463  PRO A C     1 
ATOM   1849 O  O     . PRO C 3 159 ? -6.47600  79.51300  13.96500  1.000 26.15834 ? 463  PRO A O     1 
ATOM   1850 C  CB    . PRO C 3 159 ? -7.95200  81.82900  12.76300  1.000 18.45969 ? 463  PRO A CB    1 
ATOM   1851 C  CG    . PRO C 3 159 ? -7.71900  82.57900  14.06600  1.000 22.65934 ? 463  PRO A CG    1 
ATOM   1852 C  CD    . PRO C 3 159 ? -8.81500  82.10900  14.99400  1.000 17.13455 ? 463  PRO A CD    1 
ATOM   1853 N  N     . ILE C 3 160 ? -7.65200  78.33300  12.45500  1.000 15.56277 ? 464  ILE A N     1 
ATOM   1854 C  CA    . ILE C 3 160 ? -6.61300  77.33100  12.24900  1.000 11.92658 ? 464  ILE A CA    1 
ATOM   1855 C  C     . ILE C 3 160 ? -5.81000  77.65300  10.99700  1.000 25.78255 ? 464  ILE A C     1 
ATOM   1856 O  O     . ILE C 3 160 ? -4.58000  77.50800  10.97500  1.000 17.86088 ? 464  ILE A O     1 
ATOM   1857 C  CB    . ILE C 3 160 ? -7.23100  75.92100  12.15200  1.000 20.43768 ? 464  ILE A CB    1 
ATOM   1858 C  CG1   . ILE C 3 160 ? -7.94700  75.53100  13.45500  1.000 17.34944 ? 464  ILE A CG1   1 
ATOM   1859 C  CG2   . ILE C 3 160 ? -6.16600  74.89400  11.78200  1.000 21.14870 ? 464  ILE A CG2   1 
ATOM   1860 C  CD1   . ILE C 3 160 ? -7.12900  75.77600  14.69800  1.000 19.91472 ? 464  ILE A CD1   1 
ATOM   1861 N  N     . SER C 3 161 ? -6.50300  78.09900  9.95000   1.000 16.96031 ? 465  SER A N     1 
ATOM   1862 C  CA    . SER C 3 161 ? -5.84800  78.49000  8.71200   1.000 16.50598 ? 465  SER A CA    1 
ATOM   1863 C  C     . SER C 3 161 ? -6.80700  79.35900  7.90900   1.000 16.90045 ? 465  SER A C     1 
ATOM   1864 O  O     . SER C 3 161 ? -7.92400  79.66300  8.34200   1.000 15.63818 ? 465  SER A O     1 
ATOM   1865 C  CB    . SER C 3 161 ? -5.40100  77.26500  7.91300   1.000 17.32760 ? 465  SER A CB    1 
ATOM   1866 O  OG    . SER C 3 161 ? -6.48300  76.74500  7.16100   1.000 24.62702 ? 465  SER A OG    1 
ATOM   1867 N  N     . ILE C 3 162 ? -6.34200  79.76100  6.72400   1.000 15.47561 ? 466  ILE A N     1 
ATOM   1868 C  CA    . ILE C 3 162 ? -7.14100  80.54500  5.78900   1.000 13.52361 ? 466  ILE A CA    1 
ATOM   1869 C  C     . ILE C 3 162 ? -8.50900  79.90000  5.54900   1.000 15.46994 ? 466  ILE A C     1 
ATOM   1870 O  O     . ILE C 3 162 ? -9.50800  80.59900  5.33900   1.000 18.48318 ? 466  ILE A O     1 
ATOM   1871 C  CB    . ILE C 3 162 ? -6.34300  80.71700  4.47100   1.000 17.65672 ? 466  ILE A CB    1 
ATOM   1872 C  CG1   . ILE C 3 162 ? -7.06500  81.64700  3.52000   1.000 21.95838 ? 466  ILE A CG1   1 
ATOM   1873 C  CG2   . ILE C 3 162 ? -6.06900  79.37200  3.78100   1.000 13.37640 ? 466  ILE A CG2   1 
ATOM   1874 C  CD1   . ILE C 3 162 ? -6.48600  81.68100  2.13400   1.000 24.87773 ? 466  ILE A CD1   1 
ATOM   1875 N  N     . ASP C 3 163 ? -8.58700  78.56600  5.58700   1.000 13.79481 ? 467  ASP A N     1 
ATOM   1876 C  CA    . ASP C 3 163 ? -9.82700  77.87400  5.24100   1.000 15.93007 ? 467  ASP A CA    1 
ATOM   1877 C  C     . ASP C 3 163 ? -10.30300 76.92200  6.33500   1.000 16.86067 ? 467  ASP A C     1 
ATOM   1878 O  O     . ASP C 3 163 ? -11.03300 75.96200  6.04200   1.000 14.08049 ? 467  ASP A O     1 
ATOM   1879 C  CB    . ASP C 3 163 ? -9.66000  77.09500  3.94100   1.000 13.84628 ? 467  ASP A CB    1 
ATOM   1880 C  CG    . ASP C 3 163 ? -8.66000  75.96900  4.08000   1.000 20.34351 ? 467  ASP A CG    1 
ATOM   1881 O  OD1   . ASP C 3 163 ? -7.82100  76.04200  4.99100   1.000 22.92047 ? 467  ASP A OD1   1 
ATOM   1882 O  OD2   . ASP C 3 163 ? -8.72400  75.00300  3.30900   1.000 27.96323 ? 467  ASP A OD2   1 
ATOM   1883 N  N     . GLU C 3 164 ? -9.90500  77.13300  7.58300   1.000 16.17581 ? 468  GLU A N     1 
ATOM   1884 C  CA    . GLU C 3 164 ? -10.24600 76.15000  8.60300   1.000 14.43100 ? 468  GLU A CA    1 
ATOM   1885 C  C     . GLU C 3 164 ? -10.29200 76.83700  9.95400   1.000 16.83948 ? 468  GLU A C     1 
ATOM   1886 O  O     . GLU C 3 164 ? -9.38300  77.60000  10.30400  1.000 13.82923 ? 468  GLU A O     1 
ATOM   1887 C  CB    . GLU C 3 164 ? -9.23900  74.99700  8.61300   1.000 16.33183 ? 468  GLU A CB    1 
ATOM   1888 C  CG    . GLU C 3 164 ? -9.52000  73.91200  9.64500   1.000 20.66275 ? 468  GLU A CG    1 
ATOM   1889 C  CD    . GLU C 3 164 ? -8.43100  72.84100  9.67300   1.000 26.68074 ? 468  GLU A CD    1 
ATOM   1890 O  OE1   . GLU C 3 164 ? -8.38400  72.07400  10.65300  1.000 22.52537 ? 468  GLU A OE1   1 
ATOM   1891 O  OE2   . GLU C 3 164 ? -7.61900  72.76800  8.72100   1.000 26.03303 ? 468  GLU A OE2   1 
ATOM   1892 N  N     . ALA C 3 165 ? -11.35300 76.56500  10.70300  1.000 14.11093 ? 469  ALA A N     1 
ATOM   1893 C  CA    . ALA C 3 165 ? -11.53700 77.19200  11.99900  1.000 14.86458 ? 469  ALA A CA    1 
ATOM   1894 C  C     . ALA C 3 165 ? -12.13600 76.19000  12.97200  1.000 13.34352 ? 469  ALA A C     1 
ATOM   1895 O  O     . ALA C 3 165 ? -12.87900 75.28300  12.58400  1.000 19.09499 ? 469  ALA A O     1 
ATOM   1896 C  CB    . ALA C 3 165 ? -12.43500 78.45000  11.90700  1.000 14.91595 ? 469  ALA A CB    1 
ATOM   1897 N  N     . VAL C 3 166 ? -11.79800 76.37100  14.24200  1.000 13.38576 ? 470  VAL A N     1 
ATOM   1898 C  CA    . VAL C 3 166 ? -12.35700 75.59900  15.34400  1.000 14.79069 ? 470  VAL A CA    1 
ATOM   1899 C  C     . VAL C 3 166 ? -13.25600 76.55300  16.11900  1.000 20.58175 ? 470  VAL A C     1 
ATOM   1900 O  O     . VAL C 3 166 ? -12.79300 77.59200  16.61900  1.000 19.56525 ? 470  VAL A O     1 
ATOM   1901 C  CB    . VAL C 3 166 ? -11.25800 74.98300  16.22400  1.000 12.76999 ? 470  VAL A CB    1 
ATOM   1902 C  CG1   . VAL C 3 166 ? -11.84600 74.39800  17.47500  1.000 19.62054 ? 470  VAL A CG1   1 
ATOM   1903 C  CG2   . VAL C 3 166 ? -10.50700 73.90600  15.44900  1.000 15.28100 ? 470  VAL A CG2   1 
ATOM   1904 N  N     . CYS C 3 167 ? -14.55200 76.21700  16.16700  1.000 14.65682 ? 471  CYS A N     1 
ATOM   1905 C  CA    . CYS C 3 167 ? -15.62100 77.10700  16.59000  1.000 15.30252 ? 471  CYS A CA    1 
ATOM   1906 C  C     . CYS C 3 167 ? -16.30400 76.49800  17.80900  1.000 19.01647 ? 471  CYS A C     1 
ATOM   1907 O  O     . CYS C 3 167 ? -16.76600 75.35200  17.75700  1.000 19.41173 ? 471  CYS A O     1 
ATOM   1908 C  CB    . CYS C 3 167 ? -16.60500 77.29500  15.43700  1.000 24.21824 ? 471  CYS A CB    1 
ATOM   1909 S  SG    . CYS C 3 167 ? -15.89500 78.37600  14.16600  1.000 19.49817 ? 471  CYS A SG    1 
ATOM   1910 N  N     . VAL C 3 168 ? -16.36100 77.25500  18.90200  1.000 17.87178 ? 472  VAL A N     1 
ATOM   1911 C  CA    . VAL C 3 168 ? -16.71000 76.72300  20.21500  1.000 18.27168 ? 472  VAL A CA    1 
ATOM   1912 C  C     . VAL C 3 168 ? -18.07000 77.27100  20.62800  1.000 20.09923 ? 472  VAL A C     1 
ATOM   1913 O  O     . VAL C 3 168 ? -18.29300 78.48800  20.60800  1.000 20.22734 ? 472  VAL A O     1 
ATOM   1914 C  CB    . VAL C 3 168 ? -15.64700 77.07300  21.27500  1.000 16.79697 ? 472  VAL A CB    1 
ATOM   1915 C  CG1   . VAL C 3 168 ? -15.87300 76.22800  22.55600  1.000 14.39748 ? 472  VAL A CG1   1 
ATOM   1916 C  CG2   . VAL C 3 168 ? -14.23300 76.88100  20.72600  1.000 18.38455 ? 472  VAL A CG2   1 
ATOM   1917 N  N     . ARG C 3 169 ? -18.96000 76.37400  21.03700  1.000 20.11974 ? 473  ARG A N     1 
ATOM   1918 C  CA    . ARG C 3 169 ? -20.29000 76.72700  21.51100  1.000 19.29142 ? 473  ARG A CA    1 
ATOM   1919 C  C     . ARG C 3 169 ? -20.43100 76.27600  22.95500  1.000 15.33075 ? 473  ARG A C     1 
ATOM   1920 O  O     . ARG C 3 169 ? -20.31800 75.08200  23.24300  1.000 23.67068 ? 473  ARG A O     1 
ATOM   1921 C  CB    . ARG C 3 169 ? -21.35800 76.07600  20.64200  1.000 22.65531 ? 473  ARG A CB    1 
ATOM   1922 C  CG    . ARG C 3 169 ? -22.76700 76.55500  20.89900  1.000 23.14647 ? 473  ARG A CG    1 
ATOM   1923 C  CD    . ARG C 3 169 ? -23.65400 76.11500  19.74100  1.000 28.14791 ? 473  ARG A CD    1 
ATOM   1924 N  NE    . ARG C 3 169 ? -25.06800 76.04900  20.09800  1.000 31.55501 ? 473  ARG A NE    1 
ATOM   1925 C  CZ    . ARG C 3 169 ? -25.85400 77.10900  20.21800  1.000 32.44445 ? 473  ARG A CZ    1 
ATOM   1926 N  NH1   . ARG C 3 169 ? -25.36400 78.33000  20.01600  1.000 26.87582 ? 473  ARG A NH1   1 
ATOM   1927 N  NH2   . ARG C 3 169 ? -27.13200 76.94700  20.53800  1.000 38.91545 ? 473  ARG A NH2   1 
ATOM   1928 N  N     . ILE C 3 170 ? -20.67300 77.22700  23.85300  1.000 25.12930 ? 474  ILE A N     1 
ATOM   1929 C  CA    . ILE C 3 170 ? -20.88200 76.91900  25.26400  1.000 20.76945 ? 474  ILE A CA    1 
ATOM   1930 C  C     . ILE C 3 170 ? -22.33000 76.50200  25.47300  1.000 27.61787 ? 474  ILE A C     1 
ATOM   1931 O  O     . ILE C 3 170 ? -23.25500 77.14100  24.95600  1.000 23.51488 ? 474  ILE A O     1 
ATOM   1932 C  CB    . ILE C 3 170 ? -20.51900 78.12000  26.14800  1.000 25.70282 ? 474  ILE A CB    1 
ATOM   1933 C  CG1   . ILE C 3 170 ? -19.00700 78.34800  26.12500  1.000 29.74068 ? 474  ILE A CG1   1 
ATOM   1934 C  CG2   . ILE C 3 170 ? -20.99500 77.89200  27.58200  1.000 26.93963 ? 474  ILE A CG2   1 
ATOM   1935 C  CD1   . ILE C 3 170 ? -18.56400 79.59500  26.84700  1.000 29.36029 ? 474  ILE A CD1   1 
ATOM   1936 N  N     . ILE C 3 171 ? -22.52700 75.42200  26.21900  1.000 25.02371 ? 475  ILE A N     1 
ATOM   1937 C  CA    . ILE C 3 171 ? -23.84400 74.83600  26.43600  1.000 29.55087 ? 475  ILE A CA    1 
ATOM   1938 C  C     . ILE C 3 171 ? -24.23200 75.07300  27.89100  1.000 29.84617 ? 475  ILE A C     1 
ATOM   1939 O  O     . ILE C 3 171 ? -23.59400 74.51300  28.79500  1.000 34.02701 ? 475  ILE A O     1 
ATOM   1940 C  CB    . ILE C 3 171 ? -23.86000 73.34200  26.09700  1.000 28.95202 ? 475  ILE A CB    1 
ATOM   1941 C  CG1   . ILE C 3 171 ? -23.50500 73.15800  24.62900  1.000 29.72595 ? 475  ILE A CG1   1 
ATOM   1942 C  CG2   . ILE C 3 171 ? -25.22900 72.75100  26.38400  1.000 32.68056 ? 475  ILE A CG2   1 
ATOM   1943 C  CD1   . ILE C 3 171 ? -24.40700 73.91400  23.69700  1.000 28.47628 ? 475  ILE A CD1   1 
ATOM   1944 N  N     . PRO C 3 172 ? -25.25500 75.88000  28.16900  1.000 32.80188 ? 476  PRO A N     1 
ATOM   1945 C  CA    . PRO C 3 172 ? -25.74500 75.99100  29.54800  1.000 46.64538 ? 476  PRO A CA    1 
ATOM   1946 C  C     . PRO C 3 172 ? -26.34100 74.67200  30.00900  1.000 38.46900 ? 476  PRO A C     1 
ATOM   1947 O  O     . PRO C 3 172 ? -27.01100 73.97300  29.24600  1.000 40.27876 ? 476  PRO A O     1 
ATOM   1948 C  CB    . PRO C 3 172 ? -26.81300 77.08900  29.46000  1.000 38.22696 ? 476  PRO A CB    1 
ATOM   1949 C  CG    . PRO C 3 172 ? -26.45000 77.86700  28.22300  1.000 36.47116 ? 476  PRO A CG    1 
ATOM   1950 C  CD    . PRO C 3 172 ? -25.96200 76.80800  27.26800  1.000 34.20115 ? 476  PRO A CD    1 
ATOM   1951 N  N     . ASP C 3 173 ? -26.09300 74.32800  31.27100  1.000 46.00995 ? 477  ASP A N     1 
ATOM   1952 C  CA    . ASP C 3 173 ? -26.72900 73.13100  31.81300  1.000 52.50902 ? 477  ASP A CA    1 
ATOM   1953 C  C     . ASP C 3 173 ? -28.24300 73.29000  31.95300  1.000 46.88634 ? 477  ASP A C     1 
ATOM   1954 O  O     . ASP C 3 173 ? -28.92400 72.33600  32.35200  1.000 54.02536 ? 477  ASP A O     1 
ATOM   1955 C  CB    . ASP C 3 173 ? -26.08100 72.76600  33.15200  1.000 55.56987 ? 477  ASP A CB    1 
ATOM   1956 C  CG    . ASP C 3 173 ? -24.58400 72.49700  33.01700  1.000 61.66791 ? 477  ASP A CG    1 
ATOM   1957 O  OD1   . ASP C 3 173 ? -24.14700 71.37100  33.34600  1.000 61.82741 ? 477  ASP A OD1   1 
ATOM   1958 O  OD2   . ASP C 3 173 ? -23.84400 73.40900  32.58000  1.000 57.18052 ? 477  ASP A OD2   1 
ATOM   1959 N  N     . ASN C 3 174 ? -28.76200 74.47800  31.62400  1.000 50.92328 ? 478  ASN A N     1 
ATOM   1960 C  CA    . ASN C 3 174 ? -30.19100 74.72400  31.48600  1.000 51.60755 ? 478  ASN A CA    1 
ATOM   1961 C  C     . ASN C 3 174 ? -30.75900 74.12800  30.20600  1.000 56.29517 ? 478  ASN A C     1 
ATOM   1962 O  O     . ASN C 3 174 ? -31.98200 74.03300  30.07500  1.000 54.05014 ? 478  ASN A O     1 
ATOM   1963 C  CB    . ASN C 3 174 ? -30.45900 76.23400  31.49200  1.000 50.85907 ? 478  ASN A CB    1 
ATOM   1964 N  N     . ILE C 3 175 ? -29.90800 73.75400  29.25000  1.000 55.54916 ? 479  ILE A N     1 
ATOM   1965 C  CA    . ILE C 3 175 ? -30.33700 73.21000  27.96600  1.000 44.43728 ? 479  ILE A CA    1 
ATOM   1966 C  C     . ILE C 3 175 ? -29.85100 71.77300  27.86200  1.000 43.86916 ? 479  ILE A C     1 
ATOM   1967 O  O     . ILE C 3 175 ? -28.73300 71.45200  28.28000  1.000 49.02766 ? 479  ILE A O     1 
ATOM   1968 C  CB    . ILE C 3 175 ? -29.81200 74.05000  26.78200  1.000 47.03753 ? 479  ILE A CB    1 
ATOM   1969 N  N     . HIS C 3 176 ? -30.69300 70.90800  27.31300  1.000 45.56466 ? 480  HIS A N     1 
ATOM   1970 C  CA    . HIS C 3 176 ? -30.36500 69.49700  27.15000  1.000 42.28496 ? 480  HIS A CA    1 
ATOM   1971 C  C     . HIS C 3 176 ? -29.87200 69.27500  25.72400  1.000 53.29763 ? 480  HIS A C     1 
ATOM   1972 O  O     . HIS C 3 176 ? -30.59000 69.57100  24.75900  1.000 43.73105 ? 480  HIS A O     1 
ATOM   1973 C  CB    . HIS C 3 176 ? -31.58000 68.62200  27.45700  1.000 45.58735 ? 480  HIS A CB    1 
ATOM   1974 C  CG    . HIS C 3 176 ? -31.53000 67.26000  26.83500  1.000 47.00050 ? 480  HIS A CG    1 
ATOM   1975 N  ND1   . HIS C 3 176 ? -32.21300 66.94100  25.68100  1.000 52.79752 ? 480  HIS A ND1   1 
ATOM   1976 C  CD2   . HIS C 3 176 ? -30.88900 66.12900  27.21500  1.000 48.88495 ? 480  HIS A CD2   1 
ATOM   1977 C  CE1   . HIS C 3 176 ? -31.99200 65.67500  25.37300  1.000 47.12259 ? 480  HIS A CE1   1 
ATOM   1978 N  NE2   . HIS C 3 176 ? -31.19100 65.16100  26.28800  1.000 52.65361 ? 480  HIS A NE2   1 
ATOM   1979 N  N     . ASN C 3 177 ? -28.64800 68.76700  25.59100  1.000 48.43704 ? 481  ASN A N     1 
ATOM   1980 C  CA    . ASN C 3 177 ? -28.06100 68.63100  24.26500  1.000 39.85524 ? 481  ASN A CA    1 
ATOM   1981 C  C     . ASN C 3 177 ? -28.75100 67.52400  23.47400  1.000 43.71692 ? 481  ASN A C     1 
ATOM   1982 O  O     . ASN C 3 177 ? -29.12500 66.48500  24.02700  1.000 52.26332 ? 481  ASN A O     1 
ATOM   1983 C  CB    . ASN C 3 177 ? -26.56300 68.34500  24.36300  1.000 40.22356 ? 481  ASN A CB    1 
ATOM   1984 C  CG    . ASN C 3 177 ? -25.85800 68.53300  23.02900  1.000 43.48736 ? 481  ASN A CG    1 
ATOM   1985 O  OD1   . ASN C 3 177 ? -25.93500 69.60500  22.42300  1.000 35.90320 ? 481  ASN A OD1   1 
ATOM   1986 N  ND2   . ASN C 3 177 ? -25.20400 67.48400  22.54800  1.000 36.47989 ? 481  ASN A ND2   1 
ATOM   1987 N  N     . THR C 3 178 ? -28.93200 67.75200  22.17000  1.000 33.66410 ? 482  THR A N     1 
ATOM   1988 C  CA    . THR C 3 178 ? -29.47400 66.72100  21.29200  1.000 45.62802 ? 482  THR A CA    1 
ATOM   1989 C  C     . THR C 3 178 ? -28.69500 66.67800  19.98800  1.000 40.36866 ? 482  THR A C     1 
ATOM   1990 O  O     . THR C 3 178 ? -27.98800 67.62100  19.61500  1.000 32.05714 ? 482  THR A O     1 
ATOM   1991 C  CB    . THR C 3 178 ? -30.96300 66.91500  20.95200  1.000 40.13352 ? 482  THR A CB    1 
ATOM   1992 O  OG1   . THR C 3 178 ? -31.13500 68.09000  20.14100  1.000 32.62065 ? 482  THR A OG1   1 
ATOM   1993 C  CG2   . THR C 3 178 ? -31.80200 67.00400  22.21000  1.000 31.71810 ? 482  THR A CG2   1 
ATOM   1994 N  N     . ASN C 3 179 ? -28.85900 65.55700  19.28900  1.000 40.92709 ? 483  ASN A N     1 
ATOM   1995 C  CA    . ASN C 3 179 ? -28.22800 65.40000  17.98900  1.000 41.31386 ? 483  ASN A CA    1 
ATOM   1996 C  C     . ASN C 3 179 ? -28.93200 66.25000  16.94000  1.000 36.45868 ? 483  ASN A C     1 
ATOM   1997 O  O     . ASN C 3 179 ? -28.27500 66.86700  16.09100  1.000 27.46473 ? 483  ASN A O     1 
ATOM   1998 C  CB    . ASN C 3 179 ? -28.22500 63.92400  17.59300  1.000 43.32842 ? 483  ASN A CB    1 
ATOM   1999 C  CG    . ASN C 3 179 ? -27.00600 63.54000  16.78200  1.000 47.32314 ? 483  ASN A CG    1 
ATOM   2000 O  OD1   . ASN C 3 179 ? -27.03500 63.56800  15.54700  1.000 44.65353 ? 483  ASN A OD1   1 
ATOM   2001 N  ND2   . ASN C 3 179 ? -25.91900 63.17900  17.47200  1.000 52.67277 ? 483  ASN A ND2   1 
ATOM   2002 N  N     . THR C 3 180 ? -30.26900 66.31100  16.99700  1.000 28.29382 ? 484  THR A N     1 
ATOM   2003 C  CA    . THR C 3 180 ? -31.02000 67.05600  15.99400  1.000 30.89674 ? 484  THR A CA    1 
ATOM   2004 C  C     . THR C 3 180 ? -30.66300 68.53200  16.02100  1.000 25.15352 ? 484  THR A C     1 
ATOM   2005 O  O     . THR C 3 180 ? -30.60600 69.17900  14.97100  1.000 24.86725 ? 484  THR A O     1 
ATOM   2006 C  CB    . THR C 3 180 ? -32.52600 66.87000  16.21500  1.000 27.19319 ? 484  THR A CB    1 
ATOM   2007 O  OG1   . THR C 3 180 ? -32.81700 65.46900  16.24700  1.000 43.10545 ? 484  THR A OG1   1 
ATOM   2008 C  CG2   . THR C 3 180 ? -33.31300 67.51500  15.07800  1.000 30.14550 ? 484  THR A CG2   1 
ATOM   2009 N  N     . LEU C 3 181 ? -30.41000 69.07600  17.20700  1.000 27.30345 ? 485  LEU A N     1 
ATOM   2010 C  CA    . LEU C 3 181 ? -30.08900 70.49200  17.31000  1.000 27.62477 ? 485  LEU A CA    1 
ATOM   2011 C  C     . LEU C 3 181 ? -28.69300 70.78300  16.76300  1.000 21.76577 ? 485  LEU A C     1 
ATOM   2012 O  O     . LEU C 3 181 ? -28.47100 71.81400  16.12000  1.000 20.41998 ? 485  LEU A O     1 
ATOM   2013 C  CB    . LEU C 3 181 ? -30.21800 70.94100  18.76500  1.000 30.77575 ? 485  LEU A CB    1 
ATOM   2014 C  CG    . LEU C 3 181 ? -30.89100 72.30000  18.94500  1.000 42.61349 ? 485  LEU A CG    1 
ATOM   2015 C  CD1   . LEU C 3 181 ? -32.06100 72.46500  17.96600  1.000 40.66955 ? 485  LEU A CD1   1 
ATOM   2016 C  CD2   . LEU C 3 181 ? -31.35500 72.44900  20.38500  1.000 41.53000 ? 485  LEU A CD2   1 
ATOM   2017 N  N     . ASN C 3 182 ? -27.73800 69.88600  16.99600  1.000 26.25144 ? 486  ASN A N     1 
ATOM   2018 C  CA    . ASN C 3 182 ? -26.41300 70.11400  16.42500  1.000 28.81080 ? 486  ASN A CA    1 
ATOM   2019 C  C     . ASN C 3 182 ? -26.39500 69.83000  14.93100  1.000 21.39399 ? 486  ASN A C     1 
ATOM   2020 O  O     . ASN C 3 182 ? -25.65300 70.48800  14.18600  1.000 18.66449 ? 486  ASN A O     1 
ATOM   2021 C  CB    . ASN C 3 182 ? -25.36600 69.27800  17.15900  1.000 19.01358 ? 486  ASN A CB    1 
ATOM   2022 C  CG    . ASN C 3 182 ? -25.24900 69.66100  18.61400  1.000 20.20621 ? 486  ASN A CG    1 
ATOM   2023 O  OD1   . ASN C 3 182 ? -25.13700 70.83900  18.95200  1.000 25.30439 ? 486  ASN A OD1   1 
ATOM   2024 N  ND2   . ASN C 3 182 ? -25.27700 68.66600  19.48600  1.000 29.71931 ? 486  ASN A ND2   1 
ATOM   2025 N  N     . ALA C 3 183 ? -27.21600 68.88200  14.46700  1.000 20.21993 ? 487  ALA A N     1 
ATOM   2026 C  CA    . ALA C 3 183 ? -27.32400 68.65700  13.02900  1.000 20.88183 ? 487  ALA A CA    1 
ATOM   2027 C  C     . ALA C 3 183 ? -27.90200 69.87800  12.33300  1.000 20.58941 ? 487  ALA A C     1 
ATOM   2028 O  O     . ALA C 3 183 ? -27.50300 70.20900  11.21000  1.000 21.63842 ? 487  ALA A O     1 
ATOM   2029 C  CB    . ALA C 3 183 ? -28.17200 67.41200  12.73400  1.000 19.78178 ? 487  ALA A CB    1 
ATOM   2030 N  N     . ARG C 3 184 ? -28.83700 70.57200  12.98700  1.000 20.24908 ? 488  ARG A N     1 
ATOM   2031 C  CA    . ARG C 3 184 ? -29.42400 71.76100  12.37500  1.000 21.76878 ? 488  ARG A CA    1 
ATOM   2032 C  C     . ARG C 3 184 ? -28.42200 72.91300  12.32500  1.000 17.58166 ? 488  ARG A C     1 
ATOM   2033 O  O     . ARG C 3 184 ? -28.36900 73.65300  11.33500  1.000 15.07045 ? 488  ARG A O     1 
ATOM   2034 C  CB    . ARG C 3 184 ? -30.69900 72.16800  13.12000  1.000 20.51136 ? 488  ARG A CB    1 
ATOM   2035 C  CG    . ARG C 3 184 ? -31.85900 71.19700  12.90900  1.000 34.12758 ? 488  ARG A CG    1 
ATOM   2036 C  CD    . ARG C 3 184 ? -33.12400 71.89800  12.36500  1.000 40.69891 ? 488  ARG A CD    1 
ATOM   2037 N  NE    . ARG C 3 184 ? -33.62700 72.95700  13.25000  1.000 35.83733 ? 488  ARG A NE    1 
ATOM   2038 C  CZ    . ARG C 3 184 ? -34.89300 73.05500  13.66100  1.000 45.37584 ? 488  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG C 3 184 ? -35.79300 72.16500  13.26100  1.000 46.93537 ? 488  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG C 3 184 ? -35.26800 74.04400  14.46700  1.000 36.62281 ? 488  ARG A NH2   1 
ATOM   2041 N  N     . LEU C 3 185 ? -27.60300 73.07000  13.36400  1.000 15.75991 ? 489  LEU A N     1 
ATOM   2042 C  CA    . LEU C 3 185 ? -26.55700 74.09500  13.32200  1.000 18.58141 ? 489  LEU A CA    1 
ATOM   2043 C  C     . LEU C 3 185 ? -25.57800 73.81800  12.20100  1.000 12.44689 ? 489  LEU A C     1 
ATOM   2044 O  O     . LEU C 3 185 ? -25.19800 74.71900  11.44500  1.000 17.58029 ? 489  LEU A O     1 
ATOM   2045 C  CB    . LEU C 3 185 ? -25.81800 74.15500  14.65900  1.000 14.92467 ? 489  LEU A CB    1 
ATOM   2046 C  CG    . LEU C 3 185 ? -26.69500 74.65000  15.80600  1.000 19.93013 ? 489  LEU A CG    1 
ATOM   2047 C  CD1   . LEU C 3 185 ? -25.96200 74.59700  17.16000  1.000 18.83580 ? 489  LEU A CD1   1 
ATOM   2048 C  CD2   . LEU C 3 185 ? -27.23000 76.06200  15.49200  1.000 17.99749 ? 489  LEU A CD2   1 
ATOM   2049 N  N     . CYS C 3 186 ? -25.14800 72.56600  12.09200  1.000 16.70196 ? 490  CYS A N     1 
ATOM   2050 C  CA    . CYS C 3 186 ? -24.21200 72.16800  11.05000  1.000 19.54537 ? 490  CYS A CA    1 
ATOM   2051 C  C     . CYS C 3 186 ? -24.75900 72.55100  9.68700   1.000 20.34446 ? 490  CYS A C     1 
ATOM   2052 O  O     . CYS C 3 186 ? -24.05300 73.12600  8.85300   1.000 19.72609 ? 490  CYS A O     1 
ATOM   2053 C  CB    . CYS C 3 186 ? -24.01100 70.65600  11.10600  1.000 19.37228 ? 490  CYS A CB    1 
ATOM   2054 S  SG    . CYS C 3 186 ? -22.88700 70.15900  12.40100  1.000 16.55353 ? 490  CYS A SG    1 
ATOM   2055 N  N     . GLU C 3 187 ? -26.03700 72.22700  9.45100   1.000 17.31034 ? 491  GLU A N     1 
ATOM   2056 C  CA    . GLU C 3 187 ? -26.66000 72.48500  8.16400   1.000 21.78770 ? 491  GLU A CA    1 
ATOM   2057 C  C     . GLU C 3 187 ? -26.77400 73.98200  7.90500   1.000 16.73149 ? 491  GLU A C     1 
ATOM   2058 O  O     . GLU C 3 187 ? -26.55800 74.44200  6.77700   1.000 19.98176 ? 491  GLU A O     1 
ATOM   2059 C  CB    . GLU C 3 187 ? -28.02700 71.79200  8.12700   1.000 20.42291 ? 491  GLU A CB    1 
ATOM   2060 C  CG    . GLU C 3 187 ? -27.93500 70.28800  7.84700   1.000 21.61613 ? 491  GLU A CG    1 
ATOM   2061 C  CD    . GLU C 3 187 ? -27.58900 69.96700  6.38600   1.000 39.22922 ? 491  GLU A CD    1 
ATOM   2062 O  OE1   . GLU C 3 187 ? -26.44500 70.24600  5.93800   1.000 36.00859 ? 491  GLU A OE1   1 
ATOM   2063 O  OE2   . GLU C 3 187 ? -28.47000 69.43400  5.67500   1.000 45.31962 ? 491  GLU A OE2   1 
ATOM   2064 N  N     . GLU C 3 188 ? -27.09800 74.75900  8.94600   1.000 16.68600 ? 492  GLU A N     1 
ATOM   2065 C  CA    . GLU C 3 188 ? -27.11700 76.21100  8.80400   1.000 17.26010 ? 492  GLU A CA    1 
ATOM   2066 C  C     . GLU C 3 188 ? -25.72800 76.74200  8.45600   1.000 16.65940 ? 492  GLU A C     1 
ATOM   2067 O  O     . GLU C 3 188 ? -25.57200 77.52900  7.52400   1.000 15.68083 ? 492  GLU A O     1 
ATOM   2068 C  CB    . GLU C 3 188 ? -27.64100 76.85800  10.08800  1.000 15.67476 ? 492  GLU A CB    1 
ATOM   2069 C  CG    . GLU C 3 188 ? -27.55300 78.39500  10.07500  1.000 15.99302 ? 492  GLU A CG    1 
ATOM   2070 C  CD    . GLU C 3 188 ? -27.66100 79.00300  11.46500  1.000 22.57519 ? 492  GLU A CD    1 
ATOM   2071 O  OE1   . GLU C 3 188 ? -27.59800 80.24700  11.57000  1.000 24.48388 ? 492  GLU A OE1   1 
ATOM   2072 O  OE2   . GLU C 3 188 ? -27.82100 78.24400  12.44800  1.000 21.69554 ? 492  GLU A OE2   1 
ATOM   2073 N  N     . ILE C 3 189 ? -24.70500 76.30400  9.19200   1.000 12.89685 ? 493  ILE A N     1 
ATOM   2074 C  CA    . ILE C 3 189 ? -23.34100 76.73700  8.91000   1.000 16.82985 ? 493  ILE A CA    1 
ATOM   2075 C  C     . ILE C 3 189 ? -22.97600 76.42500  7.46400   1.000 15.97906 ? 493  ILE A C     1 
ATOM   2076 O  O     . ILE C 3 189 ? -22.45800 77.28000  6.73600   1.000 12.81430 ? 493  ILE A O     1 
ATOM   2077 C  CB    . ILE C 3 189 ? -22.35800 76.07200  9.89200   1.000 17.02639 ? 493  ILE A CB    1 
ATOM   2078 C  CG1   . ILE C 3 189 ? -22.62900 76.50000  11.33000  1.000 15.75409 ? 493  ILE A CG1   1 
ATOM   2079 C  CG2   . ILE C 3 189 ? -20.92200 76.37000  9.50300   1.000 12.37024 ? 493  ILE A CG2   1 
ATOM   2080 C  CD1   . ILE C 3 189 ? -22.09000 75.46900  12.33700  1.000 15.24432 ? 493  ILE A CD1   1 
ATOM   2081 N  N     . ARG C 3 190 ? -23.25900 75.19600  7.02500   1.000 13.03654 ? 494  ARG A N     1 
ATOM   2082 C  CA    . ARG C 3 190 ? -22.87600 74.78700  5.67500   1.000 12.67179 ? 494  ARG A CA    1 
ATOM   2083 C  C     . ARG C 3 190 ? -23.61200 75.59100  4.60500   1.000 20.73359 ? 494  ARG A C     1 
ATOM   2084 O  O     . ARG C 3 190 ? -23.01800 75.95300  3.58000   1.000 12.89113 ? 494  ARG A O     1 
ATOM   2085 C  CB    . ARG C 3 190 ? -23.13400 73.29300  5.48600   1.000 13.39811 ? 494  ARG A CB    1 
ATOM   2086 C  CG    . ARG C 3 190 ? -22.06000 72.38700  6.11300   1.000 17.01830 ? 494  ARG A CG    1 
ATOM   2087 C  CD    . ARG C 3 190 ? -22.54000 70.94000  6.27500   1.000 15.12638 ? 494  ARG A CD    1 
ATOM   2088 N  NE    . ARG C 3 190 ? -23.32600 70.49500  5.13300   1.000 17.62953 ? 494  ARG A NE    1 
ATOM   2089 C  CZ    . ARG C 3 190 ? -22.85400 70.26200  3.90800   1.000 20.75697 ? 494  ARG A CZ    1 
ATOM   2090 N  NH1   . ARG C 3 190 ? -21.55600 70.42100  3.61600   1.000 16.98084 ? 494  ARG A NH1   1 
ATOM   2091 N  NH2   . ARG C 3 190 ? -23.70100 69.87400  2.96000   1.000 21.66766 ? 494  ARG A NH2   1 
ATOM   2092 N  N     . GLN C 3 191 ? -24.90900 75.86800  4.81100   1.000 16.06281 ? 495  GLN A N     1 
ATOM   2093 C  CA    . GLN C 3 191 ? -25.65800 76.61400  3.80000   1.000 15.21791 ? 495  GLN A CA    1 
ATOM   2094 C  C     . GLN C 3 191 ? -25.24800 78.08000  3.77700   1.000 15.43240 ? 495  GLN A C     1 
ATOM   2095 O  O     . GLN C 3 191 ? -25.11200 78.67400  2.70200   1.000 13.04870 ? 495  GLN A O     1 
ATOM   2096 C  CB    . GLN C 3 191 ? -27.16100 76.49300  4.04900   1.000 14.05298 ? 495  GLN A CB    1 
ATOM   2097 C  CG    . GLN C 3 191 ? -28.02600 77.26000  3.03900   1.000 17.46026 ? 495  GLN A CG    1 
ATOM   2098 C  CD    . GLN C 3 191 ? -27.75600 76.91600  1.56800   1.000 19.96416 ? 495  GLN A CD    1 
ATOM   2099 O  OE1   . GLN C 3 191 ? -27.28400 75.82100  1.23400   1.000 21.13096 ? 495  GLN A OE1   1 
ATOM   2100 N  NE2   . GLN C 3 191 ? -28.05900 77.86900  0.67900   1.000 17.39345 ? 495  GLN A NE2   1 
ATOM   2101 N  N     . GLU C 3 192 ? -25.07600 78.68400  4.95000   1.000 12.71091 ? 496  GLU A N     1 
ATOM   2102 C  CA    . GLU C 3 192 ? -24.68300 80.08900  5.01100   1.000 16.72804 ? 496  GLU A CA    1 
ATOM   2103 C  C     . GLU C 3 192 ? -23.27200 80.30500  4.45200   1.000 17.40005 ? 496  GLU A C     1 
ATOM   2104 O  O     . GLU C 3 192 ? -23.00300 81.33000  3.81600   1.000 16.28515 ? 496  GLU A O     1 
ATOM   2105 C  CB    . GLU C 3 192 ? -24.77800 80.57600  6.45200   1.000 16.21318 ? 496  GLU A CB    1 
ATOM   2106 C  CG    . GLU C 3 192 ? -26.19600 80.74300  6.93900   1.000 18.23580 ? 496  GLU A CG    1 
ATOM   2107 C  CD    . GLU C 3 192 ? -26.97300 81.71800  6.07800   1.000 18.89022 ? 496  GLU A CD    1 
ATOM   2108 O  OE1   . GLU C 3 192 ? -26.69100 82.92900  6.14600   1.000 21.78608 ? 496  GLU A OE1   1 
ATOM   2109 O  OE2   . GLU C 3 192 ? -27.85900 81.27700  5.31800   1.000 21.86368 ? 496  GLU A OE2   1 
ATOM   2110 N  N     . ILE C 3 193 ? -22.35100 79.35800  4.67200   1.000 13.90338 ? 497  ILE A N     1 
ATOM   2111 C  CA    . ILE C 3 193 ? -21.02400 79.51300  4.07800   1.000 16.02133 ? 497  ILE A CA    1 
ATOM   2112 C  C     . ILE C 3 193 ? -21.09000 79.31300  2.56600   1.000 14.32329 ? 497  ILE A C     1 
ATOM   2113 O  O     . ILE C 3 193 ? -20.49100 80.07600  1.80000   1.000 20.09548 ? 497  ILE A O     1 
ATOM   2114 C  CB    . ILE C 3 193 ? -20.01200 78.56200  4.73700   1.000 14.30924 ? 497  ILE A CB    1 
ATOM   2115 C  CG1   . ILE C 3 193 ? -19.70000 79.04600  6.15100   1.000 13.11085 ? 497  ILE A CG1   1 
ATOM   2116 C  CG2   . ILE C 3 193 ? -18.72900 78.49600  3.89900   1.000 12.41854 ? 497  ILE A CG2   1 
ATOM   2117 C  CD1   . ILE C 3 193 ? -18.92700 78.04900  6.99900   1.000 14.46660 ? 497  ILE A CD1   1 
ATOM   2118 N  N     . PHE C 3 194 ? -21.83300 78.30400  2.11100   1.000 15.15908 ? 498  PHE A N     1 
ATOM   2119 C  CA    . PHE C 3 194 ? -21.99700 78.08600  0.67300   1.000 16.95656 ? 498  PHE A CA    1 
ATOM   2120 C  C     . PHE C 3 194 ? -22.53200 79.33800  -0.02400  1.000 22.87058 ? 498  PHE A C     1 
ATOM   2121 O  O     . PHE C 3 194 ? -22.05000 79.72400  -1.09700  1.000 19.48370 ? 498  PHE A O     1 
ATOM   2122 C  CB    . PHE C 3 194 ? -22.94500 76.90300  0.45000   1.000 18.93264 ? 498  PHE A CB    1 
ATOM   2123 C  CG    . PHE C 3 194 ? -23.19400 76.58400  -0.99100  1.000 18.44860 ? 498  PHE A CG    1 
ATOM   2124 C  CD1   . PHE C 3 194 ? -22.25500 75.87900  -1.72400  1.000 12.32246 ? 498  PHE A CD1   1 
ATOM   2125 C  CD2   . PHE C 3 194 ? -24.36900 76.98400  -1.61300  1.000 18.06171 ? 498  PHE A CD2   1 
ATOM   2126 C  CE1   . PHE C 3 194 ? -22.47200 75.58800  -3.06500  1.000 23.36744 ? 498  PHE A CE1   1 
ATOM   2127 C  CE2   . PHE C 3 194 ? -24.59900 76.69200  -2.95600  1.000 21.86419 ? 498  PHE A CE2   1 
ATOM   2128 C  CZ    . PHE C 3 194 ? -23.65300 75.99700  -3.68400  1.000 25.52337 ? 498  PHE A CZ    1 
ATOM   2129 N  N     . GLN C 3 195 ? -23.53600 79.97700  0.57500   1.000 18.01613 ? 499  GLN A N     1 
ATOM   2130 C  CA    . GLN C 3 195 ? -24.09600 81.20600  0.02300   1.000 23.27511 ? 499  GLN A CA    1 
ATOM   2131 C  C     . GLN C 3 195 ? -23.10500 82.35800  0.13200   1.000 19.89440 ? 499  GLN A C     1 
ATOM   2132 O  O     . GLN C 3 195 ? -22.92800 83.13200  -0.81900  1.000 16.75239 ? 499  GLN A O     1 
ATOM   2133 C  CB    . GLN C 3 195 ? -25.39900 81.54300  0.76600   1.000 22.77067 ? 499  GLN A CB    1 
ATOM   2134 C  CG    . GLN C 3 195 ? -26.34400 82.51300  0.05400   1.000 28.58673 ? 499  GLN A CG    1 
ATOM   2135 C  CD    . GLN C 3 195 ? -25.88500 83.96000  0.11100   1.000 36.95998 ? 499  GLN A CD    1 
ATOM   2136 O  OE1   . GLN C 3 195 ? -25.19600 84.37100  1.04800   1.000 41.47992 ? 499  GLN A OE1   1 
ATOM   2137 N  NE2   . GLN C 3 195 ? -26.27300 84.74700  -0.89300  1.000 33.63348 ? 499  GLN A NE2   1 
ATOM   2138 N  N     . GLY C 3 196 ? -22.45800 82.49400  1.29100   1.000 18.56529 ? 500  GLY A N     1 
ATOM   2139 C  CA    . GLY C 3 196 ? -21.58800 83.63200  1.53200   1.000 20.85660 ? 500  GLY A CA    1 
ATOM   2140 C  C     . GLY C 3 196 ? -20.32800 83.63400  0.69500   1.000 23.21761 ? 500  GLY A C     1 
ATOM   2141 O  O     . GLY C 3 196 ? -19.76400 84.70100  0.45300   1.000 21.44640 ? 500  GLY A O     1 
ATOM   2142 N  N     . THR C 3 197 ? -19.88000 82.46500  0.23700   1.000 20.43055 ? 501  THR A N     1 
ATOM   2143 C  CA    . THR C 3 197 ? -18.67800 82.34200  -0.57300  1.000 17.90863 ? 501  THR A CA    1 
ATOM   2144 C  C     . THR C 3 197 ? -18.98800 82.13600  -2.03900  1.000 20.19065 ? 501  THR A C     1 
ATOM   2145 O  O     . THR C 3 197 ? -18.09900 81.74200  -2.80300  1.000 21.85566 ? 501  THR A O     1 
ATOM   2146 C  CB    . THR C 3 197 ? -17.82200 81.17000  -0.09300  1.000 19.62092 ? 501  THR A CB    1 
ATOM   2147 O  OG1   . THR C 3 197 ? -18.56900 79.95600  -0.22800  1.000 15.44753 ? 501  THR A OG1   1 
ATOM   2148 C  CG2   . THR C 3 197 ? -17.38800 81.35400  1.36900   1.000 18.80025 ? 501  THR A CG2   1 
ATOM   2149 N  N     . ASN C 3 198 ? -20.24300 82.31000  -2.43700  1.000 26.26834 ? 502  ASN A N     1 
ATOM   2150 C  CA    . ASN C 3 198 ? -20.63500 82.12500  -3.83100  1.000 21.99047 ? 502  ASN A CA    1 
ATOM   2151 C  C     . ASN C 3 198 ? -20.27300 80.73500  -4.35600  1.000 21.80734 ? 502  ASN A C     1 
ATOM   2152 O  O     . ASN C 3 198 ? -19.80700 80.58100  -5.48500  1.000 23.90426 ? 502  ASN A O     1 
ATOM   2153 C  CB    . ASN C 3 198 ? -20.01800 83.20900  -4.71200  1.000 21.98606 ? 502  ASN A CB    1 
ATOM   2154 C  CG    . ASN C 3 198 ? -21.02300 83.81800  -5.66700  1.000 39.85699 ? 502  ASN A CG    1 
ATOM   2155 O  OD1   . ASN C 3 198 ? -22.17600 83.37600  -5.74800  1.000 34.78729 ? 502  ASN A OD1   1 
ATOM   2156 N  ND2   . ASN C 3 198 ? -20.59600 84.85100  -6.39200  1.000 46.29580 ? 502  ASN A ND2   1 
ATOM   2157 N  N     . GLY C 3 199 ? -20.47300 79.70800  -3.53700  1.000 22.66520 ? 503  GLY A N     1 
ATOM   2158 C  CA    . GLY C 3 199 ? -20.42200 78.34200  -4.01800  1.000 21.57439 ? 503  GLY A CA    1 
ATOM   2159 C  C     . GLY C 3 199 ? -19.31100 77.43500  -3.50400  1.000 21.61287 ? 503  GLY A C     1 
ATOM   2160 O  O     . GLY C 3 199 ? -19.17100 76.32300  -4.02700  1.000 18.05951 ? 503  GLY A O     1 
ATOM   2161 N  N     . CYS C 3 200 ? -18.52100 77.85000  -2.51000  1.000 15.45350 ? 504  CYS A N     1 
ATOM   2162 C  CA    . CYS C 3 200 ? -17.60900 76.90100  -1.86400  1.000 16.86243 ? 504  CYS A CA    1 
ATOM   2163 C  C     . CYS C 3 200 ? -18.34800 76.08600  -0.79600  1.000 16.67235 ? 504  CYS A C     1 
ATOM   2164 O  O     . CYS C 3 200 ? -19.32800 76.53800  -0.20000  1.000 16.30986 ? 504  CYS A O     1 
ATOM   2165 C  CB    . CYS C 3 200 ? -16.42000 77.61600  -1.21900  1.000 11.89733 ? 504  CYS A CB    1 
ATOM   2166 S  SG    . CYS C 3 200 ? -15.70800 78.90200  -2.23900  1.000 15.78937 ? 504  CYS A SG    1 
ATOM   2167 N  N     . THR C 3 201 ? -17.86200 74.87800  -0.54200  1.000 13.91695 ? 505  THR A N     1 
ATOM   2168 C  CA    . THR C 3 201 ? -18.48500 74.01200  0.44400   1.000 14.79952 ? 505  THR A CA    1 
ATOM   2169 C  C     . THR C 3 201 ? -17.52500 73.73500  1.59100   1.000 14.74942 ? 505  THR A C     1 
ATOM   2170 O  O     . THR C 3 201 ? -16.30200 73.74200  1.41800   1.000 15.79684 ? 505  THR A O     1 
ATOM   2171 C  CB    . THR C 3 201 ? -18.94400 72.69000  -0.18500  1.000 19.52675 ? 505  THR A CB    1 
ATOM   2172 O  OG1   . THR C 3 201 ? -19.42500 71.82300  0.84700   1.000 30.61959 ? 505  THR A OG1   1 
ATOM   2173 C  CG2   . THR C 3 201 ? -17.81100 72.01300  -0.90900  1.000 11.85682 ? 505  THR A CG2   1 
ATOM   2174 N  N     . VAL C 3 202 ? -18.08800 73.51700  2.77800   1.000 13.19116 ? 506  VAL A N     1 
ATOM   2175 C  CA    . VAL C 3 202 ? -17.29200 73.12200  3.93100   1.000 12.80460 ? 506  VAL A CA    1 
ATOM   2176 C  C     . VAL C 3 202 ? -17.83400 71.82100  4.50000   1.000 17.80360 ? 506  VAL A C     1 
ATOM   2177 O  O     . VAL C 3 202 ? -19.02500 71.51200  4.39300   1.000 16.22432 ? 506  VAL A O     1 
ATOM   2178 C  CB    . VAL C 3 202 ? -17.27800 74.22000  5.01100   1.000 16.21140 ? 506  VAL A CB    1 
ATOM   2179 C  CG1   . VAL C 3 202 ? -16.65300 75.50000  4.46000   1.000 11.22845 ? 506  VAL A CG1   1 
ATOM   2180 C  CG2   . VAL C 3 202 ? -18.72700 74.48400  5.51700   1.000 15.11830 ? 506  VAL A CG2   1 
ATOM   2181 N  N     . SER C 3 203 ? -16.94800 71.05400  5.11600   1.000 14.76177 ? 507  SER A N     1 
ATOM   2182 C  CA    . SER C 3 203 ? -17.37800 69.93200  5.92700   1.000 12.41912 ? 507  SER A CA    1 
ATOM   2183 C  C     . SER C 3 203 ? -17.18200 70.30900  7.37800   1.000 14.31704 ? 507  SER A C     1 
ATOM   2184 O  O     . SER C 3 203 ? -16.51700 71.30100  7.69100   1.000 10.22132 ? 507  SER A O     1 
ATOM   2185 C  CB    . SER C 3 203 ? -16.62300 68.64400  5.59100   1.000 15.24360 ? 507  SER A CB    1 
ATOM   2186 O  OG    . SER C 3 203 ? -16.93500 68.21300  4.27800   1.000 18.96792 ? 507  SER A OG    1 
ATOM   2187 N  N     . ILE C 3 204 ? -17.80000 69.53200  8.26300   1.000 11.69770 ? 508  ILE A N     1 
ATOM   2188 C  CA    . ILE C 3 204 ? -17.87800 69.91300  9.67000   1.000 13.82951 ? 508  ILE A CA    1 
ATOM   2189 C  C     . ILE C 3 204 ? -17.82500 68.66300  10.53100  1.000 16.11926 ? 508  ILE A C     1 
ATOM   2190 O  O     . ILE C 3 204 ? -18.65700 67.76300  10.37400  1.000 15.05893 ? 508  ILE A O     1 
ATOM   2191 C  CB    . ILE C 3 204 ? -19.16400 70.68500  10.01800  1.000 16.72301 ? 508  ILE A CB    1 
ATOM   2192 C  CG1   . ILE C 3 204 ? -19.32400 71.95300  9.18300   1.000 12.31642 ? 508  ILE A CG1   1 
ATOM   2193 C  CG2   . ILE C 3 204 ? -19.15200 71.06400  11.51000  1.000 13.03568 ? 508  ILE A CG2   1 
ATOM   2194 C  CD1   . ILE C 3 204 ? -20.66400 72.67600  9.50900   1.000 12.79369 ? 508  ILE A CD1   1 
ATOM   2195 N  N     . GLY C 3 205 ? -16.87300 68.63500  11.46100  1.000 13.59930 ? 509  GLY A N     1 
ATOM   2196 C  CA    . GLY C 3 205 ? -16.85500 67.66400  12.54800  1.000 15.56836 ? 509  GLY A CA    1 
ATOM   2197 C  C     . GLY C 3 205 ? -17.30300 68.32800  13.85000  1.000 15.99936 ? 509  GLY A C     1 
ATOM   2198 O  O     . GLY C 3 205 ? -16.88900 69.44400  14.16100  1.000 13.66802 ? 509  GLY A O     1 
ATOM   2199 N  N     . CYS C 3 206 ? -18.16400 67.63200  14.58500  1.000 15.97716 ? 510  CYS A N     1 
ATOM   2200 C  CA    . CYS C 3 206 ? -18.82000 68.19600  15.76800  1.000 12.05136 ? 510  CYS A CA    1 
ATOM   2201 C  C     . CYS C 3 206 ? -18.73900 67.18900  16.90800  1.000 13.66887 ? 510  CYS A C     1 
ATOM   2202 O  O     . CYS C 3 206 ? -19.17100 66.04600  16.75700  1.000 11.60969 ? 510  CYS A O     1 
ATOM   2203 C  CB    . CYS C 3 206 ? -20.28100 68.55500  15.44900  1.000 18.40825 ? 510  CYS A CB    1 
ATOM   2204 S  SG    . CYS C 3 206 ? -21.29100 69.10700  16.84100  1.000 18.34044 ? 510  CYS A SG    1 
ATOM   2205 N  N     . SER C 3 207 ? -18.17600 67.59600  18.04000  1.000 16.98679 ? 511  SER A N     1 
ATOM   2206 C  CA    . SER C 3 207 ? -18.01200 66.67000  19.15100  1.000 13.65040 ? 511  SER A CA    1 
ATOM   2207 C  C     . SER C 3 207 ? -17.85100 67.46400  20.44200  1.000 19.10252 ? 511  SER A C     1 
ATOM   2208 O  O     . SER C 3 207 ? -17.88600 68.69800  20.45100  1.000 16.66259 ? 511  SER A O     1 
ATOM   2209 C  CB    . SER C 3 207 ? -16.80300 65.75300  18.92800  1.000 18.83000 ? 511  SER A CB    1 
ATOM   2210 O  OG    . SER C 3 207 ? -16.74000 64.75700  19.94400  1.000 23.26958 ? 511  SER A OG    1 
ATOM   2211 N  N     . ASP C 3 208 ? -17.64100 66.73600  21.53600  1.000 21.52944 ? 512  ASP A N     1 
ATOM   2212 C  CA    . ASP C 3 208 ? -17.28200 67.33300  22.81600  1.000 24.00314 ? 512  ASP A CA    1 
ATOM   2213 C  C     . ASP C 3 208 ? -15.79300 67.22900  23.12200  1.000 25.11309 ? 512  ASP A C     1 
ATOM   2214 O  O     . ASP C 3 208 ? -15.39900 67.42800  24.27900  1.000 27.92315 ? 512  ASP A O     1 
ATOM   2215 C  CB    . ASP C 3 208 ? -18.09000 66.71000  23.96600  1.000 23.60493 ? 512  ASP A CB    1 
ATOM   2216 C  CG    . ASP C 3 208 ? -18.22300 65.18400  23.85900  1.000 23.30311 ? 512  ASP A CG    1 
ATOM   2217 O  OD1   . ASP C 3 208 ? -17.67200 64.57000  22.92000  1.000 17.08424 ? 512  ASP A OD1   1 
ATOM   2218 O  OD2   . ASP C 3 208 ? -18.90500 64.60500  24.73500  1.000 25.12016 ? 512  ASP A OD2   1 
ATOM   2219 N  N     . SER C 3 209 ? -14.95800 66.91500  22.13200  1.000 15.81246 ? 513  SER A N     1 
ATOM   2220 C  CA    . SER C 3 209 ? -13.52500 67.10600  22.28800  1.000 18.56040 ? 513  SER A CA    1 
ATOM   2221 C  C     . SER C 3 209 ? -12.95800 67.60500  20.96800  1.000 19.57823 ? 513  SER A C     1 
ATOM   2222 O  O     . SER C 3 209 ? -13.53100 67.37300  19.89800  1.000 20.33720 ? 513  SER A O     1 
ATOM   2223 C  CB    . SER C 3 209 ? -12.78000 65.83000  22.73400  1.000 20.46265 ? 513  SER A CB    1 
ATOM   2224 O  OG    . SER C 3 209 ? -12.76200 64.84100  21.71900  1.000 23.01671 ? 513  SER A OG    1 
ATOM   2225 N  N     . LEU C 3 210 ? -11.83200 68.31200  21.06600  1.000 20.33217 ? 514  LEU A N     1 
ATOM   2226 C  CA    . LEU C 3 210 ? -11.12300 68.75700  19.87300  1.000 17.71358 ? 514  LEU A CA    1 
ATOM   2227 C  C     . LEU C 3 210 ? -10.69300 67.57500  19.02600  1.000 19.93019 ? 514  LEU A C     1 
ATOM   2228 O  O     . LEU C 3 210 ? -10.84600 67.59700  17.79900  1.000 16.14744 ? 514  LEU A O     1 
ATOM   2229 C  CB    . LEU C 3 210 ? -9.90200  69.59100  20.26200  1.000 20.50520 ? 514  LEU A CB    1 
ATOM   2230 C  CG    . LEU C 3 210 ? -10.17400 70.87400  21.02800  1.000 20.14287 ? 514  LEU A CG    1 
ATOM   2231 C  CD1   . LEU C 3 210 ? -8.93100  71.26200  21.82300  1.000 18.57723 ? 514  LEU A CD1   1 
ATOM   2232 C  CD2   . LEU C 3 210 ? -10.58100 71.98400  20.07200  1.000 17.13359 ? 514  LEU A CD2   1 
ATOM   2233 N  N     . VAL C 3 211 ? -10.16800 66.52200  19.65700  1.000 19.34939 ? 515  VAL A N     1 
ATOM   2234 C  CA    . VAL C 3 211 ? -9.64400  65.41800  18.86500  1.000 18.51697 ? 515  VAL A CA    1 
ATOM   2235 C  C     . VAL C 3 211 ? -10.77300 64.68500  18.14800  1.000 20.12026 ? 515  VAL A C     1 
ATOM   2236 O  O     . VAL C 3 211 ? -10.64500 64.32400  16.96800  1.000 15.67136 ? 515  VAL A O     1 
ATOM   2237 C  CB    . VAL C 3 211 ? -8.78900  64.46600  19.72600  1.000 21.10876 ? 515  VAL A CB    1 
ATOM   2238 C  CG1   . VAL C 3 211 ? -9.57700  63.90200  20.90700  1.000 23.33718 ? 515  VAL A CG1   1 
ATOM   2239 C  CG2   . VAL C 3 211 ? -8.22600  63.35300  18.85300  1.000 18.72276 ? 515  VAL A CG2   1 
ATOM   2240 N  N     . LEU C 3 212 ? -11.90400 64.46600  18.82600  1.000 15.07427 ? 516  LEU A N     1 
ATOM   2241 C  CA    . LEU C 3 212 ? -13.00700 63.81800  18.12900  1.000 21.62652 ? 516  LEU A CA    1 
ATOM   2242 C  C     . LEU C 3 212 ? -13.57200 64.72400  17.03700  1.000 13.09232 ? 516  LEU A C     1 
ATOM   2243 O  O     . LEU C 3 212 ? -13.91600 64.25200  15.94600  1.000 16.78853 ? 516  LEU A O     1 
ATOM   2244 C  CB    . LEU C 3 212 ? -14.09300 63.40300  19.11900  1.000 19.14039 ? 516  LEU A CB    1 
ATOM   2245 C  CG    . LEU C 3 212 ? -13.73500 62.18800  19.97100  1.000 20.70863 ? 516  LEU A CG    1 
ATOM   2246 C  CD1   . LEU C 3 212 ? -14.92500 61.73800  20.78000  1.000 19.06092 ? 516  LEU A CD1   1 
ATOM   2247 C  CD2   . LEU C 3 212 ? -13.24400 61.04500  19.09600  1.000 20.07876 ? 516  LEU A CD2   1 
ATOM   2248 N  N     . ALA C 3 213 ? -13.63700 66.02900  17.28700  1.000 15.82466 ? 517  ALA A N     1 
ATOM   2249 C  CA    . ALA C 3 213 ? -14.17800 66.91900  16.26200  1.000 17.07729 ? 517  ALA A CA    1 
ATOM   2250 C  C     . ALA C 3 213 ? -13.30900 66.91600  15.01600  1.000 14.01014 ? 517  ALA A C     1 
ATOM   2251 O  O     . ALA C 3 213 ? -13.81900 67.03100  13.89300  1.000 14.82057 ? 517  ALA A O     1 
ATOM   2252 C  CB    . ALA C 3 213 ? -14.32400 68.33900  16.80800  1.000 16.24670 ? 517  ALA A CB    1 
ATOM   2253 N  N     . ARG C 3 214 ? -12.00000 66.75600  15.18200  1.000 14.36636 ? 518  ARG A N     1 
ATOM   2254 C  CA    . ARG C 3 214 ? -11.14500 66.70900  14.00300  1.000 15.79552 ? 518  ARG A CA    1 
ATOM   2255 C  C     . ARG C 3 214 ? -11.32400 65.39100  13.26100  1.000 12.17208 ? 518  ARG A C     1 
ATOM   2256 O  O     . ARG C 3 214 ? -11.37800 65.37800  12.03000  1.000 15.17178 ? 518  ARG A O     1 
ATOM   2257 C  CB    . ARG C 3 214 ? -9.68300  66.93600  14.39000  1.000 23.46592 ? 518  ARG A CB    1 
ATOM   2258 C  CG    . ARG C 3 214 ? -8.73700  66.87900  13.20200  1.000 24.16726 ? 518  ARG A CG    1 
ATOM   2259 C  CD    . ARG C 3 214 ? -7.35900  67.45400  13.52900  1.000 36.38878 ? 518  ARG A CD    1 
ATOM   2260 N  NE    . ARG C 3 214 ? -6.36600  66.97400  12.57200  1.000 43.20806 ? 518  ARG A NE    1 
ATOM   2261 C  CZ    . ARG C 3 214 ? -5.82700  65.75800  12.59600  1.000 39.79559 ? 518  ARG A CZ    1 
ATOM   2262 N  NH1   . ARG C 3 214 ? -6.16800  64.89600  13.53900  1.000 36.77270 ? 518  ARG A NH1   1 
ATOM   2263 N  NH2   . ARG C 3 214 ? -4.93500  65.40300  11.68000  1.000 43.71419 ? 518  ARG A NH2   1 
ATOM   2264 N  N     . LEU C 3 215 ? -11.46100 64.27600  13.99000  1.000 14.81482 ? 519  LEU A N     1 
ATOM   2265 C  CA    . LEU C 3 215 ? -11.69600 62.99300  13.32800  1.000 15.01355 ? 519  LEU A CA    1 
ATOM   2266 C  C     . LEU C 3 215 ? -13.05800 62.97000  12.64700  1.000 17.56184 ? 519  LEU A C     1 
ATOM   2267 O  O     . LEU C 3 215 ? -13.18300 62.51700  11.50200  1.000 20.66124 ? 519  LEU A O     1 
ATOM   2268 C  CB    . LEU C 3 215 ? -11.58600 61.85000  14.34100  1.000 20.85654 ? 519  LEU A CB    1 
ATOM   2269 C  CG    . LEU C 3 215 ? -10.16200 61.59100  14.83000  1.000 20.76463 ? 519  LEU A CG    1 
ATOM   2270 C  CD1   . LEU C 3 215 ? -10.15600 60.57000  15.96900  1.000 22.94397 ? 519  LEU A CD1   1 
ATOM   2271 C  CD2   . LEU C 3 215 ? -9.25600  61.15200  13.66400  1.000 20.92707 ? 519  LEU A CD2   1 
ATOM   2272 N  N     . ALA C 3 216 ? -14.09200 63.45600  13.34000  1.000 14.49030 ? 520  ALA A N     1 
ATOM   2273 C  CA    . ALA C 3 216 ? -15.41600 63.56400  12.73600  1.000 14.20141 ? 520  ALA A CA    1 
ATOM   2274 C  C     . ALA C 3 216 ? -15.37100 64.36500  11.43800  1.000 14.72465 ? 520  ALA A C     1 
ATOM   2275 O  O     . ALA C 3 216 ? -16.06800 64.04100  10.46200  1.000 16.51431 ? 520  ALA A O     1 
ATOM   2276 C  CB    . ALA C 3 216 ? -16.38100 64.21000  13.73500  1.000 14.91043 ? 520  ALA A CB    1 
ATOM   2277 N  N     . LEU C 3 217 ? -14.54400 65.41000  11.40800  1.000 16.49937 ? 521  LEU A N     1 
ATOM   2278 C  CA    . LEU C 3 217 ? -14.41400 66.22500  10.20500  1.000 16.06095 ? 521  LEU A CA    1 
ATOM   2279 C  C     . LEU C 3 217 ? -13.82400 65.41200  9.06000   1.000 13.82363 ? 521  LEU A C     1 
ATOM   2280 O  O     . LEU C 3 217 ? -14.33100 65.44700  7.93000   1.000 15.32750 ? 521  LEU A O     1 
ATOM   2281 C  CB    . LEU C 3 217 ? -13.55400 67.45400  10.50200  1.000 15.12800 ? 521  LEU A CB    1 
ATOM   2282 C  CG    . LEU C 3 217 ? -13.18000 68.25200  9.25600   1.000 19.18629 ? 521  LEU A CG    1 
ATOM   2283 C  CD1   . LEU C 3 217 ? -14.41800 68.93000  8.63800   1.000 14.11936 ? 521  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU C 3 217 ? -12.09400 69.25000  9.59600   1.000 12.76966 ? 521  LEU A CD2   1 
ATOM   2285 N  N     . LYS C 3 218 ? -12.73100 64.69200  9.32700   1.000 13.28491 ? 522  LYS A N     1 
ATOM   2286 C  CA    . LYS C 3 218 ? -12.20400 63.75400  8.33500   1.000 17.88057 ? 522  LYS A CA    1 
ATOM   2287 C  C     . LYS C 3 218 ? -13.28800 62.78900  7.86000   1.000 18.99281 ? 522  LYS A C     1 
ATOM   2288 O  O     . LYS C 3 218 ? -13.45400 62.56200  6.65700   1.000 23.92758 ? 522  LYS A O     1 
ATOM   2289 C  CB    . LYS C 3 218 ? -11.02100 62.98400  8.91800   1.000 20.67609 ? 522  LYS A CB    1 
ATOM   2290 C  CG    . LYS C 3 218 ? -9.71300  63.78300  8.95700   1.000 22.78905 ? 522  LYS A CG    1 
ATOM   2291 C  CD    . LYS C 3 218 ? -8.72700  63.16100  9.95100   1.000 32.75274 ? 522  LYS A CD    1 
ATOM   2292 C  CE    . LYS C 3 218 ? -7.35700  63.81600  9.87800   1.000 31.30704 ? 522  LYS A CE    1 
ATOM   2293 N  NZ    . LYS C 3 218 ? -6.94700  64.02800  8.47000   1.000 29.34792 ? 522  LYS A NZ    1 
ATOM   2294 N  N     . MET C 3 219 ? -14.05100 62.22100  8.79800   1.000 17.95866 ? 523  MET A N     1 
ATOM   2295 C  CA    . MET C 3 219 ? -15.13600 61.32000  8.42300   1.000 21.16863 ? 523  MET A CA    1 
ATOM   2296 C  C     . MET C 3 219 ? -16.21300 62.03100  7.60600   1.000 19.06325 ? 523  MET A C     1 
ATOM   2297 O  O     . MET C 3 219 ? -16.82000 61.42300  6.72100   1.000 21.81117 ? 523  MET A O     1 
ATOM   2298 C  CB    . MET C 3 219 ? -15.74600 60.68500  9.67800   1.000 19.31344 ? 523  MET A CB    1 
ATOM   2299 C  CG    . MET C 3 219 ? -16.93300 59.76800  9.39800   1.000 24.53188 ? 523  MET A CG    1 
ATOM   2300 S  SD    . MET C 3 219 ? -17.59800 59.00700  10.89900  1.000 31.85323 ? 523  MET A SD    1 
ATOM   2301 C  CE    . MET C 3 219 ? -16.30200 57.77500  11.19000  1.000 20.31622 ? 523  MET A CE    1 
ATOM   2302 N  N     . ALA C 3 220 ? -16.44000 63.31900  7.85200   1.000 17.67336 ? 524  ALA A N     1 
ATOM   2303 C  CA    . ALA C 3 220 ? -17.55700 64.01100  7.21800   1.000 19.28556 ? 524  ALA A CA    1 
ATOM   2304 C  C     . ALA C 3 220 ? -17.30700 64.38900  5.76500   1.000 20.87622 ? 524  ALA A C     1 
ATOM   2305 O  O     . ALA C 3 220 ? -18.27600 64.68000  5.05800   1.000 17.57701 ? 524  ALA A O     1 
ATOM   2306 C  CB    . ALA C 3 220 ? -17.90500 65.28300  7.98800   1.000 16.57855 ? 524  ALA A CB    1 
ATOM   2307 N  N     . LYS C 3 221 ? -16.04700 64.42600  5.32100   1.000 18.27533 ? 525  LYS A N     1 
ATOM   2308 C  CA    . LYS C 3 221 ? -15.72700 64.88400  3.97500   1.000 18.94052 ? 525  LYS A CA    1 
ATOM   2309 C  C     . LYS C 3 221 ? -16.20400 63.87500  2.92900   1.000 19.14993 ? 525  LYS A C     1 
ATOM   2310 O  O     . LYS C 3 221 ? -16.22300 62.67000  3.18900   1.000 21.30211 ? 525  LYS A O     1 
ATOM   2311 C  CB    . LYS C 3 221 ? -14.21800 65.09300  3.81900   1.000 19.31412 ? 525  LYS A CB    1 
ATOM   2312 C  CG    . LYS C 3 221 ? -13.65100 66.32900  4.54800   1.000 22.45285 ? 525  LYS A CG    1 
ATOM   2313 C  CD    . LYS C 3 221 ? -12.10500 66.32500  4.55100   1.000 17.00273 ? 525  LYS A CD    1 
ATOM   2314 C  CE    . LYS C 3 221 ? -11.55200 67.37500  5.48300   1.000 21.88327 ? 525  LYS A CE    1 
ATOM   2315 N  NZ    . LYS C 3 221 ? -10.14400 67.76700  5.12600   1.000 26.45376 ? 525  LYS A NZ    1 
ATOM   2316 N  N     . PRO C 3 222 ? -16.57400 64.34400  1.71800   1.000 18.62156 ? 526  PRO A N     1 
ATOM   2317 C  CA    . PRO C 3 222 ? -16.63300 65.77300  1.36800   1.000 17.38113 ? 526  PRO A CA    1 
ATOM   2318 C  C     . PRO C 3 222 ? -18.03400 66.35600  1.49900   1.000 19.19073 ? 526  PRO A C     1 
ATOM   2319 O  O     . PRO C 3 222 ? -18.99600 65.59500  1.49400   1.000 21.60473 ? 526  PRO A O     1 
ATOM   2320 C  CB    . PRO C 3 222 ? -16.17000 65.79200  -0.09700  1.000 17.27768 ? 526  PRO A CB    1 
ATOM   2321 C  CG    . PRO C 3 222 ? -16.63400 64.46900  -0.66000  1.000 17.47314 ? 526  PRO A CG    1 
ATOM   2322 C  CD    . PRO C 3 222 ? -16.66000 63.48400  0.52000   1.000 21.37663 ? 526  PRO A CD    1 
ATOM   2323 N  N     . ASN C 3 223 ? -18.12100 67.67900  1.63300   1.000 17.54080 ? 527  ASN A N     1 
ATOM   2324 C  CA    . ASN C 3 223 ? -19.38000 68.42300  1.62300   1.000 16.14709 ? 527  ASN A CA    1 
ATOM   2325 C  C     . ASN C 3 223 ? -20.43000 67.77500  2.52800   1.000 19.35991 ? 527  ASN A C     1 
ATOM   2326 O  O     . ASN C 3 223 ? -21.53500 67.44200  2.10600   1.000 19.53476 ? 527  ASN A O     1 
ATOM   2327 C  CB    . ASN C 3 223 ? -19.91700 68.57300  0.19700   1.000 22.10672 ? 527  ASN A CB    1 
ATOM   2328 C  CG    . ASN C 3 223 ? -21.13700 69.48000  0.13300   1.000 21.73390 ? 527  ASN A CG    1 
ATOM   2329 O  OD1   . ASN C 3 223 ? -21.35800 70.31000  1.02100   1.000 19.26895 ? 527  ASN A OD1   1 
ATOM   2330 N  ND2   . ASN C 3 223 ? -21.93800 69.31300  -0.89900  1.000 20.37051 ? 527  ASN A ND2   1 
ATOM   2331 N  N     . GLY C 3 224 ? -20.07200 67.61900  3.79700   1.000 18.80806 ? 528  GLY A N     1 
ATOM   2332 C  CA    . GLY C 3 224 ? -20.96600 66.96500  4.72500   1.000 15.20919 ? 528  GLY A CA    1 
ATOM   2333 C  C     . GLY C 3 224 ? -20.61700 67.33300  6.14800   1.000 16.15783 ? 528  GLY A C     1 
ATOM   2334 O  O     . GLY C 3 224 ? -19.78900 68.20600  6.39600   1.000 16.78689 ? 528  GLY A O     1 
ATOM   2335 N  N     . TYR C 3 225 ? -21.27700 66.67100  7.09000   1.000 13.21186 ? 529  TYR A N     1 
ATOM   2336 C  CA    . TYR C 3 225 ? -20.97000 66.87000  8.49300   1.000 17.63350 ? 529  TYR A CA    1 
ATOM   2337 C  C     . TYR C 3 225 ? -21.11600 65.54800  9.21200   1.000 15.14194 ? 529  TYR A C     1 
ATOM   2338 O  O     . TYR C 3 225 ? -21.79000 64.63500  8.74200   1.000 17.49587 ? 529  TYR A O     1 
ATOM   2339 C  CB    . TYR C 3 225 ? -21.86400 67.91400  9.16000   1.000 13.61572 ? 529  TYR A CB    1 
ATOM   2340 C  CG    . TYR C 3 225 ? -23.31000 67.50300  9.22200   1.000 17.15625 ? 529  TYR A CG    1 
ATOM   2341 C  CD1   . TYR C 3 225 ? -24.14800 67.72600  8.13400   1.000 19.67916 ? 529  TYR A CD1   1 
ATOM   2342 C  CD2   . TYR C 3 225 ? -23.83900 66.88400  10.35100  1.000 15.42470 ? 529  TYR A CD2   1 
ATOM   2343 C  CE1   . TYR C 3 225 ? -25.46400 67.36400  8.16300   1.000 25.21913 ? 529  TYR A CE1   1 
ATOM   2344 C  CE2   . TYR C 3 225 ? -25.18700 66.51400  10.38700  1.000 25.01987 ? 529  TYR A CE2   1 
ATOM   2345 C  CZ    . TYR C 3 225 ? -25.98200 66.76800  9.28400   1.000 25.62871 ? 529  TYR A CZ    1 
ATOM   2346 O  OH    . TYR C 3 225 ? -27.30300 66.42700  9.26100   1.000 30.05796 ? 529  TYR A OH    1 
ATOM   2347 N  N     . ASN C 3 226 ? -20.46200 65.46000  10.36400  1.000 18.01810 ? 530  ASN A N     1 
ATOM   2348 C  CA    . ASN C 3 226 ? -20.54100 64.28700  11.21900  1.000 16.94696 ? 530  ASN A CA    1 
ATOM   2349 C  C     . ASN C 3 226 ? -20.54400 64.72800  12.67000  1.000 18.82283 ? 530  ASN A C     1 
ATOM   2350 O  O     . ASN C 3 226 ? -19.79900 65.63500  13.06100  1.000 18.47916 ? 530  ASN A O     1 
ATOM   2351 C  CB    . ASN C 3 226 ? -19.38300 63.32000  10.98400  1.000 16.80584 ? 530  ASN A CB    1 
ATOM   2352 C  CG    . ASN C 3 226 ? -19.40400 62.13900  11.95500  1.000 18.43643 ? 530  ASN A CG    1 
ATOM   2353 O  OD1   . ASN C 3 226 ? -19.00500 62.25000  13.12200  1.000 17.35380 ? 530  ASN A OD1   1 
ATOM   2354 N  ND2   . ASN C 3 226 ? -19.88200 61.00900  11.47400  1.000 19.37786 ? 530  ASN A ND2   1 
ATOM   2355 N  N     . ILE C 3 227 ? -21.40200 64.10000  13.45800  1.000 18.39374 ? 531  ILE A N     1 
ATOM   2356 C  CA    . ILE C 3 227 ? -21.51800 64.39900  14.87600  1.000 19.41515 ? 531  ILE A CA    1 
ATOM   2357 C  C     . ILE C 3 227 ? -21.22600 63.10600  15.62400  1.000 18.60666 ? 531  ILE A C     1 
ATOM   2358 O  O     . ILE C 3 227 ? -21.96900 62.12600  15.50000  1.000 18.33140 ? 531  ILE A O     1 
ATOM   2359 C  CB    . ILE C 3 227 ? -22.89700 64.96400  15.22500  1.000 20.85944 ? 531  ILE A CB    1 
ATOM   2360 C  CG1   . ILE C 3 227 ? -23.25300 66.09900  14.26100  1.000 19.84732 ? 531  ILE A CG1   1 
ATOM   2361 C  CG2   . ILE C 3 227 ? -22.90400 65.49200  16.62800  1.000 22.48674 ? 531  ILE A CG2   1 
ATOM   2362 C  CD1   . ILE C 3 227 ? -24.75000 66.39300  14.17100  1.000 26.37583 ? 531  ILE A CD1   1 
ATOM   2363 N  N     . THR C 3 228 ? -20.11500 63.07800  16.35100  1.000 20.56522 ? 532  THR A N     1 
ATOM   2364 C  CA    . THR C 3 228 ? -19.72400 61.89200  17.12000  1.000 21.73636 ? 532  THR A CA    1 
ATOM   2365 C  C     . THR C 3 228 ? -19.26800 62.40400  18.47700  1.000 20.42892 ? 532  THR A C     1 
ATOM   2366 O  O     . THR C 3 228 ? -18.15000 62.90700  18.61200  1.000 22.66533 ? 532  THR A O     1 
ATOM   2367 C  CB    . THR C 3 228 ? -18.60700 61.07900  16.45600  1.000 22.40268 ? 532  THR A CB    1 
ATOM   2368 O  OG1   . THR C 3 228 ? -19.01900 60.59300  15.17100  1.000 18.97661 ? 532  THR A OG1   1 
ATOM   2369 C  CG2   . THR C 3 228 ? -18.23300 59.88300  17.34400  1.000 17.54551 ? 532  THR A CG2   1 
ATOM   2370 N  N     . PHE C 3 229 ? -20.12900 62.29200  19.47200  1.000 19.72653 ? 533  PHE A N     1 
ATOM   2371 C  CA    . PHE C 3 229 ? -19.70300 62.62100  20.81500  1.000 22.80780 ? 533  PHE A CA    1 
ATOM   2372 C  C     . PHE C 3 229 ? -18.98300 61.43500  21.44700  1.000 22.75309 ? 533  PHE A C     1 
ATOM   2373 O  O     . PHE C 3 229 ? -18.98600 60.31900  20.92500  1.000 23.48783 ? 533  PHE A O     1 
ATOM   2374 C  CB    . PHE C 3 229 ? -20.89700 63.03900  21.65900  1.000 25.66275 ? 533  PHE A CB    1 
ATOM   2375 C  CG    . PHE C 3 229 ? -21.34400 64.42700  21.38600  1.000 27.04381 ? 533  PHE A CG    1 
ATOM   2376 C  CD1   . PHE C 3 229 ? -21.87600 64.76700  20.15300  1.000 38.63675 ? 533  PHE A CD1   1 
ATOM   2377 C  CD2   . PHE C 3 229 ? -21.23000 65.40000  22.35300  1.000 37.18436 ? 533  PHE A CD2   1 
ATOM   2378 C  CE1   . PHE C 3 229 ? -22.29400 66.05300  19.89800  1.000 34.19411 ? 533  PHE A CE1   1 
ATOM   2379 C  CE2   . PHE C 3 229 ? -21.64400 66.68700  22.10300  1.000 34.35874 ? 533  PHE A CE2   1 
ATOM   2380 C  CZ    . PHE C 3 229 ? -22.17200 67.01200  20.86500  1.000 31.50898 ? 533  PHE A CZ    1 
ATOM   2381 N  N     . LYS C 3 230 ? -18.33700 61.69200  22.58400  1.000 25.75161 ? 534  LYS A N     1 
ATOM   2382 C  CA    . LYS C 3 230 ? -17.73100 60.59700  23.33100  1.000 23.58998 ? 534  LYS A CA    1 
ATOM   2383 C  C     . LYS C 3 230 ? -18.76300 59.52100  23.64700  1.000 28.91482 ? 534  LYS A C     1 
ATOM   2384 O  O     . LYS C 3 230 ? -18.45800 58.32300  23.59800  1.000 24.34298 ? 534  LYS A O     1 
ATOM   2385 C  CB    . LYS C 3 230 ? -17.08400 61.13900  24.59900  1.000 26.22152 ? 534  LYS A CB    1 
ATOM   2386 C  CG    . LYS C 3 230 ? -15.88900 62.03900  24.29300  1.000 21.53006 ? 534  LYS A CG    1 
ATOM   2387 C  CD    . LYS C 3 230 ? -15.70200 63.09100  25.34300  1.000 24.93522 ? 534  LYS A CD    1 
ATOM   2388 C  CE    . LYS C 3 230 ? -14.34400 63.75400  25.16700  1.000 25.06346 ? 534  LYS A CE    1 
ATOM   2389 N  NZ    . LYS C 3 230 ? -14.11000 64.82100  26.17700  1.000 22.00772 ? 534  LYS A NZ    1 
ATOM   2390 N  N     . SER C 3 231 ? -20.00300 59.93400  23.92200  1.000 24.70410 ? 535  SER A N     1 
ATOM   2391 C  CA    . SER C 3 231 ? -21.08000 58.98900  24.19800  1.000 33.38255 ? 535  SER A CA    1 
ATOM   2392 C  C     . SER C 3 231 ? -21.31100 58.03700  23.03600  1.000 28.53790 ? 535  SER A C     1 
ATOM   2393 O  O     . SER C 3 231 ? -21.70400 56.88300  23.24400  1.000 30.49414 ? 535  SER A O     1 
ATOM   2394 C  CB    . SER C 3 231 ? -22.37200 59.75300  24.50000  1.000 23.86707 ? 535  SER A CB    1 
ATOM   2395 O  OG    . SER C 3 231 ? -22.38900 60.14700  25.85300  1.000 38.13428 ? 535  SER A OG    1 
ATOM   2396 N  N     . ASN C 3 232 ? -21.08500 58.50400  21.81300  1.000 30.68978 ? 536  ASN A N     1 
ATOM   2397 C  CA    . ASN C 3 232 ? -21.41200 57.75500  20.61700  1.000 26.48272 ? 536  ASN A CA    1 
ATOM   2398 C  C     . ASN C 3 232 ? -20.25000 56.93600  20.07700  1.000 21.83656 ? 536  ASN A C     1 
ATOM   2399 O  O     . ASN C 3 232 ? -20.42300 56.28000  19.04900  1.000 33.20460 ? 536  ASN A O     1 
ATOM   2400 C  CB    . ASN C 3 232 ? -21.89800 58.69900  19.50300  1.000 32.51681 ? 536  ASN A CB    1 
ATOM   2401 C  CG    . ASN C 3 232 ? -22.76000 59.84100  20.01400  1.000 32.39728 ? 536  ASN A CG    1 
ATOM   2402 O  OD1   . ASN C 3 232 ? -22.53900 61.00100  19.64100  1.000 29.73626 ? 536  ASN A OD1   1 
ATOM   2403 N  ND2   . ASN C 3 232 ? -23.76800 59.52200  20.83500  1.000 23.56089 ? 536  ASN A ND2   1 
ATOM   2404 N  N     . LEU C 3 233 ? -19.07900 56.96900  20.71100  1.000 28.79664 ? 537  LEU A N     1 
ATOM   2405 C  CA    . LEU C 3 233 ? -17.92900 56.22800  20.19900  1.000 25.42849 ? 537  LEU A CA    1 
ATOM   2406 C  C     . LEU C 3 233 ? -18.29700 54.76200  19.99100  1.000 29.91293 ? 537  LEU A C     1 
ATOM   2407 O  O     . LEU C 3 233 ? -19.09200 54.19400  20.74400  1.000 33.33868 ? 537  LEU A O     1 
ATOM   2408 C  CB    . LEU C 3 233 ? -16.74800 56.35000  21.16800  1.000 19.56097 ? 537  LEU A CB    1 
ATOM   2409 C  CG    . LEU C 3 233 ? -15.93900 57.65700  21.10500  1.000 27.58482 ? 537  LEU A CG    1 
ATOM   2410 C  CD1   . LEU C 3 233 ? -14.87000 57.72900  22.19000  1.000 22.70762 ? 537  LEU A CD1   1 
ATOM   2411 C  CD2   . LEU C 3 233 ? -15.29900 57.83600  19.72500  1.000 22.06792 ? 537  LEU A CD2   1 
ATOM   2412 N  N     . SER C 3 234 ? -17.73900 54.15900  18.94400  1.000 29.52338 ? 538  SER A N     1 
ATOM   2413 C  CA    . SER C 3 234 ? -18.00500 52.75700  18.64700  1.000 24.62033 ? 538  SER A CA    1 
ATOM   2414 C  C     . SER C 3 234 ? -16.87900 52.18700  17.78700  1.000 29.31875 ? 538  SER A C     1 
ATOM   2415 O  O     . SER C 3 234 ? -15.98500 52.90600  17.33300  1.000 22.44261 ? 538  SER A O     1 
ATOM   2416 C  CB    . SER C 3 234 ? -19.35400 52.58900  17.95000  1.000 27.84751 ? 538  SER A CB    1 
ATOM   2417 O  OG    . SER C 3 234 ? -19.30100 53.04500  16.60900  1.000 29.62183 ? 538  SER A OG    1 
ATOM   2418 N  N     . GLU C 3 235 ? -16.94700 50.86600  17.56300  1.000 29.11194 ? 539  GLU A N     1 
ATOM   2419 C  CA    . GLU C 3 235 ? -15.94000 50.18700  16.74900  1.000 28.77931 ? 539  GLU A CA    1 
ATOM   2420 C  C     . GLU C 3 235 ? -15.99600 50.63000  15.29500  1.000 23.16248 ? 539  GLU A C     1 
ATOM   2421 O  O     . GLU C 3 235 ? -14.95600 50.71100  14.63300  1.000 26.69126 ? 539  GLU A O     1 
ATOM   2422 C  CB    . GLU C 3 235 ? -16.10400 48.66300  16.84900  1.000 25.93933 ? 539  GLU A CB    1 
ATOM   2423 C  CG    . GLU C 3 235 ? -14.89800 47.96000  17.48400  1.000 34.87619 ? 539  GLU A CG    1 
ATOM   2424 C  CD    . GLU C 3 235 ? -14.85700 46.45400  17.22900  1.000 44.37435 ? 539  GLU A CD    1 
ATOM   2425 O  OE1   . GLU C 3 235 ? -15.92800 45.81400  17.27500  1.000 43.65259 ? 539  GLU A OE1   1 
ATOM   2426 O  OE2   . GLU C 3 235 ? -13.75300 45.90500  16.99400  1.000 42.16566 ? 539  GLU A OE2   1 
ATOM   2427 N  N     . GLU C 3 236 ? -17.18500 50.94400  14.78400  1.000 24.57706 ? 540  GLU A N     1 
ATOM   2428 C  CA    . GLU C 3 236 ? -17.27600 51.42500  13.41200  1.000 22.10519 ? 540  GLU A CA    1 
ATOM   2429 C  C     . GLU C 3 236 ? -16.62000 52.78800  13.25600  1.000 27.65634 ? 540  GLU A C     1 
ATOM   2430 O  O     . GLU C 3 236 ? -16.05100 53.07600  12.19700  1.000 28.44083 ? 540  GLU A O     1 
ATOM   2431 C  CB    . GLU C 3 236 ? -18.73500 51.49300  12.95300  1.000 31.33708 ? 540  GLU A CB    1 
ATOM   2432 C  CG    . GLU C 3 236 ? -19.52500 50.21600  13.15300  1.000 35.79006 ? 540  GLU A CG    1 
ATOM   2433 C  CD    . GLU C 3 236 ? -20.03100 50.07700  14.57500  1.000 42.54234 ? 540  GLU A CD    1 
ATOM   2434 O  OE1   . GLU C 3 236 ? -19.95000 51.07000  15.32100  1.000 42.55892 ? 540  GLU A OE1   1 
ATOM   2435 O  OE2   . GLU C 3 236 ? -20.50500 48.98500  14.95000  1.000 46.99766 ? 540  GLU A OE2   1 
ATOM   2436 N  N     . PHE C 3 237 ? -16.70300 53.64700  14.27700  1.000 23.38165 ? 541  PHE A N     1 
ATOM   2437 C  CA    . PHE C 3 237 ? -15.97900 54.91300  14.23200  1.000 25.98633 ? 541  PHE A CA    1 
ATOM   2438 C  C     . PHE C 3 237 ? -14.47900 54.67300  14.07900  1.000 19.72847 ? 541  PHE A C     1 
ATOM   2439 O  O     . PHE C 3 237 ? -13.86800 55.09800  13.09100  1.000 19.90068 ? 541  PHE A O     1 
ATOM   2440 C  CB    . PHE C 3 237 ? -16.28300 55.74000  15.48400  1.000 21.92771 ? 541  PHE A CB    1 
ATOM   2441 C  CG    . PHE C 3 237 ? -15.63300 57.10000  15.49400  1.000 22.36173 ? 541  PHE A CG    1 
ATOM   2442 C  CD1   . PHE C 3 237 ? -16.21900 58.16900  14.82900  1.000 24.82016 ? 541  PHE A CD1   1 
ATOM   2443 C  CD2   . PHE C 3 237 ? -14.44900 57.31700  16.20000  1.000 20.77248 ? 541  PHE A CD2   1 
ATOM   2444 C  CE1   . PHE C 3 237 ? -15.63600 59.43300  14.86300  1.000 17.38253 ? 541  PHE A CE1   1 
ATOM   2445 C  CE2   . PHE C 3 237 ? -13.84800 58.56700  16.22800  1.000 22.36666 ? 541  PHE A CE2   1 
ATOM   2446 C  CZ    . PHE C 3 237 ? -14.44700 59.63100  15.56600  1.000 22.92931 ? 541  PHE A CZ    1 
ATOM   2447 N  N     . TRP C 3 238 ? -13.87800 53.94400  15.02700  1.000 18.57712 ? 542  TRP A N     1 
ATOM   2448 C  CA    . TRP C 3 238 ? -12.42300 53.77700  15.02700  1.000 21.89558 ? 542  TRP A CA    1 
ATOM   2449 C  C     . TRP C 3 238 ? -11.93200 53.00400  13.81100  1.000 21.42531 ? 542  TRP A C     1 
ATOM   2450 O  O     . TRP C 3 238 ? -10.81000 53.23500  13.33600  1.000 19.40151 ? 542  TRP A O     1 
ATOM   2451 C  CB    . TRP C 3 238 ? -11.97000 53.07700  16.31500  1.000 21.78212 ? 542  TRP A CB    1 
ATOM   2452 C  CG    . TRP C 3 238 ? -12.25300 53.87700  17.54900  1.000 20.01299 ? 542  TRP A CG    1 
ATOM   2453 C  CD1   . TRP C 3 238 ? -13.11000 53.55200  18.56100  1.000 22.93718 ? 542  TRP A CD1   1 
ATOM   2454 C  CD2   . TRP C 3 238 ? -11.68600 55.14400  17.89200  1.000 18.74012 ? 542  TRP A CD2   1 
ATOM   2455 N  NE1   . TRP C 3 238 ? -13.10500 54.54000  19.52200  1.000 27.59412 ? 542  TRP A NE1   1 
ATOM   2456 C  CE2   . TRP C 3 238 ? -12.24200 55.53100  19.13100  1.000 22.95252 ? 542  TRP A CE2   1 
ATOM   2457 C  CE3   . TRP C 3 238 ? -10.75600 55.99000  17.27200  1.000 13.99698 ? 542  TRP A CE3   1 
ATOM   2458 C  CZ2   . TRP C 3 238 ? -11.89700 56.72300  19.76900  1.000 23.07888 ? 542  TRP A CZ2   1 
ATOM   2459 C  CZ3   . TRP C 3 238 ? -10.42000 57.17800  17.90000  1.000 18.55151 ? 542  TRP A CZ3   1 
ATOM   2460 C  CH2   . TRP C 3 238 ? -10.99000 57.53200  19.13800  1.000 22.11546 ? 542  TRP A CH2   1 
ATOM   2461 N  N     . SER C 3 239 ? -12.74500 52.07800  13.29800  1.000 21.84333 ? 543  SER A N     1 
ATOM   2462 C  CA    . SER C 3 239 ? -12.34800 51.29500  12.13700  1.000 22.97213 ? 543  SER A CA    1 
ATOM   2463 C  C     . SER C 3 239 ? -12.26000 52.15100  10.88300  1.000 23.85648 ? 543  SER A C     1 
ATOM   2464 O  O     . SER C 3 239 ? -11.71600 51.69400  9.87100   1.000 23.83536 ? 543  SER A O     1 
ATOM   2465 C  CB    . SER C 3 239 ? -13.33400 50.14000  11.92500  1.000 20.64262 ? 543  SER A CB    1 
ATOM   2466 O  OG    . SER C 3 239 ? -13.22400 49.16300  12.95700  1.000 27.80330 ? 543  SER A OG    1 
ATOM   2467 N  N     . SER C 3 240 ? -12.76200 53.38400  10.93600  1.000 24.72789 ? 544  SER A N     1 
ATOM   2468 C  CA    . SER C 3 240 ? -12.83600 54.25500  9.77700   1.000 20.36690 ? 544  SER A CA    1 
ATOM   2469 C  C     . SER C 3 240 ? -11.53400 54.98300  9.49300   1.000 22.69528 ? 544  SER A C     1 
ATOM   2470 O  O     . SER C 3 240 ? -11.38800 55.54200  8.40100   1.000 24.36597 ? 544  SER A O     1 
ATOM   2471 C  CB    . SER C 3 240 ? -13.93600 55.30200  9.97500   1.000 26.87095 ? 544  SER A CB    1 
ATOM   2472 O  OG    . SER C 3 240 ? -15.19500 54.69700  10.22600  1.000 27.82356 ? 544  SER A OG    1 
ATOM   2473 N  N     . PHE C 3 241 ? -10.60000 55.00700  10.43700  1.000 18.69531 ? 545  PHE A N     1 
ATOM   2474 C  CA    . PHE C 3 241 ? -9.46900  55.92000  10.38700  1.000 24.98659 ? 545  PHE A CA    1 
ATOM   2475 C  C     . PHE C 3 241 ? -8.15500  55.16100  10.27200  1.000 21.44727 ? 545  PHE A C     1 
ATOM   2476 O  O     . PHE C 3 241 ? -7.94500  54.14800  10.94300  1.000 22.00484 ? 545  PHE A O     1 
ATOM   2477 C  CB    . PHE C 3 241 ? -9.42300  56.80800  11.64200  1.000 20.85886 ? 545  PHE A CB    1 
ATOM   2478 C  CG    . PHE C 3 241 ? -10.62000 57.68400  11.81000  1.000 23.04921 ? 545  PHE A CG    1 
ATOM   2479 C  CD1   . PHE C 3 241 ? -10.73300 58.87100  11.11100  1.000 22.79403 ? 545  PHE A CD1   1 
ATOM   2480 C  CD2   . PHE C 3 241 ? -11.64400 57.32200  12.67100  1.000 24.66329 ? 545  PHE A CD2   1 
ATOM   2481 C  CE1   . PHE C 3 241 ? -11.85200 59.68500  11.27200  1.000 18.03290 ? 545  PHE A CE1   1 
ATOM   2482 C  CE2   . PHE C 3 241 ? -12.75700 58.13600  12.82900  1.000 22.70111 ? 545  PHE A CE2   1 
ATOM   2483 C  CZ    . PHE C 3 241 ? -12.85900 59.30700  12.12900  1.000 18.30745 ? 545  PHE A CZ    1 
ATOM   2484 N  N     . LYS C 3 242 ? -7.26100  55.68800  9.44700   1.000 23.72458 ? 546  LYS A N     1 
ATOM   2485 C  CA    . LYS C 3 242 ? -5.88400  55.23200  9.41900   1.000 24.16081 ? 546  LYS A CA    1 
ATOM   2486 C  C     . LYS C 3 242 ? -5.09900  55.84000  10.58300  1.000 22.72550 ? 546  LYS A C     1 
ATOM   2487 O  O     . LYS C 3 242 ? -5.53100  56.80900  11.22600  1.000 20.43874 ? 546  LYS A O     1 
ATOM   2488 C  CB    . LYS C 3 242 ? -5.23500  55.58500  8.08300   1.000 25.98371 ? 546  LYS A CB    1 
ATOM   2489 C  CG    . LYS C 3 242 ? -5.77800  56.84600  7.44300   1.000 33.62637 ? 546  LYS A CG    1 
ATOM   2490 C  CD    . LYS C 3 242 ? -4.96100  57.23200  6.21200   1.000 35.75357 ? 546  LYS A CD    1 
ATOM   2491 C  CE    . LYS C 3 242 ? -4.70600  58.73300  6.17200   1.000 36.01932 ? 546  LYS A CE    1 
ATOM   2492 N  NZ    . LYS C 3 242 ? -4.32900  59.20300  4.81300   1.000 47.00905 ? 546  LYS A NZ    1 
ATOM   2493 N  N     . LEU C 3 243 ? -3.92900  55.24700  10.85800  1.000 21.91190 ? 547  LEU A N     1 
ATOM   2494 C  CA    . LEU C 3 243 ? -3.16800  55.63800  12.04500  1.000 21.26777 ? 547  LEU A CA    1 
ATOM   2495 C  C     . LEU C 3 243 ? -2.68000  57.07500  11.94400  1.000 23.39307 ? 547  LEU A C     1 
ATOM   2496 O  O     . LEU C 3 243 ? -2.63000  57.79000  12.95300  1.000 16.96403 ? 547  LEU A O     1 
ATOM   2497 C  CB    . LEU C 3 243 ? -1.97700  54.69400  12.27600  1.000 19.03390 ? 547  LEU A CB    1 
ATOM   2498 C  CG    . LEU C 3 243 ? -2.20900  53.19400  12.54200  1.000 23.35258 ? 547  LEU A CG    1 
ATOM   2499 C  CD1   . LEU C 3 243 ? -1.19100  52.59200  13.52200  1.000 23.61675 ? 547  LEU A CD1   1 
ATOM   2500 C  CD2   . LEU C 3 243 ? -3.60000  52.91200  12.98900  1.000 20.63041 ? 547  LEU A CD2   1 
ATOM   2501 N  N     . ASP C 3 244 ? -2.31200  57.52200  10.74700  1.000 19.31904 ? 548  ASP A N     1 
ATOM   2502 C  CA    . ASP C 3 244 ? -1.87700  58.90900  10.62500  1.000 26.41236 ? 548  ASP A CA    1 
ATOM   2503 C  C     . ASP C 3 244 ? -3.04800  59.89100  10.50600  1.000 23.42751 ? 548  ASP A C     1 
ATOM   2504 O  O     . ASP C 3 244 ? -2.81300  61.07500  10.25700  1.000 21.76434 ? 548  ASP A O     1 
ATOM   2505 C  CB    . ASP C 3 244 ? -0.88300  59.08200  9.45700   1.000 26.84425 ? 548  ASP A CB    1 
ATOM   2506 C  CG    . ASP C 3 244 ? -1.41000  58.56800  8.11000   1.000 28.10209 ? 548  ASP A CG    1 
ATOM   2507 O  OD1   . ASP C 3 244 ? -2.47700  57.92500  8.05000   1.000 28.08948 ? 548  ASP A OD1   1 
ATOM   2508 O  OD2   . ASP C 3 244 ? -0.72100  58.79700  7.09300   1.000 27.57864 ? 548  ASP A OD2   1 
ATOM   2509 N  N     . ASP C 3 245 ? -4.29700  59.45400  10.69500  1.000 17.92354 ? 549  ASP A N     1 
ATOM   2510 C  CA    . ASP C 3 245 ? -5.35500  60.44000  10.91900  1.000 26.44563 ? 549  ASP A CA    1 
ATOM   2511 C  C     . ASP C 3 245 ? -5.26100  61.07800  12.29700  1.000 23.06462 ? 549  ASP A C     1 
ATOM   2512 O  O     . ASP C 3 245 ? -5.84900  62.14100  12.51700  1.000 26.71699 ? 549  ASP A O     1 
ATOM   2513 C  CB    . ASP C 3 245 ? -6.73900  59.82100  10.75300  1.000 24.60528 ? 549  ASP A CB    1 
ATOM   2514 C  CG    . ASP C 3 245 ? -7.06500  59.52100  9.31700   1.000 25.64133 ? 549  ASP A CG    1 
ATOM   2515 O  OD1   . ASP C 3 245 ? -6.50100  60.17700  8.41200   1.000 26.91788 ? 549  ASP A OD1   1 
ATOM   2516 O  OD2   . ASP C 3 245 ? -7.89700  58.62600  9.09900   1.000 24.21318 ? 549  ASP A OD2   1 
ATOM   2517 N  N     . LEU C 3 246 ? -4.51700  60.47500  13.21100  1.000 25.29558 ? 550  LEU A N     1 
ATOM   2518 C  CA    . LEU C 3 246 ? -4.36800  61.04300  14.54300  1.000 32.08811 ? 550  LEU A CA    1 
ATOM   2519 C  C     . LEU C 3 246 ? -3.54500  62.33000  14.49000  1.000 29.24408 ? 550  LEU A C     1 
ATOM   2520 O  O     . LEU C 3 246 ? -2.56000  62.40300  13.74900  1.000 24.33987 ? 550  LEU A O     1 
ATOM   2521 C  CB    . LEU C 3 246 ? -3.69500  60.03300  15.46900  1.000 27.88697 ? 550  LEU A CB    1 
ATOM   2522 C  CG    . LEU C 3 246 ? -4.60300  58.93100  16.01800  1.000 22.48521 ? 550  LEU A CG    1 
ATOM   2523 C  CD1   . LEU C 3 246 ? -3.82600  57.98200  16.90400  1.000 20.44962 ? 550  LEU A CD1   1 
ATOM   2524 C  CD2   . LEU C 3 246 ? -5.77000  59.54200  16.77500  1.000 31.13977 ? 550  LEU A CD2   1 
ATOM   2525 N  N     . PRO C 3 247 ? -3.91600  63.35400  15.26700  1.000 30.66881 ? 551  PRO A N     1 
ATOM   2526 C  CA    . PRO C 3 247 ? -3.09000  64.57100  15.33000  1.000 32.40989 ? 551  PRO A CA    1 
ATOM   2527 C  C     . PRO C 3 247 ? -1.69200  64.26200  15.85100  1.000 30.68025 ? 551  PRO A C     1 
ATOM   2528 O  O     . PRO C 3 247 ? -1.52200  63.68200  16.92300  1.000 32.31361 ? 551  PRO A O     1 
ATOM   2529 C  CB    . PRO C 3 247 ? -3.84900  65.48700  16.30000  1.000 33.06392 ? 551  PRO A CB    1 
ATOM   2530 C  CG    . PRO C 3 247 ? -4.94200  64.68800  16.89600  1.000 35.87564 ? 551  PRO A CG    1 
ATOM   2531 C  CD    . PRO C 3 247 ? -5.02300  63.34900  16.23900  1.000 27.31400 ? 551  PRO A CD    1 
ATOM   2532 N  N     . GLY C 3 248 ? -0.68600  64.66800  15.09300  1.000 28.88991 ? 552  GLY A N     1 
ATOM   2533 C  CA    . GLY C 3 248 ? 0.67100   64.47500  15.52500  1.000 26.62408 ? 552  GLY A CA    1 
ATOM   2534 C  C     . GLY C 3 248 ? 1.29800   63.17600  15.08500  1.000 26.81125 ? 552  GLY A C     1 
ATOM   2535 O  O     . GLY C 3 248 ? 2.44800   62.91400  15.45000  1.000 31.03106 ? 552  GLY A O     1 
ATOM   2536 N  N     . VAL C 3 249 ? 0.59300   62.35800  14.31000  1.000 22.42603 ? 553  VAL A N     1 
ATOM   2537 C  CA    . VAL C 3 249 ? 1.15500   61.14400  13.73000  1.000 21.42057 ? 553  VAL A CA    1 
ATOM   2538 C  C     . VAL C 3 249 ? 1.36600   61.39900  12.24200  1.000 25.44011 ? 553  VAL A C     1 
ATOM   2539 O  O     . VAL C 3 249 ? 0.41300   61.37900  11.45300  1.000 26.19816 ? 553  VAL A O     1 
ATOM   2540 C  CB    . VAL C 3 249 ? 0.25500   59.92500  13.95400  1.000 27.50221 ? 553  VAL A CB    1 
ATOM   2541 C  CG1   . VAL C 3 249 ? 0.86900   58.70400  13.27400  1.000 18.41015 ? 553  VAL A CG1   1 
ATOM   2542 C  CG2   . VAL C 3 249 ? 0.04500   59.67900  15.43700  1.000 25.65238 ? 553  VAL A CG2   1 
ATOM   2543 N  N     . GLY C 3 250 ? 2.61300   61.63600  11.84800  1.000 24.48686 ? 554  GLY A N     1 
ATOM   2544 C  CA    . GLY C 3 250 ? 3.00200   61.68000  10.45700  1.000 25.45698 ? 554  GLY A CA    1 
ATOM   2545 C  C     . GLY C 3 250 ? 3.69900   60.39900  10.03300  1.000 27.50740 ? 554  GLY A C     1 
ATOM   2546 O  O     . GLY C 3 250 ? 3.65500   59.37700  10.72600  1.000 25.12161 ? 554  GLY A O     1 
ATOM   2547 N  N     . HIS C 3 251 ? 4.38100   60.46500  8.88700   1.000 27.06996 ? 555  HIS A N     1 
ATOM   2548 C  CA    . HIS C 3 251 ? 4.97000   59.26200  8.30400   1.000 28.50764 ? 555  HIS A CA    1 
ATOM   2549 C  C     . HIS C 3 251 ? 5.93700   58.58100  9.27200   1.000 29.80222 ? 555  HIS A C     1 
ATOM   2550 O  O     . HIS C 3 251 ? 5.96100   57.34700  9.38000   1.000 24.09375 ? 555  HIS A O     1 
ATOM   2551 C  CB    . HIS C 3 251 ? 5.68300   59.61700  7.00100   1.000 28.69301 ? 555  HIS A CB    1 
ATOM   2552 C  CG    . HIS C 3 251 ? 7.05900   60.18500  7.20500   1.000 41.80426 ? 555  HIS A CG    1 
ATOM   2553 N  ND1   . HIS C 3 251 ? 7.29100   61.53300  7.39200   1.000 45.24570 ? 555  HIS A ND1   1 
ATOM   2554 C  CD2   . HIS C 3 251 ? 8.27300   59.58100  7.28300   1.000 39.18188 ? 555  HIS A CD2   1 
ATOM   2555 C  CE1   . HIS C 3 251 ? 8.58700   61.73600  7.56000   1.000 48.06485 ? 555  HIS A CE1   1 
ATOM   2556 N  NE2   . HIS C 3 251 ? 9.20500   60.56900  7.50100   1.000 44.95374 ? 555  HIS A NE2   1 
ATOM   2557 N  N     . SER C 3 252 ? 6.72000   59.36800  10.00300  1.000 24.97973 ? 556  SER A N     1 
ATOM   2558 C  CA    A SER C 3 252 ? 7.73700   58.79500  10.87400  0.540 28.56628 ? 556  SER A CA    1 
ATOM   2559 C  CA    B SER C 3 252 ? 7.73700   58.79400  10.87600  0.460 28.57386 ? 556  SER A CA    1 
ATOM   2560 C  C     . SER C 3 252 ? 7.10100   58.10100  12.07200  1.000 27.05624 ? 556  SER A C     1 
ATOM   2561 O  O     . SER C 3 252 ? 7.46600   56.96900  12.41300  1.000 26.49783 ? 556  SER A O     1 
ATOM   2562 C  CB    A SER C 3 252 ? 8.71000   59.88800  11.31900  0.540 30.19637 ? 556  SER A CB    1 
ATOM   2563 C  CB    B SER C 3 252 ? 8.71300   59.87900  11.33700  0.460 30.19447 ? 556  SER A CB    1 
ATOM   2564 O  OG    A SER C 3 252 ? 9.33400   59.56200  12.54200  0.540 26.06991 ? 556  SER A OG    1 
ATOM   2565 O  OG    B SER C 3 252 ? 9.53100   60.32000  10.26700  0.460 31.19065 ? 556  SER A OG    1 
ATOM   2566 N  N     . THR C 3 253 ? 6.15000   58.76700  12.72700  1.000 22.84966 ? 557  THR A N     1 
ATOM   2567 C  CA    . THR C 3 253 ? 5.44200   58.11700  13.82100  1.000 28.92043 ? 557  THR A CA    1 
ATOM   2568 C  C     . THR C 3 253 ? 4.61700   56.94100  13.30800  1.000 21.67132 ? 557  THR A C     1 
ATOM   2569 O  O     . THR C 3 253 ? 4.57700   55.87900  13.94000  1.000 26.85168 ? 557  THR A O     1 
ATOM   2570 C  CB    . THR C 3 253 ? 4.54600   59.12400  14.54600  1.000 25.60173 ? 557  THR A CB    1 
ATOM   2571 O  OG1   . THR C 3 253 ? 5.29700   60.29900  14.87900  1.000 30.12041 ? 557  THR A OG1   1 
ATOM   2572 C  CG2   . THR C 3 253 ? 4.00300   58.51200  15.80400  1.000 22.53622 ? 557  THR A CG2   1 
ATOM   2573 N  N     . LEU C 3 254 ? 3.94700   57.11900  12.16800  1.000 23.59385 ? 558  LEU A N     1 
ATOM   2574 C  CA    . LEU C 3 254 ? 3.24300   56.01100  11.52900  1.000 22.18802 ? 558  LEU A CA    1 
ATOM   2575 C  C     . LEU C 3 254 ? 4.14700   54.79300  11.41000  1.000 23.54098 ? 558  LEU A C     1 
ATOM   2576 O  O     . LEU C 3 254 ? 3.79600   53.69500  11.85000  1.000 21.85193 ? 558  LEU A O     1 
ATOM   2577 C  CB    . LEU C 3 254 ? 2.74700   56.44400  10.14900  1.000 21.71473 ? 558  LEU A CB    1 
ATOM   2578 C  CG    . LEU C 3 254 ? 1.84700   55.52200  9.30300   1.000 28.57404 ? 558  LEU A CG    1 
ATOM   2579 C  CD1   . LEU C 3 254 ? 2.67100   54.61700  8.42500   1.000 30.01737 ? 558  LEU A CD1   1 
ATOM   2580 C  CD2   . LEU C 3 254 ? 0.86600   54.70400  10.15200  1.000 20.32454 ? 558  LEU A CD2   1 
ATOM   2581 N  N     . SER C 3 255 ? 5.33700   54.98700  10.84700  1.000 25.08801 ? 559  SER A N     1 
ATOM   2582 C  CA    A SER C 3 255 ? 6.22500   53.85900  10.60800  0.430 26.59261 ? 559  SER A CA    1 
ATOM   2583 C  CA    B SER C 3 255 ? 6.25400   53.87400  10.61100  0.570 26.59868 ? 559  SER A CA    1 
ATOM   2584 C  C     . SER C 3 255 ? 6.61000   53.16200  11.90900  1.000 24.61310 ? 559  SER A C     1 
ATOM   2585 O  O     . SER C 3 255 ? 6.65700   51.92700  11.95900  1.000 27.26784 ? 559  SER A O     1 
ATOM   2586 C  CB    A SER C 3 255 ? 7.45500   54.33300  9.83800   0.430 28.59639 ? 559  SER A CB    1 
ATOM   2587 C  CB    B SER C 3 255 ? 7.51600   54.38600  9.91000   0.570 28.62888 ? 559  SER A CB    1 
ATOM   2588 O  OG    A SER C 3 255 ? 7.05700   54.92700  8.60900   0.430 26.87374 ? 559  SER A OG    1 
ATOM   2589 O  OG    B SER C 3 255 ? 8.45100   53.34700  9.64900   0.570 22.49473 ? 559  SER A OG    1 
ATOM   2590 N  N     . ARG C 3 256 ? 6.85300   53.92600  12.98000  1.000 23.63829 ? 560  ARG A N     1 
ATOM   2591 C  CA    . ARG C 3 256 ? 7.19900   53.31300  14.26500  1.000 27.34602 ? 560  ARG A CA    1 
ATOM   2592 C  C     . ARG C 3 256 ? 6.03100   52.53300  14.85100  1.000 29.84449 ? 560  ARG A C     1 
ATOM   2593 O  O     . ARG C 3 256 ? 6.22200   51.46900  15.46000  1.000 25.36942 ? 560  ARG A O     1 
ATOM   2594 C  CB    . ARG C 3 256 ? 7.64000   54.37800  15.26700  1.000 30.03609 ? 560  ARG A CB    1 
ATOM   2595 C  CG    . ARG C 3 256 ? 8.91500   55.10500  14.89800  1.000 28.85579 ? 560  ARG A CG    1 
ATOM   2596 C  CD    . ARG C 3 256 ? 9.07200   56.36500  15.72800  1.000 32.49555 ? 560  ARG A CD    1 
ATOM   2597 N  NE    . ARG C 3 256 ? 10.46700  56.78100  15.78800  1.000 38.60563 ? 560  ARG A NE    1 
ATOM   2598 C  CZ    . ARG C 3 256 ? 11.06800  57.24000  16.88000  1.000 55.71950 ? 560  ARG A CZ    1 
ATOM   2599 N  NH1   . ARG C 3 256 ? 12.35200  57.58200  16.82700  1.000 62.41805 ? 560  ARG A NH1   1 
ATOM   2600 N  NH2   . ARG C 3 256 ? 10.38700  57.36700  18.01800  1.000 44.40693 ? 560  ARG A NH2   1 
ATOM   2601 N  N     . LEU C 3 257 ? 4.81700   53.07200  14.71800  1.000 27.69277 ? 561  LEU A N     1 
ATOM   2602 C  CA    . LEU C 3 257 ? 3.63900   52.38000  15.21800  1.000 23.70045 ? 561  LEU A CA    1 
ATOM   2603 C  C     . LEU C 3 257 ? 3.45900   51.04300  14.51800  1.000 20.96824 ? 561  LEU A C     1 
ATOM   2604 O  O     . LEU C 3 257 ? 3.03300   50.06300  15.13000  1.000 21.33130 ? 561  LEU A O     1 
ATOM   2605 C  CB    . LEU C 3 257 ? 2.40800   53.25500  15.01200  1.000 25.93808 ? 561  LEU A CB    1 
ATOM   2606 C  CG    . LEU C 3 257 ? 2.31500   54.46300  15.93300  1.000 25.64976 ? 561  LEU A CG    1 
ATOM   2607 C  CD1   . LEU C 3 257 ? 1.08100   55.25700  15.57600  1.000 21.57310 ? 561  LEU A CD1   1 
ATOM   2608 C  CD2   . LEU C 3 257 ? 2.26200   53.99300  17.36500  1.000 14.31841 ? 561  LEU A CD2   1 
ATOM   2609 N  N     . GLU C 3 258 ? 3.76200   50.99600  13.22400  1.000 22.17706 ? 562  GLU A N     1 
ATOM   2610 C  CA    . GLU C 3 258 ? 3.56200   49.77000  12.46500  1.000 27.18799 ? 562  GLU A CA    1 
ATOM   2611 C  C     . GLU C 3 258 ? 4.53800   48.69000  12.91500  1.000 30.12969 ? 562  GLU A C     1 
ATOM   2612 O  O     . GLU C 3 258 ? 4.13100   47.57000  13.24500  1.000 35.25944 ? 562  GLU A O     1 
ATOM   2613 C  CB    . GLU C 3 258 ? 3.71000   50.06300  10.97200  1.000 21.68661 ? 562  GLU A CB    1 
ATOM   2614 C  CG    . GLU C 3 258 ? 2.44300   50.59900  10.35100  1.000 28.70010 ? 562  GLU A CG    1 
ATOM   2615 C  CD    . GLU C 3 258 ? 2.64400   51.11300  8.94600   1.000 29.56382 ? 562  GLU A CD    1 
ATOM   2616 O  OE1   . GLU C 3 258 ? 3.80600   51.15400  8.48000   1.000 35.19680 ? 562  GLU A OE1   1 
ATOM   2617 O  OE2   . GLU C 3 258 ? 1.63000   51.49900  8.32100   1.000 31.51118 ? 562  GLU A OE2   1 
ATOM   2618 N  N     . SER C 3 259 ? 5.82900   49.02300  12.95800  1.000 25.08622 ? 563  SER A N     1 
ATOM   2619 C  CA    . SER C 3 259 ? 6.82900   48.07800  13.44900  1.000 34.69070 ? 563  SER A CA    1 
ATOM   2620 C  C     . SER C 3 259 ? 6.48800   47.58100  14.85100  1.000 30.38518 ? 563  SER A C     1 
ATOM   2621 O  O     . SER C 3 259 ? 6.53600   46.37500  15.12800  1.000 36.26119 ? 563  SER A O     1 
ATOM   2622 C  CB    . SER C 3 259 ? 8.20500   48.74000  13.42800  1.000 32.21106 ? 563  SER A CB    1 
ATOM   2623 O  OG    . SER C 3 259 ? 9.20600   47.81500  13.79300  1.000 41.45449 ? 563  SER A OG    1 
ATOM   2624 N  N     . THR C 3 260 ? 6.09800   48.49100  15.73400  1.000 25.70896 ? 564  THR A N     1 
ATOM   2625 C  CA    . THR C 3 260 ? 5.84900   48.12300  17.11800  1.000 29.01126 ? 564  THR A CA    1 
ATOM   2626 C  C     . THR C 3 260 ? 4.63700   47.21200  17.26600  1.000 30.51392 ? 564  THR A C     1 
ATOM   2627 O  O     . THR C 3 260 ? 4.68000   46.24100  18.02900  1.000 25.01115 ? 564  THR A O     1 
ATOM   2628 C  CB    . THR C 3 260 ? 5.66400   49.37800  17.95300  1.000 25.86387 ? 564  THR A CB    1 
ATOM   2629 O  OG1   . THR C 3 260 ? 6.75900   50.26800  17.69600  1.000 38.34089 ? 564  THR A OG1   1 
ATOM   2630 C  CG2   . THR C 3 260 ? 5.63500   49.01400  19.40700  1.000 16.79564 ? 564  THR A CG2   1 
ATOM   2631 N  N     . PHE C 3 261 ? 3.52700   47.53800  16.58800  1.000 23.45526 ? 565  PHE A N     1 
ATOM   2632 C  CA    . PHE C 3 261 ? 2.25100   46.86300  16.80200  1.000 21.69473 ? 565  PHE A CA    1 
ATOM   2633 C  C     . PHE C 3 261 ? 1.81100   46.05400  15.58800  1.000 26.47718 ? 565  PHE A C     1 
ATOM   2634 O  O     . PHE C 3 261 ? 0.61400   45.94700  15.30900  1.000 22.41210 ? 565  PHE A O     1 
ATOM   2635 C  CB    . PHE C 3 261 ? 1.15100   47.85900  17.17200  1.000 26.78795 ? 565  PHE A CB    1 
ATOM   2636 C  CG    . PHE C 3 261 ? 1.42800   48.62600  18.42200  1.000 27.94584 ? 565  PHE A CG    1 
ATOM   2637 C  CD1   . PHE C 3 261 ? 1.34400   48.00800  19.67000  1.000 27.47252 ? 565  PHE A CD1   1 
ATOM   2638 C  CD2   . PHE C 3 261 ? 1.78100   49.96200  18.35600  1.000 19.99798 ? 565  PHE A CD2   1 
ATOM   2639 C  CE1   . PHE C 3 261 ? 1.60600   48.71600  20.83400  1.000 24.03814 ? 565  PHE A CE1   1 
ATOM   2640 C  CE2   . PHE C 3 261 ? 2.04800   50.68800  19.52300  1.000 29.29591 ? 565  PHE A CE2   1 
ATOM   2641 C  CZ    . PHE C 3 261 ? 1.96200   50.06600  20.75900  1.000 29.94837 ? 565  PHE A CZ    1 
ATOM   2642 N  N     . ASP C 3 262 ? 2.76700   45.50800  14.84500  1.000 26.32900 ? 566  ASP A N     1 
ATOM   2643 C  CA    . ASP C 3 262 ? 2.47000   44.51600  13.81500  1.000 32.05886 ? 566  ASP A CA    1 
ATOM   2644 C  C     . ASP C 3 262 ? 1.50600   45.06100  12.75900  1.000 32.39389 ? 566  ASP A C     1 
ATOM   2645 O  O     . ASP C 3 262 ? 0.55500   44.39000  12.35000  1.000 30.23644 ? 566  ASP A O     1 
ATOM   2646 C  CB    . ASP C 3 262 ? 1.92500   43.23800  14.45200  1.000 36.80112 ? 566  ASP A CB    1 
ATOM   2647 C  CG    . ASP C 3 262 ? 1.92400   42.07000  13.49400  1.000 44.98206 ? 566  ASP A CG    1 
ATOM   2648 O  OD1   . ASP C 3 262 ? 2.87100   41.98200  12.67700  1.000 38.00849 ? 566  ASP A OD1   1 
ATOM   2649 O  OD2   . ASP C 3 262 ? 0.97100   41.25600  13.55900  1.000 36.47628 ? 566  ASP A OD2   1 
ATOM   2650 N  N     . SER C 3 263 ? 1.75400   46.29800  12.32600  1.000 28.28312 ? 567  SER A N     1 
ATOM   2651 C  CA    . SER C 3 263 ? 1.03400   46.96800  11.24900  1.000 29.99672 ? 567  SER A CA    1 
ATOM   2652 C  C     . SER C 3 263 ? -0.47500  47.01600  11.47200  1.000 25.33218 ? 567  SER A C     1 
ATOM   2653 O  O     . SER C 3 263 ? -1.22500  46.42500  10.68600  1.000 20.65414 ? 567  SER A O     1 
ATOM   2654 C  CB    . SER C 3 263 ? 1.32100   46.29400  9.90000   1.000 32.08915 ? 567  SER A CB    1 
ATOM   2655 O  OG    . SER C 3 263 ? 2.67200   45.87300  9.77900   1.000 32.89819 ? 567  SER A OG    1 
ATOM   2656 N  N     . PRO C 3 264 ? -0.96100  47.71400  12.50100  1.000 22.39515 ? 568  PRO A N     1 
ATOM   2657 C  CA    . PRO C 3 264 ? -2.39500  48.03500  12.54200  1.000 22.24611 ? 568  PRO A CA    1 
ATOM   2658 C  C     . PRO C 3 264 ? -2.78800  48.76100  11.26200  1.000 20.07484 ? 568  PRO A C     1 
ATOM   2659 O  O     . PRO C 3 264 ? -2.01300  49.55000  10.72900  1.000 18.72973 ? 568  PRO A O     1 
ATOM   2660 C  CB    . PRO C 3 264 ? -2.52400  48.95200  13.76800  1.000 18.24087 ? 568  PRO A CB    1 
ATOM   2661 C  CG    . PRO C 3 264 ? -1.19300  48.79800  14.52700  1.000 21.79001 ? 568  PRO A CG    1 
ATOM   2662 C  CD    . PRO C 3 264 ? -0.19100  48.50700  13.47500  1.000 20.75153 ? 568  PRO A CD    1 
ATOM   2663 N  N     . HIS C 3 265 ? -3.98500  48.47100  10.74300  1.000 22.27576 ? 569  HIS A N     1 
ATOM   2664 C  CA    . HIS C 3 265 ? -4.45900  49.14500  9.53600   1.000 19.46939 ? 569  HIS A CA    1 
ATOM   2665 C  C     . HIS C 3 265 ? -5.60800  50.10200  9.80900   1.000 21.44180 ? 569  HIS A C     1 
ATOM   2666 O  O     . HIS C 3 265 ? -6.18900  50.64700  8.86300   1.000 24.66336 ? 569  HIS A O     1 
ATOM   2667 C  CB    . HIS C 3 265 ? -4.85800  48.12500  8.46800   1.000 20.15642 ? 569  HIS A CB    1 
ATOM   2668 C  CG    . HIS C 3 265 ? -3.71500  47.27100  8.03200   1.000 20.89677 ? 569  HIS A CG    1 
ATOM   2669 N  ND1   . HIS C 3 265 ? -2.63400  47.77900  7.34900   1.000 22.57731 ? 569  HIS A ND1   1 
ATOM   2670 C  CD2   . HIS C 3 265 ? -3.44600  45.96100  8.24500   1.000 22.05929 ? 569  HIS A CD2   1 
ATOM   2671 C  CE1   . HIS C 3 265 ? -1.75600  46.81500  7.13900   1.000 18.69306 ? 569  HIS A CE1   1 
ATOM   2672 N  NE2   . HIS C 3 265 ? -2.22700  45.70200  7.67000   1.000 23.11049 ? 569  HIS A NE2   1 
ATOM   2673 N  N     . SER C 3 266 ? -5.94000  50.32700  11.07500  1.000 19.64732 ? 570  SER A N     1 
ATOM   2674 C  CA    . SER C 3 266 ? -6.97800  51.27800  11.43100  1.000 18.94308 ? 570  SER A CA    1 
ATOM   2675 C  C     . SER C 3 266 ? -6.75400  51.67700  12.87800  1.000 19.31688 ? 570  SER A C     1 
ATOM   2676 O  O     . SER C 3 266 ? -6.05000  50.99100  13.62200  1.000 19.54244 ? 570  SER A O     1 
ATOM   2677 C  CB    . SER C 3 266 ? -8.38100  50.68800  11.24600  1.000 19.87060 ? 570  SER A CB    1 
ATOM   2678 O  OG    . SER C 3 266 ? -8.72600  49.89100  12.36400  1.000 20.25332 ? 570  SER A OG    1 
ATOM   2679 N  N     . LEU C 3 267 ? -7.34600  52.81000  13.26800  1.000 22.33812 ? 571  LEU A N     1 
ATOM   2680 C  CA    . LEU C 3 267 ? -7.31800  53.17400  14.68100  1.000 17.50941 ? 571  LEU A CA    1 
ATOM   2681 C  C     . LEU C 3 267 ? -7.95200  52.08800  15.55000  1.000 20.93960 ? 571  LEU A C     1 
ATOM   2682 O  O     . LEU C 3 267 ? -7.55500  51.90800  16.70500  1.000 26.83361 ? 571  LEU A O     1 
ATOM   2683 C  CB    . LEU C 3 267 ? -8.01100  54.52600  14.90000  1.000 18.09289 ? 571  LEU A CB    1 
ATOM   2684 C  CG    . LEU C 3 267 ? -7.19800  55.73500  14.40400  1.000 15.62852 ? 571  LEU A CG    1 
ATOM   2685 C  CD1   . LEU C 3 267 ? -7.85800  57.07200  14.80600  1.000 16.84541 ? 571  LEU A CD1   1 
ATOM   2686 C  CD2   . LEU C 3 267 ? -5.76300  55.64700  14.93400  1.000 17.78145 ? 571  LEU A CD2   1 
ATOM   2687 N  N     . ASN C 3 268 ? -8.92400  51.34600  15.01600  1.000 20.19939 ? 572  ASN A N     1 
ATOM   2688 C  CA    . ASN C 3 268 ? -9.50900  50.26100  15.79400  1.000 20.38826 ? 572  ASN A CA    1 
ATOM   2689 C  C     . ASN C 3 268 ? -8.47900  49.17500  16.08500  1.000 20.83786 ? 572  ASN A C     1 
ATOM   2690 O  O     . ASN C 3 268 ? -8.37400  48.69700  17.21700  1.000 26.99220 ? 572  ASN A O     1 
ATOM   2691 C  CB    . ASN C 3 268 ? -10.71700 49.67100  15.06600  1.000 19.95074 ? 572  ASN A CB    1 
ATOM   2692 C  CG    . ASN C 3 268 ? -11.52600 48.77000  15.96200  1.000 26.27971 ? 572  ASN A CG    1 
ATOM   2693 O  OD1   . ASN C 3 268 ? -12.19300 49.24400  16.88100  1.000 31.60826 ? 572  ASN A OD1   1 
ATOM   2694 N  ND2   . ASN C 3 268 ? -11.44000 47.46700  15.73800  1.000 29.12920 ? 572  ASN A ND2   1 
ATOM   2695 N  N     . ASP C 3 269 ? -7.71400  48.76900  15.06700  1.000 20.23900 ? 573  ASP A N     1 
ATOM   2696 C  CA    . ASP C 3 269 ? -6.65800  47.78200  15.26900  1.000 20.68222 ? 573  ASP A CA    1 
ATOM   2697 C  C     . ASP C 3 269 ? -5.68100  48.25900  16.33300  1.000 22.53141 ? 573  ASP A C     1 
ATOM   2698 O  O     . ASP C 3 269 ? -5.29100  47.50200  17.22700  1.000 21.21266 ? 573  ASP A O     1 
ATOM   2699 C  CB    . ASP C 3 269 ? -5.89600  47.53700  13.96900  1.000 20.87708 ? 573  ASP A CB    1 
ATOM   2700 C  CG    . ASP C 3 269 ? -6.68500  46.77600  12.93200  1.000 25.22408 ? 573  ASP A CG    1 
ATOM   2701 O  OD1   . ASP C 3 269 ? -7.77800  46.22700  13.21500  1.000 19.85988 ? 573  ASP A OD1   1 
ATOM   2702 O  OD2   . ASP C 3 269 ? -6.16900  46.72900  11.79400  1.000 24.41406 ? 573  ASP A OD2   1 
ATOM   2703 N  N     . LEU C 3 270 ? -5.25400  49.51700  16.22700  1.000 21.42653 ? 574  LEU A N     1 
ATOM   2704 C  CA    . LEU C 3 270 ? -4.31500  50.06800  17.19300  1.000 22.06698 ? 574  LEU A CA    1 
ATOM   2705 C  C     . LEU C 3 270 ? -4.91000  50.03600  18.58900  1.000 24.43637 ? 574  LEU A C     1 
ATOM   2706 O  O     . LEU C 3 270 ? -4.24700  49.63200  19.55000  1.000 25.81479 ? 574  LEU A O     1 
ATOM   2707 C  CB    . LEU C 3 270 ? -3.93900  51.50000  16.79800  1.000 23.34382 ? 574  LEU A CB    1 
ATOM   2708 C  CG    . LEU C 3 270 ? -2.86500  52.24500  17.60800  1.000 20.51568 ? 574  LEU A CG    1 
ATOM   2709 C  CD1   . LEU C 3 270 ? -1.60000  51.41800  17.77000  1.000 22.00064 ? 574  LEU A CD1   1 
ATOM   2710 C  CD2   . LEU C 3 270 ? -2.54100  53.55600  16.95400  1.000 17.98531 ? 574  LEU A CD2   1 
ATOM   2711 N  N     . ARG C 3 271 ? -6.17400  50.44800  18.70900  1.000 23.71270 ? 575  ARG A N     1 
ATOM   2712 C  CA    . ARG C 3 271 ? -6.81400  50.57300  20.01400  1.000 26.26331 ? 575  ARG A CA    1 
ATOM   2713 C  C     . ARG C 3 271 ? -6.88800  49.23700  20.72600  1.000 27.18830 ? 575  ARG A C     1 
ATOM   2714 O  O     . ARG C 3 271 ? -6.81700  49.18000  21.96200  1.000 27.99527 ? 575  ARG A O     1 
ATOM   2715 C  CB    . ARG C 3 271 ? -8.22000  51.15900  19.85400  1.000 30.90854 ? 575  ARG A CB    1 
ATOM   2716 C  CG    . ARG C 3 271 ? -8.44000  52.44000  20.65100  1.000 35.74221 ? 575  ARG A CG    1 
ATOM   2717 C  CD    . ARG C 3 271 ? -9.77600  53.11300  20.31500  1.000 30.59905 ? 575  ARG A CD    1 
ATOM   2718 N  NE    . ARG C 3 271 ? -10.90800 52.23800  20.57700  1.000 42.09545 ? 575  ARG A NE    1 
ATOM   2719 C  CZ    . ARG C 3 271 ? -11.48700 52.10300  21.76600  1.000 39.21037 ? 575  ARG A CZ    1 
ATOM   2720 N  NH1   . ARG C 3 271 ? -11.04600 52.79500  22.80500  1.000 40.66882 ? 575  ARG A NH1   1 
ATOM   2721 N  NH2   . ARG C 3 271 ? -12.51000 51.27100  21.91300  1.000 39.28872 ? 575  ARG A NH2   1 
ATOM   2722 N  N     . LYS C 3 272 ? -7.02800  48.15500  19.96700  1.000 25.73775 ? 576  LYS A N     1 
ATOM   2723 C  CA    . LYS C 3 272 ? -7.18000  46.85000  20.58300  1.000 32.25057 ? 576  LYS A CA    1 
ATOM   2724 C  C     . LYS C 3 272 ? -5.84600  46.22300  20.94800  1.000 23.60308 ? 576  LYS A C     1 
ATOM   2725 O  O     . LYS C 3 272 ? -5.81000  45.39500  21.85500  1.000 27.79249 ? 576  LYS A O     1 
ATOM   2726 C  CB    . LYS C 3 272 ? -7.97900  45.93500  19.65700  1.000 25.88726 ? 576  LYS A CB    1 
ATOM   2727 C  CG    . LYS C 3 272 ? -9.36900  46.48500  19.33100  1.000 27.96893 ? 576  LYS A CG    1 
ATOM   2728 C  CD    . LYS C 3 272 ? -10.08400 45.64600  18.27000  1.000 35.16510 ? 576  LYS A CD    1 
ATOM   2729 C  CE    . LYS C 3 272 ? -11.03700 44.63100  18.89900  1.000 40.19938 ? 576  LYS A CE    1 
ATOM   2730 N  NZ    . LYS C 3 272 ? -12.19800 44.31600  18.01300  1.000 43.60239 ? 576  LYS A NZ    1 
ATOM   2731 N  N     . ARG C 3 273 ? -4.75000  46.62600  20.29500  1.000 26.92256 ? 577  ARG A N     1 
ATOM   2732 C  CA    . ARG C 3 273 ? -3.45100  46.00100  20.51100  1.000 30.29735 ? 577  ARG A CA    1 
ATOM   2733 C  C     . ARG C 3 273 ? -2.54100  46.75100  21.47700  1.000 31.53028 ? 577  ARG A C     1 
ATOM   2734 O  O     . ARG C 3 273 ? -1.62300  46.13900  22.03000  1.000 36.24307 ? 577  ARG A O     1 
ATOM   2735 C  CB    . ARG C 3 273 ? -2.69700  45.84100  19.18300  1.000 27.69801 ? 577  ARG A CB    1 
ATOM   2736 C  CG    . ARG C 3 273 ? -3.49400  45.18700  18.08000  1.000 32.41533 ? 577  ARG A CG    1 
ATOM   2737 C  CD    . ARG C 3 273 ? -2.80100  45.35100  16.75700  1.000 23.96125 ? 577  ARG A CD    1 
ATOM   2738 N  NE    . ARG C 3 273 ? -3.57200  44.73900  15.68700  1.000 22.46589 ? 577  ARG A NE    1 
ATOM   2739 C  CZ    . ARG C 3 273 ? -3.08600  44.46700  14.48200  1.000 25.51213 ? 577  ARG A CZ    1 
ATOM   2740 N  NH1   . ARG C 3 273 ? -1.81900  44.74300  14.18200  1.000 24.32065 ? 577  ARG A NH1   1 
ATOM   2741 N  NH2   . ARG C 3 273 ? -3.87000  43.90300  13.58000  1.000 31.44011 ? 577  ARG A NH2   1 
ATOM   2742 N  N     . TYR C 3 274 ? -2.75100  48.03800  21.69800  1.000 34.06792 ? 578  TYR A N     1 
ATOM   2743 C  CA    . TYR C 3 274 ? -1.72400  48.81600  22.37200  1.000 30.27425 ? 578  TYR A CA    1 
ATOM   2744 C  C     . TYR C 3 274 ? -1.83700  48.72700  23.89000  1.000 33.25784 ? 578  TYR A C     1 
ATOM   2745 O  O     . TYR C 3 274 ? -2.88600  48.40000  24.45500  1.000 32.66099 ? 578  TYR A O     1 
ATOM   2746 C  CB    . TYR C 3 274 ? -1.79400  50.28400  21.94700  1.000 29.75039 ? 578  TYR A CB    1 
ATOM   2747 C  CG    . TYR C 3 274 ? -2.74800  51.11900  22.78000  1.000 27.97715 ? 578  TYR A CG    1 
ATOM   2748 C  CD1   . TYR C 3 274 ? -4.12300  50.97000  22.65500  1.000 24.51861 ? 578  TYR A CD1   1 
ATOM   2749 C  CD2   . TYR C 3 274 ? -2.27100  52.06900  23.67800  1.000 27.64479 ? 578  TYR A CD2   1 
ATOM   2750 C  CE1   . TYR C 3 274 ? -5.00200  51.74100  23.41200  1.000 27.52989 ? 578  TYR A CE1   1 
ATOM   2751 C  CE2   . TYR C 3 274 ? -3.13700  52.84600  24.43300  1.000 23.39916 ? 578  TYR A CE2   1 
ATOM   2752 C  CZ    . TYR C 3 274 ? -4.49800  52.67800  24.30300  1.000 25.64392 ? 578  TYR A CZ    1 
ATOM   2753 O  OH    . TYR C 3 274 ? -5.35900  53.45300  25.05700  1.000 26.51898 ? 578  TYR A OH    1 
ATOM   2754 N  N     . THR C 3 275 ? -0.70700  49.00600  24.54000  1.000 38.26794 ? 579  THR A N     1 
ATOM   2755 C  CA    . THR C 3 275 ? -0.61100  49.36000  25.94600  1.000 35.56129 ? 579  THR A CA    1 
ATOM   2756 C  C     . THR C 3 275 ? 0.15800   50.66800  26.03100  1.000 33.28432 ? 579  THR A C     1 
ATOM   2757 O  O     . THR C 3 275 ? 1.12900   50.86700  25.29500  1.000 33.83541 ? 579  THR A O     1 
ATOM   2758 C  CB    . THR C 3 275 ? 0.12400   48.30000  26.75700  1.000 33.43168 ? 579  THR A CB    1 
ATOM   2759 O  OG1   . THR C 3 275 ? 1.53300   48.54000  26.65300  1.000 36.32551 ? 579  THR A OG1   1 
ATOM   2760 C  CG2   . THR C 3 275 ? -0.18400  46.90500  26.23100  1.000 31.60838 ? 579  THR A CG2   1 
ATOM   2761 N  N     . LEU C 3 276 ? -0.27600  51.55000  26.93300  1.000 34.48619 ? 580  LEU A N     1 
ATOM   2762 C  CA    . LEU C 3 276 ? 0.35800   52.85900  27.08100  1.000 34.24511 ? 580  LEU A CA    1 
ATOM   2763 C  C     . LEU C 3 276 ? 1.86900   52.74200  27.20500  1.000 33.81363 ? 580  LEU A C     1 
ATOM   2764 O  O     . LEU C 3 276 ? 2.61300   53.57600  26.66900  1.000 33.93400 ? 580  LEU A O     1 
ATOM   2765 C  CB    . LEU C 3 276 ? -0.23000  53.57500  28.29800  1.000 33.43131 ? 580  LEU A CB    1 
ATOM   2766 C  CG    . LEU C 3 276 ? 0.30300   54.95800  28.67700  1.000 34.40810 ? 580  LEU A CG    1 
ATOM   2767 C  CD1   . LEU C 3 276 ? 0.03100   55.95400  27.57600  1.000 30.75579 ? 580  LEU A CD1   1 
ATOM   2768 C  CD2   . LEU C 3 276 ? -0.34400  55.42400  29.97100  1.000 26.59085 ? 580  LEU A CD2   1 
ATOM   2769 N  N     . ASP C 3 277 ? 2.34100   51.69300  27.88100  1.000 36.05300 ? 581  ASP A N     1 
ATOM   2770 C  CA    . ASP C 3 277 ? 3.77300   51.49400  28.07200  1.000 35.09141 ? 581  ASP A CA    1 
ATOM   2771 C  C     . ASP C 3 277 ? 4.48600   51.33500  26.73700  1.000 38.24561 ? 581  ASP A C     1 
ATOM   2772 O  O     . ASP C 3 277 ? 5.38300   52.11300  26.39100  1.000 40.29479 ? 581  ASP A O     1 
ATOM   2773 C  CB    . ASP C 3 277 ? 4.00500   50.25700  28.94500  1.000 51.35656 ? 581  ASP A CB    1 
ATOM   2774 C  CG    . ASP C 3 277 ? 5.29300   50.32900  29.74200  1.000 57.82966 ? 581  ASP A CG    1 
ATOM   2775 O  OD1   . ASP C 3 277 ? 5.45300   51.29100  30.52100  1.000 59.90132 ? 581  ASP A OD1   1 
ATOM   2776 O  OD2   . ASP C 3 277 ? 6.13400   49.41300  29.60400  1.000 56.79920 ? 581  ASP A OD2   1 
ATOM   2777 N  N     . ALA C 3 278 ? 4.10400   50.31000  25.97800  1.000 37.79986 ? 582  ALA A N     1 
ATOM   2778 C  CA    . ALA C 3 278 ? 4.74600   50.06100  24.69500  1.000 36.76232 ? 582  ALA A CA    1 
ATOM   2779 C  C     . ALA C 3 278 ? 4.56700   51.23600  23.74400  1.000 28.93643 ? 582  ALA A C     1 
ATOM   2780 O  O     . ALA C 3 278 ? 5.45100   51.51700  22.92700  1.000 30.07467 ? 582  ALA A O     1 
ATOM   2781 C  CB    . ALA C 3 278 ? 4.18500   48.77900  24.07800  1.000 31.53393 ? 582  ALA A CB    1 
ATOM   2782 N  N     . LEU C 3 279 ? 3.43000   51.92600  23.82900  1.000 31.90028 ? 583  LEU A N     1 
ATOM   2783 C  CA    . LEU C 3 279 ? 3.19500   53.07300  22.96300  1.000 31.21300 ? 583  LEU A CA    1 
ATOM   2784 C  C     . LEU C 3 279 ? 4.16600   54.20400  23.28500  1.000 27.38828 ? 583  LEU A C     1 
ATOM   2785 O  O     . LEU C 3 279 ? 4.78000   54.78400  22.38200  1.000 27.46989 ? 583  LEU A O     1 
ATOM   2786 C  CB    . LEU C 3 279 ? 1.73900   53.52500  23.10300  1.000 31.64860 ? 583  LEU A CB    1 
ATOM   2787 C  CG    . LEU C 3 279 ? 1.31800   54.76700  22.33200  1.000 24.10553 ? 583  LEU A CG    1 
ATOM   2788 C  CD1   . LEU C 3 279 ? 1.58600   54.57700  20.83900  1.000 26.87139 ? 583  LEU A CD1   1 
ATOM   2789 C  CD2   . LEU C 3 279 ? -0.13800  55.07700  22.60000  1.000 21.35593 ? 583  LEU A CD2   1 
ATOM   2790 N  N     . LYS C 3 280 ? 4.32700   54.52800  24.57200  1.000 33.14662 ? 584  LYS A N     1 
ATOM   2791 C  CA    . LYS C 3 280 ? 5.34600   55.50600  24.94600  1.000 33.28243 ? 584  LYS A CA    1 
ATOM   2792 C  C     . LYS C 3 280 ? 6.72300   55.06000  24.47800  1.000 29.32241 ? 584  LYS A C     1 
ATOM   2793 O  O     . LYS C 3 280 ? 7.51200   55.87000  23.98000  1.000 32.81939 ? 584  LYS A O     1 
ATOM   2794 C  CB    . LYS C 3 280 ? 5.35500   55.72200  26.45800  1.000 32.20727 ? 584  LYS A CB    1 
ATOM   2795 C  CG    . LYS C 3 280 ? 4.27800   56.63700  26.98300  1.000 28.58772 ? 584  LYS A CG    1 
ATOM   2796 C  CD    . LYS C 3 280 ? 4.11200   56.41500  28.47000  1.000 29.17976 ? 584  LYS A CD    1 
ATOM   2797 C  CE    . LYS C 3 280 ? 3.89000   57.71000  29.23700  1.000 40.42054 ? 584  LYS A CE    1 
ATOM   2798 N  NZ    . LYS C 3 280 ? 3.24800   57.44200  30.56700  1.000 32.58111 ? 584  LYS A NZ    1 
ATOM   2799 N  N     . ALA C 3 281 ? 7.02200   53.76600  24.61300  1.000 32.66742 ? 585  ALA A N     1 
ATOM   2800 C  CA    . ALA C 3 281 ? 8.32000   53.26400  24.18300  1.000 31.50412 ? 585  ALA A CA    1 
ATOM   2801 C  C     . ALA C 3 281 ? 8.50600   53.40000  22.68200  1.000 32.39937 ? 585  ALA A C     1 
ATOM   2802 O  O     . ALA C 3 281 ? 9.63200   53.60500  22.21400  1.000 33.97907 ? 585  ALA A O     1 
ATOM   2803 C  CB    . ALA C 3 281 ? 8.48900   51.80500  24.60400  1.000 32.26800 ? 585  ALA A CB    1 
ATOM   2804 N  N     . SER C 3 282 ? 7.42300   53.29200  21.90900  1.000 28.39158 ? 586  SER A N     1 
ATOM   2805 C  CA    . SER C 3 282 ? 7.55100   53.32000  20.45100  1.000 33.00423 ? 586  SER A CA    1 
ATOM   2806 C  C     . SER C 3 282 ? 7.80800   54.73100  19.93000  1.000 31.61670 ? 586  SER A C     1 
ATOM   2807 O  O     . SER C 3 282 ? 8.70400   54.94600  19.10400  1.000 30.47594 ? 586  SER A O     1 
ATOM   2808 C  CB    . SER C 3 282 ? 6.29400   52.74600  19.79500  1.000 30.11564 ? 586  SER A CB    1 
ATOM   2809 O  OG    . SER C 3 282 ? 6.37200   52.86500  18.37700  1.000 32.19530 ? 586  SER A OG    1 
ATOM   2810 N  N     . VAL C 3 283 ? 7.01700   55.70200  20.38300  1.000 29.07247 ? 587  VAL A N     1 
ATOM   2811 C  CA    . VAL C 3 283 ? 6.95700   57.01800  19.76600  1.000 26.86442 ? 587  VAL A CA    1 
ATOM   2812 C  C     . VAL C 3 283 ? 7.25300   58.13900  20.73900  1.000 29.03886 ? 587  VAL A C     1 
ATOM   2813 O  O     . VAL C 3 283 ? 7.21900   59.30600  20.33900  1.000 28.96377 ? 587  VAL A O     1 
ATOM   2814 C  CB    . VAL C 3 283 ? 5.58800   57.25900  19.09900  1.000 24.72909 ? 587  VAL A CB    1 
ATOM   2815 C  CG1   . VAL C 3 283 ? 5.31100   56.18800  18.06300  1.000 31.39578 ? 587  VAL A CG1   1 
ATOM   2816 C  CG2   . VAL C 3 283 ? 4.49700   57.29100  20.15800  1.000 19.36278 ? 587  VAL A CG2   1 
ATOM   2817 N  N     . GLY C 3 284 ? 7.51100   57.83400  22.00700  1.000 27.21904 ? 588  GLY A N     1 
ATOM   2818 C  CA    . GLY C 3 284 ? 7.87600   58.87700  22.94600  1.000 31.20721 ? 588  GLY A CA    1 
ATOM   2819 C  C     . GLY C 3 284 ? 6.86700   59.04800  24.06000  1.000 30.99785 ? 588  GLY A C     1 
ATOM   2820 O  O     . GLY C 3 284 ? 5.71200   58.64700  23.91500  1.000 24.82252 ? 588  GLY A O     1 
ATOM   2821 N  N     . SER C 3 285 ? 7.28300   59.65600  25.17400  1.000 25.64055 ? 589  SER A N     1 
ATOM   2822 C  CA    . SER C 3 285 ? 6.40700   59.72800  26.33900  1.000 29.08915 ? 589  SER A CA    1 
ATOM   2823 C  C     . SER C 3 285 ? 5.22300   60.67200  26.09900  1.000 28.97468 ? 589  SER A C     1 
ATOM   2824 O  O     . SER C 3 285 ? 4.06800   60.29800  26.33100  1.000 27.73727 ? 589  SER A O     1 
ATOM   2825 C  CB    . SER C 3 285 ? 7.21700   60.14600  27.56700  1.000 28.53228 ? 589  SER A CB    1 
ATOM   2826 O  OG    . SER C 3 285 ? 6.42100   60.87100  28.48400  1.000 41.89504 ? 589  SER A OG    1 
ATOM   2827 N  N     . LYS C 3 286 ? 5.48000   61.89800  25.61300  1.000 32.23920 ? 590  LYS A N     1 
ATOM   2828 C  CA    . LYS C 3 286 ? 4.38700   62.86200  25.44500  1.000 33.68171 ? 590  LYS A CA    1 
ATOM   2829 C  C     . LYS C 3 286 ? 3.47100   62.47900  24.28100  1.000 24.42292 ? 590  LYS A C     1 
ATOM   2830 O  O     . LYS C 3 286 ? 2.23900   62.46200  24.42400  1.000 27.20761 ? 590  LYS A O     1 
ATOM   2831 C  CB    . LYS C 3 286 ? 4.94100   64.27900  25.25800  1.000 30.16851 ? 590  LYS A CB    1 
ATOM   2832 C  CG    . LYS C 3 286 ? 5.17300   65.01200  26.58000  1.000 40.80188 ? 590  LYS A CG    1 
ATOM   2833 C  CD    . LYS C 3 286 ? 3.95000   65.83100  27.00300  1.000 37.43089 ? 590  LYS A CD    1 
ATOM   2834 C  CE    . LYS C 3 286 ? 3.90300   66.01800  28.52900  1.000 42.95767 ? 590  LYS A CE    1 
ATOM   2835 N  NZ    . LYS C 3 286 ? 3.34400   67.34500  28.95900  1.000 49.31087 ? 590  LYS A NZ    1 
ATOM   2836 N  N     . LEU C 3 287 ? 4.05100   62.16900  23.12100  1.000 24.94440 ? 591  LEU A N     1 
ATOM   2837 C  CA    . LEU C 3 287 ? 3.23700   61.73100  21.99000  1.000 27.72909 ? 591  LEU A CA    1 
ATOM   2838 C  C     . LEU C 3 287 ? 2.45300   60.47300  22.33200  1.000 26.75167 ? 591  LEU A C     1 
ATOM   2839 O  O     . LEU C 3 287 ? 1.25700   60.37600  22.02200  1.000 24.87502 ? 591  LEU A O     1 
ATOM   2840 C  CB    . LEU C 3 287 ? 4.11700   61.50100  20.76400  1.000 32.98643 ? 591  LEU A CB    1 
ATOM   2841 C  CG    . LEU C 3 287 ? 3.40600   61.25900  19.42600  1.000 28.16166 ? 591  LEU A CG    1 
ATOM   2842 C  CD1   . LEU C 3 287 ? 2.30700   62.30600  19.16600  1.000 18.05223 ? 591  LEU A CD1   1 
ATOM   2843 C  CD2   . LEU C 3 287 ? 4.43700   61.24400  18.29100  1.000 24.10122 ? 591  LEU A CD2   1 
ATOM   2844 N  N     . GLY C 3 288 ? 3.09800   59.51600  23.01200  1.000 26.25607 ? 592  GLY A N     1 
ATOM   2845 C  CA    . GLY C 3 288 ? 2.40300   58.29600  23.39500  1.000 23.57587 ? 592  GLY A CA    1 
ATOM   2846 C  C     . GLY C 3 288 ? 1.19200   58.55800  24.27500  1.000 27.55702 ? 592  GLY A C     1 
ATOM   2847 O  O     . GLY C 3 288 ? 0.11700   57.98100  24.06600  1.000 24.82102 ? 592  GLY A O     1 
ATOM   2848 N  N     . MET C 3 289 ? 1.34100   59.43600  25.26900  1.000 22.52757 ? 593  MET A N     1 
ATOM   2849 C  CA    . MET C 3 289 ? 0.19800   59.75600  26.11600  1.000 25.84928 ? 593  MET A CA    1 
ATOM   2850 C  C     . MET C 3 289 ? -0.89400  60.44800  25.30600  1.000 21.49913 ? 593  MET A C     1 
ATOM   2851 O  O     . MET C 3 289 ? -2.08600  60.19900  25.50800  1.000 22.27193 ? 593  MET A O     1 
ATOM   2852 C  CB    . MET C 3 289 ? 0.64400   60.62300  27.29100  1.000 23.41623 ? 593  MET A CB    1 
ATOM   2853 C  CG    . MET C 3 289 ? -0.47800  60.99200  28.24200  1.000 24.71894 ? 593  MET A CG    1 
ATOM   2854 S  SD    . MET C 3 289 ? -1.10800  59.55800  29.13500  1.000 41.09306 ? 593  MET A SD    1 
ATOM   2855 C  CE    . MET C 3 289 ? -2.48900  60.29000  30.01100  1.000 44.80320 ? 593  MET A CE    1 
ATOM   2856 N  N     . LYS C 3 290 ? -0.49500  61.30200  24.36500  1.000 24.47815 ? 594  LYS A N     1 
ATOM   2857 C  CA    . LYS C 3 290 ? -1.45400  62.00400  23.52600  1.000 21.61914 ? 594  LYS A CA    1 
ATOM   2858 C  C     . LYS C 3 290 ? -2.27100  61.02400  22.68400  1.000 18.45511 ? 594  LYS A C     1 
ATOM   2859 O  O     . LYS C 3 290 ? -3.50500  61.10500  22.62800  1.000 18.16091 ? 594  LYS A O     1 
ATOM   2860 C  CB    . LYS C 3 290 ? -0.70300  63.00300  22.65100  1.000 20.99225 ? 594  LYS A CB    1 
ATOM   2861 C  CG    . LYS C 3 290 ? -1.57900  63.69600  21.61800  1.000 34.01273 ? 594  LYS A CG    1 
ATOM   2862 C  CD    . LYS C 3 290 ? -0.73900  64.35900  20.54400  1.000 32.34031 ? 594  LYS A CD    1 
ATOM   2863 C  CE    . LYS C 3 290 ? -1.59500  65.27700  19.67800  1.000 33.11656 ? 594  LYS A CE    1 
ATOM   2864 N  NZ    . LYS C 3 290 ? -2.53600  66.09000  20.50600  1.000 28.40843 ? 594  LYS A NZ    1 
ATOM   2865 N  N     . ILE C 3 291 ? -1.59600  60.07000  22.04200  1.000 22.79746 ? 595  ILE A N     1 
ATOM   2866 C  CA    . ILE C 3 291 ? -2.29600  59.05200  21.25900  1.000 21.61667 ? 595  ILE A CA    1 
ATOM   2867 C  C     . ILE C 3 291 ? -3.22700  58.24400  22.15100  1.000 21.99903 ? 595  ILE A C     1 
ATOM   2868 O  O     . ILE C 3 291 ? -4.38700  57.99200  21.80400  1.000 19.28246 ? 595  ILE A O     1 
ATOM   2869 C  CB    . ILE C 3 291 ? -1.27600  58.15400  20.53800  1.000 21.89261 ? 595  ILE A CB    1 
ATOM   2870 C  CG1   . ILE C 3 291 ? -0.51500  58.96400  19.48600  1.000 22.90988 ? 595  ILE A CG1   1 
ATOM   2871 C  CG2   . ILE C 3 291 ? -1.94600  56.91500  19.92500  1.000 22.03262 ? 595  ILE A CG2   1 
ATOM   2872 C  CD1   . ILE C 3 291 ? 0.56000   58.14600  18.77000  1.000 22.09455 ? 595  ILE A CD1   1 
ATOM   2873 N  N     . HIS C 3 292 ? -2.73300  57.84700  23.32600  1.000 23.91621 ? 596  HIS A N     1 
ATOM   2874 C  CA    . HIS C 3 292 ? -3.53800  57.10100  24.28600  1.000 20.69361 ? 596  HIS A CA    1 
ATOM   2875 C  C     . HIS C 3 292 ? -4.78300  57.88600  24.68000  1.000 23.14152 ? 596  HIS A C     1 
ATOM   2876 O  O     . HIS C 3 292 ? -5.90200  57.35400  24.66800  1.000 19.03858 ? 596  HIS A O     1 
ATOM   2877 C  CB    . HIS C 3 292 ? -2.66800  56.76500  25.50600  1.000 26.26747 ? 596  HIS A CB    1 
ATOM   2878 C  CG    . HIS C 3 292 ? -3.43700  56.51200  26.76800  1.000 26.79530 ? 596  HIS A CG    1 
ATOM   2879 N  ND1   . HIS C 3 292 ? -4.20200  55.38200  26.96300  1.000 27.81774 ? 596  HIS A ND1   1 
ATOM   2880 C  CD2   . HIS C 3 292 ? -3.53500  57.23600  27.91000  1.000 25.82502 ? 596  HIS A CD2   1 
ATOM   2881 C  CE1   . HIS C 3 292 ? -4.75200  55.42800  28.16400  1.000 31.59429 ? 596  HIS A CE1   1 
ATOM   2882 N  NE2   . HIS C 3 292 ? -4.36900  56.54600  28.75700  1.000 33.21665 ? 596  HIS A NE2   1 
ATOM   2883 N  N     . LEU C 3 293 ? -4.60900  59.15600  25.03900  1.000 19.28777 ? 597  LEU A N     1 
ATOM   2884 C  CA    . LEU C 3 293 ? -5.76600  60.00600  25.28900  1.000 20.72180 ? 597  LEU A CA    1 
ATOM   2885 C  C     . LEU C 3 293 ? -6.66200  60.08000  24.05900  1.000 20.26741 ? 597  LEU A C     1 
ATOM   2886 O  O     . LEU C 3 293 ? -7.88300  59.89400  24.15400  1.000 20.82989 ? 597  LEU A O     1 
ATOM   2887 C  CB    . LEU C 3 293 ? -5.29700  61.39300  25.71600  1.000 22.66309 ? 597  LEU A CB    1 
ATOM   2888 C  CG    . LEU C 3 293 ? -4.71100  61.36000  27.12300  1.000 23.96476 ? 597  LEU A CG    1 
ATOM   2889 C  CD1   . LEU C 3 293 ? -4.39900  62.76600  27.63800  1.000 28.62039 ? 597  LEU A CD1   1 
ATOM   2890 C  CD2   . LEU C 3 293 ? -5.65600  60.62900  28.05200  1.000 22.80419 ? 597  LEU A CD2   1 
ATOM   2891 N  N     . ALA C 3 294 ? -6.06200  60.31300  22.88500  1.000 15.31276 ? 598  ALA A N     1 
ATOM   2892 C  CA    . ALA C 3 294 ? -6.83800  60.39900  21.65000  1.000 19.79727 ? 598  ALA A CA    1 
ATOM   2893 C  C     . ALA C 3 294 ? -7.65000  59.12900  21.40400  1.000 23.18337 ? 598  ALA A C     1 
ATOM   2894 O  O     . ALA C 3 294 ? -8.78800  59.19300  20.91900  1.000 20.83279 ? 598  ALA A O     1 
ATOM   2895 C  CB    . ALA C 3 294 ? -5.90600  60.67400  20.46600  1.000 19.34956 ? 598  ALA A CB    1 
ATOM   2896 N  N     . LEU C 3 295 ? -7.08400  57.96300  21.72400  1.000 18.50891 ? 599  LEU A N     1 
ATOM   2897 C  CA    . LEU C 3 295 ? -7.80000  56.71200  21.49900  1.000 25.55397 ? 599  LEU A CA    1 
ATOM   2898 C  C     . LEU C 3 295 ? -9.01100  56.55600  22.41300  1.000 29.93085 ? 599  LEU A C     1 
ATOM   2899 O  O     . LEU C 3 295 ? -9.88800  55.73800  22.12200  1.000 30.19940 ? 599  LEU A O     1 
ATOM   2900 C  CB    . LEU C 3 295 ? -6.85000  55.52900  21.66600  1.000 23.39852 ? 599  LEU A CB    1 
ATOM   2901 C  CG    . LEU C 3 295 ? -5.77300  55.51100  20.58000  1.000 25.88611 ? 599  LEU A CG    1 
ATOM   2902 C  CD1   . LEU C 3 295 ? -4.77100  54.40700  20.83000  1.000 21.65038 ? 599  LEU A CD1   1 
ATOM   2903 C  CD2   . LEU C 3 295 ? -6.41100  55.37200  19.19400  1.000 20.91177 ? 599  LEU A CD2   1 
ATOM   2904 N  N     . GLN C 3 296 ? -9.08800  57.31300  23.50200  1.000 27.38150 ? 600  GLN A N     1 
ATOM   2905 C  CA    . GLN C 3 296 ? -10.29400 57.36200  24.31300  1.000 26.11845 ? 600  GLN A CA    1 
ATOM   2906 C  C     . GLN C 3 296 ? -11.16300 58.55700  23.95700  1.000 25.55668 ? 600  GLN A C     1 
ATOM   2907 O  O     . GLN C 3 296 ? -12.05600 58.91600  24.72800  1.000 25.57298 ? 600  GLN A O     1 
ATOM   2908 C  CB    . GLN C 3 296 ? -9.94000  57.39300  25.80400  1.000 33.98454 ? 600  GLN A CB    1 
ATOM   2909 C  CG    . GLN C 3 296 ? -8.87700  56.37800  26.27500  1.000 28.57135 ? 600  GLN A CG    1 
ATOM   2910 C  CD    . GLN C 3 296 ? -9.11300  54.95000  25.80600  1.000 25.52602 ? 600  GLN A CD    1 
ATOM   2911 O  OE1   . GLN C 3 296 ? -10.25300 54.50700  25.65200  1.000 40.08591 ? 600  GLN A OE1   1 
ATOM   2912 N  NE2   . GLN C 3 296 ? -8.02800  54.22800  25.55900  1.000 35.53965 ? 600  GLN A NE2   1 
ATOM   2913 N  N     . GLY C 3 297 ? -10.91000 59.19400  22.81500  1.000 25.51828 ? 601  GLY A N     1 
ATOM   2914 C  CA    . GLY C 3 297 ? -11.66400 60.37900  22.45300  1.000 19.00071 ? 601  GLY A CA    1 
ATOM   2915 C  C     . GLY C 3 297 ? -11.38000 61.61100  23.28200  1.000 20.46536 ? 601  GLY A C     1 
ATOM   2916 O  O     . GLY C 3 297 ? -12.15800 62.56700  23.22600  1.000 25.43002 ? 601  GLY A O     1 
ATOM   2917 N  N     . GLN C 3 298 ? -10.27600 61.63600  24.03100  1.000 22.21732 ? 602  GLN A N     1 
ATOM   2918 C  CA    . GLN C 3 298 ? -9.98400  62.69800  24.98600  1.000 23.16423 ? 602  GLN A CA    1 
ATOM   2919 C  C     . GLN C 3 298 ? -8.80500  63.56100  24.54100  1.000 21.37763 ? 602  GLN A C     1 
ATOM   2920 O  O     . GLN C 3 298 ? -7.81500  63.05800  23.99700  1.000 24.51071 ? 602  GLN A O     1 
ATOM   2921 C  CB    . GLN C 3 298 ? -9.68000  62.12200  26.37100  1.000 23.57051 ? 602  GLN A CB    1 
ATOM   2922 C  CG    . GLN C 3 298 ? -10.88100 61.51700  27.07400  1.000 32.39423 ? 602  GLN A CG    1 
ATOM   2923 C  CD    . GLN C 3 298 ? -10.50900 60.81400  28.38000  1.000 34.46934 ? 602  GLN A CD    1 
ATOM   2924 O  OE1   . GLN C 3 298 ? -9.57100  61.21000  29.06500  1.000 39.49490 ? 602  GLN A OE1   1 
ATOM   2925 N  NE2   . GLN C 3 298 ? -11.24200 59.75800  28.71500  1.000 39.02420 ? 602  GLN A NE2   1 
ATOM   2926 N  N     . ASP C 3 299 ? -8.91600  64.85800  24.79700  1.000 26.06870 ? 603  ASP A N     1 
ATOM   2927 C  CA    . ASP C 3 299 ? -7.83900  65.79600  24.51100  1.000 28.40679 ? 603  ASP A CA    1 
ATOM   2928 C  C     . ASP C 3 299 ? -6.79800  65.77100  25.62200  1.000 29.62093 ? 603  ASP A C     1 
ATOM   2929 O  O     . ASP C 3 299 ? -7.10900  65.50500  26.78800  1.000 28.77961 ? 603  ASP A O     1 
ATOM   2930 C  CB    . ASP C 3 299 ? -8.37900  67.22100  24.37800  1.000 27.92220 ? 603  ASP A CB    1 
ATOM   2931 C  CG    . ASP C 3 299 ? -9.29600  67.39300  23.20200  1.000 19.30559 ? 603  ASP A CG    1 
ATOM   2932 O  OD1   . ASP C 3 299 ? -8.99200  66.83800  22.12900  1.000 21.54531 ? 603  ASP A OD1   1 
ATOM   2933 O  OD2   . ASP C 3 299 ? -10.31700 68.08700  23.36100  1.000 22.10830 ? 603  ASP A OD2   1 
ATOM   2934 N  N     . ASP C 3 300 ? -5.55900  66.07000  25.24800  1.000 28.08824 ? 604  ASP A N     1 
ATOM   2935 C  CA    . ASP C 3 300 ? -4.43700  66.19600  26.16700  1.000 29.67602 ? 604  ASP A CA    1 
ATOM   2936 C  C     . ASP C 3 300 ? -4.36700  67.62200  26.72000  1.000 30.54347 ? 604  ASP A C     1 
ATOM   2937 O  O     . ASP C 3 300 ? -4.97300  68.55400  26.18400  1.000 26.00564 ? 604  ASP A O     1 
ATOM   2938 C  CB    . ASP C 3 300 ? -3.13000  65.82700  25.45400  1.000 29.54694 ? 604  ASP A CB    1 
ATOM   2939 C  CG    . ASP C 3 300 ? -2.90700  66.64600  24.17100  1.000 35.01410 ? 604  ASP A CG    1 
ATOM   2940 O  OD1   . ASP C 3 300 ? -3.71100  66.52100  23.21700  1.000 35.37681 ? 604  ASP A OD1   1 
ATOM   2941 O  OD2   . ASP C 3 300 ? -1.92900  67.41800  24.11500  1.000 34.97223 ? 604  ASP A OD2   1 
ATOM   2942 N  N     . GLU C 3 301 ? -3.61300  67.78200  27.81000  1.000 33.95863 ? 605  GLU A N     1 
ATOM   2943 C  CA    . GLU C 3 301 ? -3.53200  69.08400  28.47100  1.000 35.64372 ? 605  GLU A CA    1 
ATOM   2944 C  C     . GLU C 3 301 ? -2.95800  70.15400  27.54000  1.000 30.56066 ? 605  GLU A C     1 
ATOM   2945 O  O     . GLU C 3 301 ? -3.38500  71.31500  27.57600  1.000 33.39819 ? 605  GLU A O     1 
ATOM   2946 C  CB    . GLU C 3 301 ? -2.69700  68.95600  29.74900  1.000 37.69154 ? 605  GLU A CB    1 
ATOM   2947 C  CG    . GLU C 3 301 ? -2.08100  70.24800  30.26300  1.000 49.08294 ? 605  GLU A CG    1 
ATOM   2948 C  CD    . GLU C 3 301 ? -0.69900  70.03200  30.89100  1.000 63.51552 ? 605  GLU A CD    1 
ATOM   2949 O  OE1   . GLU C 3 301 ? -0.54100  69.04400  31.64700  1.000 50.66962 ? 605  GLU A OE1   1 
ATOM   2950 O  OE2   . GLU C 3 301 ? 0.22500   70.84800  30.63200  1.000 52.26295 ? 605  GLU A OE2   1 
ATOM   2951 N  N     . GLU C 3 302 ? -2.00600  69.77800  26.68500  1.000 27.52626 ? 606  GLU A N     1 
ATOM   2952 C  CA    . GLU C 3 302 ? -1.38900  70.75100  25.78500  1.000 36.73796 ? 606  GLU A CA    1 
ATOM   2953 C  C     . GLU C 3 302 ? -2.40300  71.32000  24.80100  1.000 35.60628 ? 606  GLU A C     1 
ATOM   2954 O  O     . GLU C 3 302 ? -2.50700  72.54100  24.63600  1.000 33.33569 ? 606  GLU A O     1 
ATOM   2955 C  CB    . GLU C 3 302 ? -0.22800  70.11100  25.03100  1.000 33.88913 ? 606  GLU A CB    1 
ATOM   2956 C  CG    . GLU C 3 302 ? 0.26000   70.93800  23.85500  1.000 41.90596 ? 606  GLU A CG    1 
ATOM   2957 C  CD    . GLU C 3 302 ? 1.11700   72.12800  24.28800  1.000 48.85429 ? 606  GLU A CD    1 
ATOM   2958 O  OE1   . GLU C 3 302 ? 1.28500   72.34600  25.51500  1.000 46.57778 ? 606  GLU A OE1   1 
ATOM   2959 O  OE2   . GLU C 3 302 ? 1.62100   72.84500  23.39600  1.000 37.67336 ? 606  GLU A OE2   1 
ATOM   2960 N  N     . SER C 3 303 ? -3.15800  70.44600  24.13100  1.000 30.52462 ? 607  SER A N     1 
ATOM   2961 C  CA    . SER C 3 303 ? -4.10700  70.89800  23.12300  1.000 26.53850 ? 607  SER A CA    1 
ATOM   2962 C  C     . SER C 3 303 ? -5.29200  71.63700  23.72700  1.000 27.82737 ? 607  SER A C     1 
ATOM   2963 O  O     . SER C 3 303 ? -5.93800  72.42800  23.03000  1.000 27.65886 ? 607  SER A O     1 
ATOM   2964 C  CB    . SER C 3 303 ? -4.59400  69.70700  22.30200  1.000 28.14532 ? 607  SER A CB    1 
ATOM   2965 O  OG    . SER C 3 303 ? -5.40100  68.86300  23.09900  1.000 32.04230 ? 607  SER A OG    1 
ATOM   2966 N  N     . LEU C 3 304 ? -5.59300  71.41000  25.00600  1.000 30.71953 ? 608  LEU A N     1 
ATOM   2967 C  CA    . LEU C 3 304 ? -6.69700  72.12300  25.63600  1.000 27.41580 ? 608  LEU A CA    1 
ATOM   2968 C  C     . LEU C 3 304 ? -6.37700  73.58500  25.88100  1.000 26.52693 ? 608  LEU A C     1 
ATOM   2969 O  O     . LEU C 3 304 ? -7.30200  74.38300  26.05100  1.000 27.60518 ? 608  LEU A O     1 
ATOM   2970 C  CB    . LEU C 3 304 ? -7.07300  71.46500  26.96500  1.000 26.19530 ? 608  LEU A CB    1 
ATOM   2971 C  CG    . LEU C 3 304 ? -7.86400  70.16200  26.84600  1.000 26.91023 ? 608  LEU A CG    1 
ATOM   2972 C  CD1   . LEU C 3 304 ? -7.75200  69.40300  28.13900  1.000 28.22846 ? 608  LEU A CD1   1 
ATOM   2973 C  CD2   . LEU C 3 304 ? -9.33200  70.42500  26.48300  1.000 24.90269 ? 608  LEU A CD2   1 
ATOM   2974 N  N     . LYS C 3 305 ? -5.09600  73.95900  25.90300  1.000 25.75776 ? 609  LYS A N     1 
ATOM   2975 C  CA    . LYS C 3 305 ? -4.75900  75.32800  26.27900  1.000 27.39417 ? 609  LYS A CA    1 
ATOM   2976 C  C     . LYS C 3 305 ? -5.34100  76.33700  25.29800  1.000 24.71091 ? 609  LYS A C     1 
ATOM   2977 O  O     . LYS C 3 305 ? -5.72000  77.44500  25.69200  1.000 30.11310 ? 609  LYS A O     1 
ATOM   2978 C  CB    . LYS C 3 305 ? -3.24000  75.47100  26.39500  1.000 32.91052 ? 609  LYS A CB    1 
ATOM   2979 C  CG    . LYS C 3 305 ? -2.66100  74.65600  27.56600  1.000 38.37509 ? 609  LYS A CG    1 
ATOM   2980 C  CD    . LYS C 3 305 ? -1.24700  75.07100  27.99000  1.000 33.99567 ? 609  LYS A CD    1 
ATOM   2981 C  CE    . LYS C 3 305 ? -0.20100  74.56400  27.01800  1.000 34.76407 ? 609  LYS A CE    1 
ATOM   2982 N  NZ    . LYS C 3 305 ? 0.92700   73.84100  27.69700  1.000 42.56124 ? 609  LYS A NZ    1 
ATOM   2983 N  N     . ILE C 3 306 ? -5.46900  75.96000  24.02600  1.000 28.85298 ? 610  ILE A N     1 
ATOM   2984 C  CA    . ILE C 3 306 ? -6.04000  76.87000  23.03900  1.000 24.41571 ? 610  ILE A CA    1 
ATOM   2985 C  C     . ILE C 3 306 ? -7.47000  77.26400  23.38800  1.000 25.81658 ? 610  ILE A C     1 
ATOM   2986 O  O     . ILE C 3 306 ? -7.95500  78.30300  22.92700  1.000 26.00697 ? 610  ILE A O     1 
ATOM   2987 C  CB    . ILE C 3 306 ? -5.97300  76.23300  21.64300  1.000 25.53381 ? 610  ILE A CB    1 
ATOM   2988 C  CG1   . ILE C 3 306 ? -5.98800  77.32000  20.56400  1.000 24.67435 ? 610  ILE A CG1   1 
ATOM   2989 C  CG2   . ILE C 3 306 ? -7.13200  75.25700  21.44700  1.000 22.65488 ? 610  ILE A CG2   1 
ATOM   2990 C  CD1   . ILE C 3 306 ? -5.96800  76.76800  19.13700  1.000 17.54428 ? 610  ILE A CD1   1 
ATOM   2991 N  N     . LEU C 3 307 ? -8.16900  76.45300  24.18600  1.000 25.21598 ? 611  LEU A N     1 
ATOM   2992 C  CA    . LEU C 3 307 ? -9.51700  76.81800  24.60300  1.000 27.56959 ? 611  LEU A CA    1 
ATOM   2993 C  C     . LEU C 3 307 ? -9.48600  77.72200  25.82900  1.000 24.65156 ? 611  LEU A C     1 
ATOM   2994 O  O     . LEU C 3 307 ? -10.22900 78.70900  25.89800  1.000 23.89738 ? 611  LEU A O     1 
ATOM   2995 C  CB    . LEU C 3 307 ? -10.34400 75.56000  24.90000  1.000 25.61793 ? 611  LEU A CB    1 
ATOM   2996 C  CG    . LEU C 3 307 ? -10.77500 74.66700  23.73300  1.000 29.66920 ? 611  LEU A CG    1 
ATOM   2997 C  CD1   . LEU C 3 307 ? -11.42400 73.36600  24.22600  1.000 28.35122 ? 611  LEU A CD1   1 
ATOM   2998 C  CD2   . LEU C 3 307 ? -11.70900 75.41600  22.79300  1.000 29.68704 ? 611  LEU A CD2   1 
ATOM   2999 N  N     . TYR C 3 308 ? -8.63400  77.39400  26.80300  1.000 26.25892 ? 612  TYR A N     1 
ATOM   3000 C  CA    . TYR C 3 308 ? -8.60100  78.15200  28.04400  1.000 26.53256 ? 612  TYR A CA    1 
ATOM   3001 C  C     . TYR C 3 308 ? -7.74900  79.40600  27.92700  1.000 23.80532 ? 612  TYR A C     1 
ATOM   3002 O  O     . TYR C 3 308 ? -8.01700  80.39200  28.61700  1.000 32.59971 ? 612  TYR A O     1 
ATOM   3003 C  CB    . TYR C 3 308 ? -8.11100  77.26100  29.18500  1.000 28.88557 ? 612  TYR A CB    1 
ATOM   3004 C  CG    . TYR C 3 308 ? -9.03000  76.08800  29.39800  1.000 30.72557 ? 612  TYR A CG    1 
ATOM   3005 C  CD1   . TYR C 3 308 ? -8.64000  74.80300  29.05200  1.000 32.98177 ? 612  TYR A CD1   1 
ATOM   3006 C  CD2   . TYR C 3 308 ? -10.31200 76.27600  29.89300  1.000 39.95526 ? 612  TYR A CD2   1 
ATOM   3007 C  CE1   . TYR C 3 308 ? -9.49300  73.73300  29.22300  1.000 44.61384 ? 612  TYR A CE1   1 
ATOM   3008 C  CE2   . TYR C 3 308 ? -11.17400 75.21800  30.06800  1.000 37.38210 ? 612  TYR A CE2   1 
ATOM   3009 C  CZ    . TYR C 3 308 ? -10.76100 73.94900  29.73200  1.000 42.78220 ? 612  TYR A CZ    1 
ATOM   3010 O  OH    . TYR C 3 308 ? -11.61800 72.89000  29.89900  1.000 46.51649 ? 612  TYR A OH    1 
ATOM   3011 N  N     . ASP C 3 309 ? -6.75000  79.41900  27.05000  1.000 20.28813 ? 613  ASP A N     1 
ATOM   3012 C  CA    . ASP C 3 309 ? -5.89000  80.59400  26.88900  1.000 26.26329 ? 613  ASP A CA    1 
ATOM   3013 C  C     . ASP C 3 309 ? -5.48000  80.74200  25.42800  1.000 24.19119 ? 613  ASP A C     1 
ATOM   3014 O  O     . ASP C 3 309 ? -4.29900  80.62400  25.08100  1.000 26.64347 ? 613  ASP A O     1 
ATOM   3015 C  CB    . ASP C 3 309 ? -4.67000  80.49200  27.80800  1.000 27.07764 ? 613  ASP A CB    1 
ATOM   3016 C  CG    . ASP C 3 309 ? -4.10500  81.85300  28.21300  1.000 36.22573 ? 613  ASP A CG    1 
ATOM   3017 O  OD1   . ASP C 3 309 ? -3.08300  81.86500  28.92500  1.000 48.38201 ? 613  ASP A OD1   1 
ATOM   3018 O  OD2   . ASP C 3 309 ? -4.66500  82.90900  27.84400  1.000 46.87260 ? 613  ASP A OD2   1 
ATOM   3019 N  N     . PRO C 3 310 ? -6.44000  81.04700  24.54200  1.000 23.36109 ? 614  PRO A N     1 
ATOM   3020 C  CA    . PRO C 3 310 ? -6.10300  81.25900  23.12300  1.000 20.76166 ? 614  PRO A CA    1 
ATOM   3021 C  C     . PRO C 3 310 ? -5.16900  82.43700  22.84200  1.000 26.81818 ? 614  PRO A C     1 
ATOM   3022 O  O     . PRO C 3 310 ? -4.39600  82.37000  21.87800  1.000 24.48165 ? 614  PRO A O     1 
ATOM   3023 C  CB    . PRO C 3 310 ? -7.47900  81.48100  22.47600  1.000 17.18484 ? 614  PRO A CB    1 
ATOM   3024 C  CG    . PRO C 3 310 ? -8.39100  81.81400  23.60800  1.000 17.07707 ? 614  PRO A CG    1 
ATOM   3025 C  CD    . PRO C 3 310 ? -7.89800  80.97900  24.72500  1.000 24.97433 ? 614  PRO A CD    1 
ATOM   3026 N  N     . LYS C 3 311 ? -5.23700  83.52700  23.60800  1.000 24.70133 ? 615  LYS A N     1 
ATOM   3027 C  CA    . LYS C 3 311 ? -4.32400  84.64300  23.36500  1.000 28.18878 ? 615  LYS A CA    1 
ATOM   3028 C  C     . LYS C 3 311 ? -2.87600  84.22200  23.56200  1.000 28.49519 ? 615  LYS A C     1 
ATOM   3029 O  O     . LYS C 3 311 ? -1.99900  84.65100  22.80900  1.000 30.50416 ? 615  LYS A O     1 
ATOM   3030 C  CB    . LYS C 3 311 ? -4.64900  85.83000  24.27800  1.000 30.99965 ? 615  LYS A CB    1 
ATOM   3031 C  CG    . LYS C 3 311 ? -5.97500  86.52900  24.00300  1.000 27.66676 ? 615  LYS A CG    1 
ATOM   3032 C  CD    . LYS C 3 311 ? -5.81600  88.04200  23.73400  1.000 48.81961 ? 615  LYS A CD    1 
ATOM   3033 C  CE    . LYS C 3 311 ? -5.08100  88.76800  24.86300  1.000 52.66805 ? 615  LYS A CE    1 
ATOM   3034 N  NZ    . LYS C 3 311 ? -5.43200  90.21900  24.94200  1.000 55.56538 ? 615  LYS A NZ    1 
ATOM   3035 N  N     . GLU C 3 312 ? -2.60200  83.37700  24.56400  1.000 29.20321 ? 616  GLU A N     1 
ATOM   3036 C  CA    . GLU C 3 312 ? -1.22900  82.92200  24.78900  1.000 36.66389 ? 616  GLU A CA    1 
ATOM   3037 C  C     . GLU C 3 312 ? -0.80400  81.88600  23.75100  1.000 27.54672 ? 616  GLU A C     1 
ATOM   3038 O  O     . GLU C 3 312 ? 0.34300   81.89500  23.28600  1.000 27.37096 ? 616  GLU A O     1 
ATOM   3039 C  CB    . GLU C 3 312 ? -1.07900  82.35300  26.20400  1.000 36.25013 ? 616  GLU A CB    1 
ATOM   3040 C  CG    . GLU C 3 312 ? -1.04200  83.40200  27.32000  1.000 46.72738 ? 616  GLU A CG    1 
ATOM   3041 C  CD    . GLU C 3 312 ? 0.32800   84.04400  27.50500  1.000 53.64404 ? 616  GLU A CD    1 
ATOM   3042 O  OE1   . GLU C 3 312 ? 0.57800   85.08600  26.86600  1.000 60.75025 ? 616  GLU A OE1   1 
ATOM   3043 O  OE2   . GLU C 3 312 ? 1.15400   83.51300  28.28300  1.000 48.32576 ? 616  GLU A OE2   1 
ATOM   3044 N  N     . VAL C 3 313 ? -1.71100  80.97900  23.38200  1.000 27.16824 ? 617  VAL A N     1 
ATOM   3045 C  CA    . VAL C 3 313 ? -1.39800  79.99300  22.34700  1.000 23.49664 ? 617  VAL A CA    1 
ATOM   3046 C  C     . VAL C 3 313 ? -1.17200  80.67000  21.00600  1.000 24.04560 ? 617  VAL A C     1 
ATOM   3047 O  O     . VAL C 3 313 ? -0.26800  80.29100  20.25000  1.000 24.97203 ? 617  VAL A O     1 
ATOM   3048 C  CB    . VAL C 3 313 ? -2.51000  78.93400  22.23400  1.000 23.73788 ? 617  VAL A CB    1 
ATOM   3049 C  CG1   . VAL C 3 313 ? -2.14800  77.91900  21.15500  1.000 27.71797 ? 617  VAL A CG1   1 
ATOM   3050 C  CG2   . VAL C 3 313 ? -2.73100  78.22800  23.57700  1.000 27.71922 ? 617  VAL A CG2   1 
ATOM   3051 N  N     . LEU C 3 314 ? -2.01300  81.64800  20.66300  1.000 19.26084 ? 618  LEU A N     1 
ATOM   3052 C  CA    . LEU C 3 314 ? -1.90600  82.25200  19.34200  1.000 23.45159 ? 618  LEU A CA    1 
ATOM   3053 C  C     . LEU C 3 314 ? -0.83700  83.33400  19.27400  1.000 25.03824 ? 618  LEU A C     1 
ATOM   3054 O  O     . LEU C 3 314 ? -0.50500  83.78200  18.17200  1.000 25.11176 ? 618  LEU A O     1 
ATOM   3055 C  CB    . LEU C 3 314 ? -3.25500  82.82500  18.89500  1.000 24.64544 ? 618  LEU A CB    1 
ATOM   3056 C  CG    . LEU C 3 314 ? -4.37400  81.80500  18.67700  1.000 17.47811 ? 618  LEU A CG    1 
ATOM   3057 C  CD1   . LEU C 3 314 ? -5.55400  82.48300  17.99800  1.000 19.92312 ? 618  LEU A CD1   1 
ATOM   3058 C  CD2   . LEU C 3 314 ? -3.90400  80.59800  17.87000  1.000 18.11432 ? 618  LEU A CD2   1 
ATOM   3059 N  N     . GLN C 3 315 ? -0.27700  83.73800  20.40800  1.000 22.47981 ? 619  GLN A N     1 
ATOM   3060 C  CA    . GLN C 3 315 ? 0.75700   84.76100  20.40500  1.000 29.22299 ? 619  GLN A CA    1 
ATOM   3061 C  C     . GLN C 3 315 ? 2.04400   84.22100  19.78700  1.000 27.78621 ? 619  GLN A C     1 
ATOM   3062 O  O     . GLN C 3 315 ? 2.53100   83.15000  20.16000  1.000 21.66200 ? 619  GLN A O     1 
ATOM   3063 C  CB    . GLN C 3 315 ? 1.02200   85.26400  21.82400  1.000 26.40179 ? 619  GLN A CB    1 
ATOM   3064 C  CG    . GLN C 3 315 ? 2.11000   86.33400  21.88100  1.000 40.08656 ? 619  GLN A CG    1 
ATOM   3065 C  CD    . GLN C 3 315 ? 1.72600   87.61100  21.13900  1.000 40.91868 ? 619  GLN A CD    1 
ATOM   3066 O  OE1   . GLN C 3 315 ? 0.76600   88.29500  21.51400  1.000 52.47668 ? 619  GLN A OE1   1 
ATOM   3067 N  NE2   . GLN C 3 315 ? 2.47200   87.93600  20.08500  1.000 39.79632 ? 619  GLN A NE2   1 
ATOM   3068 N  N     . ARG C 3 316 ? 2.59100   84.98300  18.84500  1.000 26.66931 ? 620  ARG A N     1 
ATOM   3069 C  CA    . ARG C 3 316 ? 3.77400   84.58300  18.09500  1.000 28.75887 ? 620  ARG A CA    1 
ATOM   3070 C  C     . ARG C 3 316 ? 5.01800   84.56000  18.98900  1.000 28.24198 ? 620  ARG A C     1 
ATOM   3071 O  O     . ARG C 3 316 ? 5.29900   85.52700  19.70100  1.000 30.92140 ? 620  ARG A O     1 
ATOM   3072 C  CB    . ARG C 3 316 ? 3.95800   85.55600  16.93300  1.000 25.94046 ? 620  ARG A CB    1 
ATOM   3073 C  CG    . ARG C 3 316 ? 5.17900   85.31600  16.09900  1.000 26.44651 ? 620  ARG A CG    1 
ATOM   3074 C  CD    . ARG C 3 316 ? 5.39200   86.46100  15.10500  1.000 21.01563 ? 620  ARG A CD    1 
ATOM   3075 N  NE    . ARG C 3 316 ? 4.82300   86.18700  13.78300  1.000 27.28456 ? 620  ARG A NE    1 
ATOM   3076 C  CZ    . ARG C 3 316 ? 5.24000   85.22200  12.95900  1.000 29.07862 ? 620  ARG A CZ    1 
ATOM   3077 N  NH1   . ARG C 3 316 ? 6.23900   84.41300  13.30500  1.000 29.10059 ? 620  ARG A NH1   1 
ATOM   3078 N  NH2   . ARG C 3 316 ? 4.64800   85.05700  11.78200  1.000 27.94076 ? 620  ARG A NH2   1 
ATOM   3079 N  N     . LYS C 3 317 ? 5.76000   83.44800  18.96000  1.000 25.06505 ? 621  LYS A N     1 
ATOM   3080 C  CA    . LYS C 3 317 ? 6.94400   83.29100  19.80000  1.000 28.36841 ? 621  LYS A CA    1 
ATOM   3081 C  C     . LYS C 3 317 ? 8.26100   83.29300  19.03300  1.000 22.53090 ? 621  LYS A C     1 
ATOM   3082 O  O     . LYS C 3 317 ? 9.31700   83.44600  19.65700  1.000 18.27570 ? 621  LYS A O     1 
ATOM   3083 C  CB    . LYS C 3 317 ? 6.86400   81.98900  20.61900  1.000 31.04792 ? 621  LYS A CB    1 
ATOM   3084 C  CG    . LYS C 3 317 ? 6.13100   82.11900  21.96600  1.000 27.36504 ? 621  LYS A CG    1 
ATOM   3085 C  CD    . LYS C 3 317 ? 4.66700   81.72200  21.85700  1.000 42.93574 ? 621  LYS A CD    1 
ATOM   3086 C  CE    . LYS C 3 317 ? 4.46600   80.33800  21.22400  1.000 37.19406 ? 621  LYS A CE    1 
ATOM   3087 N  NZ    . LYS C 3 317 ? 2.99800   80.00900  21.04700  1.000 35.24022 ? 621  LYS A NZ    1 
ATOM   3088 N  N     . SER C 3 318 ? 8.23500   83.11700  17.71700  1.000 22.46734 ? 622  SER A N     1 
ATOM   3089 C  CA    . SER C 3 318 ? 9.44900   83.19800  16.91400  1.000 21.59143 ? 622  SER A CA    1 
ATOM   3090 C  C     . SER C 3 318 ? 9.08900   83.77400  15.55400  1.000 22.45853 ? 622  SER A C     1 
ATOM   3091 O  O     . SER C 3 318 ? 7.91600   83.99700  15.24100  1.000 22.17597 ? 622  SER A O     1 
ATOM   3092 C  CB    . SER C 3 318 ? 10.12400  81.83100  16.78100  1.000 17.91732 ? 622  SER A CB    1 
ATOM   3093 O  OG    . SER C 3 318 ? 9.24300   80.90600  16.15400  1.000 26.93306 ? 622  SER A OG    1 
ATOM   3094 N  N     . LEU C 3 319 ? 10.10800  84.01800  14.73700  1.000 15.64601 ? 623  LEU A N     1 
ATOM   3095 C  CA    . LEU C 3 319 ? 9.87400   84.61000  13.42800  1.000 16.13317 ? 623  LEU A CA    1 
ATOM   3096 C  C     . LEU C 3 319 ? 10.99800  84.19400  12.49800  1.000 22.00199 ? 623  LEU A C     1 
ATOM   3097 O  O     . LEU C 3 319 ? 12.17500  84.27200  12.86900  1.000 18.10395 ? 623  LEU A O     1 
ATOM   3098 C  CB    . LEU C 3 319 ? 9.79400   86.13300  13.52600  1.000 18.36703 ? 623  LEU A CB    1 
ATOM   3099 C  CG    . LEU C 3 319 ? 9.65100   86.87100  12.20300  1.000 27.82203 ? 623  LEU A CG    1 
ATOM   3100 C  CD1   . LEU C 3 319 ? 8.42800   86.35400  11.44600  1.000 23.56466 ? 623  LEU A CD1   1 
ATOM   3101 C  CD2   . LEU C 3 319 ? 9.56800   88.36700  12.45800  1.000 19.03130 ? 623  LEU A CD2   1 
ATOM   3102 N  N     . SER C 3 320 ? 10.64400  83.75900  11.29400  1.000 16.91489 ? 624  SER A N     1 
ATOM   3103 C  CA    . SER C 3 320 ? 11.67200  83.17700  10.44600  1.000 20.06129 ? 624  SER A CA    1 
ATOM   3104 C  C     . SER C 3 320 ? 11.22700  83.19900  8.99400   1.000 17.47786 ? 624  SER A C     1 
ATOM   3105 O  O     . SER C 3 320 ? 10.04100  83.33100  8.69000   1.000 15.45413 ? 624  SER A O     1 
ATOM   3106 C  CB    . SER C 3 320 ? 11.99100  81.74100  10.88100  1.000 18.84264 ? 624  SER A CB    1 
ATOM   3107 O  OG    . SER C 3 320 ? 10.92600  80.86400  10.55300  1.000 25.63857 ? 624  SER A OG    1 
ATOM   3108 N  N     . ILE C 3 321 ? 12.20400  83.06700  8.10600   1.000 13.26689 ? 625  ILE A N     1 
ATOM   3109 C  CA    . ILE C 3 321 ? 11.94700  82.76100  6.71000   1.000 13.71359 ? 625  ILE A CA    1 
ATOM   3110 C  C     . ILE C 3 321 ? 12.73500  81.51300  6.34100   1.000 16.43995 ? 625  ILE A C     1 
ATOM   3111 O  O     . ILE C 3 321 ? 13.75400  81.20300  6.96100   1.000 16.96852 ? 625  ILE A O     1 
ATOM   3112 C  CB    . ILE C 3 321 ? 12.30600  83.92500  5.77900   1.000 14.19892 ? 625  ILE A CB    1 
ATOM   3113 C  CG1   . ILE C 3 321 ? 13.75400  84.36200  6.02000   1.000 21.15100 ? 625  ILE A CG1   1 
ATOM   3114 C  CG2   . ILE C 3 321 ? 11.29000  85.03800  5.94400   1.000 15.19538 ? 625  ILE A CG2   1 
ATOM   3115 C  CD1   . ILE C 3 321 ? 14.29300  85.24700  4.92200   1.000 23.23962 ? 625  ILE A CD1   1 
ATOM   3116 N  N     . ASP C 3 322 ? 12.22400  80.77800  5.35100   1.000 13.44584 ? 626  ASP A N     1 
ATOM   3117 C  CA    . ASP C 3 322 ? 12.83100  79.54600  4.85400   1.000 14.26100 ? 626  ASP A CA    1 
ATOM   3118 C  C     . ASP C 3 322 ? 12.74400  79.55500  3.33900   1.000 16.03575 ? 626  ASP A C     1 
ATOM   3119 O  O     . ASP C 3 322 ? 11.64500  79.61600  2.78600   1.000 19.06612 ? 626  ASP A O     1 
ATOM   3120 C  CB    . ASP C 3 322 ? 12.11900  78.29300  5.36300   1.000 16.19786 ? 626  ASP A CB    1 
ATOM   3121 C  CG    . ASP C 3 322 ? 12.27300  78.08600  6.81800   1.000 19.73328 ? 626  ASP A CG    1 
ATOM   3122 O  OD1   . ASP C 3 322 ? 11.64900  78.84700  7.58400   1.000 32.98676 ? 626  ASP A OD1   1 
ATOM   3123 O  OD2   . ASP C 3 322 ? 13.00300  77.14700  7.20500   1.000 27.91965 ? 626  ASP A OD2   1 
ATOM   3124 N  N     . ILE C 3 323 ? 13.88000  79.47400  2.66900   1.000 10.23179 ? 627  ILE A N     1 
ATOM   3125 C  CA    . ILE C 3 323 ? 13.91400  79.50300  1.22300   1.000 10.77626 ? 627  ILE A CA    1 
ATOM   3126 C  C     . ILE C 3 323 ? 14.74500  78.29900  0.80600   1.000 18.96214 ? 627  ILE A C     1 
ATOM   3127 O  O     . ILE C 3 323 ? 15.96900  78.29000  0.97000   1.000 13.98259 ? 627  ILE A O     1 
ATOM   3128 C  CB    . ILE C 3 323 ? 14.49800  80.80800  0.67000   1.000 17.41595 ? 627  ILE A CB    1 
ATOM   3129 C  CG1   . ILE C 3 323 ? 13.71100  82.01800  1.18800   1.000 19.39408 ? 627  ILE A CG1   1 
ATOM   3130 C  CG2   . ILE C 3 323 ? 14.43700  80.79500  -0.85000  1.000 16.99808 ? 627  ILE A CG2   1 
ATOM   3131 C  CD1   . ILE C 3 323 ? 14.35100  82.74700  2.32500   1.000 20.57155 ? 627  ILE A CD1   1 
ATOM   3132 N  N     . ASN C 3 324 ? 14.07300  77.26300  0.32300   1.000 19.59224 ? 628  ASN A N     1 
ATOM   3133 C  CA    . ASN C 3 324 ? 14.72400  76.02100  -0.05700  1.000 17.36646 ? 628  ASN A CA    1 
ATOM   3134 C  C     . ASN C 3 324 ? 14.43000  75.68100  -1.50500  1.000 14.19838 ? 628  ASN A C     1 
ATOM   3135 O  O     . ASN C 3 324 ? 14.48100  74.50900  -1.89300  1.000 16.07083 ? 628  ASN A O     1 
ATOM   3136 C  CB    . ASN C 3 324 ? 14.28100  74.90200  0.88200   1.000 15.93707 ? 628  ASN A CB    1 
ATOM   3137 C  CG    . ASN C 3 324 ? 14.76700  75.11400  2.30700   1.000 20.34357 ? 628  ASN A CG    1 
ATOM   3138 O  OD1   . ASN C 3 324 ? 15.94200  74.88200  2.61100   1.000 20.61507 ? 628  ASN A OD1   1 
ATOM   3139 N  ND2   . ASN C 3 324 ? 13.87300  75.56700  3.18600   1.000 13.45529 ? 628  ASN A ND2   1 
ATOM   3140 N  N     . TRP C 3 325 ? 14.11800  76.69800  -2.30200  1.000 13.91848 ? 629  TRP A N     1 
ATOM   3141 C  CA    . TRP C 3 325 ? 13.87600  76.57800  -3.73000  1.000 17.31588 ? 629  TRP A CA    1 
ATOM   3142 C  C     . TRP C 3 325 ? 14.50700  77.76900  -4.44200  1.000 14.51689 ? 629  TRP A C     1 
ATOM   3143 O  O     . TRP C 3 325 ? 14.43400  78.90000  -3.95300  1.000 17.89588 ? 629  TRP A O     1 
ATOM   3144 C  CB    . TRP C 3 325 ? 12.38300  76.52400  -4.04000  1.000 17.49554 ? 629  TRP A CB    1 
ATOM   3145 C  CG    . TRP C 3 325 ? 12.07100  76.16000  -5.45800  1.000 15.08490 ? 629  TRP A CG    1 
ATOM   3146 C  CD1   . TRP C 3 325 ? 11.92000  74.89800  -5.96500  1.000 14.03650 ? 629  TRP A CD1   1 
ATOM   3147 C  CD2   . TRP C 3 325 ? 11.85300  77.06100  -6.55000  1.000 15.58816 ? 629  TRP A CD2   1 
ATOM   3148 N  NE1   . TRP C 3 325 ? 11.63400  74.95800  -7.30800  1.000 11.41033 ? 629  TRP A NE1   1 
ATOM   3149 C  CE2   . TRP C 3 325 ? 11.58000  76.27400  -7.69300  1.000 15.01151 ? 629  TRP A CE2   1 
ATOM   3150 C  CE3   . TRP C 3 325 ? 11.86000  78.45700  -6.67700  1.000 14.36374 ? 629  TRP A CE3   1 
ATOM   3151 C  CZ2   . TRP C 3 325 ? 11.31700  76.84000  -8.94500  1.000 15.63917 ? 629  TRP A CZ2   1 
ATOM   3152 C  CZ3   . TRP C 3 325 ? 11.60900  79.01700  -7.92700  1.000 12.87164 ? 629  TRP A CZ3   1 
ATOM   3153 C  CH2   . TRP C 3 325 ? 11.32900  78.21500  -9.03700  1.000 13.98293 ? 629  TRP A CH2   1 
ATOM   3154 N  N     . GLY C 3 326 ? 15.14000  77.50200  -5.58100  1.000 14.76517 ? 630  GLY A N     1 
ATOM   3155 C  CA    . GLY C 3 326 ? 15.78800  78.53200  -6.38400  1.000 13.46408 ? 630  GLY A CA    1 
ATOM   3156 C  C     . GLY C 3 326 ? 17.14800  78.99400  -5.89800  1.000 17.40185 ? 630  GLY A C     1 
ATOM   3157 O  O     . GLY C 3 326 ? 17.64400  80.00900  -6.39100  1.000 14.52177 ? 630  GLY A O     1 
ATOM   3158 N  N     . ILE C 3 327 ? 17.76700  78.28500  -4.95400  1.000 13.91768 ? 631  ILE A N     1 
ATOM   3159 C  CA    . ILE C 3 327 ? 18.98700  78.74500  -4.29400  1.000 19.52646 ? 631  ILE A CA    1 
ATOM   3160 C  C     . ILE C 3 327 ? 20.17800  78.19600  -5.07500  1.000 16.08705 ? 631  ILE A C     1 
ATOM   3161 O  O     . ILE C 3 327 ? 20.50200  77.01300  -4.97200  1.000 13.24816 ? 631  ILE A O     1 
ATOM   3162 C  CB    . ILE C 3 327 ? 19.02700  78.30600  -2.82700  1.000 16.58434 ? 631  ILE A CB    1 
ATOM   3163 C  CG1   . ILE C 3 327 ? 17.86900  78.92800  -2.03900  1.000 17.73687 ? 631  ILE A CG1   1 
ATOM   3164 C  CG2   . ILE C 3 327 ? 20.36100  78.65200  -2.19800  1.000 13.81634 ? 631  ILE A CG2   1 
ATOM   3165 C  CD1   . ILE C 3 327 ? 17.85600  80.45800  -2.05700  1.000 12.80361 ? 631  ILE A CD1   1 
ATOM   3166 N  N     . ARG C 3 328 ? 20.84300  79.07000  -5.84800  1.000 18.25643 ? 632  ARG A N     1 
ATOM   3167 C  CA    . ARG C 3 328 ? 22.02200  78.72800  -6.67100  1.000 16.39614 ? 632  ARG A CA    1 
ATOM   3168 C  C     . ARG C 3 328 ? 22.98600  79.91700  -6.64400  1.000 20.96853 ? 632  ARG A C     1 
ATOM   3169 O  O     . ARG C 3 328 ? 22.89500  80.82200  -7.47400  1.000 18.66464 ? 632  ARG A O     1 
ATOM   3170 C  CB    . ARG C 3 328 ? 21.64300  78.38500  -8.11500  1.000 17.04490 ? 632  ARG A CB    1 
ATOM   3171 C  CG    . ARG C 3 328 ? 20.61700  77.26200  -8.29900  1.000 15.25596 ? 632  ARG A CG    1 
ATOM   3172 C  CD    . ARG C 3 328 ? 21.20800  75.86600  -8.04000  1.000 17.16635 ? 632  ARG A CD    1 
ATOM   3173 N  NE    . ARG C 3 328 ? 20.24700  74.81200  -8.36400  1.000 18.10091 ? 632  ARG A NE    1 
ATOM   3174 C  CZ    . ARG C 3 328 ? 19.26700  74.40800  -7.55700  1.000 20.92441 ? 632  ARG A CZ    1 
ATOM   3175 N  NH1   . ARG C 3 328 ? 19.11200  74.96000  -6.34300  1.000 17.11899 ? 632  ARG A NH1   1 
ATOM   3176 N  NH2   . ARG C 3 328 ? 18.43800  73.45200  -7.96100  1.000 16.63381 ? 632  ARG A NH2   1 
ATOM   3177 N  N     . PHE C 3 329 ? 23.93700  79.90400  -5.72000  1.000 16.26992 ? 633  PHE A N     1 
ATOM   3178 C  CA    . PHE C 3 329 ? 24.86500  81.01400  -5.58300  1.000 12.27704 ? 633  PHE A CA    1 
ATOM   3179 C  C     . PHE C 3 329 ? 26.26000  80.62700  -6.06700  1.000 27.44360 ? 633  PHE A C     1 
ATOM   3180 O  O     . PHE C 3 329 ? 26.71400  79.49900  -5.83800  1.000 23.44871 ? 633  PHE A O     1 
ATOM   3181 C  CB    . PHE C 3 329 ? 24.90200  81.48100  -4.12800  1.000 14.06647 ? 633  PHE A CB    1 
ATOM   3182 C  CG    . PHE C 3 329 ? 23.64100  82.19100  -3.69900  1.000 17.80415 ? 633  PHE A CG    1 
ATOM   3183 C  CD1   . PHE C 3 329 ? 23.32200  83.43600  -4.22700  1.000 15.10076 ? 633  PHE A CD1   1 
ATOM   3184 C  CD2   . PHE C 3 329 ? 22.75500  81.59100  -2.80900  1.000 18.83567 ? 633  PHE A CD2   1 
ATOM   3185 C  CE1   . PHE C 3 329 ? 22.15100  84.10000  -3.85100  1.000 14.73881 ? 633  PHE A CE1   1 
ATOM   3186 C  CE2   . PHE C 3 329 ? 21.56900  82.24200  -2.42800  1.000 18.69263 ? 633  PHE A CE2   1 
ATOM   3187 C  CZ    . PHE C 3 329 ? 21.27200  83.49200  -2.94600  1.000 16.34761 ? 633  PHE A CZ    1 
ATOM   3188 N  N     . LYS C 3 330 ? 26.94700  81.58500  -6.71400  1.000 21.12308 ? 634  LYS A N     1 
ATOM   3189 C  CA    . LYS C 3 330 ? 28.28600  81.36800  -7.25300  1.000 21.78688 ? 634  LYS A CA    1 
ATOM   3190 C  C     . LYS C 3 330 ? 29.41200  81.75100  -6.29900  1.000 23.27227 ? 634  LYS A C     1 
ATOM   3191 O  O     . LYS C 3 330 ? 30.53100  81.26300  -6.47200  1.000 15.86032 ? 634  LYS A O     1 
ATOM   3192 C  CB    . LYS C 3 330 ? 28.48000  82.15800  -8.55500  1.000 22.35379 ? 634  LYS A CB    1 
ATOM   3193 C  CG    . LYS C 3 330 ? 27.96400  81.46000  -9.80600  1.000 31.65743 ? 634  LYS A CG    1 
ATOM   3194 C  CD    . LYS C 3 330 ? 28.23800  82.29100  -11.05500 1.000 38.95433 ? 634  LYS A CD    1 
ATOM   3195 C  CE    . LYS C 3 330 ? 27.18500  82.05100  -12.13900 1.000 44.07102 ? 634  LYS A CE    1 
ATOM   3196 N  NZ    . LYS C 3 330 ? 26.07900  83.05900  -12.08600 1.000 43.08364 ? 634  LYS A NZ    1 
ATOM   3197 N  N     . ASN C 3 331 ? 29.17300  82.62400  -5.32500  1.000 17.12377 ? 635  ASN A N     1 
ATOM   3198 C  CA    . ASN C 3 331 ? 30.25700  83.11600  -4.48200  1.000 18.75682 ? 635  ASN A CA    1 
ATOM   3199 C  C     . ASN C 3 331 ? 29.67300  83.57700  -3.15700  1.000 16.53160 ? 635  ASN A C     1 
ATOM   3200 O  O     . ASN C 3 331 ? 28.46000  83.68000  -2.99400  1.000 18.36887 ? 635  ASN A O     1 
ATOM   3201 C  CB    . ASN C 3 331 ? 31.04700  84.24900  -5.16800  1.000 15.58038 ? 635  ASN A CB    1 
ATOM   3202 C  CG    . ASN C 3 331 ? 30.16600  85.40200  -5.59900  1.000 17.26716 ? 635  ASN A CG    1 
ATOM   3203 O  OD1   . ASN C 3 331 ? 29.52300  86.05900  -4.77800  1.000 18.77837 ? 635  ASN A OD1   1 
ATOM   3204 N  ND2   . ASN C 3 331 ? 30.11100  85.64100  -6.89700  1.000 20.91450 ? 635  ASN A ND2   1 
ATOM   3205 N  N     . ILE C 3 332 ? 30.56700  83.87100  -2.21600  1.000 17.12605 ? 636  ILE A N     1 
ATOM   3206 C  CA    . ILE C 3 332 ? 30.15600  84.23800  -0.86700  1.000 16.98099 ? 636  ILE A CA    1 
ATOM   3207 C  C     . ILE C 3 332 ? 29.55300  85.63800  -0.82300  1.000 18.00627 ? 636  ILE A C     1 
ATOM   3208 O  O     . ILE C 3 332 ? 28.74300  85.93500  0.06900   1.000 16.70430 ? 636  ILE A O     1 
ATOM   3209 C  CB    . ILE C 3 332 ? 31.35200  84.11300  0.09500   1.000 19.85247 ? 636  ILE A CB    1 
ATOM   3210 C  CG1   . ILE C 3 332 ? 30.87100  84.05500  1.54700   1.000 17.76742 ? 636  ILE A CG1   1 
ATOM   3211 C  CG2   . ILE C 3 332 ? 32.33300  85.26700  -0.10200  1.000 19.40315 ? 636  ILE A CG2   1 
ATOM   3212 C  CD1   . ILE C 3 332 ? 30.17400  82.78100  1.87700   1.000 17.45918 ? 636  ILE A CD1   1 
ATOM   3213 N  N     . THR C 3 333 ? 29.95300  86.52000  -1.75400  1.000 13.23862 ? 637  THR A N     1 
ATOM   3214 C  CA    . THR C 3 333 ? 29.40100  87.87100  -1.82800  1.000 18.33753 ? 637  THR A CA    1 
ATOM   3215 C  C     . THR C 3 333 ? 27.89600  87.84000  -2.09200  1.000 18.36518 ? 637  THR A C     1 
ATOM   3216 O  O     . THR C 3 333 ? 27.13500  88.63500  -1.52300  1.000 13.20737 ? 637  THR A O     1 
ATOM   3217 C  CB    . THR C 3 333 ? 30.11200  88.65700  -2.93100  1.000 17.04238 ? 637  THR A CB    1 
ATOM   3218 O  OG1   . THR C 3 333 ? 31.52400  88.66500  -2.68300  1.000 23.32568 ? 637  THR A OG1   1 
ATOM   3219 C  CG2   . THR C 3 333 ? 29.61700  90.08500  -2.98200  1.000 18.62030 ? 637  THR A CG2   1 
ATOM   3220 N  N     . GLN C 3 334 ? 27.45200  86.92700  -2.95600  1.000 19.95408 ? 638  GLN A N     1 
ATOM   3221 C  CA    . GLN C 3 334 ? 26.03300  86.84000  -3.28300  1.000 17.35505 ? 638  GLN A CA    1 
ATOM   3222 C  C     . GLN C 3 334 ? 25.24000  86.19400  -2.15400  1.000 16.14792 ? 638  GLN A C     1 
ATOM   3223 O  O     . GLN C 3 334 ? 24.09000  86.58400  -1.89400  1.000 17.98371 ? 638  GLN A O     1 
ATOM   3224 C  CB    . GLN C 3 334 ? 25.86400  86.08200  -4.59800  1.000 17.49689 ? 638  GLN A CB    1 
ATOM   3225 C  CG    . GLN C 3 334 ? 26.36400  86.87300  -5.82600  1.000 23.33915 ? 638  GLN A CG    1 
ATOM   3226 C  CD    . GLN C 3 334 ? 25.94700  88.35800  -5.79300  1.000 39.86743 ? 638  GLN A CD    1 
ATOM   3227 O  OE1   . GLN C 3 334 ? 24.74700  88.67600  -5.83200  1.000 31.12090 ? 638  GLN A OE1   1 
ATOM   3228 N  NE2   . GLN C 3 334 ? 26.93900  89.27100  -5.73000  1.000 24.29811 ? 638  GLN A NE2   1 
ATOM   3229 N  N     . VAL C 3 335 ? 25.84000  85.23300  -1.45600  1.000 11.51868 ? 639  VAL A N     1 
ATOM   3230 C  CA    . VAL C 3 335 ? 25.20600  84.68100  -0.26000  1.000 13.63407 ? 639  VAL A CA    1 
ATOM   3231 C  C     . VAL C 3 335 ? 25.01300  85.76000  0.80600   1.000 18.31744 ? 639  VAL A C     1 
ATOM   3232 O  O     . VAL C 3 335 ? 23.93800  85.87200  1.40600   1.000 13.97194 ? 639  VAL A O     1 
ATOM   3233 C  CB    . VAL C 3 335 ? 26.02400  83.50100  0.28200   1.000 13.31924 ? 639  VAL A CB    1 
ATOM   3234 C  CG1   . VAL C 3 335 ? 25.47100  83.05700  1.63100   1.000 13.40199 ? 639  VAL A CG1   1 
ATOM   3235 C  CG2   . VAL C 3 335 ? 26.02800  82.36000  -0.73400  1.000 14.91487 ? 639  VAL A CG2   1 
ATOM   3236 N  N     . ASP C 3 336 ? 26.05600  86.55800  1.07400   1.000 12.16254 ? 640  ASP A N     1 
ATOM   3237 C  CA    . ASP C 3 336 ? 25.94400  87.59200  2.10300   1.000 15.39963 ? 640  ASP A CA    1 
ATOM   3238 C  C     . ASP C 3 336 ? 24.85100  88.61400  1.76800   1.000 14.96375 ? 640  ASP A C     1 
ATOM   3239 O  O     . ASP C 3 336 ? 24.15200  89.10300  2.66700   1.000 12.22042 ? 640  ASP A O     1 
ATOM   3240 C  CB    . ASP C 3 336 ? 27.28900  88.30500  2.28500   1.000 13.09204 ? 640  ASP A CB    1 
ATOM   3241 C  CG    . ASP C 3 336 ? 28.26200  87.52600  3.19300   1.000 22.37612 ? 640  ASP A CG    1 
ATOM   3242 O  OD1   . ASP C 3 336 ? 27.92300  86.42000  3.67200   1.000 21.89986 ? 640  ASP A OD1   1 
ATOM   3243 O  OD2   . ASP C 3 336 ? 29.38400  88.02000  3.42200   1.000 29.17771 ? 640  ASP A OD2   1 
ATOM   3244 N  N     . LEU C 3 337 ? 24.72900  88.99100  0.48400   1.000 10.52337 ? 641  LEU A N     1 
ATOM   3245 C  CA    . LEU C 3 337 ? 23.70700  89.95200  0.07700   1.000 13.96519 ? 641  LEU A CA    1 
ATOM   3246 C  C     . LEU C 3 337 ? 22.31000  89.37000  0.24600   1.000 17.30643 ? 641  LEU A C     1 
ATOM   3247 O  O     . LEU C 3 337 ? 21.36700  90.08900  0.60800   1.000 13.65038 ? 641  LEU A O     1 
ATOM   3248 C  CB    . LEU C 3 337 ? 23.91900  90.37300  -1.37800  1.000 16.22315 ? 641  LEU A CB    1 
ATOM   3249 C  CG    . LEU C 3 337 ? 24.96500  91.44500  -1.67500  1.000 20.44272 ? 641  LEU A CG    1 
ATOM   3250 C  CD1   . LEU C 3 337 ? 25.24000  91.48400  -3.18800  1.000 13.19575 ? 641  LEU A CD1   1 
ATOM   3251 C  CD2   . LEU C 3 337 ? 24.50700  92.80800  -1.12900  1.000 15.96065 ? 641  LEU A CD2   1 
ATOM   3252 N  N     . PHE C 3 338 ? 22.16100  88.07000  -0.02200  1.000 13.63670 ? 642  PHE A N     1 
ATOM   3253 C  CA    . PHE C 3 338 ? 20.86900  87.42500  0.16500   1.000 15.64534 ? 642  PHE A CA    1 
ATOM   3254 C  C     . PHE C 3 338 ? 20.51600  87.34000  1.64400   1.000 15.83353 ? 642  PHE A C     1 
ATOM   3255 O  O     . PHE C 3 338 ? 19.36200  87.57100  2.02600   1.000 9.72074  ? 642  PHE A O     1 
ATOM   3256 C  CB    . PHE C 3 338 ? 20.87400  86.03700  -0.46500  1.000 13.72846 ? 642  PHE A CB    1 
ATOM   3257 C  CG    . PHE C 3 338 ? 19.55900  85.33900  -0.36200  1.000 13.81156 ? 642  PHE A CG    1 
ATOM   3258 C  CD1   . PHE C 3 338 ? 18.52200  85.66900  -1.21400  1.000 18.55460 ? 642  PHE A CD1   1 
ATOM   3259 C  CD2   . PHE C 3 338 ? 19.35100  84.37200  0.59100   1.000 18.86169 ? 642  PHE A CD2   1 
ATOM   3260 C  CE1   . PHE C 3 338 ? 17.30600  85.04000  -1.11700  1.000 23.20241 ? 642  PHE A CE1   1 
ATOM   3261 C  CE2   . PHE C 3 338 ? 18.13400  83.73100  0.68900   1.000 22.98405 ? 642  PHE A CE2   1 
ATOM   3262 C  CZ    . PHE C 3 338 ? 17.11200  84.06600  -0.16400  1.000 22.45584 ? 642  PHE A CZ    1 
ATOM   3263 N  N     . ILE C 3 339 ? 21.50300  87.04000  2.49200   1.000 11.12149 ? 643  ILE A N     1 
ATOM   3264 C  CA    . ILE C 3 339 ? 21.25300  87.01000  3.93100   1.000 11.72445 ? 643  ILE A CA    1 
ATOM   3265 C  C     . ILE C 3 339 ? 20.81800  88.38800  4.41600   1.000 14.04831 ? 643  ILE A C     1 
ATOM   3266 O  O     . ILE C 3 339 ? 19.88700  88.51300  5.22700   1.000 17.29098 ? 643  ILE A O     1 
ATOM   3267 C  CB    . ILE C 3 339 ? 22.50400  86.52100  4.68500   1.000 14.56784 ? 643  ILE A CB    1 
ATOM   3268 C  CG1   . ILE C 3 339 ? 22.68000  85.00100  4.56700   1.000 12.58399 ? 643  ILE A CG1   1 
ATOM   3269 C  CG2   . ILE C 3 339 ? 22.44000  86.92000  6.14100   1.000 9.07304  ? 643  ILE A CG2   1 
ATOM   3270 C  CD1   . ILE C 3 339 ? 24.07000  84.56500  4.88700   1.000 10.37768 ? 643  ILE A CD1   1 
ATOM   3271 N  N     . GLU C 3 340 ? 21.49900  89.44400  3.94000   1.000 11.00933 ? 644  GLU A N     1 
ATOM   3272 C  CA    . GLU C 3 340 ? 21.12600  90.80800  4.30500   1.000 11.27501 ? 644  GLU A CA    1 
ATOM   3273 C  C     . GLU C 3 340 ? 19.68500  91.10800  3.89500   1.000 12.97202 ? 644  GLU A C     1 
ATOM   3274 O  O     . GLU C 3 340 ? 18.91900  91.67600  4.67900   1.000 12.83389 ? 644  GLU A O     1 
ATOM   3275 C  CB    . GLU C 3 340 ? 22.09300  91.81900  3.67200   1.000 9.97608  ? 644  GLU A CB    1 
ATOM   3276 C  CG    . GLU C 3 340 ? 23.51700  91.82600  4.29800   1.000 14.49514 ? 644  GLU A CG    1 
ATOM   3277 C  CD    . GLU C 3 340 ? 24.55700  92.55700  3.43100   1.000 19.62121 ? 644  GLU A CD    1 
ATOM   3278 O  OE1   . GLU C 3 340 ? 24.17500  93.43600  2.62700   1.000 20.18492 ? 644  GLU A OE1   1 
ATOM   3279 O  OE2   . GLU C 3 340 ? 25.76100  92.23700  3.53900   1.000 21.02322 ? 644  GLU A OE2   1 
ATOM   3280 N  N     . ARG C 3 341 ? 19.29200  90.71900  2.67900   1.000 14.54677 ? 645  ARG A N     1 
ATOM   3281 C  CA    . ARG C 3 341 ? 17.90900  90.93800  2.24300   1.000 16.78714 ? 645  ARG A CA    1 
ATOM   3282 C  C     . ARG C 3 341 ? 16.93000  90.20200  3.14300   1.000 17.67115 ? 645  ARG A C     1 
ATOM   3283 O  O     . ARG C 3 341 ? 15.90000  90.75900  3.54600   1.000 13.59375 ? 645  ARG A O     1 
ATOM   3284 C  CB    . ARG C 3 341 ? 17.72200  90.48000  0.79300   1.000 12.98085 ? 645  ARG A CB    1 
ATOM   3285 C  CG    . ARG C 3 341 ? 18.40400  91.38200  -0.22500  1.000 18.44520 ? 645  ARG A CG    1 
ATOM   3286 C  CD    . ARG C 3 341 ? 18.36100  90.81200  -1.65900  1.000 16.68057 ? 645  ARG A CD    1 
ATOM   3287 N  NE    . ARG C 3 341 ? 19.40100  91.46200  -2.43800  1.000 14.56222 ? 645  ARG A NE    1 
ATOM   3288 C  CZ    . ARG C 3 341 ? 20.35900  90.82900  -3.10900  1.000 17.71768 ? 645  ARG A CZ    1 
ATOM   3289 N  NH1   . ARG C 3 341 ? 20.39300  89.49800  -3.14700  1.000 11.23326 ? 645  ARG A NH1   1 
ATOM   3290 N  NH2   . ARG C 3 341 ? 21.28200  91.54100  -3.75400  1.000 13.54687 ? 645  ARG A NH2   1 
ATOM   3291 N  N     . GLY C 3 342 ? 17.22500  88.94000  3.45500   1.000 14.49517 ? 646  GLY A N     1 
ATOM   3292 C  CA    . GLY C 3 342 ? 16.35900  88.20000  4.34800   1.000 13.63243 ? 646  GLY A CA    1 
ATOM   3293 C  C     . GLY C 3 342 ? 16.23200  88.86700  5.70400   1.000 18.15489 ? 646  GLY A C     1 
ATOM   3294 O  O     . GLY C 3 342 ? 15.13300  88.95900  6.26700   1.000 14.86188 ? 646  GLY A O     1 
ATOM   3295 N  N     . CYS C 3 343 ? 17.35000  89.37100  6.23400   1.000 13.80288 ? 647  CYS A N     1 
ATOM   3296 C  CA    . CYS C 3 343 ? 17.32700  90.02400  7.53700   1.000 13.33348 ? 647  CYS A CA    1 
ATOM   3297 C  C     . CYS C 3 343 ? 16.49300  91.29300  7.47800   1.000 15.05357 ? 647  CYS A C     1 
ATOM   3298 O  O     . CYS C 3 343 ? 15.78800  91.63200  8.43600   1.000 12.92663 ? 647  CYS A O     1 
ATOM   3299 C  CB    . CYS C 3 343 ? 18.75400  90.36100  7.98700   1.000 15.00619 ? 647  CYS A CB    1 
ATOM   3300 S  SG    . CYS C 3 343 ? 19.75100  88.94000  8.53300   1.000 16.92699 ? 647  CYS A SG    1 
ATOM   3301 N  N     . GLN C 3 344 ? 16.61700  92.03800  6.37800   1.000 14.00102 ? 648  GLN A N     1 
ATOM   3302 C  CA    A GLN C 3 344 ? 15.82000  93.24600  6.21200   0.950 16.98724 ? 648  GLN A CA    1 
ATOM   3303 C  CA    B GLN C 3 344 ? 15.81900  93.24700  6.20900   0.050 16.76505 ? 648  GLN A CA    1 
ATOM   3304 C  C     . GLN C 3 344 ? 14.33500  92.91400  6.23900   1.000 14.02682 ? 648  GLN A C     1 
ATOM   3305 O  O     . GLN C 3 344 ? 13.56100  93.52000  6.99200   1.000 15.83243 ? 648  GLN A O     1 
ATOM   3306 C  CB    A GLN C 3 344 ? 16.20000  93.93600  4.90700   0.950 16.22433 ? 648  GLN A CB    1 
ATOM   3307 C  CB    B GLN C 3 344 ? 16.19500  93.93700  4.89700   0.050 16.42862 ? 648  GLN A CB    1 
ATOM   3308 C  CG    A GLN C 3 344 ? 15.34700  95.11600  4.53700   0.950 18.82003 ? 648  GLN A CG    1 
ATOM   3309 C  CG    B GLN C 3 344 ? 15.33800  95.14000  4.53400   0.050 18.79920 ? 648  GLN A CG    1 
ATOM   3310 C  CD    A GLN C 3 344 ? 15.80900  95.75600  3.24600   0.950 19.67906 ? 648  GLN A CD    1 
ATOM   3311 C  CD    B GLN C 3 344 ? 15.76100  95.77600  3.22100   0.050 19.74493 ? 648  GLN A CD    1 
ATOM   3312 O  OE1   A GLN C 3 344 ? 15.79400  95.12100  2.18600   0.950 23.18663 ? 648  GLN A OE1   1 
ATOM   3313 O  OE1   B GLN C 3 344 ? 15.68700  95.14800  2.16400   0.050 22.81955 ? 648  GLN A OE1   1 
ATOM   3314 N  NE2   A GLN C 3 344 ? 16.24400  97.00300  3.32800   0.950 16.11832 ? 648  GLN A NE2   1 
ATOM   3315 N  NE2   B GLN C 3 344 ? 16.21100  97.02400  3.28200   0.050 16.41853 ? 648  GLN A NE2   1 
ATOM   3316 N  N     . TYR C 3 345 ? 13.92900  91.93600  5.43400   1.000 15.64113 ? 649  TYR A N     1 
ATOM   3317 C  CA    . TYR C 3 345 ? 12.54300  91.48900  5.41400   1.000 15.15865 ? 649  TYR A CA    1 
ATOM   3318 C  C     . TYR C 3 345 ? 12.07400  91.10900  6.81400   1.000 16.96927 ? 649  TYR A C     1 
ATOM   3319 O  O     . TYR C 3 345 ? 11.01800  91.55700  7.27200   1.000 15.14443 ? 649  TYR A O     1 
ATOM   3320 C  CB    . TYR C 3 345 ? 12.40900  90.30900  4.45400   1.000 14.51820 ? 649  TYR A CB    1 
ATOM   3321 C  CG    . TYR C 3 345 ? 11.03100  89.67400  4.47900   1.000 20.29997 ? 649  TYR A CG    1 
ATOM   3322 C  CD1   . TYR C 3 345 ? 10.73100  88.64400  5.37100   1.000 16.78656 ? 649  TYR A CD1   1 
ATOM   3323 C  CD2   . TYR C 3 345 ? 10.03200  90.11000  3.61900   1.000 13.40088 ? 649  TYR A CD2   1 
ATOM   3324 C  CE1   . TYR C 3 345 ? 9.47800   88.07100  5.40300   1.000 16.46518 ? 649  TYR A CE1   1 
ATOM   3325 C  CE2   . TYR C 3 345 ? 8.76500   89.53700  3.64700   1.000 16.02480 ? 649  TYR A CE2   1 
ATOM   3326 C  CZ    . TYR C 3 345 ? 8.49500   88.53100  4.54100   1.000 18.56656 ? 649  TYR A CZ    1 
ATOM   3327 O  OH    . TYR C 3 345 ? 7.24300   87.95400  4.56800   1.000 24.57304 ? 649  TYR A OH    1 
ATOM   3328 N  N     . LEU C 3 346 ? 12.87300  90.30300  7.52100   1.000 14.20451 ? 650  LEU A N     1 
ATOM   3329 C  CA    . LEU C 3 346 ? 12.49000  89.84300  8.85000   1.000 14.05062 ? 650  LEU A CA    1 
ATOM   3330 C  C     . LEU C 3 346 ? 12.41500  90.98200  9.85400   1.000 17.63314 ? 650  LEU A C     1 
ATOM   3331 O  O     . LEU C 3 346 ? 11.65600  90.89900  10.83200  1.000 20.23726 ? 650  LEU A O     1 
ATOM   3332 C  CB    . LEU C 3 346 ? 13.47900  88.78800  9.35200   1.000 13.11311 ? 650  LEU A CB    1 
ATOM   3333 C  CG    . LEU C 3 346 ? 13.23200  87.34500  8.92200   1.000 21.18701 ? 650  LEU A CG    1 
ATOM   3334 C  CD1   . LEU C 3 346 ? 14.30000  86.43200  9.51300   1.000 20.47303 ? 650  LEU A CD1   1 
ATOM   3335 C  CD2   . LEU C 3 346 ? 11.82200  86.90400  9.33200   1.000 14.47738 ? 650  LEU A CD2   1 
ATOM   3336 N  N     . LEU C 3 347 ? 13.21300  92.02800  9.67400   1.000 13.94030 ? 651  LEU A N     1 
ATOM   3337 C  CA    . LEU C 3 347 ? 13.12800  93.12200  10.62600  1.000 17.00010 ? 651  LEU A CA    1 
ATOM   3338 C  C     . LEU C 3 347 ? 11.90700  94.00000  10.35400  1.000 20.28204 ? 651  LEU A C     1 
ATOM   3339 O  O     . LEU C 3 347 ? 11.37100  94.61000  11.28600  1.000 17.00607 ? 651  LEU A O     1 
ATOM   3340 C  CB    . LEU C 3 347 ? 14.41600  93.94200  10.60600  1.000 18.59969 ? 651  LEU A CB    1 
ATOM   3341 C  CG    . LEU C 3 347 ? 15.55600  93.28200  11.39500  1.000 23.55847 ? 651  LEU A CG    1 
ATOM   3342 C  CD1   . LEU C 3 347 ? 16.91600  93.82500  10.97800  1.000 16.39809 ? 651  LEU A CD1   1 
ATOM   3343 C  CD2   . LEU C 3 347 ? 15.35100  93.44800  12.90600  1.000 15.95020 ? 651  LEU A CD2   1 
ATOM   3344 N  N     . GLU C 3 348 ? 11.44200  94.06700  9.10100   1.000 15.49721 ? 652  GLU A N     1 
ATOM   3345 C  CA    . GLU C 3 348 ? 10.18500  94.75800  8.83500   1.000 21.41962 ? 652  GLU A CA    1 
ATOM   3346 C  C     . GLU C 3 348 ? 9.04600   94.06200  9.54400   1.000 24.62734 ? 652  GLU A C     1 
ATOM   3347 O  O     . GLU C 3 348 ? 8.19500   94.71900  10.15200  1.000 17.92571 ? 652  GLU A O     1 
ATOM   3348 C  CB    . GLU C 3 348 ? 9.88600   94.80700  7.34500   1.000 23.03317 ? 652  GLU A CB    1 
ATOM   3349 C  CG    . GLU C 3 348 ? 10.56300  95.91400  6.58700   1.000 30.48553 ? 652  GLU A CG    1 
ATOM   3350 C  CD    . GLU C 3 348 ? 10.25400  95.79600  5.11600   1.000 44.57064 ? 652  GLU A CD    1 
ATOM   3351 O  OE1   . GLU C 3 348 ? 9.11400   96.13200  4.72300   1.000 48.05043 ? 652  GLU A OE1   1 
ATOM   3352 O  OE2   . GLU C 3 348 ? 11.13000  95.30200  4.37000   1.000 32.89719 ? 652  GLU A OE2   1 
ATOM   3353 N  N     . LYS C 3 349 ? 9.03400   92.72300  9.48400   1.000 18.08502 ? 653  LYS A N     1 
ATOM   3354 C  CA    . LYS C 3 349 ? 8.05600   91.93800  10.22400  1.000 21.31252 ? 653  LYS A CA    1 
ATOM   3355 C  C     . LYS C 3 349 ? 8.20700   92.14900  11.72700  1.000 22.66017 ? 653  LYS A C     1 
ATOM   3356 O  O     . LYS C 3 349 ? 7.20500   92.29400  12.43800  1.000 23.39709 ? 653  LYS A O     1 
ATOM   3357 C  CB    . LYS C 3 349 ? 8.18300   90.45700  9.86000   1.000 17.74465 ? 653  LYS A CB    1 
ATOM   3358 C  CG    . LYS C 3 349 ? 7.89000   90.12400  8.37800   1.000 19.73023 ? 653  LYS A CG    1 
ATOM   3359 C  CD    . LYS C 3 349 ? 6.81100   91.06200  7.80600   1.000 28.37498 ? 653  LYS A CD    1 
ATOM   3360 C  CE    . LYS C 3 349 ? 5.98500   90.43700  6.68900   1.000 24.48980 ? 653  LYS A CE    1 
ATOM   3361 N  NZ    . LYS C 3 349 ? 4.53900   90.68300  6.93000   1.000 33.30034 ? 653  LYS A NZ    1 
ATOM   3362 N  N     . LEU C 3 350 ? 9.45300   92.20500  12.22300  1.000 16.80722 ? 654  LEU A N     1 
ATOM   3363 C  CA    . LEU C 3 350 ? 9.68100   92.36700  13.66000  1.000 16.39674 ? 654  LEU A CA    1 
ATOM   3364 C  C     . LEU C 3 350 ? 9.21700   93.73300  14.15500  1.000 22.00544 ? 654  LEU A C     1 
ATOM   3365 O  O     . LEU C 3 350 ? 8.59500   93.83200  15.21800  1.000 25.89098 ? 654  LEU A O     1 
ATOM   3366 C  CB    . LEU C 3 350 ? 11.15900  92.16100  14.00300  1.000 19.46263 ? 654  LEU A CB    1 
ATOM   3367 C  CG    . LEU C 3 350 ? 11.52700  92.12600  15.49600  1.000 14.95200 ? 654  LEU A CG    1 
ATOM   3368 C  CD1   . LEU C 3 350 ? 11.04800  90.80700  16.12500  1.000 23.42997 ? 654  LEU A CD1   1 
ATOM   3369 C  CD2   . LEU C 3 350 ? 13.02000  92.27800  15.70700  1.000 19.07033 ? 654  LEU A CD2   1 
ATOM   3370 N  N     . ASN C 3 351 ? 9.51000   94.79500  13.40600  1.000 16.77208 ? 655  ASN A N     1 
ATOM   3371 C  CA    . ASN C 3 351 ? 9.09000   96.12400  13.83600  1.000 21.16294 ? 655  ASN A CA    1 
ATOM   3372 C  C     . ASN C 3 351 ? 7.58700   96.32500  13.68800  1.000 25.21282 ? 655  ASN A C     1 
ATOM   3373 O  O     . ASN C 3 351 ? 7.00500   97.14400  14.40600  1.000 25.91962 ? 655  ASN A O     1 
ATOM   3374 C  CB    . ASN C 3 351 ? 9.84500   97.18900  13.05400  1.000 16.25909 ? 655  ASN A CB    1 
ATOM   3375 C  CG    . ASN C 3 351 ? 11.32600  97.14300  13.32000  1.000 22.71568 ? 655  ASN A CG    1 
ATOM   3376 O  OD1   . ASN C 3 351 ? 11.75900  96.79800  14.42100  1.000 24.87772 ? 655  ASN A OD1   1 
ATOM   3377 N  ND2   . ASN C 3 351 ? 12.11700  97.47400  12.31100  1.000 26.51476 ? 655  ASN A ND2   1 
ATOM   3378 N  N     . GLU C 3 352 ? 6.94900   95.60000  12.76500  1.000 21.04937 ? 656  GLU A N     1 
ATOM   3379 C  CA    . GLU C 3 352 ? 5.49300   95.62400  12.68400  1.000 27.06603 ? 656  GLU A CA    1 
ATOM   3380 C  C     . GLU C 3 352 ? 4.85700   95.28400  14.02700  1.000 27.99835 ? 656  GLU A C     1 
ATOM   3381 O  O     . GLU C 3 352 ? 3.90400   95.94300  14.45500  1.000 35.36786 ? 656  GLU A O     1 
ATOM   3382 C  CB    . GLU C 3 352 ? 5.00500   94.64900  11.61000  1.000 28.16168 ? 656  GLU A CB    1 
ATOM   3383 C  CG    . GLU C 3 352 ? 4.95400   95.21900  10.21100  1.000 32.58378 ? 656  GLU A CG    1 
ATOM   3384 C  CD    . GLU C 3 352 ? 4.77500   94.14500  9.14900   1.000 36.68856 ? 656  GLU A CD    1 
ATOM   3385 O  OE1   . GLU C 3 352 ? 4.14400   93.10400  9.44300   1.000 39.88628 ? 656  GLU A OE1   1 
ATOM   3386 O  OE2   . GLU C 3 352 ? 5.26600   94.34200  8.01500   1.000 52.38678 ? 656  GLU A OE2   1 
ATOM   3387 N  N     . ILE C 3 353 ? 5.36700   94.25900  14.70900  1.000 23.45533 ? 657  ILE A N     1 
ATOM   3388 C  CA    . ILE C 3 353 ? 4.78200   93.81700  15.96900  1.000 24.33620 ? 657  ILE A CA    1 
ATOM   3389 C  C     . ILE C 3 353 ? 5.49500   94.41700  17.17600  1.000 27.51711 ? 657  ILE A C     1 
ATOM   3390 O  O     . ILE C 3 353 ? 5.25000   93.98900  18.30700  1.000 32.58702 ? 657  ILE A O     1 
ATOM   3391 C  CB    . ILE C 3 353 ? 4.74900   92.28300  16.05600  1.000 28.43536 ? 657  ILE A CB    1 
ATOM   3392 C  CG1   . ILE C 3 353 ? 6.16400   91.71900  16.18800  1.000 29.27054 ? 657  ILE A CG1   1 
ATOM   3393 C  CG2   . ILE C 3 353 ? 4.07200   91.70000  14.82400  1.000 24.18194 ? 657  ILE A CG2   1 
ATOM   3394 C  CD1   . ILE C 3 353 ? 6.26600   90.26300  15.79400  1.000 27.24975 ? 657  ILE A CD1   1 
ATOM   3395 N  N     . ASN C 3 354 ? 6.38500   95.38500  16.95700  1.000 21.40896 ? 658  ASN A N     1 
ATOM   3396 C  CA    . ASN C 3 354 ? 7.00800   96.16600  18.03200  1.000 33.05051 ? 658  ASN A CA    1 
ATOM   3397 C  C     . ASN C 3 354 ? 7.69600   95.27300  19.07200  1.000 34.50637 ? 658  ASN A C     1 
ATOM   3398 O  O     . ASN C 3 354 ? 7.45300   95.37600  20.27700  1.000 30.58282 ? 658  ASN A O     1 
ATOM   3399 C  CB    . ASN C 3 354 ? 5.97900   97.08600  18.69100  1.000 42.26828 ? 658  ASN A CB    1 
ATOM   3400 C  CG    . ASN C 3 354 ? 6.61600   98.12500  19.60900  1.000 46.99819 ? 658  ASN A CG    1 
ATOM   3401 O  OD1   . ASN C 3 354 ? 7.72400   98.60600  19.34800  1.000 42.40828 ? 658  ASN A OD1   1 
ATOM   3402 N  ND2   . ASN C 3 354 ? 5.90800   98.48300  20.68600  1.000 43.83847 ? 658  ASN A ND2   1 
ATOM   3403 N  N     . LYS C 3 355 ? 8.60500   94.41300  18.60000  1.000 33.67394 ? 659  LYS A N     1 
ATOM   3404 C  CA    . LYS C 3 355 ? 9.32500   93.49300  19.52400  1.000 25.57246 ? 659  LYS A CA    1 
ATOM   3405 C  C     . LYS C 3 355 ? 10.77000  93.26900  19.05800  1.000 27.92378 ? 659  LYS A C     1 
ATOM   3406 O  O     . LYS C 3 355 ? 10.99300  93.16300  17.83600  1.000 34.34562 ? 659  LYS A O     1 
ATOM   3407 C  CB    . LYS C 3 355 ? 8.57900   92.15900  19.63200  1.000 26.45552 ? 659  LYS A CB    1 
ATOM   3408 C  CG    . LYS C 3 355 ? 7.36100   92.16600  20.54700  1.000 35.28472 ? 659  LYS A CG    1 
ATOM   3409 C  CD    . LYS C 3 355 ? 6.82300   90.78100  20.83800  1.000 34.48349 ? 659  LYS A CD    1 
ATOM   3410 C  CE    . LYS C 3 355 ? 5.38000   90.78900  21.29700  1.000 25.66053 ? 659  LYS A CE    1 
ATOM   3411 N  NZ    . LYS C 3 355 ? 5.09100   89.66400  22.21800  1.000 44.85634 ? 659  LYS A NZ    1 
ATOM   3412 N  N     . THR C 3 356 ? 11.70300  93.20400  20.01600  1.000 20.91808 ? 660  THR A N     1 
ATOM   3413 C  CA    . THR C 3 356 ? 13.11600  92.95200  19.75500  1.000 23.93849 ? 660  THR A CA    1 
ATOM   3414 C  C     . THR C 3 356 ? 13.37700  91.44700  19.79700  1.000 25.82019 ? 660  THR A C     1 
ATOM   3415 O  O     . THR C 3 356 ? 12.51300  90.65200  20.18600  1.000 23.07975 ? 660  THR A O     1 
ATOM   3416 C  CB    . THR C 3 356 ? 14.03000  93.63400  20.78800  1.000 22.77615 ? 660  THR A CB    1 
ATOM   3417 O  OG1   . THR C 3 356 ? 13.64300  93.24300  22.10200  1.000 18.67621 ? 660  THR A OG1   1 
ATOM   3418 C  CG2   . THR C 3 356 ? 13.94900  95.15300  20.69000  1.000 23.38752 ? 660  THR A CG2   1 
ATOM   3419 N  N     . THR C 3 357 ? 14.60300  91.05800  19.43400  1.000 18.12369 ? 661  THR A N     1 
ATOM   3420 C  CA    . THR C 3 357 ? 14.98100  89.65100  19.44800  1.000 17.60007 ? 661  THR A CA    1 
ATOM   3421 C  C     . THR C 3 357 ? 16.31200  89.45400  20.16100  1.000 19.30679 ? 661  THR A C     1 
ATOM   3422 O  O     . THR C 3 357 ? 17.25400  90.24900  20.00200  1.000 20.26074 ? 661  THR A O     1 
ATOM   3423 C  CB    . THR C 3 357 ? 15.04500  89.04400  18.02400  1.000 20.46839 ? 661  THR A CB    1 
ATOM   3424 O  OG1   . THR C 3 357 ? 15.33600  87.64300  18.12500  1.000 18.86959 ? 661  THR A OG1   1 
ATOM   3425 C  CG2   . THR C 3 357 ? 16.13800  89.70200  17.17800  1.000 18.83433 ? 661  THR A CG2   1 
ATOM   3426 N  N     . SER C 3 358 ? 16.38200  88.36000  20.92500  1.000 20.41985 ? 662  SER A N     1 
ATOM   3427 C  CA    . SER C 3 358 ? 17.52000  88.03900  21.77300  1.000 27.09064 ? 662  SER A CA    1 
ATOM   3428 C  C     . SER C 3 358 ? 18.31800  86.83100  21.30000  1.000 23.03801 ? 662  SER A C     1 
ATOM   3429 O  O     . SER C 3 358 ? 19.36600  86.52600  21.88500  1.000 18.11827 ? 662  SER A O     1 
ATOM   3430 C  CB    . SER C 3 358 ? 17.03600  87.78000  23.20500  1.000 23.69643 ? 662  SER A CB    1 
ATOM   3431 O  OG    . SER C 3 358 ? 16.37700  86.52800  23.25800  1.000 30.20318 ? 662  SER A OG    1 
ATOM   3432 N  N     . GLN C 3 359 ? 17.85400  86.12800  20.27400  1.000 21.88578 ? 663  GLN A N     1 
ATOM   3433 C  CA    . GLN C 3 359 ? 18.54800  84.92900  19.83500  1.000 16.71444 ? 663  GLN A CA    1 
ATOM   3434 C  C     . GLN C 3 359 ? 18.18700  84.68200  18.39400  1.000 21.83874 ? 663  GLN A C     1 
ATOM   3435 O  O     . GLN C 3 359 ? 17.00900  84.74700  18.04000  1.000 17.78742 ? 663  GLN A O     1 
ATOM   3436 C  CB    . GLN C 3 359 ? 18.15000  83.71600  20.65200  1.000 20.61636 ? 663  GLN A CB    1 
ATOM   3437 C  CG    . GLN C 3 359 ? 18.83900  82.44600  20.18600  1.000 26.66768 ? 663  GLN A CG    1 
ATOM   3438 C  CD    . GLN C 3 359 ? 18.27800  81.22300  20.87000  1.000 27.81440 ? 663  GLN A CD    1 
ATOM   3439 O  OE1   . GLN C 3 359 ? 17.06800  81.09500  21.01100  1.000 23.00677 ? 663  GLN A OE1   1 
ATOM   3440 N  NE2   . GLN C 3 359 ? 19.15400  80.32200  21.30500  1.000 29.36621 ? 663  GLN A NE2   1 
ATOM   3441 N  N     . ILE C 3 360 ? 19.18800  84.39400  17.57100  1.000 18.91275 ? 664  ILE A N     1 
ATOM   3442 C  CA    . ILE C 3 360 ? 18.94500  84.17800  16.15800  1.000 12.49490 ? 664  ILE A CA    1 
ATOM   3443 C  C     . ILE C 3 360 ? 19.56600  82.85800  15.74800  1.000 18.36261 ? 664  ILE A C     1 
ATOM   3444 O  O     . ILE C 3 360 ? 20.48800  82.34900  16.39000  1.000 18.06542 ? 664  ILE A O     1 
ATOM   3445 C  CB    . ILE C 3 360 ? 19.48000  85.33400  15.31200  1.000 9.59231  ? 664  ILE A CB    1 
ATOM   3446 C  CG1   . ILE C 3 360 ? 21.00800  85.38100  15.37200  1.000 17.59733 ? 664  ILE A CG1   1 
ATOM   3447 C  CG2   . ILE C 3 360 ? 18.88200  86.65000  15.84300  1.000 13.59635 ? 664  ILE A CG2   1 
ATOM   3448 C  CD1   . ILE C 3 360 ? 21.59700  86.54400  14.61900  1.000 13.86256 ? 664  ILE A CD1   1 
ATOM   3449 N  N     . THR C 3 361 ? 19.02800  82.29500  14.67400  1.000 13.42237 ? 665  THR A N     1 
ATOM   3450 C  CA    . THR C 3 361 ? 19.54000  81.06000  14.11300  1.000 14.84074 ? 665  THR A CA    1 
ATOM   3451 C  C     . THR C 3 361 ? 19.67200  81.20400  12.60400  1.000 17.55533 ? 665  THR A C     1 
ATOM   3452 O  O     . THR C 3 361 ? 18.83000  81.82200  11.94400  1.000 13.03686 ? 665  THR A O     1 
ATOM   3453 C  CB    . THR C 3 361 ? 18.62400  79.86600  14.43400  1.000 16.46057 ? 665  THR A CB    1 
ATOM   3454 O  OG1   . THR C 3 361 ? 18.50300  79.70800  15.84700  1.000 18.24061 ? 665  THR A OG1   1 
ATOM   3455 C  CG2   . THR C 3 361 ? 19.18500  78.59500  13.85100  1.000 15.32519 ? 665  THR A CG2   1 
ATOM   3456 N  N     . LEU C 3 362 ? 20.72700  80.61800  12.06500  1.000 15.79619 ? 666  LEU A N     1 
ATOM   3457 C  CA    . LEU C 3 362 ? 20.83000  80.35500  10.64300  1.000 17.02802 ? 666  LEU A CA    1 
ATOM   3458 C  C     . LEU C 3 362 ? 20.83100  78.85400  10.42100  1.000 20.66883 ? 666  LEU A C     1 
ATOM   3459 O  O     . LEU C 3 362 ? 21.60200  78.12100  11.05800  1.000 19.71844 ? 666  LEU A O     1 
ATOM   3460 C  CB    . LEU C 3 362 ? 22.09300  80.96500  10.05000  1.000 16.83377 ? 666  LEU A CB    1 
ATOM   3461 C  CG    . LEU C 3 362 ? 22.16900  80.79500  8.53100   1.000 19.60562 ? 666  LEU A CG    1 
ATOM   3462 C  CD1   . LEU C 3 362 ? 22.60900  82.08200  7.90100   1.000 15.56003 ? 666  LEU A CD1   1 
ATOM   3463 C  CD2   . LEU C 3 362 ? 23.11200  79.64800  8.12700   1.000 18.09101 ? 666  LEU A CD2   1 
ATOM   3464 N  N     . LYS C 3 363 ? 19.99100  78.40200  9.50800   1.000 15.63701 ? 667  LYS A N     1 
ATOM   3465 C  CA    . LYS C 3 363 ? 20.03000  77.02400  9.07100   1.000 15.51411 ? 667  LYS A CA    1 
ATOM   3466 C  C     . LYS C 3 363 ? 20.21100  77.02100  7.56600   1.000 16.72545 ? 667  LYS A C     1 
ATOM   3467 O  O     . LYS C 3 363 ? 19.82800  77.97200  6.88600   1.000 19.77830 ? 667  LYS A O     1 
ATOM   3468 C  CB    . LYS C 3 363 ? 18.75000  76.25500  9.45000   1.000 19.91575 ? 667  LYS A CB    1 
ATOM   3469 C  CG    . LYS C 3 363 ? 18.71900  74.85100  8.84100   1.000 29.48056 ? 667  LYS A CG    1 
ATOM   3470 C  CD    . LYS C 3 363 ? 18.31000  74.82100  7.37500   1.000 30.33024 ? 667  LYS A CD    1 
ATOM   3471 C  CE    . LYS C 3 363 ? 16.81500  74.71400  7.24700   1.000 51.72595 ? 667  LYS A CE    1 
ATOM   3472 N  NZ    . LYS C 3 363 ? 16.38200  73.42400  7.85000   1.000 50.97730 ? 667  LYS A NZ    1 
ATOM   3473 N  N     . LEU C 3 364 ? 20.81200  75.95200  7.05400   1.000 17.28408 ? 668  LEU A N     1 
ATOM   3474 C  CA    . LEU C 3 364 ? 21.05300  75.81400  5.62900   1.000 17.17490 ? 668  LEU A CA    1 
ATOM   3475 C  C     . LEU C 3 364 ? 20.88500  74.35800  5.21700   1.000 13.12327 ? 668  LEU A C     1 
ATOM   3476 O  O     . LEU C 3 364 ? 20.92500  73.44200  6.03500   1.000 11.74253 ? 668  LEU A O     1 
ATOM   3477 C  CB    . LEU C 3 364 ? 22.44300  76.33700  5.23300   1.000 15.55426 ? 668  LEU A CB    1 
ATOM   3478 C  CG    . LEU C 3 364 ? 23.73500  75.71000  5.79600   1.000 19.38142 ? 668  LEU A CG    1 
ATOM   3479 C  CD1   . LEU C 3 364 ? 24.16100  74.45500  5.05800   1.000 14.97769 ? 668  LEU A CD1   1 
ATOM   3480 C  CD2   . LEU C 3 364 ? 24.85900  76.72100  5.72900   1.000 19.61624 ? 668  LEU A CD2   1 
ATOM   3481 N  N     . MET C 3 365 ? 20.68400  74.17900  3.92400   1.000 15.54086 ? 669  MET A N     1 
ATOM   3482 C  CA    . MET C 3 365 ? 20.66900  72.88500  3.27400   1.000 18.93566 ? 669  MET A CA    1 
ATOM   3483 C  C     . MET C 3 365 ? 21.85200  72.84600  2.32400   1.000 18.10692 ? 669  MET A C     1 
ATOM   3484 O  O     . MET C 3 365 ? 22.06800  73.80000  1.56400   1.000 16.92370 ? 669  MET A O     1 
ATOM   3485 C  CB    . MET C 3 365 ? 19.36100  72.68000  2.51000   1.000 16.02850 ? 669  MET A CB    1 
ATOM   3486 C  CG    . MET C 3 365 ? 18.12800  72.65200  3.39700   1.000 18.09946 ? 669  MET A CG    1 
ATOM   3487 S  SD    . MET C 3 365 ? 18.14100  71.20300  4.46000   1.000 30.70301 ? 669  MET A SD    1 
ATOM   3488 C  CE    . MET C 3 365 ? 16.80200  70.24200  3.75100   1.000 33.98914 ? 669  MET A CE    1 
ATOM   3489 N  N     . ARG C 3 366 ? 22.61600  71.76100  2.37100   1.000 14.46226 ? 670  ARG A N     1 
ATOM   3490 C  CA    . ARG C 3 366 ? 23.77200  71.57700  1.50500   1.000 15.45701 ? 670  ARG A CA    1 
ATOM   3491 C  C     . ARG C 3 366 ? 23.62400  70.29100  0.71000   1.000 15.27976 ? 670  ARG A C     1 
ATOM   3492 O  O     . ARG C 3 366 ? 23.31700  69.23500  1.27400   1.000 15.84217 ? 670  ARG A O     1 
ATOM   3493 C  CB    . ARG C 3 366 ? 25.06900  71.52300  2.31000   1.000 17.26398 ? 670  ARG A CB    1 
ATOM   3494 C  CG    . ARG C 3 366 ? 26.30100  71.11400  1.49200   1.000 14.91037 ? 670  ARG A CG    1 
ATOM   3495 C  CD    . ARG C 3 366 ? 27.53300  71.13700  2.37900   1.000 14.76751 ? 670  ARG A CD    1 
ATOM   3496 N  NE    . ARG C 3 366 ? 28.75700  70.78300  1.66500   1.000 20.52995 ? 670  ARG A NE    1 
ATOM   3497 C  CZ    . ARG C 3 366 ? 29.99000  71.03900  2.10700   1.000 23.29203 ? 670  ARG A CZ    1 
ATOM   3498 N  NH1   . ARG C 3 366 ? 30.17600  71.65000  3.27600   1.000 20.78260 ? 670  ARG A NH1   1 
ATOM   3499 N  NH2   . ARG C 3 366 ? 31.04200  70.68200  1.37800   1.000 22.88455 ? 670  ARG A NH2   1 
ATOM   3500 N  N     . ARG C 3 367 ? 23.88600  70.38300  -0.58600  1.000 16.60514 ? 671  ARG A N     1 
ATOM   3501 C  CA    . ARG C 3 367 ? 23.84500  69.22400  -1.46200  1.000 16.96791 ? 671  ARG A CA    1 
ATOM   3502 C  C     . ARG C 3 367 ? 24.60800  68.05200  -0.85800  1.000 21.19054 ? 671  ARG A C     1 
ATOM   3503 O  O     . ARG C 3 367 ? 25.74900  68.19900  -0.40400  1.000 13.68456 ? 671  ARG A O     1 
ATOM   3504 C  CB    . ARG C 3 367 ? 24.43500  69.59500  -2.81500  1.000 13.57440 ? 671  ARG A CB    1 
ATOM   3505 C  CG    . ARG C 3 367 ? 24.41900  68.48100  -3.81800  1.000 17.92473 ? 671  ARG A CG    1 
ATOM   3506 C  CD    . ARG C 3 367 ? 25.23700  68.89100  -5.00900  1.000 19.48655 ? 671  ARG A CD    1 
ATOM   3507 N  NE    . ARG C 3 367 ? 26.66700  68.90900  -4.69600  1.000 21.42772 ? 671  ARG A NE    1 
ATOM   3508 C  CZ    . ARG C 3 367 ? 27.48600  67.85500  -4.77000  1.000 26.10593 ? 671  ARG A CZ    1 
ATOM   3509 N  NH1   . ARG C 3 367 ? 27.03500  66.66000  -5.16300  1.000 16.09843 ? 671  ARG A NH1   1 
ATOM   3510 N  NH2   . ARG C 3 367 ? 28.77400  67.99900  -4.45400  1.000 17.15561 ? 671  ARG A NH2   1 
ATOM   3511 N  N     . CYS C 3 368 ? 23.93600  66.90600  -0.80200  1.000 19.55684 ? 672  CYS A N     1 
ATOM   3512 C  CA    . CYS C 3 368 ? 24.57400  65.66600  -0.39300  1.000 19.85549 ? 672  CYS A CA    1 
ATOM   3513 C  C     . CYS C 3 368 ? 25.72600  65.36000  -1.33800  1.000 24.01594 ? 672  CYS A C     1 
ATOM   3514 O  O     . CYS C 3 368 ? 25.62500  65.60300  -2.54300  1.000 19.57893 ? 672  CYS A O     1 
ATOM   3515 C  CB    . CYS C 3 368 ? 23.54900  64.53800  -0.41100  1.000 24.18987 ? 672  CYS A CB    1 
ATOM   3516 S  SG    . CYS C 3 368 ? 22.48700  64.57100  1.03100   1.000 24.74314 ? 672  CYS A SG    1 
ATOM   3517 N  N     . LYS C 3 369 ? 26.83300  64.83100  -0.79100  1.000 22.84052 ? 673  LYS A N     1 
ATOM   3518 C  CA    . LYS C 3 369 ? 28.04200  64.69500  -1.60400  1.000 21.60927 ? 673  LYS A CA    1 
ATOM   3519 C  C     . LYS C 3 369 ? 27.81000  63.85500  -2.85100  1.000 16.68948 ? 673  LYS A C     1 
ATOM   3520 O  O     . LYS C 3 369 ? 28.48100  64.06700  -3.87100  1.000 19.47355 ? 673  LYS A O     1 
ATOM   3521 C  CB    . LYS C 3 369 ? 29.19200  64.09000  -0.79200  1.000 28.86185 ? 673  LYS A CB    1 
ATOM   3522 N  N     . ASP C 3 370 ? 26.87000  62.91300  -2.80300  1.000 16.39922 ? 674  ASP A N     1 
ATOM   3523 C  CA    . ASP C 3 370 ? 26.57500  62.05700  -3.94500  1.000 24.80751 ? 674  ASP A CA    1 
ATOM   3524 C  C     . ASP C 3 370 ? 25.28500  62.43300  -4.67700  1.000 22.43518 ? 674  ASP A C     1 
ATOM   3525 O  O     . ASP C 3 370 ? 24.78700  61.63400  -5.47900  1.000 19.96047 ? 674  ASP A O     1 
ATOM   3526 C  CB    . ASP C 3 370 ? 26.50200  60.60300  -3.48700  1.000 28.16094 ? 674  ASP A CB    1 
ATOM   3527 C  CG    . ASP C 3 370 ? 25.33400  60.35200  -2.55700  1.000 31.84919 ? 674  ASP A CG    1 
ATOM   3528 O  OD1   . ASP C 3 370 ? 24.79500  61.33400  -1.99800  1.000 37.31175 ? 674  ASP A OD1   1 
ATOM   3529 O  OD2   . ASP C 3 370 ? 24.95200  59.17800  -2.38600  1.000 36.35422 ? 674  ASP A OD2   1 
ATOM   3530 N  N     . ALA C 3 371 ? 24.72400  63.61500  -4.41300  1.000 17.19243 ? 675  ALA A N     1 
ATOM   3531 C  CA    . ALA C 3 371 ? 23.52300  64.02000  -5.13100  1.000 17.06179 ? 675  ALA A CA    1 
ATOM   3532 C  C     . ALA C 3 371 ? 23.89000  64.86200  -6.34900  1.000 19.68583 ? 675  ALA A C     1 
ATOM   3533 O  O     . ALA C 3 371 ? 24.89700  65.57600  -6.33600  1.000 22.15154 ? 675  ALA A O     1 
ATOM   3534 C  CB    . ALA C 3 371 ? 22.59000  64.81700  -4.21300  1.000 16.55887 ? 675  ALA A CB    1 
ATOM   3535 N  N     . PRO C 3 372 ? 23.10900  64.79900  -7.42100  1.000 23.75341 ? 676  PRO A N     1 
ATOM   3536 C  CA    . PRO C 3 372 ? 23.43000  65.60000  -8.60000  1.000 19.48244 ? 676  PRO A CA    1 
ATOM   3537 C  C     . PRO C 3 372 ? 23.32300  67.08900  -8.30900  1.000 22.46473 ? 676  PRO A C     1 
ATOM   3538 O  O     . PRO C 3 372 ? 22.49900  67.53800  -7.50400  1.000 21.55764 ? 676  PRO A O     1 
ATOM   3539 C  CB    . PRO C 3 372 ? 22.37600  65.16100  -9.61800  1.000 19.81090 ? 676  PRO A CB    1 
ATOM   3540 C  CG    . PRO C 3 372 ? 21.20700  64.75100  -8.76800  1.000 23.96503 ? 676  PRO A CG    1 
ATOM   3541 C  CD    . PRO C 3 372 ? 21.84900  64.05200  -7.59600  1.000 23.46301 ? 676  PRO A CD    1 
ATOM   3542 N  N     . ILE C 3 373 ? 24.18000  67.85700  -8.97800  1.000 20.28019 ? 677  ILE A N     1 
ATOM   3543 C  CA    . ILE C 3 373 ? 24.13000  69.31000  -8.83700  1.000 23.24726 ? 677  ILE A CA    1 
ATOM   3544 C  C     . ILE C 3 373 ? 22.76300  69.83500  -9.24500  1.000 27.73646 ? 677  ILE A C     1 
ATOM   3545 O  O     . ILE C 3 373 ? 22.24400  70.79100  -8.64900  1.000 25.28837 ? 677  ILE A O     1 
ATOM   3546 C  CB    . ILE C 3 373 ? 25.23600  69.97500  -9.66700  1.000 22.45672 ? 677  ILE A CB    1 
ATOM   3547 C  CG1   . ILE C 3 373 ? 26.59600  69.34900  -9.35300  1.000 31.75740 ? 677  ILE A CG1   1 
ATOM   3548 C  CG2   . ILE C 3 373 ? 25.23900  71.47900  -9.42000  1.000 28.66102 ? 677  ILE A CG2   1 
ATOM   3549 C  CD1   . ILE C 3 373 ? 26.95600  69.39600  -7.91800  1.000 23.62177 ? 677  ILE A CD1   1 
ATOM   3550 N  N     . GLU C 3 374 ? 22.21100  69.22600  -10.29000 1.000 23.52912 ? 678  GLU A N     1 
ATOM   3551 C  CA    . GLU C 3 374 ? 20.85900  69.61800  -10.73200 1.000 24.78583 ? 678  GLU A CA    1 
ATOM   3552 C  C     . GLU C 3 374 ? 19.89800  68.48200  -10.40300 1.000 27.38097 ? 678  GLU A C     1 
ATOM   3553 O  O     . GLU C 3 374 ? 19.98400  67.44600  -10.99300 1.000 22.68863 ? 678  GLU A O     1 
ATOM   3554 C  CB    . GLU C 3 374 ? 20.84600  70.20200  -12.13600 1.000 30.29726 ? 678  GLU A CB    1 
ATOM   3555 C  CG    . GLU C 3 374 ? 21.26100  71.66700  -12.15600 1.000 29.77993 ? 678  GLU A CG    1 
ATOM   3556 C  CD    . GLU C 3 374 ? 20.65600  72.63500  -11.14300 1.000 35.61152 ? 678  GLU A CD    1 
ATOM   3557 O  OE1   . GLU C 3 374 ? 19.57300  72.38800  -10.67400 1.000 35.58883 ? 678  GLU A OE1   1 
ATOM   3558 O  OE2   . GLU C 3 374 ? 21.26700  73.63700  -10.85800 1.000 31.91033 ? 678  GLU A OE2   1 
ATOM   3559 N  N     . PRO C 3 375 ? 19.00500  68.68900  -9.42800  1.000 28.07228 ? 679  PRO A N     1 
ATOM   3560 C  CA    . PRO C 3 375 ? 18.08200  67.66700  -9.00300  1.000 27.74247 ? 679  PRO A CA    1 
ATOM   3561 C  C     . PRO C 3 375 ? 16.88000  67.48700  -9.94800  1.000 22.11187 ? 679  PRO A C     1 
ATOM   3562 O  O     . PRO C 3 375 ? 16.72500  68.25200  -10.82300 1.000 18.38097 ? 679  PRO A O     1 
ATOM   3563 C  CB    . PRO C 3 375 ? 17.64200  68.14000  -7.62600  1.000 24.07096 ? 679  PRO A CB    1 
ATOM   3564 C  CG    . PRO C 3 375 ? 17.69700  69.62800  -7.73800  1.000 25.79943 ? 679  PRO A CG    1 
ATOM   3565 C  CD    . PRO C 3 375 ? 18.82600  69.92800  -8.69400  1.000 24.13309 ? 679  PRO A CD    1 
ATOM   3566 N  N     . PRO C 3 376 ? 16.11500  66.43400  -9.75400  1.000 22.94787 ? 680  PRO A N     1 
ATOM   3567 C  CA    . PRO C 3 376 ? 14.93700  66.14800  -10.58300 1.000 24.06470 ? 680  PRO A CA    1 
ATOM   3568 C  C     . PRO C 3 376 ? 14.01800  67.37600  -10.68700 1.000 25.02880 ? 680  PRO A C     1 
ATOM   3569 O  O     . PRO C 3 376 ? 13.67400  67.74100  -11.73700 1.000 20.72091 ? 680  PRO A O     1 
ATOM   3570 C  CB    . PRO C 3 376 ? 14.24900  64.96100  -9.89500  1.000 24.23649 ? 680  PRO A CB    1 
ATOM   3571 C  CG    . PRO C 3 376 ? 15.33500  64.32200  -9.06400  1.000 26.04438 ? 680  PRO A CG    1 
ATOM   3572 C  CD    . PRO C 3 376 ? 16.29600  65.42600  -8.72400  1.000 19.48697 ? 680  PRO A CD    1 
ATOM   3573 N  N     . LYS C 3 377 ? 13.71600  67.99800  -9.55700  1.000 22.37586 ? 681  LYS A N     1 
ATOM   3574 C  CA    . LYS C 3 377 ? 12.84600  69.19100  -9.59700  1.000 24.28225 ? 681  LYS A CA    1 
ATOM   3575 C  C     . LYS C 3 377 ? 13.66700  70.41900  -10.00900 1.000 16.97263 ? 681  LYS A C     1 
ATOM   3576 O  O     . LYS C 3 377 ? 14.64600  70.68100  -9.38000  1.000 20.86987 ? 681  LYS A O     1 
ATOM   3577 C  CB    . LYS C 3 377 ? 12.17100  69.43400  -8.24500  1.000 17.33268 ? 681  LYS A CB    1 
ATOM   3578 C  CG    . LYS C 3 377 ? 11.26000  70.64800  -8.16600  1.000 11.70055 ? 681  LYS A CG    1 
ATOM   3579 C  CD    . LYS C 3 377 ? 10.83000  71.02700  -6.77100  1.000 12.84303 ? 681  LYS A CD    1 
ATOM   3580 C  CE    . LYS C 3 377 ? 9.48600   71.72000  -6.66400  1.000 19.70553 ? 681  LYS A CE    1 
ATOM   3581 N  NZ    . LYS C 3 377 ? 8.33200   70.86900  -7.00100  1.000 13.91958 ? 681  LYS A NZ    1 
ATOM   3582 N  N     . TYR C 3 378 ? 13.22400  71.11600  -11.03900 1.000 18.06174 ? 682  TYR A N     1 
ATOM   3583 C  CA    . TYR C 3 378 ? 13.84100  72.37900  -11.43400 1.000 17.92465 ? 682  TYR A CA    1 
ATOM   3584 C  C     . TYR C 3 378 ? 13.93900  73.31400  -10.23900 1.000 17.46554 ? 682  TYR A C     1 
ATOM   3585 O  O     . TYR C 3 378 ? 12.96100  73.50400  -9.51000  1.000 18.06461 ? 682  TYR A O     1 
ATOM   3586 C  CB    . TYR C 3 378 ? 13.02400  73.03700  -12.54300 1.000 18.04645 ? 682  TYR A CB    1 
ATOM   3587 C  CG    . TYR C 3 378 ? 13.53300  74.40600  -12.94200 1.000 22.58079 ? 682  TYR A CG    1 
ATOM   3588 C  CD1   . TYR C 3 378 ? 14.73100  74.54900  -13.63000 1.000 18.78689 ? 682  TYR A CD1   1 
ATOM   3589 C  CD2   . TYR C 3 378 ? 12.81500  75.55500  -12.61800 1.000 14.95097 ? 682  TYR A CD2   1 
ATOM   3590 C  CE1   . TYR C 3 378 ? 15.19300  75.79500  -13.99400 1.000 21.37465 ? 682  TYR A CE1   1 
ATOM   3591 C  CE2   . TYR C 3 378 ? 13.26200  76.78900  -12.97300 1.000 22.77635 ? 682  TYR A CE2   1 
ATOM   3592 C  CZ    . TYR C 3 378 ? 14.45500  76.90900  -13.65500 1.000 24.37096 ? 682  TYR A CZ    1 
ATOM   3593 O  OH    . TYR C 3 378 ? 14.89600  78.15300  -14.00700 1.000 31.36408 ? 682  TYR A OH    1 
ATOM   3594 N  N     . MET C 3 379 ? 15.13600  73.85200  -10.01200 1.000 17.69615 ? 683  MET A N     1 
ATOM   3595 C  CA    . MET C 3 379 ? 15.45300  74.78800  -8.93100  1.000 14.89851 ? 683  MET A CA    1 
ATOM   3596 C  C     . MET C 3 379 ? 15.21300  74.19400  -7.54600  1.000 17.26521 ? 683  MET A C     1 
ATOM   3597 O  O     . MET C 3 379 ? 15.31300  74.90900  -6.53100  1.000 16.17357 ? 683  MET A O     1 
ATOM   3598 C  CB    . MET C 3 379 ? 14.67600  76.10400  -9.09400  1.000 13.90770 ? 683  MET A CB    1 
ATOM   3599 C  CG    . MET C 3 379 ? 15.30600  77.04900  -10.11600 1.000 19.61817 ? 683  MET A CG    1 
ATOM   3600 S  SD    . MET C 3 379 ? 17.06500  77.37600  -9.77400  1.000 19.41126 ? 683  MET A SD    1 
ATOM   3601 C  CE    . MET C 3 379 ? 17.81000  76.82300  -11.30300 1.000 20.34338 ? 683  MET A CE    1 
ATOM   3602 N  N     . GLY C 3 380 ? 14.92400  72.89800  -7.47100  1.000 17.49470 ? 684  GLY A N     1 
ATOM   3603 C  CA    . GLY C 3 380 ? 14.72500  72.25600  -6.19300  1.000 10.60005 ? 684  GLY A CA    1 
ATOM   3604 C  C     . GLY C 3 380 ? 16.00700  72.15100  -5.40200  1.000 16.90828 ? 684  GLY A C     1 
ATOM   3605 O  O     . GLY C 3 380 ? 17.10900  72.23300  -5.93400  1.000 16.05473 ? 684  GLY A O     1 
ATOM   3606 N  N     . MET C 3 381 ? 15.84300  71.97300  -4.09300  1.000 18.92593 ? 685  MET A N     1 
ATOM   3607 C  CA    . MET C 3 381 ? 16.99500  71.76400  -3.22700  1.000 16.43664 ? 685  MET A CA    1 
ATOM   3608 C  C     . MET C 3 381 ? 17.58000  70.36800  -3.40800  1.000 21.56611 ? 685  MET A C     1 
ATOM   3609 O  O     . MET C 3 381 ? 18.77300  70.16600  -3.15800  1.000 13.40212 ? 685  MET A O     1 
ATOM   3610 C  CB    . MET C 3 381 ? 16.59900  72.00500  -1.76500  1.000 16.99256 ? 685  MET A CB    1 
ATOM   3611 C  CG    . MET C 3 381 ? 15.56500  71.01300  -1.21200  1.000 19.20629 ? 685  MET A CG    1 
ATOM   3612 S  SD    . MET C 3 381 ? 15.44300  71.10600  0.58300   1.000 27.81766 ? 685  MET A SD    1 
ATOM   3613 C  CE    . MET C 3 381 ? 13.72500  71.52000  0.79000   1.000 31.87941 ? 685  MET A CE    1 
ATOM   3614 N  N     . GLY C 3 382 ? 16.76700  69.39800  -3.85300  1.000 15.53400 ? 686  GLY A N     1 
ATOM   3615 C  CA    . GLY C 3 382 ? 17.23100  68.02300  -3.94700  1.000 17.58711 ? 686  GLY A CA    1 
ATOM   3616 C  C     . GLY C 3 382 ? 17.54300  67.40700  -2.58500  1.000 18.31629 ? 686  GLY A C     1 
ATOM   3617 O  O     . GLY C 3 382 ? 17.11400  67.88900  -1.53000  1.000 16.00271 ? 686  GLY A O     1 
ATOM   3618 N  N     . ARG C 3 383 ? 18.32300  66.32400  -2.62100  1.000 17.31874 ? 687  ARG A N     1 
ATOM   3619 C  CA    . ARG C 3 383 ? 18.74500  65.63700  -1.39600  1.000 22.34253 ? 687  ARG A CA    1 
ATOM   3620 C  C     . ARG C 3 383 ? 19.86700  66.41400  -0.71700  1.000 20.67554 ? 687  ARG A C     1 
ATOM   3621 O  O     . ARG C 3 383 ? 20.91500  66.65800  -1.32500  1.000 18.50362 ? 687  ARG A O     1 
ATOM   3622 C  CB    . ARG C 3 383 ? 19.23300  64.21100  -1.68200  1.000 23.74476 ? 687  ARG A CB    1 
ATOM   3623 C  CG    . ARG C 3 383 ? 18.31300  63.32400  -2.49400  1.000 27.40015 ? 687  ARG A CG    1 
ATOM   3624 C  CD    . ARG C 3 383 ? 18.92900  61.92700  -2.70500  1.000 31.56257 ? 687  ARG A CD    1 
ATOM   3625 N  NE    . ARG C 3 383 ? 19.96700  61.60200  -1.72100  1.000 39.04160 ? 687  ARG A NE    1 
ATOM   3626 C  CZ    . ARG C 3 383 ? 21.24800  61.36500  -2.00700  1.000 28.86498 ? 687  ARG A CZ    1 
ATOM   3627 N  NH1   . ARG C 3 383 ? 21.68100  61.39900  -3.25900  1.000 31.79762 ? 687  ARG A NH1   1 
ATOM   3628 N  NH2   . ARG C 3 383 ? 22.09700  61.07800  -1.02900  1.000 32.51399 ? 687  ARG A NH2   1 
ATOM   3629 N  N     . CYS C 3 384 ? 19.66900  66.74500  0.56300   1.000 19.70411 ? 688  CYS A N     1 
ATOM   3630 C  CA    . CYS C 3 384 ? 20.51900  67.69200  1.26700   1.000 20.11411 ? 688  CYS A CA    1 
ATOM   3631 C  C     . CYS C 3 384 ? 20.76400  67.23900  2.69500   1.000 21.63882 ? 688  CYS A C     1 
ATOM   3632 O  O     . CYS C 3 384 ? 19.98200  66.48100  3.26900   1.000 24.79328 ? 688  CYS A O     1 
ATOM   3633 C  CB    . CYS C 3 384 ? 19.87800  69.08500  1.31100   1.000 18.56735 ? 688  CYS A CB    1 
ATOM   3634 S  SG    . CYS C 3 384 ? 19.91200  69.89200  -0.26800  1.000 17.57404 ? 688  CYS A SG    1 
ATOM   3635 N  N     . ASP C 3 385 ? 21.86500  67.73300  3.26400   1.000 23.93804 ? 689  ASP A N     1 
ATOM   3636 C  CA    . ASP C 3 385 ? 22.11400  67.67100  4.69500   1.000 21.31440 ? 689  ASP A CA    1 
ATOM   3637 C  C     . ASP C 3 385 ? 21.81500  69.03500  5.30800   1.000 24.57286 ? 689  ASP A C     1 
ATOM   3638 O  O     . ASP C 3 385 ? 22.11700  70.07400  4.71100   1.000 17.88507 ? 689  ASP A O     1 
ATOM   3639 C  CB    . ASP C 3 385 ? 23.55700  67.26800  5.00300   1.000 20.98343 ? 689  ASP A CB    1 
ATOM   3640 C  CG    . ASP C 3 385 ? 23.99200  66.02300  4.25100   1.000 23.85743 ? 689  ASP A CG    1 
ATOM   3641 O  OD1   . ASP C 3 385 ? 23.35700  64.96800  4.44400   1.000 19.63490 ? 689  ASP A OD1   1 
ATOM   3642 O  OD2   . ASP C 3 385 ? 24.96400  66.11100  3.45700   1.000 23.34767 ? 689  ASP A OD2   1 
ATOM   3643 N  N     . SER C 3 386 ? 21.21500  69.01200  6.49400   1.000 15.74712 ? 690  SER A N     1 
ATOM   3644 C  CA    . SER C 3 386 ? 20.85000  70.19900  7.24900   1.000 20.99286 ? 690  SER A CA    1 
ATOM   3645 C  C     . SER C 3 386 ? 21.93000  70.52000  8.26600   1.000 24.76295 ? 690  SER A C     1 
ATOM   3646 O  O     . SER C 3 386 ? 22.45500  69.62400  8.93000   1.000 25.16745 ? 690  SER A O     1 
ATOM   3647 C  CB    . SER C 3 386 ? 19.52500  69.99100  7.98800   1.000 29.30295 ? 690  SER A CB    1 
ATOM   3648 O  OG    . SER C 3 386 ? 18.42000  70.42900  7.21100   1.000 41.11033 ? 690  SER A OG    1 
ATOM   3649 N  N     . PHE C 3 387 ? 22.24300  71.80800  8.38800   1.000 16.57221 ? 691  PHE A N     1 
ATOM   3650 C  CA    . PHE C 3 387 ? 23.16500  72.33500  9.37800   1.000 22.80074 ? 691  PHE A CA    1 
ATOM   3651 C  C     . PHE C 3 387 ? 22.50900  73.55000  10.01000  1.000 22.46294 ? 691  PHE A C     1 
ATOM   3652 O  O     . PHE C 3 387 ? 21.91900  74.37300  9.30800   1.000 22.01882 ? 691  PHE A O     1 
ATOM   3653 C  CB    . PHE C 3 387 ? 24.50800  72.77600  8.76100   1.000 25.79011 ? 691  PHE A CB    1 
ATOM   3654 C  CG    . PHE C 3 387 ? 25.27700  71.67500  8.08900   1.000 23.66097 ? 691  PHE A CG    1 
ATOM   3655 C  CD1   . PHE C 3 387 ? 24.83000  71.11600  6.90400   1.000 29.83535 ? 691  PHE A CD1   1 
ATOM   3656 C  CD2   . PHE C 3 387 ? 26.47500  71.23400  8.62200   1.000 35.90305 ? 691  PHE A CD2   1 
ATOM   3657 C  CE1   . PHE C 3 387 ? 25.54100  70.10000  6.27800   1.000 31.65171 ? 691  PHE A CE1   1 
ATOM   3658 C  CE2   . PHE C 3 387 ? 27.20300  70.23300  8.00000   1.000 40.35640 ? 691  PHE A CE2   1 
ATOM   3659 C  CZ    . PHE C 3 387 ? 26.73000  69.65900  6.82600   1.000 39.34446 ? 691  PHE A CZ    1 
ATOM   3660 N  N     . SER C 3 388 ? 22.63900  73.69000  11.31900  1.000 17.14688 ? 692  SER A N     1 
ATOM   3661 C  CA    . SER C 3 388 ? 22.02400  74.81400  12.00800  1.000 27.01993 ? 692  SER A CA    1 
ATOM   3662 C  C     . SER C 3 388 ? 22.94800  75.28000  13.11900  1.000 20.66134 ? 692  SER A C     1 
ATOM   3663 O  O     . SER C 3 388 ? 23.66900  74.47900  13.70900  1.000 20.98969 ? 692  SER A O     1 
ATOM   3664 C  CB    . SER C 3 388 ? 20.65300  74.42100  12.56000  1.000 22.30470 ? 692  SER A CB    1 
ATOM   3665 O  OG    . SER C 3 388 ? 20.37500  75.11600  13.75000  1.000 32.04713 ? 692  SER A OG    1 
ATOM   3666 N  N     . ARG C 3 389 ? 22.95400  76.58800  13.37100  1.000 23.43082 ? 693  ARG A N     1 
ATOM   3667 C  CA    . ARG C 3 389 ? 23.68000  77.15300  14.50600  1.000 18.72055 ? 693  ARG A CA    1 
ATOM   3668 C  C     . ARG C 3 389 ? 22.99400  78.44100  14.94800  1.000 23.56332 ? 693  ARG A C     1 
ATOM   3669 O  O     . ARG C 3 389 ? 22.52200  79.22700  14.11900  1.000 19.30252 ? 693  ARG A O     1 
ATOM   3670 C  CB    . ARG C 3 389 ? 25.15100  77.43000  14.18100  1.000 23.67027 ? 693  ARG A CB    1 
ATOM   3671 C  CG    . ARG C 3 389 ? 25.96900  77.92400  15.38400  1.000 26.75992 ? 693  ARG A CG    1 
ATOM   3672 C  CD    . ARG C 3 389 ? 27.33100  77.27800  15.43800  1.000 37.56416 ? 693  ARG A CD    1 
ATOM   3673 N  NE    . ARG C 3 389 ? 28.19900  77.87600  16.45600  1.000 52.21076 ? 693  ARG A NE    1 
ATOM   3674 C  CZ    . ARG C 3 389 ? 28.70500  79.10700  16.39300  1.000 40.55160 ? 693  ARG A CZ    1 
ATOM   3675 N  NH1   . ARG C 3 389 ? 28.43200  79.89700  15.36100  1.000 47.00068 ? 693  ARG A NH1   1 
ATOM   3676 N  NH2   . ARG C 3 389 ? 29.48700  79.55200  17.36400  1.000 44.15406 ? 693  ARG A NH2   1 
ATOM   3677 N  N     . SER C 3 390 ? 22.94600  78.65200  16.25600  1.000 19.63726 ? 694  SER A N     1 
ATOM   3678 C  CA    . SER C 3 390 ? 22.25100  79.78600  16.82700  1.000 17.52663 ? 694  SER A CA    1 
ATOM   3679 C  C     . SER C 3 390 ? 23.22900  80.61700  17.64500  1.000 21.05180 ? 694  SER A C     1 
ATOM   3680 O  O     . SER C 3 390 ? 24.35200  80.20300  17.92900  1.000 22.30722 ? 694  SER A O     1 
ATOM   3681 C  CB    . SER C 3 390 ? 21.06800  79.33300  17.69200  1.000 22.93086 ? 694  SER A CB    1 
ATOM   3682 O  OG    . SER C 3 390 ? 21.49400  78.47400  18.72400  1.000 22.52362 ? 694  SER A OG    1 
ATOM   3683 N  N     A SER C 3 391 ? 22.77600  81.80600  18.02100  0.960 22.85166 ? 695  SER A N     1 
ATOM   3684 N  N     B SER C 3 391 ? 22.78700  81.81200  18.02700  0.040 22.72087 ? 695  SER A N     1 
ATOM   3685 C  CA    A SER C 3 391 ? 23.61300  82.76000  18.72600  0.960 22.15981 ? 695  SER A CA    1 
ATOM   3686 C  CA    B SER C 3 391 ? 23.64900  82.74000  18.75000  0.040 22.23222 ? 695  SER A CA    1 
ATOM   3687 C  C     A SER C 3 391 ? 22.72800  83.60700  19.62800  0.960 21.88505 ? 695  SER A C     1 
ATOM   3688 C  C     B SER C 3 391 ? 22.79200  83.65400  19.61200  0.040 21.98078 ? 695  SER A C     1 
ATOM   3689 O  O     A SER C 3 391 ? 21.72200  84.15900  19.17000  0.960 21.04428 ? 695  SER A O     1 
ATOM   3690 O  O     B SER C 3 391 ? 21.87600  84.30900  19.10600  0.040 21.46027 ? 695  SER A O     1 
ATOM   3691 C  CB    A SER C 3 391 ? 24.39100  83.62500  17.72200  0.960 22.90106 ? 695  SER A CB    1 
ATOM   3692 C  CB    B SER C 3 391 ? 24.50400  83.55500  17.77300  0.040 23.00828 ? 695  SER A CB    1 
ATOM   3693 O  OG    A SER C 3 391 ? 24.85400  84.82400  18.30200  0.960 28.24829 ? 695  SER A OG    1 
ATOM   3694 O  OG    B SER C 3 391 ? 24.86700  84.80600  18.32500  0.040 27.91765 ? 695  SER A OG    1 
ATOM   3695 N  N     . ARG C 3 392 ? 23.09100  83.69100  20.90900  1.000 25.64730 ? 696  ARG A N     1 
ATOM   3696 C  CA    . ARG C 3 392 ? 22.40600  84.59000  21.83500  1.000 21.31895 ? 696  ARG A CA    1 
ATOM   3697 C  C     . ARG C 3 392 ? 22.93800  86.00200  21.63400  1.000 22.64783 ? 696  ARG A C     1 
ATOM   3698 O  O     . ARG C 3 392 ? 24.15300  86.22300  21.62600  1.000 25.52551 ? 696  ARG A O     1 
ATOM   3699 C  CB    . ARG C 3 392 ? 22.61200  84.16100  23.29600  1.000 23.14533 ? 696  ARG A CB    1 
ATOM   3700 C  CG    . ARG C 3 392 ? 22.14300  82.75500  23.64400  1.000 30.08461 ? 696  ARG A CG    1 
ATOM   3701 C  CD    . ARG C 3 392 ? 20.63300  82.68700  23.68600  1.000 30.44212 ? 696  ARG A CD    1 
ATOM   3702 N  NE    . ARG C 3 392 ? 20.12800  81.35000  23.99100  1.000 33.15361 ? 696  ARG A NE    1 
ATOM   3703 C  CZ    . ARG C 3 392 ? 19.08600  81.11500  24.78600  1.000 40.17514 ? 696  ARG A CZ    1 
ATOM   3704 N  NH1   . ARG C 3 392 ? 18.46500  82.13200  25.35900  1.000 33.69797 ? 696  ARG A NH1   1 
ATOM   3705 N  NH2   . ARG C 3 392 ? 18.66300  79.87200  25.00400  1.000 36.86590 ? 696  ARG A NH2   1 
ATOM   3706 N  N     . LEU C 3 393 ? 22.04300  86.95300  21.43000  1.000 25.55164 ? 697  LEU A N     1 
ATOM   3707 C  CA    . LEU C 3 393 ? 22.48600  88.33200  21.35600  1.000 28.73231 ? 697  LEU A CA    1 
ATOM   3708 C  C     . LEU C 3 393 ? 22.63000  88.88100  22.77000  1.000 28.55428 ? 697  LEU A C     1 
ATOM   3709 O  O     . LEU C 3 393 ? 21.87600  88.51700  23.67700  1.000 35.74221 ? 697  LEU A O     1 
ATOM   3710 C  CB    . LEU C 3 393 ? 21.51000  89.16900  20.52600  1.000 20.60401 ? 697  LEU A CB    1 
ATOM   3711 C  CG    . LEU C 3 393 ? 21.28500  88.52700  19.15500  1.000 23.59723 ? 697  LEU A CG    1 
ATOM   3712 C  CD1   . LEU C 3 393 ? 20.35600  89.36600  18.28600  1.000 21.55117 ? 697  LEU A CD1   1 
ATOM   3713 C  CD2   . LEU C 3 393 ? 22.63300  88.27800  18.44900  1.000 19.79109 ? 697  LEU A CD2   1 
ATOM   3714 N  N     . GLY C 3 394 ? 23.63400  89.73100  22.96300  1.000 33.85044 ? 698  GLY A N     1 
ATOM   3715 C  CA    . GLY C 3 394 ? 23.85500  90.29900  24.27800  1.000 31.68764 ? 698  GLY A CA    1 
ATOM   3716 C  C     . GLY C 3 394 ? 22.61300  91.00000  24.78600  1.000 31.23825 ? 698  GLY A C     1 
ATOM   3717 O  O     . GLY C 3 394 ? 21.94100  90.53000  25.70600  1.000 34.80736 ? 698  GLY A O     1 
ATOM   3718 N  N     . ILE C 3 395 ? 22.28000  92.11100  24.14600  1.000 34.00581 ? 699  ILE A N     1 
ATOM   3719 C  CA    . ILE C 3 395 ? 21.09500  92.89600  24.47000  1.000 30.89038 ? 699  ILE A CA    1 
ATOM   3720 C  C     . ILE C 3 395 ? 20.02600  92.54200  23.44100  1.000 32.67301 ? 699  ILE A C     1 
ATOM   3721 O  O     . ILE C 3 395 ? 20.36900  92.29400  22.27500  1.000 24.87182 ? 699  ILE A O     1 
ATOM   3722 C  CB    . ILE C 3 395 ? 21.42900  94.39800  24.45900  1.000 29.78572 ? 699  ILE A CB    1 
ATOM   3723 C  CG1   . ILE C 3 395 ? 22.86900  94.63000  24.93900  1.000 28.19610 ? 699  ILE A CG1   1 
ATOM   3724 C  CG2   . ILE C 3 395 ? 20.44300  95.19000  25.30100  1.000 43.19140 ? 699  ILE A CG2   1 
ATOM   3725 C  CD1   . ILE C 3 395 ? 23.13400  94.17500  26.36400  1.000 34.28318 ? 699  ILE A CD1   1 
ATOM   3726 N  N     . PRO C 3 396 ? 18.74100  92.47600  23.80800  1.000 26.47267 ? 700  PRO A N     1 
ATOM   3727 C  CA    . PRO C 3 396 ? 17.70300  92.32000  22.77800  1.000 23.40286 ? 700  PRO A CA    1 
ATOM   3728 C  C     . PRO C 3 396 ? 17.71900  93.52600  21.85600  1.000 21.42407 ? 700  PRO A C     1 
ATOM   3729 O  O     . PRO C 3 396 ? 17.84400  94.66600  22.30700  1.000 24.56227 ? 700  PRO A O     1 
ATOM   3730 C  CB    . PRO C 3 396 ? 16.40100  92.24100  23.58100  1.000 23.31044 ? 700  PRO A CB    1 
ATOM   3731 C  CG    . PRO C 3 396 ? 16.81800  91.91800  24.99000  1.000 27.94497 ? 700  PRO A CG    1 
ATOM   3732 C  CD    . PRO C 3 396 ? 18.18200  92.50200  25.17100  1.000 22.35303 ? 700  PRO A CD    1 
ATOM   3733 N  N     . THR C 3 397 ? 17.60900  93.27300  20.55500  1.000 22.74445 ? 701  THR A N     1 
ATOM   3734 C  CA    . THR C 3 397 ? 17.81800  94.34000  19.58300  1.000 21.48328 ? 701  THR A CA    1 
ATOM   3735 C  C     . THR C 3 397 ? 16.91400  94.14700  18.36900  1.000 22.64767 ? 701  THR A C     1 
ATOM   3736 O  O     . THR C 3 397 ? 16.39000  93.05800  18.11800  1.000 15.71641 ? 701  THR A O     1 
ATOM   3737 C  CB    . THR C 3 397 ? 19.29200  94.40400  19.15300  1.000 18.49231 ? 701  THR A CB    1 
ATOM   3738 O  OG1   . THR C 3 397 ? 19.52900  95.61400  18.42800  1.000 23.08366 ? 701  THR A OG1   1 
ATOM   3739 C  CG2   . THR C 3 397 ? 19.66000  93.21000  18.26500  1.000 19.45551 ? 701  THR A CG2   1 
ATOM   3740 N  N     . ASN C 3 398 ? 16.71000  95.24100  17.63000  1.000 19.29643 ? 702  ASN A N     1 
ATOM   3741 C  CA    . ASN C 3 398 ? 16.17500  95.15700  16.27800  1.000 17.45404 ? 702  ASN A CA    1 
ATOM   3742 C  C     . ASN C 3 398 ? 17.14400  95.74100  15.25300  1.000 24.47726 ? 702  ASN A C     1 
ATOM   3743 O  O     . ASN C 3 398 ? 16.72800  96.08800  14.14100  1.000 24.62839 ? 702  ASN A O     1 
ATOM   3744 C  CB    . ASN C 3 398 ? 14.81300  95.84300  16.17100  1.000 18.63610 ? 702  ASN A CB    1 
ATOM   3745 C  CG    . ASN C 3 398 ? 14.87500  97.33200  16.45300  1.000 23.74752 ? 702  ASN A CG    1 
ATOM   3746 O  OD1   . ASN C 3 398 ? 15.85100  97.83500  17.00500  1.000 29.71850 ? 702  ASN A OD1   1 
ATOM   3747 N  ND2   . ASN C 3 398 ? 13.81800  98.04500  16.08000  1.000 34.01596 ? 702  ASN A ND2   1 
ATOM   3748 N  N     . GLU C 3 399 ? 18.42900  95.84200  15.60100  1.000 21.02638 ? 703  GLU A N     1 
ATOM   3749 C  CA    . GLU C 3 399 ? 19.39100  96.59000  14.79500  1.000 25.35127 ? 703  GLU A CA    1 
ATOM   3750 C  C     . GLU C 3 399 ? 19.93400  95.71700  13.67000  1.000 20.93075 ? 703  GLU A C     1 
ATOM   3751 O  O     . GLU C 3 399 ? 20.48000  94.63600  13.91700  1.000 18.54104 ? 703  GLU A O     1 
ATOM   3752 C  CB    . GLU C 3 399 ? 20.53000  97.10700  15.67300  1.000 21.06298 ? 703  GLU A CB    1 
ATOM   3753 C  CG    . GLU C 3 399 ? 20.09200  98.21500  16.62700  1.000 34.13868 ? 703  GLU A CG    1 
ATOM   3754 C  CD    . GLU C 3 399 ? 21.25300  98.86500  17.37400  1.000 36.80919 ? 703  GLU A CD    1 
ATOM   3755 O  OE1   . GLU C 3 399 ? 22.42000  98.68600  16.95900  1.000 31.34418 ? 703  GLU A OE1   1 
ATOM   3756 O  OE2   . GLU C 3 399 ? 20.98700  99.56600  18.37400  1.000 41.76565 ? 703  GLU A OE2   1 
ATOM   3757 N  N     . PHE C 3 400 ? 19.78800  96.19700  12.43600  1.000 18.79412 ? 704  PHE A N     1 
ATOM   3758 C  CA    . PHE C 3 400 ? 20.24700  95.43300  11.28600  1.000 17.08172 ? 704  PHE A CA    1 
ATOM   3759 C  C     . PHE C 3 400 ? 21.74000  95.16200  11.37500  1.000 16.43260 ? 704  PHE A C     1 
ATOM   3760 O  O     . PHE C 3 400 ? 22.19600  94.05000  11.08800  1.000 16.14000 ? 704  PHE A O     1 
ATOM   3761 C  CB    . PHE C 3 400 ? 19.91000  96.18700  9.99400   1.000 19.97884 ? 704  PHE A CB    1 
ATOM   3762 C  CG    . PHE C 3 400 ? 20.49300  95.55800  8.75000   1.000 15.65918 ? 704  PHE A CG    1 
ATOM   3763 C  CD1   . PHE C 3 400 ? 21.78300  95.85400  8.33600   1.000 21.54271 ? 704  PHE A CD1   1 
ATOM   3764 C  CD2   . PHE C 3 400 ? 19.74500  94.66800  8.00000   1.000 14.93741 ? 704  PHE A CD2   1 
ATOM   3765 C  CE1   . PHE C 3 400 ? 22.31100  95.26500  7.19400   1.000 22.60179 ? 704  PHE A CE1   1 
ATOM   3766 C  CE2   . PHE C 3 400 ? 20.26100  94.08400  6.86400   1.000 15.37071 ? 704  PHE A CE2   1 
ATOM   3767 C  CZ    . PHE C 3 400 ? 21.53200  94.38500  6.44800   1.000 15.32541 ? 704  PHE A CZ    1 
ATOM   3768 N  N     . GLY C 3 401 ? 22.51400  96.17300  11.76300  1.000 17.34086 ? 705  GLY A N     1 
ATOM   3769 C  CA    . GLY C 3 401 ? 23.95500  96.00900  11.82200  1.000 21.23326 ? 705  GLY A CA    1 
ATOM   3770 C  C     . GLY C 3 401 ? 24.37600  94.86200  12.71500  1.000 20.09614 ? 705  GLY A C     1 
ATOM   3771 O  O     . GLY C 3 401 ? 25.32700  94.13800  12.40800  1.000 26.18941 ? 705  GLY A O     1 
ATOM   3772 N  N     . ILE C 3 402 ? 23.66300  94.66600  13.82000  1.000 20.11214 ? 706  ILE A N     1 
ATOM   3773 C  CA    . ILE C 3 402 ? 23.99200  93.57800  14.73100  1.000 17.28401 ? 706  ILE A CA    1 
ATOM   3774 C  C     . ILE C 3 402 ? 23.53900  92.24500  14.16100  1.000 16.84842 ? 706  ILE A C     1 
ATOM   3775 O  O     . ILE C 3 402 ? 24.31400  91.28500  14.07600  1.000 14.06780 ? 706  ILE A O     1 
ATOM   3776 C  CB    . ILE C 3 402 ? 23.36100  93.83900  16.11000  1.000 17.52253 ? 706  ILE A CB    1 
ATOM   3777 C  CG1   . ILE C 3 402 ? 23.90900  95.12900  16.72500  1.000 26.77842 ? 706  ILE A CG1   1 
ATOM   3778 C  CG2   . ILE C 3 402 ? 23.53600  92.63100  17.05000  1.000 15.35543 ? 706  ILE A CG2   1 
ATOM   3779 C  CD1   . ILE C 3 402 ? 25.37900  95.39700  16.42200  1.000 28.26172 ? 706  ILE A CD1   1 
ATOM   3780 N  N     . ILE C 3 403 ? 22.27200  92.16100  13.78100  1.000 14.48816 ? 707  ILE A N     1 
ATOM   3781 C  CA    . ILE C 3 403 ? 21.70300  90.87000  13.42800  1.000 12.15114 ? 707  ILE A CA    1 
ATOM   3782 C  C     . ILE C 3 403 ? 22.28400  90.37000  12.11100  1.000 10.11201 ? 707  ILE A C     1 
ATOM   3783 O  O     . ILE C 3 403 ? 22.64800  89.19800  11.98400  1.000 14.97239 ? 707  ILE A O     1 
ATOM   3784 C  CB    . ILE C 3 403 ? 20.16100  90.97900  13.40700  1.000 17.01756 ? 707  ILE A CB    1 
ATOM   3785 C  CG1   . ILE C 3 403 ? 19.63800  91.17800  14.83500  1.000 13.98890 ? 707  ILE A CG1   1 
ATOM   3786 C  CG2   . ILE C 3 403 ? 19.49200  89.76900  12.74500  1.000 11.95062 ? 707  ILE A CG2   1 
ATOM   3787 C  CD1   . ILE C 3 403 ? 18.21800  91.74200  14.91100  1.000 12.53812 ? 707  ILE A CD1   1 
ATOM   3788 N  N     . ALA C 3 404 ? 22.38600  91.24300  11.11800  1.000 11.14243 ? 708  ALA A N     1 
ATOM   3789 C  CA    . ALA C 3 404 ? 22.89200  90.81400  9.81600   1.000 17.68283 ? 708  ALA A CA    1 
ATOM   3790 C  C     . ALA C 3 404 ? 24.33600  90.33700  9.92000   1.000 14.17971 ? 708  ALA A C     1 
ATOM   3791 O  O     . ALA C 3 404 ? 24.70600  89.30900  9.34200   1.000 11.60371 ? 708  ALA A O     1 
ATOM   3792 C  CB    . ALA C 3 404 ? 22.77000  91.95300  8.80100   1.000 14.23035 ? 708  ALA A CB    1 
ATOM   3793 N  N     . THR C 3 405 ? 25.15900  91.06200  10.67100  1.000 10.98998 ? 709  THR A N     1 
ATOM   3794 C  CA    . THR C 3 405 ? 26.55200  90.65500  10.83700  1.000 19.00733 ? 709  THR A CA    1 
ATOM   3795 C  C     . THR C 3 405 ? 26.63700  89.29300  11.51000  1.000 13.32565 ? 709  THR A C     1 
ATOM   3796 O  O     . THR C 3 405 ? 27.40800  88.42400  11.08600  1.000 18.25849 ? 709  THR A O     1 
ATOM   3797 C  CB    . THR C 3 405 ? 27.30500  91.71800  11.65000  1.000 15.25462 ? 709  THR A CB    1 
ATOM   3798 O  OG1   . THR C 3 405 ? 27.07800  93.00200  11.05800  1.000 16.18535 ? 709  THR A OG1   1 
ATOM   3799 C  CG2   . THR C 3 405 ? 28.80900  91.43200  11.69000  1.000 18.44769 ? 709  THR A CG2   1 
ATOM   3800 N  N     . GLU C 3 406 ? 25.84100  89.08700  12.55700  1.000 19.22590 ? 710  GLU A N     1 
ATOM   3801 C  CA    . GLU C 3 406 ? 25.87200  87.80600  13.24800  1.000 18.04330 ? 710  GLU A CA    1 
ATOM   3802 C  C     . GLU C 3 406 ? 25.36600  86.69200  12.34600  1.000 15.71203 ? 710  GLU A C     1 
ATOM   3803 O  O     . GLU C 3 406 ? 25.96500  85.61100  12.29200  1.000 16.27010 ? 710  GLU A O     1 
ATOM   3804 C  CB    . GLU C 3 406 ? 25.07000  87.88500  14.53800  1.000 16.91123 ? 710  GLU A CB    1 
ATOM   3805 C  CG    . GLU C 3 406 ? 25.27200  86.68400  15.47900  1.000 24.85862 ? 710  GLU A CG    1 
ATOM   3806 C  CD    . GLU C 3 406 ? 26.74600  86.30500  15.69400  1.000 29.00964 ? 710  GLU A CD    1 
ATOM   3807 O  OE1   . GLU C 3 406 ? 27.62200  87.20000  15.64400  1.000 27.70297 ? 710  GLU A OE1   1 
ATOM   3808 O  OE2   . GLU C 3 406 ? 27.02500  85.10900  15.92100  1.000 25.39037 ? 710  GLU A OE2   1 
ATOM   3809 N  N     . MET C 3 407 ? 24.32400  86.97100  11.56300  1.000 16.88213 ? 711  MET A N     1 
ATOM   3810 C  CA    . MET C 3 407 ? 23.82100  85.97900  10.61800  1.000 18.10040 ? 711  MET A CA    1 
ATOM   3811 C  C     . MET C 3 407 ? 24.87700  85.59100  9.58900   1.000 15.68521 ? 711  MET A C     1 
ATOM   3812 O  O     . MET C 3 407 ? 25.06600  84.40400  9.29700   1.000 15.13467 ? 711  MET A O     1 
ATOM   3813 C  CB    . MET C 3 407 ? 22.56700  86.51300  9.93200   1.000 21.58612 ? 711  MET A CB    1 
ATOM   3814 C  CG    . MET C 3 407 ? 21.35300  86.40300  10.80500  1.000 23.55431 ? 711  MET A CG    1 
ATOM   3815 S  SD    . MET C 3 407 ? 20.83500  84.70100  11.09900  1.000 21.25874 ? 711  MET A SD    1 
ATOM   3816 C  CE    . MET C 3 407 ? 19.10800  85.00800  11.45700  1.000 18.19383 ? 711  MET A CE    1 
ATOM   3817 N  N     . LYS C 3 408 ? 25.56900  86.57500  9.01300   1.000 20.85459 ? 712  LYS A N     1 
ATOM   3818 C  CA    . LYS C 3 408 ? 26.62600  86.24200  8.06000   1.000 16.97235 ? 712  LYS A CA    1 
ATOM   3819 C  C     . LYS C 3 408 ? 27.77700  85.51400  8.74300   1.000 18.29489 ? 712  LYS A C     1 
ATOM   3820 O  O     . LYS C 3 408 ? 28.39900  84.62800  8.14200   1.000 19.53208 ? 712  LYS A O     1 
ATOM   3821 C  CB    . LYS C 3 408 ? 27.11000  87.50600  7.35200   1.000 16.68427 ? 712  LYS A CB    1 
ATOM   3822 C  CG    . LYS C 3 408 ? 26.10400  88.02000  6.29400   1.000 13.74662 ? 712  LYS A CG    1 
ATOM   3823 C  CD    . LYS C 3 408 ? 26.57600  89.30700  5.59900   1.000 18.46911 ? 712  LYS A CD    1 
ATOM   3824 C  CE    . LYS C 3 408 ? 26.50300  90.55600  6.47500   1.000 14.48006 ? 712  LYS A CE    1 
ATOM   3825 N  NZ    . LYS C 3 408 ? 26.87900  91.78500  5.69500   1.000 14.65892 ? 712  LYS A NZ    1 
ATOM   3826 N  N     . SER C 3 409 ? 28.05200  85.85800  10.00100  1.000 16.75839 ? 713  SER A N     1 
ATOM   3827 C  CA    . SER C 3 409 ? 29.02300  85.11100  10.79300  1.000 17.66484 ? 713  SER A CA    1 
ATOM   3828 C  C     . SER C 3 409 ? 28.59800  83.66400  10.98600  1.000 21.10749 ? 713  SER A C     1 
ATOM   3829 O  O     . SER C 3 409 ? 29.40000  82.73800  10.79700  1.000 18.96659 ? 713  SER A O     1 
ATOM   3830 C  CB    . SER C 3 409 ? 29.21800  85.78000  12.14500  1.000 15.41860 ? 713  SER A CB    1 
ATOM   3831 O  OG    . SER C 3 409 ? 30.45700  85.38800  12.68300  1.000 22.85597 ? 713  SER A OG    1 
ATOM   3832 N  N     . LEU C 3 410 ? 27.34600  83.45600  11.39800  1.000 14.87263 ? 714  LEU A N     1 
ATOM   3833 C  CA    . LEU C 3 410 ? 26.83500  82.10500  11.55200  1.000 16.19026 ? 714  LEU A CA    1 
ATOM   3834 C  C     . LEU C 3 410 ? 27.04500  81.29700  10.28200  1.000 14.59550 ? 714  LEU A C     1 
ATOM   3835 O  O     . LEU C 3 410 ? 27.44500  80.13400  10.34000  1.000 15.02976 ? 714  LEU A O     1 
ATOM   3836 C  CB    . LEU C 3 410 ? 25.35000  82.14700  11.92600  1.000 15.64499 ? 714  LEU A CB    1 
ATOM   3837 C  CG    . LEU C 3 410 ? 25.11700  82.66200  13.34200  1.000 17.09231 ? 714  LEU A CG    1 
ATOM   3838 C  CD1   . LEU C 3 410 ? 23.62700  82.75300  13.61400  1.000 17.45448 ? 714  LEU A CD1   1 
ATOM   3839 C  CD2   . LEU C 3 410 ? 25.80800  81.75200  14.38600  1.000 23.78316 ? 714  LEU A CD2   1 
ATOM   3840 N  N     . TYR C 3 411 ? 26.79800  81.90000  9.11800   1.000 18.64645 ? 715  TYR A N     1 
ATOM   3841 C  CA    . TYR C 3 411 ? 26.96900  81.15000  7.87700   1.000 18.12077 ? 715  TYR A CA    1 
ATOM   3842 C  C     . TYR C 3 411 ? 28.40200  80.65500  7.75100   1.000 20.91282 ? 715  TYR A C     1 
ATOM   3843 O  O     . TYR C 3 411 ? 28.64200  79.46900  7.48700   1.000 15.91850 ? 715  TYR A O     1 
ATOM   3844 C  CB    . TYR C 3 411 ? 26.58500  81.99600  6.65700   1.000 13.64444 ? 715  TYR A CB    1 
ATOM   3845 C  CG    . TYR C 3 411 ? 26.67600  81.21400  5.35100   1.000 15.07578 ? 715  TYR A CG    1 
ATOM   3846 C  CD1   . TYR C 3 411 ? 27.89600  81.07800  4.69100   1.000 18.71810 ? 715  TYR A CD1   1 
ATOM   3847 C  CD2   . TYR C 3 411 ? 25.55000  80.60400  4.78200   1.000 12.72746 ? 715  TYR A CD2   1 
ATOM   3848 C  CE1   . TYR C 3 411 ? 28.00100  80.36100  3.50900   1.000 17.45026 ? 715  TYR A CE1   1 
ATOM   3849 C  CE2   . TYR C 3 411 ? 25.64800  79.88500  3.59000   1.000 13.30392 ? 715  TYR A CE2   1 
ATOM   3850 C  CZ    . TYR C 3 411 ? 26.88900  79.76800  2.96300   1.000 15.73774 ? 715  TYR A CZ    1 
ATOM   3851 O  OH    . TYR C 3 411 ? 27.04700  79.07500  1.78100   1.000 12.87928 ? 715  TYR A OH    1 
ATOM   3852 N  N     . ARG C 3 412 ? 29.37200  81.54800  7.97300   1.000 16.61394 ? 716  ARG A N     1 
ATOM   3853 C  CA    . ARG C 3 412 ? 30.76300  81.14300  7.84800   1.000 19.62780 ? 716  ARG A CA    1 
ATOM   3854 C  C     . ARG C 3 412 ? 31.12400  80.03300  8.83100   1.000 14.71028 ? 716  ARG A C     1 
ATOM   3855 O  O     . ARG C 3 412 ? 31.95400  79.18200  8.50700   1.000 22.51148 ? 716  ARG A O     1 
ATOM   3856 C  CB    . ARG C 3 412 ? 31.67200  82.36200  8.01000   1.000 24.69170 ? 716  ARG A CB    1 
ATOM   3857 C  CG    . ARG C 3 412 ? 31.75200  83.15100  6.72000   1.000 21.75135 ? 716  ARG A CG    1 
ATOM   3858 C  CD    . ARG C 3 412 ? 32.07400  84.60000  6.94300   1.000 32.02494 ? 716  ARG A CD    1 
ATOM   3859 N  NE    . ARG C 3 412 ? 32.16000  85.33600  5.67800   1.000 24.20810 ? 716  ARG A NE    1 
ATOM   3860 C  CZ    . ARG C 3 412 ? 31.11000  85.79800  5.00700   1.000 27.93893 ? 716  ARG A CZ    1 
ATOM   3861 N  NH1   . ARG C 3 412 ? 29.87400  85.60000  5.46200   1.000 29.47628 ? 716  ARG A NH1   1 
ATOM   3862 N  NH2   . ARG C 3 412 ? 31.29300  86.45900  3.87700   1.000 25.13980 ? 716  ARG A NH2   1 
ATOM   3863 N  N     . THR C 3 413 ? 30.49900  79.99000  10.00900  1.000 14.05770 ? 717  THR A N     1 
ATOM   3864 C  CA    . THR C 3 413 ? 30.81700  78.91300  10.94700  1.000 12.63126 ? 717  THR A CA    1 
ATOM   3865 C  C     . THR C 3 413 ? 30.34000  77.55600  10.45900  1.000 16.59960 ? 717  THR A C     1 
ATOM   3866 O  O     . THR C 3 413 ? 30.87100  76.53300  10.90500  1.000 16.81248 ? 717  THR A O     1 
ATOM   3867 C  CB    . THR C 3 413 ? 30.21000  79.14800  12.32900  1.000 17.40787 ? 717  THR A CB    1 
ATOM   3868 O  OG1   . THR C 3 413 ? 28.81200  78.82000  12.29700  1.000 26.45568 ? 717  THR A OG1   1 
ATOM   3869 C  CG2   . THR C 3 413 ? 30.39900  80.57800  12.78000  1.000 17.50746 ? 717  THR A CG2   1 
ATOM   3870 N  N     . LEU C 3 414 ? 29.35000  77.51500  9.57500   1.000 16.88831 ? 718  LEU A N     1 
ATOM   3871 C  CA    . LEU C 3 414 ? 28.83700  76.24400  9.07100   1.000 15.58986 ? 718  LEU A CA    1 
ATOM   3872 C  C     . LEU C 3 414 ? 29.59100  75.73900  7.84700   1.000 12.58039 ? 718  LEU A C     1 
ATOM   3873 O  O     . LEU C 3 414 ? 29.37500  74.59300  7.44100   1.000 19.35103 ? 718  LEU A O     1 
ATOM   3874 C  CB    . LEU C 3 414 ? 27.34800  76.36500  8.74400   1.000 14.26273 ? 718  LEU A CB    1 
ATOM   3875 C  CG    . LEU C 3 414 ? 26.39700  76.45900  9.94700   1.000 22.66598 ? 718  LEU A CG    1 
ATOM   3876 C  CD1   . LEU C 3 414 ? 24.98900  76.80400  9.50400   1.000 19.09432 ? 718  LEU A CD1   1 
ATOM   3877 C  CD2   . LEU C 3 414 ? 26.38800  75.17000  10.77500  1.000 24.07947 ? 718  LEU A CD2   1 
ATOM   3878 N  N     . GLY C 3 415 ? 30.43700  76.57200  7.23700   1.000 12.86674 ? 719  GLY A N     1 
ATOM   3879 C  CA    . GLY C 3 415 ? 31.44300  76.09900  6.30400   1.000 14.62401 ? 719  GLY A CA    1 
ATOM   3880 C  C     . GLY C 3 415 ? 30.94800  75.64400  4.95500   1.000 18.40644 ? 719  GLY A C     1 
ATOM   3881 O  O     . GLY C 3 415 ? 31.66500  74.92000  4.25200   1.000 21.37749 ? 719  GLY A O     1 
ATOM   3882 N  N     . CYS C 3 416 ? 29.74900  76.04100  4.56200   1.000 17.66419 ? 720  CYS A N     1 
ATOM   3883 C  CA    . CYS C 3 416 ? 29.17400  75.54200  3.32300   1.000 15.57057 ? 720  CYS A CA    1 
ATOM   3884 C  C     . CYS C 3 416 ? 29.70500  76.33800  2.13300   1.000 17.51501 ? 720  CYS A C     1 
ATOM   3885 O  O     . CYS C 3 416 ? 29.54200  77.55800  2.10500   1.000 21.13017 ? 720  CYS A O     1 
ATOM   3886 C  CB    . CYS C 3 416 ? 27.65200  75.63800  3.37700   1.000 14.54255 ? 720  CYS A CB    1 
ATOM   3887 S  SG    . CYS C 3 416 ? 26.81400  74.90900  1.98000   1.000 16.73006 ? 720  CYS A SG    1 
ATOM   3888 N  N     . PRO C 3 417 ? 30.32000  75.70100  1.14200   1.000 16.49437 ? 721  PRO A N     1 
ATOM   3889 C  CA    . PRO C 3 417 ? 30.71900  76.44300  -0.07100  1.000 21.36449 ? 721  PRO A CA    1 
ATOM   3890 C  C     . PRO C 3 417 ? 29.50300  76.98200  -0.79700  1.000 18.41601 ? 721  PRO A C     1 
ATOM   3891 O  O     . PRO C 3 417 ? 28.50800  76.25900  -0.96000  1.000 15.01730 ? 721  PRO A O     1 
ATOM   3892 C  CB    . PRO C 3 417 ? 31.45100  75.39200  -0.92600  1.000 15.07559 ? 721  PRO A CB    1 
ATOM   3893 C  CG    . PRO C 3 417 ? 31.83500  74.30400  0.03900   1.000 17.82469 ? 721  PRO A CG    1 
ATOM   3894 C  CD    . PRO C 3 417 ? 30.77200  74.30100  1.11700   1.000 14.37014 ? 721  PRO A CD    1 
ATOM   3895 N  N     . PRO C 3 418 ? 29.54900  78.24700  -1.25300  1.000 18.15211 ? 722  PRO A N     1 
ATOM   3896 C  CA    . PRO C 3 418 ? 28.35500  78.85700  -1.86500  1.000 19.16566 ? 722  PRO A CA    1 
ATOM   3897 C  C     . PRO C 3 418 ? 27.70200  77.99600  -2.92800  1.000 25.91436 ? 722  PRO A C     1 
ATOM   3898 O  O     . PRO C 3 418 ? 26.46300  77.92000  -2.97500  1.000 19.14221 ? 722  PRO A O     1 
ATOM   3899 C  CB    . PRO C 3 418 ? 28.90100  80.17100  -2.44500  1.000 18.94952 ? 722  PRO A CB    1 
ATOM   3900 C  CG    . PRO C 3 418 ? 29.99300  80.55800  -1.48200  1.000 22.99447 ? 722  PRO A CG    1 
ATOM   3901 C  CD    . PRO C 3 418 ? 30.62200  79.23700  -1.02300  1.000 17.09806 ? 722  PRO A CD    1 
ATOM   3902 N  N     . MET C 3 419 ? 28.50000  77.32100  -3.76500  1.000 18.27387 ? 723  MET A N     1 
ATOM   3903 C  CA    . MET C 3 419 ? 27.94400  76.48800  -4.82800  1.000 19.61878 ? 723  MET A CA    1 
ATOM   3904 C  C     . MET C 3 419 ? 27.26900  75.23200  -4.29100  1.000 16.86309 ? 723  MET A C     1 
ATOM   3905 O  O     . MET C 3 419 ? 26.52500  74.58100  -5.02400  1.000 18.70590 ? 723  MET A O     1 
ATOM   3906 C  CB    . MET C 3 419 ? 29.04300  76.09500  -5.82600  1.000 21.69263 ? 723  MET A CB    1 
ATOM   3907 C  CG    . MET C 3 419 ? 29.53900  77.22300  -6.71400  1.000 24.20238 ? 723  MET A CG    1 
ATOM   3908 S  SD    . MET C 3 419 ? 28.48600  77.54000  -8.16000  1.000 43.17532 ? 723  MET A SD    1 
ATOM   3909 C  CE    . MET C 3 419 ? 29.01800  76.23100  -9.27900  1.000 36.83937 ? 723  MET A CE    1 
ATOM   3910 N  N     . GLU C 3 420 ? 27.51500  74.86400  -3.04300  1.000 16.80527 ? 724  GLU A N     1 
ATOM   3911 C  CA    . GLU C 3 420 ? 26.86800  73.69200  -2.47700  1.000 16.55359 ? 724  GLU A CA    1 
ATOM   3912 C  C     . GLU C 3 420 ? 25.56200  74.04100  -1.77300  1.000 16.17411 ? 724  GLU A C     1 
ATOM   3913 O  O     . GLU C 3 420 ? 24.81200  73.13400  -1.38700  1.000 14.17799 ? 724  GLU A O     1 
ATOM   3914 C  CB    . GLU C 3 420 ? 27.81800  72.98500  -1.49100  1.000 14.16620 ? 724  GLU A CB    1 
ATOM   3915 C  CG    . GLU C 3 420 ? 29.14200  72.49400  -2.10700  1.000 16.78442 ? 724  GLU A CG    1 
ATOM   3916 C  CD    . GLU C 3 420 ? 28.93400  71.65500  -3.36900  1.000 20.96652 ? 724  GLU A CD    1 
ATOM   3917 O  OE1   . GLU C 3 420 ? 28.25300  70.60700  -3.30900  1.000 31.90100 ? 724  GLU A OE1   1 
ATOM   3918 O  OE2   . GLU C 3 420 ? 29.43200  72.04300  -4.43600  1.000 25.53214 ? 724  GLU A OE2   1 
ATOM   3919 N  N     . LEU C 3 421 ? 25.28400  75.33000  -1.60100  1.000 12.62279 ? 725  LEU A N     1 
ATOM   3920 C  CA    . LEU C 3 421 ? 24.10900  75.75000  -0.86100  1.000 15.07936 ? 725  LEU A CA    1 
ATOM   3921 C  C     . LEU C 3 421 ? 22.85700  75.49400  -1.68500  1.000 12.65604 ? 725  LEU A C     1 
ATOM   3922 O  O     . LEU C 3 421 ? 22.83700  75.72100  -2.89500  1.000 13.73730 ? 725  LEU A O     1 
ATOM   3923 C  CB    . LEU C 3 421 ? 24.23100  77.22800  -0.49200  1.000 17.83023 ? 725  LEU A CB    1 
ATOM   3924 C  CG    . LEU C 3 421 ? 23.20700  77.80000  0.48400   1.000 13.64612 ? 725  LEU A CG    1 
ATOM   3925 C  CD1   . LEU C 3 421 ? 23.29500  77.10400  1.81300   1.000 9.49848  ? 725  LEU A CD1   1 
ATOM   3926 C  CD2   . LEU C 3 421 ? 23.43500  79.29400  0.63400   1.000 19.57921 ? 725  LEU A CD2   1 
ATOM   3927 N  N     . ARG C 3 422 ? 21.81900  74.97800  -1.02600  1.000 14.94655 ? 726  ARG A N     1 
ATOM   3928 C  CA    . ARG C 3 422 ? 20.55900  74.65400  -1.67500  1.000 12.44176 ? 726  ARG A CA    1 
ATOM   3929 C  C     . ARG C 3 422 ? 19.37000  75.16800  -0.88500  1.000 17.98184 ? 726  ARG A C     1 
ATOM   3930 O  O     . ARG C 3 422 ? 18.22100  74.98000  -1.31300  1.000 11.21906 ? 726  ARG A O     1 
ATOM   3931 C  CB    . ARG C 3 422 ? 20.41600  73.13100  -1.86100  1.000 13.88403 ? 726  ARG A CB    1 
ATOM   3932 C  CG    . ARG C 3 422 ? 21.37200  72.50500  -2.88400  1.000 13.97550 ? 726  ARG A CG    1 
ATOM   3933 C  CD    . ARG C 3 422 ? 20.96600  72.91700  -4.27800  1.000 15.26764 ? 726  ARG A CD    1 
ATOM   3934 N  NE    . ARG C 3 422 ? 21.84500  72.43800  -5.34700  1.000 18.06270 ? 726  ARG A NE    1 
ATOM   3935 C  CZ    . ARG C 3 422 ? 22.90600  73.10500  -5.80500  1.000 18.98926 ? 726  ARG A CZ    1 
ATOM   3936 N  NH1   . ARG C 3 422 ? 23.26900  74.26500  -5.25700  1.000 16.37184 ? 726  ARG A NH1   1 
ATOM   3937 N  NH2   . ARG C 3 422 ? 23.61600  72.60200  -6.80300  1.000 18.12654 ? 726  ARG A NH2   1 
ATOM   3938 N  N     . GLY C 3 423 ? 19.61300  75.78500  0.26600   1.000 13.76609 ? 727  GLY A N     1 
ATOM   3939 C  CA    . GLY C 3 423 ? 18.52700  76.22300  1.10800   1.000 17.34388 ? 727  GLY A CA    1 
ATOM   3940 C  C     . GLY C 3 423 ? 19.03800  77.03000  2.27800   1.000 19.88840 ? 727  GLY A C     1 
ATOM   3941 O  O     . GLY C 3 423 ? 20.14400  76.78700  2.76700   1.000 16.42627 ? 727  GLY A O     1 
ATOM   3942 N  N     . LEU C 3 424 ? 18.23000  77.98100  2.74200   1.000 14.01752 ? 728  LEU A N     1 
ATOM   3943 C  CA    . LEU C 3 424 ? 18.63700  78.92200  3.77700   1.000 19.44477 ? 728  LEU A CA    1 
ATOM   3944 C  C     . LEU C 3 424 ? 17.42900  79.27000  4.62700   1.000 16.88724 ? 728  LEU A C     1 
ATOM   3945 O  O     . LEU C 3 424 ? 16.39200  79.66500  4.08500   1.000 17.28931 ? 728  LEU A O     1 
ATOM   3946 C  CB    . LEU C 3 424 ? 19.20100  80.20100  3.15300   1.000 16.54107 ? 728  LEU A CB    1 
ATOM   3947 C  CG    . LEU C 3 424 ? 20.66400  80.56100  3.24600   1.000 18.00461 ? 728  LEU A CG    1 
ATOM   3948 C  CD1   . LEU C 3 424 ? 20.78200  82.04900  2.98100   1.000 27.16427 ? 728  LEU A CD1   1 
ATOM   3949 C  CD2   . LEU C 3 424 ? 21.24500  80.19800  4.59700   1.000 19.15000 ? 728  LEU A CD2   1 
ATOM   3950 N  N     . ALA C 3 425 ? 17.55400  79.13200  5.93700   1.000 14.35907 ? 729  ALA A N     1 
ATOM   3951 C  CA    . ALA C 3 425 ? 16.52900  79.61400  6.85600   1.000 18.20550 ? 729  ALA A CA    1 
ATOM   3952 C  C     . ALA C 3 425 ? 17.15600  80.64300  7.78700   1.000 17.72297 ? 729  ALA A C     1 
ATOM   3953 O  O     . ALA C 3 425 ? 18.30300  80.48100  8.22300   1.000 13.40292 ? 729  ALA A O     1 
ATOM   3954 C  CB    . ALA C 3 425 ? 15.89200  78.46600  7.64800   1.000 13.56190 ? 729  ALA A CB    1 
ATOM   3955 N  N     . LEU C 3 426 ? 16.41700  81.72000  8.04900   1.000 12.30915 ? 730  LEU A N     1 
ATOM   3956 C  CA    . LEU C 3 426 ? 16.83600  82.79800  8.94100   1.000 12.82946 ? 730  LEU A CA    1 
ATOM   3957 C  C     . LEU C 3 426 ? 15.75200  82.95100  10.00100  1.000 18.20867 ? 730  LEU A C     1 
ATOM   3958 O  O     . LEU C 3 426 ? 14.58700  83.14100  9.65400   1.000 15.13573 ? 730  LEU A O     1 
ATOM   3959 C  CB    . LEU C 3 426 ? 17.01900  84.10600  8.16200   1.000 13.43797 ? 730  LEU A CB    1 
ATOM   3960 C  CG    . LEU C 3 426 ? 18.12400  84.19800  7.09500   1.000 13.69891 ? 730  LEU A CG    1 
ATOM   3961 C  CD1   . LEU C 3 426 ? 18.19600  85.60200  6.50000   1.000 10.07957 ? 730  LEU A CD1   1 
ATOM   3962 C  CD2   . LEU C 3 426 ? 19.47900  83.84500  7.68800   1.000 17.83353 ? 730  LEU A CD2   1 
ATOM   3963 N  N     . GLN C 3 427 ? 16.12500  82.86900  11.28100  1.000 15.51396 ? 731  GLN A N     1 
ATOM   3964 C  CA    . GLN C 3 427 ? 15.16200  82.77200  12.37100  1.000 15.72878 ? 731  GLN A CA    1 
ATOM   3965 C  C     . GLN C 3 427 ? 15.51200  83.73100  13.49700  1.000 18.92782 ? 731  GLN A C     1 
ATOM   3966 O  O     . GLN C 3 427 ? 16.68000  83.84200  13.87500  1.000 14.90662 ? 731  GLN A O     1 
ATOM   3967 C  CB    . GLN C 3 427 ? 15.11800  81.35900  12.96100  1.000 16.03195 ? 731  GLN A CB    1 
ATOM   3968 C  CG    . GLN C 3 427 ? 15.06000  80.21600  11.96000  1.000 19.87725 ? 731  GLN A CG    1 
ATOM   3969 C  CD    . GLN C 3 427 ? 14.98700  78.85200  12.66400  1.000 25.70527 ? 731  GLN A CD    1 
ATOM   3970 O  OE1   . GLN C 3 427 ? 15.54100  78.67200  13.74600  1.000 24.78608 ? 731  GLN A OE1   1 
ATOM   3971 N  NE2   . GLN C 3 427 ? 14.27900  77.90600  12.05900  1.000 22.09996 ? 731  GLN A NE2   1 
ATOM   3972 N  N     . PHE C 3 428 ? 14.49100  84.39700  14.05200  1.000 15.94826 ? 732  PHE A N     1 
ATOM   3973 C  CA    . PHE C 3 428 ? 14.59000  85.13700  15.31800  1.000 16.98803 ? 732  PHE A CA    1 
ATOM   3974 C  C     . PHE C 3 428 ? 13.86800  84.30100  16.36800  1.000 19.36640 ? 732  PHE A C     1 
ATOM   3975 O  O     . PHE C 3 428 ? 12.62900  84.23300  16.37100  1.000 23.78508 ? 732  PHE A O     1 
ATOM   3976 C  CB    . PHE C 3 428 ? 13.96100  86.53000  15.22200  1.000 14.29159 ? 732  PHE A CB    1 
ATOM   3977 C  CG    . PHE C 3 428 ? 14.61000  87.44600  14.20400  1.000 15.68213 ? 732  PHE A CG    1 
ATOM   3978 C  CD1   . PHE C 3 428 ? 15.83500  87.13900  13.62300  1.000 19.28506 ? 732  PHE A CD1   1 
ATOM   3979 C  CD2   . PHE C 3 428 ? 13.97300  88.62600  13.82700  1.000 20.73242 ? 732  PHE A CD2   1 
ATOM   3980 C  CE1   . PHE C 3 428 ? 16.41000  87.99200  12.67400  1.000 13.82926 ? 732  PHE A CE1   1 
ATOM   3981 C  CE2   . PHE C 3 428 ? 14.55000  89.49500  12.89200  1.000 16.72966 ? 732  PHE A CE2   1 
ATOM   3982 C  CZ    . PHE C 3 428 ? 15.76900  89.17700  12.31900  1.000 14.88420 ? 732  PHE A CZ    1 
ATOM   3983 N  N     . ASN C 3 429 ? 14.62600  83.67200  17.26000  1.000 21.34205 ? 733  ASN A N     1 
ATOM   3984 C  CA    . ASN C 3 429 ? 14.08600  82.57500  18.05700  1.000 18.36925 ? 733  ASN A CA    1 
ATOM   3985 C  C     . ASN C 3 429 ? 13.40500  83.02400  19.33700  1.000 23.22045 ? 733  ASN A C     1 
ATOM   3986 O  O     . ASN C 3 429 ? 12.49400  82.33600  19.81500  1.000 31.57792 ? 733  ASN A O     1 
ATOM   3987 C  CB    . ASN C 3 429 ? 15.19100  81.58100  18.41200  1.000 25.02557 ? 733  ASN A CB    1 
ATOM   3988 C  CG    . ASN C 3 429 ? 15.90700  81.04200  17.18200  1.000 23.99081 ? 733  ASN A CG    1 
ATOM   3989 O  OD1   . ASN C 3 429 ? 16.98700  81.50700  16.83700  1.000 22.68506 ? 733  ASN A OD1   1 
ATOM   3990 N  ND2   . ASN C 3 429 ? 15.31100  80.05900  16.52600  1.000 21.17848 ? 733  ASN A ND2   1 
ATOM   3991 N  N     . LYS C 3 430 ? 13.82600  84.14000  19.91500  1.000 25.93355 ? 734  LYS A N     1 
ATOM   3992 C  CA    . LYS C 3 430 ? 13.20400  84.66600  21.11900  1.000 24.85783 ? 734  LYS A CA    1 
ATOM   3993 C  C     . LYS C 3 430 ? 12.92800  86.13600  20.88700  1.000 28.77378 ? 734  LYS A C     1 
ATOM   3994 O  O     . LYS C 3 430 ? 13.78900  86.85800  20.37200  1.000 28.11512 ? 734  LYS A O     1 
ATOM   3995 C  CB    . LYS C 3 430 ? 14.08600  84.46500  22.35700  1.000 31.13246 ? 734  LYS A CB    1 
ATOM   3996 C  CG    . LYS C 3 430 ? 14.59900  83.04400  22.51800  1.000 26.83418 ? 734  LYS A CG    1 
ATOM   3997 C  CD    . LYS C 3 430 ? 14.66000  82.64000  23.97400  1.000 31.09408 ? 734  LYS A CD    1 
ATOM   3998 C  CE    . LYS C 3 430 ? 15.53000  81.39200  24.17500  1.000 41.89237 ? 734  LYS A CE    1 
ATOM   3999 N  NZ    . LYS C 3 430 ? 14.79000  80.10000  24.03300  1.000 33.73292 ? 734  LYS A NZ    1 
ATOM   4000 N  N     . LEU C 3 431 ? 11.71800  86.55900  21.23300  1.000 21.30791 ? 735  LEU A N     1 
ATOM   4001 C  CA    . LEU C 3 431 ? 11.25200  87.91700  21.00800  1.000 26.81273 ? 735  LEU A CA    1 
ATOM   4002 C  C     . LEU C 3 431 ? 10.96100  88.57700  22.35500  1.000 25.20780 ? 735  LEU A C     1 
ATOM   4003 O  O     . LEU C 3 431 ? 10.43800  87.93700  23.27000  1.000 20.52656 ? 735  LEU A O     1 
ATOM   4004 C  CB    . LEU C 3 431 ? 10.00500  87.90300  20.10600  1.000 23.26776 ? 735  LEU A CB    1 
ATOM   4005 C  CG    . LEU C 3 431 ? 9.94900   86.88900  18.94300  1.000 22.08641 ? 735  LEU A CG    1 
ATOM   4006 C  CD1   . LEU C 3 431 ? 8.74500   87.17500  18.06100  1.000 30.56306 ? 735  LEU A CD1   1 
ATOM   4007 C  CD2   . LEU C 3 431 ? 11.19500  86.86900  18.05600  1.000 20.23574 ? 735  LEU A CD2   1 
ATOM   4008 N  N     . VAL C 3 432 ? 11.33900  89.84100  22.48900  1.000 21.27806 ? 736  VAL A N     1 
ATOM   4009 C  CA    . VAL C 3 432 ? 11.13900  90.60200  23.71700  1.000 23.94299 ? 736  VAL A CA    1 
ATOM   4010 C  C     . VAL C 3 432 ? 10.25500  91.79400  23.38600  1.000 29.10097 ? 736  VAL A C     1 
ATOM   4011 O  O     . VAL C 3 432 ? 10.47600  92.47000  22.37100  1.000 23.14189 ? 736  VAL A O     1 
ATOM   4012 C  CB    . VAL C 3 432 ? 12.48600  91.06500  24.32800  1.000 28.99372 ? 736  VAL A CB    1 
ATOM   4013 C  CG1   . VAL C 3 432 ? 12.31800  91.55300  25.78300  1.000 21.50519 ? 736  VAL A CG1   1 
ATOM   4014 C  CG2   . VAL C 3 432 ? 13.53300  89.94900  24.24600  1.000 19.71070 ? 736  VAL A CG2   1 
ATOM   4015 N  N     . ASP C 3 433 ? 9.24700   92.04300  24.23000  1.000 28.41959 ? 737  ASP A N     1 
ATOM   4016 C  CA    . ASP C 3 433 ? 8.37700   93.19700  24.02400  1.000 27.09453 ? 737  ASP A CA    1 
ATOM   4017 C  C     . ASP C 3 433 ? 9.16800   94.49900  24.11800  1.000 31.22526 ? 737  ASP A C     1 
ATOM   4018 O  O     . ASP C 3 433 ? 10.15900  94.60700  24.84500  1.000 27.29634 ? 737  ASP A O     1 
ATOM   4019 C  CB    . ASP C 3 433 ? 7.23500   93.25800  25.05700  1.000 39.88834 ? 737  ASP A CB    1 
ATOM   4020 C  CG    . ASP C 3 433 ? 6.65800   91.89700  25.42500  1.000 49.29912 ? 737  ASP A CG    1 
ATOM   4021 O  OD1   . ASP C 3 433 ? 6.41600   91.68200  26.64000  1.000 44.88714 ? 737  ASP A OD1   1 
ATOM   4022 O  OD2   . ASP C 3 433 ? 6.40700   91.06600  24.52100  1.000 49.81476 ? 737  ASP A OD2   1 
ATOM   4023 N  N     . VAL C 3 434 ? 8.69900   95.50400  23.38900  1.000 32.52685 ? 738  VAL A N     1 
ATOM   4024 C  CA    . VAL C 3 434 ? 9.19400   96.86900  23.51100  1.000 36.48189 ? 738  VAL A CA    1 
ATOM   4025 C  C     . VAL C 3 434 ? 8.20300   97.63400  24.38000  1.000 36.06553 ? 738  VAL A C     1 
ATOM   4026 O  O     . VAL C 3 434 ? 6.99100   97.60300  24.13300  1.000 30.42326 ? 738  VAL A O     1 
ATOM   4027 C  CB    . VAL C 3 434 ? 9.37800   97.52500  22.13300  1.000 34.30696 ? 738  VAL A CB    1 
ATOM   4028 C  CG1   . VAL C 3 434 ? 9.47400   99.03600  22.27600  1.000 38.60936 ? 738  VAL A CG1   1 
ATOM   4029 C  CG2   . VAL C 3 434 ? 10.61000  96.95600  21.43000  1.000 28.97453 ? 738  VAL A CG2   1 
ATOM   4030 N  N     . GLY C 3 435 ? 8.70800   98.26600  25.43100  1.000 37.36282 ? 739  GLY A N     1 
ATOM   4031 C  CA    . GLY C 3 435 ? 7.86000   98.92800  26.39200  1.000 32.25293 ? 739  GLY A CA    1 
ATOM   4032 C  C     . GLY C 3 435 ? 8.04100   100.42900 26.32900  1.000 31.08791 ? 739  GLY A C     1 
ATOM   4033 O  O     . GLY C 3 435 ? 8.91600   100.93300 25.62400  1.000 30.93067 ? 739  GLY A O     1 
ATOM   4034 N  N     . PRO C 3 436 ? 7.21300   101.18000 27.06000  1.000 35.89629 ? 740  PRO A N     1 
ATOM   4035 C  CA    . PRO C 3 436 ? 7.27500   102.64800 26.96000  1.000 31.33837 ? 740  PRO A CA    1 
ATOM   4036 C  C     . PRO C 3 436 ? 8.50000   103.26500 27.62800  1.000 35.24072 ? 740  PRO A C     1 
ATOM   4037 O  O     . PRO C 3 436 ? 8.83600   104.41700 27.33300  1.000 35.82189 ? 740  PRO A O     1 
ATOM   4038 C  CB    . PRO C 3 436 ? 5.97700   103.09100 27.65200  1.000 33.64023 ? 740  PRO A CB    1 
ATOM   4039 C  CG    . PRO C 3 436 ? 5.69000   102.00800 28.62800  1.000 31.27020 ? 740  PRO A CG    1 
ATOM   4040 C  CD    . PRO C 3 436 ? 6.07600   100.74400 27.88800  1.000 32.36866 ? 740  PRO A CD    1 
ATOM   4041 N  N     . ASP C 3 437 ? 9.16700   102.55600 28.52000  1.000 30.49744 ? 741  ASP A N     1 
ATOM   4042 C  CA    . ASP C 3 437 ? 10.31700  103.08700 29.24500  1.000 36.21865 ? 741  ASP A CA    1 
ATOM   4043 C  C     . ASP C 3 437 ? 11.56600  102.49000 28.63100  1.000 35.02109 ? 741  ASP A C     1 
ATOM   4044 O  O     . ASP C 3 437 ? 11.75700  101.28100 28.67700  1.000 33.02039 ? 741  ASP A O     1 
ATOM   4045 C  CB    . ASP C 3 437 ? 10.18500  102.78900 30.74300  1.000 31.58039 ? 741  ASP A CB    1 
ATOM   4046 C  CG    . ASP C 3 437 ? 11.48400  102.96500 31.51000  1.000 36.33956 ? 741  ASP A CG    1 
ATOM   4047 O  OD1   . ASP C 3 437 ? 12.44600  103.60600 31.00100  1.000 27.66608 ? 741  ASP A OD1   1 
ATOM   4048 O  OD2   . ASP C 3 437 ? 11.51800  102.46400 32.66300  1.000 31.70147 ? 741  ASP A OD2   1 
ATOM   4049 N  N     . ASN C 3 438 ? 12.41200  103.34700 28.06300  1.000 39.71480 ? 742  ASN A N     1 
ATOM   4050 C  CA    . ASN C 3 438 ? 13.63600  102.93600 27.39600  1.000 36.45854 ? 742  ASN A CA    1 
ATOM   4051 C  C     . ASN C 3 438 ? 14.84600  103.68900 27.93500  1.000 40.35539 ? 742  ASN A C     1 
ATOM   4052 O  O     . ASN C 3 438 ? 15.73200  104.10700 27.18600  1.000 45.76993 ? 742  ASN A O     1 
ATOM   4053 C  CB    . ASN C 3 438 ? 13.47800  103.10600 25.88800  1.000 35.99219 ? 742  ASN A CB    1 
ATOM   4054 C  CG    . ASN C 3 438 ? 12.21400  102.41200 25.35200  1.000 44.85348 ? 742  ASN A CG    1 
ATOM   4055 O  OD1   . ASN C 3 438 ? 11.28600  103.06400 24.84700  1.000 41.93583 ? 742  ASN A OD1   1 
ATOM   4056 N  ND2   . ASN C 3 438 ? 12.17100  101.08200 25.47600  1.000 49.86480 ? 742  ASN A ND2   1 
ATOM   4057 N  N     . ASN C 3 439 ? 14.89700  103.85000 29.25300  1.000 36.41490 ? 743  ASN A N     1 
ATOM   4058 C  CA    . ASN C 3 439 ? 16.02300  104.53500 29.89600  1.000 33.25208 ? 743  ASN A CA    1 
ATOM   4059 C  C     . ASN C 3 439 ? 16.83900  103.60600 30.78900  1.000 28.77752 ? 743  ASN A C     1 
ATOM   4060 O  O     . ASN C 3 439 ? 16.29600  102.76800 31.51800  1.000 26.50080 ? 743  ASN A O     1 
ATOM   4061 C  CB    . ASN C 3 439 ? 15.51500  105.75100 30.67700  1.000 25.38012 ? 743  ASN A CB    1 
ATOM   4062 C  CG    . ASN C 3 439 ? 16.61300  106.45600 31.44800  1.000 22.97041 ? 743  ASN A CG    1 
ATOM   4063 O  OD1   . ASN C 3 439 ? 17.26900  107.35500 30.92800  1.000 26.64264 ? 743  ASN A OD1   1 
ATOM   4064 N  ND2   . ASN C 3 439 ? 16.79000  106.08300 32.70200  1.000 27.15062 ? 743  ASN A ND2   1 
HETATM 4065 MG MG    . MG  D 4 .   ? -1.43800  62.86800  10.99800  1.000 37.04387 ? 801  MG  P MG    1 
HETATM 4066 O  O     . HOH E 5 .   ? -6.52000  74.03800  6.56100   1.000 30.50507 ? 901  HOH P O     1 
HETATM 4067 O  O     . HOH E 5 .   ? -0.39300  74.69300  9.82000   1.000 40.53444 ? 902  HOH P O     1 
HETATM 4068 O  O     . HOH E 5 .   ? 14.83600  72.68000  22.17200  1.000 36.35804 ? 903  HOH P O     1 
HETATM 4069 O  O     . HOH E 5 .   ? 22.14700  80.12500  20.81300  1.000 27.62654 ? 904  HOH P O     1 
HETATM 4070 O  O     . HOH E 5 .   ? 17.44600  68.35500  10.39700  1.000 38.17672 ? 905  HOH P O     1 
HETATM 4071 O  O     . HOH E 5 .   ? 10.92800  66.28400  9.46100   1.000 38.70308 ? 906  HOH P O     1 
HETATM 4072 O  O     . HOH E 5 .   ? 3.00900   71.21900  14.76300  1.000 34.03933 ? 907  HOH P O     1 
HETATM 4073 O  O     . HOH E 5 .   ? 6.11000   64.65000  9.19200   1.000 31.04000 ? 908  HOH P O     1 
HETATM 4074 O  O     . HOH E 5 .   ? 15.54500  72.08300  26.15600  1.000 33.34733 ? 909  HOH P O     1 
HETATM 4075 O  O     . HOH E 5 .   ? 10.32100  70.84200  8.42200   1.000 35.20973 ? 910  HOH P O     1 
HETATM 4076 O  O     . HOH E 5 .   ? 17.63600  74.15500  41.21200  1.000 43.52258 ? 911  HOH P O     1 
HETATM 4077 O  O     . HOH E 5 .   ? 12.36400  71.89400  11.05700  1.000 35.11574 ? 912  HOH P O     1 
HETATM 4078 O  O     . HOH E 5 .   ? 16.48600  71.81900  12.25300  1.000 37.20167 ? 913  HOH P O     1 
HETATM 4079 O  O     . HOH E 5 .   ? -0.15000  66.74300  8.11100   1.000 29.02412 ? 914  HOH P O     1 
HETATM 4080 O  O     . HOH E 5 .   ? 12.64600  69.57700  10.38000  1.000 27.82491 ? 915  HOH P O     1 
HETATM 4081 O  O     . HOH E 5 .   ? -0.73400  63.29900  9.03200   1.000 30.01449 ? 916  HOH P O     1 
HETATM 4082 O  O     . HOH E 5 .   ? 5.72800   68.19400  6.62200   1.000 25.55301 ? 917  HOH P O     1 
HETATM 4083 O  O     . HOH E 5 .   ? 5.84500   67.03400  15.78500  1.000 30.89549 ? 918  HOH P O     1 
HETATM 4084 O  O     . HOH E 5 .   ? 24.55600  72.58600  26.34600  1.000 36.02837 ? 919  HOH P O     1 
HETATM 4085 O  O     . HOH E 5 .   ? 1.08100   67.87100  4.99500   1.000 35.82138 ? 920  HOH P O     1 
HETATM 4086 O  O     . HOH E 5 .   ? 27.08800  74.72300  19.74600  1.000 39.52996 ? 921  HOH P O     1 
HETATM 4087 O  O     . HOH E 5 .   ? 3.61800   65.00900  8.45100   1.000 30.13284 ? 922  HOH P O     1 
HETATM 4088 O  O     . HOH E 5 .   ? 0.68400   73.91500  4.31100   1.000 32.77547 ? 923  HOH P O     1 
HETATM 4089 O  O     . HOH E 5 .   ? 17.905    65.782    37.837    1.000 36.74535 ? 924  HOH P O     1 
HETATM 4090 O  O     . HOH E 5 .   ? 2.30900   70.21100  2.88100   1.000 43.42590 ? 925  HOH P O     1 
HETATM 4091 O  O     . HOH E 5 .   ? -2.34300  76.70300  6.74000   1.000 26.37076 ? 926  HOH P O     1 
HETATM 4092 O  O     . HOH E 5 .   ? 0.05400   72.06900  2.67900   1.000 36.41330 ? 927  HOH P O     1 
HETATM 4093 O  O     . HOH F 5 .   ? 5.47300   83.34700  9.98300   1.000 33.63315 ? 101  HOH T O     1 
HETATM 4094 O  O     . HOH F 5 .   ? 23.10100  75.53200  37.76400  1.000 43.22171 ? 102  HOH T O     1 
HETATM 4095 O  O     . HOH F 5 .   ? 11.61300  72.70300  22.00800  1.000 33.73395 ? 103  HOH T O     1 
HETATM 4096 O  O     . HOH F 5 .   ? 28.03500  63.32100  23.76200  1.000 48.48476 ? 104  HOH T O     1 
HETATM 4097 O  O     . HOH F 5 .   ? 19.88600  60.37900  26.55000  1.000 48.00921 ? 105  HOH T O     1 
HETATM 4098 O  O     . HOH F 5 .   ? 3.19200   77.37700  -4.98500  1.000 16.99583 ? 106  HOH T O     1 
HETATM 4099 O  O     . HOH F 5 .   ? 2.43900   76.93800  5.05500   1.000 20.58153 ? 107  HOH T O     1 
HETATM 4100 O  O     . HOH F 5 .   ? 7.89000   79.53100  18.19400  1.000 28.15372 ? 108  HOH T O     1 
HETATM 4101 O  O     . HOH F 5 .   ? 1.52900   81.97900  16.55600  1.000 27.74734 ? 109  HOH T O     1 
HETATM 4102 O  O     . HOH F 5 .   ? 10.83100  76.57600  10.89500  1.000 21.42785 ? 110  HOH T O     1 
HETATM 4103 O  O     . HOH F 5 .   ? 10.40500  82.20600  -19.88800 1.000 31.29569 ? 111  HOH T O     1 
HETATM 4104 O  O     . HOH F 5 .   ? 11.20200  72.97200  3.53700   1.000 24.14966 ? 112  HOH T O     1 
HETATM 4105 O  O     . HOH F 5 .   ? 11.52300  69.84900  -12.83900 1.000 19.49929 ? 113  HOH T O     1 
HETATM 4106 O  O     . HOH F 5 .   ? 26.44200  71.85600  28.14900  1.000 37.59219 ? 114  HOH T O     1 
HETATM 4107 O  O     . HOH F 5 .   ? 14.44900  67.26500  -6.74700  1.000 23.20555 ? 115  HOH T O     1 
HETATM 4108 O  O     . HOH F 5 .   ? 12.65800  71.35900  24.46500  1.000 37.17164 ? 116  HOH T O     1 
HETATM 4109 O  O     . HOH F 5 .   ? 6.99300   61.86100  22.37500  1.000 29.61537 ? 117  HOH T O     1 
HETATM 4110 O  O     . HOH F 5 .   ? 3.10300   75.10000  15.16100  1.000 33.96792 ? 118  HOH T O     1 
HETATM 4111 O  O     . HOH F 5 .   ? 12.19400  76.34900  14.03400  1.000 27.91840 ? 119  HOH T O     1 
HETATM 4112 O  O     . HOH F 5 .   ? 14.99800  68.15400  26.51500  1.000 30.27128 ? 120  HOH T O     1 
HETATM 4113 O  O     . HOH F 5 .   ? 10.88100  79.66200  13.75400  1.000 31.11186 ? 121  HOH T O     1 
HETATM 4114 O  O     . HOH F 5 .   ? 10.29300  60.38400  25.02800  1.000 43.02974 ? 122  HOH T O     1 
HETATM 4115 O  O     . HOH F 5 .   ? 23.71200  75.65900  31.63600  1.000 43.01282 ? 123  HOH T O     1 
HETATM 4116 O  O     . HOH F 5 .   ? 12.16100  65.35500  -4.48900  1.000 27.75082 ? 124  HOH T O     1 
HETATM 4117 O  O     . HOH F 5 .   ? 10.92800  82.25400  -10.23100 1.000 31.93160 ? 125  HOH T O     1 
HETATM 4118 O  O     . HOH F 5 .   ? 4.44900   80.41900  -13.09200 1.000 30.40962 ? 126  HOH T O     1 
HETATM 4119 O  O     . HOH F 5 .   ? 3.90200   71.27200  17.12700  1.000 38.60173 ? 127  HOH T O     1 
HETATM 4120 O  O     . HOH F 5 .   ? 7.58300   67.44900  -1.39400  1.000 27.29252 ? 128  HOH T O     1 
HETATM 4121 O  O     . HOH F 5 .   ? 1.23400   75.64900  19.62600  1.000 37.88429 ? 129  HOH T O     1 
HETATM 4122 O  O     . HOH F 5 .   ? 2.03800   72.96900  19.02300  1.000 37.27790 ? 130  HOH T O     1 
HETATM 4123 O  O     . HOH F 5 .   ? 9.64900   63.55500  -4.51500  1.000 39.56645 ? 131  HOH T O     1 
HETATM 4124 O  O     . HOH F 5 .   ? 8.70000   79.24500  20.26400  1.000 34.09748 ? 132  HOH T O     1 
HETATM 4125 O  O     . HOH F 5 .   ? 12.97500  63.46200  -5.92600  1.000 33.96621 ? 133  HOH T O     1 
HETATM 4126 O  O     . HOH G 5 .   ? -11.14100 49.99800  8.59600   1.000 31.06822 ? 901  HOH A O     1 
HETATM 4127 O  O     . HOH G 5 .   ? -18.22900 64.71600  -9.16400  1.000 34.83790 ? 902  HOH A O     1 
HETATM 4128 O  O     . HOH G 5 .   ? 9.90200   59.69100  14.67500  1.000 41.87431 ? 903  HOH A O     1 
HETATM 4129 O  O     . HOH G 5 .   ? -18.88500 77.00000  -14.86500 1.000 37.89569 ? 904  HOH A O     1 
HETATM 4130 O  O     . HOH G 5 .   ? 2.50000   77.84100  20.83700  1.000 41.26998 ? 905  HOH A O     1 
HETATM 4131 O  O     . HOH G 5 .   ? -12.76600 67.60600  1.35800   1.000 28.75379 ? 906  HOH A O     1 
HETATM 4132 O  O     . HOH G 5 .   ? -3.31600  63.90600  11.07200  1.000 38.69933 ? 907  HOH A O     1 
HETATM 4133 O  O     . HOH G 5 .   ? -7.94800  72.94700  4.01600   1.000 32.96441 ? 908  HOH A O     1 
HETATM 4134 O  O     . HOH G 5 .   ? 20.61800  75.64400  15.99800  1.000 25.51358 ? 909  HOH A O     1 
HETATM 4135 O  O     . HOH G 5 .   ? 17.29800  72.62100  -11.16400 1.000 21.12892 ? 910  HOH A O     1 
HETATM 4136 O  O     . HOH G 5 .   ? -17.41700 59.51500  5.49800   1.000 36.94859 ? 911  HOH A O     1 
HETATM 4137 O  O     . HOH G 5 .   ? -27.43000 83.03400  17.86000  1.000 38.97548 ? 912  HOH A O     1 
HETATM 4138 O  O     . HOH G 5 .   ? -0.88600  41.66300  12.14100  1.000 39.35322 ? 913  HOH A O     1 
HETATM 4139 O  O     . HOH G 5 .   ? -9.63200  71.55000  3.26900   1.000 28.10474 ? 914  HOH A O     1 
HETATM 4140 O  O     . HOH G 5 .   ? 4.27200   90.03200  24.80400  1.000 37.56087 ? 915  HOH A O     1 
HETATM 4141 O  O     . HOH G 5 .   ? -9.67000  68.65100  0.77800   1.000 27.64712 ? 916  HOH A O     1 
HETATM 4142 O  O     . HOH G 5 .   ? -19.81300 55.36500  16.21800  1.000 29.94147 ? 917  HOH A O     1 
HETATM 4143 O  O     . HOH G 5 .   ? -21.50100 73.87400  32.89300  1.000 36.88314 ? 918  HOH A O     1 
HETATM 4144 O  O     . HOH G 5 .   ? -3.27400  69.27100  -16.97900 1.000 24.05108 ? 919  HOH A O     1 
HETATM 4145 O  O     . HOH G 5 .   ? 26.28000  67.72600  2.19800   1.000 26.79769 ? 920  HOH A O     1 
HETATM 4146 O  O     . HOH G 5 .   ? -20.17600 62.56200  25.15200  1.000 29.79021 ? 921  HOH A O     1 
HETATM 4147 O  O     . HOH G 5 .   ? -3.93600  87.95200  5.13600   1.000 22.87688 ? 922  HOH A O     1 
HETATM 4148 O  O     . HOH G 5 .   ? 14.45700  75.60300  5.99200   1.000 31.75728 ? 923  HOH A O     1 
HETATM 4149 O  O     . HOH G 5 .   ? 12.23000  78.00500  9.80300   1.000 27.66586 ? 924  HOH A O     1 
HETATM 4150 O  O     . HOH G 5 .   ? -7.04600  69.26100  -1.46300  1.000 29.12728 ? 925  HOH A O     1 
HETATM 4151 O  O     . HOH G 5 .   ? 7.27600   50.68900  9.93600   1.000 37.24836 ? 926  HOH A O     1 
HETATM 4152 O  O     . HOH G 5 .   ? -8.51400  63.42700  29.03600  1.000 33.52116 ? 927  HOH A O     1 
HETATM 4153 O  O     . HOH G 5 .   ? 13.20000  100.32000 30.44200  1.000 35.33526 ? 928  HOH A O     1 
HETATM 4154 O  O     . HOH G 5 .   ? -28.37600 64.57200  10.50800  1.000 31.72335 ? 929  HOH A O     1 
HETATM 4155 O  O     . HOH G 5 .   ? 27.91200  69.35100  -0.85700  1.000 19.59907 ? 930  HOH A O     1 
HETATM 4156 O  O     . HOH G 5 .   ? -21.63400 88.78000  6.12800   1.000 30.35232 ? 931  HOH A O     1 
HETATM 4157 O  O     . HOH G 5 .   ? 28.58900  89.37200  14.85600  1.000 24.73718 ? 932  HOH A O     1 
HETATM 4158 O  O     . HOH G 5 .   ? 8.95600   63.30000  -12.39500 1.000 36.68919 ? 933  HOH A O     1 
HETATM 4159 O  O     . HOH G 5 .   ? 13.28700  94.63800  24.16300  1.000 25.48802 ? 934  HOH A O     1 
HETATM 4160 O  O     . HOH G 5 .   ? 3.48700   62.51400  -16.89500 1.000 35.95297 ? 935  HOH A O     1 
HETATM 4161 O  O     . HOH G 5 .   ? 10.86200  96.65400  16.76800  1.000 24.54033 ? 936  HOH A O     1 
HETATM 4162 O  O     . HOH G 5 .   ? -21.59600 74.85800  30.36200  1.000 36.28920 ? 937  HOH A O     1 
HETATM 4163 O  O     . HOH G 5 .   ? -16.589   92.199    11.091    1.000 31.08579 ? 938  HOH A O     1 
HETATM 4164 O  O     . HOH G 5 .   ? 27.26700  93.28200  1.80100   1.000 19.57229 ? 939  HOH A O     1 
HETATM 4165 O  O     . HOH G 5 .   ? -23.30300 66.57600  -16.75600 1.000 35.25793 ? 940  HOH A O     1 
HETATM 4166 O  O     . HOH G 5 .   ? -13.35600 91.03900  10.40300  1.000 36.54841 ? 941  HOH A O     1 
HETATM 4167 O  O     . HOH G 5 .   ? -10.95800 70.16400  16.58500  1.000 14.55522 ? 942  HOH A O     1 
HETATM 4168 O  O     . HOH G 5 .   ? 14.71200  86.60000  25.18500  1.000 36.75734 ? 943  HOH A O     1 
HETATM 4169 O  O     . HOH G 5 .   ? 34.43800  85.20100  4.54500   1.000 33.19775 ? 944  HOH A O     1 
HETATM 4170 O  O     . HOH G 5 .   ? 7.22600   70.79200  -1.92500  1.000 23.40233 ? 945  HOH A O     1 
HETATM 4171 O  O     . HOH G 5 .   ? -14.40100 90.46400  2.16900   1.000 24.97427 ? 946  HOH A O     1 
HETATM 4172 O  O     . HOH G 5 .   ? -23.00800 55.58900  25.01600  1.000 40.24392 ? 947  HOH A O     1 
HETATM 4173 O  O     . HOH G 5 .   ? 0.06700   70.72200  -15.25300 1.000 18.80569 ? 948  HOH A O     1 
HETATM 4174 O  O     . HOH G 5 .   ? -5.59000  88.53000  -8.38700  1.000 28.32633 ? 949  HOH A O     1 
HETATM 4175 O  O     . HOH G 5 .   ? 10.12000  53.38600  17.64600  1.000 35.18349 ? 950  HOH A O     1 
HETATM 4176 O  O     . HOH G 5 .   ? 27.99600  77.95000  5.52500   1.000 22.15363 ? 951  HOH A O     1 
HETATM 4177 O  O     . HOH G 5 .   ? 5.16800   67.82400  -2.67600  1.000 28.64927 ? 952  HOH A O     1 
HETATM 4178 O  O     . HOH G 5 .   ? -5.20000  90.36900  5.20400   1.000 28.69560 ? 953  HOH A O     1 
HETATM 4179 O  O     . HOH G 5 .   ? 1.82800   88.76100  16.61000  1.000 35.44927 ? 954  HOH A O     1 
HETATM 4180 O  O     . HOH G 5 .   ? -6.83100  67.00700  20.74200  1.000 27.04940 ? 955  HOH A O     1 
HETATM 4181 O  O     . HOH G 5 .   ? 2.27300   80.06400  -11.86500 1.000 30.52730 ? 956  HOH A O     1 
HETATM 4182 O  O     . HOH G 5 .   ? -2.43400  65.81500  28.98900  1.000 32.31104 ? 957  HOH A O     1 
HETATM 4183 O  O     . HOH G 5 .   ? -5.77400  90.62900  8.75300   1.000 25.20562 ? 958  HOH A O     1 
HETATM 4184 O  O     . HOH G 5 .   ? -8.18800  44.75800  15.30100  1.000 36.17763 ? 959  HOH A O     1 
HETATM 4185 O  O     . HOH G 5 .   ? -5.62000  54.84600  -9.13600  1.000 41.60215 ? 960  HOH A O     1 
HETATM 4186 O  O     . HOH G 5 .   ? 17.08800  70.47500  -12.10000 1.000 26.98886 ? 961  HOH A O     1 
HETATM 4187 O  O     . HOH G 5 .   ? 4.53400   90.13600  27.53800  1.000 42.48376 ? 962  HOH A O     1 
HETATM 4188 O  O     . HOH G 5 .   ? 25.11900  88.94900  -9.09200  1.000 37.70784 ? 963  HOH A O     1 
HETATM 4189 O  O     . HOH G 5 .   ? -7.14400  85.81000  -7.46400  1.000 16.41091 ? 964  HOH A O     1 
HETATM 4190 O  O     . HOH G 5 .   ? -27.72700 81.82000  13.64000  1.000 28.85417 ? 965  HOH A O     1 
HETATM 4191 O  O     . HOH G 5 .   ? -27.10800 68.51500  27.67700  1.000 42.83521 ? 966  HOH A O     1 
HETATM 4192 O  O     . HOH G 5 .   ? 5.90400   88.83500  -2.41900  1.000 23.81686 ? 967  HOH A O     1 
HETATM 4193 O  O     . HOH G 5 .   ? -11.87400 70.34500  29.39200  1.000 33.75636 ? 968  HOH A O     1 
HETATM 4194 O  O     . HOH G 5 .   ? -3.57100  61.56700  4.01500   1.000 38.49596 ? 969  HOH A O     1 
HETATM 4195 O  O     . HOH G 5 .   ? -20.00100 48.39700  17.44300  1.000 38.29281 ? 970  HOH A O     1 
HETATM 4196 O  O     . HOH G 5 .   ? 32.85600  86.60900  -3.58600  1.000 20.56873 ? 971  HOH A O     1 
HETATM 4197 O  O     . HOH G 5 .   ? -13.70900 89.41500  13.60400  1.000 31.96060 ? 972  HOH A O     1 
HETATM 4198 O  O     . HOH G 5 .   ? -5.94600  47.97400  24.10900  1.000 37.72401 ? 973  HOH A O     1 
HETATM 4199 O  O     . HOH G 5 .   ? 8.69800   45.45900  12.77900  1.000 36.34533 ? 974  HOH A O     1 
HETATM 4200 O  O     . HOH G 5 .   ? 18.03700  88.11100  -3.87100  1.000 15.14944 ? 975  HOH A O     1 
HETATM 4201 O  O     . HOH G 5 .   ? -19.63900 89.18100  9.92200   1.000 23.92453 ? 976  HOH A O     1 
HETATM 4202 O  O     . HOH G 5 .   ? 21.92100  69.52400  -5.88900  1.000 22.49656 ? 977  HOH A O     1 
HETATM 4203 O  O     . HOH G 5 .   ? -4.61600  52.08200  7.32300   1.000 27.16338 ? 978  HOH A O     1 
HETATM 4204 O  O     . HOH G 5 .   ? -12.15500 68.67600  25.23000  1.000 23.82579 ? 979  HOH A O     1 
HETATM 4205 O  O     . HOH G 5 .   ? 17.80000  81.15000  -8.75800  1.000 15.65262 ? 980  HOH A O     1 
HETATM 4206 O  O     . HOH G 5 .   ? 33.63800  71.11400  1.52700   1.000 29.88316 ? 981  HOH A O     1 
HETATM 4207 O  O     . HOH G 5 .   ? 0.86600   64.13200  25.93500  1.000 34.21301 ? 982  HOH A O     1 
HETATM 4208 O  O     . HOH G 5 .   ? 26.73700  91.40500  15.11400  1.000 25.47582 ? 983  HOH A O     1 
HETATM 4209 O  O     . HOH G 5 .   ? 5.14300   62.85600  -6.57300  1.000 30.06239 ? 984  HOH A O     1 
HETATM 4210 O  O     . HOH G 5 .   ? -27.18800 74.42800  21.33100  1.000 46.09786 ? 985  HOH A O     1 
HETATM 4211 O  O     . HOH G 5 .   ? 14.14200  67.13300  -14.26500 1.000 35.72075 ? 986  HOH A O     1 
HETATM 4212 O  O     . HOH G 5 .   ? -29.259   79.094    5.826     1.000 23.19781 ? 987  HOH A O     1 
HETATM 4213 O  O     . HOH G 5 .   ? -25.81800 72.96200  20.38100  1.000 28.64184 ? 988  HOH A O     1 
HETATM 4214 O  O     . HOH G 5 .   ? 21.66400  60.40500  -5.71500  1.000 37.83129 ? 989  HOH A O     1 
HETATM 4215 O  O     . HOH G 5 .   ? 31.46900  74.29700  9.60400   1.000 29.35762 ? 990  HOH A O     1 
HETATM 4216 O  O     . HOH G 5 .   ? -8.83900  67.35300  2.84800   1.000 35.96443 ? 991  HOH A O     1 
HETATM 4217 O  O     . HOH G 5 .   ? 9.23000   98.84200  17.16900  1.000 36.36847 ? 992  HOH A O     1 
HETATM 4218 O  O     . HOH G 5 .   ? 2.87800   88.00100  13.78700  1.000 23.99518 ? 993  HOH A O     1 
HETATM 4219 O  O     . HOH G 5 .   ? -26.71300 72.22300  4.17500   1.000 31.98399 ? 994  HOH A O     1 
HETATM 4220 O  O     . HOH G 5 .   ? -5.04400  59.68400  -19.07100 1.000 36.16365 ? 995  HOH A O     1 
HETATM 4221 O  O     . HOH G 5 .   ? -10.58700 69.00600  2.80900   1.000 31.43761 ? 996  HOH A O     1 
HETATM 4222 O  O     . HOH G 5 .   ? 3.93100   64.77600  16.65800  1.000 35.16059 ? 997  HOH A O     1 
HETATM 4223 O  O     . HOH G 5 .   ? -21.18100 77.78300  31.10800  1.000 30.16054 ? 998  HOH A O     1 
HETATM 4224 O  O     . HOH G 5 .   ? -2.48200  44.05500  11.30100  1.000 26.79955 ? 999  HOH A O     1 
HETATM 4225 O  O     . HOH G 5 .   ? 22.85700  90.85800  -6.02900  1.000 23.38448 ? 1000 HOH A O     1 
HETATM 4226 O  O     . HOH G 5 .   ? 32.59900  72.42000  4.46300   1.000 24.65974 ? 1001 HOH A O     1 
HETATM 4227 O  O     . HOH G 5 .   ? -3.01800  77.28200  13.13800  1.000 24.15388 ? 1002 HOH A O     1 
HETATM 4228 O  O     . HOH G 5 .   ? -12.23000 49.66700  19.78700  1.000 35.95215 ? 1003 HOH A O     1 
HETATM 4229 O  O     . HOH G 5 .   ? -31.22500 64.35100  18.92500  1.000 38.75691 ? 1004 HOH A O     1 
HETATM 4230 O  O     . HOH G 5 .   ? 11.65400  86.35000  25.05700  1.000 29.90101 ? 1005 HOH A O     1 
HETATM 4231 O  O     . HOH G 5 .   ? 17.38400  66.25200  1.87900   1.000 28.16319 ? 1006 HOH A O     1 
HETATM 4232 O  O     . HOH G 5 .   ? -10.32700 47.74400  12.16300  1.000 27.87693 ? 1007 HOH A O     1 
HETATM 4233 O  O     . HOH G 5 .   ? -20.75300 53.84100  14.49100  1.000 40.80313 ? 1008 HOH A O     1 
HETATM 4234 O  O     . HOH G 5 .   ? 15.02900  97.65300  12.76500  1.000 24.74123 ? 1009 HOH A O     1 
HETATM 4235 O  O     . HOH G 5 .   ? -4.87300  64.75800  20.51100  1.000 29.34818 ? 1010 HOH A O     1 
HETATM 4236 O  O     . HOH G 5 .   ? 5.45200   55.88900  6.67000   1.000 25.55139 ? 1011 HOH A O     1 
HETATM 4237 O  O     . HOH G 5 .   ? -18.54500 49.24700  19.01100  1.000 32.93939 ? 1012 HOH A O     1 
HETATM 4238 O  O     . HOH G 5 .   ? -4.34700  63.31000  8.53300   1.000 29.29913 ? 1013 HOH A O     1 
HETATM 4239 O  O     . HOH G 5 .   ? 10.29600  83.63000  -8.29900  1.000 26.31820 ? 1014 HOH A O     1 
HETATM 4240 O  O     . HOH G 5 .   ? -7.98400  90.05800  5.38000   1.000 21.30294 ? 1015 HOH A O     1 
HETATM 4241 O  O     . HOH G 5 .   ? 25.57300  61.65700  0.57300   1.000 30.72649 ? 1016 HOH A O     1 
HETATM 4242 O  O     . HOH G 5 .   ? 11.82700  97.87700  9.65100   1.000 30.59677 ? 1017 HOH A O     1 
HETATM 4243 O  O     . HOH G 5 .   ? -1.03600  76.37000  -13.88800 1.000 26.12347 ? 1018 HOH A O     1 
HETATM 4244 O  O     . HOH G 5 .   ? -1.24400  51.51400  9.03000   1.000 25.41471 ? 1019 HOH A O     1 
HETATM 4245 O  O     . HOH G 5 .   ? -24.70600 83.42800  3.60300   1.000 26.47273 ? 1020 HOH A O     1 
HETATM 4246 O  O     . HOH G 5 .   ? 15.37100  88.92500  -2.68900  1.000 18.66657 ? 1021 HOH A O     1 
HETATM 4247 O  O     . HOH G 5 .   ? -14.95800 74.52600  -0.80500  1.000 12.63260 ? 1022 HOH A O     1 
HETATM 4248 O  O     . HOH G 5 .   ? 23.06900  83.28500  -8.60600  1.000 31.31634 ? 1023 HOH A O     1 
HETATM 4249 O  O     . HOH G 5 .   ? 20.79400  68.18400  -3.57100  1.000 19.00099 ? 1024 HOH A O     1 
HETATM 4250 O  O     . HOH G 5 .   ? 30.65800  66.06500  -4.13500  1.000 30.07369 ? 1025 HOH A O     1 
HETATM 4251 O  O     . HOH G 5 .   ? -2.55200  50.40700  6.65700   1.000 23.46286 ? 1026 HOH A O     1 
HETATM 4252 O  O     . HOH G 5 .   ? -20.85900 83.10100  15.79400  1.000 19.20316 ? 1027 HOH A O     1 
HETATM 4253 O  O     . HOH G 5 .   ? -20.58100 75.61200  -6.24700  1.000 22.90986 ? 1028 HOH A O     1 
HETATM 4254 O  O     . HOH G 5 .   ? 12.00200  91.98000  -11.39800 1.000 31.34144 ? 1029 HOH A O     1 
HETATM 4255 O  O     . HOH G 5 .   ? 2.37700   74.08600  -7.86100  1.000 18.57385 ? 1030 HOH A O     1 
HETATM 4256 O  O     . HOH G 5 .   ? -8.06000  43.62800  12.41800  1.000 29.61809 ? 1031 HOH A O     1 
HETATM 4257 O  O     . HOH G 5 .   ? -21.16200 74.19400  2.61500   1.000 19.27419 ? 1032 HOH A O     1 
HETATM 4258 O  O     . HOH G 5 .   ? 24.40900  77.35400  -4.68900  1.000 20.55073 ? 1033 HOH A O     1 
HETATM 4259 O  O     . HOH G 5 .   ? -4.84300  82.91500  -11.87200 1.000 32.62011 ? 1034 HOH A O     1 
HETATM 4260 O  O     . HOH G 5 .   ? 8.29400   69.51800  -4.47900  1.000 27.66671 ? 1035 HOH A O     1 
HETATM 4261 O  O     . HOH G 5 .   ? -29.58100 76.28600  13.21300  1.000 21.60104 ? 1036 HOH A O     1 
HETATM 4262 O  O     . HOH G 5 .   ? 26.70000  64.14300  1.86000   1.000 26.82645 ? 1037 HOH A O     1 
HETATM 4263 O  O     . HOH G 5 .   ? -14.17700 46.59100  12.93700  1.000 22.59744 ? 1038 HOH A O     1 
HETATM 4264 O  O     . HOH G 5 .   ? 18.24300  85.05600  24.62800  1.000 27.09148 ? 1039 HOH A O     1 
HETATM 4265 O  O     . HOH G 5 .   ? -14.88000 81.76300  -13.15400 1.000 28.01244 ? 1040 HOH A O     1 
HETATM 4266 O  O     . HOH G 5 .   ? -26.68900 73.23500  1.93700   1.000 35.80563 ? 1041 HOH A O     1 
HETATM 4267 O  O     . HOH G 5 .   ? 6.42000   86.62100  21.95800  1.000 38.19211 ? 1042 HOH A O     1 
HETATM 4268 O  O     . HOH G 5 .   ? -7.84500  85.71000  5.82500   1.000 23.91308 ? 1043 HOH A O     1 
HETATM 4269 O  O     . HOH G 5 .   ? 9.63800   84.54500  22.15900  1.000 22.62351 ? 1044 HOH A O     1 
HETATM 4270 O  O     . HOH G 5 .   ? 3.45200   78.40800  9.31800   1.000 28.30104 ? 1045 HOH A O     1 
HETATM 4271 O  O     . HOH G 5 .   ? -5.12700  44.47400  10.60900  1.000 20.33688 ? 1046 HOH A O     1 
HETATM 4272 O  O     . HOH G 5 .   ? -28.04500 82.76300  3.00400   1.000 33.30699 ? 1047 HOH A O     1 
HETATM 4273 O  O     . HOH G 5 .   ? 13.01400  90.74200  -2.80900  1.000 25.70260 ? 1048 HOH A O     1 
HETATM 4274 O  O     . HOH G 5 .   ? 20.30400  87.88800  -11.65200 1.000 29.98311 ? 1049 HOH A O     1 
HETATM 4275 O  O     . HOH G 5 .   ? 14.56600  92.50600  1.87100   1.000 20.19811 ? 1050 HOH A O     1 
HETATM 4276 O  O     . HOH G 5 .   ? 13.69500  100.48400 17.38200  1.000 44.30139 ? 1051 HOH A O     1 
HETATM 4277 O  O     . HOH G 5 .   ? 20.50000  66.46700  7.32200   1.000 27.06511 ? 1052 HOH A O     1 
HETATM 4278 O  O     . HOH G 5 .   ? -14.74700 85.19400  12.41200  1.000 25.57769 ? 1053 HOH A O     1 
HETATM 4279 O  O     . HOH G 5 .   ? 23.859    95.704    1.063     1.000 15.29140 ? 1054 HOH A O     1 
HETATM 4280 O  O     . HOH G 5 .   ? 24.19000  81.15300  -9.90400  1.000 38.29279 ? 1055 HOH A O     1 
HETATM 4281 O  O     . HOH G 5 .   ? -10.94400 66.31200  -18.09700 1.000 31.59258 ? 1056 HOH A O     1 
HETATM 4282 O  O     . HOH G 5 .   ? 22.80100  87.92500  -4.00200  1.000 13.71714 ? 1057 HOH A O     1 
HETATM 4283 O  O     . HOH G 5 .   ? -10.43700 76.58600  -23.92900 1.000 41.81984 ? 1058 HOH A O     1 
HETATM 4284 O  O     . HOH G 5 .   ? -0.68500  57.90700  4.45900   1.000 40.25396 ? 1059 HOH A O     1 
HETATM 4285 O  O     . HOH G 5 .   ? -7.20000  71.45000  -0.54300  1.000 25.56058 ? 1060 HOH A O     1 
HETATM 4286 O  O     . HOH G 5 .   ? 11.54100  93.44700  -4.21000  1.000 35.40519 ? 1061 HOH A O     1 
HETATM 4287 O  O     . HOH G 5 .   ? -17.18600 82.37800  -6.37700  1.000 32.17446 ? 1062 HOH A O     1 
HETATM 4288 O  O     . HOH G 5 .   ? 25.84900  84.11300  -7.13600  1.000 25.54939 ? 1063 HOH A O     1 
HETATM 4289 O  O     . HOH G 5 .   ? -0.78100  43.31600  7.82900   1.000 26.80166 ? 1064 HOH A O     1 
HETATM 4290 O  O     . HOH G 5 .   ? 17.14900  75.27400  -3.87700  1.000 13.18353 ? 1065 HOH A O     1 
HETATM 4291 O  O     . HOH G 5 .   ? 9.01500   51.10800  16.27500  1.000 32.40310 ? 1066 HOH A O     1 
HETATM 4292 O  O     . HOH G 5 .   ? -28.97500 80.38000  1.50300   1.000 24.11390 ? 1067 HOH A O     1 
HETATM 4293 O  O     . HOH G 5 .   ? -7.92500  80.51100  -14.19100 1.000 18.75474 ? 1068 HOH A O     1 
HETATM 4294 O  O     . HOH G 5 .   ? -24.26800 60.72200  16.26600  1.000 34.90873 ? 1069 HOH A O     1 
HETATM 4295 O  O     . HOH G 5 .   ? -5.26400  57.88600  31.04900  1.000 43.71062 ? 1070 HOH A O     1 
HETATM 4296 O  O     . HOH G 5 .   ? -8.08700  64.68000  15.88100  1.000 22.80150 ? 1071 HOH A O     1 
HETATM 4297 O  O     . HOH G 5 .   ? 7.64100   97.44100  9.78300   1.000 29.61219 ? 1072 HOH A O     1 
HETATM 4298 O  O     . HOH G 5 .   ? -6.47600  73.49900  -1.11600  1.000 17.41941 ? 1073 HOH A O     1 
HETATM 4299 O  O     . HOH G 5 .   ? -13.187   84.423    -13.857   1.000 31.28800 ? 1074 HOH A O     1 
HETATM 4300 O  O     . HOH G 5 .   ? -3.02900  53.45200  8.87800   1.000 22.32934 ? 1075 HOH A O     1 
HETATM 4301 O  O     . HOH G 5 .   ? -27.77100 78.23800  -2.10200  1.000 34.92218 ? 1076 HOH A O     1 
HETATM 4302 O  O     . HOH G 5 .   ? -3.12300  74.47700  22.67400  1.000 30.74535 ? 1077 HOH A O     1 
HETATM 4303 O  O     . HOH G 5 .   ? 22.69600  92.53300  20.69100  1.000 32.42539 ? 1078 HOH A O     1 
HETATM 4304 O  O     . HOH G 5 .   ? 29.27900  91.27700  4.28100   1.000 32.68867 ? 1079 HOH A O     1 
HETATM 4305 O  O     . HOH G 5 .   ? -14.49500 67.94300  -5.42100  1.000 15.55001 ? 1080 HOH A O     1 
HETATM 4306 O  O     . HOH G 5 .   ? -6.89100  59.93900  -3.32000  1.000 25.28881 ? 1081 HOH A O     1 
HETATM 4307 O  O     . HOH G 5 .   ? 5.84100   94.70900  22.51200  1.000 35.05467 ? 1082 HOH A O     1 
HETATM 4308 O  O     . HOH G 5 .   ? -15.99200 71.91800  -3.22600  1.000 16.91084 ? 1083 HOH A O     1 
HETATM 4309 O  O     . HOH G 5 .   ? -13.60100 88.25500  7.55200   1.000 13.40571 ? 1084 HOH A O     1 
HETATM 4310 O  O     . HOH G 5 .   ? -14.27100 60.85300  4.53700   1.000 29.70443 ? 1085 HOH A O     1 
HETATM 4311 O  O     . HOH G 5 .   ? -15.05200 88.29700  0.39900   1.000 20.55784 ? 1086 HOH A O     1 
HETATM 4312 O  O     . HOH G 5 .   ? -20.68800 74.97300  35.65600  1.000 43.43624 ? 1087 HOH A O     1 
HETATM 4313 O  O     . HOH G 5 .   ? 18.39300  77.06300  16.89300  1.000 24.78943 ? 1088 HOH A O     1 
HETATM 4314 O  O     . HOH G 5 .   ? 20.27200  66.80800  -5.88700  1.000 18.12167 ? 1089 HOH A O     1 
HETATM 4315 O  O     . HOH G 5 .   ? -23.28900 62.45500  12.09700  1.000 18.81590 ? 1090 HOH A O     1 
HETATM 4316 O  O     . HOH G 5 .   ? -17.87400 73.85600  -4.62200  1.000 20.86294 ? 1091 HOH A O     1 
HETATM 4317 O  O     . HOH G 5 .   ? 23.62800  99.62700  19.44900  1.000 32.23886 ? 1092 HOH A O     1 
HETATM 4318 O  O     . HOH G 5 .   ? -9.66000  62.80500  0.18600   1.000 32.40370 ? 1093 HOH A O     1 
HETATM 4319 O  O     . HOH G 5 .   ? 21.80700  98.93400  11.47300  1.000 21.93913 ? 1094 HOH A O     1 
HETATM 4320 O  O     . HOH G 5 .   ? 24.31900  62.43700  3.50800   1.000 33.03399 ? 1095 HOH A O     1 
HETATM 4321 O  O     . HOH G 5 .   ? -2.68100  76.00100  9.44200   1.000 33.17331 ? 1096 HOH A O     1 
HETATM 4322 O  O     . HOH G 5 .   ? -18.70600 51.73300  22.16800  1.000 33.81884 ? 1097 HOH A O     1 
HETATM 4323 O  O     . HOH G 5 .   ? 1.49700   94.00800  10.08600  1.000 41.95370 ? 1098 HOH A O     1 
HETATM 4324 O  O     . HOH G 5 .   ? 15.97500  76.24500  15.21600  1.000 24.32716 ? 1099 HOH A O     1 
HETATM 4325 O  O     . HOH G 5 .   ? -22.15800 67.66700  -14.53700 1.000 41.81244 ? 1100 HOH A O     1 
HETATM 4326 O  O     . HOH G 5 .   ? -5.15400  63.45200  22.81700  1.000 19.68319 ? 1101 HOH A O     1 
HETATM 4327 O  O     . HOH G 5 .   ? 33.15900  82.74100  -2.73800  1.000 24.02856 ? 1102 HOH A O     1 
HETATM 4328 O  O     . HOH G 5 .   ? -11.46200 62.90500  4.61000   1.000 29.06859 ? 1103 HOH A O     1 
HETATM 4329 O  O     . HOH G 5 .   ? 1.05000   85.89700  13.95400  1.000 24.25564 ? 1104 HOH A O     1 
HETATM 4330 O  O     . HOH G 5 .   ? 27.31200  72.45100  -6.79700  1.000 32.28282 ? 1105 HOH A O     1 
HETATM 4331 O  O     . HOH G 5 .   ? 31.43000  79.39000  3.28400   1.000 23.19923 ? 1106 HOH A O     1 
HETATM 4332 O  O     . HOH G 5 .   ? -3.51500  79.43900  6.25100   1.000 15.51347 ? 1107 HOH A O     1 
HETATM 4333 O  O     . HOH G 5 .   ? 3.01000   57.74600  -4.13600  1.000 39.14877 ? 1108 HOH A O     1 
HETATM 4334 O  O     . HOH G 5 .   ? 18.49900  64.89200  -5.12000  1.000 23.68616 ? 1109 HOH A O     1 
HETATM 4335 O  O     . HOH G 5 .   ? -16.84000 66.16600  -18.30000 1.000 41.95504 ? 1110 HOH A O     1 
HETATM 4336 O  O     . HOH G 5 .   ? -22.34800 59.35000  16.22300  1.000 36.62391 ? 1111 HOH A O     1 
HETATM 4337 O  O     . HOH G 5 .   ? 6.56400   50.87500  7.64800   1.000 33.03563 ? 1112 HOH A O     1 
HETATM 4338 O  O     . HOH G 5 .   ? -17.07200 83.03700  26.34100  1.000 43.57878 ? 1113 HOH A O     1 
HETATM 4339 O  O     . HOH G 5 .   ? -10.84700 58.10400  31.05900  1.000 30.50454 ? 1114 HOH A O     1 
HETATM 4340 O  O     . HOH G 5 .   ? 13.86600  96.36900  7.41700   1.000 25.21920 ? 1115 HOH A O     1 
HETATM 4341 O  O     . HOH G 5 .   ? 21.01600  61.75800  1.57300   1.000 40.68794 ? 1116 HOH A O     1 
HETATM 4342 O  O     . HOH G 5 .   ? -3.69200  64.31500  -18.16900 1.000 31.25821 ? 1117 HOH A O     1 
HETATM 4343 O  O     . HOH G 5 .   ? 6.00800   63.44100  5.61900   1.000 45.23976 ? 1118 HOH A O     1 
HETATM 4344 O  O     . HOH G 5 .   ? 29.37600  88.82000  -7.24500  1.000 28.41533 ? 1119 HOH A O     1 
HETATM 4345 O  O     . HOH G 5 .   ? -2.34300  58.13900  2.96800   1.000 46.70309 ? 1120 HOH A O     1 
HETATM 4346 O  O     . HOH G 5 .   ? -11.78700 84.87000  15.30300  1.000 28.75756 ? 1121 HOH A O     1 
HETATM 4347 O  O     . HOH G 5 .   ? 0.30700   86.17800  16.70800  1.000 29.50110 ? 1122 HOH A O     1 
HETATM 4348 O  O     . HOH G 5 .   ? -13.33300 69.78900  4.12200   1.000 20.32946 ? 1123 HOH A O     1 
HETATM 4349 O  O     . HOH G 5 .   ? -12.96600 55.71700  5.94300   1.000 31.12863 ? 1124 HOH A O     1 
HETATM 4350 O  O     . HOH G 5 .   ? -12.91100 62.18000  -15.25400 1.000 38.37153 ? 1125 HOH A O     1 
HETATM 4351 O  O     . HOH G 5 .   ? 4.42400   69.72300  -0.81800  1.000 36.36133 ? 1126 HOH A O     1 
HETATM 4352 O  O     . HOH G 5 .   ? 31.41800  77.62500  -3.89500  1.000 25.75791 ? 1127 HOH A O     1 
HETATM 4353 O  O     . HOH G 5 .   ? -9.84700  50.51400  24.21400  1.000 46.10759 ? 1128 HOH A O     1 
HETATM 4354 O  O     . HOH G 5 .   ? 30.31300  89.82400  1.29400   1.000 21.82688 ? 1129 HOH A O     1 
HETATM 4355 O  O     . HOH G 5 .   ? -3.99400  54.29100  -19.01400 1.000 43.87322 ? 1130 HOH A O     1 
HETATM 4356 O  O     . HOH G 5 .   ? 18.63500  98.84300  11.85300  1.000 24.22404 ? 1131 HOH A O     1 
HETATM 4357 O  O     . HOH G 5 .   ? -1.23600  86.49400  -7.13400  1.000 33.95391 ? 1132 HOH A O     1 
HETATM 4358 O  O     . HOH G 5 .   ? 3.57700   60.16700  -3.77800  1.000 48.01224 ? 1133 HOH A O     1 
HETATM 4359 O  O     . HOH G 5 .   ? 7.51200   88.05100  23.64400  1.000 37.31212 ? 1134 HOH A O     1 
HETATM 4360 O  O     . HOH G 5 .   ? 32.67900  80.21500  -4.73100  1.000 33.45653 ? 1135 HOH A O     1 
HETATM 4361 O  O     . HOH G 5 .   ? -5.47800  72.48500  20.10500  1.000 22.14644 ? 1136 HOH A O     1 
HETATM 4362 O  O     . HOH G 5 .   ? -5.38100  86.13700  6.62900   1.000 28.78368 ? 1137 HOH A O     1 
HETATM 4363 O  O     . HOH G 5 .   ? 16.89000  96.16100  24.68000  1.000 34.88409 ? 1138 HOH A O     1 
HETATM 4364 O  O     . HOH G 5 .   ? 3.91500   62.77700  7.09000   1.000 30.71566 ? 1139 HOH A O     1 
HETATM 4365 O  O     . HOH G 5 .   ? -13.44400 49.98700  24.41800  1.000 38.23033 ? 1140 HOH A O     1 
HETATM 4366 O  O     . HOH G 5 .   ? 28.33400  72.73600  5.33200   1.000 22.05427 ? 1141 HOH A O     1 
HETATM 4367 O  O     . HOH G 5 .   ? -13.98000 84.54500  18.90500  1.000 18.83685 ? 1142 HOH A O     1 
HETATM 4368 O  O     . HOH G 5 .   ? 7.79600   59.77800  16.39400  1.000 35.96709 ? 1143 HOH A O     1 
HETATM 4369 O  O     . HOH G 5 .   ? 17.36100  97.79400  19.56100  1.000 27.33980 ? 1144 HOH A O     1 
HETATM 4370 O  O     . HOH G 5 .   ? -7.94900  79.19200  -12.02400 1.000 19.66063 ? 1145 HOH A O     1 
HETATM 4371 O  O     . HOH G 5 .   ? -24.43200 71.78000  29.62700  1.000 46.08247 ? 1146 HOH A O     1 
HETATM 4372 O  O     . HOH G 5 .   ? 0.38900   74.46200  -15.08100 1.000 32.42654 ? 1147 HOH A O     1 
HETATM 4373 O  O     . HOH G 5 .   ? 29.93700  89.01500  9.61700   1.000 19.35952 ? 1148 HOH A O     1 
HETATM 4374 O  O     . HOH G 5 .   ? -5.77100  75.13800  2.90300   1.000 29.69103 ? 1149 HOH A O     1 
HETATM 4375 O  O     . HOH G 5 .   ? -12.56900 75.54800  -21.69400 1.000 34.72280 ? 1150 HOH A O     1 
HETATM 4376 O  O     . HOH G 5 .   ? -10.98200 86.80300  11.25400  1.000 28.19349 ? 1151 HOH A O     1 
HETATM 4377 O  O     . HOH G 5 .   ? 7.21300   85.49400  6.26700   1.000 26.87599 ? 1152 HOH A O     1 
HETATM 4378 O  O     . HOH G 5 .   ? 25.26900  81.81100  21.72600  1.000 23.78887 ? 1153 HOH A O     1 
HETATM 4379 O  O     . HOH G 5 .   ? -2.56400  84.53500  -7.86100  1.000 20.08733 ? 1154 HOH A O     1 
HETATM 4380 O  O     . HOH G 5 .   ? 12.47600  79.10000  16.79800  1.000 26.70391 ? 1155 HOH A O     1 
HETATM 4381 O  O     . HOH G 5 .   ? -1.98500  55.33000  6.60300   1.000 41.34421 ? 1156 HOH A O     1 
HETATM 4382 O  O     . HOH G 5 .   ? -23.14200 72.73700  1.03400   1.000 22.67677 ? 1157 HOH A O     1 
HETATM 4383 O  O     . HOH G 5 .   ? 2.71600   81.39400  10.35300  1.000 24.92589 ? 1158 HOH A O     1 
HETATM 4384 O  O     . HOH G 5 .   ? 29.20700  83.06300  15.50300  1.000 29.56631 ? 1159 HOH A O     1 
HETATM 4385 O  O     . HOH G 5 .   ? 27.18300  81.26100  18.31900  1.000 33.49525 ? 1160 HOH A O     1 
HETATM 4386 O  O     . HOH G 5 .   ? -6.20100  43.37100  16.31000  1.000 31.37619 ? 1161 HOH A O     1 
HETATM 4387 O  O     . HOH G 5 .   ? -13.96000 44.63200  14.24600  1.000 32.69699 ? 1162 HOH A O     1 
HETATM 4388 O  O     . HOH G 5 .   ? -8.887    51.380    7.677     1.000 33.00248 ? 1163 HOH A O     1 
HETATM 4389 O  O     . HOH G 5 .   ? 7.80100   85.37100  8.45500   1.000 35.85615 ? 1164 HOH A O     1 
HETATM 4390 O  O     . HOH G 5 .   ? -5.27200  72.04400  -18.16400 1.000 23.77331 ? 1165 HOH A O     1 
HETATM 4391 O  O     . HOH G 5 .   ? -18.48400 78.09900  -12.22900 1.000 24.64390 ? 1166 HOH A O     1 
HETATM 4392 O  O     . HOH G 5 .   ? 3.31100   88.11500  1.58600   1.000 36.13489 ? 1167 HOH A O     1 
HETATM 4393 O  O     . HOH G 5 .   ? -23.57000 64.94200  6.07100   1.000 23.24575 ? 1168 HOH A O     1 
HETATM 4394 O  O     . HOH G 5 .   ? -0.46400  79.86400  -11.17100 1.000 22.54838 ? 1169 HOH A O     1 
HETATM 4395 O  O     . HOH G 5 .   ? -29.08700 69.56400  31.08200  1.000 41.01508 ? 1170 HOH A O     1 
HETATM 4396 O  O     . HOH G 5 .   ? 10.77800  83.84800  -12.04300 1.000 45.04139 ? 1171 HOH A O     1 
HETATM 4397 O  O     . HOH G 5 .   ? 25.78300  74.39100  -8.01200  1.000 26.23697 ? 1172 HOH A O     1 
HETATM 4398 O  O     . HOH G 5 .   ? 32.94800  83.77300  11.94300  1.000 31.29301 ? 1173 HOH A O     1 
HETATM 4399 O  O     . HOH G 5 .   ? -3.62700  68.35900  18.76700  1.000 31.42557 ? 1174 HOH A O     1 
HETATM 4400 O  O     . HOH G 5 .   ? 1.28900   49.81000  30.06100  1.000 37.54827 ? 1175 HOH A O     1 
HETATM 4401 O  O     . HOH G 5 .   ? 31.93500  84.42000  -9.04100  1.000 30.53630 ? 1176 HOH A O     1 
HETATM 4402 O  O     . HOH G 5 .   ? -9.10300  84.26500  -13.60500 1.000 31.36850 ? 1177 HOH A O     1 
HETATM 4403 O  O     . HOH G 5 .   ? 20.11100  90.40500  -11.15400 1.000 34.72632 ? 1178 HOH A O     1 
HETATM 4404 O  O     . HOH G 5 .   ? 17.29000  87.97300  -12.49700 1.000 33.34867 ? 1179 HOH A O     1 
HETATM 4405 O  O     . HOH G 5 .   ? -1.943    90.635    -3.355    1.000 33.61319 ? 1180 HOH A O     1 
HETATM 4406 O  O     . HOH G 5 .   ? -7.20500  69.84000  7.79300   1.000 30.81394 ? 1181 HOH A O     1 
HETATM 4407 O  O     . HOH G 5 .   ? 1.13400   89.38200  4.88800   1.000 32.18586 ? 1182 HOH A O     1 
HETATM 4408 O  O     . HOH G 5 .   ? 28.26800  91.05000  0.10400   1.000 28.52055 ? 1183 HOH A O     1 
HETATM 4409 O  O     . HOH G 5 .   ? 15.06100  81.20300  -9.95300  1.000 22.13051 ? 1184 HOH A O     1 
HETATM 4410 O  O     . HOH G 5 .   ? -8.50200  58.99400  31.00500  1.000 38.10641 ? 1185 HOH A O     1 
HETATM 4411 O  O     . HOH G 5 .   ? -0.10800  42.33000  10.06200  1.000 34.62462 ? 1186 HOH A O     1 
HETATM 4412 O  O     . HOH G 5 .   ? 5.37800   88.75900  2.15700   1.000 31.11112 ? 1187 HOH A O     1 
HETATM 4413 O  O     . HOH G 5 .   ? -29.21800 79.53900  14.98100  1.000 27.24426 ? 1188 HOH A O     1 
HETATM 4414 O  O     . HOH G 5 .   ? 0.61000   87.00400  -5.23100  1.000 37.74828 ? 1189 HOH A O     1 
HETATM 4415 O  O     . HOH G 5 .   ? 30.66700  90.03600  5.50500   1.000 38.77423 ? 1190 HOH A O     1 
HETATM 4416 O  O     . HOH G 5 .   ? 1.69900   81.53500  12.50900  1.000 26.39178 ? 1191 HOH A O     1 
HETATM 4417 O  O     . HOH G 5 .   ? -22.27500 85.58900  -2.73700  1.000 40.65354 ? 1192 HOH A O     1 
HETATM 4418 O  O     . HOH G 5 .   ? -15.06000 53.17000  22.13600  1.000 37.99149 ? 1193 HOH A O     1 
HETATM 4419 O  O     . HOH G 5 .   ? -13.43900 87.67000  11.98300  1.000 33.77068 ? 1194 HOH A O     1 
HETATM 4420 O  O     . HOH G 5 .   ? 12.25400  60.14100  14.92800  1.000 44.33321 ? 1195 HOH A O     1 
HETATM 4421 O  O     . HOH G 5 .   ? -13.69900 71.15300  34.63800  1.000 39.15749 ? 1196 HOH A O     1 
HETATM 4422 O  O     . HOH G 5 .   ? -22.54000 57.40000  27.48800  1.000 38.95121 ? 1197 HOH A O     1 
HETATM 4423 O  O     . HOH G 5 .   ? -15.45600 51.27000  20.36700  1.000 36.54355 ? 1198 HOH A O     1 
HETATM 4424 O  O     . HOH G 5 .   ? -19.58800 72.68300  -16.12900 1.000 32.45680 ? 1199 HOH A O     1 
HETATM 4425 O  O     . HOH G 5 .   ? -19.44600 72.23800  -11.95900 1.000 27.78403 ? 1200 HOH A O     1 
HETATM 4426 O  O     . HOH G 5 .   ? 19.09600  63.40900  2.95200   1.000 37.09398 ? 1201 HOH A O     1 
HETATM 4427 O  O     . HOH G 5 .   ? 0.90500   61.55600  7.38200   1.000 40.57983 ? 1202 HOH A O     1 
HETATM 4428 O  O     . HOH G 5 .   ? -7.24300  69.37700  1.25000   1.000 28.87453 ? 1203 HOH A O     1 
HETATM 4429 O  O     . HOH G 5 .   ? -8.58800  71.28900  1.31900   1.000 22.66193 ? 1204 HOH A O     1 
HETATM 4430 O  O     . HOH G 5 .   ? 9.45200   90.66400  -7.37600  1.000 28.33777 ? 1205 HOH A O     1 
HETATM 4431 O  O     . HOH G 5 .   ? 21.18300  58.20700  -2.78900  1.000 35.54795 ? 1206 HOH A O     1 
HETATM 4432 O  O     . HOH G 5 .   ? -9.59600  59.35100  6.39800   1.000 35.14512 ? 1207 HOH A O     1 
HETATM 4433 O  O     . HOH G 5 .   ? 21.78600  83.38700  -10.80400 1.000 37.19301 ? 1208 HOH A O     1 
HETATM 4434 O  O     . HOH G 5 .   ? 1.38600   86.65200  1.45800   1.000 32.96967 ? 1209 HOH A O     1 
HETATM 4435 O  O     . HOH G 5 .   ? -19.17500 74.57500  -17.45200 1.000 33.64627 ? 1210 HOH A O     1 
HETATM 4436 O  O     . HOH G 5 .   ? -8.32600  61.30900  5.88300   1.000 44.05910 ? 1211 HOH A O     1 
HETATM 4437 O  O     . HOH G 5 .   ? -6.42500  88.21300  8.77100   1.000 25.20553 ? 1212 HOH A O     1 
HETATM 4438 O  O     . HOH G 5 .   ? 25.04600  76.85200  -6.98400  1.000 19.09356 ? 1213 HOH A O     1 
HETATM 4439 O  O     . HOH G 5 .   ? -0.19000  73.05400  0.00100   1.000 20.25492 ? 1214 HOH A O     1 
HETATM 4440 O  O     . HOH G 5 .   ? 32.48700  89.30600  0.48400   1.000 35.33178 ? 1215 HOH A O     1 
HETATM 4441 O  O     . HOH G 5 .   ? -2.94900  62.17000  -18.17000 1.000 36.29824 ? 1216 HOH A O     1 
HETATM 4442 O  O     . HOH G 5 .   ? -17.21900 49.75000  20.75300  1.000 41.67854 ? 1217 HOH A O     1 
HETATM 4443 O  O     . HOH G 5 .   ? 15.15000  92.37100  -0.85700  1.000 27.20252 ? 1218 HOH A O     1 
HETATM 4444 O  O     . HOH G 5 .   ? -9.076    53.685    6.737     1.000 37.29521 ? 1219 HOH A O     1 
HETATM 4445 O  O     . HOH G 5 .   ? 29.95400  86.29300  -10.23700 1.000 35.47761 ? 1220 HOH A O     1 
HETATM 4446 O  O     . HOH G 5 .   ? -14.92800 81.01000  -23.34400 1.000 39.39200 ? 1221 HOH A O     1 
HETATM 4447 O  O     . HOH G 5 .   ? -17.803   86.754    -5.778    1.000 29.43572 ? 1222 HOH A O     1 
HETATM 4448 O  O     . HOH G 5 .   ? 22.085    91.345    -9.527    1.000 35.24770 ? 1223 HOH A O     1 
HETATM 4449 O  O     . HOH G 5 .   ? -26.945   69.134    2.038     1.000 37.55510 ? 1224 HOH A O     1 
HETATM 4450 O  O     . HOH G 5 .   ? -8.36400  67.71900  8.09800   1.000 37.80100 ? 1225 HOH A O     1 
HETATM 4451 O  O     . HOH G 5 .   ? -11.17000 87.39400  8.46100   1.000 25.21798 ? 1226 HOH A O     1 
HETATM 4452 O  O     . HOH G 5 .   ? 3.58200   87.79000  -1.62400  1.000 30.73493 ? 1227 HOH A O     1 
HETATM 4453 O  O     . HOH G 5 .   ? 0.37000   78.88800  -14.12000 1.000 32.56348 ? 1228 HOH A O     1 
HETATM 4454 O  O     . HOH G 5 .   ? -6.78600  42.07700  14.34200  1.000 32.77754 ? 1229 HOH A O     1 
HETATM 4455 O  O     . HOH G 5 .   ? -23.45800 80.08700  -5.59800  1.000 35.23349 ? 1230 HOH A O     1 
HETATM 4456 O  O     . HOH G 5 .   ? 15.920    95.181    -9.175    1.000 31.35912 ? 1231 HOH A O     1 
HETATM 4457 O  O     . HOH G 5 .   ? 25.38600  91.35600  20.32800  1.000 33.24694 ? 1232 HOH A O     1 
HETATM 4458 O  O     . HOH G 5 .   ? -23.25400 82.66300  20.97900  1.000 32.42244 ? 1233 HOH A O     1 
HETATM 4459 O  O     . HOH G 5 .   ? -11.73800 58.89900  7.24200   1.000 31.95520 ? 1234 HOH A O     1 
HETATM 4460 O  O     . HOH G 5 .   ? -12.86500 54.55000  -8.01900  1.000 41.89623 ? 1235 HOH A O     1 
HETATM 4461 O  O     . HOH G 5 .   ? -24.72000 62.65900  9.29900   1.000 37.53275 ? 1236 HOH A O     1 
HETATM 4462 O  O     . HOH G 5 .   ? -12.97500 77.35300  -23.58700 1.000 45.45792 ? 1237 HOH A O     1 
HETATM 4463 O  O     . HOH G 5 .   ? 2.42900   82.36100  -12.23200 1.000 34.29947 ? 1238 HOH A O     1 
HETATM 4464 O  O     . HOH G 5 .   ? -3.346    89.186    1.785     1.000 28.35460 ? 1239 HOH A O     1 
HETATM 4465 O  O     . HOH G 5 .   ? 2.86800   65.24600  21.65600  1.000 41.24658 ? 1240 HOH A O     1 
HETATM 4466 O  O     . HOH G 5 .   ? 32.06300  74.48900  -4.79800  1.000 35.84470 ? 1241 HOH A O     1 
HETATM 4467 O  O     . HOH G 5 .   ? -5.92400  49.06100  26.30600  1.000 29.92561 ? 1242 HOH A O     1 
HETATM 4468 O  O     . HOH G 5 .   ? -25.04900 63.83500  7.33900   1.000 38.57853 ? 1243 HOH A O     1 
HETATM 4469 O  O     . HOH G 5 .   ? -18.79000 67.81700  -18.83000 1.000 31.44578 ? 1244 HOH A O     1 
HETATM 4470 O  O     . HOH G 5 .   ? 0.11800   69.48000  -17.64000 1.000 37.26521 ? 1245 HOH A O     1 
HETATM 4471 O  O     . HOH G 5 .   ? 2.32500   83.43700  14.13900  1.000 26.64493 ? 1246 HOH A O     1 
HETATM 4472 O  O     . HOH G 5 .   ? -21.600   86.138    -9.710    1.000 35.98764 ? 1247 HOH A O     1 
HETATM 4473 O  O     . HOH G 5 .   ? 19.28600  62.17900  -5.99600  1.000 33.87777 ? 1248 HOH A O     1 
HETATM 4474 O  O     . HOH G 5 .   ? -28.736   81.104    -1.028    1.000 28.03522 ? 1249 HOH A O     1 
HETATM 4475 O  O     . HOH G 5 .   ? -11.85400 55.21800  -10.59700 1.000 41.70679 ? 1250 HOH A O     1 
HETATM 4476 O  O     . HOH G 5 .   ? 26.593    95.679    0.646     1.000 20.49827 ? 1251 HOH A O     1 
HETATM 4477 O  O     . HOH G 5 .   ? 1.04400   88.24600  -3.16700  1.000 39.66596 ? 1252 HOH A O     1 
HETATM 4478 O  O     . HOH G 5 .   ? 28.25000  93.62100  14.95300  1.000 29.82762 ? 1253 HOH A O     1 
HETATM 4479 O  O     . HOH G 5 .   ? 13.429    96.134    -0.875    1.000 33.19415 ? 1254 HOH A O     1 
HETATM 4480 O  O     . HOH G 5 .   ? -16.83400 64.71400  -7.12900  1.000 31.48113 ? 1255 HOH A O     1 
HETATM 4481 O  O     . HOH G 5 .   ? -2.25300  69.82500  -18.91500 1.000 36.52915 ? 1256 HOH A O     1 
HETATM 4482 O  O     . HOH G 5 .   ? 5.17100   91.11300  3.05500   1.000 32.06135 ? 1257 HOH A O     1 
HETATM 4483 O  O     . HOH G 5 .   ? -6.83000  67.06000  17.61500  1.000 31.40575 ? 1258 HOH A O     1 
HETATM 4484 O  O     . HOH G 5 .   ? 25.41200  77.62700  -9.07000  1.000 34.48613 ? 1259 HOH A O     1 
HETATM 4485 O  O     . HOH G 5 .   ? -22.26100 52.90700  12.65400  1.000 39.11968 ? 1260 HOH A O     1 
HETATM 4486 O  O     . HOH G 5 .   ? 6.68400   89.30300  -8.01700  1.000 28.13845 ? 1261 HOH A O     1 
HETATM 4487 O  O     . HOH G 5 .   ? -19.09200 61.44700  27.68200  1.000 35.48696 ? 1262 HOH A O     1 
HETATM 4488 O  O     . HOH G 5 .   ? -28.070   83.873    9.962     1.000 38.76704 ? 1263 HOH A O     1 
HETATM 4489 O  O     . HOH G 5 .   ? 15.53500  100.39700 13.33400  1.000 36.64365 ? 1264 HOH A O     1 
HETATM 4490 O  O     . HOH G 5 .   ? -8.17500  70.87700  16.90000  1.000 25.77179 ? 1265 HOH A O     1 
HETATM 4491 O  O     . HOH G 5 .   ? -14.744   88.406    -8.030    1.000 26.37050 ? 1266 HOH A O     1 
HETATM 4492 O  O     . HOH G 5 .   ? -6.97900  82.97300  -13.75200 1.000 41.32935 ? 1267 HOH A O     1 
HETATM 4493 O  O     . HOH G 5 .   ? 18.073    68.804    -14.598   1.000 43.48621 ? 1268 HOH A O     1 
HETATM 4494 O  O     . HOH G 5 .   ? 1.282     44.749    5.849     1.000 30.62089 ? 1269 HOH A O     1 
HETATM 4495 O  O     . HOH G 5 .   ? 13.11600  69.57700  -15.33000 1.000 33.67728 ? 1270 HOH A O     1 
HETATM 4496 O  O     . HOH G 5 .   ? -9.05100  91.52800  7.99600   1.000 31.04652 ? 1271 HOH A O     1 
HETATM 4497 O  O     . HOH G 5 .   ? -24.67500 72.41400  -0.57500  1.000 36.49963 ? 1272 HOH A O     1 
HETATM 4498 O  O     . HOH G 5 .   ? 10.58900  52.09000  13.39700  1.000 30.89008 ? 1273 HOH A O     1 
HETATM 4499 O  O     . HOH G 5 .   ? -16.63000 74.16400  -7.29900  1.000 20.71224 ? 1274 HOH A O     1 
HETATM 4500 O  O     . HOH G 5 .   ? 7.95900   62.56400  17.27400  1.000 34.63009 ? 1275 HOH A O     1 
HETATM 4501 O  O     . HOH G 5 .   ? 6.90500   63.79900  -4.55400  1.000 39.84952 ? 1276 HOH A O     1 
HETATM 4502 O  O     . HOH G 5 .   ? -6.41900  69.34000  18.99100  1.000 36.23591 ? 1277 HOH A O     1 
HETATM 4503 O  O     . HOH G 5 .   ? 13.23700  71.57600  4.58000   1.000 41.05744 ? 1278 HOH A O     1 
HETATM 4504 O  O     . HOH G 5 .   ? 15.98300  63.96900  -5.31900  1.000 38.21827 ? 1279 HOH A O     1 
HETATM 4505 O  O     . HOH G 5 .   ? -6.79800  69.18100  16.21300  1.000 35.66393 ? 1280 HOH A O     1 
HETATM 4506 O  O     . HOH G 5 .   ? 1.26100   82.69700  -8.95700  1.000 27.78462 ? 1281 HOH A O     1 
HETATM 4507 O  O     . HOH G 5 .   ? 10.87000  82.94700  23.75100  1.000 35.08600 ? 1282 HOH A O     1 
HETATM 4508 O  O     . HOH G 5 .   ? 5.02200   70.16500  1.27900   1.000 40.50540 ? 1283 HOH A O     1 
HETATM 4509 O  O     . HOH G 5 .   ? -15.321   61.230    28.976    1.000 45.56291 ? 1284 HOH A O     1 
HETATM 4510 O  O     . HOH G 5 .   ? 0.12900   76.66100  17.86500  1.000 34.02369 ? 1285 HOH A O     1 
HETATM 4511 O  O     . HOH G 5 .   ? 0.26200   57.60600  -19.01500 1.000 37.66989 ? 1286 HOH A O     1 
HETATM 4512 O  O     . HOH G 5 .   ? -5.18000  74.68100  0.75000   1.000 24.57302 ? 1287 HOH A O     1 
HETATM 4513 O  O     . HOH G 5 .   ? -19.00000 74.87900  -8.17000  1.000 25.90452 ? 1288 HOH A O     1 
HETATM 4514 O  O     . HOH G 5 .   ? 19.63100  80.88000  -10.69500 1.000 21.38848 ? 1289 HOH A O     1 
HETATM 4515 O  O     . HOH G 5 .   ? -5.48100  41.72300  19.10600  1.000 36.92049 ? 1290 HOH A O     1 
HETATM 4516 O  O     . HOH G 5 .   ? 15.09300  71.59000  -15.22600 1.000 38.32848 ? 1291 HOH A O     1 
HETATM 4517 O  O     . HOH G 5 .   ? 31.94100  74.66200  -7.33100  1.000 33.52078 ? 1292 HOH A O     1 
HETATM 4518 O  O     . HOH G 5 .   ? 29.93700  92.96700  1.58800   1.000 31.99999 ? 1293 HOH A O     1 
HETATM 4519 O  O     . HOH G 5 .   ? 1.93400   66.30900  19.12700  1.000 31.09308 ? 1294 HOH A O     1 
HETATM 4520 O  O     . HOH G 5 .   ? -14.84700 86.16000  15.32000  1.000 28.85127 ? 1295 HOH A O     1 
HETATM 4521 O  O     . HOH G 5 .   ? 27.62000  91.74400  21.32500  1.000 41.27743 ? 1296 HOH A O     1 
HETATM 4522 O  O     . HOH G 5 .   ? -6.97600  73.16100  18.34500  1.000 28.60304 ? 1297 HOH A O     1 
HETATM 4523 O  O     . HOH G 5 .   ? 28.68400  93.25100  -2.09900  1.000 24.83875 ? 1298 HOH A O     1 
HETATM 4524 O  O     . HOH G 5 .   ? -22.36500 72.94300  -6.24200  1.000 33.24371 ? 1299 HOH A O     1 
HETATM 4525 O  O     . HOH G 5 .   ? 1.08000   55.75100  -23.78900 1.000 42.21738 ? 1300 HOH A O     1 
HETATM 4526 O  O     . HOH G 5 .   ? -17.56700 64.71600  -4.28900  1.000 29.10337 ? 1301 HOH A O     1 
HETATM 4527 O  O     . HOH G 5 .   ? 1.16500   58.29000  -21.77700 1.000 44.97104 ? 1302 HOH A O     1 
HETATM 4528 O  O     . HOH G 5 .   ? 13.48600  69.17700  3.82500   1.000 31.11191 ? 1303 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  DG  P . n 
A 1 2   DG  2   2   2   DG  DG  P . n 
A 1 3   DG  3   3   3   DG  DG  P . n 
A 1 4   DG  4   4   4   DG  DG  P . n 
A 1 5   DT  5   5   5   DT  DT  P . n 
A 1 6   DG  6   6   6   DG  DG  P . n 
A 1 7   DT  7   7   7   DT  DT  P . n 
A 1 8   DG  8   8   8   DG  DG  P . n 
A 1 9   DG  9   9   9   DG  DG  P . n 
A 1 10  DT  10  10  10  DT  DT  P . n 
A 1 11  DA  11  11  11  DA  DA  P . n 
A 1 12  DG  12  12  12  DG  DG  P . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DG  5   5   5   DG  DG  T . n 
B 2 6   DC  6   6   6   DC  DC  T . n 
B 2 7   DT  7   7   7   DT  DT  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DC  10  10  10  DC  DC  T . n 
B 2 11  DA  11  11  11  DA  DA  T . n 
B 2 12  DC  12  12  12  DC  DC  T . n 
B 2 13  DA  13  13  13  DA  DA  T . n 
B 2 14  DC  14  14  14  DC  DC  T . n 
B 2 15  DC  15  15  15  DC  DC  T . n 
B 2 16  DC  16  16  16  DC  DC  T . n 
B 2 17  DC  17  17  17  DC  DC  T . n 
C 3 1   LYS 1   305 ?   ?   ?   A . n 
C 3 2   ARG 2   306 ?   ?   ?   A . n 
C 3 3   ILE 3   307 307 ILE ILE A . n 
C 3 4   VAL 4   308 308 VAL VAL A . n 
C 3 5   ALA 5   309 309 ALA ALA A . n 
C 3 6   CYS 6   310 310 CYS CYS A . n 
C 3 7   ASP 7   311 311 ASP ASP A . n 
C 3 8   ASP 8   312 312 ASP ASP A . n 
C 3 9   PRO 9   313 313 PRO PRO A . n 
C 3 10  ASP 10  314 314 ASP ASP A . n 
C 3 11  PHE 11  315 315 PHE PHE A . n 
C 3 12  LEU 12  316 316 LEU LEU A . n 
C 3 13  THR 13  317 317 THR THR A . n 
C 3 14  SER 14  318 318 SER SER A . n 
C 3 15  TYR 15  319 319 TYR TYR A . n 
C 3 16  PHE 16  320 320 PHE PHE A . n 
C 3 17  ALA 17  321 321 ALA ALA A . n 
C 3 18  HIS 18  322 322 HIS HIS A . n 
C 3 19  SER 19  323 323 SER SER A . n 
C 3 20  ARG 20  324 324 ARG ARG A . n 
C 3 21  LEU 21  325 325 LEU LEU A . n 
C 3 22  HIS 22  326 326 HIS HIS A . n 
C 3 23  HIS 23  327 327 HIS HIS A . n 
C 3 24  LEU 24  328 328 LEU LEU A . n 
C 3 25  SER 25  329 329 SER SER A . n 
C 3 26  ALA 26  330 330 ALA ALA A . n 
C 3 27  TRP 27  331 331 TRP TRP A . n 
C 3 28  LYS 28  332 332 LYS LYS A . n 
C 3 29  ALA 29  333 333 ALA ALA A . n 
C 3 30  ASN 30  334 334 ASN ASN A . n 
C 3 31  LEU 31  335 335 LEU LEU A . n 
C 3 32  LYS 32  336 336 LYS LYS A . n 
C 3 33  ASP 33  337 337 ASP ASP A . n 
C 3 34  LYS 34  338 338 LYS LYS A . n 
C 3 35  PHE 35  339 339 PHE PHE A . n 
C 3 36  LEU 36  340 340 LEU LEU A . n 
C 3 37  ASN 37  341 341 ASN ASN A . n 
C 3 38  GLU 38  342 342 GLU GLU A . n 
C 3 39  ASN 39  343 343 ASN ASN A . n 
C 3 40  ILE 40  344 344 ILE ILE A . n 
C 3 41  HIS 41  345 345 HIS HIS A . n 
C 3 42  LYS 42  346 346 LYS LYS A . n 
C 3 43  TYR 43  347 347 TYR TYR A . n 
C 3 44  THR 44  348 348 THR THR A . n 
C 3 45  LYS 45  349 349 LYS LYS A . n 
C 3 46  ILE 46  350 350 ILE ILE A . n 
C 3 47  THR 47  351 351 THR THR A . n 
C 3 48  ASP 48  352 352 ASP ASP A . n 
C 3 49  LYS 49  353 353 LYS LYS A . n 
C 3 50  ASP 50  354 354 ASP ASP A . n 
C 3 51  THR 51  355 355 THR THR A . n 
C 3 52  TYR 52  356 356 TYR TYR A . n 
C 3 53  ILE 53  357 357 ILE ILE A . n 
C 3 54  ILE 54  358 358 ILE ILE A . n 
C 3 55  PHE 55  359 359 PHE PHE A . n 
C 3 56  HIS 56  360 360 HIS HIS A . n 
C 3 57  ILE 57  361 361 ILE ILE A . n 
C 3 58  ASP 58  362 362 ASP ASP A . n 
C 3 59  PHE 59  363 363 PHE PHE A . n 
C 3 60  ASP 60  364 364 ASP ASP A . n 
C 3 61  CYS 61  365 365 CYS CYS A . n 
C 3 62  PHE 62  366 366 PHE PHE A . n 
C 3 63  PHE 63  367 367 PHE PHE A . n 
C 3 64  ALA 64  368 368 ALA ALA A . n 
C 3 65  THR 65  369 369 THR THR A . n 
C 3 66  VAL 66  370 370 VAL VAL A . n 
C 3 67  ALA 67  371 371 ALA ALA A . n 
C 3 68  TYR 68  372 372 TYR TYR A . n 
C 3 69  LEU 69  373 373 LEU LEU A . n 
C 3 70  CYS 70  374 374 CYS CYS A . n 
C 3 71  ARG 71  375 375 ARG ARG A . n 
C 3 72  SER 72  376 376 SER SER A . n 
C 3 73  SER 73  377 377 SER SER A . n 
C 3 74  SER 74  378 378 SER SER A . n 
C 3 75  PHE 75  379 379 PHE PHE A . n 
C 3 76  SER 76  380 380 SER SER A . n 
C 3 77  ALA 77  381 381 ALA ALA A . n 
C 3 78  CYS 78  382 382 CYS CYS A . n 
C 3 79  ASP 79  383 383 ASP ASP A . n 
C 3 80  PHE 80  384 384 PHE PHE A . n 
C 3 81  LYS 81  385 385 LYS LYS A . n 
C 3 82  ARG 82  386 386 ARG ARG A . n 
C 3 83  ASP 83  387 387 ASP ASP A . n 
C 3 84  PRO 84  388 388 PRO PRO A . n 
C 3 85  ILE 85  389 389 ILE ILE A . n 
C 3 86  VAL 86  390 390 VAL VAL A . n 
C 3 87  VAL 87  391 391 VAL VAL A . n 
C 3 88  CYS 88  392 392 CYS CYS A . n 
C 3 89  HIS 89  393 393 HIS HIS A . n 
C 3 90  GLY 90  394 394 GLY GLY A . n 
C 3 91  THR 91  395 395 THR THR A . n 
C 3 92  LYS 92  396 396 LYS LYS A . n 
C 3 93  ASN 93  397 397 ASN ASN A . n 
C 3 94  SER 94  398 398 SER SER A . n 
C 3 95  ASP 95  399 399 ASP ASP A . n 
C 3 96  ILE 96  400 400 ILE ILE A . n 
C 3 97  ALA 97  401 401 ALA ALA A . n 
C 3 98  SER 98  402 402 SER SER A . n 
C 3 99  CYS 99  403 403 CYS CYS A . n 
C 3 100 ASN 100 404 404 ASN ASN A . n 
C 3 101 TYR 101 405 405 TYR TYR A . n 
C 3 102 VAL 102 406 406 VAL VAL A . n 
C 3 103 ALA 103 407 407 ALA ALA A . n 
C 3 104 ARG 104 408 408 ARG ARG A . n 
C 3 105 SER 105 409 409 SER SER A . n 
C 3 106 TYR 106 410 410 TYR TYR A . n 
C 3 107 GLY 107 411 411 GLY GLY A . n 
C 3 108 ILE 108 412 412 ILE ILE A . n 
C 3 109 LYS 109 413 413 LYS LYS A . n 
C 3 110 ASN 110 414 414 ASN ASN A . n 
C 3 111 GLY 111 415 415 GLY GLY A . n 
C 3 112 MET 112 416 416 MET MET A . n 
C 3 113 TRP 113 417 417 TRP TRP A . n 
C 3 114 VAL 114 418 418 VAL VAL A . n 
C 3 115 SER 115 419 419 SER SER A . n 
C 3 116 GLN 116 420 420 GLN GLN A . n 
C 3 117 ALA 117 421 421 ALA ALA A . n 
C 3 118 GLU 118 422 422 GLU GLU A . n 
C 3 119 LYS 119 423 423 LYS LYS A . n 
C 3 120 MET 120 424 424 MET MET A . n 
C 3 121 LEU 121 425 425 LEU LEU A . n 
C 3 122 PRO 122 426 426 PRO PRO A . n 
C 3 123 ASN 123 427 427 ASN ASN A . n 
C 3 124 GLY 124 428 428 GLY GLY A . n 
C 3 125 ILE 125 429 429 ILE ILE A . n 
C 3 126 LYS 126 430 430 LYS LYS A . n 
C 3 127 LEU 127 431 431 LEU LEU A . n 
C 3 128 ILE 128 432 432 ILE ILE A . n 
C 3 129 SER 129 433 433 SER SER A . n 
C 3 130 LEU 130 434 434 LEU LEU A . n 
C 3 131 PRO 131 435 435 PRO PRO A . n 
C 3 132 TYR 132 436 436 TYR TYR A . n 
C 3 133 THR 133 437 437 THR THR A . n 
C 3 134 PHE 134 438 438 PHE PHE A . n 
C 3 135 GLU 135 439 439 GLU GLU A . n 
C 3 136 GLN 136 440 440 GLN GLN A . n 
C 3 137 PHE 137 441 441 PHE PHE A . n 
C 3 138 GLN 138 442 442 GLN GLN A . n 
C 3 139 LEU 139 443 443 LEU LEU A . n 
C 3 140 LYS 140 444 444 LYS LYS A . n 
C 3 141 SER 141 445 445 SER SER A . n 
C 3 142 GLU 142 446 446 GLU GLU A . n 
C 3 143 ALA 143 447 447 ALA ALA A . n 
C 3 144 PHE 144 448 448 PHE PHE A . n 
C 3 145 TYR 145 449 449 TYR TYR A . n 
C 3 146 SER 146 450 450 SER SER A . n 
C 3 147 THR 147 451 451 THR THR A . n 
C 3 148 LEU 148 452 452 LEU LEU A . n 
C 3 149 LYS 149 453 453 LYS LYS A . n 
C 3 150 ARG 150 454 454 ARG ARG A . n 
C 3 151 LEU 151 455 455 LEU LEU A . n 
C 3 152 ASN 152 456 456 ASN ASN A . n 
C 3 153 ILE 153 457 457 ILE ILE A . n 
C 3 154 PHE 154 458 458 PHE PHE A . n 
C 3 155 ASN 155 459 459 ASN ASN A . n 
C 3 156 LEU 156 460 460 LEU LEU A . n 
C 3 157 ILE 157 461 461 ILE ILE A . n 
C 3 158 LEU 158 462 462 LEU LEU A . n 
C 3 159 PRO 159 463 463 PRO PRO A . n 
C 3 160 ILE 160 464 464 ILE ILE A . n 
C 3 161 SER 161 465 465 SER SER A . n 
C 3 162 ILE 162 466 466 ILE ILE A . n 
C 3 163 ASP 163 467 467 ASP ASP A . n 
C 3 164 GLU 164 468 468 GLU GLU A . n 
C 3 165 ALA 165 469 469 ALA ALA A . n 
C 3 166 VAL 166 470 470 VAL VAL A . n 
C 3 167 CYS 167 471 471 CYS CYS A . n 
C 3 168 VAL 168 472 472 VAL VAL A . n 
C 3 169 ARG 169 473 473 ARG ARG A . n 
C 3 170 ILE 170 474 474 ILE ILE A . n 
C 3 171 ILE 171 475 475 ILE ILE A . n 
C 3 172 PRO 172 476 476 PRO PRO A . n 
C 3 173 ASP 173 477 477 ASP ASP A . n 
C 3 174 ASN 174 478 478 ASN ASN A . n 
C 3 175 ILE 175 479 479 ILE ILE A . n 
C 3 176 HIS 176 480 480 HIS HIS A . n 
C 3 177 ASN 177 481 481 ASN ASN A . n 
C 3 178 THR 178 482 482 THR THR A . n 
C 3 179 ASN 179 483 483 ASN ASN A . n 
C 3 180 THR 180 484 484 THR THR A . n 
C 3 181 LEU 181 485 485 LEU LEU A . n 
C 3 182 ASN 182 486 486 ASN ASN A . n 
C 3 183 ALA 183 487 487 ALA ALA A . n 
C 3 184 ARG 184 488 488 ARG ARG A . n 
C 3 185 LEU 185 489 489 LEU LEU A . n 
C 3 186 CYS 186 490 490 CYS CYS A . n 
C 3 187 GLU 187 491 491 GLU GLU A . n 
C 3 188 GLU 188 492 492 GLU GLU A . n 
C 3 189 ILE 189 493 493 ILE ILE A . n 
C 3 190 ARG 190 494 494 ARG ARG A . n 
C 3 191 GLN 191 495 495 GLN GLN A . n 
C 3 192 GLU 192 496 496 GLU GLU A . n 
C 3 193 ILE 193 497 497 ILE ILE A . n 
C 3 194 PHE 194 498 498 PHE PHE A . n 
C 3 195 GLN 195 499 499 GLN GLN A . n 
C 3 196 GLY 196 500 500 GLY GLY A . n 
C 3 197 THR 197 501 501 THR THR A . n 
C 3 198 ASN 198 502 502 ASN ASN A . n 
C 3 199 GLY 199 503 503 GLY GLY A . n 
C 3 200 CYS 200 504 504 CYS CYS A . n 
C 3 201 THR 201 505 505 THR THR A . n 
C 3 202 VAL 202 506 506 VAL VAL A . n 
C 3 203 SER 203 507 507 SER SER A . n 
C 3 204 ILE 204 508 508 ILE ILE A . n 
C 3 205 GLY 205 509 509 GLY GLY A . n 
C 3 206 CYS 206 510 510 CYS CYS A . n 
C 3 207 SER 207 511 511 SER SER A . n 
C 3 208 ASP 208 512 512 ASP ASP A . n 
C 3 209 SER 209 513 513 SER SER A . n 
C 3 210 LEU 210 514 514 LEU LEU A . n 
C 3 211 VAL 211 515 515 VAL VAL A . n 
C 3 212 LEU 212 516 516 LEU LEU A . n 
C 3 213 ALA 213 517 517 ALA ALA A . n 
C 3 214 ARG 214 518 518 ARG ARG A . n 
C 3 215 LEU 215 519 519 LEU LEU A . n 
C 3 216 ALA 216 520 520 ALA ALA A . n 
C 3 217 LEU 217 521 521 LEU LEU A . n 
C 3 218 LYS 218 522 522 LYS LYS A . n 
C 3 219 MET 219 523 523 MET MET A . n 
C 3 220 ALA 220 524 524 ALA ALA A . n 
C 3 221 LYS 221 525 525 LYS LYS A . n 
C 3 222 PRO 222 526 526 PRO PRO A . n 
C 3 223 ASN 223 527 527 ASN ASN A . n 
C 3 224 GLY 224 528 528 GLY GLY A . n 
C 3 225 TYR 225 529 529 TYR TYR A . n 
C 3 226 ASN 226 530 530 ASN ASN A . n 
C 3 227 ILE 227 531 531 ILE ILE A . n 
C 3 228 THR 228 532 532 THR THR A . n 
C 3 229 PHE 229 533 533 PHE PHE A . n 
C 3 230 LYS 230 534 534 LYS LYS A . n 
C 3 231 SER 231 535 535 SER SER A . n 
C 3 232 ASN 232 536 536 ASN ASN A . n 
C 3 233 LEU 233 537 537 LEU LEU A . n 
C 3 234 SER 234 538 538 SER SER A . n 
C 3 235 GLU 235 539 539 GLU GLU A . n 
C 3 236 GLU 236 540 540 GLU GLU A . n 
C 3 237 PHE 237 541 541 PHE PHE A . n 
C 3 238 TRP 238 542 542 TRP TRP A . n 
C 3 239 SER 239 543 543 SER SER A . n 
C 3 240 SER 240 544 544 SER SER A . n 
C 3 241 PHE 241 545 545 PHE PHE A . n 
C 3 242 LYS 242 546 546 LYS LYS A . n 
C 3 243 LEU 243 547 547 LEU LEU A . n 
C 3 244 ASP 244 548 548 ASP ASP A . n 
C 3 245 ASP 245 549 549 ASP ASP A . n 
C 3 246 LEU 246 550 550 LEU LEU A . n 
C 3 247 PRO 247 551 551 PRO PRO A . n 
C 3 248 GLY 248 552 552 GLY GLY A . n 
C 3 249 VAL 249 553 553 VAL VAL A . n 
C 3 250 GLY 250 554 554 GLY GLY A . n 
C 3 251 HIS 251 555 555 HIS HIS A . n 
C 3 252 SER 252 556 556 SER SER A . n 
C 3 253 THR 253 557 557 THR THR A . n 
C 3 254 LEU 254 558 558 LEU LEU A . n 
C 3 255 SER 255 559 559 SER SER A . n 
C 3 256 ARG 256 560 560 ARG ARG A . n 
C 3 257 LEU 257 561 561 LEU LEU A . n 
C 3 258 GLU 258 562 562 GLU GLU A . n 
C 3 259 SER 259 563 563 SER SER A . n 
C 3 260 THR 260 564 564 THR THR A . n 
C 3 261 PHE 261 565 565 PHE PHE A . n 
C 3 262 ASP 262 566 566 ASP ASP A . n 
C 3 263 SER 263 567 567 SER SER A . n 
C 3 264 PRO 264 568 568 PRO PRO A . n 
C 3 265 HIS 265 569 569 HIS HIS A . n 
C 3 266 SER 266 570 570 SER SER A . n 
C 3 267 LEU 267 571 571 LEU LEU A . n 
C 3 268 ASN 268 572 572 ASN ASN A . n 
C 3 269 ASP 269 573 573 ASP ASP A . n 
C 3 270 LEU 270 574 574 LEU LEU A . n 
C 3 271 ARG 271 575 575 ARG ARG A . n 
C 3 272 LYS 272 576 576 LYS LYS A . n 
C 3 273 ARG 273 577 577 ARG ARG A . n 
C 3 274 TYR 274 578 578 TYR TYR A . n 
C 3 275 THR 275 579 579 THR THR A . n 
C 3 276 LEU 276 580 580 LEU LEU A . n 
C 3 277 ASP 277 581 581 ASP ASP A . n 
C 3 278 ALA 278 582 582 ALA ALA A . n 
C 3 279 LEU 279 583 583 LEU LEU A . n 
C 3 280 LYS 280 584 584 LYS LYS A . n 
C 3 281 ALA 281 585 585 ALA ALA A . n 
C 3 282 SER 282 586 586 SER SER A . n 
C 3 283 VAL 283 587 587 VAL VAL A . n 
C 3 284 GLY 284 588 588 GLY GLY A . n 
C 3 285 SER 285 589 589 SER SER A . n 
C 3 286 LYS 286 590 590 LYS LYS A . n 
C 3 287 LEU 287 591 591 LEU LEU A . n 
C 3 288 GLY 288 592 592 GLY GLY A . n 
C 3 289 MET 289 593 593 MET MET A . n 
C 3 290 LYS 290 594 594 LYS LYS A . n 
C 3 291 ILE 291 595 595 ILE ILE A . n 
C 3 292 HIS 292 596 596 HIS HIS A . n 
C 3 293 LEU 293 597 597 LEU LEU A . n 
C 3 294 ALA 294 598 598 ALA ALA A . n 
C 3 295 LEU 295 599 599 LEU LEU A . n 
C 3 296 GLN 296 600 600 GLN GLN A . n 
C 3 297 GLY 297 601 601 GLY GLY A . n 
C 3 298 GLN 298 602 602 GLN GLN A . n 
C 3 299 ASP 299 603 603 ASP ASP A . n 
C 3 300 ASP 300 604 604 ASP ASP A . n 
C 3 301 GLU 301 605 605 GLU GLU A . n 
C 3 302 GLU 302 606 606 GLU GLU A . n 
C 3 303 SER 303 607 607 SER SER A . n 
C 3 304 LEU 304 608 608 LEU LEU A . n 
C 3 305 LYS 305 609 609 LYS LYS A . n 
C 3 306 ILE 306 610 610 ILE ILE A . n 
C 3 307 LEU 307 611 611 LEU LEU A . n 
C 3 308 TYR 308 612 612 TYR TYR A . n 
C 3 309 ASP 309 613 613 ASP ASP A . n 
C 3 310 PRO 310 614 614 PRO PRO A . n 
C 3 311 LYS 311 615 615 LYS LYS A . n 
C 3 312 GLU 312 616 616 GLU GLU A . n 
C 3 313 VAL 313 617 617 VAL VAL A . n 
C 3 314 LEU 314 618 618 LEU LEU A . n 
C 3 315 GLN 315 619 619 GLN GLN A . n 
C 3 316 ARG 316 620 620 ARG ARG A . n 
C 3 317 LYS 317 621 621 LYS LYS A . n 
C 3 318 SER 318 622 622 SER SER A . n 
C 3 319 LEU 319 623 623 LEU LEU A . n 
C 3 320 SER 320 624 624 SER SER A . n 
C 3 321 ILE 321 625 625 ILE ILE A . n 
C 3 322 ASP 322 626 626 ASP ASP A . n 
C 3 323 ILE 323 627 627 ILE ILE A . n 
C 3 324 ASN 324 628 628 ASN ASN A . n 
C 3 325 TRP 325 629 629 TRP TRP A . n 
C 3 326 GLY 326 630 630 GLY GLY A . n 
C 3 327 ILE 327 631 631 ILE ILE A . n 
C 3 328 ARG 328 632 632 ARG ARG A . n 
C 3 329 PHE 329 633 633 PHE PHE A . n 
C 3 330 LYS 330 634 634 LYS LYS A . n 
C 3 331 ASN 331 635 635 ASN ASN A . n 
C 3 332 ILE 332 636 636 ILE ILE A . n 
C 3 333 THR 333 637 637 THR THR A . n 
C 3 334 GLN 334 638 638 GLN GLN A . n 
C 3 335 VAL 335 639 639 VAL VAL A . n 
C 3 336 ASP 336 640 640 ASP ASP A . n 
C 3 337 LEU 337 641 641 LEU LEU A . n 
C 3 338 PHE 338 642 642 PHE PHE A . n 
C 3 339 ILE 339 643 643 ILE ILE A . n 
C 3 340 GLU 340 644 644 GLU GLU A . n 
C 3 341 ARG 341 645 645 ARG ARG A . n 
C 3 342 GLY 342 646 646 GLY GLY A . n 
C 3 343 CYS 343 647 647 CYS CYS A . n 
C 3 344 GLN 344 648 648 GLN GLN A . n 
C 3 345 TYR 345 649 649 TYR TYR A . n 
C 3 346 LEU 346 650 650 LEU LEU A . n 
C 3 347 LEU 347 651 651 LEU LEU A . n 
C 3 348 GLU 348 652 652 GLU GLU A . n 
C 3 349 LYS 349 653 653 LYS LYS A . n 
C 3 350 LEU 350 654 654 LEU LEU A . n 
C 3 351 ASN 351 655 655 ASN ASN A . n 
C 3 352 GLU 352 656 656 GLU GLU A . n 
C 3 353 ILE 353 657 657 ILE ILE A . n 
C 3 354 ASN 354 658 658 ASN ASN A . n 
C 3 355 LYS 355 659 659 LYS LYS A . n 
C 3 356 THR 356 660 660 THR THR A . n 
C 3 357 THR 357 661 661 THR THR A . n 
C 3 358 SER 358 662 662 SER SER A . n 
C 3 359 GLN 359 663 663 GLN GLN A . n 
C 3 360 ILE 360 664 664 ILE ILE A . n 
C 3 361 THR 361 665 665 THR THR A . n 
C 3 362 LEU 362 666 666 LEU LEU A . n 
C 3 363 LYS 363 667 667 LYS LYS A . n 
C 3 364 LEU 364 668 668 LEU LEU A . n 
C 3 365 MET 365 669 669 MET MET A . n 
C 3 366 ARG 366 670 670 ARG ARG A . n 
C 3 367 ARG 367 671 671 ARG ARG A . n 
C 3 368 CYS 368 672 672 CYS CYS A . n 
C 3 369 LYS 369 673 673 LYS LYS A . n 
C 3 370 ASP 370 674 674 ASP ASP A . n 
C 3 371 ALA 371 675 675 ALA ALA A . n 
C 3 372 PRO 372 676 676 PRO PRO A . n 
C 3 373 ILE 373 677 677 ILE ILE A . n 
C 3 374 GLU 374 678 678 GLU GLU A . n 
C 3 375 PRO 375 679 679 PRO PRO A . n 
C 3 376 PRO 376 680 680 PRO PRO A . n 
C 3 377 LYS 377 681 681 LYS LYS A . n 
C 3 378 TYR 378 682 682 TYR TYR A . n 
C 3 379 MET 379 683 683 MET MET A . n 
C 3 380 GLY 380 684 684 GLY GLY A . n 
C 3 381 MET 381 685 685 MET MET A . n 
C 3 382 GLY 382 686 686 GLY GLY A . n 
C 3 383 ARG 383 687 687 ARG ARG A . n 
C 3 384 CYS 384 688 688 CYS CYS A . n 
C 3 385 ASP 385 689 689 ASP ASP A . n 
C 3 386 SER 386 690 690 SER SER A . n 
C 3 387 PHE 387 691 691 PHE PHE A . n 
C 3 388 SER 388 692 692 SER SER A . n 
C 3 389 ARG 389 693 693 ARG ARG A . n 
C 3 390 SER 390 694 694 SER SER A . n 
C 3 391 SER 391 695 695 SER SER A . n 
C 3 392 ARG 392 696 696 ARG ARG A . n 
C 3 393 LEU 393 697 697 LEU LEU A . n 
C 3 394 GLY 394 698 698 GLY GLY A . n 
C 3 395 ILE 395 699 699 ILE ILE A . n 
C 3 396 PRO 396 700 700 PRO PRO A . n 
C 3 397 THR 397 701 701 THR THR A . n 
C 3 398 ASN 398 702 702 ASN ASN A . n 
C 3 399 GLU 399 703 703 GLU GLU A . n 
C 3 400 PHE 400 704 704 PHE PHE A . n 
C 3 401 GLY 401 705 705 GLY GLY A . n 
C 3 402 ILE 402 706 706 ILE ILE A . n 
C 3 403 ILE 403 707 707 ILE ILE A . n 
C 3 404 ALA 404 708 708 ALA ALA A . n 
C 3 405 THR 405 709 709 THR THR A . n 
C 3 406 GLU 406 710 710 GLU GLU A . n 
C 3 407 MET 407 711 711 MET MET A . n 
C 3 408 LYS 408 712 712 LYS LYS A . n 
C 3 409 SER 409 713 713 SER SER A . n 
C 3 410 LEU 410 714 714 LEU LEU A . n 
C 3 411 TYR 411 715 715 TYR TYR A . n 
C 3 412 ARG 412 716 716 ARG ARG A . n 
C 3 413 THR 413 717 717 THR THR A . n 
C 3 414 LEU 414 718 718 LEU LEU A . n 
C 3 415 GLY 415 719 719 GLY GLY A . n 
C 3 416 CYS 416 720 720 CYS CYS A . n 
C 3 417 PRO 417 721 721 PRO PRO A . n 
C 3 418 PRO 418 722 722 PRO PRO A . n 
C 3 419 MET 419 723 723 MET MET A . n 
C 3 420 GLU 420 724 724 GLU GLU A . n 
C 3 421 LEU 421 725 725 LEU LEU A . n 
C 3 422 ARG 422 726 726 ARG ARG A . n 
C 3 423 GLY 423 727 727 GLY GLY A . n 
C 3 424 LEU 424 728 728 LEU LEU A . n 
C 3 425 ALA 425 729 729 ALA ALA A . n 
C 3 426 LEU 426 730 730 LEU LEU A . n 
C 3 427 GLN 427 731 731 GLN GLN A . n 
C 3 428 PHE 428 732 732 PHE PHE A . n 
C 3 429 ASN 429 733 733 ASN ASN A . n 
C 3 430 LYS 430 734 734 LYS LYS A . n 
C 3 431 LEU 431 735 735 LEU LEU A . n 
C 3 432 VAL 432 736 736 VAL VAL A . n 
C 3 433 ASP 433 737 737 ASP ASP A . n 
C 3 434 VAL 434 738 738 VAL VAL A . n 
C 3 435 GLY 435 739 739 GLY GLY A . n 
C 3 436 PRO 436 740 740 PRO PRO A . n 
C 3 437 ASP 437 741 741 ASP ASP A . n 
C 3 438 ASN 438 742 742 ASN ASN A . n 
C 3 439 ASN 439 743 743 ASN ASN A . n 
C 3 440 GLN 440 744 ?   ?   ?   A . n 
C 3 441 LEU 441 745 ?   ?   ?   A . n 
C 3 442 LYS 442 746 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   801  1   MG  MG  P . 
E 5 HOH 1   901  114 HOH HOH P . 
E 5 HOH 2   902  432 HOH HOH P . 
E 5 HOH 3   903  250 HOH HOH P . 
E 5 HOH 4   904  225 HOH HOH P . 
E 5 HOH 5   905  340 HOH HOH P . 
E 5 HOH 6   906  200 HOH HOH P . 
E 5 HOH 7   907  147 HOH HOH P . 
E 5 HOH 8   908  272 HOH HOH P . 
E 5 HOH 9   909  273 HOH HOH P . 
E 5 HOH 10  910  357 HOH HOH P . 
E 5 HOH 11  911  382 HOH HOH P . 
E 5 HOH 12  912  175 HOH HOH P . 
E 5 HOH 13  913  366 HOH HOH P . 
E 5 HOH 14  914  301 HOH HOH P . 
E 5 HOH 15  915  46  HOH HOH P . 
E 5 HOH 16  916  41  HOH HOH P . 
E 5 HOH 17  917  84  HOH HOH P . 
E 5 HOH 18  918  113 HOH HOH P . 
E 5 HOH 19  919  317 HOH HOH P . 
E 5 HOH 20  920  411 HOH HOH P . 
E 5 HOH 21  921  463 HOH HOH P . 
E 5 HOH 22  922  237 HOH HOH P . 
E 5 HOH 23  923  418 HOH HOH P . 
E 5 HOH 24  924  409 HOH HOH P . 
E 5 HOH 25  925  344 HOH HOH P . 
E 5 HOH 26  926  140 HOH HOH P . 
E 5 HOH 27  927  310 HOH HOH P . 
F 5 HOH 1   101  291 HOH HOH T . 
F 5 HOH 2   102  329 HOH HOH T . 
F 5 HOH 3   103  169 HOH HOH T . 
F 5 HOH 4   104  412 HOH HOH T . 
F 5 HOH 5   105  337 HOH HOH T . 
F 5 HOH 6   106  5   HOH HOH T . 
F 5 HOH 7   107  28  HOH HOH T . 
F 5 HOH 8   108  87  HOH HOH T . 
F 5 HOH 9   109  141 HOH HOH T . 
F 5 HOH 10  110  80  HOH HOH T . 
F 5 HOH 11  111  376 HOH HOH T . 
F 5 HOH 12  112  56  HOH HOH T . 
F 5 HOH 13  113  8   HOH HOH T . 
F 5 HOH 14  114  277 HOH HOH T . 
F 5 HOH 15  115  31  HOH HOH T . 
F 5 HOH 16  116  128 HOH HOH T . 
F 5 HOH 17  117  239 HOH HOH T . 
F 5 HOH 18  118  390 HOH HOH T . 
F 5 HOH 19  119  283 HOH HOH T . 
F 5 HOH 20  120  196 HOH HOH T . 
F 5 HOH 21  121  164 HOH HOH T . 
F 5 HOH 22  122  379 HOH HOH T . 
F 5 HOH 23  123  218 HOH HOH T . 
F 5 HOH 24  124  120 HOH HOH T . 
F 5 HOH 25  125  474 HOH HOH T . 
F 5 HOH 26  126  245 HOH HOH T . 
F 5 HOH 27  127  262 HOH HOH T . 
F 5 HOH 28  128  190 HOH HOH T . 
F 5 HOH 29  129  131 HOH HOH T . 
F 5 HOH 30  130  246 HOH HOH T . 
F 5 HOH 31  131  330 HOH HOH T . 
F 5 HOH 32  132  286 HOH HOH T . 
F 5 HOH 33  133  242 HOH HOH T . 
G 5 HOH 1   901  231 HOH HOH A . 
G 5 HOH 2   902  384 HOH HOH A . 
G 5 HOH 3   903  480 HOH HOH A . 
G 5 HOH 4   904  213 HOH HOH A . 
G 5 HOH 5   905  475 HOH HOH A . 
G 5 HOH 6   906  91  HOH HOH A . 
G 5 HOH 7   907  51  HOH HOH A . 
G 5 HOH 8   908  253 HOH HOH A . 
G 5 HOH 9   909  135 HOH HOH A . 
G 5 HOH 10  910  355 HOH HOH A . 
G 5 HOH 11  911  201 HOH HOH A . 
G 5 HOH 12  912  284 HOH HOH A . 
G 5 HOH 13  913  182 HOH HOH A . 
G 5 HOH 14  914  467 HOH HOH A . 
G 5 HOH 15  915  136 HOH HOH A . 
G 5 HOH 16  916  397 HOH HOH A . 
G 5 HOH 17  917  47  HOH HOH A . 
G 5 HOH 18  918  378 HOH HOH A . 
G 5 HOH 19  919  215 HOH HOH A . 
G 5 HOH 20  920  118 HOH HOH A . 
G 5 HOH 21  921  189 HOH HOH A . 
G 5 HOH 22  922  52  HOH HOH A . 
G 5 HOH 23  923  236 HOH HOH A . 
G 5 HOH 24  924  229 HOH HOH A . 
G 5 HOH 25  925  226 HOH HOH A . 
G 5 HOH 26  926  415 HOH HOH A . 
G 5 HOH 27  927  185 HOH HOH A . 
G 5 HOH 28  928  469 HOH HOH A . 
G 5 HOH 29  929  373 HOH HOH A . 
G 5 HOH 30  930  36  HOH HOH A . 
G 5 HOH 31  931  251 HOH HOH A . 
G 5 HOH 32  932  184 HOH HOH A . 
G 5 HOH 33  933  385 HOH HOH A . 
G 5 HOH 34  934  198 HOH HOH A . 
G 5 HOH 35  935  367 HOH HOH A . 
G 5 HOH 36  936  75  HOH HOH A . 
G 5 HOH 37  937  302 HOH HOH A . 
G 5 HOH 38  938  358 HOH HOH A . 
G 5 HOH 39  939  394 HOH HOH A . 
G 5 HOH 40  940  408 HOH HOH A . 
G 5 HOH 41  941  267 HOH HOH A . 
G 5 HOH 42  942  4   HOH HOH A . 
G 5 HOH 43  943  288 HOH HOH A . 
G 5 HOH 44  944  85  HOH HOH A . 
G 5 HOH 45  945  40  HOH HOH A . 
G 5 HOH 46  946  35  HOH HOH A . 
G 5 HOH 47  947  352 HOH HOH A . 
G 5 HOH 48  948  60  HOH HOH A . 
G 5 HOH 49  949  127 HOH HOH A . 
G 5 HOH 50  950  235 HOH HOH A . 
G 5 HOH 51  951  23  HOH HOH A . 
G 5 HOH 52  952  82  HOH HOH A . 
G 5 HOH 53  953  326 HOH HOH A . 
G 5 HOH 54  954  350 HOH HOH A . 
G 5 HOH 55  955  309 HOH HOH A . 
G 5 HOH 56  956  183 HOH HOH A . 
G 5 HOH 57  957  313 HOH HOH A . 
G 5 HOH 58  958  178 HOH HOH A . 
G 5 HOH 59  959  280 HOH HOH A . 
G 5 HOH 60  960  332 HOH HOH A . 
G 5 HOH 61  961  95  HOH HOH A . 
G 5 HOH 62  962  167 HOH HOH A . 
G 5 HOH 63  963  293 HOH HOH A . 
G 5 HOH 64  964  395 HOH HOH A . 
G 5 HOH 65  965  65  HOH HOH A . 
G 5 HOH 66  966  331 HOH HOH A . 
G 5 HOH 67  967  78  HOH HOH A . 
G 5 HOH 68  968  241 HOH HOH A . 
G 5 HOH 69  969  261 HOH HOH A . 
G 5 HOH 70  970  428 HOH HOH A . 
G 5 HOH 71  971  101 HOH HOH A . 
G 5 HOH 72  972  233 HOH HOH A . 
G 5 HOH 73  973  220 HOH HOH A . 
G 5 HOH 74  974  195 HOH HOH A . 
G 5 HOH 75  975  3   HOH HOH A . 
G 5 HOH 76  976  34  HOH HOH A . 
G 5 HOH 77  977  228 HOH HOH A . 
G 5 HOH 78  978  179 HOH HOH A . 
G 5 HOH 79  979  7   HOH HOH A . 
G 5 HOH 80  980  2   HOH HOH A . 
G 5 HOH 81  981  132 HOH HOH A . 
G 5 HOH 82  982  297 HOH HOH A . 
G 5 HOH 83  983  129 HOH HOH A . 
G 5 HOH 84  984  155 HOH HOH A . 
G 5 HOH 85  985  368 HOH HOH A . 
G 5 HOH 86  986  430 HOH HOH A . 
G 5 HOH 87  987  71  HOH HOH A . 
G 5 HOH 88  988  153 HOH HOH A . 
G 5 HOH 89  989  107 HOH HOH A . 
G 5 HOH 90  990  260 HOH HOH A . 
G 5 HOH 91  991  429 HOH HOH A . 
G 5 HOH 92  992  388 HOH HOH A . 
G 5 HOH 93  993  482 HOH HOH A . 
G 5 HOH 94  994  157 HOH HOH A . 
G 5 HOH 95  995  123 HOH HOH A . 
G 5 HOH 96  996  477 HOH HOH A . 
G 5 HOH 97  997  456 HOH HOH A . 
G 5 HOH 98  998  453 HOH HOH A . 
G 5 HOH 99  999  81  HOH HOH A . 
G 5 HOH 100 1000 18  HOH HOH A . 
G 5 HOH 101 1001 171 HOH HOH A . 
G 5 HOH 102 1002 161 HOH HOH A . 
G 5 HOH 103 1003 335 HOH HOH A . 
G 5 HOH 104 1004 265 HOH HOH A . 
G 5 HOH 105 1005 99  HOH HOH A . 
G 5 HOH 106 1006 240 HOH HOH A . 
G 5 HOH 107 1007 203 HOH HOH A . 
G 5 HOH 108 1008 275 HOH HOH A . 
G 5 HOH 109 1009 117 HOH HOH A . 
G 5 HOH 110 1010 300 HOH HOH A . 
G 5 HOH 111 1011 356 HOH HOH A . 
G 5 HOH 112 1012 138 HOH HOH A . 
G 5 HOH 113 1013 451 HOH HOH A . 
G 5 HOH 114 1014 473 HOH HOH A . 
G 5 HOH 115 1015 59  HOH HOH A . 
G 5 HOH 116 1016 158 HOH HOH A . 
G 5 HOH 117 1017 103 HOH HOH A . 
G 5 HOH 118 1018 48  HOH HOH A . 
G 5 HOH 119 1019 98  HOH HOH A . 
G 5 HOH 120 1020 417 HOH HOH A . 
G 5 HOH 121 1021 15  HOH HOH A . 
G 5 HOH 122 1022 12  HOH HOH A . 
G 5 HOH 123 1023 321 HOH HOH A . 
G 5 HOH 124 1024 43  HOH HOH A . 
G 5 HOH 125 1025 124 HOH HOH A . 
G 5 HOH 126 1026 63  HOH HOH A . 
G 5 HOH 127 1027 14  HOH HOH A . 
G 5 HOH 128 1028 88  HOH HOH A . 
G 5 HOH 129 1029 219 HOH HOH A . 
G 5 HOH 130 1030 9   HOH HOH A . 
G 5 HOH 131 1031 122 HOH HOH A . 
G 5 HOH 132 1032 29  HOH HOH A . 
G 5 HOH 133 1033 27  HOH HOH A . 
G 5 HOH 134 1034 74  HOH HOH A . 
G 5 HOH 135 1035 83  HOH HOH A . 
G 5 HOH 136 1036 126 HOH HOH A . 
G 5 HOH 137 1037 199 HOH HOH A . 
G 5 HOH 138 1038 79  HOH HOH A . 
G 5 HOH 139 1039 446 HOH HOH A . 
G 5 HOH 140 1040 320 HOH HOH A . 
G 5 HOH 141 1041 276 HOH HOH A . 
G 5 HOH 142 1042 312 HOH HOH A . 
G 5 HOH 143 1043 64  HOH HOH A . 
G 5 HOH 144 1044 50  HOH HOH A . 
G 5 HOH 145 1045 214 HOH HOH A . 
G 5 HOH 146 1046 42  HOH HOH A . 
G 5 HOH 147 1047 166 HOH HOH A . 
G 5 HOH 148 1048 44  HOH HOH A . 
G 5 HOH 149 1049 210 HOH HOH A . 
G 5 HOH 150 1050 25  HOH HOH A . 
G 5 HOH 151 1051 343 HOH HOH A . 
G 5 HOH 152 1052 290 HOH HOH A . 
G 5 HOH 153 1053 206 HOH HOH A . 
G 5 HOH 154 1054 45  HOH HOH A . 
G 5 HOH 155 1055 393 HOH HOH A . 
G 5 HOH 156 1056 70  HOH HOH A . 
G 5 HOH 157 1057 16  HOH HOH A . 
G 5 HOH 158 1058 294 HOH HOH A . 
G 5 HOH 159 1059 187 HOH HOH A . 
G 5 HOH 160 1060 221 HOH HOH A . 
G 5 HOH 161 1061 347 HOH HOH A . 
G 5 HOH 162 1062 348 HOH HOH A . 
G 5 HOH 163 1063 62  HOH HOH A . 
G 5 HOH 164 1064 303 HOH HOH A . 
G 5 HOH 165 1065 6   HOH HOH A . 
G 5 HOH 166 1066 109 HOH HOH A . 
G 5 HOH 167 1067 30  HOH HOH A . 
G 5 HOH 168 1068 72  HOH HOH A . 
G 5 HOH 169 1069 186 HOH HOH A . 
G 5 HOH 170 1070 377 HOH HOH A . 
G 5 HOH 171 1071 224 HOH HOH A . 
G 5 HOH 172 1072 369 HOH HOH A . 
G 5 HOH 173 1073 11  HOH HOH A . 
G 5 HOH 174 1074 279 HOH HOH A . 
G 5 HOH 175 1075 54  HOH HOH A . 
G 5 HOH 176 1076 334 HOH HOH A . 
G 5 HOH 177 1077 106 HOH HOH A . 
G 5 HOH 178 1078 322 HOH HOH A . 
G 5 HOH 179 1079 154 HOH HOH A . 
G 5 HOH 180 1080 13  HOH HOH A . 
G 5 HOH 181 1081 105 HOH HOH A . 
G 5 HOH 182 1082 181 HOH HOH A . 
G 5 HOH 183 1083 1   HOH HOH A . 
G 5 HOH 184 1084 57  HOH HOH A . 
G 5 HOH 185 1085 151 HOH HOH A . 
G 5 HOH 186 1086 39  HOH HOH A . 
G 5 HOH 187 1087 381 HOH HOH A . 
G 5 HOH 188 1088 66  HOH HOH A . 
G 5 HOH 189 1089 22  HOH HOH A . 
G 5 HOH 190 1090 58  HOH HOH A . 
G 5 HOH 191 1091 33  HOH HOH A . 
G 5 HOH 192 1092 170 HOH HOH A . 
G 5 HOH 193 1093 323 HOH HOH A . 
G 5 HOH 194 1094 223 HOH HOH A . 
G 5 HOH 195 1095 194 HOH HOH A . 
G 5 HOH 196 1096 324 HOH HOH A . 
G 5 HOH 197 1097 146 HOH HOH A . 
G 5 HOH 198 1098 387 HOH HOH A . 
G 5 HOH 199 1099 67  HOH HOH A . 
G 5 HOH 200 1100 204 HOH HOH A . 
G 5 HOH 201 1101 26  HOH HOH A . 
G 5 HOH 202 1102 130 HOH HOH A . 
G 5 HOH 203 1103 116 HOH HOH A . 
G 5 HOH 204 1104 17  HOH HOH A . 
G 5 HOH 205 1105 298 HOH HOH A . 
G 5 HOH 206 1106 92  HOH HOH A . 
G 5 HOH 207 1107 19  HOH HOH A . 
G 5 HOH 208 1108 211 HOH HOH A . 
G 5 HOH 209 1109 53  HOH HOH A . 
G 5 HOH 210 1110 365 HOH HOH A . 
G 5 HOH 211 1111 380 HOH HOH A . 
G 5 HOH 212 1112 444 HOH HOH A . 
G 5 HOH 213 1113 386 HOH HOH A . 
G 5 HOH 214 1114 341 HOH HOH A . 
G 5 HOH 215 1115 121 HOH HOH A . 
G 5 HOH 216 1116 462 HOH HOH A . 
G 5 HOH 217 1117 263 HOH HOH A . 
G 5 HOH 218 1118 392 HOH HOH A . 
G 5 HOH 219 1119 111 HOH HOH A . 
G 5 HOH 220 1120 247 HOH HOH A . 
G 5 HOH 221 1121 269 HOH HOH A . 
G 5 HOH 222 1122 243 HOH HOH A . 
G 5 HOH 223 1123 49  HOH HOH A . 
G 5 HOH 224 1124 152 HOH HOH A . 
G 5 HOH 225 1125 304 HOH HOH A . 
G 5 HOH 226 1126 401 HOH HOH A . 
G 5 HOH 227 1127 314 HOH HOH A . 
G 5 HOH 228 1128 375 HOH HOH A . 
G 5 HOH 229 1129 69  HOH HOH A . 
G 5 HOH 230 1130 424 HOH HOH A . 
G 5 HOH 231 1131 115 HOH HOH A . 
G 5 HOH 232 1132 282 HOH HOH A . 
G 5 HOH 233 1133 257 HOH HOH A . 
G 5 HOH 234 1134 391 HOH HOH A . 
G 5 HOH 235 1135 346 HOH HOH A . 
G 5 HOH 236 1136 102 HOH HOH A . 
G 5 HOH 237 1137 234 HOH HOH A . 
G 5 HOH 238 1138 230 HOH HOH A . 
G 5 HOH 239 1139 188 HOH HOH A . 
G 5 HOH 240 1140 460 HOH HOH A . 
G 5 HOH 241 1141 20  HOH HOH A . 
G 5 HOH 242 1142 38  HOH HOH A . 
G 5 HOH 243 1143 289 HOH HOH A . 
G 5 HOH 244 1144 209 HOH HOH A . 
G 5 HOH 245 1145 119 HOH HOH A . 
G 5 HOH 246 1146 336 HOH HOH A . 
G 5 HOH 247 1147 108 HOH HOH A . 
G 5 HOH 248 1148 68  HOH HOH A . 
G 5 HOH 249 1149 248 HOH HOH A . 
G 5 HOH 250 1150 96  HOH HOH A . 
G 5 HOH 251 1151 285 HOH HOH A . 
G 5 HOH 252 1152 134 HOH HOH A . 
G 5 HOH 253 1153 55  HOH HOH A . 
G 5 HOH 254 1154 61  HOH HOH A . 
G 5 HOH 255 1155 150 HOH HOH A . 
G 5 HOH 256 1156 448 HOH HOH A . 
G 5 HOH 257 1157 125 HOH HOH A . 
G 5 HOH 258 1158 21  HOH HOH A . 
G 5 HOH 259 1159 104 HOH HOH A . 
G 5 HOH 260 1160 404 HOH HOH A . 
G 5 HOH 261 1161 144 HOH HOH A . 
G 5 HOH 262 1162 249 HOH HOH A . 
G 5 HOH 263 1163 222 HOH HOH A . 
G 5 HOH 264 1164 372 HOH HOH A . 
G 5 HOH 265 1165 168 HOH HOH A . 
G 5 HOH 266 1166 32  HOH HOH A . 
G 5 HOH 267 1167 374 HOH HOH A . 
G 5 HOH 268 1168 10  HOH HOH A . 
G 5 HOH 269 1169 37  HOH HOH A . 
G 5 HOH 270 1170 305 HOH HOH A . 
G 5 HOH 271 1171 244 HOH HOH A . 
G 5 HOH 272 1172 484 HOH HOH A . 
G 5 HOH 273 1173 177 HOH HOH A . 
G 5 HOH 274 1174 165 HOH HOH A . 
G 5 HOH 275 1175 483 HOH HOH A . 
G 5 HOH 276 1176 76  HOH HOH A . 
G 5 HOH 277 1177 442 HOH HOH A . 
G 5 HOH 278 1178 295 HOH HOH A . 
G 5 HOH 279 1179 238 HOH HOH A . 
G 5 HOH 280 1180 266 HOH HOH A . 
G 5 HOH 281 1181 93  HOH HOH A . 
G 5 HOH 282 1182 162 HOH HOH A . 
G 5 HOH 283 1183 197 HOH HOH A . 
G 5 HOH 284 1184 139 HOH HOH A . 
G 5 HOH 285 1185 464 HOH HOH A . 
G 5 HOH 286 1186 389 HOH HOH A . 
G 5 HOH 287 1187 143 HOH HOH A . 
G 5 HOH 288 1188 180 HOH HOH A . 
G 5 HOH 289 1189 278 HOH HOH A . 
G 5 HOH 290 1190 342 HOH HOH A . 
G 5 HOH 291 1191 112 HOH HOH A . 
G 5 HOH 292 1192 398 HOH HOH A . 
G 5 HOH 293 1193 439 HOH HOH A . 
G 5 HOH 294 1194 370 HOH HOH A . 
G 5 HOH 295 1195 425 HOH HOH A . 
G 5 HOH 296 1196 422 HOH HOH A . 
G 5 HOH 297 1197 434 HOH HOH A . 
G 5 HOH 298 1198 399 HOH HOH A . 
G 5 HOH 299 1199 405 HOH HOH A . 
G 5 HOH 300 1200 478 HOH HOH A . 
G 5 HOH 301 1201 455 HOH HOH A . 
G 5 HOH 302 1202 414 HOH HOH A . 
G 5 HOH 303 1203 465 HOH HOH A . 
G 5 HOH 304 1204 466 HOH HOH A . 
G 5 HOH 305 1205 449 HOH HOH A . 
G 5 HOH 306 1206 396 HOH HOH A . 
G 5 HOH 307 1207 97  HOH HOH A . 
G 5 HOH 308 1208 362 HOH HOH A . 
G 5 HOH 309 1209 419 HOH HOH A . 
G 5 HOH 310 1210 421 HOH HOH A . 
G 5 HOH 311 1211 423 HOH HOH A . 
G 5 HOH 312 1212 90  HOH HOH A . 
G 5 HOH 313 1213 77  HOH HOH A . 
G 5 HOH 314 1214 308 HOH HOH A . 
G 5 HOH 315 1215 145 HOH HOH A . 
G 5 HOH 316 1216 271 HOH HOH A . 
G 5 HOH 317 1217 447 HOH HOH A . 
G 5 HOH 318 1218 133 HOH HOH A . 
G 5 HOH 319 1219 327 HOH HOH A . 
G 5 HOH 320 1220 441 HOH HOH A . 
G 5 HOH 321 1221 438 HOH HOH A . 
G 5 HOH 322 1222 316 HOH HOH A . 
G 5 HOH 323 1223 281 HOH HOH A . 
G 5 HOH 324 1224 259 HOH HOH A . 
G 5 HOH 325 1225 292 HOH HOH A . 
G 5 HOH 326 1226 363 HOH HOH A . 
G 5 HOH 327 1227 315 HOH HOH A . 
G 5 HOH 328 1228 440 HOH HOH A . 
G 5 HOH 329 1229 328 HOH HOH A . 
G 5 HOH 330 1230 383 HOH HOH A . 
G 5 HOH 331 1231 318 HOH HOH A . 
G 5 HOH 332 1232 461 HOH HOH A . 
G 5 HOH 333 1233 479 HOH HOH A . 
G 5 HOH 334 1234 264 HOH HOH A . 
G 5 HOH 335 1235 454 HOH HOH A . 
G 5 HOH 336 1236 338 HOH HOH A . 
G 5 HOH 337 1237 371 HOH HOH A . 
G 5 HOH 338 1238 433 HOH HOH A . 
G 5 HOH 339 1239 255 HOH HOH A . 
G 5 HOH 340 1240 299 HOH HOH A . 
G 5 HOH 341 1241 148 HOH HOH A . 
G 5 HOH 342 1242 202 HOH HOH A . 
G 5 HOH 343 1243 232 HOH HOH A . 
G 5 HOH 344 1244 436 HOH HOH A . 
G 5 HOH 345 1245 192 HOH HOH A . 
G 5 HOH 346 1246 205 HOH HOH A . 
G 5 HOH 347 1247 270 HOH HOH A . 
G 5 HOH 348 1248 268 HOH HOH A . 
G 5 HOH 349 1249 307 HOH HOH A . 
G 5 HOH 350 1250 457 HOH HOH A . 
G 5 HOH 351 1251 24  HOH HOH A . 
G 5 HOH 352 1252 403 HOH HOH A . 
G 5 HOH 353 1253 445 HOH HOH A . 
G 5 HOH 354 1254 216 HOH HOH A . 
G 5 HOH 355 1255 333 HOH HOH A . 
G 5 HOH 356 1256 407 HOH HOH A . 
G 5 HOH 357 1257 287 HOH HOH A . 
G 5 HOH 358 1258 402 HOH HOH A . 
G 5 HOH 359 1259 359 HOH HOH A . 
G 5 HOH 360 1260 349 HOH HOH A . 
G 5 HOH 361 1261 437 HOH HOH A . 
G 5 HOH 362 1262 472 HOH HOH A . 
G 5 HOH 363 1263 459 HOH HOH A . 
G 5 HOH 364 1264 354 HOH HOH A . 
G 5 HOH 365 1265 252 HOH HOH A . 
G 5 HOH 366 1266 227 HOH HOH A . 
G 5 HOH 367 1267 431 HOH HOH A . 
G 5 HOH 368 1268 353 HOH HOH A . 
G 5 HOH 369 1269 311 HOH HOH A . 
G 5 HOH 370 1270 173 HOH HOH A . 
G 5 HOH 371 1271 258 HOH HOH A . 
G 5 HOH 372 1272 176 HOH HOH A . 
G 5 HOH 373 1273 427 HOH HOH A . 
G 5 HOH 374 1274 89  HOH HOH A . 
G 5 HOH 375 1275 410 HOH HOH A . 
G 5 HOH 376 1276 137 HOH HOH A . 
G 5 HOH 377 1277 212 HOH HOH A . 
G 5 HOH 378 1278 156 HOH HOH A . 
G 5 HOH 379 1279 191 HOH HOH A . 
G 5 HOH 380 1280 361 HOH HOH A . 
G 5 HOH 381 1281 476 HOH HOH A . 
G 5 HOH 382 1282 351 HOH HOH A . 
G 5 HOH 383 1283 452 HOH HOH A . 
G 5 HOH 384 1284 426 HOH HOH A . 
G 5 HOH 385 1285 208 HOH HOH A . 
G 5 HOH 386 1286 160 HOH HOH A . 
G 5 HOH 387 1287 163 HOH HOH A . 
G 5 HOH 388 1288 174 HOH HOH A . 
G 5 HOH 389 1289 110 HOH HOH A . 
G 5 HOH 390 1290 339 HOH HOH A . 
G 5 HOH 391 1291 413 HOH HOH A . 
G 5 HOH 392 1292 159 HOH HOH A . 
G 5 HOH 393 1293 325 HOH HOH A . 
G 5 HOH 394 1294 254 HOH HOH A . 
G 5 HOH 395 1295 193 HOH HOH A . 
G 5 HOH 396 1296 450 HOH HOH A . 
G 5 HOH 397 1297 149 HOH HOH A . 
G 5 HOH 398 1298 217 HOH HOH A . 
G 5 HOH 399 1299 306 HOH HOH A . 
G 5 HOH 400 1300 416 HOH HOH A . 
G 5 HOH 401 1301 296 HOH HOH A . 
G 5 HOH 402 1302 345 HOH HOH A . 
G 5 HOH 403 1303 274 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5140  ? 
1 MORE         -51   ? 
1 'SSA (A^2)'  23730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP1 ? A DA  11  ? P DA  11  ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? E HOH .   ? P HOH 916 ? 1_555 100.1 ? 
2  OP1 ? A DA  11  ? P DA  11  ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? C ASP 244 ? A ASP 548 ? 1_555 162.0 ? 
3  O   ? E HOH .   ? P HOH 916 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? C ASP 244 ? A ASP 548 ? 1_555 93.2  ? 
4  OP1 ? A DA  11  ? P DA  11  ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? C VAL 249 ? A VAL 553 ? 1_555 99.3  ? 
5  O   ? E HOH .   ? P HOH 916 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? C VAL 249 ? A VAL 553 ? 1_555 92.6  ? 
6  O   ? C ASP 244 ? A ASP 548 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? C VAL 249 ? A VAL 553 ? 1_555 92.1  ? 
7  OP1 ? A DA  11  ? P DA  11  ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? G HOH .   ? A HOH 907 ? 1_555 82.7  ? 
8  O   ? E HOH .   ? P HOH 916 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? G HOH .   ? A HOH 907 ? 1_555 102.9 ? 
9  O   ? C ASP 244 ? A ASP 548 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? G HOH .   ? A HOH 907 ? 1_555 82.5  ? 
10 O   ? C VAL 249 ? A VAL 553 ? 1_555 MG ? D MG . ? P MG 801 ? 1_555 O ? G HOH .   ? A HOH 907 ? 1_555 163.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-30 
2 'Structure model' 1 1 2020-10-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.pdbx_database_id_DOI'    
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation.title'                   
7 2 'Structure model' '_citation_author.identifier_ORCID' 
8 2 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.15.2_3472 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .           4 
# 
_pdbx_entry_details.entry_id                 6X70 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 347 ? ? -117.60 50.86  
2 1 THR A 348 ? ? -64.52  11.09  
3 1 CYS A 365 ? ? 37.43   69.33  
4 1 LYS A 396 ? ? -129.83 -95.27 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       1303 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.11 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC  1   ? "O5'" ? B DC  1   "O5'" 
2  1 Y 1 T DC  1   ? "C5'" ? B DC  1   "C5'" 
3  1 Y 1 T DC  1   ? "C4'" ? B DC  1   "C4'" 
4  1 Y 1 T DC  1   ? "O4'" ? B DC  1   "O4'" 
5  1 Y 1 T DC  1   ? "C3'" ? B DC  1   "C3'" 
6  1 Y 1 T DC  1   ? "C2'" ? B DC  1   "C2'" 
7  1 Y 1 T DC  1   ? "C1'" ? B DC  1   "C1'" 
8  1 Y 1 T DC  1   ? N1    ? B DC  1   N1    
9  1 Y 1 T DC  1   ? C2    ? B DC  1   C2    
10 1 Y 1 T DC  1   ? O2    ? B DC  1   O2    
11 1 Y 1 T DC  1   ? N3    ? B DC  1   N3    
12 1 Y 1 T DC  1   ? C4    ? B DC  1   C4    
13 1 Y 1 T DC  1   ? N4    ? B DC  1   N4    
14 1 Y 1 T DC  1   ? C5    ? B DC  1   C5    
15 1 Y 1 T DC  1   ? C6    ? B DC  1   C6    
16 1 Y 1 A TYR 347 ? CG    ? C TYR 43  CG    
17 1 Y 1 A TYR 347 ? CD1   ? C TYR 43  CD1   
18 1 Y 1 A TYR 347 ? CD2   ? C TYR 43  CD2   
19 1 Y 1 A TYR 347 ? CE1   ? C TYR 43  CE1   
20 1 Y 1 A TYR 347 ? CE2   ? C TYR 43  CE2   
21 1 Y 1 A TYR 347 ? CZ    ? C TYR 43  CZ    
22 1 Y 1 A TYR 347 ? OH    ? C TYR 43  OH    
23 1 Y 1 A THR 348 ? OG1   ? C THR 44  OG1   
24 1 Y 1 A THR 348 ? CG2   ? C THR 44  CG2   
25 1 Y 1 A LYS 349 ? CG    ? C LYS 45  CG    
26 1 Y 1 A LYS 349 ? CD    ? C LYS 45  CD    
27 1 Y 1 A LYS 349 ? CE    ? C LYS 45  CE    
28 1 Y 1 A LYS 349 ? NZ    ? C LYS 45  NZ    
29 1 Y 1 A LYS 353 ? CG    ? C LYS 49  CG    
30 1 Y 1 A LYS 353 ? CD    ? C LYS 49  CD    
31 1 Y 1 A LYS 353 ? CE    ? C LYS 49  CE    
32 1 Y 1 A LYS 353 ? NZ    ? C LYS 49  NZ    
33 1 Y 1 A ASN 478 ? CG    ? C ASN 174 CG    
34 1 Y 1 A ASN 478 ? OD1   ? C ASN 174 OD1   
35 1 Y 1 A ASN 478 ? ND2   ? C ASN 174 ND2   
36 1 Y 1 A ILE 479 ? CG1   ? C ILE 175 CG1   
37 1 Y 1 A ILE 479 ? CG2   ? C ILE 175 CG2   
38 1 Y 1 A ILE 479 ? CD1   ? C ILE 175 CD1   
39 1 Y 1 A LYS 673 ? CG    ? C LYS 369 CG    
40 1 Y 1 A LYS 673 ? CD    ? C LYS 369 CD    
41 1 Y 1 A LYS 673 ? CE    ? C LYS 369 CE    
42 1 Y 1 A LYS 673 ? NZ    ? C LYS 369 NZ    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 305 ? C LYS 1   
2 1 Y 1 A ARG 306 ? C ARG 2   
3 1 Y 1 A GLN 744 ? C GLN 440 
4 1 Y 1 A LEU 745 ? C LEU 441 
5 1 Y 1 A LYS 746 ? C LYS 442 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6X70 'double helix'         
6X70 'a-form double helix'  
6X70 'b-form double helix'  
6X70 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 17 1_555 -0.235 -0.276 0.000  -10.529 -6.712  -4.073 1  P_DG1:DC17_T P 1  ? T 17 ? 19 1 
1 A DG 2  1_555 B DC 16 1_555 0.123  -0.348 -0.015 -3.271  -12.400 -0.322 2  P_DG2:DC16_T P 2  ? T 16 ? 19 1 
1 A DG 3  1_555 B DC 15 1_555 -0.715 -0.120 -0.033 -12.339 -15.228 10.300 3  P_DG3:DC15_T P 3  ? T 15 ? 19 1 
1 A DG 4  1_555 B DC 14 1_555 -0.478 -0.353 -0.402 -26.375 -14.473 1.876  4  P_DG4:DC14_T P 4  ? T 14 ? 19 1 
1 A DT 5  1_555 B DA 13 1_555 0.101  -0.012 -0.045 -12.106 -8.030  -0.297 5  P_DT5:DA13_T P 5  ? T 13 ? 20 1 
1 A DG 6  1_555 B DC 12 1_555 -0.512 -0.231 0.210  1.691   -7.898  -2.228 6  P_DG6:DC12_T P 6  ? T 12 ? 19 1 
1 A DT 7  1_555 B DA 11 1_555 -0.064 0.067  -0.401 0.187   -11.859 -0.629 7  P_DT7:DA11_T P 7  ? T 11 ? 20 1 
1 A DG 8  1_555 B DC 10 1_555 0.569  -0.112 -0.177 -5.795  -7.907  -0.950 8  P_DG8:DC10_T P 8  ? T 10 ? 19 1 
1 A DG 9  1_555 B DC 9  1_555 -0.375 -0.103 -0.344 -11.020 -6.303  2.099  9  P_DG9:DC9_T  P 9  ? T 9  ? 19 1 
1 A DT 10 1_555 B DA 8  1_555 -0.145 -0.045 0.079  0.826   -6.332  2.309  10 P_DT10:DA8_T P 10 ? T 8  ? 20 1 
1 A DA 11 1_555 B DT 7  1_555 0.319  -0.048 -0.175 16.155  -12.060 8.877  11 P_DA11:DT7_T P 11 ? T 7  ? 20 1 
1 A DG 12 1_555 B DC 6  1_555 -0.205 -0.095 0.084  23.064  -13.108 -4.524 12 P_DG12:DC6_T P 12 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 17 1_555 A DG 2  1_555 B DC 16 1_555 0.208  -1.493 3.265 2.004  2.247  29.178 -3.425 0.013  3.150 4.445  
-3.965  29.330 1  PP_DG1DG2:DC16DC17_TT P 1  ? T 17 ? P 2  ? T 16 ? 
1 A DG 2  1_555 B DC 16 1_555 A DG 3  1_555 B DC 15 1_555 0.995  -1.756 3.402 3.048  7.247  26.728 -5.365 -1.348 2.927 15.263 
-6.419  27.840 2  PP_DG2DG3:DC15DC16_TT P 2  ? T 16 ? P 3  ? T 15 ? 
1 A DG 3  1_555 B DC 15 1_555 A DG 4  1_555 B DC 14 1_555 -0.126 -1.447 3.651 4.883  5.480  34.341 -3.287 1.000  3.339 9.151  
-8.154  35.094 3  PP_DG3DG4:DC14DC15_TT P 3  ? T 15 ? P 4  ? T 14 ? 
1 A DG 4  1_555 B DC 14 1_555 A DT 5  1_555 B DA 13 1_555 -0.919 -0.586 2.955 0.182  11.976 29.626 -2.963 1.701  2.529 22.307 
-0.340  31.905 4  PP_DG4DT5:DA13DC14_TT P 4  ? T 14 ? P 5  ? T 13 ? 
1 A DT 5  1_555 B DA 13 1_555 A DG 6  1_555 B DC 12 1_555 -0.065 0.278  3.101 -5.226 3.660  33.899 -0.074 -0.664 3.089 6.209  
8.865   34.477 5  PP_DT5DG6:DC12DA13_TT P 5  ? T 13 ? P 6  ? T 12 ? 
1 A DG 6  1_555 B DC 12 1_555 A DT 7  1_555 B DA 11 1_555 0.008  -0.583 3.339 6.327  -2.445 33.694 -0.594 1.004  3.319 -4.165 
-10.779 34.350 6  PP_DG6DT7:DA11DC12_TT P 6  ? T 12 ? P 7  ? T 11 ? 
1 A DT 7  1_555 B DA 11 1_555 A DG 8  1_555 B DC 10 1_555 0.373  -0.427 3.564 -0.726 10.324 30.634 -2.726 -0.808 3.244 18.876 
1.328   32.295 7  PP_DT7DG8:DC10DA11_TT P 7  ? T 11 ? P 8  ? T 10 ? 
1 A DG 8  1_555 B DC 10 1_555 A DG 9  1_555 B DC 9  1_555 -0.510 -0.092 3.410 -2.793 1.688  34.321 -0.430 0.406  3.431 2.852  
4.720   34.471 8  PP_DG8DG9:DC9DC10_TT  P 8  ? T 10 ? P 9  ? T 9  ? 
1 A DG 9  1_555 B DC 9  1_555 A DT 10 1_555 B DA 8  1_555 -0.271 -0.517 3.109 -1.776 2.917  28.050 -1.701 0.166  3.052 5.991  
3.648   28.253 9  PP_DG9DT10:DA8DC9_TT  P 9  ? T 9  ? P 10 ? T 8  ? 
1 A DT 10 1_555 B DA 8  1_555 A DA 11 1_555 B DT 7  1_555 0.857  0.945  3.049 5.509  1.578  41.336 1.168  -0.650 3.165 2.223  
-7.759  41.714 10 PP_DT10DA11:DT7DA8_TT P 10 ? T 8  ? P 11 ? T 7  ? 
1 A DA 11 1_555 B DT 7  1_555 A DG 12 1_555 B DC 6  1_555 -0.203 0.575  3.155 -0.911 9.189  16.315 -3.189 0.133  3.041 29.503 
2.924   18.732 11 PP_DA11DG12:DC6DT7_TT P 11 ? T 7  ? P 12 ? T 6  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                ? 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
#