data_6XR4
# 
_entry.id   6XR4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6XR4         
WWPDB D_1000250514 
EMDB  EMD-20825    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-20825 'associated EM volume' 
EMDB . EMD-20826 'other EM volume'      
EMDB . EMD-20827 'other EM volume'      
EMDB . EMD-20828 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XR4 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Villa, E.'      1 0000-0003-4677-9809 
'Lasker, K.'     2 ?                   
'Audagnotto, M.' 3 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            182 
_citation.language                  ? 
_citation.page_first                1508 
_citation.page_last                 ? 
_citation.title                     
;The In Situ Structure of Parkinson's Disease-Linked LRRK2.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2020.08.004 
_citation.pdbx_database_id_PubMed   32783917 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Watanabe, R.'   1 ? 
primary 'Buschauer, R.'  2 ? 
primary 'Bohning, J.'    3 ? 
primary 'Audagnotto, M.' 4 ? 
primary 'Lasker, K.'     5 ? 
primary 'Lu, T.W.'       6 ? 
primary 'Boassa, D.'     7 ? 
primary 'Taylor, S.'     8 ? 
primary 'Villa, E.'      9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'Leucine-rich repeat serine/threonine-protein kinase 2' 
_entity.formula_weight             286450.719 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    2.7.11.1,3.6.5.- 
_entity.pdbx_mutation              I2020T 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Dardarin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQV
GWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIF
MLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLT
ETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHRE
VMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQ
KCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKD
VAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVAN
NSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPD
SSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHL
DLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKIS
GICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLE
LRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKS
DLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVG
QLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEP
KWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPE
SFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLL
VNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNV
LLFTLYPNAAIIAKIADYGTAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFP
NEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEK
MTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCG
TKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNT
EGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQV
GWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIF
MLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLT
ETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHRE
VMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQ
KCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKD
VAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVAN
NSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPD
SSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHL
DLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKIS
GICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLE
LRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKS
DLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVG
QLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEP
KWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPE
SFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLL
VNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNV
LLFTLYPNAAIIAKIADYGTAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFP
NEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEK
MTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCG
TKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNT
EGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    SER n 
1 4    GLY n 
1 5    SER n 
1 6    CYS n 
1 7    GLN n 
1 8    GLY n 
1 9    CYS n 
1 10   GLU n 
1 11   GLU n 
1 12   ASP n 
1 13   GLU n 
1 14   GLU n 
1 15   THR n 
1 16   LEU n 
1 17   LYS n 
1 18   LYS n 
1 19   LEU n 
1 20   ILE n 
1 21   VAL n 
1 22   ARG n 
1 23   LEU n 
1 24   ASN n 
1 25   ASN n 
1 26   VAL n 
1 27   GLN n 
1 28   GLU n 
1 29   GLY n 
1 30   LYS n 
1 31   GLN n 
1 32   ILE n 
1 33   GLU n 
1 34   THR n 
1 35   LEU n 
1 36   VAL n 
1 37   GLN n 
1 38   ILE n 
1 39   LEU n 
1 40   GLU n 
1 41   ASP n 
1 42   LEU n 
1 43   LEU n 
1 44   VAL n 
1 45   PHE n 
1 46   THR n 
1 47   TYR n 
1 48   SER n 
1 49   GLU n 
1 50   ARG n 
1 51   ALA n 
1 52   SER n 
1 53   LYS n 
1 54   LEU n 
1 55   PHE n 
1 56   GLN n 
1 57   GLY n 
1 58   LYS n 
1 59   ASN n 
1 60   ILE n 
1 61   HIS n 
1 62   VAL n 
1 63   PRO n 
1 64   LEU n 
1 65   LEU n 
1 66   ILE n 
1 67   VAL n 
1 68   LEU n 
1 69   ASP n 
1 70   SER n 
1 71   TYR n 
1 72   MET n 
1 73   ARG n 
1 74   VAL n 
1 75   ALA n 
1 76   SER n 
1 77   VAL n 
1 78   GLN n 
1 79   GLN n 
1 80   VAL n 
1 81   GLY n 
1 82   TRP n 
1 83   SER n 
1 84   LEU n 
1 85   LEU n 
1 86   CYS n 
1 87   LYS n 
1 88   LEU n 
1 89   ILE n 
1 90   GLU n 
1 91   VAL n 
1 92   CYS n 
1 93   PRO n 
1 94   GLY n 
1 95   THR n 
1 96   MET n 
1 97   GLN n 
1 98   SER n 
1 99   LEU n 
1 100  MET n 
1 101  GLY n 
1 102  PRO n 
1 103  GLN n 
1 104  ASP n 
1 105  VAL n 
1 106  GLY n 
1 107  ASN n 
1 108  ASP n 
1 109  TRP n 
1 110  GLU n 
1 111  VAL n 
1 112  LEU n 
1 113  GLY n 
1 114  VAL n 
1 115  HIS n 
1 116  GLN n 
1 117  LEU n 
1 118  ILE n 
1 119  LEU n 
1 120  LYS n 
1 121  MET n 
1 122  LEU n 
1 123  THR n 
1 124  VAL n 
1 125  HIS n 
1 126  ASN n 
1 127  ALA n 
1 128  SER n 
1 129  VAL n 
1 130  ASN n 
1 131  LEU n 
1 132  SER n 
1 133  VAL n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  LYS n 
1 138  THR n 
1 139  LEU n 
1 140  ASP n 
1 141  LEU n 
1 142  LEU n 
1 143  LEU n 
1 144  THR n 
1 145  SER n 
1 146  GLY n 
1 147  LYS n 
1 148  ILE n 
1 149  THR n 
1 150  LEU n 
1 151  LEU n 
1 152  ILE n 
1 153  LEU n 
1 154  ASP n 
1 155  GLU n 
1 156  GLU n 
1 157  SER n 
1 158  ASP n 
1 159  ILE n 
1 160  PHE n 
1 161  MET n 
1 162  LEU n 
1 163  ILE n 
1 164  PHE n 
1 165  ASP n 
1 166  ALA n 
1 167  MET n 
1 168  HIS n 
1 169  SER n 
1 170  PHE n 
1 171  PRO n 
1 172  ALA n 
1 173  ASN n 
1 174  ASP n 
1 175  GLU n 
1 176  VAL n 
1 177  GLN n 
1 178  LYS n 
1 179  LEU n 
1 180  GLY n 
1 181  CYS n 
1 182  LYS n 
1 183  ALA n 
1 184  LEU n 
1 185  HIS n 
1 186  VAL n 
1 187  LEU n 
1 188  PHE n 
1 189  GLU n 
1 190  ARG n 
1 191  VAL n 
1 192  SER n 
1 193  GLU n 
1 194  GLU n 
1 195  GLN n 
1 196  LEU n 
1 197  THR n 
1 198  GLU n 
1 199  PHE n 
1 200  VAL n 
1 201  GLU n 
1 202  ASN n 
1 203  LYS n 
1 204  ASP n 
1 205  TYR n 
1 206  MET n 
1 207  ILE n 
1 208  LEU n 
1 209  LEU n 
1 210  SER n 
1 211  ALA n 
1 212  LEU n 
1 213  THR n 
1 214  ASN n 
1 215  PHE n 
1 216  LYS n 
1 217  ASP n 
1 218  GLU n 
1 219  GLU n 
1 220  GLU n 
1 221  ILE n 
1 222  VAL n 
1 223  LEU n 
1 224  HIS n 
1 225  VAL n 
1 226  LEU n 
1 227  HIS n 
1 228  CYS n 
1 229  LEU n 
1 230  HIS n 
1 231  SER n 
1 232  LEU n 
1 233  ALA n 
1 234  ILE n 
1 235  PRO n 
1 236  CYS n 
1 237  ASN n 
1 238  ASN n 
1 239  VAL n 
1 240  GLU n 
1 241  VAL n 
1 242  LEU n 
1 243  MET n 
1 244  SER n 
1 245  GLY n 
1 246  ASN n 
1 247  VAL n 
1 248  ARG n 
1 249  CYS n 
1 250  TYR n 
1 251  ASN n 
1 252  ILE n 
1 253  VAL n 
1 254  VAL n 
1 255  GLU n 
1 256  ALA n 
1 257  MET n 
1 258  LYS n 
1 259  ALA n 
1 260  PHE n 
1 261  PRO n 
1 262  MET n 
1 263  SER n 
1 264  GLU n 
1 265  ARG n 
1 266  ILE n 
1 267  GLN n 
1 268  GLU n 
1 269  VAL n 
1 270  SER n 
1 271  CYS n 
1 272  CYS n 
1 273  LEU n 
1 274  LEU n 
1 275  HIS n 
1 276  ARG n 
1 277  LEU n 
1 278  THR n 
1 279  LEU n 
1 280  GLY n 
1 281  ASN n 
1 282  PHE n 
1 283  PHE n 
1 284  ASN n 
1 285  ILE n 
1 286  LEU n 
1 287  VAL n 
1 288  LEU n 
1 289  ASN n 
1 290  GLU n 
1 291  VAL n 
1 292  HIS n 
1 293  GLU n 
1 294  PHE n 
1 295  VAL n 
1 296  VAL n 
1 297  LYS n 
1 298  ALA n 
1 299  VAL n 
1 300  GLN n 
1 301  GLN n 
1 302  TYR n 
1 303  PRO n 
1 304  GLU n 
1 305  ASN n 
1 306  ALA n 
1 307  ALA n 
1 308  LEU n 
1 309  GLN n 
1 310  ILE n 
1 311  SER n 
1 312  ALA n 
1 313  LEU n 
1 314  SER n 
1 315  CYS n 
1 316  LEU n 
1 317  ALA n 
1 318  LEU n 
1 319  LEU n 
1 320  THR n 
1 321  GLU n 
1 322  THR n 
1 323  ILE n 
1 324  PHE n 
1 325  LEU n 
1 326  ASN n 
1 327  GLN n 
1 328  ASP n 
1 329  LEU n 
1 330  GLU n 
1 331  GLU n 
1 332  LYS n 
1 333  ASN n 
1 334  GLU n 
1 335  ASN n 
1 336  GLN n 
1 337  GLU n 
1 338  ASN n 
1 339  ASP n 
1 340  ASP n 
1 341  GLU n 
1 342  GLY n 
1 343  GLU n 
1 344  GLU n 
1 345  ASP n 
1 346  LYS n 
1 347  LEU n 
1 348  PHE n 
1 349  TRP n 
1 350  LEU n 
1 351  GLU n 
1 352  ALA n 
1 353  CYS n 
1 354  TYR n 
1 355  LYS n 
1 356  ALA n 
1 357  LEU n 
1 358  THR n 
1 359  TRP n 
1 360  HIS n 
1 361  ARG n 
1 362  LYS n 
1 363  ASN n 
1 364  LYS n 
1 365  HIS n 
1 366  VAL n 
1 367  GLN n 
1 368  GLU n 
1 369  ALA n 
1 370  ALA n 
1 371  CYS n 
1 372  TRP n 
1 373  ALA n 
1 374  LEU n 
1 375  ASN n 
1 376  ASN n 
1 377  LEU n 
1 378  LEU n 
1 379  MET n 
1 380  TYR n 
1 381  GLN n 
1 382  ASN n 
1 383  SER n 
1 384  LEU n 
1 385  HIS n 
1 386  GLU n 
1 387  LYS n 
1 388  ILE n 
1 389  GLY n 
1 390  ASP n 
1 391  GLU n 
1 392  ASP n 
1 393  GLY n 
1 394  HIS n 
1 395  PHE n 
1 396  PRO n 
1 397  ALA n 
1 398  HIS n 
1 399  ARG n 
1 400  GLU n 
1 401  VAL n 
1 402  MET n 
1 403  LEU n 
1 404  SER n 
1 405  MET n 
1 406  LEU n 
1 407  MET n 
1 408  HIS n 
1 409  SER n 
1 410  SER n 
1 411  SER n 
1 412  LYS n 
1 413  GLU n 
1 414  VAL n 
1 415  PHE n 
1 416  GLN n 
1 417  ALA n 
1 418  SER n 
1 419  ALA n 
1 420  ASN n 
1 421  ALA n 
1 422  LEU n 
1 423  SER n 
1 424  THR n 
1 425  LEU n 
1 426  LEU n 
1 427  GLU n 
1 428  GLN n 
1 429  ASN n 
1 430  VAL n 
1 431  ASN n 
1 432  PHE n 
1 433  ARG n 
1 434  LYS n 
1 435  ILE n 
1 436  LEU n 
1 437  LEU n 
1 438  SER n 
1 439  LYS n 
1 440  GLY n 
1 441  ILE n 
1 442  HIS n 
1 443  LEU n 
1 444  ASN n 
1 445  VAL n 
1 446  LEU n 
1 447  GLU n 
1 448  LEU n 
1 449  MET n 
1 450  GLN n 
1 451  LYS n 
1 452  HIS n 
1 453  ILE n 
1 454  HIS n 
1 455  SER n 
1 456  PRO n 
1 457  GLU n 
1 458  VAL n 
1 459  ALA n 
1 460  GLU n 
1 461  SER n 
1 462  GLY n 
1 463  CYS n 
1 464  LYS n 
1 465  MET n 
1 466  LEU n 
1 467  ASN n 
1 468  HIS n 
1 469  LEU n 
1 470  PHE n 
1 471  GLU n 
1 472  GLY n 
1 473  SER n 
1 474  ASN n 
1 475  THR n 
1 476  SER n 
1 477  LEU n 
1 478  ASP n 
1 479  ILE n 
1 480  MET n 
1 481  ALA n 
1 482  ALA n 
1 483  VAL n 
1 484  VAL n 
1 485  PRO n 
1 486  LYS n 
1 487  ILE n 
1 488  LEU n 
1 489  THR n 
1 490  VAL n 
1 491  MET n 
1 492  LYS n 
1 493  ARG n 
1 494  HIS n 
1 495  GLU n 
1 496  THR n 
1 497  SER n 
1 498  LEU n 
1 499  PRO n 
1 500  VAL n 
1 501  GLN n 
1 502  LEU n 
1 503  GLU n 
1 504  ALA n 
1 505  LEU n 
1 506  ARG n 
1 507  ALA n 
1 508  ILE n 
1 509  LEU n 
1 510  HIS n 
1 511  PHE n 
1 512  ILE n 
1 513  VAL n 
1 514  PRO n 
1 515  GLY n 
1 516  MET n 
1 517  PRO n 
1 518  GLU n 
1 519  GLU n 
1 520  SER n 
1 521  ARG n 
1 522  GLU n 
1 523  ASP n 
1 524  THR n 
1 525  GLU n 
1 526  PHE n 
1 527  HIS n 
1 528  HIS n 
1 529  LYS n 
1 530  LEU n 
1 531  ASN n 
1 532  MET n 
1 533  VAL n 
1 534  LYS n 
1 535  LYS n 
1 536  GLN n 
1 537  CYS n 
1 538  PHE n 
1 539  LYS n 
1 540  ASN n 
1 541  ASP n 
1 542  ILE n 
1 543  HIS n 
1 544  LYS n 
1 545  LEU n 
1 546  VAL n 
1 547  LEU n 
1 548  ALA n 
1 549  ALA n 
1 550  LEU n 
1 551  ASN n 
1 552  ARG n 
1 553  PHE n 
1 554  ILE n 
1 555  GLY n 
1 556  ASN n 
1 557  PRO n 
1 558  GLY n 
1 559  ILE n 
1 560  GLN n 
1 561  LYS n 
1 562  CYS n 
1 563  GLY n 
1 564  LEU n 
1 565  LYS n 
1 566  VAL n 
1 567  ILE n 
1 568  SER n 
1 569  SER n 
1 570  ILE n 
1 571  VAL n 
1 572  HIS n 
1 573  PHE n 
1 574  PRO n 
1 575  ASP n 
1 576  ALA n 
1 577  LEU n 
1 578  GLU n 
1 579  MET n 
1 580  LEU n 
1 581  SER n 
1 582  LEU n 
1 583  GLU n 
1 584  GLY n 
1 585  ALA n 
1 586  MET n 
1 587  ASP n 
1 588  SER n 
1 589  VAL n 
1 590  LEU n 
1 591  HIS n 
1 592  THR n 
1 593  LEU n 
1 594  GLN n 
1 595  MET n 
1 596  TYR n 
1 597  PRO n 
1 598  ASP n 
1 599  ASP n 
1 600  GLN n 
1 601  GLU n 
1 602  ILE n 
1 603  GLN n 
1 604  CYS n 
1 605  LEU n 
1 606  GLY n 
1 607  LEU n 
1 608  SER n 
1 609  LEU n 
1 610  ILE n 
1 611  GLY n 
1 612  TYR n 
1 613  LEU n 
1 614  ILE n 
1 615  THR n 
1 616  LYS n 
1 617  LYS n 
1 618  ASN n 
1 619  VAL n 
1 620  PHE n 
1 621  ILE n 
1 622  GLY n 
1 623  THR n 
1 624  GLY n 
1 625  HIS n 
1 626  LEU n 
1 627  LEU n 
1 628  ALA n 
1 629  LYS n 
1 630  ILE n 
1 631  LEU n 
1 632  VAL n 
1 633  SER n 
1 634  SER n 
1 635  LEU n 
1 636  TYR n 
1 637  ARG n 
1 638  PHE n 
1 639  LYS n 
1 640  ASP n 
1 641  VAL n 
1 642  ALA n 
1 643  GLU n 
1 644  ILE n 
1 645  GLN n 
1 646  THR n 
1 647  LYS n 
1 648  GLY n 
1 649  PHE n 
1 650  GLN n 
1 651  THR n 
1 652  ILE n 
1 653  LEU n 
1 654  ALA n 
1 655  ILE n 
1 656  LEU n 
1 657  LYS n 
1 658  LEU n 
1 659  SER n 
1 660  ALA n 
1 661  SER n 
1 662  PHE n 
1 663  SER n 
1 664  LYS n 
1 665  LEU n 
1 666  LEU n 
1 667  VAL n 
1 668  HIS n 
1 669  HIS n 
1 670  SER n 
1 671  PHE n 
1 672  ASP n 
1 673  LEU n 
1 674  VAL n 
1 675  ILE n 
1 676  PHE n 
1 677  HIS n 
1 678  GLN n 
1 679  MET n 
1 680  SER n 
1 681  SER n 
1 682  ASN n 
1 683  ILE n 
1 684  MET n 
1 685  GLU n 
1 686  GLN n 
1 687  LYS n 
1 688  ASP n 
1 689  GLN n 
1 690  GLN n 
1 691  PHE n 
1 692  LEU n 
1 693  ASN n 
1 694  LEU n 
1 695  CYS n 
1 696  CYS n 
1 697  LYS n 
1 698  CYS n 
1 699  PHE n 
1 700  ALA n 
1 701  LYS n 
1 702  VAL n 
1 703  ALA n 
1 704  MET n 
1 705  ASP n 
1 706  ASP n 
1 707  TYR n 
1 708  LEU n 
1 709  LYS n 
1 710  ASN n 
1 711  VAL n 
1 712  MET n 
1 713  LEU n 
1 714  GLU n 
1 715  ARG n 
1 716  ALA n 
1 717  CYS n 
1 718  ASP n 
1 719  GLN n 
1 720  ASN n 
1 721  ASN n 
1 722  SER n 
1 723  ILE n 
1 724  MET n 
1 725  VAL n 
1 726  GLU n 
1 727  CYS n 
1 728  LEU n 
1 729  LEU n 
1 730  LEU n 
1 731  LEU n 
1 732  GLY n 
1 733  ALA n 
1 734  ASP n 
1 735  ALA n 
1 736  ASN n 
1 737  GLN n 
1 738  ALA n 
1 739  LYS n 
1 740  GLU n 
1 741  GLY n 
1 742  SER n 
1 743  SER n 
1 744  LEU n 
1 745  ILE n 
1 746  CYS n 
1 747  GLN n 
1 748  VAL n 
1 749  CYS n 
1 750  GLU n 
1 751  LYS n 
1 752  GLU n 
1 753  SER n 
1 754  SER n 
1 755  PRO n 
1 756  LYS n 
1 757  LEU n 
1 758  VAL n 
1 759  GLU n 
1 760  LEU n 
1 761  LEU n 
1 762  LEU n 
1 763  ASN n 
1 764  SER n 
1 765  GLY n 
1 766  SER n 
1 767  ARG n 
1 768  GLU n 
1 769  GLN n 
1 770  ASP n 
1 771  VAL n 
1 772  ARG n 
1 773  LYS n 
1 774  ALA n 
1 775  LEU n 
1 776  THR n 
1 777  ILE n 
1 778  SER n 
1 779  ILE n 
1 780  GLY n 
1 781  LYS n 
1 782  GLY n 
1 783  ASP n 
1 784  SER n 
1 785  GLN n 
1 786  ILE n 
1 787  ILE n 
1 788  SER n 
1 789  LEU n 
1 790  LEU n 
1 791  LEU n 
1 792  ARG n 
1 793  ARG n 
1 794  LEU n 
1 795  ALA n 
1 796  LEU n 
1 797  ASP n 
1 798  VAL n 
1 799  ALA n 
1 800  ASN n 
1 801  ASN n 
1 802  SER n 
1 803  ILE n 
1 804  CYS n 
1 805  LEU n 
1 806  GLY n 
1 807  GLY n 
1 808  PHE n 
1 809  CYS n 
1 810  ILE n 
1 811  GLY n 
1 812  LYS n 
1 813  VAL n 
1 814  GLU n 
1 815  PRO n 
1 816  SER n 
1 817  TRP n 
1 818  LEU n 
1 819  GLY n 
1 820  PRO n 
1 821  LEU n 
1 822  PHE n 
1 823  PRO n 
1 824  ASP n 
1 825  LYS n 
1 826  THR n 
1 827  SER n 
1 828  ASN n 
1 829  LEU n 
1 830  ARG n 
1 831  LYS n 
1 832  GLN n 
1 833  THR n 
1 834  ASN n 
1 835  ILE n 
1 836  ALA n 
1 837  SER n 
1 838  THR n 
1 839  LEU n 
1 840  ALA n 
1 841  ARG n 
1 842  MET n 
1 843  VAL n 
1 844  ILE n 
1 845  ARG n 
1 846  TYR n 
1 847  GLN n 
1 848  MET n 
1 849  LYS n 
1 850  SER n 
1 851  ALA n 
1 852  VAL n 
1 853  GLU n 
1 854  GLU n 
1 855  GLY n 
1 856  THR n 
1 857  ALA n 
1 858  SER n 
1 859  GLY n 
1 860  SER n 
1 861  ASP n 
1 862  GLY n 
1 863  ASN n 
1 864  PHE n 
1 865  SER n 
1 866  GLU n 
1 867  ASP n 
1 868  VAL n 
1 869  LEU n 
1 870  SER n 
1 871  LYS n 
1 872  PHE n 
1 873  ASP n 
1 874  GLU n 
1 875  TRP n 
1 876  THR n 
1 877  PHE n 
1 878  ILE n 
1 879  PRO n 
1 880  ASP n 
1 881  SER n 
1 882  SER n 
1 883  MET n 
1 884  ASP n 
1 885  SER n 
1 886  VAL n 
1 887  PHE n 
1 888  ALA n 
1 889  GLN n 
1 890  SER n 
1 891  ASP n 
1 892  ASP n 
1 893  LEU n 
1 894  ASP n 
1 895  SER n 
1 896  GLU n 
1 897  GLY n 
1 898  SER n 
1 899  GLU n 
1 900  GLY n 
1 901  SER n 
1 902  PHE n 
1 903  LEU n 
1 904  VAL n 
1 905  LYS n 
1 906  LYS n 
1 907  LYS n 
1 908  SER n 
1 909  ASN n 
1 910  SER n 
1 911  ILE n 
1 912  SER n 
1 913  VAL n 
1 914  GLY n 
1 915  GLU n 
1 916  PHE n 
1 917  TYR n 
1 918  ARG n 
1 919  ASP n 
1 920  ALA n 
1 921  VAL n 
1 922  LEU n 
1 923  GLN n 
1 924  ARG n 
1 925  CYS n 
1 926  SER n 
1 927  PRO n 
1 928  ASN n 
1 929  LEU n 
1 930  GLN n 
1 931  ARG n 
1 932  HIS n 
1 933  SER n 
1 934  ASN n 
1 935  SER n 
1 936  LEU n 
1 937  GLY n 
1 938  PRO n 
1 939  ILE n 
1 940  PHE n 
1 941  ASP n 
1 942  HIS n 
1 943  GLU n 
1 944  ASP n 
1 945  LEU n 
1 946  LEU n 
1 947  LYS n 
1 948  ARG n 
1 949  LYS n 
1 950  ARG n 
1 951  LYS n 
1 952  ILE n 
1 953  LEU n 
1 954  SER n 
1 955  SER n 
1 956  ASP n 
1 957  ASP n 
1 958  SER n 
1 959  LEU n 
1 960  ARG n 
1 961  SER n 
1 962  SER n 
1 963  LYS n 
1 964  LEU n 
1 965  GLN n 
1 966  SER n 
1 967  HIS n 
1 968  MET n 
1 969  ARG n 
1 970  HIS n 
1 971  SER n 
1 972  ASP n 
1 973  SER n 
1 974  ILE n 
1 975  SER n 
1 976  SER n 
1 977  LEU n 
1 978  ALA n 
1 979  SER n 
1 980  GLU n 
1 981  ARG n 
1 982  GLU n 
1 983  TYR n 
1 984  ILE n 
1 985  THR n 
1 986  SER n 
1 987  LEU n 
1 988  ASP n 
1 989  LEU n 
1 990  SER n 
1 991  ALA n 
1 992  ASN n 
1 993  GLU n 
1 994  LEU n 
1 995  ARG n 
1 996  ASP n 
1 997  ILE n 
1 998  ASP n 
1 999  ALA n 
1 1000 LEU n 
1 1001 SER n 
1 1002 GLN n 
1 1003 LYS n 
1 1004 CYS n 
1 1005 CYS n 
1 1006 ILE n 
1 1007 SER n 
1 1008 VAL n 
1 1009 HIS n 
1 1010 LEU n 
1 1011 GLU n 
1 1012 HIS n 
1 1013 LEU n 
1 1014 GLU n 
1 1015 LYS n 
1 1016 LEU n 
1 1017 GLU n 
1 1018 LEU n 
1 1019 HIS n 
1 1020 GLN n 
1 1021 ASN n 
1 1022 ALA n 
1 1023 LEU n 
1 1024 THR n 
1 1025 SER n 
1 1026 PHE n 
1 1027 PRO n 
1 1028 GLN n 
1 1029 GLN n 
1 1030 LEU n 
1 1031 CYS n 
1 1032 GLU n 
1 1033 THR n 
1 1034 LEU n 
1 1035 LYS n 
1 1036 SER n 
1 1037 LEU n 
1 1038 THR n 
1 1039 HIS n 
1 1040 LEU n 
1 1041 ASP n 
1 1042 LEU n 
1 1043 HIS n 
1 1044 SER n 
1 1045 ASN n 
1 1046 LYS n 
1 1047 PHE n 
1 1048 THR n 
1 1049 SER n 
1 1050 PHE n 
1 1051 PRO n 
1 1052 SER n 
1 1053 TYR n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 LYS n 
1 1057 MET n 
1 1058 SER n 
1 1059 CYS n 
1 1060 ILE n 
1 1061 ALA n 
1 1062 ASN n 
1 1063 LEU n 
1 1064 ASP n 
1 1065 VAL n 
1 1066 SER n 
1 1067 ARG n 
1 1068 ASN n 
1 1069 ASP n 
1 1070 ILE n 
1 1071 GLY n 
1 1072 PRO n 
1 1073 SER n 
1 1074 VAL n 
1 1075 VAL n 
1 1076 LEU n 
1 1077 ASP n 
1 1078 PRO n 
1 1079 THR n 
1 1080 VAL n 
1 1081 LYS n 
1 1082 CYS n 
1 1083 PRO n 
1 1084 THR n 
1 1085 LEU n 
1 1086 LYS n 
1 1087 GLN n 
1 1088 PHE n 
1 1089 ASN n 
1 1090 LEU n 
1 1091 SER n 
1 1092 TYR n 
1 1093 ASN n 
1 1094 GLN n 
1 1095 LEU n 
1 1096 SER n 
1 1097 PHE n 
1 1098 VAL n 
1 1099 PRO n 
1 1100 GLU n 
1 1101 ASN n 
1 1102 LEU n 
1 1103 THR n 
1 1104 ASP n 
1 1105 VAL n 
1 1106 VAL n 
1 1107 GLU n 
1 1108 LYS n 
1 1109 LEU n 
1 1110 GLU n 
1 1111 GLN n 
1 1112 LEU n 
1 1113 ILE n 
1 1114 LEU n 
1 1115 GLU n 
1 1116 GLY n 
1 1117 ASN n 
1 1118 LYS n 
1 1119 ILE n 
1 1120 SER n 
1 1121 GLY n 
1 1122 ILE n 
1 1123 CYS n 
1 1124 SER n 
1 1125 PRO n 
1 1126 LEU n 
1 1127 ARG n 
1 1128 LEU n 
1 1129 LYS n 
1 1130 GLU n 
1 1131 LEU n 
1 1132 LYS n 
1 1133 ILE n 
1 1134 LEU n 
1 1135 ASN n 
1 1136 LEU n 
1 1137 SER n 
1 1138 LYS n 
1 1139 ASN n 
1 1140 HIS n 
1 1141 ILE n 
1 1142 SER n 
1 1143 SER n 
1 1144 LEU n 
1 1145 SER n 
1 1146 GLU n 
1 1147 ASN n 
1 1148 PHE n 
1 1149 LEU n 
1 1150 GLU n 
1 1151 ALA n 
1 1152 CYS n 
1 1153 PRO n 
1 1154 LYS n 
1 1155 VAL n 
1 1156 GLU n 
1 1157 SER n 
1 1158 PHE n 
1 1159 SER n 
1 1160 ALA n 
1 1161 ARG n 
1 1162 MET n 
1 1163 ASN n 
1 1164 PHE n 
1 1165 LEU n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 MET n 
1 1169 PRO n 
1 1170 PHE n 
1 1171 LEU n 
1 1172 PRO n 
1 1173 PRO n 
1 1174 SER n 
1 1175 MET n 
1 1176 THR n 
1 1177 ILE n 
1 1178 LEU n 
1 1179 LYS n 
1 1180 LEU n 
1 1181 SER n 
1 1182 GLN n 
1 1183 ASN n 
1 1184 LYS n 
1 1185 PHE n 
1 1186 SER n 
1 1187 CYS n 
1 1188 ILE n 
1 1189 PRO n 
1 1190 GLU n 
1 1191 ALA n 
1 1192 ILE n 
1 1193 LEU n 
1 1194 ASN n 
1 1195 LEU n 
1 1196 PRO n 
1 1197 HIS n 
1 1198 LEU n 
1 1199 ARG n 
1 1200 SER n 
1 1201 LEU n 
1 1202 ASP n 
1 1203 MET n 
1 1204 SER n 
1 1205 SER n 
1 1206 ASN n 
1 1207 ASP n 
1 1208 ILE n 
1 1209 GLN n 
1 1210 TYR n 
1 1211 LEU n 
1 1212 PRO n 
1 1213 GLY n 
1 1214 PRO n 
1 1215 ALA n 
1 1216 HIS n 
1 1217 TRP n 
1 1218 LYS n 
1 1219 SER n 
1 1220 LEU n 
1 1221 ASN n 
1 1222 LEU n 
1 1223 ARG n 
1 1224 GLU n 
1 1225 LEU n 
1 1226 LEU n 
1 1227 PHE n 
1 1228 SER n 
1 1229 HIS n 
1 1230 ASN n 
1 1231 GLN n 
1 1232 ILE n 
1 1233 SER n 
1 1234 ILE n 
1 1235 LEU n 
1 1236 ASP n 
1 1237 LEU n 
1 1238 SER n 
1 1239 GLU n 
1 1240 LYS n 
1 1241 ALA n 
1 1242 TYR n 
1 1243 LEU n 
1 1244 TRP n 
1 1245 SER n 
1 1246 ARG n 
1 1247 VAL n 
1 1248 GLU n 
1 1249 LYS n 
1 1250 LEU n 
1 1251 HIS n 
1 1252 LEU n 
1 1253 SER n 
1 1254 HIS n 
1 1255 ASN n 
1 1256 LYS n 
1 1257 LEU n 
1 1258 LYS n 
1 1259 GLU n 
1 1260 ILE n 
1 1261 PRO n 
1 1262 PRO n 
1 1263 GLU n 
1 1264 ILE n 
1 1265 GLY n 
1 1266 CYS n 
1 1267 LEU n 
1 1268 GLU n 
1 1269 ASN n 
1 1270 LEU n 
1 1271 THR n 
1 1272 SER n 
1 1273 LEU n 
1 1274 ASP n 
1 1275 VAL n 
1 1276 SER n 
1 1277 TYR n 
1 1278 ASN n 
1 1279 LEU n 
1 1280 GLU n 
1 1281 LEU n 
1 1282 ARG n 
1 1283 SER n 
1 1284 PHE n 
1 1285 PRO n 
1 1286 ASN n 
1 1287 GLU n 
1 1288 MET n 
1 1289 GLY n 
1 1290 LYS n 
1 1291 LEU n 
1 1292 SER n 
1 1293 LYS n 
1 1294 ILE n 
1 1295 TRP n 
1 1296 ASP n 
1 1297 LEU n 
1 1298 PRO n 
1 1299 LEU n 
1 1300 ASP n 
1 1301 GLU n 
1 1302 LEU n 
1 1303 HIS n 
1 1304 LEU n 
1 1305 ASN n 
1 1306 PHE n 
1 1307 ASP n 
1 1308 PHE n 
1 1309 LYS n 
1 1310 HIS n 
1 1311 ILE n 
1 1312 GLY n 
1 1313 CYS n 
1 1314 LYS n 
1 1315 ALA n 
1 1316 LYS n 
1 1317 ASP n 
1 1318 ILE n 
1 1319 ILE n 
1 1320 ARG n 
1 1321 PHE n 
1 1322 LEU n 
1 1323 GLN n 
1 1324 GLN n 
1 1325 ARG n 
1 1326 LEU n 
1 1327 LYS n 
1 1328 LYS n 
1 1329 ALA n 
1 1330 VAL n 
1 1331 PRO n 
1 1332 TYR n 
1 1333 ASN n 
1 1334 ARG n 
1 1335 MET n 
1 1336 LYS n 
1 1337 LEU n 
1 1338 MET n 
1 1339 ILE n 
1 1340 VAL n 
1 1341 GLY n 
1 1342 ASN n 
1 1343 THR n 
1 1344 GLY n 
1 1345 SER n 
1 1346 GLY n 
1 1347 LYS n 
1 1348 THR n 
1 1349 THR n 
1 1350 LEU n 
1 1351 LEU n 
1 1352 GLN n 
1 1353 GLN n 
1 1354 LEU n 
1 1355 MET n 
1 1356 LYS n 
1 1357 THR n 
1 1358 LYS n 
1 1359 LYS n 
1 1360 SER n 
1 1361 ASP n 
1 1362 LEU n 
1 1363 GLY n 
1 1364 MET n 
1 1365 GLN n 
1 1366 SER n 
1 1367 ALA n 
1 1368 THR n 
1 1369 VAL n 
1 1370 GLY n 
1 1371 ILE n 
1 1372 ASP n 
1 1373 VAL n 
1 1374 LYS n 
1 1375 ASP n 
1 1376 TRP n 
1 1377 PRO n 
1 1378 ILE n 
1 1379 GLN n 
1 1380 ILE n 
1 1381 ARG n 
1 1382 ASP n 
1 1383 LYS n 
1 1384 ARG n 
1 1385 LYS n 
1 1386 ARG n 
1 1387 ASP n 
1 1388 LEU n 
1 1389 VAL n 
1 1390 LEU n 
1 1391 ASN n 
1 1392 VAL n 
1 1393 TRP n 
1 1394 ASP n 
1 1395 PHE n 
1 1396 ALA n 
1 1397 GLY n 
1 1398 ARG n 
1 1399 GLU n 
1 1400 GLU n 
1 1401 PHE n 
1 1402 TYR n 
1 1403 SER n 
1 1404 THR n 
1 1405 HIS n 
1 1406 PRO n 
1 1407 HIS n 
1 1408 PHE n 
1 1409 MET n 
1 1410 THR n 
1 1411 GLN n 
1 1412 ARG n 
1 1413 ALA n 
1 1414 LEU n 
1 1415 TYR n 
1 1416 LEU n 
1 1417 ALA n 
1 1418 VAL n 
1 1419 TYR n 
1 1420 ASP n 
1 1421 LEU n 
1 1422 SER n 
1 1423 LYS n 
1 1424 GLY n 
1 1425 GLN n 
1 1426 ALA n 
1 1427 GLU n 
1 1428 VAL n 
1 1429 ASP n 
1 1430 ALA n 
1 1431 MET n 
1 1432 LYS n 
1 1433 PRO n 
1 1434 TRP n 
1 1435 LEU n 
1 1436 PHE n 
1 1437 ASN n 
1 1438 ILE n 
1 1439 LYS n 
1 1440 ALA n 
1 1441 ARG n 
1 1442 ALA n 
1 1443 SER n 
1 1444 SER n 
1 1445 SER n 
1 1446 PRO n 
1 1447 VAL n 
1 1448 ILE n 
1 1449 LEU n 
1 1450 VAL n 
1 1451 GLY n 
1 1452 THR n 
1 1453 HIS n 
1 1454 LEU n 
1 1455 ASP n 
1 1456 VAL n 
1 1457 SER n 
1 1458 ASP n 
1 1459 GLU n 
1 1460 LYS n 
1 1461 GLN n 
1 1462 ARG n 
1 1463 LYS n 
1 1464 ALA n 
1 1465 CYS n 
1 1466 MET n 
1 1467 SER n 
1 1468 LYS n 
1 1469 ILE n 
1 1470 THR n 
1 1471 LYS n 
1 1472 GLU n 
1 1473 LEU n 
1 1474 LEU n 
1 1475 ASN n 
1 1476 LYS n 
1 1477 ARG n 
1 1478 GLY n 
1 1479 PHE n 
1 1480 PRO n 
1 1481 ALA n 
1 1482 ILE n 
1 1483 ARG n 
1 1484 ASP n 
1 1485 TYR n 
1 1486 HIS n 
1 1487 PHE n 
1 1488 VAL n 
1 1489 ASN n 
1 1490 ALA n 
1 1491 THR n 
1 1492 GLU n 
1 1493 GLU n 
1 1494 SER n 
1 1495 ASP n 
1 1496 ALA n 
1 1497 LEU n 
1 1498 ALA n 
1 1499 LYS n 
1 1500 LEU n 
1 1501 ARG n 
1 1502 LYS n 
1 1503 THR n 
1 1504 ILE n 
1 1505 ILE n 
1 1506 ASN n 
1 1507 GLU n 
1 1508 SER n 
1 1509 LEU n 
1 1510 ASN n 
1 1511 PHE n 
1 1512 LYS n 
1 1513 ILE n 
1 1514 ARG n 
1 1515 ASP n 
1 1516 GLN n 
1 1517 LEU n 
1 1518 VAL n 
1 1519 VAL n 
1 1520 GLY n 
1 1521 GLN n 
1 1522 LEU n 
1 1523 ILE n 
1 1524 PRO n 
1 1525 ASP n 
1 1526 CYS n 
1 1527 TYR n 
1 1528 VAL n 
1 1529 GLU n 
1 1530 LEU n 
1 1531 GLU n 
1 1532 LYS n 
1 1533 ILE n 
1 1534 ILE n 
1 1535 LEU n 
1 1536 SER n 
1 1537 GLU n 
1 1538 ARG n 
1 1539 LYS n 
1 1540 ASN n 
1 1541 VAL n 
1 1542 PRO n 
1 1543 ILE n 
1 1544 GLU n 
1 1545 PHE n 
1 1546 PRO n 
1 1547 VAL n 
1 1548 ILE n 
1 1549 ASP n 
1 1550 ARG n 
1 1551 LYS n 
1 1552 ARG n 
1 1553 LEU n 
1 1554 LEU n 
1 1555 GLN n 
1 1556 LEU n 
1 1557 VAL n 
1 1558 ARG n 
1 1559 GLU n 
1 1560 ASN n 
1 1561 GLN n 
1 1562 LEU n 
1 1563 GLN n 
1 1564 LEU n 
1 1565 ASP n 
1 1566 GLU n 
1 1567 ASN n 
1 1568 GLU n 
1 1569 LEU n 
1 1570 PRO n 
1 1571 HIS n 
1 1572 ALA n 
1 1573 VAL n 
1 1574 HIS n 
1 1575 PHE n 
1 1576 LEU n 
1 1577 ASN n 
1 1578 GLU n 
1 1579 SER n 
1 1580 GLY n 
1 1581 VAL n 
1 1582 LEU n 
1 1583 LEU n 
1 1584 HIS n 
1 1585 PHE n 
1 1586 GLN n 
1 1587 ASP n 
1 1588 PRO n 
1 1589 ALA n 
1 1590 LEU n 
1 1591 GLN n 
1 1592 LEU n 
1 1593 SER n 
1 1594 ASP n 
1 1595 LEU n 
1 1596 TYR n 
1 1597 PHE n 
1 1598 VAL n 
1 1599 GLU n 
1 1600 PRO n 
1 1601 LYS n 
1 1602 TRP n 
1 1603 LEU n 
1 1604 CYS n 
1 1605 LYS n 
1 1606 ILE n 
1 1607 MET n 
1 1608 ALA n 
1 1609 GLN n 
1 1610 ILE n 
1 1611 LEU n 
1 1612 THR n 
1 1613 VAL n 
1 1614 LYS n 
1 1615 VAL n 
1 1616 GLU n 
1 1617 GLY n 
1 1618 CYS n 
1 1619 PRO n 
1 1620 LYS n 
1 1621 HIS n 
1 1622 PRO n 
1 1623 LYS n 
1 1624 GLY n 
1 1625 ILE n 
1 1626 ILE n 
1 1627 SER n 
1 1628 ARG n 
1 1629 ARG n 
1 1630 ASP n 
1 1631 VAL n 
1 1632 GLU n 
1 1633 LYS n 
1 1634 PHE n 
1 1635 LEU n 
1 1636 SER n 
1 1637 LYS n 
1 1638 LYS n 
1 1639 ARG n 
1 1640 LYS n 
1 1641 PHE n 
1 1642 PRO n 
1 1643 LYS n 
1 1644 ASN n 
1 1645 TYR n 
1 1646 MET n 
1 1647 SER n 
1 1648 GLN n 
1 1649 TYR n 
1 1650 PHE n 
1 1651 LYS n 
1 1652 LEU n 
1 1653 LEU n 
1 1654 GLU n 
1 1655 LYS n 
1 1656 PHE n 
1 1657 GLN n 
1 1658 ILE n 
1 1659 ALA n 
1 1660 LEU n 
1 1661 PRO n 
1 1662 ILE n 
1 1663 GLY n 
1 1664 GLU n 
1 1665 GLU n 
1 1666 TYR n 
1 1667 LEU n 
1 1668 LEU n 
1 1669 VAL n 
1 1670 PRO n 
1 1671 SER n 
1 1672 SER n 
1 1673 LEU n 
1 1674 SER n 
1 1675 ASP n 
1 1676 HIS n 
1 1677 ARG n 
1 1678 PRO n 
1 1679 VAL n 
1 1680 ILE n 
1 1681 GLU n 
1 1682 LEU n 
1 1683 PRO n 
1 1684 HIS n 
1 1685 CYS n 
1 1686 GLU n 
1 1687 ASN n 
1 1688 SER n 
1 1689 GLU n 
1 1690 ILE n 
1 1691 ILE n 
1 1692 ILE n 
1 1693 ARG n 
1 1694 LEU n 
1 1695 TYR n 
1 1696 GLU n 
1 1697 MET n 
1 1698 PRO n 
1 1699 TYR n 
1 1700 PHE n 
1 1701 PRO n 
1 1702 MET n 
1 1703 GLY n 
1 1704 PHE n 
1 1705 TRP n 
1 1706 SER n 
1 1707 ARG n 
1 1708 LEU n 
1 1709 ILE n 
1 1710 ASN n 
1 1711 ARG n 
1 1712 LEU n 
1 1713 LEU n 
1 1714 GLU n 
1 1715 ILE n 
1 1716 SER n 
1 1717 PRO n 
1 1718 TYR n 
1 1719 MET n 
1 1720 LEU n 
1 1721 SER n 
1 1722 GLY n 
1 1723 ARG n 
1 1724 GLU n 
1 1725 ARG n 
1 1726 ALA n 
1 1727 LEU n 
1 1728 ARG n 
1 1729 PRO n 
1 1730 ASN n 
1 1731 ARG n 
1 1732 MET n 
1 1733 TYR n 
1 1734 TRP n 
1 1735 ARG n 
1 1736 GLN n 
1 1737 GLY n 
1 1738 ILE n 
1 1739 TYR n 
1 1740 LEU n 
1 1741 ASN n 
1 1742 TRP n 
1 1743 SER n 
1 1744 PRO n 
1 1745 GLU n 
1 1746 ALA n 
1 1747 TYR n 
1 1748 CYS n 
1 1749 LEU n 
1 1750 VAL n 
1 1751 GLY n 
1 1752 SER n 
1 1753 GLU n 
1 1754 VAL n 
1 1755 LEU n 
1 1756 ASP n 
1 1757 ASN n 
1 1758 HIS n 
1 1759 PRO n 
1 1760 GLU n 
1 1761 SER n 
1 1762 PHE n 
1 1763 LEU n 
1 1764 LYS n 
1 1765 ILE n 
1 1766 THR n 
1 1767 VAL n 
1 1768 PRO n 
1 1769 SER n 
1 1770 CYS n 
1 1771 ARG n 
1 1772 LYS n 
1 1773 GLY n 
1 1774 CYS n 
1 1775 ILE n 
1 1776 LEU n 
1 1777 LEU n 
1 1778 GLY n 
1 1779 GLN n 
1 1780 VAL n 
1 1781 VAL n 
1 1782 ASP n 
1 1783 HIS n 
1 1784 ILE n 
1 1785 ASP n 
1 1786 SER n 
1 1787 LEU n 
1 1788 MET n 
1 1789 GLU n 
1 1790 GLU n 
1 1791 TRP n 
1 1792 PHE n 
1 1793 PRO n 
1 1794 GLY n 
1 1795 LEU n 
1 1796 LEU n 
1 1797 GLU n 
1 1798 ILE n 
1 1799 ASP n 
1 1800 ILE n 
1 1801 CYS n 
1 1802 GLY n 
1 1803 GLU n 
1 1804 GLY n 
1 1805 GLU n 
1 1806 THR n 
1 1807 LEU n 
1 1808 LEU n 
1 1809 LYS n 
1 1810 LYS n 
1 1811 TRP n 
1 1812 ALA n 
1 1813 LEU n 
1 1814 TYR n 
1 1815 SER n 
1 1816 PHE n 
1 1817 ASN n 
1 1818 ASP n 
1 1819 GLY n 
1 1820 GLU n 
1 1821 GLU n 
1 1822 HIS n 
1 1823 GLN n 
1 1824 LYS n 
1 1825 ILE n 
1 1826 LEU n 
1 1827 LEU n 
1 1828 ASP n 
1 1829 ASP n 
1 1830 LEU n 
1 1831 MET n 
1 1832 LYS n 
1 1833 LYS n 
1 1834 ALA n 
1 1835 GLU n 
1 1836 GLU n 
1 1837 GLY n 
1 1838 ASP n 
1 1839 LEU n 
1 1840 LEU n 
1 1841 VAL n 
1 1842 ASN n 
1 1843 PRO n 
1 1844 ASP n 
1 1845 GLN n 
1 1846 PRO n 
1 1847 ARG n 
1 1848 LEU n 
1 1849 THR n 
1 1850 ILE n 
1 1851 PRO n 
1 1852 ILE n 
1 1853 SER n 
1 1854 GLN n 
1 1855 ILE n 
1 1856 ALA n 
1 1857 PRO n 
1 1858 ASP n 
1 1859 LEU n 
1 1860 ILE n 
1 1861 LEU n 
1 1862 ALA n 
1 1863 ASP n 
1 1864 LEU n 
1 1865 PRO n 
1 1866 ARG n 
1 1867 ASN n 
1 1868 ILE n 
1 1869 MET n 
1 1870 LEU n 
1 1871 ASN n 
1 1872 ASN n 
1 1873 ASP n 
1 1874 GLU n 
1 1875 LEU n 
1 1876 GLU n 
1 1877 PHE n 
1 1878 GLU n 
1 1879 GLN n 
1 1880 ALA n 
1 1881 PRO n 
1 1882 GLU n 
1 1883 PHE n 
1 1884 LEU n 
1 1885 LEU n 
1 1886 GLY n 
1 1887 ASP n 
1 1888 GLY n 
1 1889 SER n 
1 1890 PHE n 
1 1891 GLY n 
1 1892 SER n 
1 1893 VAL n 
1 1894 TYR n 
1 1895 ARG n 
1 1896 ALA n 
1 1897 ALA n 
1 1898 TYR n 
1 1899 GLU n 
1 1900 GLY n 
1 1901 GLU n 
1 1902 GLU n 
1 1903 VAL n 
1 1904 ALA n 
1 1905 VAL n 
1 1906 LYS n 
1 1907 ILE n 
1 1908 PHE n 
1 1909 ASN n 
1 1910 LYS n 
1 1911 HIS n 
1 1912 THR n 
1 1913 SER n 
1 1914 LEU n 
1 1915 ARG n 
1 1916 LEU n 
1 1917 LEU n 
1 1918 ARG n 
1 1919 GLN n 
1 1920 GLU n 
1 1921 LEU n 
1 1922 VAL n 
1 1923 VAL n 
1 1924 LEU n 
1 1925 CYS n 
1 1926 HIS n 
1 1927 LEU n 
1 1928 HIS n 
1 1929 HIS n 
1 1930 PRO n 
1 1931 SER n 
1 1932 LEU n 
1 1933 ILE n 
1 1934 SER n 
1 1935 LEU n 
1 1936 LEU n 
1 1937 ALA n 
1 1938 ALA n 
1 1939 GLY n 
1 1940 ILE n 
1 1941 ARG n 
1 1942 PRO n 
1 1943 ARG n 
1 1944 MET n 
1 1945 LEU n 
1 1946 VAL n 
1 1947 MET n 
1 1948 GLU n 
1 1949 LEU n 
1 1950 ALA n 
1 1951 SER n 
1 1952 LYS n 
1 1953 GLY n 
1 1954 SER n 
1 1955 LEU n 
1 1956 ASP n 
1 1957 ARG n 
1 1958 LEU n 
1 1959 LEU n 
1 1960 GLN n 
1 1961 GLN n 
1 1962 ASP n 
1 1963 LYS n 
1 1964 ALA n 
1 1965 SER n 
1 1966 LEU n 
1 1967 THR n 
1 1968 ARG n 
1 1969 THR n 
1 1970 LEU n 
1 1971 GLN n 
1 1972 HIS n 
1 1973 ARG n 
1 1974 ILE n 
1 1975 ALA n 
1 1976 LEU n 
1 1977 HIS n 
1 1978 VAL n 
1 1979 ALA n 
1 1980 ASP n 
1 1981 GLY n 
1 1982 LEU n 
1 1983 ARG n 
1 1984 TYR n 
1 1985 LEU n 
1 1986 HIS n 
1 1987 SER n 
1 1988 ALA n 
1 1989 MET n 
1 1990 ILE n 
1 1991 ILE n 
1 1992 TYR n 
1 1993 ARG n 
1 1994 ASP n 
1 1995 LEU n 
1 1996 LYS n 
1 1997 PRO n 
1 1998 HIS n 
1 1999 ASN n 
1 2000 VAL n 
1 2001 LEU n 
1 2002 LEU n 
1 2003 PHE n 
1 2004 THR n 
1 2005 LEU n 
1 2006 TYR n 
1 2007 PRO n 
1 2008 ASN n 
1 2009 ALA n 
1 2010 ALA n 
1 2011 ILE n 
1 2012 ILE n 
1 2013 ALA n 
1 2014 LYS n 
1 2015 ILE n 
1 2016 ALA n 
1 2017 ASP n 
1 2018 TYR n 
1 2019 GLY n 
1 2020 THR n 
1 2021 ALA n 
1 2022 GLN n 
1 2023 TYR n 
1 2024 CYS n 
1 2025 CYS n 
1 2026 ARG n 
1 2027 MET n 
1 2028 GLY n 
1 2029 ILE n 
1 2030 LYS n 
1 2031 THR n 
1 2032 SER n 
1 2033 GLU n 
1 2034 GLY n 
1 2035 THR n 
1 2036 PRO n 
1 2037 GLY n 
1 2038 PHE n 
1 2039 ARG n 
1 2040 ALA n 
1 2041 PRO n 
1 2042 GLU n 
1 2043 VAL n 
1 2044 ALA n 
1 2045 ARG n 
1 2046 GLY n 
1 2047 ASN n 
1 2048 VAL n 
1 2049 ILE n 
1 2050 TYR n 
1 2051 ASN n 
1 2052 GLN n 
1 2053 GLN n 
1 2054 ALA n 
1 2055 ASP n 
1 2056 VAL n 
1 2057 TYR n 
1 2058 SER n 
1 2059 PHE n 
1 2060 GLY n 
1 2061 LEU n 
1 2062 LEU n 
1 2063 LEU n 
1 2064 TYR n 
1 2065 ASP n 
1 2066 ILE n 
1 2067 LEU n 
1 2068 THR n 
1 2069 THR n 
1 2070 GLY n 
1 2071 GLY n 
1 2072 ARG n 
1 2073 ILE n 
1 2074 VAL n 
1 2075 GLU n 
1 2076 GLY n 
1 2077 LEU n 
1 2078 LYS n 
1 2079 PHE n 
1 2080 PRO n 
1 2081 ASN n 
1 2082 GLU n 
1 2083 PHE n 
1 2084 ASP n 
1 2085 GLU n 
1 2086 LEU n 
1 2087 GLU n 
1 2088 ILE n 
1 2089 GLN n 
1 2090 GLY n 
1 2091 LYS n 
1 2092 LEU n 
1 2093 PRO n 
1 2094 ASP n 
1 2095 PRO n 
1 2096 VAL n 
1 2097 LYS n 
1 2098 GLU n 
1 2099 TYR n 
1 2100 GLY n 
1 2101 CYS n 
1 2102 ALA n 
1 2103 PRO n 
1 2104 TRP n 
1 2105 PRO n 
1 2106 MET n 
1 2107 VAL n 
1 2108 GLU n 
1 2109 LYS n 
1 2110 LEU n 
1 2111 ILE n 
1 2112 LYS n 
1 2113 GLN n 
1 2114 CYS n 
1 2115 LEU n 
1 2116 LYS n 
1 2117 GLU n 
1 2118 ASN n 
1 2119 PRO n 
1 2120 GLN n 
1 2121 GLU n 
1 2122 ARG n 
1 2123 PRO n 
1 2124 THR n 
1 2125 SER n 
1 2126 ALA n 
1 2127 GLN n 
1 2128 VAL n 
1 2129 PHE n 
1 2130 ASP n 
1 2131 ILE n 
1 2132 LEU n 
1 2133 ASN n 
1 2134 SER n 
1 2135 ALA n 
1 2136 GLU n 
1 2137 LEU n 
1 2138 VAL n 
1 2139 CYS n 
1 2140 LEU n 
1 2141 THR n 
1 2142 ARG n 
1 2143 ARG n 
1 2144 ILE n 
1 2145 LEU n 
1 2146 LEU n 
1 2147 PRO n 
1 2148 LYS n 
1 2149 ASN n 
1 2150 VAL n 
1 2151 ILE n 
1 2152 VAL n 
1 2153 GLU n 
1 2154 CYS n 
1 2155 MET n 
1 2156 VAL n 
1 2157 ALA n 
1 2158 THR n 
1 2159 HIS n 
1 2160 HIS n 
1 2161 ASN n 
1 2162 SER n 
1 2163 ARG n 
1 2164 ASN n 
1 2165 ALA n 
1 2166 SER n 
1 2167 ILE n 
1 2168 TRP n 
1 2169 LEU n 
1 2170 GLY n 
1 2171 CYS n 
1 2172 GLY n 
1 2173 HIS n 
1 2174 THR n 
1 2175 ASP n 
1 2176 ARG n 
1 2177 GLY n 
1 2178 GLN n 
1 2179 LEU n 
1 2180 SER n 
1 2181 PHE n 
1 2182 LEU n 
1 2183 ASP n 
1 2184 LEU n 
1 2185 ASN n 
1 2186 THR n 
1 2187 GLU n 
1 2188 GLY n 
1 2189 TYR n 
1 2190 THR n 
1 2191 SER n 
1 2192 GLU n 
1 2193 GLU n 
1 2194 VAL n 
1 2195 ALA n 
1 2196 ASP n 
1 2197 SER n 
1 2198 ARG n 
1 2199 ILE n 
1 2200 LEU n 
1 2201 CYS n 
1 2202 LEU n 
1 2203 ALA n 
1 2204 LEU n 
1 2205 VAL n 
1 2206 HIS n 
1 2207 LEU n 
1 2208 PRO n 
1 2209 VAL n 
1 2210 GLU n 
1 2211 LYS n 
1 2212 GLU n 
1 2213 SER n 
1 2214 TRP n 
1 2215 ILE n 
1 2216 VAL n 
1 2217 SER n 
1 2218 GLY n 
1 2219 THR n 
1 2220 GLN n 
1 2221 SER n 
1 2222 GLY n 
1 2223 THR n 
1 2224 LEU n 
1 2225 LEU n 
1 2226 VAL n 
1 2227 ILE n 
1 2228 ASN n 
1 2229 THR n 
1 2230 GLU n 
1 2231 ASP n 
1 2232 GLY n 
1 2233 LYS n 
1 2234 LYS n 
1 2235 ARG n 
1 2236 HIS n 
1 2237 THR n 
1 2238 LEU n 
1 2239 GLU n 
1 2240 LYS n 
1 2241 MET n 
1 2242 THR n 
1 2243 ASP n 
1 2244 SER n 
1 2245 VAL n 
1 2246 THR n 
1 2247 CYS n 
1 2248 LEU n 
1 2249 TYR n 
1 2250 CYS n 
1 2251 ASN n 
1 2252 SER n 
1 2253 PHE n 
1 2254 SER n 
1 2255 LYS n 
1 2256 GLN n 
1 2257 SER n 
1 2258 LYS n 
1 2259 GLN n 
1 2260 LYS n 
1 2261 ASN n 
1 2262 PHE n 
1 2263 LEU n 
1 2264 LEU n 
1 2265 VAL n 
1 2266 GLY n 
1 2267 THR n 
1 2268 ALA n 
1 2269 ASP n 
1 2270 GLY n 
1 2271 LYS n 
1 2272 LEU n 
1 2273 ALA n 
1 2274 ILE n 
1 2275 PHE n 
1 2276 GLU n 
1 2277 ASP n 
1 2278 LYS n 
1 2279 THR n 
1 2280 VAL n 
1 2281 LYS n 
1 2282 LEU n 
1 2283 LYS n 
1 2284 GLY n 
1 2285 ALA n 
1 2286 ALA n 
1 2287 PRO n 
1 2288 LEU n 
1 2289 LYS n 
1 2290 ILE n 
1 2291 LEU n 
1 2292 ASN n 
1 2293 ILE n 
1 2294 GLY n 
1 2295 ASN n 
1 2296 VAL n 
1 2297 SER n 
1 2298 THR n 
1 2299 PRO n 
1 2300 LEU n 
1 2301 MET n 
1 2302 CYS n 
1 2303 LEU n 
1 2304 SER n 
1 2305 GLU n 
1 2306 SER n 
1 2307 THR n 
1 2308 ASN n 
1 2309 SER n 
1 2310 THR n 
1 2311 GLU n 
1 2312 ARG n 
1 2313 ASN n 
1 2314 VAL n 
1 2315 MET n 
1 2316 TRP n 
1 2317 GLY n 
1 2318 GLY n 
1 2319 CYS n 
1 2320 GLY n 
1 2321 THR n 
1 2322 LYS n 
1 2323 ILE n 
1 2324 PHE n 
1 2325 SER n 
1 2326 PHE n 
1 2327 SER n 
1 2328 ASN n 
1 2329 ASP n 
1 2330 PHE n 
1 2331 THR n 
1 2332 ILE n 
1 2333 GLN n 
1 2334 LYS n 
1 2335 LEU n 
1 2336 ILE n 
1 2337 GLU n 
1 2338 THR n 
1 2339 ARG n 
1 2340 THR n 
1 2341 SER n 
1 2342 GLN n 
1 2343 LEU n 
1 2344 PHE n 
1 2345 SER n 
1 2346 TYR n 
1 2347 ALA n 
1 2348 ALA n 
1 2349 PHE n 
1 2350 SER n 
1 2351 ASP n 
1 2352 SER n 
1 2353 ASN n 
1 2354 ILE n 
1 2355 ILE n 
1 2356 THR n 
1 2357 VAL n 
1 2358 VAL n 
1 2359 VAL n 
1 2360 ASP n 
1 2361 THR n 
1 2362 ALA n 
1 2363 LEU n 
1 2364 TYR n 
1 2365 ILE n 
1 2366 ALA n 
1 2367 LYS n 
1 2368 GLN n 
1 2369 ASN n 
1 2370 SER n 
1 2371 PRO n 
1 2372 VAL n 
1 2373 VAL n 
1 2374 GLU n 
1 2375 VAL n 
1 2376 TRP n 
1 2377 ASP n 
1 2378 LYS n 
1 2379 LYS n 
1 2380 THR n 
1 2381 GLU n 
1 2382 LYS n 
1 2383 LEU n 
1 2384 CYS n 
1 2385 GLY n 
1 2386 LEU n 
1 2387 ILE n 
1 2388 ASP n 
1 2389 CYS n 
1 2390 VAL n 
1 2391 HIS n 
1 2392 PHE n 
1 2393 LEU n 
1 2394 ARG n 
1 2395 GLU n 
1 2396 VAL n 
1 2397 MET n 
1 2398 VAL n 
1 2399 LYS n 
1 2400 GLU n 
1 2401 ASN n 
1 2402 LYS n 
1 2403 GLU n 
1 2404 SER n 
1 2405 LYS n 
1 2406 HIS n 
1 2407 LYS n 
1 2408 MET n 
1 2409 SER n 
1 2410 TYR n 
1 2411 SER n 
1 2412 GLY n 
1 2413 ARG n 
1 2414 VAL n 
1 2415 LYS n 
1 2416 THR n 
1 2417 LEU n 
1 2418 CYS n 
1 2419 LEU n 
1 2420 GLN n 
1 2421 LYS n 
1 2422 ASN n 
1 2423 THR n 
1 2424 ALA n 
1 2425 LEU n 
1 2426 TRP n 
1 2427 ILE n 
1 2428 GLY n 
1 2429 THR n 
1 2430 GLY n 
1 2431 GLY n 
1 2432 GLY n 
1 2433 HIS n 
1 2434 ILE n 
1 2435 LEU n 
1 2436 LEU n 
1 2437 LEU n 
1 2438 ASP n 
1 2439 LEU n 
1 2440 SER n 
1 2441 THR n 
1 2442 ARG n 
1 2443 ARG n 
1 2444 LEU n 
1 2445 ILE n 
1 2446 ARG n 
1 2447 VAL n 
1 2448 ILE n 
1 2449 TYR n 
1 2450 ASN n 
1 2451 PHE n 
1 2452 CYS n 
1 2453 ASN n 
1 2454 SER n 
1 2455 VAL n 
1 2456 ARG n 
1 2457 VAL n 
1 2458 MET n 
1 2459 MET n 
1 2460 THR n 
1 2461 ALA n 
1 2462 GLN n 
1 2463 LEU n 
1 2464 GLY n 
1 2465 SER n 
1 2466 LEU n 
1 2467 LYS n 
1 2468 ASN n 
1 2469 VAL n 
1 2470 MET n 
1 2471 LEU n 
1 2472 VAL n 
1 2473 LEU n 
1 2474 GLY n 
1 2475 TYR n 
1 2476 ASN n 
1 2477 ARG n 
1 2478 LYS n 
1 2479 ASN n 
1 2480 THR n 
1 2481 GLU n 
1 2482 GLY n 
1 2483 THR n 
1 2484 GLN n 
1 2485 LYS n 
1 2486 GLN n 
1 2487 LYS n 
1 2488 GLU n 
1 2489 ILE n 
1 2490 GLN n 
1 2491 SER n 
1 2492 CYS n 
1 2493 LEU n 
1 2494 THR n 
1 2495 VAL n 
1 2496 TRP n 
1 2497 ASP n 
1 2498 ILE n 
1 2499 ASN n 
1 2500 LEU n 
1 2501 PRO n 
1 2502 HIS n 
1 2503 GLU n 
1 2504 VAL n 
1 2505 GLN n 
1 2506 ASN n 
1 2507 LEU n 
1 2508 GLU n 
1 2509 LYS n 
1 2510 HIS n 
1 2511 ILE n 
1 2512 GLU n 
1 2513 VAL n 
1 2514 ARG n 
1 2515 LYS n 
1 2516 GLU n 
1 2517 LEU n 
1 2518 ALA n 
1 2519 GLU n 
1 2520 LYS n 
1 2521 MET n 
1 2522 ARG n 
1 2523 ARG n 
1 2524 THR n 
1 2525 SER n 
1 2526 VAL n 
1 2527 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           2527 
_entity_src_nat.common_name                Human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             HEK293 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LRRK2_HUMAN 
_struct_ref.pdbx_db_accession          Q5S007 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQV
GWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIF
MLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLT
ETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHRE
VMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQ
KCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKD
VAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVAN
NSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPD
SSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHL
DLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKIS
GICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLE
LRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKS
DLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVG
QLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEP
KWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPE
SFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLL
VNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNV
LLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFP
NEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEK
MTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCG
TKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNT
EGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6XR4 A 1 ? 2527 ? Q5S007 1 ? 2527 ? 1 2536 
2 1 6XR4 B 1 ? 2527 ? Q5S007 1 ? 2527 ? 1 2536 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6XR4 THR A 2020 ? UNP Q5S007 ILE 2020 variant 2020 1 
2 6XR4 THR B 2020 ? UNP Q5S007 ILE 2020 variant 2020 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XR4 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.entry_id                                 6XR4 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_d_res_high                            . 
_refine.details                                  
;Each model in the conformation ensemble represents a cluster. 
Models are arranged sequentially from lowest to highest cluster RMSD.
Model 1 is the best representative model.
Model-Cluster correpondence is as follows:

Model 1  = Cluster 20
Model 2  = Cluster 16
Model 3  = Cluster 24
Model 4  = Cluster 32
Model 5  = Cluster 14
Model 6  = Cluster 1
Model 7  = Cluster 44
Model 8  = Cluster 11
Model 9  = Cluster 3
Model 10 = Cluster 22
Model 11 = Cluster 4
Model 12 = Cluster 12
Model 13 = Cluster 19
Model 14 = Cluster 7
Model 15 = Cluster 31
Model 16 = Cluster 26
Model 17 = Cluster 52
Model 18 = Cluster 2
Model 19 = Cluster 45
Model 20 = Cluster 8
Model 21 = Cluster 5
Model 22 = Cluster 23
Model 23 = Cluster 42
Model 24 = Cluster 25
Model 25 = Cluster 43
Model 26 = Cluster 27
Model 27 = Cluster 39
Model 28 = Cluster 6
Model 29 = Cluster 13
Model 30 = Cluster 28
Model 31 = Cluster 21
Model 32 = Cluster 10
Model 33 = Cluster 53
Model 34 = Cluster 30
Model 35 = Cluster 35
Model 36 = Cluster 38
Model 37 = Cluster 33
Model 38 = Cluster 40
Model 39 = Cluster 37
Model 40 = Cluster 29
Model 41 = Cluster 51
Model 42 = Cluster 41
Model 43 = Cluster 15
Model 44 = Cluster 9
Model 45 = Cluster 17
Model 46 = Cluster 50
Model 47 = Cluster 48
Model 48 = Cluster 49
Model 49 = Cluster 18
Model 50 = Cluster 46
Model 51 = Cluster 36
Model 52 = Cluster 47
Model 53 = Cluster 34
;
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_struct.entry_id                     6XR4 
_struct.title                        'Integrative in situ structure of Parkinsons disease-linked human LRRK2' 
_struct.pdbx_descriptor              'Leucine-rich repeat serine/threonine-protein kinase 2 (E.C.2.7.11.1,3.6.5.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XR4 
_struct_keywords.text            
;kinase, GTPase, Parkinson's Disease, pseudo-kinase, SIGNALING PROTEIN, TRANSFERASE
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_atom_sites.entry_id                    6XR4 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
_atom_type.symbol   C 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      C CA . TYR A 1 1332 ? 117.966 148.069 173.944 1.00 0.00 ? 1332 TYR A CA 1  
ATOM 2      C CA . ASN A 1 1333 ? 116.005 144.877 172.998 1.00 0.00 ? 1333 ASN A CA 1  
ATOM 3      C CA . ARG A 1 1334 ? 116.440 145.003 169.253 1.00 0.00 ? 1334 ARG A CA 1  
ATOM 4      C CA . MET A 1 1335 ? 118.332 142.788 166.772 1.00 0.00 ? 1335 MET A CA 1  
ATOM 5      C CA . LYS A 1 1336 ? 119.032 142.486 163.030 1.00 0.00 ? 1336 LYS A CA 1  
ATOM 6      C CA . LEU A 1 1337 ? 118.337 139.153 161.329 1.00 0.00 ? 1337 LEU A CA 1  
ATOM 7      C CA . MET A 1 1338 ? 120.159 139.032 158.010 1.00 0.00 ? 1338 MET A CA 1  
ATOM 8      C CA . ILE A 1 1339 ? 118.800 136.399 155.623 1.00 0.00 ? 1339 ILE A CA 1  
ATOM 9      C CA . VAL A 1 1340 ? 121.710 135.024 153.562 1.00 0.00 ? 1340 VAL A CA 1  
ATOM 10     C CA . GLY A 1 1341 ? 121.593 132.594 150.627 1.00 0.00 ? 1341 GLY A CA 1  
ATOM 11     C CA . ASN A 1 1342 ? 121.240 132.172 146.874 1.00 0.00 ? 1342 ASN A CA 1  
ATOM 12     C CA . THR A 1 1343 ? 118.013 133.746 145.448 1.00 0.00 ? 1343 THR A CA 1  
ATOM 13     C CA . GLY A 1 1344 ? 115.136 131.422 146.384 1.00 0.00 ? 1344 GLY A CA 1  
ATOM 14     C CA . SER A 1 1345 ? 116.666 128.787 148.648 1.00 0.00 ? 1345 SER A CA 1  
ATOM 15     C CA . GLY A 1 1346 ? 113.373 129.475 150.496 1.00 0.00 ? 1346 GLY A CA 1  
ATOM 16     C CA . LYS A 1 1347 ? 114.042 132.841 152.185 1.00 0.00 ? 1347 LYS A CA 1  
ATOM 17     C CA . THR A 1 1348 ? 110.351 133.879 151.875 1.00 0.00 ? 1348 THR A CA 1  
ATOM 18     C CA . THR A 1 1349 ? 109.265 130.276 152.706 1.00 0.00 ? 1349 THR A CA 1  
ATOM 19     C CA . LEU A 1 1350 ? 111.291 130.243 155.926 1.00 0.00 ? 1350 LEU A CA 1  
ATOM 20     C CA . LEU A 1 1351 ? 109.946 133.718 156.859 1.00 0.00 ? 1351 LEU A CA 1  
ATOM 21     C CA . GLN A 1 1352 ? 106.275 132.742 156.257 1.00 0.00 ? 1352 GLN A CA 1  
ATOM 22     C CA . GLN A 1 1353 ? 106.772 129.751 158.561 1.00 0.00 ? 1353 GLN A CA 1  
ATOM 23     C CA . LEU A 1 1354 ? 108.515 131.639 161.423 1.00 0.00 ? 1354 LEU A CA 1  
ATOM 24     C CA . MET A 1 1355 ? 106.190 134.590 161.539 1.00 0.00 ? 1355 MET A CA 1  
ATOM 25     C CA . LYS A 1 1356 ? 102.785 132.838 162.183 1.00 0.00 ? 1356 LYS A CA 1  
ATOM 26     C CA . THR A 1 1357 ? 100.788 136.126 162.296 1.00 0.00 ? 1357 THR A CA 1  
ATOM 27     C CA . LYS A 1 1358 ? 97.282  136.793 160.850 1.00 0.00 ? 1358 LYS A CA 1  
ATOM 28     C CA . LYS A 1 1359 ? 99.051  137.214 157.480 1.00 0.00 ? 1359 LYS A CA 1  
ATOM 29     C CA . SER A 1 1360 ? 99.345  140.962 158.233 1.00 0.00 ? 1360 SER A CA 1  
ATOM 30     C CA . ASP A 1 1361 ? 102.050 142.061 155.757 1.00 0.00 ? 1361 ASP A CA 1  
ATOM 31     C CA . LEU A 1 1362 ? 103.498 138.573 156.375 1.00 0.00 ? 1362 LEU A CA 1  
ATOM 32     C CA . GLY A 1 1363 ? 103.657 137.789 152.676 1.00 0.00 ? 1363 GLY A CA 1  
ATOM 33     C CA . MET A 1 1364 ? 106.354 139.232 150.400 1.00 0.00 ? 1364 MET A CA 1  
ATOM 34     C CA . GLN A 1 1365 ? 108.559 137.109 148.141 1.00 0.00 ? 1365 GLN A CA 1  
ATOM 35     C CA . SER A 1 1366 ? 111.515 138.959 146.599 1.00 0.00 ? 1366 SER A CA 1  
ATOM 36     C CA . ALA A 1 1367 ? 114.085 136.200 146.740 1.00 0.00 ? 1367 ALA A CA 1  
ATOM 37     C CA . THR A 1 1368 ? 116.231 137.366 143.721 1.00 0.00 ? 1368 THR A CA 1  
ATOM 38     C CA . VAL A 1 1369 ? 117.928 140.820 143.587 1.00 0.00 ? 1369 VAL A CA 1  
ATOM 39     C CA . GLY A 1 1370 ? 115.447 142.594 145.905 1.00 0.00 ? 1370 GLY A CA 1  
ATOM 40     C CA . ILE A 1 1371 ? 115.326 144.453 149.234 1.00 0.00 ? 1371 ILE A CA 1  
ATOM 41     C CA . ASP A 1 1372 ? 112.855 144.519 152.162 1.00 0.00 ? 1372 ASP A CA 1  
ATOM 42     C CA . VAL A 1 1373 ? 112.529 144.665 155.977 1.00 0.00 ? 1373 VAL A CA 1  
ATOM 43     C CA . LYS A 1 1374 ? 109.982 142.828 158.097 1.00 0.00 ? 1374 LYS A CA 1  
ATOM 44     C CA . ASP A 1 1375 ? 110.034 143.785 161.759 1.00 0.00 ? 1375 ASP A CA 1  
ATOM 45     C CA . TRP A 1 1376 ? 108.181 141.463 164.167 1.00 0.00 ? 1376 TRP A CA 1  
ATOM 46     C CA . PRO A 1 1377 ? 108.306 141.124 167.986 1.00 0.00 ? 1377 PRO A CA 1  
ATOM 47     C CA . ILE A 1 1378 ? 109.138 137.350 168.123 1.00 0.00 ? 1378 ILE A CA 1  
ATOM 48     C CA . GLN A 1 1379 ? 109.338 136.681 171.781 1.00 0.00 ? 1379 GLN A CA 1  
ATOM 49     C CA . ILE A 1 1380 ? 108.777 134.495 174.822 1.00 0.00 ? 1380 ILE A CA 1  
ATOM 50     C CA . ARG A 1 1381 ? 106.055 135.733 177.143 1.00 0.00 ? 1381 ARG A CA 1  
ATOM 51     C CA . ASP A 1 1382 ? 107.134 136.306 180.785 1.00 0.00 ? 1382 ASP A CA 1  
ATOM 52     C CA . LYS A 1 1383 ? 110.900 136.131 180.056 1.00 0.00 ? 1383 LYS A CA 1  
ATOM 53     C CA . ARG A 1 1384 ? 113.668 138.650 179.113 1.00 0.00 ? 1384 ARG A CA 1  
ATOM 54     C CA . LYS A 1 1385 ? 112.755 138.082 175.493 1.00 0.00 ? 1385 LYS A CA 1  
ATOM 55     C CA . ARG A 1 1386 ? 109.224 139.626 176.177 1.00 0.00 ? 1386 ARG A CA 1  
ATOM 56     C CA . ASP A 1 1387 ? 110.219 143.100 174.869 1.00 0.00 ? 1387 ASP A CA 1  
ATOM 57     C CA . LEU A 1 1388 ? 112.522 141.901 171.992 1.00 0.00 ? 1388 LEU A CA 1  
ATOM 58     C CA . VAL A 1 1389 ? 112.157 143.292 168.459 1.00 0.00 ? 1389 VAL A CA 1  
ATOM 59     C CA . LEU A 1 1390 ? 113.487 141.278 165.489 1.00 0.00 ? 1390 LEU A CA 1  
ATOM 60     C CA . ASN A 1 1391 ? 114.260 143.092 162.240 1.00 0.00 ? 1391 ASN A CA 1  
ATOM 61     C CA . VAL A 1 1392 ? 114.461 140.692 159.278 1.00 0.00 ? 1392 VAL A CA 1  
ATOM 62     C CA . TRP A 1 1393 ? 116.578 142.160 156.488 1.00 0.00 ? 1393 TRP A CA 1  
ATOM 63     C CA . ASP A 1 1394 ? 117.257 140.841 153.040 1.00 0.00 ? 1394 ASP A CA 1  
ATOM 64     C CA . PHE A 1 1395 ? 119.768 142.788 150.908 1.00 0.00 ? 1395 PHE A CA 1  
ATOM 65     C CA . ALA A 1 1396 ? 120.070 140.055 148.235 1.00 0.00 ? 1396 ALA A CA 1  
ATOM 66     C CA . GLY A 1 1397 ? 123.886 139.665 148.396 1.00 0.00 ? 1397 GLY A CA 1  
ATOM 67     C CA . ARG A 1 1398 ? 124.625 143.379 147.966 1.00 0.00 ? 1398 ARG A CA 1  
ATOM 68     C CA . GLU A 1 1399 ? 125.515 144.581 151.461 1.00 0.00 ? 1399 GLU A CA 1  
ATOM 69     C CA . GLU A 1 1400 ? 124.697 148.290 150.823 1.00 0.00 ? 1400 GLU A CA 1  
ATOM 70     C CA . PHE A 1 1401 ? 125.216 149.505 154.437 1.00 0.00 ? 1401 PHE A CA 1  
ATOM 71     C CA . TYR A 1 1402 ? 128.803 148.097 154.728 1.00 0.00 ? 1402 TYR A CA 1  
ATOM 72     C CA . SER A 1 1403 ? 130.972 151.135 153.779 1.00 0.00 ? 1403 SER A CA 1  
ATOM 73     C CA . THR A 1 1404 ? 129.244 153.857 155.838 1.00 0.00 ? 1404 THR A CA 1  
ATOM 74     C CA . HIS A 1 1405 ? 127.740 151.781 158.671 1.00 0.00 ? 1405 HIS A CA 1  
ATOM 75     C CA . PRO A 1 1406 ? 130.300 149.026 159.713 1.00 0.00 ? 1406 PRO A CA 1  
ATOM 76     C CA . HIS A 1 1407 ? 128.499 148.179 162.980 1.00 0.00 ? 1407 HIS A CA 1  
ATOM 77     C CA . PHE A 1 1408 ? 125.164 147.536 161.196 1.00 0.00 ? 1408 PHE A CA 1  
ATOM 78     C CA . MET A 1 1409 ? 126.761 144.329 159.867 1.00 0.00 ? 1409 MET A CA 1  
ATOM 79     C CA . THR A 1 1410 ? 129.332 143.541 162.607 1.00 0.00 ? 1410 THR A CA 1  
ATOM 80     C CA . GLN A 1 1411 ? 127.262 144.293 165.727 1.00 0.00 ? 1411 GLN A CA 1  
ATOM 81     C CA . ARG A 1 1412 ? 123.576 143.902 166.626 1.00 0.00 ? 1412 ARG A CA 1  
ATOM 82     C CA . ALA A 1 1413 ? 123.235 141.109 164.086 1.00 0.00 ? 1413 ALA A CA 1  
ATOM 83     C CA . LEU A 1 1414 ? 122.387 137.469 163.436 1.00 0.00 ? 1414 LEU A CA 1  
ATOM 84     C CA . TYR A 1 1415 ? 123.120 135.856 160.083 1.00 0.00 ? 1415 TYR A CA 1  
ATOM 85     C CA . LEU A 1 1416 ? 120.700 133.163 158.924 1.00 0.00 ? 1416 LEU A CA 1  
ATOM 86     C CA . ALA A 1 1417 ? 122.127 131.082 156.128 1.00 0.00 ? 1417 ALA A CA 1  
ATOM 87     C CA . VAL A 1 1418 ? 119.434 129.431 154.025 1.00 0.00 ? 1418 VAL A CA 1  
ATOM 88     C CA . TYR A 1 1419 ? 120.593 126.383 152.102 1.00 0.00 ? 1419 TYR A CA 1  
ATOM 89     C CA . ASP A 1 1420 ? 118.329 124.365 149.931 1.00 0.00 ? 1420 ASP A CA 1  
ATOM 90     C CA . LEU A 1 1421 ? 120.604 121.347 150.360 1.00 0.00 ? 1421 LEU A CA 1  
ATOM 91     C CA . SER A 1 1422 ? 119.234 119.510 147.277 1.00 0.00 ? 1422 SER A CA 1  
ATOM 92     C CA . LYS A 1 1423 ? 119.574 122.578 145.006 1.00 0.00 ? 1423 LYS A CA 1  
ATOM 93     C CA . GLY A 1 1424 ? 121.573 125.479 146.582 1.00 0.00 ? 1424 GLY A CA 1  
ATOM 94     C CA . GLN A 1 1425 ? 124.196 123.094 148.011 1.00 0.00 ? 1425 GLN A CA 1  
ATOM 95     C CA . ALA A 1 1426 ? 123.908 120.332 145.355 1.00 0.00 ? 1426 ALA A CA 1  
ATOM 96     C CA . GLU A 1 1427 ? 123.571 122.315 142.036 1.00 0.00 ? 1427 GLU A CA 1  
ATOM 97     C CA . VAL A 1 1428 ? 125.941 125.246 142.722 1.00 0.00 ? 1428 VAL A CA 1  
ATOM 98     C CA . ASP A 1 1429 ? 127.836 124.453 146.019 1.00 0.00 ? 1429 ASP A CA 1  
ATOM 99     C CA . ALA A 1 1430 ? 127.254 128.034 147.145 1.00 0.00 ? 1430 ALA A CA 1  
ATOM 100    C CA . MET A 1 1431 ? 127.580 127.071 150.814 1.00 0.00 ? 1431 MET A CA 1  
ATOM 101    C CA . LYS A 1 1432 ? 131.340 127.818 150.879 1.00 0.00 ? 1432 LYS A CA 1  
ATOM 102    C CA . PRO A 1 1433 ? 130.882 131.318 149.230 1.00 0.00 ? 1433 PRO A CA 1  
ATOM 103    C CA . TRP A 1 1434 ? 127.966 132.334 151.513 1.00 0.00 ? 1434 TRP A CA 1  
ATOM 104    C CA . LEU A 1 1435 ? 129.761 131.175 154.658 1.00 0.00 ? 1435 LEU A CA 1  
ATOM 105    C CA . PHE A 1 1436 ? 132.841 133.325 153.775 1.00 0.00 ? 1436 PHE A CA 1  
ATOM 106    C CA . ASN A 1 1437 ? 130.446 136.215 152.850 1.00 0.00 ? 1437 ASN A CA 1  
ATOM 107    C CA . ILE A 1 1438 ? 128.969 136.018 156.392 1.00 0.00 ? 1438 ILE A CA 1  
ATOM 108    C CA . LYS A 1 1439 ? 132.501 135.907 157.956 1.00 0.00 ? 1439 LYS A CA 1  
ATOM 109    C CA . ALA A 1 1440 ? 133.812 139.014 156.110 1.00 0.00 ? 1440 ALA A CA 1  
ATOM 110    C CA . ARG A 1 1441 ? 130.707 141.269 156.282 1.00 0.00 ? 1441 ARG A CA 1  
ATOM 111    C CA . ALA A 1 1442 ? 129.778 140.327 159.781 1.00 0.00 ? 1442 ALA A CA 1  
ATOM 112    C CA . SER A 1 1443 ? 132.554 139.908 162.352 1.00 0.00 ? 1443 SER A CA 1  
ATOM 113    C CA . SER A 1 1444 ? 131.991 137.735 165.417 1.00 0.00 ? 1444 SER A CA 1  
ATOM 114    C CA . SER A 1 1445 ? 128.228 137.890 164.670 1.00 0.00 ? 1445 SER A CA 1  
ATOM 115    C CA . PRO A 1 1446 ? 126.418 134.475 165.048 1.00 0.00 ? 1446 PRO A CA 1  
ATOM 116    C CA . VAL A 1 1447 ? 125.289 132.461 162.179 1.00 0.00 ? 1447 VAL A CA 1  
ATOM 117    C CA . ILE A 1 1448 ? 122.507 129.883 162.117 1.00 0.00 ? 1448 ILE A CA 1  
ATOM 118    C CA . LEU A 1 1449 ? 122.592 127.364 159.266 1.00 0.00 ? 1449 LEU A CA 1  
ATOM 119    C CA . VAL A 1 1450 ? 119.153 126.291 158.024 1.00 0.00 ? 1450 VAL A CA 1  
ATOM 120    C CA . GLY A 1 1451 ? 118.936 123.327 155.628 1.00 0.00 ? 1451 GLY A CA 1  
ATOM 121    C CA . THR A 1 1452 ? 115.625 123.791 153.778 1.00 0.00 ? 1452 THR A CA 1  
ATOM 122    C CA . HIS A 1 1453 ? 113.261 121.653 151.646 1.00 0.00 ? 1453 HIS A CA 1  
ATOM 123    C CA . LEU A 1 1454 ? 114.125 118.473 153.539 1.00 0.00 ? 1454 LEU A CA 1  
ATOM 124    C CA . ASP A 1 1455 ? 110.779 116.831 152.576 1.00 0.00 ? 1455 ASP A CA 1  
ATOM 125    C CA . VAL A 1 1456 ? 111.888 116.607 148.893 1.00 0.00 ? 1456 VAL A CA 1  
ATOM 126    C CA . SER A 1 1457 ? 115.162 114.957 149.964 1.00 0.00 ? 1457 SER A CA 1  
ATOM 127    C CA . ASP A 1 1458 ? 113.748 112.153 152.186 1.00 0.00 ? 1458 ASP A CA 1  
ATOM 128    C CA . GLU A 1 1459 ? 115.888 113.402 155.120 1.00 0.00 ? 1459 GLU A CA 1  
ATOM 129    C CA . LYS A 1 1460 ? 119.109 112.524 153.205 1.00 0.00 ? 1460 LYS A CA 1  
ATOM 130    C CA . GLN A 1 1461 ? 120.758 115.924 152.635 1.00 0.00 ? 1461 GLN A CA 1  
ATOM 131    C CA . ARG A 1 1462 ? 120.960 116.641 156.358 1.00 0.00 ? 1462 ARG A CA 1  
ATOM 132    C CA . LYS A 1 1463 ? 123.294 113.732 157.039 1.00 0.00 ? 1463 LYS A CA 1  
ATOM 133    C CA . ALA A 1 1464 ? 127.026 114.049 157.918 1.00 0.00 ? 1464 ALA A CA 1  
ATOM 134    C CA . CYS A 1 1465 ? 127.737 112.442 154.526 1.00 0.00 ? 1465 CYS A CA 1  
ATOM 135    C CA . MET A 1 1466 ? 126.486 115.559 152.645 1.00 0.00 ? 1466 MET A CA 1  
ATOM 136    C CA . SER A 1 1467 ? 126.337 118.305 155.306 1.00 0.00 ? 1467 SER A CA 1  
ATOM 137    C CA . LYS A 1 1468 ? 129.766 118.606 156.919 1.00 0.00 ? 1468 LYS A CA 1  
ATOM 138    C CA . ILE A 1 1469 ? 128.536 120.126 160.251 1.00 0.00 ? 1469 ILE A CA 1  
ATOM 139    C CA . THR A 1 1470 ? 131.363 119.192 162.664 1.00 0.00 ? 1470 THR A CA 1  
ATOM 140    C CA . LYS A 1 1471 ? 133.869 118.317 159.991 1.00 0.00 ? 1471 LYS A CA 1  
ATOM 141    C CA . GLU A 1 1472 ? 133.847 121.648 157.979 1.00 0.00 ? 1472 GLU A CA 1  
ATOM 142    C CA . LEU A 1 1473 ? 131.069 124.006 159.183 1.00 0.00 ? 1473 LEU A CA 1  
ATOM 143    C CA . LEU A 1 1474 ? 131.729 124.372 162.968 1.00 0.00 ? 1474 LEU A CA 1  
ATOM 144    C CA . ASN A 1 1475 ? 134.554 125.436 165.380 1.00 0.00 ? 1475 ASN A CA 1  
ATOM 145    C CA . LYS A 1 1476 ? 136.753 122.381 164.556 1.00 0.00 ? 1476 LYS A CA 1  
ATOM 146    C CA . ARG A 1 1477 ? 137.409 123.721 161.032 1.00 0.00 ? 1477 ARG A CA 1  
ATOM 147    C CA . GLY A 1 1478 ? 137.430 127.478 161.419 1.00 0.00 ? 1478 GLY A CA 1  
ATOM 148    C CA . PHE A 1 1479 ? 133.721 128.388 161.622 1.00 0.00 ? 1479 PHE A CA 1  
ATOM 149    C CA . PRO A 1 1480 ? 133.420 129.470 165.292 1.00 0.00 ? 1480 PRO A CA 1  
ATOM 150    C CA . ALA A 1 1481 ? 130.298 131.661 165.447 1.00 0.00 ? 1481 ALA A CA 1  
ATOM 151    C CA . ILE A 1 1482 ? 127.793 128.998 164.283 1.00 0.00 ? 1482 ILE A CA 1  
ATOM 152    C CA . ARG A 1 1483 ? 127.136 126.363 167.040 1.00 0.00 ? 1483 ARG A CA 1  
ATOM 153    C CA . ASP A 1 1484 ? 123.637 125.715 165.564 1.00 0.00 ? 1484 ASP A CA 1  
ATOM 154    C CA . TYR A 1 1485 ? 122.242 123.798 162.569 1.00 0.00 ? 1485 TYR A CA 1  
ATOM 155    C CA . HIS A 1 1486 ? 118.629 123.192 161.461 1.00 0.00 ? 1486 HIS A CA 1  
ATOM 156    C CA . PHE A 1 1487 ? 116.988 120.805 159.082 1.00 0.00 ? 1487 PHE A CA 1  
ATOM 157    C CA . VAL A 1 1488 ? 113.502 121.956 158.162 1.00 0.00 ? 1488 VAL A CA 1  
ATOM 158    C CA . ASN A 1 1489 ? 110.641 120.524 156.082 1.00 0.00 ? 1489 ASN A CA 1  
ATOM 159    C CA . ALA A 1 1490 ? 107.953 123.203 156.011 1.00 0.00 ? 1490 ALA A CA 1  
ATOM 160    C CA . THR A 1 1491 ? 105.037 121.418 154.375 1.00 0.00 ? 1491 THR A CA 1  
ATOM 161    C CA . GLU A 1 1492 ? 105.465 118.227 156.417 1.00 0.00 ? 1492 GLU A CA 1  
ATOM 162    C CA . GLU A 1 1493 ? 105.667 119.627 159.964 1.00 0.00 ? 1493 GLU A CA 1  
ATOM 163    C CA . SER A 1 1494 ? 106.667 122.856 161.783 1.00 0.00 ? 1494 SER A CA 1  
ATOM 164    C CA . ASP A 1 1495 ? 108.464 121.185 164.702 1.00 0.00 ? 1495 ASP A CA 1  
ATOM 165    C CA . ALA A 1 1496 ? 112.022 121.855 163.442 1.00 0.00 ? 1496 ALA A CA 1  
ATOM 166    C CA . LEU A 1 1497 ? 111.147 125.537 162.802 1.00 0.00 ? 1497 LEU A CA 1  
ATOM 167    C CA . ALA A 1 1498 ? 110.261 125.992 166.478 1.00 0.00 ? 1498 ALA A CA 1  
ATOM 168    C CA . LYS A 1 1499 ? 113.878 124.849 167.102 1.00 0.00 ? 1499 LYS A CA 1  
ATOM 169    C CA . LEU A 1 1500 ? 115.067 127.801 164.923 1.00 0.00 ? 1500 LEU A CA 1  
ATOM 170    C CA . ARG A 1 1501 ? 113.450 130.052 167.546 1.00 0.00 ? 1501 ARG A CA 1  
ATOM 171    C CA . LYS A 1 1502 ? 115.761 128.508 170.214 1.00 0.00 ? 1502 LYS A CA 1  
ATOM 172    C CA . THR A 1 1503 ? 118.789 129.554 168.146 1.00 0.00 ? 1503 THR A CA 1  
ATOM 173    C CA . ILE A 1 1504 ? 117.267 133.053 167.691 1.00 0.00 ? 1504 ILE A CA 1  
ATOM 174    C CA . ILE A 1 1505 ? 117.045 132.924 171.530 1.00 0.00 ? 1505 ILE A CA 1  
ATOM 175    C CA . ASN A 1 1506 ? 120.740 131.779 171.814 1.00 0.00 ? 1506 ASN A CA 1  
ATOM 176    C CA . GLU A 1 1507 ? 121.775 134.788 169.745 1.00 0.00 ? 1507 GLU A CA 1  
ATOM 177    C CA . SER A 1 1508 ? 120.694 138.456 170.449 1.00 0.00 ? 1508 SER A CA 1  
ATOM 178    C CA . LEU A 1 1509 ? 122.348 137.724 173.845 1.00 0.00 ? 1509 LEU A CA 1  
ATOM 179    C CA . ASN A 1 1510 ? 125.850 138.960 172.950 1.00 0.00 ? 1510 ASN A CA 1  
ATOM 180    C CA . PHE A 1 1511 ? 124.553 141.748 170.585 1.00 0.00 ? 1511 PHE A CA 1  
ATOM 181    C CA . LYS A 1 1512 ? 122.211 143.854 172.606 1.00 0.00 ? 1512 LYS A CA 1  
ATOM 182    C CA . ILE A 1 1513 ? 122.071 142.661 176.273 1.00 0.00 ? 1513 ILE A CA 1  
ATOM 183    C CA . ARG A 1 1514 ? 125.671 143.586 177.202 1.00 0.00 ? 1514 ARG A CA 1  
ATOM 184    C CA . PRO A 1 1524 ? 120.596 155.069 182.257 1.00 0.00 ? 1524 PRO A CA 1  
ATOM 185    C CA . ASP A 1 1525 ? 117.016 156.423 181.834 1.00 0.00 ? 1525 ASP A CA 1  
ATOM 186    C CA . CYS A 1 1526 ? 118.327 159.879 180.756 1.00 0.00 ? 1526 CYS A CA 1  
ATOM 187    C CA . TYR A 1 1527 ? 120.092 158.379 177.663 1.00 0.00 ? 1527 TYR A CA 1  
ATOM 188    C CA . VAL A 1 1528 ? 116.835 156.563 176.602 1.00 0.00 ? 1528 VAL A CA 1  
ATOM 189    C CA . GLU A 1 1529 ? 114.732 159.720 177.286 1.00 0.00 ? 1529 GLU A CA 1  
ATOM 190    C CA . LEU A 1 1530 ? 117.075 161.897 175.258 1.00 0.00 ? 1530 LEU A CA 1  
ATOM 191    C CA . GLU A 1 1531 ? 117.252 159.318 172.405 1.00 0.00 ? 1531 GLU A CA 1  
ATOM 192    C CA . LYS A 1 1532 ? 113.424 159.330 172.084 1.00 0.00 ? 1532 LYS A CA 1  
ATOM 193    C CA . ILE A 1 1533 ? 113.199 163.157 172.097 1.00 0.00 ? 1533 ILE A CA 1  
ATOM 194    C CA . ILE A 1 1534 ? 116.099 163.401 169.610 1.00 0.00 ? 1534 ILE A CA 1  
ATOM 195    C CA . LEU A 1 1535 ? 114.408 160.851 167.273 1.00 0.00 ? 1535 LEU A CA 1  
ATOM 196    C CA . SER A 1 1536 ? 111.022 162.653 167.442 1.00 0.00 ? 1536 SER A CA 1  
ATOM 197    C CA . GLU A 1 1537 ? 112.647 166.091 166.806 1.00 0.00 ? 1537 GLU A CA 1  
ATOM 198    C CA . ARG A 1 1538 ? 114.882 164.685 164.036 1.00 0.00 ? 1538 ARG A CA 1  
ATOM 199    C CA . LYS A 1 1539 ? 112.301 162.720 162.001 1.00 0.00 ? 1539 LYS A CA 1  
ATOM 200    C CA . ASN A 1 1540 ? 109.998 165.778 161.994 1.00 0.00 ? 1540 ASN A CA 1  
ATOM 201    C CA . VAL A 1 1541 ? 112.668 167.745 160.081 1.00 0.00 ? 1541 VAL A CA 1  
ATOM 202    C CA . PRO A 1 1542 ? 112.840 165.690 156.776 1.00 0.00 ? 1542 PRO A CA 1  
ATOM 203    C CA . ILE A 1 1543 ? 112.516 168.773 154.628 1.00 0.00 ? 1543 ILE A CA 1  
ATOM 204    C CA . GLU A 1 1544 ? 115.416 170.618 156.126 1.00 0.00 ? 1544 GLU A CA 1  
ATOM 205    C CA . PHE A 1 1545 ? 119.043 169.766 157.133 1.00 0.00 ? 1545 PHE A CA 1  
ATOM 206    C CA . PRO A 1 1546 ? 119.546 171.385 160.627 1.00 0.00 ? 1546 PRO A CA 1  
ATOM 207    C CA . VAL A 1 1547 ? 117.327 168.726 161.959 1.00 0.00 ? 1547 VAL A CA 1  
ATOM 208    C CA . ILE A 1 1548 ? 118.847 169.579 165.292 1.00 0.00 ? 1548 ILE A CA 1  
ATOM 209    C CA . ASP A 1 1549 ? 121.189 172.562 165.786 1.00 0.00 ? 1549 ASP A CA 1  
ATOM 210    C CA . ARG A 1 1550 ? 123.691 172.788 168.699 1.00 0.00 ? 1550 ARG A CA 1  
ATOM 211    C CA . LYS A 1 1551 ? 121.429 174.940 170.910 1.00 0.00 ? 1551 LYS A CA 1  
ATOM 212    C CA . ARG A 1 1552 ? 118.422 172.700 170.353 1.00 0.00 ? 1552 ARG A CA 1  
ATOM 213    C CA . LEU A 1 1553 ? 120.141 169.431 171.486 1.00 0.00 ? 1553 LEU A CA 1  
ATOM 214    C CA . LEU A 1 1554 ? 121.653 171.308 174.469 1.00 0.00 ? 1554 LEU A CA 1  
ATOM 215    C CA . GLN A 1 1555 ? 118.076 172.264 175.418 1.00 0.00 ? 1555 GLN A CA 1  
ATOM 216    C CA . LEU A 1 1556 ? 116.828 168.626 175.105 1.00 0.00 ? 1556 LEU A CA 1  
ATOM 217    C CA . VAL A 1 1557 ? 119.840 167.300 177.113 1.00 0.00 ? 1557 VAL A CA 1  
ATOM 218    C CA . ARG A 1 1558 ? 119.039 169.792 179.946 1.00 0.00 ? 1558 ARG A CA 1  
ATOM 219    C CA . GLU A 1 1559 ? 115.363 168.757 180.129 1.00 0.00 ? 1559 GLU A CA 1  
ATOM 220    C CA . ASN A 1 1560 ? 116.491 165.159 180.876 1.00 0.00 ? 1560 ASN A CA 1  
ATOM 221    C CA . GLN A 1 1561 ? 119.123 166.460 183.383 1.00 0.00 ? 1561 GLN A CA 1  
ATOM 222    C CA . LEU A 1 1562 ? 122.269 165.795 181.246 1.00 0.00 ? 1562 LEU A CA 1  
ATOM 223    C CA . GLN A 1 1563 ? 123.536 169.417 180.852 1.00 0.00 ? 1563 GLN A CA 1  
ATOM 224    C CA . LEU A 1 1564 ? 125.543 168.718 184.035 1.00 0.00 ? 1564 LEU A CA 1  
ATOM 225    C CA . ASP A 1 1565 ? 128.567 167.608 181.989 1.00 0.00 ? 1565 ASP A CA 1  
ATOM 226    C CA . GLU A 1 1566 ? 129.452 168.615 178.384 1.00 0.00 ? 1566 GLU A CA 1  
ATOM 227    C CA . ASN A 1 1567 ? 131.751 165.598 178.379 1.00 0.00 ? 1567 ASN A CA 1  
ATOM 228    C CA . GLU A 1 1568 ? 128.873 163.009 178.810 1.00 0.00 ? 1568 GLU A CA 1  
ATOM 229    C CA . LEU A 1 1569 ? 126.799 164.652 176.097 1.00 0.00 ? 1569 LEU A CA 1  
ATOM 230    C CA . PRO A 1 1570 ? 129.554 163.939 173.423 1.00 0.00 ? 1570 PRO A CA 1  
ATOM 231    C CA . HIS A 1 1571 ? 129.652 160.366 174.747 1.00 0.00 ? 1571 HIS A CA 1  
ATOM 232    C CA . ALA A 1 1572 ? 125.831 159.941 174.559 1.00 0.00 ? 1572 ALA A CA 1  
ATOM 233    C CA . VAL A 1 1573 ? 125.664 161.398 171.022 1.00 0.00 ? 1573 VAL A CA 1  
ATOM 234    C CA . HIS A 1 1574 ? 128.845 159.418 170.080 1.00 0.00 ? 1574 HIS A CA 1  
ATOM 235    C CA . PHE A 1 1575 ? 126.924 156.274 171.217 1.00 0.00 ? 1575 PHE A CA 1  
ATOM 236    C CA . LEU A 1 1576 ? 123.779 157.249 169.320 1.00 0.00 ? 1576 LEU A CA 1  
ATOM 237    C CA . ASN A 1 1577 ? 125.902 157.943 166.213 1.00 0.00 ? 1577 ASN A CA 1  
ATOM 238    C CA . GLU A 1 1578 ? 127.814 154.591 166.553 1.00 0.00 ? 1578 GLU A CA 1  
ATOM 239    C CA . SER A 1 1579 ? 124.416 152.850 166.764 1.00 0.00 ? 1579 SER A CA 1  
ATOM 240    C CA . GLY A 1 1580 ? 122.874 154.743 163.760 1.00 0.00 ? 1580 GLY A CA 1  
ATOM 241    C CA . VAL A 1 1581 ? 119.906 156.025 165.777 1.00 0.00 ? 1581 VAL A CA 1  
ATOM 242    C CA . LEU A 1 1582 ? 121.030 159.513 164.880 1.00 0.00 ? 1582 LEU A CA 1  
ATOM 243    C CA . LEU A 1 1583 ? 124.034 160.787 162.983 1.00 0.00 ? 1583 LEU A CA 1  
ATOM 244    C CA . HIS A 1 1584 ? 126.591 163.123 164.596 1.00 0.00 ? 1584 HIS A CA 1  
ATOM 245    C CA . PHE A 1 1585 ? 129.764 163.987 162.767 1.00 0.00 ? 1585 PHE A CA 1  
ATOM 246    C CA . GLN A 1 1586 ? 132.477 165.034 165.240 1.00 0.00 ? 1586 GLN A CA 1  
ATOM 247    C CA . ASP A 1 1587 ? 135.044 165.797 162.454 1.00 0.00 ? 1587 ASP A CA 1  
ATOM 248    C CA . PRO A 1 1588 ? 132.949 168.650 160.760 1.00 0.00 ? 1588 PRO A CA 1  
ATOM 249    C CA . ALA A 1 1589 ? 131.580 169.754 164.202 1.00 0.00 ? 1589 ALA A CA 1  
ATOM 250    C CA . LEU A 1 1590 ? 134.349 172.364 164.717 1.00 0.00 ? 1590 LEU A CA 1  
ATOM 251    C CA . GLN A 1 1591 ? 132.680 174.854 162.331 1.00 0.00 ? 1591 GLN A CA 1  
ATOM 252    C CA . LEU A 1 1592 ? 129.118 173.527 162.259 1.00 0.00 ? 1592 LEU A CA 1  
ATOM 253    C CA . SER A 1 1593 ? 126.675 174.336 165.112 1.00 0.00 ? 1593 SER A CA 1  
ATOM 254    C CA . ASP A 1 1594 ? 123.788 174.862 162.649 1.00 0.00 ? 1594 ASP A CA 1  
ATOM 255    C CA . LEU A 1 1595 ? 123.791 171.208 161.576 1.00 0.00 ? 1595 LEU A CA 1  
ATOM 256    C CA . TYR A 1 1596 ? 124.970 169.232 164.567 1.00 0.00 ? 1596 TYR A CA 1  
ATOM 257    C CA . PHE A 1 1597 ? 122.960 165.996 164.717 1.00 0.00 ? 1597 PHE A CA 1  
ATOM 258    C CA . VAL A 1 1598 ? 121.236 164.398 161.700 1.00 0.00 ? 1598 VAL A CA 1  
ATOM 259    C CA . GLU A 1 1599 ? 118.305 162.085 160.669 1.00 0.00 ? 1599 GLU A CA 1  
ATOM 260    C CA . PRO A 1 1600 ? 119.838 158.905 159.064 1.00 0.00 ? 1600 PRO A CA 1  
ATOM 261    C CA . LYS A 1 1601 ? 117.025 158.589 156.483 1.00 0.00 ? 1601 LYS A CA 1  
ATOM 262    C CA . TRP A 1 1602 ? 117.493 162.168 155.334 1.00 0.00 ? 1602 TRP A CA 1  
ATOM 263    C CA . LEU A 1 1603 ? 121.289 161.633 154.927 1.00 0.00 ? 1603 LEU A CA 1  
ATOM 264    C CA . CYS A 1 1604 ? 120.910 158.255 153.145 1.00 0.00 ? 1604 CYS A CA 1  
ATOM 265    C CA . LYS A 1 1605 ? 118.309 159.550 150.641 1.00 0.00 ? 1605 LYS A CA 1  
ATOM 266    C CA . ILE A 1 1606 ? 120.621 162.507 149.867 1.00 0.00 ? 1606 ILE A CA 1  
ATOM 267    C CA . MET A 1 1607 ? 123.563 160.464 148.855 1.00 0.00 ? 1607 MET A CA 1  
ATOM 268    C CA . ALA A 1 1608 ? 121.649 157.811 146.971 1.00 0.00 ? 1608 ALA A CA 1  
ATOM 269    C CA . GLN A 1 1609 ? 120.190 160.658 144.827 1.00 0.00 ? 1609 GLN A CA 1  
ATOM 270    C CA . ILE A 1 1610 ? 123.754 161.923 144.096 1.00 0.00 ? 1610 ILE A CA 1  
ATOM 271    C CA . LEU A 1 1611 ? 124.956 158.348 143.373 1.00 0.00 ? 1611 LEU A CA 1  
ATOM 272    C CA . THR A 1 1612 ? 122.059 157.521 140.972 1.00 0.00 ? 1612 THR A CA 1  
ATOM 273    C CA . VAL A 1 1613 ? 121.836 160.888 139.199 1.00 0.00 ? 1613 VAL A CA 1  
ATOM 274    C CA . LYS A 1 1614 ? 122.148 160.897 135.370 1.00 0.00 ? 1614 LYS A CA 1  
ATOM 275    C CA . VAL A 1 1615 ? 124.448 163.957 135.541 1.00 0.00 ? 1615 VAL A CA 1  
ATOM 276    C CA . GLU A 1 1616 ? 127.778 162.284 136.389 1.00 0.00 ? 1616 GLU A CA 1  
ATOM 277    C CA . GLY A 1 1617 ? 129.733 164.572 134.045 1.00 0.00 ? 1617 GLY A CA 1  
ATOM 278    C CA . CYS A 1 1618 ? 129.887 166.565 130.821 1.00 0.00 ? 1618 CYS A CA 1  
ATOM 279    C CA . PRO A 1 1619 ? 127.533 165.341 127.962 1.00 0.00 ? 1619 PRO A CA 1  
ATOM 280    C CA . LYS A 1 1620 ? 129.950 163.026 126.055 1.00 0.00 ? 1620 LYS A CA 1  
ATOM 281    C CA . HIS A 1 1621 ? 132.050 161.908 129.060 1.00 0.00 ? 1621 HIS A CA 1  
ATOM 282    C CA . PRO A 1 1622 ? 130.029 161.116 132.254 1.00 0.00 ? 1622 PRO A CA 1  
ATOM 283    C CA . LYS A 1 1623 ? 132.541 159.029 134.243 1.00 0.00 ? 1623 LYS A CA 1  
ATOM 284    C CA . GLY A 1 1624 ? 131.699 159.583 137.957 1.00 0.00 ? 1624 GLY A CA 1  
ATOM 285    C CA . ILE A 1 1625 ? 132.139 163.384 137.809 1.00 0.00 ? 1625 ILE A CA 1  
ATOM 286    C CA . ILE A 1 1626 ? 130.007 165.538 140.149 1.00 0.00 ? 1626 ILE A CA 1  
ATOM 287    C CA . SER A 1 1627 ? 129.744 169.129 138.871 1.00 0.00 ? 1627 SER A CA 1  
ATOM 288    C CA . ARG A 1 1628 ? 129.007 171.157 142.060 1.00 0.00 ? 1628 ARG A CA 1  
ATOM 289    C CA . ARG A 1 1629 ? 126.612 173.594 140.283 1.00 0.00 ? 1629 ARG A CA 1  
ATOM 290    C CA . ASP A 1 1630 ? 124.121 170.976 139.379 1.00 0.00 ? 1630 ASP A CA 1  
ATOM 291    C CA . VAL A 1 1631 ? 123.413 169.753 142.980 1.00 0.00 ? 1631 VAL A CA 1  
ATOM 292    C CA . GLU A 1 1632 ? 120.210 171.872 143.198 1.00 0.00 ? 1632 GLU A CA 1  
ATOM 293    C CA . LYS A 1 1633 ? 118.697 169.951 140.275 1.00 0.00 ? 1633 LYS A CA 1  
ATOM 294    C CA . PHE A 1 1634 ? 119.837 166.474 141.482 1.00 0.00 ? 1634 PHE A CA 1  
ATOM 295    C CA . LEU A 1 1635 ? 118.592 166.770 144.992 1.00 0.00 ? 1635 LEU A CA 1  
ATOM 296    C CA . SER A 1 1636 ? 115.425 168.959 144.715 1.00 0.00 ? 1636 SER A CA 1  
ATOM 297    C CA . LYS A 1 1637 ? 112.303 168.820 144.862 1.00 0.00 ? 1637 LYS A CA 1  
ATOM 298    C CA . LYS A 1 1638 ? 112.195 165.025 145.673 1.00 0.00 ? 1638 LYS A CA 1  
ATOM 299    C CA . ARG A 1 1639 ? 113.903 166.071 148.836 1.00 0.00 ? 1639 ARG A CA 1  
ATOM 300    C CA . LYS A 1 1640 ? 114.443 169.633 150.020 1.00 0.00 ? 1640 LYS A CA 1  
ATOM 301    C CA . PHE A 1 1641 ? 118.090 170.702 149.994 1.00 0.00 ? 1641 PHE A CA 1  
ATOM 302    C CA . PRO A 1 1642 ? 118.973 174.383 150.260 1.00 0.00 ? 1642 PRO A CA 1  
ATOM 303    C CA . LYS A 1 1643 ? 122.493 175.634 149.345 1.00 0.00 ? 1643 LYS A CA 1  
ATOM 304    C CA . ASN A 1 1644 ? 124.169 175.340 152.806 1.00 0.00 ? 1644 ASN A CA 1  
ATOM 305    C CA . TYR A 1 1645 ? 122.666 171.844 153.179 1.00 0.00 ? 1645 TYR A CA 1  
ATOM 306    C CA . MET A 1 1646 ? 124.104 171.107 149.716 1.00 0.00 ? 1646 MET A CA 1  
ATOM 307    C CA . SER A 1 1647 ? 127.673 172.065 150.748 1.00 0.00 ? 1647 SER A CA 1  
ATOM 308    C CA . GLN A 1 1648 ? 127.473 169.868 153.900 1.00 0.00 ? 1648 GLN A CA 1  
ATOM 309    C CA . TYR A 1 1649 ? 126.160 166.650 152.226 1.00 0.00 ? 1649 TYR A CA 1  
ATOM 310    C CA . PHE A 1 1650 ? 129.283 166.744 150.043 1.00 0.00 ? 1650 PHE A CA 1  
ATOM 311    C CA . LYS A 1 1651 ? 131.335 166.717 153.274 1.00 0.00 ? 1651 LYS A CA 1  
ATOM 312    C CA . LEU A 1 1652 ? 129.277 163.671 154.362 1.00 0.00 ? 1652 LEU A CA 1  
ATOM 313    C CA . LEU A 1 1653 ? 130.146 161.948 151.007 1.00 0.00 ? 1653 LEU A CA 1  
ATOM 314    C CA . GLU A 1 1654 ? 133.849 162.719 151.640 1.00 0.00 ? 1654 GLU A CA 1  
ATOM 315    C CA . LYS A 1 1655 ? 133.530 161.332 155.175 1.00 0.00 ? 1655 LYS A CA 1  
ATOM 316    C CA . PHE A 1 1656 ? 131.640 158.199 153.954 1.00 0.00 ? 1656 PHE A CA 1  
ATOM 317    C CA . GLN A 1 1657 ? 134.501 157.811 151.386 1.00 0.00 ? 1657 GLN A CA 1  
ATOM 318    C CA . ILE A 1 1658 ? 132.162 157.946 148.387 1.00 0.00 ? 1658 ILE A CA 1  
ATOM 319    C CA . ALA A 1 1659 ? 133.841 160.920 146.709 1.00 0.00 ? 1659 ALA A CA 1  
ATOM 320    C CA . LEU A 1 1660 ? 136.909 163.201 146.770 1.00 0.00 ? 1660 LEU A CA 1  
ATOM 321    C CA . PRO A 1 1661 ? 137.564 166.812 145.581 1.00 0.00 ? 1661 PRO A CA 1  
ATOM 322    C CA . ILE A 1 1662 ? 140.045 167.544 142.740 1.00 0.00 ? 1662 ILE A CA 1  
ATOM 323    C CA . GLY A 1 1663 ? 139.699 171.336 143.183 1.00 0.00 ? 1663 GLY A CA 1  
ATOM 324    C CA . GLU A 1 1664 ? 137.765 172.750 140.192 1.00 0.00 ? 1664 GLU A CA 1  
ATOM 325    C CA . GLU A 1 1665 ? 134.241 172.402 141.765 1.00 0.00 ? 1665 GLU A CA 1  
ATOM 326    C CA . TYR A 1 1666 ? 134.281 168.906 140.235 1.00 0.00 ? 1666 TYR A CA 1  
ATOM 327    C CA . LEU A 1 1667 ? 134.342 165.792 142.435 1.00 0.00 ? 1667 LEU A CA 1  
ATOM 328    C CA . LEU A 1 1668 ? 135.163 162.175 141.582 1.00 0.00 ? 1668 LEU A CA 1  
ATOM 329    C CA . VAL A 1 1669 ? 132.803 159.338 142.616 1.00 0.00 ? 1669 VAL A CA 1  
ATOM 330    C CA . ILE A 1 1690 ? 159.247 139.156 142.618 1.00 0.00 ? 1690 ILE A CA 1  
ATOM 331    C CA . ILE A 1 1691 ? 158.355 139.602 146.357 1.00 0.00 ? 1691 ILE A CA 1  
ATOM 332    C CA . ILE A 1 1692 ? 155.343 137.433 147.179 1.00 0.00 ? 1692 ILE A CA 1  
ATOM 333    C CA . ARG A 1 1693 ? 153.555 137.580 150.548 1.00 0.00 ? 1693 ARG A CA 1  
ATOM 334    C CA . LEU A 1 1694 ? 150.406 135.533 151.304 1.00 0.00 ? 1694 LEU A CA 1  
ATOM 335    C CA . TYR A 1 1695 ? 147.813 136.055 154.110 1.00 0.00 ? 1695 TYR A CA 1  
ATOM 336    C CA . GLU A 1 1696 ? 145.611 133.047 155.155 1.00 0.00 ? 1696 GLU A CA 1  
ATOM 337    C CA . MET A 1 1697 ? 142.224 133.900 156.743 1.00 0.00 ? 1697 MET A CA 1  
ATOM 338    C CA . PRO A 1 1698 ? 139.835 131.135 158.239 1.00 0.00 ? 1698 PRO A CA 1  
ATOM 339    C CA . TYR A 1 1699 ? 137.150 133.417 156.992 1.00 0.00 ? 1699 TYR A CA 1  
ATOM 340    C CA . PHE A 1 1700 ? 137.986 135.927 154.208 1.00 0.00 ? 1700 PHE A CA 1  
ATOM 341    C CA . PRO A 1 1701 ? 135.375 138.802 154.309 1.00 0.00 ? 1701 PRO A CA 1  
ATOM 342    C CA . MET A 1 1702 ? 134.128 139.604 150.797 1.00 0.00 ? 1702 MET A CA 1  
ATOM 343    C CA . GLY A 1 1703 ? 134.400 143.289 151.716 1.00 0.00 ? 1703 GLY A CA 1  
ATOM 344    C CA . PHE A 1 1704 ? 138.234 143.192 152.102 1.00 0.00 ? 1704 PHE A CA 1  
ATOM 345    C CA . TRP A 1 1705 ? 139.141 143.665 148.438 1.00 0.00 ? 1705 TRP A CA 1  
ATOM 346    C CA . SER A 1 1706 ? 136.373 146.142 147.804 1.00 0.00 ? 1706 SER A CA 1  
ATOM 347    C CA . ARG A 1 1707 ? 137.526 148.252 150.763 1.00 0.00 ? 1707 ARG A CA 1  
ATOM 348    C CA . LEU A 1 1708 ? 141.244 147.941 149.953 1.00 0.00 ? 1708 LEU A CA 1  
ATOM 349    C CA . ILE A 1 1709 ? 140.447 149.044 146.362 1.00 0.00 ? 1709 ILE A CA 1  
ATOM 350    C CA . ASN A 1 1710 ? 138.825 152.166 147.919 1.00 0.00 ? 1710 ASN A CA 1  
ATOM 351    C CA . ARG A 1 1711 ? 141.803 152.886 150.262 1.00 0.00 ? 1711 ARG A CA 1  
ATOM 352    C CA . LEU A 1 1712 ? 144.158 152.484 147.276 1.00 0.00 ? 1712 LEU A CA 1  
ATOM 353    C CA . LEU A 1 1713 ? 142.029 154.072 144.454 1.00 0.00 ? 1713 LEU A CA 1  
ATOM 354    C CA . GLU A 1 1714 ? 144.716 156.593 143.507 1.00 0.00 ? 1714 GLU A CA 1  
ATOM 355    C CA . ILE A 1 1715 ? 147.367 153.946 142.656 1.00 0.00 ? 1715 ILE A CA 1  
ATOM 356    C CA . SER A 1 1716 ? 145.231 151.622 140.465 1.00 0.00 ? 1716 SER A CA 1  
ATOM 357    C CA . PRO A 1 1717 ? 145.674 153.497 137.124 1.00 0.00 ? 1717 PRO A CA 1  
ATOM 358    C CA . TYR A 1 1718 ? 149.132 154.615 138.268 1.00 0.00 ? 1718 TYR A CA 1  
ATOM 359    C CA . MET A 1 1719 ? 150.612 157.233 140.558 1.00 0.00 ? 1719 MET A CA 1  
ATOM 360    C CA . LEU A 1 1720 ? 153.943 157.691 138.651 1.00 0.00 ? 1720 LEU A CA 1  
ATOM 361    C CA . SER A 1 1721 ? 154.162 159.318 135.248 1.00 0.00 ? 1721 SER A CA 1  
ATOM 362    C CA . GLY A 1 1722 ? 156.941 156.687 134.671 1.00 0.00 ? 1722 GLY A CA 1  
ATOM 363    C CA . ARG A 1 1723 ? 154.845 153.764 133.552 1.00 0.00 ? 1723 ARG A CA 1  
ATOM 364    C CA . GLU A 1 1724 ? 156.546 150.785 131.879 1.00 0.00 ? 1724 GLU A CA 1  
ATOM 365    C CA . ARG A 1 1725 ? 153.778 148.183 131.668 1.00 0.00 ? 1725 ARG A CA 1  
ATOM 366    C CA . ALA A 1 1726 ? 150.469 149.017 129.941 1.00 0.00 ? 1726 ALA A CA 1  
ATOM 367    C CA . LEU A 1 1727 ? 148.627 145.949 131.278 1.00 0.00 ? 1727 LEU A CA 1  
ATOM 368    C CA . ARG A 1 1728 ? 148.985 145.951 135.079 1.00 0.00 ? 1728 ARG A CA 1  
ATOM 369    C CA . PRO A 1 1729 ? 147.772 149.504 136.059 1.00 0.00 ? 1729 PRO A CA 1  
ATOM 370    C CA . ASN A 1 1730 ? 145.063 151.276 133.829 1.00 0.00 ? 1730 ASN A CA 1  
ATOM 371    C CA . ARG A 1 1731 ? 141.685 150.397 135.379 1.00 0.00 ? 1731 ARG A CA 1  
ATOM 372    C CA . MET A 1 1732 ? 143.028 146.972 136.060 1.00 0.00 ? 1732 MET A CA 1  
ATOM 373    C CA . TYR A 1 1733 ? 140.911 146.098 138.923 1.00 0.00 ? 1733 TYR A CA 1  
ATOM 374    C CA . TRP A 1 1734 ? 138.499 143.256 139.172 1.00 0.00 ? 1734 TRP A CA 1  
ATOM 375    C CA . ARG A 1 1735 ? 136.264 141.551 141.743 1.00 0.00 ? 1735 ARG A CA 1  
ATOM 376    C CA . GLN A 1 1736 ? 139.177 139.504 143.185 1.00 0.00 ? 1736 GLN A CA 1  
ATOM 377    C CA . GLY A 1 1737 ? 142.097 141.965 142.836 1.00 0.00 ? 1737 GLY A CA 1  
ATOM 378    C CA . ILE A 1 1738 ? 143.936 145.043 141.633 1.00 0.00 ? 1738 ILE A CA 1  
ATOM 379    C CA . TYR A 1 1739 ? 147.259 146.223 140.193 1.00 0.00 ? 1739 TYR A CA 1  
ATOM 380    C CA . LEU A 1 1740 ? 148.894 149.070 142.037 1.00 0.00 ? 1740 LEU A CA 1  
ATOM 381    C CA . ASN A 1 1741 ? 151.686 151.423 140.899 1.00 0.00 ? 1741 ASN A CA 1  
ATOM 382    C CA . TRP A 1 1742 ? 153.266 154.183 143.036 1.00 0.00 ? 1742 TRP A CA 1  
ATOM 383    C CA . SER A 1 1743 ? 155.810 156.980 142.656 1.00 0.00 ? 1743 SER A CA 1  
ATOM 384    C CA . PRO A 1 1744 ? 158.834 156.610 142.886 1.00 0.00 ? 1744 PRO A CA 1  
ATOM 385    C CA . GLU A 1 1745 ? 160.457 154.206 141.953 1.00 0.00 ? 1745 GLU A CA 1  
ATOM 386    C CA . ALA A 1 1746 ? 157.641 152.763 139.719 1.00 0.00 ? 1746 ALA A CA 1  
ATOM 387    C CA . TYR A 1 1747 ? 157.042 149.630 141.665 1.00 0.00 ? 1747 TYR A CA 1  
ATOM 388    C CA . CYS A 1 1748 ? 154.099 147.488 140.428 1.00 0.00 ? 1748 CYS A CA 1  
ATOM 389    C CA . LEU A 1 1749 ? 152.062 145.436 142.944 1.00 0.00 ? 1749 LEU A CA 1  
ATOM 390    C CA . VAL A 1 1750 ? 149.359 142.864 142.236 1.00 0.00 ? 1750 VAL A CA 1  
ATOM 391    C CA . GLY A 1 1751 ? 146.963 142.097 145.019 1.00 0.00 ? 1751 GLY A CA 1  
ATOM 392    C CA . SER A 1 1752 ? 144.759 139.049 144.435 1.00 0.00 ? 1752 SER A CA 1  
ATOM 393    C CA . GLU A 1 1753 ? 142.829 137.392 147.288 1.00 0.00 ? 1753 GLU A CA 1  
ATOM 394    C CA . VAL A 1 1754 ? 145.324 137.307 150.076 1.00 0.00 ? 1754 VAL A CA 1  
ATOM 395    C CA . LEU A 1 1755 ? 148.285 137.202 147.668 1.00 0.00 ? 1755 LEU A CA 1  
ATOM 396    C CA . ASP A 1 1756 ? 150.508 140.265 147.209 1.00 0.00 ? 1756 ASP A CA 1  
ATOM 397    C CA . ASN A 1 1757 ? 153.167 139.973 144.436 1.00 0.00 ? 1757 ASN A CA 1  
ATOM 398    C CA . HIS A 1 1758 ? 155.616 142.828 143.808 1.00 0.00 ? 1758 HIS A CA 1  
ATOM 399    C CA . PRO A 1 1759 ? 158.341 143.735 141.094 1.00 0.00 ? 1759 PRO A CA 1  
ATOM 400    C CA . GLU A 1 1760 ? 160.946 146.638 141.651 1.00 0.00 ? 1760 GLU A CA 1  
ATOM 401    C CA . SER A 1 1761 ? 163.917 147.366 143.986 1.00 0.00 ? 1761 SER A CA 1  
ATOM 402    C CA . PHE A 1 1762 ? 161.677 149.348 146.472 1.00 0.00 ? 1762 PHE A CA 1  
ATOM 403    C CA . LEU A 1 1763 ? 159.691 146.196 147.191 1.00 0.00 ? 1763 LEU A CA 1  
ATOM 404    C CA . LYS A 1 1764 ? 160.061 146.037 150.862 1.00 0.00 ? 1764 LYS A CA 1  
ATOM 405    C CA . ILE A 1 1765 ? 158.645 149.531 151.660 1.00 0.00 ? 1765 ILE A CA 1  
ATOM 406    C CA . THR A 1 1766 ? 155.666 149.047 149.325 1.00 0.00 ? 1766 THR A CA 1  
ATOM 407    C CA . VAL A 1 1767 ? 154.539 145.818 150.916 1.00 0.00 ? 1767 VAL A CA 1  
ATOM 408    C CA . PRO A 1 1768 ? 154.025 147.404 154.505 1.00 0.00 ? 1768 PRO A CA 1  
ATOM 409    C CA . SER A 1 1769 ? 151.927 150.198 153.160 1.00 0.00 ? 1769 SER A CA 1  
ATOM 410    C CA . CYS A 1 1770 ? 149.718 147.594 151.393 1.00 0.00 ? 1770 CYS A CA 1  
ATOM 411    C CA . ARG A 1 1771 ? 150.075 145.198 154.407 1.00 0.00 ? 1771 ARG A CA 1  
ATOM 412    C CA . LYS A 1 1772 ? 149.145 148.016 156.810 1.00 0.00 ? 1772 LYS A CA 1  
ATOM 413    C CA . GLY A 1 1773 ? 146.040 148.968 154.765 1.00 0.00 ? 1773 GLY A CA 1  
ATOM 414    C CA . CYS A 1 1774 ? 144.957 145.319 154.771 1.00 0.00 ? 1774 CYS A CA 1  
ATOM 415    C CA . ILE A 1 1775 ? 145.579 145.014 158.555 1.00 0.00 ? 1775 ILE A CA 1  
ATOM 416    C CA . LEU A 1 1776 ? 143.546 148.239 159.109 1.00 0.00 ? 1776 LEU A CA 1  
ATOM 417    C CA . LEU A 1 1777 ? 140.556 146.699 157.289 1.00 0.00 ? 1777 LEU A CA 1  
ATOM 418    C CA . GLY A 1 1778 ? 140.983 143.423 159.197 1.00 0.00 ? 1778 GLY A CA 1  
ATOM 419    C CA . GLN A 1 1779 ? 140.641 145.285 162.524 1.00 0.00 ? 1779 GLN A CA 1  
ATOM 420    C CA . VAL A 1 1780 ? 136.996 146.218 161.641 1.00 0.00 ? 1780 VAL A CA 1  
ATOM 421    C CA . VAL A 1 1781 ? 136.136 142.493 161.977 1.00 0.00 ? 1781 VAL A CA 1  
ATOM 422    C CA . ASP A 1 1782 ? 136.191 140.968 165.503 1.00 0.00 ? 1782 ASP A CA 1  
ATOM 423    C CA . HIS A 1 1783 ? 137.966 137.564 165.962 1.00 0.00 ? 1783 HIS A CA 1  
ATOM 424    C CA . ILE A 1 1784 ? 139.545 137.463 162.438 1.00 0.00 ? 1784 ILE A CA 1  
ATOM 425    C CA . ASP A 1 1785 ? 142.599 135.136 162.309 1.00 0.00 ? 1785 ASP A CA 1  
ATOM 426    C CA . SER A 1 1786 ? 145.281 135.891 159.683 1.00 0.00 ? 1786 SER A CA 1  
ATOM 427    C CA . LEU A 1 1787 ? 148.356 133.698 159.161 1.00 0.00 ? 1787 LEU A CA 1  
ATOM 428    C CA . MET A 1 1788 ? 151.095 135.192 157.004 1.00 0.00 ? 1788 MET A CA 1  
ATOM 429    C CA . GLU A 1 1789 ? 153.166 133.087 154.599 1.00 0.00 ? 1789 GLU A CA 1  
ATOM 430    C CA . GLU A 1 1790 ? 156.138 133.408 152.303 1.00 0.00 ? 1790 GLU A CA 1  
ATOM 431    C CA . TRP A 1 1791 ? 156.829 131.187 149.312 1.00 0.00 ? 1791 TRP A CA 1  
ATOM 432    C CA . PHE A 1 1792 ? 160.085 129.225 149.327 1.00 0.00 ? 1792 PHE A CA 1  
ATOM 433    C CA . PRO A 1 1793 ? 162.804 130.480 146.791 1.00 0.00 ? 1793 PRO A CA 1  
ATOM 434    C CA . GLY A 1 1794 ? 162.597 128.298 143.676 1.00 0.00 ? 1794 GLY A CA 1  
ATOM 435    C CA . LEU A 1 1795 ? 159.373 126.634 144.881 1.00 0.00 ? 1795 LEU A CA 1  
ATOM 436    C CA . LEU A 1 1796 ? 156.397 129.013 144.443 1.00 0.00 ? 1796 LEU A CA 1  
ATOM 437    C CA . GLU A 1 1797 ? 153.760 126.609 145.884 1.00 0.00 ? 1797 GLU A CA 1  
ATOM 438    C CA . ILE A 1 1798 ? 155.756 125.632 149.031 1.00 0.00 ? 1798 ILE A CA 1  
ATOM 439    C CA . ASP A 1 1799 ? 155.008 128.108 151.817 1.00 0.00 ? 1799 ASP A CA 1  
ATOM 440    C CA . ILE A 1 1800 ? 156.678 128.855 155.155 1.00 0.00 ? 1800 ILE A CA 1  
ATOM 441    C CA . CYS A 1 1801 ? 154.885 130.739 157.931 1.00 0.00 ? 1801 CYS A CA 1  
ATOM 442    C CA . GLY A 1 1802 ? 156.444 134.185 158.719 1.00 0.00 ? 1802 GLY A CA 1  
ATOM 443    C CA . GLU A 1 1803 ? 155.873 133.486 162.424 1.00 0.00 ? 1803 GLU A CA 1  
ATOM 444    C CA . GLY A 1 1804 ? 158.005 130.329 161.917 1.00 0.00 ? 1804 GLY A CA 1  
ATOM 445    C CA . GLU A 1 1805 ? 160.983 132.284 160.517 1.00 0.00 ? 1805 GLU A CA 1  
ATOM 446    C CA . THR A 1 1806 ? 160.793 135.001 163.243 1.00 0.00 ? 1806 THR A CA 1  
ATOM 447    C CA . LEU A 1 1807 ? 160.710 132.213 165.870 1.00 0.00 ? 1807 LEU A CA 1  
ATOM 448    C CA . LEU A 1 1808 ? 163.741 130.555 164.233 1.00 0.00 ? 1808 LEU A CA 1  
ATOM 449    C CA . LYS A 1 1809 ? 165.612 133.929 164.469 1.00 0.00 ? 1809 LYS A CA 1  
ATOM 450    C CA . LYS A 1 1810 ? 164.683 134.334 168.169 1.00 0.00 ? 1810 LYS A CA 1  
ATOM 451    C CA . TRP A 1 1811 ? 165.997 130.781 168.708 1.00 0.00 ? 1811 TRP A CA 1  
ATOM 452    C CA . ALA A 1 1812 ? 169.285 131.871 167.053 1.00 0.00 ? 1812 ALA A CA 1  
ATOM 453    C CA . LEU A 1 1813 ? 168.892 129.533 164.050 1.00 0.00 ? 1813 LEU A CA 1  
ATOM 454    C CA . TYR A 1 1814 ? 169.597 130.579 160.465 1.00 0.00 ? 1814 TYR A CA 1  
ATOM 455    C CA . SER A 1 1815 ? 168.565 127.317 158.767 1.00 0.00 ? 1815 SER A CA 1  
ATOM 456    C CA . PHE A 1 1816 ? 165.037 126.534 157.767 1.00 0.00 ? 1816 PHE A CA 1  
ATOM 457    C CA . ASN A 1 1817 ? 165.097 122.886 156.638 1.00 0.00 ? 1817 ASN A CA 1  
ATOM 458    C CA . ASP A 1 1818 ? 162.534 121.635 154.153 1.00 0.00 ? 1818 ASP A CA 1  
ATOM 459    C CA . GLY A 1 1819 ? 162.291 117.866 154.782 1.00 0.00 ? 1819 GLY A CA 1  
ATOM 460    C CA . GLU A 1 1820 ? 159.923 117.007 151.900 1.00 0.00 ? 1820 GLU A CA 1  
ATOM 461    C CA . GLU A 1 1821 ? 162.002 118.991 149.364 1.00 0.00 ? 1821 GLU A CA 1  
ATOM 462    C CA . HIS A 1 1822 ? 165.335 117.989 151.009 1.00 0.00 ? 1822 HIS A CA 1  
ATOM 463    C CA . GLN A 1 1823 ? 166.701 121.560 150.661 1.00 0.00 ? 1823 GLN A CA 1  
ATOM 464    C CA . LYS A 1 1824 ? 167.776 124.065 153.354 1.00 0.00 ? 1824 LYS A CA 1  
ATOM 465    C CA . ILE A 1 1825 ? 167.234 127.816 153.183 1.00 0.00 ? 1825 ILE A CA 1  
ATOM 466    C CA . LEU A 1 1826 ? 168.652 130.865 154.861 1.00 0.00 ? 1826 LEU A CA 1  
ATOM 467    C CA . LEU A 1 1827 ? 166.099 132.242 157.300 1.00 0.00 ? 1827 LEU A CA 1  
ATOM 468    C CA . ASP A 1 1828 ? 167.618 135.719 157.369 1.00 0.00 ? 1828 ASP A CA 1  
ATOM 469    C CA . ASP A 1 1829 ? 167.958 135.981 153.559 1.00 0.00 ? 1829 ASP A CA 1  
ATOM 470    C CA . LEU A 1 1830 ? 164.244 135.262 152.910 1.00 0.00 ? 1830 LEU A CA 1  
ATOM 471    C CA . MET A 1 1831 ? 163.159 137.326 155.966 1.00 0.00 ? 1831 MET A CA 1  
ATOM 472    C CA . LYS A 1 1832 ? 165.199 140.471 155.056 1.00 0.00 ? 1832 LYS A CA 1  
ATOM 473    C CA . LYS A 1 1833 ? 163.877 140.518 151.447 1.00 0.00 ? 1833 LYS A CA 1  
ATOM 474    C CA . ALA A 1 1834 ? 160.764 142.216 152.817 1.00 0.00 ? 1834 ALA A CA 1  
ATOM 475    C CA . GLU A 1 1835 ? 160.295 145.163 155.270 1.00 0.00 ? 1835 GLU A CA 1  
ATOM 476    C CA . GLU A 1 1836 ? 160.737 142.948 158.339 1.00 0.00 ? 1836 GLU A CA 1  
ATOM 477    C CA . GLY A 1 1837 ? 164.503 143.554 158.612 1.00 0.00 ? 1837 GLY A CA 1  
ATOM 478    C CA . PHE A 1 1883 ? 174.662 145.246 181.525 1.00 0.00 ? 1883 PHE A CA 1  
ATOM 479    C CA . LEU A 1 1884 ? 170.877 144.600 181.902 1.00 0.00 ? 1884 LEU A CA 1  
ATOM 480    C CA . LEU A 1 1885 ? 168.472 147.422 183.015 1.00 0.00 ? 1885 LEU A CA 1  
ATOM 481    C CA . GLY A 1 1886 ? 165.200 145.974 181.657 1.00 0.00 ? 1886 GLY A CA 1  
ATOM 482    C CA . ASP A 1 1887 ? 161.795 147.223 182.770 1.00 0.00 ? 1887 ASP A CA 1  
ATOM 483    C CA . GLY A 1 1888 ? 160.453 146.490 179.207 1.00 0.00 ? 1888 GLY A CA 1  
ATOM 484    C CA . SER A 1 1889 ? 156.935 146.053 177.756 1.00 0.00 ? 1889 SER A CA 1  
ATOM 485    C CA . PHE A 1 1890 ? 157.795 143.123 175.462 1.00 0.00 ? 1890 PHE A CA 1  
ATOM 486    C CA . GLY A 1 1891 ? 161.315 142.162 176.554 1.00 0.00 ? 1891 GLY A CA 1  
ATOM 487    C CA . SER A 1 1892 ? 164.589 143.040 178.250 1.00 0.00 ? 1892 SER A CA 1  
ATOM 488    C CA . VAL A 1 1893 ? 166.458 146.376 177.974 1.00 0.00 ? 1893 VAL A CA 1  
ATOM 489    C CA . TYR A 1 1894 ? 170.292 146.328 177.950 1.00 0.00 ? 1894 TYR A CA 1  
ATOM 490    C CA . ARG A 1 1895 ? 172.978 149.000 178.162 1.00 0.00 ? 1895 ARG A CA 1  
ATOM 491    C CA . ALA A 1 1896 ? 175.859 148.594 175.715 1.00 0.00 ? 1896 ALA A CA 1  
ATOM 492    C CA . ALA A 1 1897 ? 177.957 150.502 173.159 1.00 0.00 ? 1897 ALA A CA 1  
ATOM 493    C CA . TYR A 1 1898 ? 178.412 150.615 169.345 1.00 0.00 ? 1898 TYR A CA 1  
ATOM 494    C CA . GLU A 1 1899 ? 181.944 149.252 168.649 1.00 0.00 ? 1899 GLU A CA 1  
ATOM 495    C CA . GLY A 1 1900 ? 182.729 151.837 165.898 1.00 0.00 ? 1900 GLY A CA 1  
ATOM 496    C CA . GLU A 1 1901 ? 181.821 155.072 167.783 1.00 0.00 ? 1901 GLU A CA 1  
ATOM 497    C CA . GLU A 1 1902 ? 181.906 154.148 171.511 1.00 0.00 ? 1902 GLU A CA 1  
ATOM 498    C CA . VAL A 1 1903 ? 178.354 155.744 171.515 1.00 0.00 ? 1903 VAL A CA 1  
ATOM 499    C CA . ALA A 1 1904 ? 176.408 154.485 174.523 1.00 0.00 ? 1904 ALA A CA 1  
ATOM 500    C CA . VAL A 1 1905 ? 173.376 152.562 173.482 1.00 0.00 ? 1905 VAL A CA 1  
ATOM 501    C CA . LYS A 1 1906 ? 170.129 151.085 174.831 1.00 0.00 ? 1906 LYS A CA 1  
ATOM 502    C CA . ILE A 1 1907 ? 169.010 147.716 173.364 1.00 0.00 ? 1907 ILE A CA 1  
ATOM 503    C CA . PHE A 1 1908 ? 165.405 146.525 173.615 1.00 0.00 ? 1908 PHE A CA 1  
ATOM 504    C CA . ASN A 1 1909 ? 164.867 142.839 172.687 1.00 0.00 ? 1909 ASN A CA 1  
ATOM 505    C CA . LYS A 1 1910 ? 162.501 139.811 172.433 1.00 0.00 ? 1910 LYS A CA 1  
ATOM 506    C CA . HIS A 1 1911 ? 160.006 141.864 170.628 1.00 0.00 ? 1911 HIS A CA 1  
ATOM 507    C CA . THR A 1 1912 ? 160.363 140.299 167.144 1.00 0.00 ? 1912 THR A CA 1  
ATOM 508    C CA . SER A 1 1913 ? 156.915 138.902 166.482 1.00 0.00 ? 1913 SER A CA 1  
ATOM 509    C CA . LEU A 1 1914 ? 154.899 141.669 168.123 1.00 0.00 ? 1914 LEU A CA 1  
ATOM 510    C CA . ARG A 1 1915 ? 152.632 144.174 166.396 1.00 0.00 ? 1915 ARG A CA 1  
ATOM 511    C CA . LEU A 1 1916 ? 153.677 146.867 168.952 1.00 0.00 ? 1916 LEU A CA 1  
ATOM 512    C CA . LEU A 1 1917 ? 157.463 146.472 168.143 1.00 0.00 ? 1917 LEU A CA 1  
ATOM 513    C CA . ARG A 1 1918 ? 156.721 146.634 164.479 1.00 0.00 ? 1918 ARG A CA 1  
ATOM 514    C CA . GLN A 1 1919 ? 154.817 149.875 164.910 1.00 0.00 ? 1919 GLN A CA 1  
ATOM 515    C CA . GLU A 1 1920 ? 157.600 151.288 167.127 1.00 0.00 ? 1920 GLU A CA 1  
ATOM 516    C CA . LEU A 1 1921 ? 160.269 150.438 164.483 1.00 0.00 ? 1921 LEU A CA 1  
ATOM 517    C CA . VAL A 1 1922 ? 158.105 151.859 161.629 1.00 0.00 ? 1922 VAL A CA 1  
ATOM 518    C CA . VAL A 1 1923 ? 157.335 155.136 163.519 1.00 0.00 ? 1923 VAL A CA 1  
ATOM 519    C CA . LEU A 1 1924 ? 160.952 155.673 164.699 1.00 0.00 ? 1924 LEU A CA 1  
ATOM 520    C CA . CYS A 1 1925 ? 162.510 154.989 161.232 1.00 0.00 ? 1925 CYS A CA 1  
ATOM 521    C CA . HIS A 1 1926 ? 161.394 158.399 159.852 1.00 0.00 ? 1926 HIS A CA 1  
ATOM 522    C CA . LEU A 1 1927 ? 162.016 160.479 163.034 1.00 0.00 ? 1927 LEU A CA 1  
ATOM 523    C CA . HIS A 1 1928 ? 165.303 162.405 163.332 1.00 0.00 ? 1928 HIS A CA 1  
ATOM 524    C CA . HIS A 1 1929 ? 165.117 165.318 165.815 1.00 0.00 ? 1929 HIS A CA 1  
ATOM 525    C CA . PRO A 1 1930 ? 167.286 166.228 168.871 1.00 0.00 ? 1930 PRO A CA 1  
ATOM 526    C CA . SER A 1 1931 ? 164.394 166.091 171.368 1.00 0.00 ? 1931 SER A CA 1  
ATOM 527    C CA . LEU A 1 1932 ? 163.206 162.637 170.227 1.00 0.00 ? 1932 LEU A CA 1  
ATOM 528    C CA . ILE A 1 1933 ? 164.969 159.392 171.244 1.00 0.00 ? 1933 ILE A CA 1  
ATOM 529    C CA . SER A 1 1934 ? 166.906 158.326 168.136 1.00 0.00 ? 1934 SER A CA 1  
ATOM 530    C CA . LEU A 1 1935 ? 166.757 154.834 166.681 1.00 0.00 ? 1935 LEU A CA 1  
ATOM 531    C CA . LEU A 1 1936 ? 170.264 153.803 165.588 1.00 0.00 ? 1936 LEU A CA 1  
ATOM 532    C CA . ALA A 1 1937 ? 169.651 150.373 164.071 1.00 0.00 ? 1937 ALA A CA 1  
ATOM 533    C CA . ALA A 1 1938 ? 167.826 147.033 164.146 1.00 0.00 ? 1938 ALA A CA 1  
ATOM 534    C CA . GLY A 1 1939 ? 169.259 143.628 165.186 1.00 0.00 ? 1939 GLY A CA 1  
ATOM 535    C CA . ILE A 1 1940 ? 167.986 140.072 164.534 1.00 0.00 ? 1940 ILE A CA 1  
ATOM 536    C CA . ARG A 1 1941 ? 168.045 136.763 166.491 1.00 0.00 ? 1941 ARG A CA 1  
ATOM 537    C CA . PRO A 1 1942 ? 166.355 138.006 168.646 1.00 0.00 ? 1942 PRO A CA 1  
ATOM 538    C CA . ARG A 1 1943 ? 164.948 141.186 167.071 1.00 0.00 ? 1943 ARG A CA 1  
ATOM 539    C CA . MET A 1 1944 ? 166.432 144.284 168.745 1.00 0.00 ? 1944 MET A CA 1  
ATOM 540    C CA . LEU A 1 1945 ? 165.864 148.015 168.543 1.00 0.00 ? 1945 LEU A CA 1  
ATOM 541    C CA . VAL A 1 1946 ? 169.124 149.795 169.261 1.00 0.00 ? 1946 VAL A CA 1  
ATOM 542    C CA . MET A 1 1947 ? 168.332 153.284 170.640 1.00 0.00 ? 1947 MET A CA 1  
ATOM 543    C CA . GLU A 1 1948 ? 170.499 156.178 171.924 1.00 0.00 ? 1948 GLU A CA 1  
ATOM 544    C CA . LEU A 1 1949 ? 171.159 155.881 175.682 1.00 0.00 ? 1949 LEU A CA 1  
ATOM 545    C CA . ALA A 1 1950 ? 169.657 158.774 177.657 1.00 0.00 ? 1950 ALA A CA 1  
ATOM 546    C CA . SER A 1 1951 ? 171.670 159.023 180.857 1.00 0.00 ? 1951 SER A CA 1  
ATOM 547    C CA . LYS A 1 1952 ? 169.719 160.877 183.587 1.00 0.00 ? 1952 LYS A CA 1  
ATOM 548    C CA . GLY A 1 1953 ? 166.590 158.692 183.782 1.00 0.00 ? 1953 GLY A CA 1  
ATOM 549    C CA . SER A 1 1954 ? 163.008 159.864 183.235 1.00 0.00 ? 1954 SER A CA 1  
ATOM 550    C CA . LEU A 1 1955 ? 161.031 162.989 184.190 1.00 0.00 ? 1955 LEU A CA 1  
ATOM 551    C CA . ASP A 1 1956 ? 158.536 161.076 186.405 1.00 0.00 ? 1956 ASP A CA 1  
ATOM 552    C CA . ARG A 1 1957 ? 161.222 159.612 188.730 1.00 0.00 ? 1957 ARG A CA 1  
ATOM 553    C CA . LEU A 1 1958 ? 163.127 162.909 188.932 1.00 0.00 ? 1958 LEU A CA 1  
ATOM 554    C CA . LEU A 1 1959 ? 159.981 164.874 189.914 1.00 0.00 ? 1959 LEU A CA 1  
ATOM 555    C CA . GLN A 1 1960 ? 159.475 162.407 192.832 1.00 0.00 ? 1960 GLN A CA 1  
ATOM 556    C CA . GLN A 1 1961 ? 162.618 163.959 194.465 1.00 0.00 ? 1961 GLN A CA 1  
ATOM 557    C CA . ASP A 1 1962 ? 160.761 166.742 196.422 1.00 0.00 ? 1962 ASP A CA 1  
ATOM 558    C CA . LYS A 1 1963 ? 163.892 167.596 198.506 1.00 0.00 ? 1963 LYS A CA 1  
ATOM 559    C CA . ALA A 1 1964 ? 165.788 168.634 195.344 1.00 0.00 ? 1964 ALA A CA 1  
ATOM 560    C CA . SER A 1 1965 ? 163.342 170.748 193.324 1.00 0.00 ? 1965 SER A CA 1  
ATOM 561    C CA . LEU A 1 1966 ? 164.180 171.509 189.682 1.00 0.00 ? 1966 LEU A CA 1  
ATOM 562    C CA . THR A 1 1967 ? 165.223 175.152 189.315 1.00 0.00 ? 1967 THR A CA 1  
ATOM 563    C CA . ARG A 1 1968 ? 162.923 177.380 187.246 1.00 0.00 ? 1968 ARG A CA 1  
ATOM 564    C CA . THR A 1 1969 ? 165.384 178.002 184.343 1.00 0.00 ? 1969 THR A CA 1  
ATOM 565    C CA . LEU A 1 1970 ? 165.745 174.252 183.920 1.00 0.00 ? 1970 LEU A CA 1  
ATOM 566    C CA . GLN A 1 1971 ? 161.933 173.683 184.135 1.00 0.00 ? 1971 GLN A CA 1  
ATOM 567    C CA . HIS A 1 1972 ? 161.603 176.127 181.191 1.00 0.00 ? 1972 HIS A CA 1  
ATOM 568    C CA . ARG A 1 1973 ? 164.299 174.205 179.246 1.00 0.00 ? 1973 ARG A CA 1  
ATOM 569    C CA . ILE A 1 1974 ? 162.372 170.913 179.856 1.00 0.00 ? 1974 ILE A CA 1  
ATOM 570    C CA . ALA A 1 1975 ? 159.053 172.499 178.740 1.00 0.00 ? 1975 ALA A CA 1  
ATOM 571    C CA . LEU A 1 1976 ? 160.557 173.875 175.482 1.00 0.00 ? 1976 LEU A CA 1  
ATOM 572    C CA . HIS A 1 1977 ? 162.454 170.640 174.601 1.00 0.00 ? 1977 HIS A CA 1  
ATOM 573    C CA . VAL A 1 1978 ? 159.317 168.510 174.897 1.00 0.00 ? 1978 VAL A CA 1  
ATOM 574    C CA . ALA A 1 1979 ? 157.405 171.191 172.920 1.00 0.00 ? 1979 ALA A CA 1  
ATOM 575    C CA . ASP A 1 1980 ? 159.984 171.132 170.056 1.00 0.00 ? 1980 ASP A CA 1  
ATOM 576    C CA . GLY A 1 1981 ? 159.839 167.301 169.870 1.00 0.00 ? 1981 GLY A CA 1  
ATOM 577    C CA . LEU A 1 1982 ? 156.025 167.435 169.678 1.00 0.00 ? 1982 LEU A CA 1  
ATOM 578    C CA . ARG A 1 1983 ? 156.333 170.345 167.166 1.00 0.00 ? 1983 ARG A CA 1  
ATOM 579    C CA . TYR A 1 1984 ? 158.623 168.214 164.942 1.00 0.00 ? 1984 TYR A CA 1  
ATOM 580    C CA . LEU A 1 1985 ? 155.980 165.524 165.393 1.00 0.00 ? 1985 LEU A CA 1  
ATOM 581    C CA . HIS A 1 1986 ? 153.254 167.933 164.255 1.00 0.00 ? 1986 HIS A CA 1  
ATOM 582    C CA . SER A 1 1987 ? 155.225 168.371 160.967 1.00 0.00 ? 1987 SER A CA 1  
ATOM 583    C CA . ALA A 1 1988 ? 155.278 164.598 160.318 1.00 0.00 ? 1988 ALA A CA 1  
ATOM 584    C CA . MET A 1 1989 ? 151.537 164.113 161.266 1.00 0.00 ? 1989 MET A CA 1  
ATOM 585    C CA . ILE A 1 1990 ? 152.228 161.436 163.925 1.00 0.00 ? 1990 ILE A CA 1  
ATOM 586    C CA . ILE A 1 1991 ? 150.132 160.899 167.120 1.00 0.00 ? 1991 ILE A CA 1  
ATOM 587    C CA . TYR A 1 1992 ? 152.108 159.545 170.121 1.00 0.00 ? 1992 TYR A CA 1  
ATOM 588    C CA . ARG A 1 1993 ? 149.172 158.673 172.472 1.00 0.00 ? 1993 ARG A CA 1  
ATOM 589    C CA . ASP A 1 1994 ? 151.296 157.776 175.545 1.00 0.00 ? 1994 ASP A CA 1  
ATOM 590    C CA . LEU A 1 1995 ? 152.686 161.217 176.459 1.00 0.00 ? 1995 LEU A CA 1  
ATOM 591    C CA . LYS A 1 1996 ? 153.237 161.129 180.239 1.00 0.00 ? 1996 LYS A CA 1  
ATOM 592    C CA . PRO A 1 1997 ? 156.355 161.958 182.338 1.00 0.00 ? 1997 PRO A CA 1  
ATOM 593    C CA . HIS A 1 1998 ? 157.641 158.343 182.466 1.00 0.00 ? 1998 HIS A CA 1  
ATOM 594    C CA . ASN A 1 1999 ? 158.091 158.566 178.669 1.00 0.00 ? 1999 ASN A CA 1  
ATOM 595    C CA . VAL A 1 2000 ? 160.096 161.817 178.864 1.00 0.00 ? 2000 VAL A CA 1  
ATOM 596    C CA . LEU A 1 2001 ? 163.779 160.847 179.092 1.00 0.00 ? 2001 LEU A CA 1  
ATOM 597    C CA . LEU A 1 2002 ? 166.318 163.211 180.536 1.00 0.00 ? 2002 LEU A CA 1  
ATOM 598    C CA . PHE A 1 2003 ? 169.598 163.753 178.719 1.00 0.00 ? 2003 PHE A CA 1  
ATOM 599    C CA . THR A 1 2004 ? 170.975 166.521 180.933 1.00 0.00 ? 2004 THR A CA 1  
ATOM 600    C CA . LEU A 1 2005 ? 169.696 168.794 183.798 1.00 0.00 ? 2005 LEU A CA 1  
ATOM 601    C CA . TYR A 1 2006 ? 172.310 171.579 183.340 1.00 0.00 ? 2006 TYR A CA 1  
ATOM 602    C CA . PRO A 1 2007 ? 170.360 174.604 181.945 1.00 0.00 ? 2007 PRO A CA 1  
ATOM 603    C CA . ASN A 1 2008 ? 173.019 175.398 179.266 1.00 0.00 ? 2008 ASN A CA 1  
ATOM 604    C CA . ALA A 1 2009 ? 173.051 171.829 177.842 1.00 0.00 ? 2009 ALA A CA 1  
ATOM 605    C CA . ALA A 1 2010 ? 172.376 171.299 174.124 1.00 0.00 ? 2010 ALA A CA 1  
ATOM 606    C CA . ILE A 1 2011 ? 169.566 168.840 174.970 1.00 0.00 ? 2011 ILE A CA 1  
ATOM 607    C CA . ILE A 1 2012 ? 167.761 168.367 178.331 1.00 0.00 ? 2012 ILE A CA 1  
ATOM 608    C CA . ALA A 1 2013 ? 164.745 166.245 177.488 1.00 0.00 ? 2013 ALA A CA 1  
ATOM 609    C CA . LYS A 1 2014 ? 163.756 163.785 174.801 1.00 0.00 ? 2014 LYS A CA 1  
ATOM 610    C CA . ILE A 1 2015 ? 160.381 162.167 174.036 1.00 0.00 ? 2015 ILE A CA 1  
ATOM 611    C CA . ALA A 1 2016 ? 160.480 158.329 174.109 1.00 0.00 ? 2016 ALA A CA 1  
ATOM 612    C CA . ASP A 1 2017 ? 158.354 155.156 173.943 1.00 0.00 ? 2017 ASP A CA 1  
ATOM 613    C CA . TYR A 1 2018 ? 156.383 155.392 170.718 1.00 0.00 ? 2018 TYR A CA 1  
ATOM 614    C CA . GLY A 1 2019 ? 154.975 151.848 170.884 1.00 0.00 ? 2019 GLY A CA 1  
ATOM 615    C CA . THR A 1 2020 ? 151.367 152.979 170.681 1.00 0.00 ? 2020 THR A CA 1  
ATOM 616    C CA . ALA A 1 2021 ? 151.845 155.762 168.055 1.00 0.00 ? 2021 ALA A CA 1  
ATOM 617    C CA . GLN A 1 2022 ? 149.765 156.397 164.874 1.00 0.00 ? 2022 GLN A CA 1  
ATOM 618    C CA . TYR A 1 2023 ? 150.616 158.066 161.577 1.00 0.00 ? 2023 TYR A CA 1  
ATOM 619    C CA . CYS A 1 2024 ? 147.599 157.915 159.289 1.00 0.00 ? 2024 CYS A CA 1  
ATOM 620    C CA . CYS A 1 2025 ? 145.926 159.978 156.535 1.00 0.00 ? 2025 CYS A CA 1  
ATOM 621    C CA . ARG A 1 2026 ? 142.585 158.790 157.940 1.00 0.00 ? 2026 ARG A CA 1  
ATOM 622    C CA . MET A 1 2027 ? 140.917 159.465 161.282 1.00 0.00 ? 2027 MET A CA 1  
ATOM 623    C CA . GLY A 1 2028 ? 142.621 157.889 164.351 1.00 0.00 ? 2028 GLY A CA 1  
ATOM 624    C CA . ILE A 1 2029 ? 140.723 156.001 167.097 1.00 0.00 ? 2029 ILE A CA 1  
ATOM 625    C CA . LYS A 1 2030 ? 141.567 154.171 170.420 1.00 0.00 ? 2030 LYS A CA 1  
ATOM 626    C CA . THR A 1 2031 ? 140.109 152.737 173.764 1.00 0.00 ? 2031 THR A CA 1  
ATOM 627    C CA . SER A 1 2032 ? 143.105 151.063 175.279 1.00 0.00 ? 2032 SER A CA 1  
ATOM 628    C CA . GLU A 1 2033 ? 145.317 153.945 176.432 1.00 0.00 ? 2033 GLU A CA 1  
ATOM 629    C CA . GLY A 1 2034 ? 143.352 153.621 179.682 1.00 0.00 ? 2034 GLY A CA 1  
ATOM 630    C CA . THR A 1 2035 ? 145.568 155.974 181.820 1.00 0.00 ? 2035 THR A CA 1  
ATOM 631    C CA . PRO A 1 2036 ? 143.117 158.898 181.673 1.00 0.00 ? 2036 PRO A CA 1  
ATOM 632    C CA . GLY A 1 2037 ? 144.866 161.354 184.061 1.00 0.00 ? 2037 GLY A CA 1  
ATOM 633    C CA . PHE A 1 2038 ? 147.177 162.178 181.127 1.00 0.00 ? 2038 PHE A CA 1  
ATOM 634    C CA . ARG A 1 2039 ? 144.805 161.470 178.187 1.00 0.00 ? 2039 ARG A CA 1  
ATOM 635    C CA . ALA A 1 2040 ? 142.400 163.683 176.242 1.00 0.00 ? 2040 ALA A CA 1  
ATOM 636    C CA . PRO A 1 2041 ? 138.588 163.438 176.969 1.00 0.00 ? 2041 PRO A CA 1  
ATOM 637    C CA . GLU A 1 2042 ? 137.953 161.271 173.851 1.00 0.00 ? 2042 GLU A CA 1  
ATOM 638    C CA . VAL A 1 2043 ? 138.895 158.356 176.239 1.00 0.00 ? 2043 VAL A CA 1  
ATOM 639    C CA . ALA A 1 2044 ? 135.165 157.795 176.628 1.00 0.00 ? 2044 ALA A CA 1  
ATOM 640    C CA . ARG A 1 2045 ? 135.069 154.719 174.230 1.00 0.00 ? 2045 ARG A CA 1  
ATOM 641    C CA . GLY A 1 2046 ? 136.315 153.194 170.831 1.00 0.00 ? 2046 GLY A CA 1  
ATOM 642    C CA . ASN A 1 2047 ? 133.544 154.694 168.815 1.00 0.00 ? 2047 ASN A CA 1  
ATOM 643    C CA . VAL A 1 2048 ? 135.055 158.240 168.655 1.00 0.00 ? 2048 VAL A CA 1  
ATOM 644    C CA . ILE A 1 2049 ? 137.764 159.643 166.396 1.00 0.00 ? 2049 ILE A CA 1  
ATOM 645    C CA . TYR A 1 2050 ? 140.555 162.050 167.229 1.00 0.00 ? 2050 TYR A CA 1  
ATOM 646    C CA . ASN A 1 2051 ? 143.824 163.634 165.979 1.00 0.00 ? 2051 ASN A CA 1  
ATOM 647    C CA . GLN A 1 2052 ? 147.273 164.967 167.147 1.00 0.00 ? 2052 GLN A CA 1  
ATOM 648    C CA . GLN A 1 2053 ? 145.263 167.365 169.312 1.00 0.00 ? 2053 GLN A CA 1  
ATOM 649    C CA . ALA A 1 2054 ? 145.040 164.433 171.779 1.00 0.00 ? 2054 ALA A CA 1  
ATOM 650    C CA . ASP A 1 2055 ? 148.857 164.679 172.298 1.00 0.00 ? 2055 ASP A CA 1  
ATOM 651    C CA . VAL A 1 2056 ? 148.479 168.492 172.717 1.00 0.00 ? 2056 VAL A CA 1  
ATOM 652    C CA . TYR A 1 2057 ? 146.223 167.699 175.721 1.00 0.00 ? 2057 TYR A CA 1  
ATOM 653    C CA . SER A 1 2058 ? 148.811 165.178 177.077 1.00 0.00 ? 2058 SER A CA 1  
ATOM 654    C CA . PHE A 1 2059 ? 151.453 167.953 176.717 1.00 0.00 ? 2059 PHE A CA 1  
ATOM 655    C CA . GLY A 1 2060 ? 149.376 170.347 178.937 1.00 0.00 ? 2060 GLY A CA 1  
ATOM 656    C CA . LEU A 1 2061 ? 149.504 167.698 181.669 1.00 0.00 ? 2061 LEU A CA 1  
ATOM 657    C CA . LEU A 1 2062 ? 153.318 167.419 181.141 1.00 0.00 ? 2062 LEU A CA 1  
ATOM 658    C CA . LEU A 1 2063 ? 153.587 171.211 181.641 1.00 0.00 ? 2063 LEU A CA 1  
ATOM 659    C CA . TYR A 1 2064 ? 151.440 170.975 184.823 1.00 0.00 ? 2064 TYR A CA 1  
ATOM 660    C CA . ASP A 1 2065 ? 153.606 168.129 186.273 1.00 0.00 ? 2065 ASP A CA 1  
ATOM 661    C CA . ILE A 1 2066 ? 156.879 170.089 185.505 1.00 0.00 ? 2066 ILE A CA 1  
ATOM 662    C CA . LEU A 1 2067 ? 155.437 173.353 186.947 1.00 0.00 ? 2067 LEU A CA 1  
ATOM 663    C CA . THR A 1 2068 ? 154.121 171.772 190.146 1.00 0.00 ? 2068 THR A CA 1  
ATOM 664    C CA . THR A 1 2069 ? 156.269 168.624 190.747 1.00 0.00 ? 2069 THR A CA 1  
ATOM 665    C CA . GLY A 1 2070 ? 152.890 166.857 191.321 1.00 0.00 ? 2070 GLY A CA 1  
ATOM 666    C CA . GLY A 1 2071 ? 150.905 164.224 189.372 1.00 0.00 ? 2071 GLY A CA 1  
ATOM 667    C CA . ARG A 1 2072 ? 147.701 162.159 189.601 1.00 0.00 ? 2072 ARG A CA 1  
ATOM 668    C CA . ILE A 1 2073 ? 146.438 158.929 187.906 1.00 0.00 ? 2073 ILE A CA 1  
ATOM 669    C CA . VAL A 1 2074 ? 142.709 158.255 188.151 1.00 0.00 ? 2074 VAL A CA 1  
ATOM 670    C CA . GLU A 1 2075 ? 140.541 155.319 186.919 1.00 0.00 ? 2075 GLU A CA 1  
ATOM 671    C CA . GLY A 1 2076 ? 136.752 154.620 187.068 1.00 0.00 ? 2076 GLY A CA 1  
ATOM 672    C CA . LEU A 1 2077 ? 133.445 156.085 185.833 1.00 0.00 ? 2077 LEU A CA 1  
ATOM 673    C CA . LYS A 1 2078 ? 132.789 159.277 187.833 1.00 0.00 ? 2078 LYS A CA 1  
ATOM 674    C CA . PHE A 1 2079 ? 136.337 160.595 187.116 1.00 0.00 ? 2079 PHE A CA 1  
ATOM 675    C CA . PRO A 1 2080 ? 136.060 160.189 183.235 1.00 0.00 ? 2080 PRO A CA 1  
ATOM 676    C CA . ASN A 1 2081 ? 132.541 161.763 183.310 1.00 0.00 ? 2081 ASN A CA 1  
ATOM 677    C CA . GLU A 1 2082 ? 133.980 164.673 185.320 1.00 0.00 ? 2082 GLU A CA 1  
ATOM 678    C CA . PHE A 1 2083 ? 136.929 165.103 182.921 1.00 0.00 ? 2083 PHE A CA 1  
ATOM 679    C CA . ASP A 1 2084 ? 134.792 164.693 179.727 1.00 0.00 ? 2084 ASP A CA 1  
ATOM 680    C CA . GLU A 1 2085 ? 131.485 166.490 180.635 1.00 0.00 ? 2085 GLU A CA 1  
ATOM 681    C CA . LEU A 1 2086 ? 132.301 168.795 183.624 1.00 0.00 ? 2086 LEU A CA 1  
ATOM 682    C CA . GLU A 1 2087 ? 135.645 170.270 182.372 1.00 0.00 ? 2087 GLU A CA 1  
ATOM 683    C CA . ILE A 1 2088 ? 137.683 168.902 185.364 1.00 0.00 ? 2088 ILE A CA 1  
ATOM 684    C CA . GLN A 1 2089 ? 141.401 169.502 184.920 1.00 0.00 ? 2089 GLN A CA 1  
ATOM 685    C CA . GLY A 1 2090 ? 144.367 169.931 187.270 1.00 0.00 ? 2090 GLY A CA 1  
ATOM 686    C CA . LYS A 1 2091 ? 144.157 173.737 186.989 1.00 0.00 ? 2091 LYS A CA 1  
ATOM 687    C CA . LEU A 1 2092 ? 140.355 173.971 187.525 1.00 0.00 ? 2092 LEU A CA 1  
ATOM 688    C CA . PRO A 1 2093 ? 140.165 171.836 190.766 1.00 0.00 ? 2093 PRO A CA 1  
ATOM 689    C CA . ASP A 1 2094 ? 143.074 173.730 192.371 1.00 0.00 ? 2094 ASP A CA 1  
ATOM 690    C CA . PRO A 1 2095 ? 142.900 177.542 191.480 1.00 0.00 ? 2095 PRO A CA 1  
ATOM 691    C CA . VAL A 1 2096 ? 144.771 178.381 194.729 1.00 0.00 ? 2096 VAL A CA 1  
ATOM 692    C CA . LYS A 1 2097 ? 147.652 175.926 194.058 1.00 0.00 ? 2097 LYS A CA 1  
ATOM 693    C CA . GLU A 1 2098 ? 148.458 177.511 190.712 1.00 0.00 ? 2098 GLU A CA 1  
ATOM 694    C CA . TYR A 1 2099 ? 146.822 181.063 190.605 1.00 0.00 ? 2099 TYR A CA 1  
ATOM 695    C CA . GLY A 1 2100 ? 147.663 181.885 194.304 1.00 0.00 ? 2100 GLY A CA 1  
ATOM 696    C CA . CYS A 1 2101 ? 151.384 181.224 193.677 1.00 0.00 ? 2101 CYS A CA 1  
ATOM 697    C CA . ALA A 1 2102 ? 151.194 183.455 190.559 1.00 0.00 ? 2102 ALA A CA 1  
ATOM 698    C CA . PRO A 1 2103 ? 152.608 181.115 187.772 1.00 0.00 ? 2103 PRO A CA 1  
ATOM 699    C CA . TRP A 1 2104 ? 153.483 183.290 184.716 1.00 0.00 ? 2104 TRP A CA 1  
ATOM 700    C CA . PRO A 1 2105 ? 150.164 184.279 182.984 1.00 0.00 ? 2105 PRO A CA 1  
ATOM 701    C CA . MET A 1 2106 ? 151.493 183.202 179.550 1.00 0.00 ? 2106 MET A CA 1  
ATOM 702    C CA . VAL A 1 2107 ? 152.308 179.679 180.939 1.00 0.00 ? 2107 VAL A CA 1  
ATOM 703    C CA . GLU A 1 2108 ? 148.832 179.569 182.515 1.00 0.00 ? 2108 GLU A CA 1  
ATOM 704    C CA . LYS A 1 2109 ? 147.157 180.558 179.201 1.00 0.00 ? 2109 LYS A CA 1  
ATOM 705    C CA . LEU A 1 2110 ? 149.119 177.896 177.298 1.00 0.00 ? 2110 LEU A CA 1  
ATOM 706    C CA . ILE A 1 2111 ? 148.208 175.058 179.759 1.00 0.00 ? 2111 ILE A CA 1  
ATOM 707    C CA . LYS A 1 2112 ? 144.510 176.121 179.669 1.00 0.00 ? 2112 LYS A CA 1  
ATOM 708    C CA . GLN A 1 2113 ? 144.385 176.281 175.849 1.00 0.00 ? 2113 GLN A CA 1  
ATOM 709    C CA . CYS A 1 2114 ? 146.281 172.946 175.497 1.00 0.00 ? 2114 CYS A CA 1  
ATOM 710    C CA . LEU A 1 2115 ? 143.822 171.186 177.873 1.00 0.00 ? 2115 LEU A CA 1  
ATOM 711    C CA . LYS A 1 2116 ? 140.654 172.501 176.168 1.00 0.00 ? 2116 LYS A CA 1  
ATOM 712    C CA . GLU A 1 2117 ? 137.753 170.020 175.992 1.00 0.00 ? 2117 GLU A CA 1  
ATOM 713    C CA . ASN A 1 2118 ? 137.203 171.045 172.372 1.00 0.00 ? 2118 ASN A CA 1  
ATOM 714    C CA . PRO A 1 2119 ? 140.261 169.672 170.392 1.00 0.00 ? 2119 PRO A CA 1  
ATOM 715    C CA . GLN A 1 2120 ? 140.088 172.558 167.863 1.00 0.00 ? 2120 GLN A CA 1  
ATOM 716    C CA . GLU A 1 2121 ? 140.817 175.221 170.530 1.00 0.00 ? 2121 GLU A CA 1  
ATOM 717    C CA . ARG A 1 2122 ? 144.091 173.544 171.534 1.00 0.00 ? 2122 ARG A CA 1  
ATOM 718    C CA . PRO A 1 2123 ? 146.929 175.538 169.846 1.00 0.00 ? 2123 PRO A CA 1  
ATOM 719    C CA . THR A 1 2124 ? 149.336 174.716 167.011 1.00 0.00 ? 2124 THR A CA 1  
ATOM 720    C CA . SER A 1 2125 ? 152.818 173.919 168.395 1.00 0.00 ? 2125 SER A CA 1  
ATOM 721    C CA . ALA A 1 2126 ? 154.344 176.990 166.713 1.00 0.00 ? 2126 ALA A CA 1  
ATOM 722    C CA . GLN A 1 2127 ? 152.184 179.164 169.051 1.00 0.00 ? 2127 GLN A CA 1  
ATOM 723    C CA . VAL A 1 2128 ? 153.138 176.888 171.990 1.00 0.00 ? 2128 VAL A CA 1  
ATOM 724    C CA . PHE A 1 2129 ? 156.894 177.214 171.249 1.00 0.00 ? 2129 PHE A CA 1  
ATOM 725    C CA . ASP A 1 2130 ? 156.693 181.045 170.805 1.00 0.00 ? 2130 ASP A CA 1  
ATOM 726    C CA . ILE A 1 2131 ? 154.810 181.425 174.145 1.00 0.00 ? 2131 ILE A CA 1  
ATOM 727    C CA . LEU A 1 2132 ? 157.214 179.102 176.095 1.00 0.00 ? 2132 LEU A CA 1  
ATOM 728    C CA . ASN A 1 2133 ? 160.225 181.005 174.669 1.00 0.00 ? 2133 ASN A CA 1  
ATOM 729    C CA . SER A 1 2134 ? 158.862 184.287 176.199 1.00 0.00 ? 2134 SER A CA 1  
ATOM 730    C CA . ALA A 1 2135 ? 158.868 182.974 179.838 1.00 0.00 ? 2135 ALA A CA 1  
ATOM 731    C CA . ARG A 1 2142 ? 148.860 192.852 180.775 1.00 0.00 ? 2142 ARG A CA 1  
ATOM 732    C CA . ARG A 1 2143 ? 146.669 195.831 179.918 1.00 0.00 ? 2143 ARG A CA 1  
ATOM 733    C CA . ILE A 1 2144 ? 146.045 198.640 182.414 1.00 0.00 ? 2144 ILE A CA 1  
ATOM 734    C CA . LEU A 1 2145 ? 143.089 200.862 181.536 1.00 0.00 ? 2145 LEU A CA 1  
ATOM 735    C CA . LEU A 1 2146 ? 143.441 204.523 182.435 1.00 0.00 ? 2146 LEU A CA 1  
ATOM 736    C CA . PRO A 1 2147 ? 140.401 206.463 183.692 1.00 0.00 ? 2147 PRO A CA 1  
ATOM 737    C CA . LYS A 1 2148 ? 137.923 207.271 180.950 1.00 0.00 ? 2148 LYS A CA 1  
ATOM 738    C CA . ASN A 1 2149 ? 138.811 210.232 178.661 1.00 0.00 ? 2149 ASN A CA 1  
ATOM 739    C CA . VAL A 1 2150 ? 142.340 210.572 180.098 1.00 0.00 ? 2150 VAL A CA 1  
ATOM 740    C CA . ILE A 1 2151 ? 144.642 211.492 177.204 1.00 0.00 ? 2151 ILE A CA 1  
ATOM 741    C CA . VAL A 1 2152 ? 148.384 210.963 177.680 1.00 0.00 ? 2152 VAL A CA 1  
ATOM 742    C CA . GLU A 1 2153 ? 150.797 213.387 176.023 1.00 0.00 ? 2153 GLU A CA 1  
ATOM 743    C CA . CYS A 1 2154 ? 154.002 212.054 177.578 1.00 0.00 ? 2154 CYS A CA 1  
ATOM 744    C CA . MET A 1 2155 ? 155.173 209.306 179.884 1.00 0.00 ? 2155 MET A CA 1  
ATOM 745    C CA . VAL A 1 2156 ? 158.210 208.357 182.002 1.00 0.00 ? 2156 VAL A CA 1  
ATOM 746    C CA . ALA A 1 2157 ? 158.755 205.173 184.006 1.00 0.00 ? 2157 ALA A CA 1  
ATOM 747    C CA . THR A 1 2158 ? 160.229 204.502 187.442 1.00 0.00 ? 2158 THR A CA 1  
ATOM 748    C CA . ASN A 1 2164 ? 155.666 198.717 193.026 1.00 0.00 ? 2164 ASN A CA 1  
ATOM 749    C CA . ALA A 1 2165 ? 156.752 200.094 189.670 1.00 0.00 ? 2165 ALA A CA 1  
ATOM 750    C CA . SER A 1 2166 ? 154.942 203.216 188.536 1.00 0.00 ? 2166 SER A CA 1  
ATOM 751    C CA . ILE A 1 2167 ? 154.759 205.822 185.793 1.00 0.00 ? 2167 ILE A CA 1  
ATOM 752    C CA . TRP A 1 2168 ? 154.427 209.607 185.518 1.00 0.00 ? 2168 TRP A CA 1  
ATOM 753    C CA . LEU A 1 2169 ? 152.014 210.875 182.859 1.00 0.00 ? 2169 LEU A CA 1  
ATOM 754    C CA . GLY A 1 2170 ? 151.496 214.271 181.262 1.00 0.00 ? 2170 GLY A CA 1  
ATOM 755    C CA . CYS A 1 2171 ? 147.862 214.856 180.374 1.00 0.00 ? 2171 CYS A CA 1  
ATOM 756    C CA . GLY A 1 2172 ? 146.482 216.118 177.068 1.00 0.00 ? 2172 GLY A CA 1  
ATOM 757    C CA . HIS A 1 2173 ? 142.780 216.285 177.901 1.00 0.00 ? 2173 HIS A CA 1  
ATOM 758    C CA . THR A 1 2174 ? 143.304 219.657 179.617 1.00 0.00 ? 2174 THR A CA 1  
ATOM 759    C CA . ASP A 1 2175 ? 144.660 223.076 178.682 1.00 0.00 ? 2175 ASP A CA 1  
ATOM 760    C CA . ARG A 1 2176 ? 146.562 223.418 181.986 1.00 0.00 ? 2176 ARG A CA 1  
ATOM 761    C CA . GLY A 1 2177 ? 149.437 221.465 183.503 1.00 0.00 ? 2177 GLY A CA 1  
ATOM 762    C CA . GLN A 1 2178 ? 148.183 218.242 185.094 1.00 0.00 ? 2178 GLN A CA 1  
ATOM 763    C CA . LEU A 1 2179 ? 150.683 215.645 186.334 1.00 0.00 ? 2179 LEU A CA 1  
ATOM 764    C CA . SER A 1 2180 ? 149.384 212.095 186.806 1.00 0.00 ? 2180 SER A CA 1  
ATOM 765    C CA . PHE A 1 2181 ? 150.793 209.041 188.576 1.00 0.00 ? 2181 PHE A CA 1  
ATOM 766    C CA . LEU A 1 2182 ? 150.059 205.370 187.866 1.00 0.00 ? 2182 LEU A CA 1  
ATOM 767    C CA . ASP A 1 2183 ? 151.038 202.465 190.129 1.00 0.00 ? 2183 ASP A CA 1  
ATOM 768    C CA . LEU A 1 2184 ? 151.733 199.661 187.645 1.00 0.00 ? 2184 LEU A CA 1  
ATOM 769    C CA . ASN A 1 2185 ? 151.066 197.066 190.380 1.00 0.00 ? 2185 ASN A CA 1  
ATOM 770    C CA . THR A 1 2186 ? 147.775 198.344 191.839 1.00 0.00 ? 2186 THR A CA 1  
ATOM 771    C CA . GLU A 1 2187 ? 146.636 200.174 188.661 1.00 0.00 ? 2187 GLU A CA 1  
ATOM 772    C CA . GLY A 1 2188 ? 145.836 203.140 190.907 1.00 0.00 ? 2188 GLY A CA 1  
ATOM 773    C CA . TYR A 1 2189 ? 145.723 206.553 189.249 1.00 0.00 ? 2189 TYR A CA 1  
ATOM 774    C CA . THR A 1 2190 ? 146.158 209.980 190.845 1.00 0.00 ? 2190 THR A CA 1  
ATOM 775    C CA . SER A 1 2191 ? 146.637 213.395 189.256 1.00 0.00 ? 2191 SER A CA 1  
ATOM 776    C CA . GLU A 1 2192 ? 147.392 216.965 190.305 1.00 0.00 ? 2192 GLU A CA 1  
ATOM 777    C CA . GLU A 1 2193 ? 147.097 220.264 188.429 1.00 0.00 ? 2193 GLU A CA 1  
ATOM 778    C CA . VAL A 1 2194 ? 150.653 221.560 188.709 1.00 0.00 ? 2194 VAL A CA 1  
ATOM 779    C CA . ALA A 1 2195 ? 151.203 224.201 185.989 1.00 0.00 ? 2195 ALA A CA 1  
ATOM 780    C CA . ASP A 1 2196 ? 149.418 226.808 183.867 1.00 0.00 ? 2196 ASP A CA 1  
ATOM 781    C CA . SER A 1 2197 ? 149.862 225.165 180.440 1.00 0.00 ? 2197 SER A CA 1  
ATOM 782    C CA . ARG A 1 2198 ? 149.693 221.621 179.101 1.00 0.00 ? 2198 ARG A CA 1  
ATOM 783    C CA . ILE A 1 2199 ? 152.560 219.362 180.153 1.00 0.00 ? 2199 ILE A CA 1  
ATOM 784    C CA . LEU A 1 2200 ? 154.248 218.386 176.885 1.00 0.00 ? 2200 LEU A CA 1  
ATOM 785    C CA . CYS A 1 2201 ? 157.145 216.218 178.066 1.00 0.00 ? 2201 CYS A CA 1  
ATOM 786    C CA . LEU A 1 2202 ? 158.571 214.572 181.180 1.00 0.00 ? 2202 LEU A CA 1  
ATOM 787    C CA . ALA A 1 2203 ? 162.072 213.673 182.339 1.00 0.00 ? 2203 ALA A CA 1  
ATOM 788    C CA . LEU A 1 2204 ? 163.229 212.021 185.562 1.00 0.00 ? 2204 LEU A CA 1  
ATOM 789    C CA . VAL A 1 2205 ? 166.478 213.436 186.974 1.00 0.00 ? 2205 VAL A CA 1  
ATOM 790    C CA . HIS A 1 2206 ? 168.001 211.132 189.593 1.00 0.00 ? 2206 HIS A CA 1  
ATOM 791    C CA . LEU A 1 2207 ? 170.786 212.329 191.889 1.00 0.00 ? 2207 LEU A CA 1  
ATOM 792    C CA . PRO A 1 2208 ? 172.564 209.268 193.368 1.00 0.00 ? 2208 PRO A CA 1  
ATOM 793    C CA . VAL A 1 2209 ? 174.532 211.347 195.795 1.00 0.00 ? 2209 VAL A CA 1  
ATOM 794    C CA . GLU A 1 2210 ? 172.062 213.471 197.800 1.00 0.00 ? 2210 GLU A CA 1  
ATOM 795    C CA . LYS A 1 2211 ? 169.620 210.572 197.203 1.00 0.00 ? 2211 LYS A CA 1  
ATOM 796    C CA . GLU A 1 2212 ? 166.983 212.615 195.419 1.00 0.00 ? 2212 GLU A CA 1  
ATOM 797    C CA . SER A 1 2213 ? 164.754 212.181 192.368 1.00 0.00 ? 2213 SER A CA 1  
ATOM 798    C CA . TRP A 1 2214 ? 163.097 215.126 190.617 1.00 0.00 ? 2214 TRP A CA 1  
ATOM 799    C CA . ILE A 1 2215 ? 160.371 214.922 187.973 1.00 0.00 ? 2215 ILE A CA 1  
ATOM 800    C CA . VAL A 1 2216 ? 160.737 217.642 185.327 1.00 0.00 ? 2216 VAL A CA 1  
ATOM 801    C CA . SER A 1 2217 ? 157.704 218.778 183.323 1.00 0.00 ? 2217 SER A CA 1  
ATOM 802    C CA . GLY A 1 2218 ? 158.093 220.751 180.104 1.00 0.00 ? 2218 GLY A CA 1  
ATOM 803    C CA . THR A 1 2219 ? 155.018 222.751 179.154 1.00 0.00 ? 2219 THR A CA 1  
ATOM 804    C CA . GLN A 1 2220 ? 153.320 224.521 176.248 1.00 0.00 ? 2220 GLN A CA 1  
ATOM 805    C CA . SER A 1 2221 ? 154.359 227.933 177.623 1.00 0.00 ? 2221 SER A CA 1  
ATOM 806    C CA . GLY A 1 2222 ? 158.073 227.138 178.004 1.00 0.00 ? 2222 GLY A CA 1  
ATOM 807    C CA . THR A 1 2223 ? 158.028 226.549 181.764 1.00 0.00 ? 2223 THR A CA 1  
ATOM 808    C CA . LEU A 1 2224 ? 160.255 223.840 183.259 1.00 0.00 ? 2224 LEU A CA 1  
ATOM 809    C CA . LEU A 1 2225 ? 158.553 222.716 186.477 1.00 0.00 ? 2225 LEU A CA 1  
ATOM 810    C CA . VAL A 1 2226 ? 160.709 220.591 188.801 1.00 0.00 ? 2226 VAL A CA 1  
ATOM 811    C CA . ILE A 1 2227 ? 158.917 218.610 191.520 1.00 0.00 ? 2227 ILE A CA 1  
ATOM 812    C CA . ASN A 1 2228 ? 160.368 216.317 194.185 1.00 0.00 ? 2228 ASN A CA 1  
ATOM 813    C CA . THR A 1 2229 ? 159.318 212.672 194.013 1.00 0.00 ? 2229 THR A CA 1  
ATOM 814    C CA . GLU A 1 2230 ? 159.147 212.104 197.775 1.00 0.00 ? 2230 GLU A CA 1  
ATOM 815    C CA . ASP A 1 2231 ? 157.811 215.496 198.955 1.00 0.00 ? 2231 ASP A CA 1  
ATOM 816    C CA . GLY A 1 2232 ? 155.505 217.220 196.465 1.00 0.00 ? 2232 GLY A CA 1  
ATOM 817    C CA . LYS A 1 2233 ? 155.770 220.408 198.533 1.00 0.00 ? 2233 LYS A CA 1  
ATOM 818    C CA . LYS A 1 2234 ? 159.326 220.708 197.142 1.00 0.00 ? 2234 LYS A CA 1  
ATOM 819    C CA . ARG A 1 2235 ? 158.884 222.258 193.703 1.00 0.00 ? 2235 ARG A CA 1  
ATOM 820    C CA . HIS A 1 2236 ? 160.333 225.152 191.729 1.00 0.00 ? 2236 HIS A CA 1  
ATOM 821    C CA . THR A 1 2237 ? 160.892 226.441 188.197 1.00 0.00 ? 2237 THR A CA 1  
ATOM 822    C CA . LEU A 1 2238 ? 164.002 226.641 186.015 1.00 0.00 ? 2238 LEU A CA 1  
ATOM 823    C CA . GLU A 1 2239 ? 164.637 229.371 183.435 1.00 0.00 ? 2239 GLU A CA 1  
ATOM 824    C CA . LYS A 1 2240 ? 161.631 229.944 181.192 1.00 0.00 ? 2240 LYS A CA 1  
ATOM 825    C CA . MET A 1 2241 ? 162.060 228.837 177.586 1.00 0.00 ? 2241 MET A CA 1  
ATOM 826    C CA . THR A 1 2242 ? 161.315 231.204 174.714 1.00 0.00 ? 2242 THR A CA 1  
ATOM 827    C CA . ASP A 1 2243 ? 158.899 228.649 173.215 1.00 0.00 ? 2243 ASP A CA 1  
ATOM 828    C CA . SER A 1 2244 ? 157.112 225.484 174.304 1.00 0.00 ? 2244 SER A CA 1  
ATOM 829    C CA . VAL A 1 2245 ? 159.214 222.607 175.622 1.00 0.00 ? 2245 VAL A CA 1  
ATOM 830    C CA . THR A 1 2246 ? 158.918 219.768 173.105 1.00 0.00 ? 2246 THR A CA 1  
ATOM 831    C CA . CYS A 1 2247 ? 161.707 217.441 174.281 1.00 0.00 ? 2247 CYS A CA 1  
ATOM 832    C CA . LEU A 1 2248 ? 163.252 216.286 177.566 1.00 0.00 ? 2248 LEU A CA 1  
ATOM 833    C CA . TYR A 1 2249 ? 166.118 213.789 177.672 1.00 0.00 ? 2249 TYR A CA 1  
ATOM 834    C CA . CYS A 1 2250 ? 168.523 212.766 180.442 1.00 0.00 ? 2250 CYS A CA 1  
ATOM 835    C CA . ASN A 1 2251 ? 172.069 212.201 179.196 1.00 0.00 ? 2251 ASN A CA 1  
ATOM 836    C CA . SER A 1 2252 ? 175.496 211.270 180.543 1.00 0.00 ? 2252 SER A CA 1  
ATOM 837    C CA . PHE A 1 2253 ? 179.061 212.040 179.466 1.00 0.00 ? 2253 PHE A CA 1  
ATOM 838    C CA . GLN A 1 2259 ? 180.716 210.928 183.955 1.00 0.00 ? 2254 GLN A CA 1  
ATOM 839    C CA . LYS A 1 2260 ? 178.499 214.025 184.090 1.00 0.00 ? 2260 LYS A CA 1  
ATOM 840    C CA . ASN A 1 2261 ? 174.714 213.869 183.756 1.00 0.00 ? 2261 ASN A CA 1  
ATOM 841    C CA . PHE A 1 2262 ? 172.664 216.477 181.910 1.00 0.00 ? 2262 PHE A CA 1  
ATOM 842    C CA . LEU A 1 2263 ? 169.079 217.485 181.154 1.00 0.00 ? 2263 LEU A CA 1  
ATOM 843    C CA . LEU A 1 2264 ? 168.613 218.244 177.451 1.00 0.00 ? 2264 LEU A CA 1  
ATOM 844    C CA . VAL A 1 2265 ? 165.610 220.455 176.666 1.00 0.00 ? 2265 VAL A CA 1  
ATOM 845    C CA . GLY A 1 2266 ? 164.371 220.753 173.083 1.00 0.00 ? 2266 GLY A CA 1  
ATOM 846    C CA . THR A 1 2267 ? 162.058 223.675 172.337 1.00 0.00 ? 2267 THR A CA 1  
ATOM 847    C CA . ALA A 1 2268 ? 159.565 224.518 169.601 1.00 0.00 ? 2268 ALA A CA 1  
ATOM 848    C CA . ASP A 1 2269 ? 161.733 227.337 168.184 1.00 0.00 ? 2269 ASP A CA 1  
ATOM 849    C CA . GLY A 1 2270 ? 164.604 225.029 167.231 1.00 0.00 ? 2270 GLY A CA 1  
ATOM 850    C CA . LYS A 1 2271 ? 166.736 225.485 170.353 1.00 0.00 ? 2271 LYS A CA 1  
ATOM 851    C CA . LEU A 1 2272 ? 168.315 222.921 172.686 1.00 0.00 ? 2272 LEU A CA 1  
ATOM 852    C CA . ALA A 1 2273 ? 169.135 223.995 176.248 1.00 0.00 ? 2273 ALA A CA 1  
ATOM 853    C CA . ILE A 1 2274 ? 171.518 221.993 178.443 1.00 0.00 ? 2274 ILE A CA 1  
ATOM 854    C CA . PHE A 1 2275 ? 171.167 221.880 182.226 1.00 0.00 ? 2275 PHE A CA 1  
ATOM 855    C CA . GLU A 1 2276 ? 173.712 220.190 184.441 1.00 0.00 ? 2276 GLU A CA 1  
ATOM 856    C CA . ASP A 1 2277 ? 172.646 217.356 186.739 1.00 0.00 ? 2277 ASP A CA 1  
ATOM 857    C CA . LYS A 1 2278 ? 172.954 219.378 189.952 1.00 0.00 ? 2278 LYS A CA 1  
ATOM 858    C CA . THR A 1 2279 ? 171.649 222.737 188.685 1.00 0.00 ? 2279 THR A CA 1  
ATOM 859    C CA . VAL A 1 2280 ? 168.164 221.228 188.276 1.00 0.00 ? 2280 VAL A CA 1  
ATOM 860    C CA . LYS A 1 2281 ? 167.688 221.546 192.054 1.00 0.00 ? 2281 LYS A CA 1  
ATOM 861    C CA . LEU A 1 2282 ? 168.038 225.346 191.946 1.00 0.00 ? 2282 LEU A CA 1  
ATOM 862    C CA . LYS A 1 2283 ? 165.143 227.762 191.506 1.00 0.00 ? 2283 LYS A CA 1  
ATOM 863    C CA . GLY A 1 2284 ? 165.505 229.888 188.391 1.00 0.00 ? 2284 GLY A CA 1  
ATOM 864    C CA . ALA A 1 2285 ? 168.588 228.000 187.219 1.00 0.00 ? 2285 ALA A CA 1  
ATOM 865    C CA . ALA A 1 2286 ? 169.878 228.953 183.770 1.00 0.00 ? 2286 ALA A CA 1  
ATOM 866    C CA . PRO A 1 2287 ? 171.169 226.415 181.225 1.00 0.00 ? 2287 PRO A CA 1  
ATOM 867    C CA . LEU A 1 2288 ? 174.868 225.843 180.685 1.00 0.00 ? 2288 LEU A CA 1  
ATOM 868    C CA . LYS A 1 2289 ? 174.396 226.370 176.944 1.00 0.00 ? 2289 LYS A CA 1  
ATOM 869    C CA . ILE A 1 2290 ? 171.639 226.966 174.390 1.00 0.00 ? 2290 ILE A CA 1  
ATOM 870    C CA . LEU A 1 2291 ? 172.061 225.681 170.831 1.00 0.00 ? 2291 LEU A CA 1  
ATOM 871    C CA . ASN A 1 2292 ? 170.129 227.517 168.110 1.00 0.00 ? 2292 ASN A CA 1  
ATOM 872    C CA . ILE A 1 2293 ? 169.674 224.638 165.667 1.00 0.00 ? 2293 ILE A CA 1  
ATOM 873    C CA . GLY A 1 2294 ? 166.571 225.905 163.821 1.00 0.00 ? 2294 GLY A CA 1  
ATOM 874    C CA . ASN A 1 2295 ? 163.802 228.481 163.946 1.00 0.00 ? 2295 ASN A CA 1  
ATOM 875    C CA . VAL A 1 2296 ? 160.213 228.933 165.122 1.00 0.00 ? 2296 VAL A CA 1  
ATOM 876    C CA . SER A 1 2297 ? 159.131 226.644 162.262 1.00 0.00 ? 2297 SER A CA 1  
ATOM 877    C CA . THR A 1 2298 ? 161.502 223.731 163.077 1.00 0.00 ? 2298 THR A CA 1  
ATOM 878    C CA . PRO A 1 2299 ? 160.699 222.282 166.517 1.00 0.00 ? 2299 PRO A CA 1  
ATOM 879    C CA . LEU A 1 2300 ? 163.250 220.072 168.258 1.00 0.00 ? 2300 LEU A CA 1  
ATOM 880    C CA . MET A 1 2301 ? 161.101 217.034 169.009 1.00 0.00 ? 2301 MET A CA 1  
ATOM 881    C CA . CYS A 1 2302 ? 163.332 214.001 169.616 1.00 0.00 ? 2302 CYS A CA 1  
ATOM 882    C CA . LEU A 1 2303 ? 166.684 212.998 171.105 1.00 0.00 ? 2303 LEU A CA 1  
ATOM 883    C CA . SER A 1 2304 ? 168.460 209.647 171.270 1.00 0.00 ? 2304 SER A CA 1  
ATOM 884    C CA . GLU A 1 2305 ? 171.802 208.139 172.228 1.00 0.00 ? 2305 GLU A CA 1  
ATOM 885    C CA . VAL A 1 2314 ? 177.337 210.952 171.144 1.00 0.00 ? 2314 VAL A CA 1  
ATOM 886    C CA . MET A 1 2315 ? 173.799 212.317 170.796 1.00 0.00 ? 2315 MET A CA 1  
ATOM 887    C CA . TRP A 1 2316 ? 171.562 212.458 167.729 1.00 0.00 ? 2316 TRP A CA 1  
ATOM 888    C CA . GLY A 1 2317 ? 168.410 214.520 167.398 1.00 0.00 ? 2317 GLY A CA 1  
ATOM 889    C CA . GLY A 1 2318 ? 165.749 215.744 165.033 1.00 0.00 ? 2318 GLY A CA 1  
ATOM 890    C CA . CYS A 1 2319 ? 164.967 219.389 164.260 1.00 0.00 ? 2319 CYS A CA 1  
ATOM 891    C CA . GLY A 1 2320 ? 162.516 219.898 161.422 1.00 0.00 ? 2320 GLY A CA 1  
ATOM 892    C CA . THR A 1 2321 ? 163.826 217.850 158.513 1.00 0.00 ? 2321 THR A CA 1  
ATOM 893    C CA . LYS A 1 2322 ? 167.421 217.922 159.814 1.00 0.00 ? 2322 LYS A CA 1  
ATOM 894    C CA . ILE A 1 2323 ? 169.256 215.320 161.885 1.00 0.00 ? 2323 ILE A CA 1  
ATOM 895    C CA . PHE A 1 2324 ? 171.914 216.764 164.175 1.00 0.00 ? 2324 PHE A CA 1  
ATOM 896    C CA . SER A 1 2325 ? 174.710 215.295 166.275 1.00 0.00 ? 2325 SER A CA 1  
ATOM 897    C CA . PHE A 1 2326 ? 176.726 216.553 169.227 1.00 0.00 ? 2326 PHE A CA 1  
ATOM 898    C CA . SER A 1 2327 ? 179.004 215.197 171.932 1.00 0.00 ? 2327 SER A CA 1  
ATOM 899    C CA . ASN A 1 2328 ? 181.021 216.588 174.837 1.00 0.00 ? 2328 ASN A CA 1  
ATOM 900    C CA . ASP A 1 2329 ? 181.371 220.297 174.024 1.00 0.00 ? 2329 ASP A CA 1  
ATOM 901    C CA . PHE A 1 2330 ? 177.784 220.695 172.708 1.00 0.00 ? 2330 PHE A CA 1  
ATOM 902    C CA . THR A 1 2331 ? 178.990 221.928 169.336 1.00 0.00 ? 2331 THR A CA 1  
ATOM 903    C CA . ILE A 1 2332 ? 176.858 220.607 166.489 1.00 0.00 ? 2332 ILE A CA 1  
ATOM 904    C CA . GLN A 1 2333 ? 179.030 218.196 164.528 1.00 0.00 ? 2333 GLN A CA 1  
ATOM 905    C CA . LYS A 1 2334 ? 176.845 216.441 161.948 1.00 0.00 ? 2334 LYS A CA 1  
ATOM 906    C CA . LEU A 1 2335 ? 173.851 218.097 160.283 1.00 0.00 ? 2335 LEU A CA 1  
ATOM 907    C CA . ILE A 1 2336 ? 172.001 216.061 157.640 1.00 0.00 ? 2336 ILE A CA 1  
ATOM 908    C CA . GLU A 1 2337 ? 169.156 217.411 155.505 1.00 0.00 ? 2337 GLU A CA 1  
ATOM 909    C CA . THR A 1 2338 ? 166.585 214.650 154.980 1.00 0.00 ? 2338 THR A CA 1  
ATOM 910    C CA . ARG A 1 2339 ? 164.037 216.642 152.957 1.00 0.00 ? 2339 ARG A CA 1  
ATOM 911    C CA . THR A 1 2340 ? 165.570 215.566 149.628 1.00 0.00 ? 2340 THR A CA 1  
ATOM 912    C CA . SER A 1 2341 ? 166.804 212.263 148.202 1.00 0.00 ? 2341 SER A CA 1  
ATOM 913    C CA . GLN A 1 2342 ? 166.522 210.932 144.655 1.00 0.00 ? 2342 GLN A CA 1  
ATOM 914    C CA . LEU A 1 2343 ? 165.831 207.375 145.859 1.00 0.00 ? 2343 LEU A CA 1  
ATOM 915    C CA . PHE A 1 2344 ? 162.719 208.495 147.759 1.00 0.00 ? 2344 PHE A CA 1  
ATOM 916    C CA . SER A 1 2345 ? 159.853 206.130 146.996 1.00 0.00 ? 2345 SER A CA 1  
ATOM 917    C CA . TYR A 1 2346 ? 157.499 209.087 147.543 1.00 0.00 ? 2346 TYR A CA 1  
ATOM 918    C CA . ALA A 1 2347 ? 158.647 212.671 147.991 1.00 0.00 ? 2347 ALA A CA 1  
ATOM 919    C CA . ALA A 1 2348 ? 155.856 214.315 150.003 1.00 0.00 ? 2348 ALA A CA 1  
ATOM 920    C CA . PHE A 1 2349 ? 156.436 212.042 153.012 1.00 0.00 ? 2349 PHE A CA 1  
ATOM 921    C CA . SER A 1 2350 ? 160.078 213.079 153.390 1.00 0.00 ? 2350 SER A CA 1  
ATOM 922    C CA . ASP A 1 2351 ? 159.098 216.767 153.567 1.00 0.00 ? 2351 ASP A CA 1  
ATOM 923    C CA . SER A 1 2352 ? 157.862 216.528 157.142 1.00 0.00 ? 2352 SER A CA 1  
ATOM 924    C CA . ASN A 1 2353 ? 159.224 217.125 160.621 1.00 0.00 ? 2353 ASN A CA 1  
ATOM 925    C CA . ILE A 1 2354 ? 161.128 214.198 162.115 1.00 0.00 ? 2354 ILE A CA 1  
ATOM 926    C CA . ILE A 1 2355 ? 159.132 212.776 165.030 1.00 0.00 ? 2355 ILE A CA 1  
ATOM 927    C CA . THR A 1 2356 ? 161.584 210.163 166.358 1.00 0.00 ? 2356 THR A CA 1  
ATOM 928    C CA . VAL A 1 2357 ? 165.179 208.994 165.906 1.00 0.00 ? 2357 VAL A CA 1  
ATOM 929    C CA . VAL A 1 2358 ? 166.546 205.590 166.932 1.00 0.00 ? 2358 VAL A CA 1  
ATOM 930    C CA . VAL A 1 2359 ? 170.311 205.093 166.677 1.00 0.00 ? 2359 VAL A CA 1  
ATOM 931    C CA . ASP A 1 2360 ? 171.916 201.704 166.053 1.00 0.00 ? 2360 ASP A CA 1  
ATOM 932    C CA . THR A 1 2361 ? 174.337 200.956 163.217 1.00 0.00 ? 2361 THR A CA 1  
ATOM 933    C CA . ALA A 1 2362 ? 172.472 203.520 161.104 1.00 0.00 ? 2362 ALA A CA 1  
ATOM 934    C CA . LEU A 1 2363 ? 169.882 206.224 161.759 1.00 0.00 ? 2363 LEU A CA 1  
ATOM 935    C CA . TYR A 1 2364 ? 166.238 205.122 161.535 1.00 0.00 ? 2364 TYR A CA 1  
ATOM 936    C CA . ILE A 1 2365 ? 164.057 208.235 161.429 1.00 0.00 ? 2365 ILE A CA 1  
ATOM 937    C CA . ALA A 1 2366 ? 160.294 208.581 161.116 1.00 0.00 ? 2366 ALA A CA 1  
ATOM 938    C CA . LYS A 1 2367 ? 158.466 211.703 159.962 1.00 0.00 ? 2367 LYS A CA 1  
ATOM 939    C CA . GLN A 1 2368 ? 155.066 213.166 160.762 1.00 0.00 ? 2368 GLN A CA 1  
ATOM 940    C CA . ASN A 1 2369 ? 152.184 211.624 158.787 1.00 0.00 ? 2369 ASN A CA 1  
ATOM 941    C CA . SER A 1 2370 ? 154.585 209.350 156.894 1.00 0.00 ? 2370 SER A CA 1  
ATOM 942    C CA . PRO A 1 2371 ? 154.530 205.534 156.564 1.00 0.00 ? 2371 PRO A CA 1  
ATOM 943    C CA . VAL A 1 2372 ? 158.211 205.339 155.536 1.00 0.00 ? 2372 VAL A CA 1  
ATOM 944    C CA . VAL A 1 2373 ? 161.009 204.826 158.051 1.00 0.00 ? 2373 VAL A CA 1  
ATOM 945    C CA . GLU A 1 2374 ? 164.066 206.387 156.422 1.00 0.00 ? 2374 GLU A CA 1  
ATOM 946    C CA . VAL A 1 2375 ? 167.507 204.887 157.046 1.00 0.00 ? 2375 VAL A CA 1  
ATOM 947    C CA . TRP A 1 2376 ? 170.510 207.223 156.848 1.00 0.00 ? 2376 TRP A CA 1  
ATOM 948    C CA . ASP A 1 2377 ? 174.242 206.596 157.214 1.00 0.00 ? 2377 ASP A CA 1  
ATOM 949    C CA . LYS A 1 2378 ? 176.161 208.404 159.952 1.00 0.00 ? 2378 LYS A CA 1  
ATOM 950    C CA . LYS A 1 2379 ? 179.373 208.614 157.914 1.00 0.00 ? 2379 LYS A CA 1  
ATOM 951    C CA . THR A 1 2380 ? 178.273 209.319 154.333 1.00 0.00 ? 2380 THR A CA 1  
ATOM 952    C CA . GLU A 1 2381 ? 175.160 211.291 155.417 1.00 0.00 ? 2381 GLU A CA 1  
ATOM 953    C CA . LYS A 1 2382 ? 173.022 209.706 152.672 1.00 0.00 ? 2382 LYS A CA 1  
ATOM 954    C CA . LEU A 1 2383 ? 170.136 207.268 152.411 1.00 0.00 ? 2383 LEU A CA 1  
ATOM 955    C CA . CYS A 1 2384 ? 171.014 203.800 153.645 1.00 0.00 ? 2384 CYS A CA 1  
ATOM 956    C CA . GLY A 1 2385 ? 167.562 202.423 152.900 1.00 0.00 ? 2385 GLY A CA 1  
ATOM 957    C CA . LEU A 1 2386 ? 163.793 202.681 153.148 1.00 0.00 ? 2386 LEU A CA 1  
ATOM 958    C CA . ILE A 1 2387 ? 161.262 200.702 155.185 1.00 0.00 ? 2387 ILE A CA 1  
ATOM 959    C CA . ASP A 1 2388 ? 157.717 201.133 153.839 1.00 0.00 ? 2388 ASP A CA 1  
ATOM 960    C CA . CYS A 1 2389 ? 155.289 200.018 156.551 1.00 0.00 ? 2389 CYS A CA 1  
ATOM 961    C CA . VAL A 1 2390 ? 152.335 199.975 154.126 1.00 0.00 ? 2390 VAL A CA 1  
ATOM 962    C CA . HIS A 1 2391 ? 153.933 197.107 152.197 1.00 0.00 ? 2391 HIS A CA 1  
ATOM 963    C CA . PHE A 1 2392 ? 154.924 195.197 155.339 1.00 0.00 ? 2392 PHE A CA 1  
ATOM 964    C CA . LEU A 1 2393 ? 151.367 195.504 156.657 1.00 0.00 ? 2393 LEU A CA 1  
ATOM 965    C CA . ARG A 1 2394 ? 149.791 194.406 153.352 1.00 0.00 ? 2394 ARG A CA 1  
ATOM 966    C CA . GLU A 1 2395 ? 151.393 190.936 153.602 1.00 0.00 ? 2395 GLU A CA 1  
ATOM 967    C CA . MET A 1 2408 ? 144.705 196.365 152.897 1.00 0.00 ? 2408 MET A CA 1  
ATOM 968    C CA . SER A 1 2409 ? 143.429 199.903 153.524 1.00 0.00 ? 2409 SER A CA 1  
ATOM 969    C CA . TYR A 1 2410 ? 146.111 200.679 156.122 1.00 0.00 ? 2410 TYR A CA 1  
ATOM 970    C CA . SER A 1 2411 ? 147.625 204.159 156.198 1.00 0.00 ? 2411 SER A CA 1  
ATOM 971    C CA . GLY A 1 2412 ? 150.753 202.715 157.816 1.00 0.00 ? 2412 GLY A CA 1  
ATOM 972    C CA . ARG A 1 2413 ? 151.464 206.132 159.313 1.00 0.00 ? 2413 ARG A CA 1  
ATOM 973    C CA . VAL A 1 2414 ? 154.409 205.620 161.658 1.00 0.00 ? 2414 VAL A CA 1  
ATOM 974    C CA . LYS A 1 2415 ? 153.811 206.796 165.223 1.00 0.00 ? 2415 LYS A CA 1  
ATOM 975    C CA . THR A 1 2416 ? 156.726 205.423 167.236 1.00 0.00 ? 2416 THR A CA 1  
ATOM 976    C CA . LEU A 1 2417 ? 160.017 203.516 166.963 1.00 0.00 ? 2417 LEU A CA 1  
ATOM 977    C CA . CYS A 1 2418 ? 161.708 201.430 169.653 1.00 0.00 ? 2418 CYS A CA 1  
ATOM 978    C CA . LEU A 1 2419 ? 164.864 199.313 169.616 1.00 0.00 ? 2419 LEU A CA 1  
ATOM 979    C CA . GLN A 1 2420 ? 164.828 195.819 171.117 1.00 0.00 ? 2420 GLN A CA 1  
ATOM 980    C CA . LYS A 1 2421 ? 168.289 194.636 172.205 1.00 0.00 ? 2421 LYS A CA 1  
ATOM 981    C CA . ASN A 1 2422 ? 170.784 194.931 169.347 1.00 0.00 ? 2422 ASN A CA 1  
ATOM 982    C CA . THR A 1 2423 ? 168.777 193.445 166.469 1.00 0.00 ? 2423 THR A CA 1  
ATOM 983    C CA . ALA A 1 2424 ? 165.087 194.245 166.631 1.00 0.00 ? 2424 ALA A CA 1  
ATOM 984    C CA . LEU A 1 2425 ? 163.056 197.348 165.769 1.00 0.00 ? 2425 LEU A CA 1  
ATOM 985    C CA . TRP A 1 2426 ? 159.471 197.869 166.947 1.00 0.00 ? 2426 TRP A CA 1  
ATOM 986    C CA . ILE A 1 2427 ? 157.292 200.155 164.807 1.00 0.00 ? 2427 ILE A CA 1  
ATOM 987    C CA . GLY A 1 2428 ? 153.947 201.393 166.145 1.00 0.00 ? 2428 GLY A CA 1  
ATOM 988    C CA . THR A 1 2429 ? 151.788 202.644 163.291 1.00 0.00 ? 2429 THR A CA 1  
ATOM 989    C CA . GLY A 1 2430 ? 148.771 205.011 163.388 1.00 0.00 ? 2430 GLY A CA 1  
ATOM 990    C CA . GLY A 1 2431 ? 146.358 202.119 163.474 1.00 0.00 ? 2431 GLY A CA 1  
ATOM 991    C CA . GLY A 1 2432 ? 146.630 199.590 166.242 1.00 0.00 ? 2432 GLY A CA 1  
ATOM 992    C CA . HIS A 1 2433 ? 149.434 197.822 164.411 1.00 0.00 ? 2433 HIS A CA 1  
ATOM 993    C CA . ILE A 1 2434 ? 152.835 196.884 165.832 1.00 0.00 ? 2434 ILE A CA 1  
ATOM 994    C CA . LEU A 1 2435 ? 155.649 195.580 163.610 1.00 0.00 ? 2435 LEU A CA 1  
ATOM 995    C CA . LEU A 1 2436 ? 158.888 193.873 164.663 1.00 0.00 ? 2436 LEU A CA 1  
ATOM 996    C CA . LEU A 1 2437 ? 161.704 193.987 162.092 1.00 0.00 ? 2437 LEU A CA 1  
ATOM 997    C CA . ASP A 1 2438 ? 165.144 192.369 162.133 1.00 0.00 ? 2438 ASP A CA 1  
ATOM 998    C CA . LEU A 1 2439 ? 167.829 195.018 161.495 1.00 0.00 ? 2439 LEU A CA 1  
ATOM 999    C CA . SER A 1 2440 ? 170.663 193.014 159.923 1.00 0.00 ? 2440 SER A CA 1  
ATOM 1000   C CA . THR A 1 2441 ? 170.289 190.626 156.987 1.00 0.00 ? 2441 THR A CA 1  
ATOM 1001   C CA . ARG A 1 2442 ? 166.483 190.339 156.762 1.00 0.00 ? 2442 ARG A CA 1  
ATOM 1002   C CA . ARG A 1 2443 ? 163.343 192.227 157.800 1.00 0.00 ? 2443 ARG A CA 1  
ATOM 1003   C CA . LEU A 1 2444 ? 159.990 191.165 159.261 1.00 0.00 ? 2444 LEU A CA 1  
ATOM 1004   C CA . ILE A 1 2445 ? 160.013 189.080 162.448 1.00 0.00 ? 2445 ILE A CA 1  
ATOM 1005   C CA . ARG A 1 2446 ? 156.612 189.625 164.063 1.00 0.00 ? 2446 ARG A CA 1  
ATOM 1006   C CA . VAL A 1 2447 ? 153.374 191.500 163.362 1.00 0.00 ? 2447 VAL A CA 1  
ATOM 1007   C CA . ILE A 1 2448 ? 150.424 192.112 165.681 1.00 0.00 ? 2448 ILE A CA 1  
ATOM 1008   C CA . TYR A 1 2449 ? 147.359 193.677 164.039 1.00 0.00 ? 2449 TYR A CA 1  
ATOM 1009   C CA . ASN A 1 2450 ? 144.685 195.668 165.882 1.00 0.00 ? 2450 ASN A CA 1  
ATOM 1010   C CA . PHE A 1 2451 ? 146.758 195.669 169.069 1.00 0.00 ? 2451 PHE A CA 1  
ATOM 1011   C CA . CYS A 1 2452 ? 144.751 198.835 169.760 1.00 0.00 ? 2452 CYS A CA 1  
ATOM 1012   C CA . ASN A 1 2453 ? 143.115 201.576 167.698 1.00 0.00 ? 2453 ASN A CA 1  
ATOM 1013   C CA . SER A 1 2454 ? 146.241 203.779 167.633 1.00 0.00 ? 2454 SER A CA 1  
ATOM 1014   C CA . VAL A 1 2455 ? 149.716 203.206 169.116 1.00 0.00 ? 2455 VAL A CA 1  
ATOM 1015   C CA . ARG A 1 2456 ? 150.864 206.491 170.652 1.00 0.00 ? 2456 ARG A CA 1  
ATOM 1016   C CA . VAL A 1 2457 ? 153.940 205.708 172.782 1.00 0.00 ? 2457 VAL A CA 1  
ATOM 1017   C CA . MET A 1 2458 ? 156.295 202.728 172.897 1.00 0.00 ? 2458 MET A CA 1  
ATOM 1018   C CA . MET A 1 2459 ? 159.335 202.558 175.176 1.00 0.00 ? 2459 MET A CA 1  
ATOM 1019   C CA . THR A 1 2460 ? 161.675 200.283 177.120 1.00 0.00 ? 2460 THR A CA 1  
ATOM 1020   C CA . ALA A 1 2461 ? 162.201 200.585 180.879 1.00 0.00 ? 2461 ALA A CA 1  
ATOM 1021   C CA . GLN A 1 2462 ? 164.084 198.812 183.661 1.00 0.00 ? 2462 GLN A CA 1  
ATOM 1022   C CA . ASN A 1 2468 ? 163.929 194.735 180.648 1.00 0.00 ? 2468 ASN A CA 1  
ATOM 1023   C CA . VAL A 1 2469 ? 160.280 195.771 180.299 1.00 0.00 ? 2469 VAL A CA 1  
ATOM 1024   C CA . MET A 1 2470 ? 158.151 196.956 177.369 1.00 0.00 ? 2470 MET A CA 1  
ATOM 1025   C CA . LEU A 1 2471 ? 155.513 199.699 177.672 1.00 0.00 ? 2471 LEU A CA 1  
ATOM 1026   C CA . VAL A 1 2472 ? 153.008 200.546 174.918 1.00 0.00 ? 2472 VAL A CA 1  
ATOM 1027   C CA . LEU A 1 2473 ? 150.488 203.346 175.452 1.00 0.00 ? 2473 LEU A CA 1  
ATOM 1028   C CA . GLY A 1 2474 ? 147.657 203.239 172.925 1.00 0.00 ? 2474 GLY A CA 1  
ATOM 1029   C CA . TYR A 1 2475 ? 144.279 204.932 172.831 1.00 0.00 ? 2475 TYR A CA 1  
ATOM 1030   C CA . ASN A 1 2476 ? 140.807 203.903 171.604 1.00 0.00 ? 2476 ASN A CA 1  
ATOM 1031   C CA . ARG A 1 2477 ? 138.019 206.255 170.604 1.00 0.00 ? 2477 ARG A CA 1  
ATOM 1032   C CA . GLU A 1 2488 ? 134.858 209.458 174.280 1.00 0.00 ? 2497 GLU A CA 1  
ATOM 1033   C CA . ILE A 1 2489 ? 138.477 208.304 174.624 1.00 0.00 ? 2498 ILE A CA 1  
ATOM 1034   C CA . GLN A 1 2490 ? 139.926 205.316 176.506 1.00 0.00 ? 2499 GLN A CA 1  
ATOM 1035   C CA . SER A 1 2491 ? 143.699 205.237 176.948 1.00 0.00 ? 2500 SER A CA 1  
ATOM 1036   C CA . CYS A 1 2492 ? 145.391 201.937 177.785 1.00 0.00 ? 2501 CYS A CA 1  
ATOM 1037   C CA . LEU A 1 2493 ? 148.915 200.984 178.849 1.00 0.00 ? 2502 LEU A CA 1  
ATOM 1038   C CA . THR A 1 2494 ? 150.103 197.505 177.834 1.00 0.00 ? 2503 THR A CA 1  
ATOM 1039   C CA . VAL A 1 2495 ? 153.218 196.023 179.426 1.00 0.00 ? 2504 VAL A CA 1  
ATOM 1040   C CA . TRP A 1 2496 ? 155.347 192.886 179.104 1.00 0.00 ? 2505 TRP A CA 1  
ATOM 1041   C CA . TYR B 1 1332 ? 126.899 123.912 91.917  1.00 0.00 ? 1332 TYR B CA 1  
ATOM 1042   C CA . ASN B 1 1333 ? 123.311 125.351 91.924  1.00 0.00 ? 1333 ASN B CA 1  
ATOM 1043   C CA . ARG B 1 1334 ? 122.806 125.665 95.648  1.00 0.00 ? 1334 ARG B CA 1  
ATOM 1044   C CA . MET B 1 1335 ? 122.423 128.671 97.980  1.00 0.00 ? 1335 MET B CA 1  
ATOM 1045   C CA . LYS B 1 1336 ? 121.882 129.490 101.672 1.00 0.00 ? 1336 LYS B CA 1  
ATOM 1046   C CA . LEU B 1 1337 ? 119.024 131.822 102.602 1.00 0.00 ? 1337 LEU B CA 1  
ATOM 1047   C CA . MET B 1 1338 ? 119.570 133.144 106.107 1.00 0.00 ? 1338 MET B CA 1  
ATOM 1048   C CA . ILE B 1 1339 ? 116.419 134.549 107.717 1.00 0.00 ? 1339 ILE B CA 1  
ATOM 1049   C CA . VAL B 1 1340 ? 117.415 137.472 109.969 1.00 0.00 ? 1340 VAL B CA 1  
ATOM 1050   C CA . GLY B 1 1341 ? 115.222 139.475 112.357 1.00 0.00 ? 1341 GLY B CA 1  
ATOM 1051   C CA . ASN B 1 1342 ? 113.783 139.764 115.853 1.00 0.00 ? 1342 ASN B CA 1  
ATOM 1052   C CA . THR B 1 1343 ? 111.798 136.639 116.961 1.00 0.00 ? 1343 THR B CA 1  
ATOM 1053   C CA . GLY B 1 1344 ? 108.446 136.752 115.141 1.00 0.00 ? 1344 GLY B CA 1  
ATOM 1054   C CA . SER B 1 1345 ? 108.705 139.683 112.742 1.00 0.00 ? 1345 SER B CA 1  
ATOM 1055   C CA . GLY B 1 1346 ? 106.962 137.093 110.506 1.00 0.00 ? 1346 GLY B CA 1  
ATOM 1056   C CA . LYS B 1 1347 ? 109.819 134.717 109.587 1.00 0.00 ? 1347 LYS B CA 1  
ATOM 1057   C CA . THR B 1 1348 ? 107.436 131.702 109.436 1.00 0.00 ? 1348 THR B CA 1  
ATOM 1058   C CA . THR B 1 1349 ? 104.737 133.911 107.797 1.00 0.00 ? 1349 THR B CA 1  
ATOM 1059   C CA . LEU B 1 1350 ? 107.097 135.007 105.024 1.00 0.00 ? 1350 LEU B CA 1  
ATOM 1060   C CA . LEU B 1 1351 ? 108.248 131.379 104.510 1.00 0.00 ? 1351 LEU B CA 1  
ATOM 1061   C CA . GLN B 1 1352 ? 104.664 130.003 104.285 1.00 0.00 ? 1352 GLN B CA 1  
ATOM 1062   C CA . GLN B 1 1353 ? 103.916 132.601 101.604 1.00 0.00 ? 1353 GLN B CA 1  
ATOM 1063   C CA . LEU B 1 1354 ? 107.062 132.002 99.469  1.00 0.00 ? 1354 LEU B CA 1  
ATOM 1064   C CA . MET B 1 1355 ? 106.945 128.245 99.486  1.00 0.00 ? 1355 MET B CA 1  
ATOM 1065   C CA . LYS B 1 1356 ? 103.434 127.597 97.959  1.00 0.00 ? 1356 LYS B CA 1  
ATOM 1066   C CA . THR B 1 1357 ? 103.765 123.767 98.094  1.00 0.00 ? 1357 THR B CA 1  
ATOM 1067   C CA . LYS B 1 1358 ? 101.035 121.207 99.007  1.00 0.00 ? 1358 LYS B CA 1  
ATOM 1068   C CA . LYS B 1 1359 ? 101.839 122.063 102.653 1.00 0.00 ? 1359 LYS B CA 1  
ATOM 1069   C CA . SER B 1 1360 ? 104.390 119.199 102.645 1.00 0.00 ? 1360 SER B CA 1  
ATOM 1070   C CA . ASP B 1 1361 ? 106.529 120.029 105.707 1.00 0.00 ? 1361 ASP B CA 1  
ATOM 1071   C CA . LEU B 1 1362 ? 105.831 123.665 104.735 1.00 0.00 ? 1362 LEU B CA 1  
ATOM 1072   C CA . GLY B 1 1363 ? 104.604 124.545 108.203 1.00 0.00 ? 1363 GLY B CA 1  
ATOM 1073   C CA . MET B 1 1364 ? 106.983 125.087 111.132 1.00 0.00 ? 1364 MET B CA 1  
ATOM 1074   C CA . GLN B 1 1365 ? 106.954 128.201 113.321 1.00 0.00 ? 1365 GLN B CA 1  
ATOM 1075   C CA . SER B 1 1366 ? 109.947 128.539 115.656 1.00 0.00 ? 1366 SER B CA 1  
ATOM 1076   C CA . ALA B 1 1367 ? 110.428 132.276 115.470 1.00 0.00 ? 1367 ALA B CA 1  
ATOM 1077   C CA . THR B 1 1368 ? 112.035 132.746 118.973 1.00 0.00 ? 1368 THR B CA 1  
ATOM 1078   C CA . VAL B 1 1369 ? 115.301 130.992 120.016 1.00 0.00 ? 1369 VAL B CA 1  
ATOM 1079   C CA . GLY B 1 1370 ? 114.931 127.992 117.660 1.00 0.00 ? 1370 GLY B CA 1  
ATOM 1080   C CA . ILE B 1 1371 ? 116.710 126.286 114.746 1.00 0.00 ? 1371 ILE B CA 1  
ATOM 1081   C CA . ASP B 1 1372 ? 115.528 124.640 111.494 1.00 0.00 ? 1372 ASP B CA 1  
ATOM 1082   C CA . VAL B 1 1373 ? 116.290 124.168 107.770 1.00 0.00 ? 1373 VAL B CA 1  
ATOM 1083   C CA . LYS B 1 1374 ? 113.766 124.039 104.948 1.00 0.00 ? 1374 LYS B CA 1  
ATOM 1084   C CA . ASP B 1 1375 ? 115.248 123.146 101.581 1.00 0.00 ? 1375 ASP B CA 1  
ATOM 1085   C CA . TRP B 1 1376 ? 113.064 123.803 98.514  1.00 0.00 ? 1376 TRP B CA 1  
ATOM 1086   C CA . PRO B 1 1377 ? 113.904 123.990 94.776  1.00 0.00 ? 1377 PRO B CA 1  
ATOM 1087   C CA . ILE B 1 1378 ? 112.442 127.507 94.111  1.00 0.00 ? 1378 ILE B CA 1  
ATOM 1088   C CA . GLN B 1 1379 ? 113.118 128.008 90.481  1.00 0.00 ? 1379 GLN B CA 1  
ATOM 1089   C CA . ILE B 1 1380 ? 112.177 129.301 87.049  1.00 0.00 ? 1380 ILE B CA 1  
ATOM 1090   C CA . ARG B 1 1381 ? 111.315 126.591 84.552  1.00 0.00 ? 1381 ARG B CA 1  
ATOM 1091   C CA . ASP B 1 1382 ? 113.379 126.619 81.312  1.00 0.00 ? 1382 ASP B CA 1  
ATOM 1092   C CA . LYS B 1 1383 ? 116.058 129.031 82.638  1.00 0.00 ? 1383 LYS B CA 1  
ATOM 1093   C CA . ARG B 1 1384 ? 119.431 128.697 84.481  1.00 0.00 ? 1384 ARG B CA 1  
ATOM 1094   C CA . LYS B 1 1385 ? 117.504 128.762 87.726  1.00 0.00 ? 1385 LYS B CA 1  
ATOM 1095   C CA . ARG B 1 1386 ? 115.782 125.392 86.732  1.00 0.00 ? 1386 ARG B CA 1  
ATOM 1096   C CA . ASP B 1 1387 ? 118.217 123.251 88.792  1.00 0.00 ? 1387 ASP B CA 1  
ATOM 1097   C CA . LEU B 1 1388 ? 118.637 125.706 91.763  1.00 0.00 ? 1388 LEU B CA 1  
ATOM 1098   C CA . VAL B 1 1389 ? 118.276 124.522 95.371  1.00 0.00 ? 1389 VAL B CA 1  
ATOM 1099   C CA . LEU B 1 1390 ? 117.447 127.054 98.116  1.00 0.00 ? 1390 LEU B CA 1  
ATOM 1100   C CA . ASN B 1 1391 ? 118.290 126.197 101.722 1.00 0.00 ? 1391 ASN B CA 1  
ATOM 1101   C CA . VAL B 1 1392 ? 116.356 128.367 104.195 1.00 0.00 ? 1392 VAL B CA 1  
ATOM 1102   C CA . TRP B 1 1393 ? 118.167 128.566 107.525 1.00 0.00 ? 1393 TRP B CA 1  
ATOM 1103   C CA . ASP B 1 1394 ? 117.105 130.175 110.747 1.00 0.00 ? 1394 ASP B CA 1  
ATOM 1104   C CA . PHE B 1 1395 ? 119.661 130.195 113.594 1.00 0.00 ? 1395 PHE B CA 1  
ATOM 1105   C CA . ALA B 1 1396 ? 117.687 132.681 115.745 1.00 0.00 ? 1396 ALA B CA 1  
ATOM 1106   C CA . GLY B 1 1397 ? 120.499 135.258 116.180 1.00 0.00 ? 1397 GLY B CA 1  
ATOM 1107   C CA . ARG B 1 1398 ? 123.087 132.737 117.388 1.00 0.00 ? 1398 ARG B CA 1  
ATOM 1108   C CA . GLU B 1 1399 ? 125.327 132.155 114.371 1.00 0.00 ? 1399 GLU B CA 1  
ATOM 1109   C CA . GLU B 1 1400 ? 126.637 128.718 115.512 1.00 0.00 ? 1400 GLU B CA 1  
ATOM 1110   C CA . PHE B 1 1401 ? 128.624 127.900 112.319 1.00 0.00 ? 1401 PHE B CA 1  
ATOM 1111   C CA . TYR B 1 1402 ? 130.709 131.153 112.406 1.00 0.00 ? 1402 TYR B CA 1  
ATOM 1112   C CA . SER B 1 1403 ? 133.908 130.043 114.243 1.00 0.00 ? 1403 SER B CA 1  
ATOM 1113   C CA . THR B 1 1404 ? 134.606 126.745 112.437 1.00 0.00 ? 1404 THR B CA 1  
ATOM 1114   C CA . HIS B 1 1405 ? 132.938 127.397 109.063 1.00 0.00 ? 1405 HIS B CA 1  
ATOM 1115   C CA . PRO B 1 1406 ? 133.636 131.087 108.003 1.00 0.00 ? 1406 PRO B CA 1  
ATOM 1116   C CA . HIS B 1 1407 ? 132.540 130.558 104.374 1.00 0.00 ? 1407 HIS B CA 1  
ATOM 1117   C CA . PHE B 1 1408 ? 129.120 129.162 105.411 1.00 0.00 ? 1408 PHE B CA 1  
ATOM 1118   C CA . MET B 1 1409 ? 128.222 132.743 106.401 1.00 0.00 ? 1409 MET B CA 1  
ATOM 1119   C CA . THR B 1 1410 ? 130.463 134.791 104.049 1.00 0.00 ? 1410 THR B CA 1  
ATOM 1120   C CA . GLN B 1 1411 ? 130.032 132.823 100.803 1.00 0.00 ? 1411 GLN B CA 1  
ATOM 1121   C CA . ARG B 1 1412 ? 127.137 130.906 99.226  1.00 0.00 ? 1412 ARG B CA 1  
ATOM 1122   C CA . ALA B 1 1413 ? 124.657 133.050 101.129 1.00 0.00 ? 1413 ALA B CA 1  
ATOM 1123   C CA . LEU B 1 1414 ? 121.761 135.494 100.959 1.00 0.00 ? 1414 LEU B CA 1  
ATOM 1124   C CA . TYR B 1 1415 ? 120.596 137.367 104.046 1.00 0.00 ? 1415 TYR B CA 1  
ATOM 1125   C CA . LEU B 1 1416 ? 116.879 138.137 104.267 1.00 0.00 ? 1416 LEU B CA 1  
ATOM 1126   C CA . ALA B 1 1417 ? 116.130 140.775 106.850 1.00 0.00 ? 1417 ALA B CA 1  
ATOM 1127   C CA . VAL B 1 1418 ? 112.560 140.585 108.125 1.00 0.00 ? 1418 VAL B CA 1  
ATOM 1128   C CA . TYR B 1 1419 ? 111.265 143.801 109.642 1.00 0.00 ? 1419 TYR B CA 1  
ATOM 1129   C CA . ASP B 1 1420 ? 107.807 144.166 110.993 1.00 0.00 ? 1420 ASP B CA 1  
ATOM 1130   C CA . LEU B 1 1421 ? 107.980 147.925 110.431 1.00 0.00 ? 1421 LEU B CA 1  
ATOM 1131   C CA . SER B 1 1422 ? 105.102 148.712 112.852 1.00 0.00 ? 1422 SER B CA 1  
ATOM 1132   C CA . LYS B 1 1423 ? 106.559 146.550 115.658 1.00 0.00 ? 1423 LYS B CA 1  
ATOM 1133   C CA . GLY B 1 1424 ? 110.164 145.344 114.997 1.00 0.00 ? 1424 GLY B CA 1  
ATOM 1134   C CA . GLN B 1 1425 ? 111.215 148.760 113.641 1.00 0.00 ? 1425 GLN B CA 1  
ATOM 1135   C CA . ALA B 1 1426 ? 108.768 150.916 115.667 1.00 0.00 ? 1426 ALA B CA 1  
ATOM 1136   C CA . GLU B 1 1427 ? 108.818 149.264 119.180 1.00 0.00 ? 1427 GLU B CA 1  
ATOM 1137   C CA . VAL B 1 1428 ? 112.514 148.293 119.450 1.00 0.00 ? 1428 VAL B CA 1  
ATOM 1138   C CA . ASP B 1 1429 ? 114.358 149.920 116.439 1.00 0.00 ? 1429 ASP B CA 1  
ATOM 1139   C CA . ALA B 1 1430 ? 116.215 146.651 115.891 1.00 0.00 ? 1430 ALA B CA 1  
ATOM 1140   C CA . MET B 1 1431 ? 116.824 147.462 112.222 1.00 0.00 ? 1431 MET B CA 1  
ATOM 1141   C CA . LYS B 1 1432 ? 120.215 149.098 112.940 1.00 0.00 ? 1432 LYS B CA 1  
ATOM 1142   C CA . PRO B 1 1433 ? 121.444 146.087 115.085 1.00 0.00 ? 1433 PRO B CA 1  
ATOM 1143   C CA . TRP B 1 1434 ? 120.294 143.439 112.552 1.00 0.00 ? 1434 TRP B CA 1  
ATOM 1144   C CA . LEU B 1 1435 ? 121.813 145.305 109.609 1.00 0.00 ? 1435 LEU B CA 1  
ATOM 1145   C CA . PHE B 1 1436 ? 125.237 145.452 111.380 1.00 0.00 ? 1436 PHE B CA 1  
ATOM 1146   C CA . ASN B 1 1437 ? 124.776 141.743 112.379 1.00 0.00 ? 1437 ASN B CA 1  
ATOM 1147   C CA . ILE B 1 1438 ? 124.374 140.874 108.659 1.00 0.00 ? 1438 ILE B CA 1  
ATOM 1148   C CA . LYS B 1 1439 ? 127.466 142.997 107.736 1.00 0.00 ? 1439 LYS B CA 1  
ATOM 1149   C CA . ALA B 1 1440 ? 129.809 141.364 110.304 1.00 0.00 ? 1440 ALA B CA 1  
ATOM 1150   C CA . ARG B 1 1441 ? 128.699 137.699 110.007 1.00 0.00 ? 1441 ARG B CA 1  
ATOM 1151   C CA . ALA B 1 1442 ? 128.291 137.756 106.286 1.00 0.00 ? 1442 ALA B CA 1  
ATOM 1152   C CA . SER B 1 1443 ? 130.862 139.632 104.202 1.00 0.00 ? 1443 SER B CA 1  
ATOM 1153   C CA . SER B 1 1444 ? 129.935 140.913 100.747 1.00 0.00 ? 1444 SER B CA 1  
ATOM 1154   C CA . SER B 1 1445 ? 126.886 138.580 100.852 1.00 0.00 ? 1445 SER B CA 1  
ATOM 1155   C CA . PRO B 1 1446 ? 123.616 140.228 99.560  1.00 0.00 ? 1446 PRO B CA 1  
ATOM 1156   C CA . VAL B 1 1447 ? 120.880 141.294 101.782 1.00 0.00 ? 1447 VAL B CA 1  
ATOM 1157   C CA . ILE B 1 1448 ? 117.212 141.711 100.901 1.00 0.00 ? 1448 ILE B CA 1  
ATOM 1158   C CA . LEU B 1 1449 ? 115.148 143.903 103.225 1.00 0.00 ? 1449 LEU B CA 1  
ATOM 1159   C CA . VAL B 1 1450 ? 111.532 142.769 103.642 1.00 0.00 ? 1450 VAL B CA 1  
ATOM 1160   C CA . GLY B 1 1451 ? 109.088 145.119 105.394 1.00 0.00 ? 1451 GLY B CA 1  
ATOM 1161   C CA . THR B 1 1452 ? 106.301 142.855 106.698 1.00 0.00 ? 1452 THR B CA 1  
ATOM 1162   C CA . HIS B 1 1453 ? 102.705 143.254 107.971 1.00 0.00 ? 1453 HIS B CA 1  
ATOM 1163   C CA . LEU B 1 1454 ? 102.039 146.241 105.718 1.00 0.00 ? 1454 LEU B CA 1  
ATOM 1164   C CA . ASP B 1 1455 ? 98.240  145.607 105.779 1.00 0.00 ? 1455 ASP B CA 1  
ATOM 1165   C CA . VAL B 1 1456 ? 98.079  146.602 109.497 1.00 0.00 ? 1456 VAL B CA 1  
ATOM 1166   C CA . SER B 1 1457 ? 99.976  149.829 108.730 1.00 0.00 ? 1457 SER B CA 1  
ATOM 1167   C CA . ASP B 1 1458 ? 97.812  151.146 105.831 1.00 0.00 ? 1458 ASP B CA 1  
ATOM 1168   C CA . GLU B 1 1459 ? 100.923 151.293 103.582 1.00 0.00 ? 1459 GLU B CA 1  
ATOM 1169   C CA . LYS B 1 1460 ? 102.485 153.993 105.836 1.00 0.00 ? 1460 LYS B CA 1  
ATOM 1170   C CA . GLN B 1 1461 ? 105.572 152.273 107.282 1.00 0.00 ? 1461 GLN B CA 1  
ATOM 1171   C CA . ARG B 1 1462 ? 107.050 151.658 103.840 1.00 0.00 ? 1462 ARG B CA 1  
ATOM 1172   C CA . LYS B 1 1463 ? 107.394 155.354 103.062 1.00 0.00 ? 1463 LYS B CA 1  
ATOM 1173   C CA . ALA B 1 1464 ? 110.717 157.283 102.913 1.00 0.00 ? 1464 ALA B CA 1  
ATOM 1174   C CA . CYS B 1 1465 ? 109.530 159.138 106.034 1.00 0.00 ? 1465 CYS B CA 1  
ATOM 1175   C CA . MET B 1 1466 ? 109.861 155.973 108.197 1.00 0.00 ? 1466 MET B CA 1  
ATOM 1176   C CA . SER B 1 1467 ? 111.959 153.567 106.086 1.00 0.00 ? 1467 SER B CA 1  
ATOM 1177   C CA . LYS B 1 1468 ? 115.219 155.299 105.170 1.00 0.00 ? 1468 LYS B CA 1  
ATOM 1178   C CA . ILE B 1 1469 ? 115.934 153.207 102.000 1.00 0.00 ? 1469 ILE B CA 1  
ATOM 1179   C CA . THR B 1 1470 ? 118.212 155.536 99.987  1.00 0.00 ? 1470 THR B CA 1  
ATOM 1180   C CA . LYS B 1 1471 ? 119.026 157.844 102.851 1.00 0.00 ? 1471 LYS B CA 1  
ATOM 1181   C CA . GLU B 1 1472 ? 120.413 155.241 105.392 1.00 0.00 ? 1472 GLU B CA 1  
ATOM 1182   C CA . LEU B 1 1473 ? 119.868 151.646 104.168 1.00 0.00 ? 1473 LEU B CA 1  
ATOM 1183   C CA . LEU B 1 1474 ? 121.524 151.586 100.683 1.00 0.00 ? 1474 LEU B CA 1  
ATOM 1184   C CA . ASN B 1 1475 ? 124.936 152.309 99.024  1.00 0.00 ? 1475 ASN B CA 1  
ATOM 1185   C CA . LYS B 1 1476 ? 124.721 156.105 99.656  1.00 0.00 ? 1476 LYS B CA 1  
ATOM 1186   C CA . ARG B 1 1477 ? 125.135 155.571 103.421 1.00 0.00 ? 1477 ARG B CA 1  
ATOM 1187   C CA . GLY B 1 1478 ? 127.386 152.550 103.726 1.00 0.00 ? 1478 GLY B CA 1  
ATOM 1188   C CA . PHE B 1 1479 ? 125.042 149.604 103.051 1.00 0.00 ? 1479 PHE B CA 1  
ATOM 1189   C CA . PRO B 1 1480 ? 126.322 148.402 99.637  1.00 0.00 ? 1480 PRO B CA 1  
ATOM 1190   C CA . ALA B 1 1481 ? 125.156 144.779 99.339  1.00 0.00 ? 1481 ALA B CA 1  
ATOM 1191   C CA . ILE B 1 1482 ? 121.389 145.475 99.557  1.00 0.00 ? 1482 ILE B CA 1  
ATOM 1192   C CA . ARG B 1 1483 ? 120.050 147.081 96.303  1.00 0.00 ? 1483 ARG B CA 1  
ATOM 1193   C CA . ASP B 1 1484 ? 116.573 145.583 97.010  1.00 0.00 ? 1484 ASP B CA 1  
ATOM 1194   C CA . TYR B 1 1485 ? 113.651 146.417 99.328  1.00 0.00 ? 1485 TYR B CA 1  
ATOM 1195   C CA . HIS B 1 1486 ? 110.201 144.799 99.667  1.00 0.00 ? 1486 HIS B CA 1  
ATOM 1196   C CA . PHE B 1 1487 ? 106.971 145.838 101.262 1.00 0.00 ? 1487 PHE B CA 1  
ATOM 1197   C CA . VAL B 1 1488 ? 104.665 142.879 101.753 1.00 0.00 ? 1488 VAL B CA 1  
ATOM 1198   C CA . ASN B 1 1489 ? 101.095 142.414 103.021 1.00 0.00 ? 1489 ASN B CA 1  
ATOM 1199   C CA . ALA B 1 1490 ? 100.492 138.669 103.104 1.00 0.00 ? 1490 ALA B CA 1  
ATOM 1200   C CA . THR B 1 1491 ? 96.787  138.434 103.864 1.00 0.00 ? 1491 THR B CA 1  
ATOM 1201   C CA . GLU B 1 1492 ? 95.807  141.162 101.391 1.00 0.00 ? 1492 GLU B CA 1  
ATOM 1202   C CA . GLU B 1 1493 ? 97.632  140.010 98.240  1.00 0.00 ? 1493 GLU B CA 1  
ATOM 1203   C CA . SER B 1 1494 ? 100.701 137.936 97.231  1.00 0.00 ? 1494 SER B CA 1  
ATOM 1204   C CA . ASP B 1 1495 ? 101.873 140.223 94.413  1.00 0.00 ? 1495 ASP B CA 1  
ATOM 1205   C CA . ALA B 1 1496 ? 104.742 141.857 96.369  1.00 0.00 ? 1496 ALA B CA 1  
ATOM 1206   C CA . LEU B 1 1497 ? 105.992 138.409 97.497  1.00 0.00 ? 1497 LEU B CA 1  
ATOM 1207   C CA . ALA B 1 1498 ? 106.456 137.361 93.864  1.00 0.00 ? 1498 ALA B CA 1  
ATOM 1208   C CA . LYS B 1 1499 ? 108.797 140.405 93.680  1.00 0.00 ? 1499 LYS B CA 1  
ATOM 1209   C CA . LEU B 1 1500 ? 110.877 138.834 96.525  1.00 0.00 ? 1500 LEU B CA 1  
ATOM 1210   C CA . ARG B 1 1501 ? 111.534 135.953 94.109  1.00 0.00 ? 1501 ARG B CA 1  
ATOM 1211   C CA . LYS B 1 1502 ? 113.122 138.457 91.645  1.00 0.00 ? 1502 LYS B CA 1  
ATOM 1212   C CA . THR B 1 1503 ? 115.585 139.506 94.359  1.00 0.00 ? 1503 THR B CA 1  
ATOM 1213   C CA . ILE B 1 1504 ? 116.271 135.812 95.163  1.00 0.00 ? 1504 ILE B CA 1  
ATOM 1214   C CA . ILE B 1 1505 ? 116.966 135.621 91.383  1.00 0.00 ? 1505 ILE B CA 1  
ATOM 1215   C CA . ASN B 1 1506 ? 119.285 138.727 91.543  1.00 0.00 ? 1506 ASN B CA 1  
ATOM 1216   C CA . GLU B 1 1507 ? 121.301 137.016 94.263  1.00 0.00 ? 1507 GLU B CA 1  
ATOM 1217   C CA . SER B 1 1508 ? 122.712 133.398 94.053  1.00 0.00 ? 1508 SER B CA 1  
ATOM 1218   C CA . LEU B 1 1509 ? 124.426 134.827 90.918  1.00 0.00 ? 1509 LEU B CA 1  
ATOM 1219   C CA . ASN B 1 1510 ? 127.660 135.957 92.607  1.00 0.00 ? 1510 ASN B CA 1  
ATOM 1220   C CA . PHE B 1 1511 ? 127.649 133.048 95.178  1.00 0.00 ? 1511 PHE B CA 1  
ATOM 1221   C CA . LYS B 1 1512 ? 127.505 129.878 93.192  1.00 0.00 ? 1512 LYS B CA 1  
ATOM 1222   C CA . ILE B 1 1513 ? 127.615 130.599 89.403  1.00 0.00 ? 1513 ILE B CA 1  
ATOM 1223   C CA . ARG B 1 1514 ? 131.193 131.960 89.290  1.00 0.00 ? 1514 ARG B CA 1  
ATOM 1224   C CA . PRO B 1 1524 ? 134.185 117.076 81.428  1.00 0.00 ? 1524 PRO B CA 1  
ATOM 1225   C CA . ASP B 1 1525 ? 132.682 113.530 81.417  1.00 0.00 ? 1525 ASP B CA 1  
ATOM 1226   C CA . CYS B 1 1526 ? 135.997 111.997 82.632  1.00 0.00 ? 1526 CYS B CA 1  
ATOM 1227   C CA . TYR B 1 1527 ? 135.869 114.025 85.920  1.00 0.00 ? 1527 TYR B CA 1  
ATOM 1228   C CA . VAL B 1 1528 ? 132.239 112.839 86.587  1.00 0.00 ? 1528 VAL B CA 1  
ATOM 1229   C CA . GLU B 1 1529 ? 133.142 109.213 85.647  1.00 0.00 ? 1529 GLU B CA 1  
ATOM 1230   C CA . LEU B 1 1530 ? 136.162 109.218 87.935  1.00 0.00 ? 1530 LEU B CA 1  
ATOM 1231   C CA . GLU B 1 1531 ? 134.184 110.868 90.797  1.00 0.00 ? 1531 GLU B CA 1  
ATOM 1232   C CA . LYS B 1 1532 ? 131.547 108.080 90.659  1.00 0.00 ? 1532 LYS B CA 1  
ATOM 1233   C CA . ILE B 1 1533 ? 134.168 105.279 90.608  1.00 0.00 ? 1533 ILE B CA 1  
ATOM 1234   C CA . ILE B 1 1534 ? 136.130 106.977 93.421  1.00 0.00 ? 1534 ILE B CA 1  
ATOM 1235   C CA . LEU B 1 1535 ? 132.935 107.312 95.547  1.00 0.00 ? 1535 LEU B CA 1  
ATOM 1236   C CA . SER B 1 1536 ? 131.939 103.649 94.969  1.00 0.00 ? 1536 SER B CA 1  
ATOM 1237   C CA . GLU B 1 1537 ? 135.491 102.393 95.786  1.00 0.00 ? 1537 GLU B CA 1  
ATOM 1238   C CA . ARG B 1 1538 ? 135.779 104.724 98.807  1.00 0.00 ? 1538 ARG B CA 1  
ATOM 1239   C CA . LYS B 1 1539 ? 132.426 104.041 100.523 1.00 0.00 ? 1539 LYS B CA 1  
ATOM 1240   C CA . ASN B 1 1540 ? 133.064 100.275 100.247 1.00 0.00 ? 1540 ASN B CA 1  
ATOM 1241   C CA . VAL B 1 1541 ? 136.162 100.672 102.458 1.00 0.00 ? 1541 VAL B CA 1  
ATOM 1242   C CA . PRO B 1 1542 ? 134.528 101.917 105.768 1.00 0.00 ? 1542 PRO B CA 1  
ATOM 1243   C CA . ILE B 1 1543 ? 136.365 99.370  107.852 1.00 0.00 ? 1543 ILE B CA 1  
ATOM 1244   C CA . GLU B 1 1544 ? 139.809 100.316 106.705 1.00 0.00 ? 1544 GLU B CA 1  
ATOM 1245   C CA . PHE B 1 1545 ? 141.754 103.601 106.143 1.00 0.00 ? 1545 PHE B CA 1  
ATOM 1246   C CA . PRO B 1 1546 ? 143.552 103.158 102.730 1.00 0.00 ? 1546 PRO B CA 1  
ATOM 1247   C CA . VAL B 1 1547 ? 140.215 103.512 101.149 1.00 0.00 ? 1547 VAL B CA 1  
ATOM 1248   C CA . ILE B 1 1548 ? 142.141 104.313 98.019  1.00 0.00 ? 1548 ILE B CA 1  
ATOM 1249   C CA . ASP B 1 1549 ? 145.947 103.986 97.799  1.00 0.00 ? 1549 ASP B CA 1  
ATOM 1250   C CA . ARG B 1 1550 ? 148.054 105.891 95.208  1.00 0.00 ? 1550 ARG B CA 1  
ATOM 1251   C CA . LYS B 1 1551 ? 148.244 102.976 92.736  1.00 0.00 ? 1551 LYS B CA 1  
ATOM 1252   C CA . ARG B 1 1552 ? 144.518 102.308 92.936  1.00 0.00 ? 1552 ARG B CA 1  
ATOM 1253   C CA . LEU B 1 1553 ? 143.417 105.898 92.025  1.00 0.00 ? 1553 LEU B CA 1  
ATOM 1254   C CA . LEU B 1 1554 ? 146.051 105.955 89.240  1.00 0.00 ? 1554 LEU B CA 1  
ATOM 1255   C CA . GLN B 1 1555 ? 144.372 102.808 87.865  1.00 0.00 ? 1555 GLN B CA 1  
ATOM 1256   C CA . LEU B 1 1556 ? 140.856 104.389 88.038  1.00 0.00 ? 1556 LEU B CA 1  
ATOM 1257   C CA . VAL B 1 1557 ? 142.120 107.647 86.408  1.00 0.00 ? 1557 VAL B CA 1  
ATOM 1258   C CA . ARG B 1 1558 ? 143.604 105.606 83.493  1.00 0.00 ? 1558 ARG B CA 1  
ATOM 1259   C CA . GLU B 1 1559 ? 140.352 103.691 82.875  1.00 0.00 ? 1559 GLU B CA 1  
ATOM 1260   C CA . ASN B 1 1560 ? 138.578 107.048 82.279  1.00 0.00 ? 1560 ASN B CA 1  
ATOM 1261   C CA . GLN B 1 1561 ? 141.524 108.266 80.100  1.00 0.00 ? 1561 GLN B CA 1  
ATOM 1262   C CA . LEU B 1 1562 ? 143.021 110.799 82.601  1.00 0.00 ? 1562 LEU B CA 1  
ATOM 1263   C CA . GLN B 1 1563 ? 146.482 109.178 83.133  1.00 0.00 ? 1563 GLN B CA 1  
ATOM 1264   C CA . LEU B 1 1564 ? 147.604 111.386 80.215  1.00 0.00 ? 1564 LEU B CA 1  
ATOM 1265   C CA . ASP B 1 1565 ? 148.706 114.144 82.611  1.00 0.00 ? 1565 ASP B CA 1  
ATOM 1266   C CA . GLU B 1 1566 ? 149.753 113.768 86.292  1.00 0.00 ? 1566 GLU B CA 1  
ATOM 1267   C CA . ASN B 1 1567 ? 149.139 117.499 86.582  1.00 0.00 ? 1567 ASN B CA 1  
ATOM 1268   C CA . GLU B 1 1568 ? 145.327 117.253 85.818  1.00 0.00 ? 1568 GLU B CA 1  
ATOM 1269   C CA . LEU B 1 1569 ? 144.881 114.388 88.258  1.00 0.00 ? 1569 LEU B CA 1  
ATOM 1270   C CA . PRO B 1 1570 ? 146.033 116.623 91.245  1.00 0.00 ? 1570 PRO B CA 1  
ATOM 1271   C CA . HIS B 1 1571 ? 143.620 119.273 89.953  1.00 0.00 ? 1571 HIS B CA 1  
ATOM 1272   C CA . ALA B 1 1572 ? 140.681 116.801 89.683  1.00 0.00 ? 1572 ALA B CA 1  
ATOM 1273   C CA . VAL B 1 1573 ? 141.338 115.362 93.171  1.00 0.00 ? 1573 VAL B CA 1  
ATOM 1274   C CA . HIS B 1 1574 ? 142.003 118.932 94.492  1.00 0.00 ? 1574 HIS B CA 1  
ATOM 1275   C CA . PHE B 1 1575 ? 138.502 119.818 93.144  1.00 0.00 ? 1575 PHE B CA 1  
ATOM 1276   C CA . LEU B 1 1576 ? 136.904 116.716 94.647  1.00 0.00 ? 1576 LEU B CA 1  
ATOM 1277   C CA . ASN B 1 1577 ? 138.610 117.488 97.982  1.00 0.00 ? 1577 ASN B CA 1  
ATOM 1278   C CA . GLU B 1 1578 ? 137.516 121.203 97.885  1.00 0.00 ? 1578 GLU B CA 1  
ATOM 1279   C CA . SER B 1 1579 ? 133.947 119.978 97.272  1.00 0.00 ? 1579 SER B CA 1  
ATOM 1280   C CA . GLY B 1 1580 ? 134.022 117.297 100.067 1.00 0.00 ? 1580 GLY B CA 1  
ATOM 1281   C CA . VAL B 1 1581 ? 133.081 114.458 97.706  1.00 0.00 ? 1581 VAL B CA 1  
ATOM 1282   C CA . LEU B 1 1582 ? 136.308 112.783 98.720  1.00 0.00 ? 1582 LEU B CA 1  
ATOM 1283   C CA . LEU B 1 1583 ? 139.134 113.898 100.959 1.00 0.00 ? 1583 LEU B CA 1  
ATOM 1284   C CA . HIS B 1 1584 ? 142.706 114.270 99.655  1.00 0.00 ? 1584 HIS B CA 1  
ATOM 1285   C CA . PHE B 1 1585 ? 145.357 115.795 101.849 1.00 0.00 ? 1585 PHE B CA 1  
ATOM 1286   C CA . GLN B 1 1586 ? 148.171 117.244 99.716  1.00 0.00 ? 1586 GLN B CA 1  
ATOM 1287   C CA . ASP B 1 1587 ? 150.257 118.318 102.785 1.00 0.00 ? 1587 ASP B CA 1  
ATOM 1288   C CA . PRO B 1 1588 ? 150.754 114.695 104.208 1.00 0.00 ? 1588 PRO B CA 1  
ATOM 1289   C CA . ALA B 1 1589 ? 150.893 113.255 100.624 1.00 0.00 ? 1589 ALA B CA 1  
ATOM 1290   C CA . LEU B 1 1590 ? 154.721 113.495 100.436 1.00 0.00 ? 1590 LEU B CA 1  
ATOM 1291   C CA . GLN B 1 1591 ? 155.194 110.365 102.599 1.00 0.00 ? 1591 GLN B CA 1  
ATOM 1292   C CA . LEU B 1 1592 ? 151.787 108.712 102.249 1.00 0.00 ? 1592 LEU B CA 1  
ATOM 1293   C CA . SER B 1 1593 ? 150.931 106.649 99.121  1.00 0.00 ? 1593 SER B CA 1  
ATOM 1294   C CA . ASP B 1 1594 ? 149.139 103.992 101.217 1.00 0.00 ? 1594 ASP B CA 1  
ATOM 1295   C CA . LEU B 1 1595 ? 146.407 106.418 102.296 1.00 0.00 ? 1595 LEU B CA 1  
ATOM 1296   C CA . TYR B 1 1596 ? 146.021 108.893 99.474  1.00 0.00 ? 1596 TYR B CA 1  
ATOM 1297   C CA . PHE B 1 1597 ? 142.313 109.689 99.093  1.00 0.00 ? 1597 PHE B CA 1  
ATOM 1298   C CA . VAL B 1 1598 ? 139.733 109.283 101.886 1.00 0.00 ? 1598 VAL B CA 1  
ATOM 1299   C CA . GLU B 1 1599 ? 135.968 108.677 102.567 1.00 0.00 ? 1599 GLU B CA 1  
ATOM 1300   C CA . PRO B 1 1600 ? 134.583 111.830 104.351 1.00 0.00 ? 1600 PRO B CA 1  
ATOM 1301   C CA . LYS B 1 1601 ? 132.223 109.795 106.580 1.00 0.00 ? 1601 LYS B CA 1  
ATOM 1302   C CA . TRP B 1 1602 ? 135.044 107.563 107.765 1.00 0.00 ? 1602 TRP B CA 1  
ATOM 1303   C CA . LEU B 1 1603 ? 137.220 110.626 108.625 1.00 0.00 ? 1603 LEU B CA 1  
ATOM 1304   C CA . CYS B 1 1604 ? 134.369 112.523 110.360 1.00 0.00 ? 1604 CYS B CA 1  
ATOM 1305   C CA . LYS B 1 1605 ? 133.330 109.538 112.529 1.00 0.00 ? 1605 LYS B CA 1  
ATOM 1306   C CA . ILE B 1 1606 ? 136.991 109.094 113.566 1.00 0.00 ? 1606 ILE B CA 1  
ATOM 1307   C CA . MET B 1 1607 ? 137.442 112.529 114.928 1.00 0.00 ? 1607 MET B CA 1  
ATOM 1308   C CA . ALA B 1 1608 ? 134.059 112.813 116.579 1.00 0.00 ? 1608 ALA B CA 1  
ATOM 1309   C CA . GLN B 1 1609 ? 134.951 109.611 118.524 1.00 0.00 ? 1609 GLN B CA 1  
ATOM 1310   C CA . ILE B 1 1610 ? 138.248 111.238 119.673 1.00 0.00 ? 1610 ILE B CA 1  
ATOM 1311   C CA . LEU B 1 1611 ? 136.420 114.502 120.544 1.00 0.00 ? 1611 LEU B CA 1  
ATOM 1312   C CA . THR B 1 1612 ? 133.646 112.775 122.585 1.00 0.00 ? 1612 THR B CA 1  
ATOM 1313   C CA . VAL B 1 1613 ? 135.791 110.136 124.307 1.00 0.00 ? 1613 VAL B CA 1  
ATOM 1314   C CA . LYS B 1 1614 ? 135.705 110.016 128.145 1.00 0.00 ? 1614 LYS B CA 1  
ATOM 1315   C CA . VAL B 1 1615 ? 139.510 109.576 128.243 1.00 0.00 ? 1615 VAL B CA 1  
ATOM 1316   C CA . GLU B 1 1616 ? 140.642 113.199 127.806 1.00 0.00 ? 1616 GLU B CA 1  
ATOM 1317   C CA . GLY B 1 1617 ? 143.453 112.821 130.358 1.00 0.00 ? 1617 GLY B CA 1  
ATOM 1318   C CA . CYS B 1 1618 ? 144.742 111.273 133.570 1.00 0.00 ? 1618 CYS B CA 1  
ATOM 1319   C CA . PRO B 1 1619 ? 142.014 110.169 136.133 1.00 0.00 ? 1619 PRO B CA 1  
ATOM 1320   C CA . LYS B 1 1620 ? 141.837 113.334 138.321 1.00 0.00 ? 1620 LYS B CA 1  
ATOM 1321   C CA . HIS B 1 1621 ? 142.706 115.880 135.594 1.00 0.00 ? 1621 HIS B CA 1  
ATOM 1322   C CA . PRO B 1 1622 ? 141.007 115.258 132.182 1.00 0.00 ? 1622 PRO B CA 1  
ATOM 1323   C CA . LYS B 1 1623 ? 141.374 118.678 130.513 1.00 0.00 ? 1623 LYS B CA 1  
ATOM 1324   C CA . GLY B 1 1624 ? 141.497 118.021 126.724 1.00 0.00 ? 1624 GLY B CA 1  
ATOM 1325   C CA . ILE B 1 1625 ? 144.542 115.703 126.915 1.00 0.00 ? 1625 ILE B CA 1  
ATOM 1326   C CA . ILE B 1 1626 ? 144.830 112.895 124.329 1.00 0.00 ? 1626 ILE B CA 1  
ATOM 1327   C CA . SER B 1 1627 ? 147.150 110.117 125.556 1.00 0.00 ? 1627 SER B CA 1  
ATOM 1328   C CA . ARG B 1 1628 ? 148.371 108.473 122.296 1.00 0.00 ? 1628 ARG B CA 1  
ATOM 1329   C CA . ARG B 1 1629 ? 148.355 104.913 123.766 1.00 0.00 ? 1629 ARG B CA 1  
ATOM 1330   C CA . ASP B 1 1630 ? 144.681 104.846 124.374 1.00 0.00 ? 1630 ASP B CA 1  
ATOM 1331   C CA . VAL B 1 1631 ? 143.599 105.499 120.716 1.00 0.00 ? 1631 VAL B CA 1  
ATOM 1332   C CA . GLU B 1 1632 ? 142.960 101.754 120.110 1.00 0.00 ? 1632 GLU B CA 1  
ATOM 1333   C CA . LYS B 1 1633 ? 140.297 101.728 122.837 1.00 0.00 ? 1633 LYS B CA 1  
ATOM 1334   C CA . PHE B 1 1634 ? 138.657 105.053 121.786 1.00 0.00 ? 1634 PHE B CA 1  
ATOM 1335   C CA . LEU B 1 1635 ? 138.299 104.264 118.152 1.00 0.00 ? 1635 LEU B CA 1  
ATOM 1336   C CA . SER B 1 1636 ? 137.697 100.455 118.040 1.00 0.00 ? 1636 SER B CA 1  
ATOM 1337   C CA . LYS B 1 1637 ? 135.471 98.318  117.522 1.00 0.00 ? 1637 LYS B CA 1  
ATOM 1338   C CA . LYS B 1 1638 ? 132.712 100.927 116.713 1.00 0.00 ? 1638 LYS B CA 1  
ATOM 1339   C CA . ARG B 1 1639 ? 134.891 101.716 113.777 1.00 0.00 ? 1639 ARG B CA 1  
ATOM 1340   C CA . LYS B 1 1640 ? 137.939 99.755  112.655 1.00 0.00 ? 1640 LYS B CA 1  
ATOM 1341   C CA . PHE B 1 1641 ? 141.208 101.639 113.114 1.00 0.00 ? 1641 PHE B CA 1  
ATOM 1342   C CA . PRO B 1 1642 ? 144.501 99.760  112.945 1.00 0.00 ? 1642 PRO B CA 1  
ATOM 1343   C CA . LYS B 1 1643 ? 147.741 101.348 114.270 1.00 0.00 ? 1643 LYS B CA 1  
ATOM 1344   C CA . ASN B 1 1644 ? 148.954 103.064 111.036 1.00 0.00 ? 1644 ASN B CA 1  
ATOM 1345   C CA . TYR B 1 1645 ? 145.424 104.425 110.496 1.00 0.00 ? 1645 TYR B CA 1  
ATOM 1346   C CA . MET B 1 1646 ? 145.595 105.660 114.109 1.00 0.00 ? 1646 MET B CA 1  
ATOM 1347   C CA . SER B 1 1647 ? 148.815 107.658 113.507 1.00 0.00 ? 1647 SER B CA 1  
ATOM 1348   C CA . GLN B 1 1648 ? 147.339 109.309 110.361 1.00 0.00 ? 1648 GLN B CA 1  
ATOM 1349   C CA . TYR B 1 1649 ? 143.973 110.432 111.875 1.00 0.00 ? 1649 TYR B CA 1  
ATOM 1350   C CA . PHE B 1 1650 ? 146.005 112.420 114.417 1.00 0.00 ? 1650 PHE B CA 1  
ATOM 1351   C CA . LYS B 1 1651 ? 147.649 114.201 111.452 1.00 0.00 ? 1651 LYS B CA 1  
ATOM 1352   C CA . LEU B 1 1652 ? 144.118 114.916 110.136 1.00 0.00 ? 1652 LEU B CA 1  
ATOM 1353   C CA . LEU B 1 1653 ? 143.196 116.431 113.575 1.00 0.00 ? 1653 LEU B CA 1  
ATOM 1354   C CA . GLU B 1 1654 ? 146.339 118.620 113.389 1.00 0.00 ? 1654 GLU B CA 1  
ATOM 1355   C CA . LYS B 1 1655 ? 145.400 119.660 109.846 1.00 0.00 ? 1655 LYS B CA 1  
ATOM 1356   C CA . PHE B 1 1656 ? 141.738 120.352 110.840 1.00 0.00 ? 1656 PHE B CA 1  
ATOM 1357   C CA . GLN B 1 1657 ? 143.208 122.448 113.734 1.00 0.00 ? 1657 GLN B CA 1  
ATOM 1358   C CA . ILE B 1 1658 ? 141.464 120.407 116.431 1.00 0.00 ? 1658 ILE B CA 1  
ATOM 1359   C CA . ALA B 1 1659 ? 144.635 119.416 118.290 1.00 0.00 ? 1659 ALA B CA 1  
ATOM 1360   C CA . LEU B 1 1660 ? 148.392 120.055 118.588 1.00 0.00 ? 1660 LEU B CA 1  
ATOM 1361   C CA . PRO B 1 1661 ? 151.362 117.933 119.836 1.00 0.00 ? 1661 PRO B CA 1  
ATOM 1362   C CA . ILE B 1 1662 ? 153.362 118.962 122.952 1.00 0.00 ? 1662 ILE B CA 1  
ATOM 1363   C CA . GLY B 1 1663 ? 155.908 116.140 122.459 1.00 0.00 ? 1663 GLY B CA 1  
ATOM 1364   C CA . GLU B 1 1664 ? 155.369 113.508 125.194 1.00 0.00 ? 1664 GLU B CA 1  
ATOM 1365   C CA . GLU B 1 1665 ? 152.832 111.353 123.212 1.00 0.00 ? 1665 GLU B CA 1  
ATOM 1366   C CA . TYR B 1 1666 ? 150.203 113.656 124.745 1.00 0.00 ? 1666 TYR B CA 1  
ATOM 1367   C CA . LEU B 1 1667 ? 148.165 116.041 122.577 1.00 0.00 ? 1667 LEU B CA 1  
ATOM 1368   C CA . LEU B 1 1668 ? 146.037 119.047 123.532 1.00 0.00 ? 1668 LEU B CA 1  
ATOM 1369   C CA . VAL B 1 1669 ? 142.448 119.397 122.233 1.00 0.00 ? 1669 VAL B CA 1  
ATOM 1370   C CA . ILE B 1 1690 ? 152.390 151.780 126.033 1.00 0.00 ? 1690 ILE B CA 1  
ATOM 1371   C CA . ILE B 1 1691 ? 151.773 151.763 122.211 1.00 0.00 ? 1691 ILE B CA 1  
ATOM 1372   C CA . ILE B 1 1692 ? 148.040 152.075 121.561 1.00 0.00 ? 1692 ILE B CA 1  
ATOM 1373   C CA . ARG B 1 1693 ? 146.522 151.735 118.074 1.00 0.00 ? 1693 ARG B CA 1  
ATOM 1374   C CA . LEU B 1 1694 ? 142.742 151.861 117.450 1.00 0.00 ? 1694 LEU B CA 1  
ATOM 1375   C CA . TYR B 1 1695 ? 140.775 150.657 114.363 1.00 0.00 ? 1695 TYR B CA 1  
ATOM 1376   C CA . GLU B 1 1696 ? 137.252 152.139 113.741 1.00 0.00 ? 1696 GLU B CA 1  
ATOM 1377   C CA . MET B 1 1697 ? 134.837 149.967 111.697 1.00 0.00 ? 1697 MET B CA 1  
ATOM 1378   C CA . PRO B 1 1698 ? 131.277 151.249 110.569 1.00 0.00 ? 1698 PRO B CA 1  
ATOM 1379   C CA . TYR B 1 1699 ? 130.325 147.668 111.066 1.00 0.00 ? 1699 TYR B CA 1  
ATOM 1380   C CA . PHE B 1 1700 ? 132.485 145.469 113.354 1.00 0.00 ? 1700 PHE B CA 1  
ATOM 1381   C CA . PRO B 1 1701 ? 131.876 141.745 112.425 1.00 0.00 ? 1701 PRO B CA 1  
ATOM 1382   C CA . MET B 1 1702 ? 131.384 139.645 115.571 1.00 0.00 ? 1702 MET B CA 1  
ATOM 1383   C CA . GLY B 1 1703 ? 133.602 137.002 113.955 1.00 0.00 ? 1703 GLY B CA 1  
ATOM 1384   C CA . PHE B 1 1704 ? 136.742 139.240 113.962 1.00 0.00 ? 1704 PHE B CA 1  
ATOM 1385   C CA . TRP B 1 1705 ? 137.874 138.536 117.526 1.00 0.00 ? 1705 TRP B CA 1  
ATOM 1386   C CA . SER B 1 1706 ? 136.940 134.889 117.381 1.00 0.00 ? 1706 SER B CA 1  
ATOM 1387   C CA . ARG B 1 1707 ? 138.967 134.454 114.180 1.00 0.00 ? 1707 ARG B CA 1  
ATOM 1388   C CA . LEU B 1 1708 ? 141.928 136.537 115.389 1.00 0.00 ? 1708 LEU B CA 1  
ATOM 1389   C CA . ILE B 1 1709 ? 141.979 134.417 118.590 1.00 0.00 ? 1709 ILE B CA 1  
ATOM 1390   C CA . ASN B 1 1710 ? 142.288 131.352 116.288 1.00 0.00 ? 1710 ASN B CA 1  
ATOM 1391   C CA . ARG B 1 1711 ? 145.096 132.893 114.142 1.00 0.00 ? 1711 ARG B CA 1  
ATOM 1392   C CA . LEU B 1 1712 ? 146.937 133.834 117.359 1.00 0.00 ? 1712 LEU B CA 1  
ATOM 1393   C CA . LEU B 1 1713 ? 146.117 130.771 119.588 1.00 0.00 ? 1713 LEU B CA 1  
ATOM 1394   C CA . GLU B 1 1714 ? 149.774 129.967 120.256 1.00 0.00 ? 1714 GLU B CA 1  
ATOM 1395   C CA . ILE B 1 1715 ? 150.568 133.362 121.875 1.00 0.00 ? 1715 ILE B CA 1  
ATOM 1396   C CA . SER B 1 1716 ? 147.578 133.609 124.275 1.00 0.00 ? 1716 SER B CA 1  
ATOM 1397   C CA . PRO B 1 1717 ? 149.081 131.586 127.194 1.00 0.00 ? 1717 PRO B CA 1  
ATOM 1398   C CA . TYR B 1 1718 ? 152.547 132.801 126.186 1.00 0.00 ? 1718 TYR B CA 1  
ATOM 1399   C CA . MET B 1 1719 ? 155.146 131.983 123.568 1.00 0.00 ? 1719 MET B CA 1  
ATOM 1400   C CA . LEU B 1 1720 ? 158.242 132.990 125.652 1.00 0.00 ? 1720 LEU B CA 1  
ATOM 1401   C CA . SER B 1 1721 ? 159.422 131.037 128.661 1.00 0.00 ? 1721 SER B CA 1  
ATOM 1402   C CA . GLY B 1 1722 ? 160.324 134.547 130.019 1.00 0.00 ? 1722 GLY B CA 1  
ATOM 1403   C CA . ARG B 1 1723 ? 157.003 135.538 131.500 1.00 0.00 ? 1723 ARG B CA 1  
ATOM 1404   C CA . GLU B 1 1724 ? 156.846 138.508 133.895 1.00 0.00 ? 1724 GLU B CA 1  
ATOM 1405   C CA . ARG B 1 1725 ? 153.112 139.077 134.361 1.00 0.00 ? 1725 ARG B CA 1  
ATOM 1406   C CA . ALA B 1 1726 ? 150.858 136.229 135.560 1.00 0.00 ? 1726 ALA B CA 1  
ATOM 1407   C CA . LEU B 1 1727 ? 147.597 138.019 134.699 1.00 0.00 ? 1727 LEU B CA 1  
ATOM 1408   C CA . ARG B 1 1728 ? 147.777 139.049 131.030 1.00 0.00 ? 1728 ARG B CA 1  
ATOM 1409   C CA . PRO B 1 1729 ? 148.680 135.726 129.239 1.00 0.00 ? 1729 PRO B CA 1  
ATOM 1410   C CA . ASN B 1 1730 ? 147.456 132.332 130.796 1.00 0.00 ? 1730 ASN B CA 1  
ATOM 1411   C CA . ARG B 1 1731 ? 144.103 131.560 129.140 1.00 0.00 ? 1731 ARG B CA 1  
ATOM 1412   C CA . MET B 1 1732 ? 143.325 135.218 129.296 1.00 0.00 ? 1732 MET B CA 1  
ATOM 1413   C CA . TYR B 1 1733 ? 140.986 135.416 126.481 1.00 0.00 ? 1733 TYR B CA 1  
ATOM 1414   C CA . TRP B 1 1734 ? 137.405 136.475 126.581 1.00 0.00 ? 1734 TRP B CA 1  
ATOM 1415   C CA . ARG B 1 1735 ? 134.522 137.217 124.203 1.00 0.00 ? 1735 ARG B CA 1  
ATOM 1416   C CA . GLN B 1 1736 ? 135.790 140.774 123.492 1.00 0.00 ? 1736 GLN B CA 1  
ATOM 1417   C CA . GLY B 1 1737 ? 139.590 140.276 123.613 1.00 0.00 ? 1737 GLY B CA 1  
ATOM 1418   C CA . ILE B 1 1738 ? 142.853 138.505 124.341 1.00 0.00 ? 1738 ILE B CA 1  
ATOM 1419   C CA . TYR B 1 1739 ? 146.321 139.025 125.823 1.00 0.00 ? 1739 TYR B CA 1  
ATOM 1420   C CA . LEU B 1 1740 ? 149.189 138.008 123.610 1.00 0.00 ? 1740 LEU B CA 1  
ATOM 1421   C CA . ASN B 1 1741 ? 152.852 137.354 124.509 1.00 0.00 ? 1741 ASN B CA 1  
ATOM 1422   C CA . TRP B 1 1742 ? 155.615 136.442 122.019 1.00 0.00 ? 1742 TRP B CA 1  
ATOM 1423   C CA . SER B 1 1743 ? 159.287 135.463 122.070 1.00 0.00 ? 1743 SER B CA 1  
ATOM 1424   C CA . PRO B 1 1744 ? 161.602 137.449 122.209 1.00 0.00 ? 1744 PRO B CA 1  
ATOM 1425   C CA . GLU B 1 1745 ? 161.671 140.072 123.758 1.00 0.00 ? 1745 GLU B CA 1  
ATOM 1426   C CA . ALA B 1 1746 ? 158.601 139.226 125.958 1.00 0.00 ? 1746 ALA B CA 1  
ATOM 1427   C CA . TYR B 1 1747 ? 156.319 141.875 124.637 1.00 0.00 ? 1747 TYR B CA 1  
ATOM 1428   C CA . CYS B 1 1748 ? 152.725 141.749 125.994 1.00 0.00 ? 1748 CYS B CA 1  
ATOM 1429   C CA . LEU B 1 1749 ? 149.819 142.870 123.761 1.00 0.00 ? 1749 LEU B CA 1  
ATOM 1430   C CA . VAL B 1 1750 ? 146.172 143.340 124.712 1.00 0.00 ? 1750 VAL B CA 1  
ATOM 1431   C CA . GLY B 1 1751 ? 143.661 143.283 121.924 1.00 0.00 ? 1751 GLY B CA 1  
ATOM 1432   C CA . SER B 1 1752 ? 140.164 144.436 122.897 1.00 0.00 ? 1752 SER B CA 1  
ATOM 1433   C CA . GLU B 1 1753 ? 137.556 145.369 120.268 1.00 0.00 ? 1753 GLU B CA 1  
ATOM 1434   C CA . VAL B 1 1754 ? 139.506 147.403 117.805 1.00 0.00 ? 1754 VAL B CA 1  
ATOM 1435   C CA . LEU B 1 1755 ? 141.998 148.557 120.456 1.00 0.00 ? 1755 LEU B CA 1  
ATOM 1436   C CA . ASP B 1 1756 ? 145.551 147.170 120.497 1.00 0.00 ? 1756 ASP B CA 1  
ATOM 1437   C CA . ASN B 1 1757 ? 147.700 148.232 123.513 1.00 0.00 ? 1757 ASN B CA 1  
ATOM 1438   C CA . HIS B 1 1758 ? 151.332 147.098 123.783 1.00 0.00 ? 1758 HIS B CA 1  
ATOM 1439   C CA . PRO B 1 1759 ? 154.191 147.237 126.505 1.00 0.00 ? 1759 PRO B CA 1  
ATOM 1440   C CA . GLU B 1 1760 ? 157.944 146.410 125.626 1.00 0.00 ? 1760 GLU B CA 1  
ATOM 1441   C CA . SER B 1 1761 ? 160.751 147.942 123.489 1.00 0.00 ? 1761 SER B CA 1  
ATOM 1442   C CA . PHE B 1 1762 ? 159.888 145.672 120.451 1.00 0.00 ? 1762 PHE B CA 1  
ATOM 1443   C CA . LEU B 1 1763 ? 156.479 147.316 120.196 1.00 0.00 ? 1763 LEU B CA 1  
ATOM 1444   C CA . LYS B 1 1764 ? 156.585 148.457 116.685 1.00 0.00 ? 1764 LYS B CA 1  
ATOM 1445   C CA . ILE B 1 1765 ? 157.290 145.032 115.065 1.00 0.00 ? 1765 ILE B CA 1  
ATOM 1446   C CA . THR B 1 1766 ? 154.608 143.300 117.155 1.00 0.00 ? 1766 THR B CA 1  
ATOM 1447   C CA . VAL B 1 1767 ? 151.846 145.660 116.148 1.00 0.00 ? 1767 VAL B CA 1  
ATOM 1448   C CA . PRO B 1 1768 ? 152.174 144.889 112.280 1.00 0.00 ? 1768 PRO B CA 1  
ATOM 1449   C CA . SER B 1 1769 ? 151.993 141.190 112.829 1.00 0.00 ? 1769 SER B CA 1  
ATOM 1450   C CA . CYS B 1 1770 ? 148.776 141.718 114.863 1.00 0.00 ? 1770 CYS B CA 1  
ATOM 1451   C CA . ARG B 1 1771 ? 147.666 144.520 112.444 1.00 0.00 ? 1771 ARG B CA 1  
ATOM 1452   C CA . LYS B 1 1772 ? 148.357 142.264 109.447 1.00 0.00 ? 1772 LYS B CA 1  
ATOM 1453   C CA . GLY B 1 1773 ? 146.350 139.361 110.949 1.00 0.00 ? 1773 GLY B CA 1  
ATOM 1454   C CA . CYS B 1 1774 ? 143.442 141.739 111.576 1.00 0.00 ? 1774 CYS B CA 1  
ATOM 1455   C CA . ILE B 1 1775 ? 143.677 143.158 108.008 1.00 0.00 ? 1775 ILE B CA 1  
ATOM 1456   C CA . LEU B 1 1776 ? 143.726 139.564 106.622 1.00 0.00 ? 1776 LEU B CA 1  
ATOM 1457   C CA . LEU B 1 1777 ? 140.438 138.796 108.421 1.00 0.00 ? 1777 LEU B CA 1  
ATOM 1458   C CA . GLY B 1 1778 ? 138.943 142.107 107.264 1.00 0.00 ? 1778 GLY B CA 1  
ATOM 1459   C CA . GLN B 1 1779 ? 139.573 141.145 103.613 1.00 0.00 ? 1779 GLN B CA 1  
ATOM 1460   C CA . VAL B 1 1780 ? 137.066 138.223 103.937 1.00 0.00 ? 1780 VAL B CA 1  
ATOM 1461   C CA . VAL B 1 1781 ? 134.294 140.856 104.280 1.00 0.00 ? 1781 VAL B CA 1  
ATOM 1462   C CA . ASP B 1 1782 ? 133.393 142.902 101.156 1.00 0.00 ? 1782 ASP B CA 1  
ATOM 1463   C CA . HIS B 1 1783 ? 132.996 146.728 101.566 1.00 0.00 ? 1783 HIS B CA 1  
ATOM 1464   C CA . ILE B 1 1784 ? 134.372 146.884 105.170 1.00 0.00 ? 1784 ILE B CA 1  
ATOM 1465   C CA . ASP B 1 1785 ? 135.652 150.396 106.058 1.00 0.00 ? 1785 ASP B CA 1  
ATOM 1466   C CA . SER B 1 1786 ? 138.392 150.652 108.721 1.00 0.00 ? 1786 SER B CA 1  
ATOM 1467   C CA . LEU B 1 1787 ? 139.774 153.980 109.967 1.00 0.00 ? 1787 LEU B CA 1  
ATOM 1468   C CA . MET B 1 1788 ? 142.950 153.769 112.029 1.00 0.00 ? 1788 MET B CA 1  
ATOM 1469   C CA . GLU B 1 1789 ? 143.605 156.067 114.995 1.00 0.00 ? 1789 GLU B CA 1  
ATOM 1470   C CA . GLU B 1 1790 ? 146.338 156.905 117.454 1.00 0.00 ? 1790 GLU B CA 1  
ATOM 1471   C CA . TRP B 1 1791 ? 145.792 158.421 120.883 1.00 0.00 ? 1791 TRP B CA 1  
ATOM 1472   C CA . PHE B 1 1792 ? 147.435 161.775 121.576 1.00 0.00 ? 1792 PHE B CA 1  
ATOM 1473   C CA . PRO B 1 1793 ? 150.478 161.667 124.054 1.00 0.00 ? 1793 PRO B CA 1  
ATOM 1474   C CA . GLY B 1 1794 ? 149.206 162.639 127.510 1.00 0.00 ? 1794 GLY B CA 1  
ATOM 1475   C CA . LEU B 1 1795 ? 145.562 162.513 126.364 1.00 0.00 ? 1795 LEU B CA 1  
ATOM 1476   C CA . LEU B 1 1796 ? 144.392 158.875 126.027 1.00 0.00 ? 1796 LEU B CA 1  
ATOM 1477   C CA . GLU B 1 1797 ? 140.826 159.718 124.854 1.00 0.00 ? 1797 GLU B CA 1  
ATOM 1478   C CA . ILE B 1 1798 ? 141.859 162.289 122.177 1.00 0.00 ? 1798 ILE B CA 1  
ATOM 1479   C CA . ASP B 1 1799 ? 142.505 160.490 118.888 1.00 0.00 ? 1799 ASP B CA 1  
ATOM 1480   C CA . ILE B 1 1800 ? 144.203 161.525 115.644 1.00 0.00 ? 1800 ILE B CA 1  
ATOM 1481   C CA . CYS B 1 1801 ? 143.648 159.639 112.386 1.00 0.00 ? 1801 CYS B CA 1  
ATOM 1482   C CA . GLY B 1 1802 ? 146.816 157.859 111.073 1.00 0.00 ? 1802 GLY B CA 1  
ATOM 1483   C CA . GLU B 1 1803 ? 145.840 158.937 107.547 1.00 0.00 ? 1803 GLU B CA 1  
ATOM 1484   C CA . GLY B 1 1804 ? 145.907 162.541 108.882 1.00 0.00 ? 1804 GLY B CA 1  
ATOM 1485   C CA . GLU B 1 1805 ? 149.513 162.253 110.136 1.00 0.00 ? 1805 GLU B CA 1  
ATOM 1486   C CA . THR B 1 1806 ? 150.755 160.548 106.914 1.00 0.00 ? 1806 THR B CA 1  
ATOM 1487   C CA . LEU B 1 1807 ? 149.077 163.346 104.908 1.00 0.00 ? 1807 LEU B CA 1  
ATOM 1488   C CA . LEU B 1 1808 ? 150.752 165.969 107.127 1.00 0.00 ? 1808 LEU B CA 1  
ATOM 1489   C CA . LYS B 1 1809 ? 154.159 164.295 106.395 1.00 0.00 ? 1809 LYS B CA 1  
ATOM 1490   C CA . LYS B 1 1810 ? 153.486 164.281 102.619 1.00 0.00 ? 1810 LYS B CA 1  
ATOM 1491   C CA . TRP B 1 1811 ? 152.621 167.996 102.935 1.00 0.00 ? 1811 TRP B CA 1  
ATOM 1492   C CA . ALA B 1 1812 ? 156.018 168.521 104.642 1.00 0.00 ? 1812 ALA B CA 1  
ATOM 1493   C CA . LEU B 1 1813 ? 154.503 169.542 108.003 1.00 0.00 ? 1813 LEU B CA 1  
ATOM 1494   C CA . TYR B 1 1814 ? 155.779 168.283 111.354 1.00 0.00 ? 1814 TYR B CA 1  
ATOM 1495   C CA . SER B 1 1815 ? 153.182 169.997 113.568 1.00 0.00 ? 1815 SER B CA 1  
ATOM 1496   C CA . PHE B 1 1816 ? 149.837 168.505 114.365 1.00 0.00 ? 1816 PHE B CA 1  
ATOM 1497   C CA . ASN B 1 1817 ? 147.923 171.248 116.208 1.00 0.00 ? 1817 ASN B CA 1  
ATOM 1498   C CA . ASP B 1 1818 ? 145.172 170.328 118.636 1.00 0.00 ? 1818 ASP B CA 1  
ATOM 1499   C CA . GLY B 1 1819 ? 142.881 173.394 118.761 1.00 0.00 ? 1819 GLY B CA 1  
ATOM 1500   C CA . GLU B 1 1820 ? 140.524 172.175 121.517 1.00 0.00 ? 1820 GLU B CA 1  
ATOM 1501   C CA . GLU B 1 1821 ? 143.429 171.128 123.788 1.00 0.00 ? 1821 GLU B CA 1  
ATOM 1502   C CA . HIS B 1 1822 ? 145.614 174.107 122.706 1.00 0.00 ? 1822 HIS B CA 1  
ATOM 1503   C CA . GLN B 1 1823 ? 148.722 171.870 122.453 1.00 0.00 ? 1823 GLN B CA 1  
ATOM 1504   C CA . LYS B 1 1824 ? 150.911 171.013 119.425 1.00 0.00 ? 1824 LYS B CA 1  
ATOM 1505   C CA . ILE B 1 1825 ? 152.518 167.637 118.785 1.00 0.00 ? 1825 ILE B CA 1  
ATOM 1506   C CA . LEU B 1 1826 ? 155.323 166.301 116.670 1.00 0.00 ? 1826 LEU B CA 1  
ATOM 1507   C CA . LEU B 1 1827 ? 153.864 164.342 113.770 1.00 0.00 ? 1827 LEU B CA 1  
ATOM 1508   C CA . ASP B 1 1828 ? 157.039 162.357 113.146 1.00 0.00 ? 1828 ASP B CA 1  
ATOM 1509   C CA . ASP B 1 1829 ? 157.587 161.485 116.840 1.00 0.00 ? 1829 ASP B CA 1  
ATOM 1510   C CA . LEU B 1 1830 ? 154.108 159.917 117.263 1.00 0.00 ? 1830 LEU B CA 1  
ATOM 1511   C CA . MET B 1 1831 ? 154.237 158.331 113.763 1.00 0.00 ? 1831 MET B CA 1  
ATOM 1512   C CA . LYS B 1 1832 ? 157.694 156.680 114.211 1.00 0.00 ? 1832 LYS B CA 1  
ATOM 1513   C CA . LYS B 1 1833 ? 156.731 155.130 117.592 1.00 0.00 ? 1833 LYS B CA 1  
ATOM 1514   C CA . ALA B 1 1834 ? 155.015 152.371 115.616 1.00 0.00 ? 1834 ALA B CA 1  
ATOM 1515   C CA . GLU B 1 1835 ? 156.161 150.267 112.587 1.00 0.00 ? 1835 GLU B CA 1  
ATOM 1516   C CA . GLU B 1 1836 ? 155.218 152.982 110.086 1.00 0.00 ? 1836 GLU B CA 1  
ATOM 1517   C CA . GLY B 1 1837 ? 158.693 154.586 110.056 1.00 0.00 ? 1837 GLY B CA 1  
ATOM 1518   C CA . PHE B 1 1883 ? 168.364 161.018 86.566  1.00 0.00 ? 1883 PHE B CA 1  
ATOM 1519   C CA . LEU B 1 1884 ? 165.182 158.977 85.790  1.00 0.00 ? 1884 LEU B CA 1  
ATOM 1520   C CA . LEU B 1 1885 ? 165.395 155.220 84.876  1.00 0.00 ? 1885 LEU B CA 1  
ATOM 1521   C CA . GLY B 1 1886 ? 161.811 154.200 85.746  1.00 0.00 ? 1886 GLY B CA 1  
ATOM 1522   C CA . ASP B 1 1887 ? 160.258 150.958 84.532  1.00 0.00 ? 1887 ASP B CA 1  
ATOM 1523   C CA . GLY B 1 1888 ? 158.237 150.787 87.837  1.00 0.00 ? 1888 GLY B CA 1  
ATOM 1524   C CA . SER B 1 1889 ? 155.112 148.851 88.917  1.00 0.00 ? 1889 SER B CA 1  
ATOM 1525   C CA . PHE B 1 1890 ? 153.498 151.722 90.854  1.00 0.00 ? 1890 PHE B CA 1  
ATOM 1526   C CA . GLY B 1 1891 ? 155.660 154.720 89.936  1.00 0.00 ? 1891 GLY B CA 1  
ATOM 1527   C CA . SER B 1 1892 ? 158.926 156.151 88.657  1.00 0.00 ? 1892 SER B CA 1  
ATOM 1528   C CA . VAL B 1 1893 ? 162.445 154.909 89.540  1.00 0.00 ? 1893 VAL B CA 1  
ATOM 1529   C CA . TYR B 1 1894 ? 165.265 157.484 89.878  1.00 0.00 ? 1894 TYR B CA 1  
ATOM 1530   C CA . ARG B 1 1895 ? 169.033 157.256 90.258  1.00 0.00 ? 1895 ARG B CA 1  
ATOM 1531   C CA . ALA B 1 1896 ? 170.540 159.585 92.859  1.00 0.00 ? 1896 ALA B CA 1  
ATOM 1532   C CA . ALA B 1 1897 ? 172.950 159.668 95.816  1.00 0.00 ? 1897 ALA B CA 1  
ATOM 1533   C CA . TYR B 1 1898 ? 172.778 160.068 99.636  1.00 0.00 ? 1898 TYR B CA 1  
ATOM 1534   C CA . GLU B 1 1899 ? 174.418 163.461 100.430 1.00 0.00 ? 1899 GLU B CA 1  
ATOM 1535   C CA . GLY B 1 1900 ? 176.260 162.178 103.565 1.00 0.00 ? 1900 GLY B CA 1  
ATOM 1536   C CA . GLU B 1 1901 ? 177.974 159.069 102.073 1.00 0.00 ? 1901 GLU B CA 1  
ATOM 1537   C CA . GLU B 1 1902 ? 178.007 159.640 98.273  1.00 0.00 ? 1902 GLU B CA 1  
ATOM 1538   C CA . VAL B 1 1903 ? 176.400 156.092 98.190  1.00 0.00 ? 1903 VAL B CA 1  
ATOM 1539   C CA . ALA B 1 1904 ? 174.594 155.601 94.886  1.00 0.00 ? 1904 ALA B CA 1  
ATOM 1540   C CA . VAL B 1 1905 ? 170.929 155.080 95.398  1.00 0.00 ? 1905 VAL B CA 1  
ATOM 1541   C CA . LYS B 1 1906 ? 167.757 153.971 93.594  1.00 0.00 ? 1906 LYS B CA 1  
ATOM 1542   C CA . ILE B 1 1907 ? 164.511 155.815 94.485  1.00 0.00 ? 1907 ILE B CA 1  
ATOM 1543   C CA . PHE B 1 1908 ? 161.090 154.306 93.777  1.00 0.00 ? 1908 PHE B CA 1  
ATOM 1544   C CA . ASN B 1 1909 ? 158.153 156.751 94.142  1.00 0.00 ? 1909 ASN B CA 1  
ATOM 1545   C CA . LYS B 1 1910 ? 154.383 157.459 93.781  1.00 0.00 ? 1910 LYS B CA 1  
ATOM 1546   C CA . HIS B 1 1911 ? 153.586 154.357 95.637  1.00 0.00 ? 1911 HIS B CA 1  
ATOM 1547   C CA . THR B 1 1912 ? 152.302 155.930 98.891  1.00 0.00 ? 1912 THR B CA 1  
ATOM 1548   C CA . SER B 1 1913 ? 148.724 154.721 99.064  1.00 0.00 ? 1913 SER B CA 1  
ATOM 1549   C CA . LEU B 1 1914 ? 149.273 151.240 97.657  1.00 0.00 ? 1914 LEU B CA 1  
ATOM 1550   C CA . ARG B 1 1915 ? 148.950 147.946 99.515  1.00 0.00 ? 1915 ARG B CA 1  
ATOM 1551   C CA . LEU B 1 1916 ? 151.869 146.504 97.447  1.00 0.00 ? 1916 LEU B CA 1  
ATOM 1552   C CA . LEU B 1 1917 ? 154.305 149.346 98.507  1.00 0.00 ? 1917 LEU B CA 1  
ATOM 1553   C CA . ARG B 1 1918 ? 153.298 148.908 102.084 1.00 0.00 ? 1918 ARG B CA 1  
ATOM 1554   C CA . GLN B 1 1919 ? 154.053 145.203 101.944 1.00 0.00 ? 1919 GLN B CA 1  
ATOM 1555   C CA . GLU B 1 1920 ? 157.383 145.884 100.179 1.00 0.00 ? 1920 GLU B CA 1  
ATOM 1556   C CA . LEU B 1 1921 ? 158.413 148.413 102.897 1.00 0.00 ? 1921 LEU B CA 1  
ATOM 1557   C CA . VAL B 1 1922 ? 157.289 146.053 105.728 1.00 0.00 ? 1922 VAL B CA 1  
ATOM 1558   C CA . VAL B 1 1923 ? 159.135 143.003 104.246 1.00 0.00 ? 1923 VAL B CA 1  
ATOM 1559   C CA . LEU B 1 1924 ? 162.357 144.943 103.456 1.00 0.00 ? 1924 LEU B CA 1  
ATOM 1560   C CA . CYS B 1 1925 ? 162.540 146.651 106.914 1.00 0.00 ? 1925 CYS B CA 1  
ATOM 1561   C CA . HIS B 1 1926 ? 163.716 143.427 108.650 1.00 0.00 ? 1926 HIS B CA 1  
ATOM 1562   C CA . LEU B 1 1927 ? 166.016 142.133 105.847 1.00 0.00 ? 1927 LEU B CA 1  
ATOM 1563   C CA . HIS B 1 1928 ? 169.763 142.855 106.091 1.00 0.00 ? 1928 HIS B CA 1  
ATOM 1564   C CA . HIS B 1 1929 ? 171.896 140.436 104.022 1.00 0.00 ? 1929 HIS B CA 1  
ATOM 1565   C CA . PRO B 1 1930 ? 174.569 141.047 101.310 1.00 0.00 ? 1930 PRO B CA 1  
ATOM 1566   C CA . SER B 1 1931 ? 172.710 139.116 98.586  1.00 0.00 ? 1931 SER B CA 1  
ATOM 1567   C CA . LEU B 1 1932 ? 169.406 140.967 99.140  1.00 0.00 ? 1932 LEU B CA 1  
ATOM 1568   C CA . ILE B 1 1933 ? 168.766 144.511 97.838  1.00 0.00 ? 1933 ILE B CA 1  
ATOM 1569   C CA . SER B 1 1934 ? 169.040 146.739 100.922 1.00 0.00 ? 1934 SER B CA 1  
ATOM 1570   C CA . LEU B 1 1935 ? 166.437 149.320 101.869 1.00 0.00 ? 1935 LEU B CA 1  
ATOM 1571   C CA . LEU B 1 1936 ? 168.210 152.467 103.101 1.00 0.00 ? 1936 LEU B CA 1  
ATOM 1572   C CA . ALA B 1 1937 ? 165.292 154.696 104.077 1.00 0.00 ? 1937 ALA B CA 1  
ATOM 1573   C CA . ALA B 1 1938 ? 161.775 155.983 103.395 1.00 0.00 ? 1938 ALA B CA 1  
ATOM 1574   C CA . GLY B 1 1939 ? 160.786 159.426 102.021 1.00 0.00 ? 1939 GLY B CA 1  
ATOM 1575   C CA . ILE B 1 1940 ? 157.430 161.272 102.071 1.00 0.00 ? 1940 ILE B CA 1  
ATOM 1576   C CA . ARG B 1 1941 ? 155.623 163.692 99.693  1.00 0.00 ? 1941 ARG B CA 1  
ATOM 1577   C CA . PRO B 1 1942 ? 155.502 161.541 97.595  1.00 0.00 ? 1942 PRO B CA 1  
ATOM 1578   C CA . ARG B 1 1943 ? 156.280 158.305 99.468  1.00 0.00 ? 1943 ARG B CA 1  
ATOM 1579   C CA . MET B 1 1944 ? 159.654 156.893 98.362  1.00 0.00 ? 1944 MET B CA 1  
ATOM 1580   C CA . LEU B 1 1945 ? 161.624 153.738 99.024  1.00 0.00 ? 1945 LEU B CA 1  
ATOM 1581   C CA . VAL B 1 1946 ? 165.319 154.533 98.831  1.00 0.00 ? 1946 VAL B CA 1  
ATOM 1582   C CA . MET B 1 1947 ? 167.207 151.334 97.882  1.00 0.00 ? 1947 MET B CA 1  
ATOM 1583   C CA . GLU B 1 1948 ? 170.897 150.543 97.190  1.00 0.00 ? 1948 GLU B CA 1  
ATOM 1584   C CA . LEU B 1 1949 ? 171.772 151.026 93.494  1.00 0.00 ? 1949 LEU B CA 1  
ATOM 1585   C CA . ALA B 1 1950 ? 172.835 147.774 91.816  1.00 0.00 ? 1950 ALA B CA 1  
ATOM 1586   C CA . SER B 1 1951 ? 174.984 148.768 88.860  1.00 0.00 ? 1951 SER B CA 1  
ATOM 1587   C CA . LYS B 1 1952 ? 175.156 145.960 86.255  1.00 0.00 ? 1952 LYS B CA 1  
ATOM 1588   C CA . GLY B 1 1953 ? 171.437 145.512 85.503  1.00 0.00 ? 1953 GLY B CA 1  
ATOM 1589   C CA . SER B 1 1954 ? 169.447 142.288 85.905  1.00 0.00 ? 1954 SER B CA 1  
ATOM 1590   C CA . LEU B 1 1955 ? 170.151 138.598 85.224  1.00 0.00 ? 1955 LEU B CA 1  
ATOM 1591   C CA . ASP B 1 1956 ? 167.392 138.269 82.569  1.00 0.00 ? 1956 ASP B CA 1  
ATOM 1592   C CA . ARG B 1 1957 ? 168.794 141.032 80.298  1.00 0.00 ? 1957 ARG B CA 1  
ATOM 1593   C CA . LEU B 1 1958 ? 172.386 139.818 80.708  1.00 0.00 ? 1958 LEU B CA 1  
ATOM 1594   C CA . LEU B 1 1959 ? 171.471 136.220 79.745  1.00 0.00 ? 1959 LEU B CA 1  
ATOM 1595   C CA . GLN B 1 1960 ? 169.939 137.589 76.483  1.00 0.00 ? 1960 GLN B CA 1  
ATOM 1596   C CA . GLN B 1 1961 ? 173.536 138.435 75.347  1.00 0.00 ? 1961 GLN B CA 1  
ATOM 1597   C CA . ASP B 1 1962 ? 174.260 135.029 73.641  1.00 0.00 ? 1962 ASP B CA 1  
ATOM 1598   C CA . LYS B 1 1963 ? 177.466 136.364 71.963  1.00 0.00 ? 1963 LYS B CA 1  
ATOM 1599   C CA . ALA B 1 1964 ? 179.070 136.997 75.383  1.00 0.00 ? 1964 ALA B CA 1  
ATOM 1600   C CA . SER B 1 1965 ? 178.313 133.892 77.462  1.00 0.00 ? 1965 SER B CA 1  
ATOM 1601   C CA . LEU B 1 1966 ? 178.876 134.051 81.231  1.00 0.00 ? 1966 LEU B CA 1  
ATOM 1602   C CA . THR B 1 1967 ? 181.963 132.036 82.180  1.00 0.00 ? 1967 THR B CA 1  
ATOM 1603   C CA . ARG B 1 1968 ? 181.380 128.946 84.334  1.00 0.00 ? 1968 ARG B CA 1  
ATOM 1604   C CA . THR B 1 1969 ? 183.173 130.248 87.490  1.00 0.00 ? 1969 THR B CA 1  
ATOM 1605   C CA . LEU B 1 1970 ? 180.940 133.312 87.426  1.00 0.00 ? 1970 LEU B CA 1  
ATOM 1606   C CA . GLN B 1 1971 ? 177.765 131.203 86.817  1.00 0.00 ? 1971 GLN B CA 1  
ATOM 1607   C CA . HIS B 1 1972 ? 178.657 129.296 90.029  1.00 0.00 ? 1972 HIS B CA 1  
ATOM 1608   C CA . ARG B 1 1973 ? 179.118 132.612 91.912  1.00 0.00 ? 1973 ARG B CA 1  
ATOM 1609   C CA . ILE B 1 1974 ? 175.637 133.769 90.698  1.00 0.00 ? 1974 ILE B CA 1  
ATOM 1610   C CA . ALA B 1 1975 ? 174.026 130.437 91.740  1.00 0.00 ? 1975 ALA B CA 1  
ATOM 1611   C CA . LEU B 1 1976 ? 175.540 130.558 95.269  1.00 0.00 ? 1976 LEU B CA 1  
ATOM 1612   C CA . HIS B 1 1977 ? 174.716 134.276 95.855  1.00 0.00 ? 1977 HIS B CA 1  
ATOM 1613   C CA . VAL B 1 1978 ? 171.042 133.775 95.009  1.00 0.00 ? 1978 VAL B CA 1  
ATOM 1614   C CA . ALA B 1 1979 ? 171.060 130.600 97.169  1.00 0.00 ? 1979 ALA B CA 1  
ATOM 1615   C CA . ASP B 1 1980 ? 172.502 132.488 100.202 1.00 0.00 ? 1980 ASP B CA 1  
ATOM 1616   C CA . GLY B 1 1981 ? 169.876 135.266 99.850  1.00 0.00 ? 1981 GLY B CA 1  
ATOM 1617   C CA . LEU B 1 1982 ? 167.094 132.648 99.739  1.00 0.00 ? 1982 LEU B CA 1  
ATOM 1618   C CA . ARG B 1 1983 ? 168.831 130.794 102.642 1.00 0.00 ? 1983 ARG B CA 1  
ATOM 1619   C CA . TYR B 1 1984 ? 168.808 134.011 104.738 1.00 0.00 ? 1984 TYR B CA 1  
ATOM 1620   C CA . LEU B 1 1985 ? 165.162 134.249 103.703 1.00 0.00 ? 1985 LEU B CA 1  
ATOM 1621   C CA . HIS B 1 1986 ? 164.526 130.697 104.930 1.00 0.00 ? 1986 HIS B CA 1  
ATOM 1622   C CA . SER B 1 1987 ? 165.774 131.834 108.398 1.00 0.00 ? 1987 SER B CA 1  
ATOM 1623   C CA . ALA B 1 1988 ? 163.263 134.719 108.528 1.00 0.00 ? 1988 ALA B CA 1  
ATOM 1624   C CA . MET B 1 1989 ? 160.307 132.560 107.213 1.00 0.00 ? 1989 MET B CA 1  
ATOM 1625   C CA . ILE B 1 1990 ? 159.489 134.891 104.282 1.00 0.00 ? 1990 ILE B CA 1  
ATOM 1626   C CA . ILE B 1 1991 ? 158.070 133.752 100.878 1.00 0.00 ? 1991 ILE B CA 1  
ATOM 1627   C CA . TYR B 1 1992 ? 159.118 135.931 97.896  1.00 0.00 ? 1992 TYR B CA 1  
ATOM 1628   C CA . ARG B 1 1993 ? 156.725 134.527 95.211  1.00 0.00 ? 1993 ARG B CA 1  
ATOM 1629   C CA . ASP B 1 1994 ? 158.193 136.458 92.232  1.00 0.00 ? 1994 ASP B CA 1  
ATOM 1630   C CA . LEU B 1 1995 ? 161.605 134.761 91.916  1.00 0.00 ? 1995 LEU B CA 1  
ATOM 1631   C CA . LYS B 1 1996 ? 162.537 135.013 88.218  1.00 0.00 ? 1996 LYS B CA 1  
ATOM 1632   C CA . PRO B 1 1997 ? 165.718 136.357 86.522  1.00 0.00 ? 1997 PRO B CA 1  
ATOM 1633   C CA . HIS B 1 1998 ? 164.345 139.908 86.008  1.00 0.00 ? 1998 HIS B CA 1  
ATOM 1634   C CA . ASN B 1 1999 ? 164.245 140.221 89.823  1.00 0.00 ? 1999 ASN B CA 1  
ATOM 1635   C CA . VAL B 1 2000 ? 167.880 139.108 90.243  1.00 0.00 ? 2000 VAL B CA 1  
ATOM 1636   C CA . LEU B 1 2001 ? 170.026 142.262 90.192  1.00 0.00 ? 2001 LEU B CA 1  
ATOM 1637   C CA . LEU B 1 2002 ? 173.673 142.106 89.302  1.00 0.00 ? 2002 LEU B CA 1  
ATOM 1638   C CA . PHE B 1 2003 ? 176.188 143.960 91.443  1.00 0.00 ? 2003 PHE B CA 1  
ATOM 1639   C CA . THR B 1 2004 ? 179.353 142.697 89.752  1.00 0.00 ? 2004 THR B CA 1  
ATOM 1640   C CA . LEU B 1 2005 ? 180.315 140.016 87.129  1.00 0.00 ? 2005 LEU B CA 1  
ATOM 1641   C CA . TYR B 1 2006 ? 184.001 139.687 88.179  1.00 0.00 ? 2006 TYR B CA 1  
ATOM 1642   C CA . PRO B 1 2007 ? 184.302 136.198 89.807  1.00 0.00 ? 2007 PRO B CA 1  
ATOM 1643   C CA . ASN B 1 2008 ? 186.386 137.496 92.782  1.00 0.00 ? 2008 ASN B CA 1  
ATOM 1644   C CA . ALA B 1 2009 ? 183.874 140.254 93.702  1.00 0.00 ? 2009 ALA B CA 1  
ATOM 1645   C CA . ALA B 1 2010 ? 182.458 140.379 97.244  1.00 0.00 ? 2010 ALA B CA 1  
ATOM 1646   C CA . ILE B 1 2011 ? 178.898 140.315 95.838  1.00 0.00 ? 2011 ILE B CA 1  
ATOM 1647   C CA . ILE B 1 2012 ? 177.761 139.312 92.305  1.00 0.00 ? 2012 ILE B CA 1  
ATOM 1648   C CA . ALA B 1 2013 ? 174.008 138.943 92.595  1.00 0.00 ? 2013 ALA B CA 1  
ATOM 1649   C CA . LYS B 1 2014 ? 171.262 140.253 94.828  1.00 0.00 ? 2014 LYS B CA 1  
ATOM 1650   C CA . ILE B 1 2015 ? 167.580 139.265 95.081  1.00 0.00 ? 2015 ILE B CA 1  
ATOM 1651   C CA . ALA B 1 2016 ? 165.172 142.195 94.491  1.00 0.00 ? 2016 ALA B CA 1  
ATOM 1652   C CA . ASP B 1 2017 ? 161.500 143.168 94.045  1.00 0.00 ? 2017 ASP B CA 1  
ATOM 1653   C CA . TYR B 1 2018 ? 159.693 141.838 97.095  1.00 0.00 ? 2018 TYR B CA 1  
ATOM 1654   C CA . GLY B 1 2019 ? 156.367 143.549 96.328  1.00 0.00 ? 2019 GLY B CA 1  
ATOM 1655   C CA . THR B 1 2020 ? 154.384 140.323 96.383  1.00 0.00 ? 2020 THR B CA 1  
ATOM 1656   C CA . ALA B 1 2021 ? 156.149 138.682 99.396  1.00 0.00 ? 2021 ALA B CA 1  
ATOM 1657   C CA . GLN B 1 2022 ? 154.526 136.981 102.448 1.00 0.00 ? 2022 GLN B CA 1  
ATOM 1658   C CA . TYR B 1 2023 ? 155.738 136.455 106.003 1.00 0.00 ? 2023 TYR B CA 1  
ATOM 1659   C CA . CYS B 1 2024 ? 153.046 134.677 107.988 1.00 0.00 ? 2024 CYS B CA 1  
ATOM 1660   C CA . CYS B 1 2025 ? 152.718 132.158 110.850 1.00 0.00 ? 2025 CYS B CA 1  
ATOM 1661   C CA . ARG B 1 2026 ? 149.674 130.766 109.020 1.00 0.00 ? 2026 ARG B CA 1  
ATOM 1662   C CA . MET B 1 2027 ? 149.382 128.998 105.676 1.00 0.00 ? 2027 MET B CA 1  
ATOM 1663   C CA . GLY B 1 2028 ? 150.096 131.159 102.573 1.00 0.00 ? 2028 GLY B CA 1  
ATOM 1664   C CA . ILE B 1 2029 ? 147.876 131.182 99.444  1.00 0.00 ? 2029 ILE B CA 1  
ATOM 1665   C CA . LYS B 1 2030 ? 147.823 132.950 95.986  1.00 0.00 ? 2030 LYS B CA 1  
ATOM 1666   C CA . THR B 1 2031 ? 146.318 132.900 92.367  1.00 0.00 ? 2031 THR B CA 1  
ATOM 1667   C CA . SER B 1 2032 ? 147.694 136.064 90.892  1.00 0.00 ? 2032 SER B CA 1  
ATOM 1668   C CA . GLU B 1 2033 ? 151.389 135.321 90.334  1.00 0.00 ? 2033 GLU B CA 1  
ATOM 1669   C CA . GLY B 1 2034 ? 150.213 134.104 86.918  1.00 0.00 ? 2034 GLY B CA 1  
ATOM 1670   C CA . THR B 1 2035 ? 153.719 133.710 85.314  1.00 0.00 ? 2035 THR B CA 1  
ATOM 1671   C CA . PRO B 1 2036 ? 153.773 129.910 85.654  1.00 0.00 ? 2036 PRO B CA 1  
ATOM 1672   C CA . GLY B 1 2037 ? 157.037 129.118 83.779  1.00 0.00 ? 2037 GLY B CA 1  
ATOM 1673   C CA . PHE B 1 2038 ? 158.841 130.172 86.982  1.00 0.00 ? 2038 PHE B CA 1  
ATOM 1674   C CA . ARG B 1 2039 ? 156.167 129.271 89.587  1.00 0.00 ? 2039 ARG B CA 1  
ATOM 1675   C CA . ALA B 1 2040 ? 155.518 126.114 91.610  1.00 0.00 ? 2040 ALA B CA 1  
ATOM 1676   C CA . PRO B 1 2041 ? 152.631 123.738 90.539  1.00 0.00 ? 2041 PRO B CA 1  
ATOM 1677   C CA . GLU B 1 2042 ? 150.272 125.088 93.269  1.00 0.00 ? 2042 GLU B CA 1  
ATOM 1678   C CA . VAL B 1 2043 ? 149.445 127.777 90.591  1.00 0.00 ? 2043 VAL B CA 1  
ATOM 1679   C CA . ALA B 1 2044 ? 146.364 125.707 89.820  1.00 0.00 ? 2044 ALA B CA 1  
ATOM 1680   C CA . ARG B 1 2045 ? 143.927 128.057 91.758  1.00 0.00 ? 2045 ARG B CA 1  
ATOM 1681   C CA . GLY B 1 2046 ? 143.341 130.183 95.008  1.00 0.00 ? 2046 GLY B CA 1  
ATOM 1682   C CA . ASN B 1 2047 ? 141.945 127.321 96.973  1.00 0.00 ? 2047 ASN B CA 1  
ATOM 1683   C CA . VAL B 1 2048 ? 145.350 125.681 97.740  1.00 0.00 ? 2048 VAL B CA 1  
ATOM 1684   C CA . ILE B 1 2049 ? 147.933 126.535 100.390 1.00 0.00 ? 2049 ILE B CA 1  
ATOM 1685   C CA . TYR B 1 2050 ? 151.704 126.542 100.130 1.00 0.00 ? 2050 TYR B CA 1  
ATOM 1686   C CA . ASN B 1 2051 ? 154.975 127.584 101.853 1.00 0.00 ? 2051 ASN B CA 1  
ATOM 1687   C CA . GLN B 1 2052 ? 158.587 128.815 101.170 1.00 0.00 ? 2052 GLN B CA 1  
ATOM 1688   C CA . GLN B 1 2053 ? 158.980 125.587 99.191  1.00 0.00 ? 2053 GLN B CA 1  
ATOM 1689   C CA . ALA B 1 2054 ? 157.286 127.514 96.337  1.00 0.00 ? 2054 ALA B CA 1  
ATOM 1690   C CA . ASP B 1 2055 ? 160.367 129.835 96.178  1.00 0.00 ? 2055 ASP B CA 1  
ATOM 1691   C CA . VAL B 1 2056 ? 162.628 126.714 96.255  1.00 0.00 ? 2056 VAL B CA 1  
ATOM 1692   C CA . TYR B 1 2057 ? 160.894 125.669 92.992  1.00 0.00 ? 2057 TYR B CA 1  
ATOM 1693   C CA . SER B 1 2058 ? 161.388 129.204 91.525  1.00 0.00 ? 2058 SER B CA 1  
ATOM 1694   C CA . PHE B 1 2059 ? 165.103 128.897 92.480  1.00 0.00 ? 2059 PHE B CA 1  
ATOM 1695   C CA . GLY B 1 2060 ? 165.453 125.625 90.443  1.00 0.00 ? 2060 GLY B CA 1  
ATOM 1696   C CA . LEU B 1 2061 ? 164.245 127.560 87.395  1.00 0.00 ? 2061 LEU B CA 1  
ATOM 1697   C CA . LEU B 1 2062 ? 166.821 130.321 88.196  1.00 0.00 ? 2062 LEU B CA 1  
ATOM 1698   C CA . LEU B 1 2063 ? 169.564 127.640 88.245  1.00 0.00 ? 2063 LEU B CA 1  
ATOM 1699   C CA . TYR B 1 2064 ? 168.298 126.242 84.892  1.00 0.00 ? 2064 TYR B CA 1  
ATOM 1700   C CA . ASP B 1 2065 ? 168.283 129.736 83.252  1.00 0.00 ? 2065 ASP B CA 1  
ATOM 1701   C CA . ILE B 1 2066 ? 171.877 130.475 84.550  1.00 0.00 ? 2066 ILE B CA 1  
ATOM 1702   C CA . LEU B 1 2067 ? 173.145 127.011 83.453  1.00 0.00 ? 2067 LEU B CA 1  
ATOM 1703   C CA . THR B 1 2068 ? 171.627 127.170 79.969  1.00 0.00 ? 2068 THR B CA 1  
ATOM 1704   C CA . THR B 1 2069 ? 171.274 130.918 79.126  1.00 0.00 ? 2069 THR B CA 1  
ATOM 1705   C CA . GLY B 1 2070 ? 167.696 129.972 78.036  1.00 0.00 ? 2070 GLY B CA 1  
ATOM 1706   C CA . GLY B 1 2071 ? 164.208 130.718 79.434  1.00 0.00 ? 2071 GLY B CA 1  
ATOM 1707   C CA . ARG B 1 2072 ? 160.517 130.130 78.657  1.00 0.00 ? 2072 ARG B CA 1  
ATOM 1708   C CA . ILE B 1 2073 ? 157.218 131.790 79.783  1.00 0.00 ? 2073 ILE B CA 1  
ATOM 1709   C CA . VAL B 1 2074 ? 154.041 129.811 79.139  1.00 0.00 ? 2074 VAL B CA 1  
ATOM 1710   C CA . GLU B 1 2075 ? 150.330 130.630 79.772  1.00 0.00 ? 2075 GLU B CA 1  
ATOM 1711   C CA . GLY B 1 2076 ? 147.079 128.635 79.213  1.00 0.00 ? 2076 GLY B CA 1  
ATOM 1712   C CA . LEU B 1 2077 ? 145.379 125.406 80.355  1.00 0.00 ? 2077 LEU B CA 1  
ATOM 1713   C CA . LYS B 1 2078 ? 147.272 122.490 78.764  1.00 0.00 ? 2078 LYS B CA 1  
ATOM 1714   C CA . PHE B 1 2079 ? 150.660 123.890 79.948  1.00 0.00 ? 2079 PHE B CA 1  
ATOM 1715   C CA . PRO B 1 2080 ? 149.597 124.194 83.700  1.00 0.00 ? 2080 PRO B CA 1  
ATOM 1716   C CA . ASN B 1 2081 ? 148.012 120.683 83.547  1.00 0.00 ? 2081 ASN B CA 1  
ATOM 1717   C CA . GLU B 1 2082 ? 151.281 119.364 82.081  1.00 0.00 ? 2082 GLU B CA 1  
ATOM 1718   C CA . PHE B 1 2083 ? 153.390 121.112 84.755  1.00 0.00 ? 2083 PHE B CA 1  
ATOM 1719   C CA . ASP B 1 2084 ? 151.043 120.154 87.673  1.00 0.00 ? 2084 ASP B CA 1  
ATOM 1720   C CA . GLU B 1 2085 ? 149.887 116.577 86.748  1.00 0.00 ? 2085 GLU B CA 1  
ATOM 1721   C CA . LEU B 1 2086 ? 152.451 115.253 84.180  1.00 0.00 ? 2086 LEU B CA 1  
ATOM 1722   C CA . GLU B 1 2087 ? 155.708 116.425 85.898  1.00 0.00 ? 2087 GLU B CA 1  
ATOM 1723   C CA . ILE B 1 2088 ? 156.792 118.653 82.924  1.00 0.00 ? 2088 ILE B CA 1  
ATOM 1724   C CA . GLN B 1 2089 ? 159.881 120.689 83.757  1.00 0.00 ? 2089 GLN B CA 1  
ATOM 1725   C CA . GLY B 1 2090 ? 162.728 122.223 81.744  1.00 0.00 ? 2090 GLY B CA 1  
ATOM 1726   C CA . LYS B 1 2091 ? 165.003 119.250 82.524  1.00 0.00 ? 2091 LYS B CA 1  
ATOM 1727   C CA . LEU B 1 2092 ? 162.406 116.531 81.709  1.00 0.00 ? 2092 LEU B CA 1  
ATOM 1728   C CA . PRO B 1 2093 ? 161.372 117.847 78.201  1.00 0.00 ? 2093 PRO B CA 1  
ATOM 1729   C CA . ASP B 1 2094 ? 165.014 118.283 77.120  1.00 0.00 ? 2094 ASP B CA 1  
ATOM 1730   C CA . PRO B 1 2095 ? 167.227 115.359 78.506  1.00 0.00 ? 2095 PRO B CA 1  
ATOM 1731   C CA . VAL B 1 2096 ? 169.663 115.817 75.571  1.00 0.00 ? 2096 VAL B CA 1  
ATOM 1732   C CA . LYS B 1 2097 ? 170.110 119.593 76.137  1.00 0.00 ? 2097 LYS B CA 1  
ATOM 1733   C CA . GLU B 1 2098 ? 171.227 119.101 79.724  1.00 0.00 ? 2098 GLU B CA 1  
ATOM 1734   C CA . TYR B 1 2099 ? 172.302 115.366 80.180  1.00 0.00 ? 2099 TYR B CA 1  
ATOM 1735   C CA . GLY B 1 2100 ? 174.028 115.133 76.710  1.00 0.00 ? 2100 GLY B CA 1  
ATOM 1736   C CA . CYS B 1 2101 ? 176.273 118.122 77.550  1.00 0.00 ? 2101 CYS B CA 1  
ATOM 1737   C CA . ALA B 1 2102 ? 177.105 116.477 80.916  1.00 0.00 ? 2102 ALA B CA 1  
ATOM 1738   C CA . PRO B 1 2103 ? 176.210 119.296 83.464  1.00 0.00 ? 2103 PRO B CA 1  
ATOM 1739   C CA . TRP B 1 2104 ? 177.806 118.395 86.852  1.00 0.00 ? 2104 TRP B CA 1  
ATOM 1740   C CA . PRO B 1 2105 ? 175.716 115.541 88.420  1.00 0.00 ? 2105 PRO B CA 1  
ATOM 1741   C CA . MET B 1 2106 ? 175.477 117.387 91.773  1.00 0.00 ? 2106 MET B CA 1  
ATOM 1742   C CA . VAL B 1 2107 ? 174.006 120.496 89.987  1.00 0.00 ? 2107 VAL B CA 1  
ATOM 1743   C CA . GLU B 1 2108 ? 171.589 118.202 88.129  1.00 0.00 ? 2108 GLU B CA 1  
ATOM 1744   C CA . LYS B 1 2109 ? 170.478 116.508 91.394  1.00 0.00 ? 2109 LYS B CA 1  
ATOM 1745   C CA . LEU B 1 2110 ? 169.917 119.889 93.074  1.00 0.00 ? 2110 LEU B CA 1  
ATOM 1746   C CA . ILE B 1 2111 ? 167.770 121.289 90.180  1.00 0.00 ? 2111 ILE B CA 1  
ATOM 1747   C CA . LYS B 1 2112 ? 165.695 118.050 90.105  1.00 0.00 ? 2112 LYS B CA 1  
ATOM 1748   C CA . GLN B 1 2113 ? 165.122 118.029 93.886  1.00 0.00 ? 2113 GLN B CA 1  
ATOM 1749   C CA . CYS B 1 2114 ? 164.313 121.795 93.935  1.00 0.00 ? 2114 CYS B CA 1  
ATOM 1750   C CA . LEU B 1 2115 ? 161.700 121.369 91.144  1.00 0.00 ? 2115 LEU B CA 1  
ATOM 1751   C CA . LYS B 1 2116 ? 159.936 118.370 92.743  1.00 0.00 ? 2116 LYS B CA 1  
ATOM 1752   C CA . GLU B 1 2117 ? 156.136 118.312 92.337  1.00 0.00 ? 2117 GLU B CA 1  
ATOM 1753   C CA . ASN B 1 2118 ? 155.841 117.352 96.003  1.00 0.00 ? 2118 ASN B CA 1  
ATOM 1754   C CA . PRO B 1 2119 ? 156.921 120.498 98.025  1.00 0.00 ? 2119 PRO B CA 1  
ATOM 1755   C CA . GLN B 1 2120 ? 158.283 118.347 100.900 1.00 0.00 ? 2120 GLN B CA 1  
ATOM 1756   C CA . GLU B 1 2121 ? 160.963 116.710 98.694  1.00 0.00 ? 2121 GLU B CA 1  
ATOM 1757   C CA . ARG B 1 2122 ? 162.463 120.086 97.747  1.00 0.00 ? 2122 ARG B CA 1  
ATOM 1758   C CA . PRO B 1 2123 ? 165.614 120.556 99.922  1.00 0.00 ? 2123 PRO B CA 1  
ATOM 1759   C CA . THR B 1 2124 ? 166.437 122.900 102.810 1.00 0.00 ? 2124 THR B CA 1  
ATOM 1760   C CA . SER B 1 2125 ? 168.725 125.736 101.625 1.00 0.00 ? 2125 SER B CA 1  
ATOM 1761   C CA . ALA B 1 2126 ? 171.599 124.531 103.831 1.00 0.00 ? 2126 ALA B CA 1  
ATOM 1762   C CA . GLN B 1 2127 ? 171.762 121.364 101.642 1.00 0.00 ? 2127 GLN B CA 1  
ATOM 1763   C CA . VAL B 1 2128 ? 171.442 123.558 98.508  1.00 0.00 ? 2128 VAL B CA 1  
ATOM 1764   C CA . PHE B 1 2129 ? 174.336 125.837 99.598  1.00 0.00 ? 2129 PHE B CA 1  
ATOM 1765   C CA . ASP B 1 2130 ? 176.608 122.860 100.544 1.00 0.00 ? 2130 ASP B CA 1  
ATOM 1766   C CA . ILE B 1 2131 ? 175.965 121.170 97.143  1.00 0.00 ? 2131 ILE B CA 1  
ATOM 1767   C CA . LEU B 1 2132 ? 176.543 124.408 95.101  1.00 0.00 ? 2132 LEU B CA 1  
ATOM 1768   C CA . ASN B 1 2133 ? 179.804 125.047 97.019  1.00 0.00 ? 2133 ASN B CA 1  
ATOM 1769   C CA . SER B 1 2134 ? 181.156 121.617 95.844  1.00 0.00 ? 2134 SER B CA 1  
ATOM 1770   C CA . ALA B 1 2135 ? 180.863 122.430 92.074  1.00 0.00 ? 2135 ALA B CA 1  
ATOM 1771   C CA . ARG B 1 2142 ? 179.540 108.028 87.834  1.00 0.00 ? 2142 ARG B CA 1  
ATOM 1772   C CA . ARG B 1 2143 ? 179.597 104.286 88.473  1.00 0.00 ? 2143 ARG B CA 1  
ATOM 1773   C CA . ILE B 1 2144 ? 181.155 101.856 85.987  1.00 0.00 ? 2144 ILE B CA 1  
ATOM 1774   C CA . LEU B 1 2145 ? 180.145 98.232  86.525  1.00 0.00 ? 2145 LEU B CA 1  
ATOM 1775   C CA . LEU B 1 2146 ? 182.799 95.640  85.773  1.00 0.00 ? 2146 LEU B CA 1  
ATOM 1776   C CA . PRO B 1 2147 ? 181.801 92.317  84.181  1.00 0.00 ? 2147 PRO B CA 1  
ATOM 1777   C CA . LYS B 1 2148 ? 180.062 89.979  86.592  1.00 0.00 ? 2148 LYS B CA 1  
ATOM 1778   C CA . ASN B 1 2149 ? 182.320 88.069  89.051  1.00 0.00 ? 2149 ASN B CA 1  
ATOM 1779   C CA . VAL B 1 2150 ? 185.432 90.080  88.098  1.00 0.00 ? 2150 VAL B CA 1  
ATOM 1780   C CA . ILE B 1 2151 ? 187.446 90.604  91.291  1.00 0.00 ? 2151 ILE B CA 1  
ATOM 1781   C CA . VAL B 1 2152 ? 190.071 93.364  91.295  1.00 0.00 ? 2152 VAL B CA 1  
ATOM 1782   C CA . GLU B 1 2153 ? 193.249 92.858  93.314  1.00 0.00 ? 2153 GLU B CA 1  
ATOM 1783   C CA . CYS B 1 2154 ? 195.085 95.984  92.160  1.00 0.00 ? 2154 CYS B CA 1  
ATOM 1784   C CA . MET B 1 2155 ? 194.555 99.003  89.959  1.00 0.00 ? 2155 MET B CA 1  
ATOM 1785   C CA . VAL B 1 2156 ? 196.567 101.758 88.234  1.00 0.00 ? 2156 VAL B CA 1  
ATOM 1786   C CA . ALA B 1 2157 ? 195.246 104.712 86.241  1.00 0.00 ? 2157 ALA B CA 1  
ATOM 1787   C CA . THR B 1 2158 ? 196.376 106.362 83.010  1.00 0.00 ? 2158 THR B CA 1  
ATOM 1788   C CA . ASN B 1 2164 ? 189.904 108.413 76.735  1.00 0.00 ? 2164 ASN B CA 1  
ATOM 1789   C CA . ALA B 1 2165 ? 191.206 107.797 80.235  1.00 0.00 ? 2165 ALA B CA 1  
ATOM 1790   C CA . SER B 1 2166 ? 191.612 104.163 81.202  1.00 0.00 ? 2166 SER B CA 1  
ATOM 1791   C CA . ILE B 1 2167 ? 192.766 101.839 83.962  1.00 0.00 ? 2167 ILE B CA 1  
ATOM 1792   C CA . TRP B 1 2168 ? 194.831 98.654  84.286  1.00 0.00 ? 2168 TRP B CA 1  
ATOM 1793   C CA . LEU B 1 2169 ? 193.435 96.002  86.636  1.00 0.00 ? 2169 LEU B CA 1  
ATOM 1794   C CA . GLY B 1 2170 ? 194.958 92.925  88.237  1.00 0.00 ? 2170 GLY B CA 1  
ATOM 1795   C CA . CYS B 1 2171 ? 192.403 90.160  88.655  1.00 0.00 ? 2171 CYS B CA 1  
ATOM 1796   C CA . GLY B 1 2172 ? 191.731 88.113  91.783  1.00 0.00 ? 2172 GLY B CA 1  
ATOM 1797   C CA . HIS B 1 2173 ? 189.067 85.742  90.475  1.00 0.00 ? 2173 HIS B CA 1  
ATOM 1798   C CA . THR B 1 2174 ? 191.773 83.534  88.928  1.00 0.00 ? 2174 THR B CA 1  
ATOM 1799   C CA . ASP B 1 2175 ? 194.837 81.640  90.118  1.00 0.00 ? 2175 ASP B CA 1  
ATOM 1800   C CA . ARG B 1 2176 ? 196.914 82.754  87.103  1.00 0.00 ? 2176 ARG B CA 1  
ATOM 1801   C CA . GLY B 1 2177 ? 198.106 86.157  85.927  1.00 0.00 ? 2177 GLY B CA 1  
ATOM 1802   C CA . GLN B 1 2178 ? 195.315 88.002  84.106  1.00 0.00 ? 2178 GLN B CA 1  
ATOM 1803   C CA . LEU B 1 2179 ? 195.784 91.660  83.137  1.00 0.00 ? 2179 LEU B CA 1  
ATOM 1804   C CA . SER B 1 2180 ? 192.625 93.664  82.411  1.00 0.00 ? 2180 SER B CA 1  
ATOM 1805   C CA . PHE B 1 2181 ? 192.026 97.035  80.764  1.00 0.00 ? 2181 PHE B CA 1  
ATOM 1806   C CA . LEU B 1 2182 ? 189.091 99.411  81.279  1.00 0.00 ? 2182 LEU B CA 1  
ATOM 1807   C CA . ASP B 1 2183 ? 188.310 102.434 79.094  1.00 0.00 ? 2183 ASP B CA 1  
ATOM 1808   C CA . LEU B 1 2184 ? 186.812 104.905 81.575  1.00 0.00 ? 2184 LEU B CA 1  
ATOM 1809   C CA . ASN B 1 2185 ? 185.003 106.691 78.711  1.00 0.00 ? 2185 ASN B CA 1  
ATOM 1810   C CA . THR B 1 2186 ? 183.424 103.743 76.865  1.00 0.00 ? 2186 THR B CA 1  
ATOM 1811   C CA . GLU B 1 2187 ? 183.304 101.410 79.913  1.00 0.00 ? 2187 GLU B CA 1  
ATOM 1812   C CA . GLY B 1 2188 ? 184.796 98.731  77.656  1.00 0.00 ? 2188 GLY B CA 1  
ATOM 1813   C CA . TYR B 1 2189 ? 186.634 95.887  79.370  1.00 0.00 ? 2189 TYR B CA 1  
ATOM 1814   C CA . THR B 1 2190 ? 189.291 93.572  77.932  1.00 0.00 ? 2190 THR B CA 1  
ATOM 1815   C CA . SER B 1 2191 ? 191.597 91.097  79.655  1.00 0.00 ? 2191 SER B CA 1  
ATOM 1816   C CA . GLU B 1 2192 ? 194.527 88.835  78.802  1.00 0.00 ? 2192 GLU B CA 1  
ATOM 1817   C CA . GLU B 1 2193 ? 196.128 85.954  80.709  1.00 0.00 ? 2193 GLU B CA 1  
ATOM 1818   C CA . VAL B 1 2194 ? 199.718 87.158  80.929  1.00 0.00 ? 2194 VAL B CA 1  
ATOM 1819   C CA . ALA B 1 2195 ? 201.467 85.263  83.763  1.00 0.00 ? 2195 ALA B CA 1  
ATOM 1820   C CA . ASP B 1 2196 ? 201.455 81.986  85.698  1.00 0.00 ? 2196 ASP B CA 1  
ATOM 1821   C CA . SER B 1 2197 ? 200.373 83.335  89.112  1.00 0.00 ? 2197 SER B CA 1  
ATOM 1822   C CA . ARG B 1 2198 ? 197.878 85.921  90.326  1.00 0.00 ? 2198 ARG B CA 1  
ATOM 1823   C CA . ILE B 1 2199 ? 198.818 89.530  89.605  1.00 0.00 ? 2199 ILE B CA 1  
ATOM 1824   C CA . LEU B 1 2200 ? 199.131 91.136  93.038  1.00 0.00 ? 2200 LEU B CA 1  
ATOM 1825   C CA . CYS B 1 2201 ? 200.166 94.700  92.193  1.00 0.00 ? 2201 CYS B CA 1  
ATOM 1826   C CA . LEU B 1 2202 ? 200.612 97.066  89.252  1.00 0.00 ? 2202 LEU B CA 1  
ATOM 1827   C CA . ALA B 1 2203 ? 202.901 100.008 88.540  1.00 0.00 ? 2203 ALA B CA 1  
ATOM 1828   C CA . LEU B 1 2204 ? 203.154 102.219 85.455  1.00 0.00 ? 2204 LEU B CA 1  
ATOM 1829   C CA . VAL B 1 2205 ? 206.713 103.210 84.518  1.00 0.00 ? 2205 VAL B CA 1  
ATOM 1830   C CA . HIS B 1 2206 ? 206.771 106.120 82.063  1.00 0.00 ? 2206 HIS B CA 1  
ATOM 1831   C CA . LEU B 1 2207 ? 209.941 107.050 80.183  1.00 0.00 ? 2207 LEU B CA 1  
ATOM 1832   C CA . PRO B 1 2208 ? 209.588 110.638 78.873  1.00 0.00 ? 2208 PRO B CA 1  
ATOM 1833   C CA . VAL B 1 2209 ? 212.693 110.380 76.779  1.00 0.00 ? 2209 VAL B CA 1  
ATOM 1834   C CA . GLU B 1 2210 ? 212.337 107.313 74.522  1.00 0.00 ? 2210 GLU B CA 1  
ATOM 1835   C CA . LYS B 1 2211 ? 208.574 108.032 74.719  1.00 0.00 ? 2211 LYS B CA 1  
ATOM 1836   C CA . GLU B 1 2212 ? 207.590 104.690 76.192  1.00 0.00 ? 2212 GLU B CA 1  
ATOM 1837   C CA . SER B 1 2213 ? 205.236 103.460 78.915  1.00 0.00 ? 2213 SER B CA 1  
ATOM 1838   C CA . TRP B 1 2214 ? 205.577 100.020 80.508  1.00 0.00 ? 2214 TRP B CA 1  
ATOM 1839   C CA . ILE B 1 2215 ? 203.028 98.327  82.765  1.00 0.00 ? 2215 ILE B CA 1  
ATOM 1840   C CA . VAL B 1 2216 ? 204.691 96.260  85.502  1.00 0.00 ? 2216 VAL B CA 1  
ATOM 1841   C CA . SER B 1 2217 ? 202.811 93.369  87.120  1.00 0.00 ? 2217 SER B CA 1  
ATOM 1842   C CA . GLY B 1 2218 ? 203.960 91.866  90.413  1.00 0.00 ? 2218 GLY B CA 1  
ATOM 1843   C CA . THR B 1 2219 ? 202.710 88.338  91.000  1.00 0.00 ? 2219 THR B CA 1  
ATOM 1844   C CA . GLN B 1 2220 ? 202.152 85.721  93.703  1.00 0.00 ? 2220 GLN B CA 1  
ATOM 1845   C CA . SER B 1 2221 ? 205.243 83.778  92.561  1.00 0.00 ? 2221 SER B CA 1  
ATOM 1846   C CA . GLY B 1 2222 ? 207.668 86.723  92.650  1.00 0.00 ? 2222 GLY B CA 1  
ATOM 1847   C CA . THR B 1 2223 ? 207.710 87.391  88.903  1.00 0.00 ? 2223 THR B CA 1  
ATOM 1848   C CA . LEU B 1 2224 ? 207.926 90.982  87.645  1.00 0.00 ? 2224 LEU B CA 1  
ATOM 1849   C CA . LEU B 1 2225 ? 206.291 91.008  84.206  1.00 0.00 ? 2225 LEU B CA 1  
ATOM 1850   C CA . VAL B 1 2226 ? 206.912 94.150  82.131  1.00 0.00 ? 2226 VAL B CA 1  
ATOM 1851   C CA . ILE B 1 2227 ? 204.611 94.760  79.151  1.00 0.00 ? 2227 ILE B CA 1  
ATOM 1852   C CA . ASN B 1 2228 ? 204.626 97.618  76.644  1.00 0.00 ? 2228 ASN B CA 1  
ATOM 1853   C CA . THR B 1 2229 ? 201.526 99.810  76.584  1.00 0.00 ? 2229 THR B CA 1  
ATOM 1854   C CA . GLU B 1 2230 ? 201.487 100.384 72.819  1.00 0.00 ? 2230 GLU B CA 1  
ATOM 1855   C CA . ASP B 1 2231 ? 202.700 96.973  71.561  1.00 0.00 ? 2231 ASP B CA 1  
ATOM 1856   C CA . GLY B 1 2232 ? 201.693 94.042  73.768  1.00 0.00 ? 2232 GLY B CA 1  
ATOM 1857   C CA . LYS B 1 2233 ? 204.125 91.839  71.834  1.00 0.00 ? 2233 LYS B CA 1  
ATOM 1858   C CA . LYS B 1 2234 ? 206.900 93.720  73.686  1.00 0.00 ? 2234 LYS B CA 1  
ATOM 1859   C CA . ARG B 1 2235 ? 207.116 92.021  77.075  1.00 0.00 ? 2235 ARG B CA 1  
ATOM 1860   C CA . HIS B 1 2236 ? 209.803 90.530  79.295  1.00 0.00 ? 2236 HIS B CA 1  
ATOM 1861   C CA . THR B 1 2237 ? 210.621 89.648  82.901  1.00 0.00 ? 2237 THR B CA 1  
ATOM 1862   C CA . LEU B 1 2238 ? 212.895 91.281  85.476  1.00 0.00 ? 2238 LEU B CA 1  
ATOM 1863   C CA . GLU B 1 2239 ? 214.778 89.378  88.183  1.00 0.00 ? 2239 GLU B CA 1  
ATOM 1864   C CA . LYS B 1 2240 ? 212.544 86.928  90.027  1.00 0.00 ? 2240 LYS B CA 1  
ATOM 1865   C CA . MET B 1 2241 ? 211.762 87.837  93.630  1.00 0.00 ? 2241 MET B CA 1  
ATOM 1866   C CA . THR B 1 2242 ? 212.318 85.344  96.437  1.00 0.00 ? 2242 THR B CA 1  
ATOM 1867   C CA . ASP B 1 2243 ? 208.681 85.756  97.543  1.00 0.00 ? 2243 ASP B CA 1  
ATOM 1868   C CA . SER B 1 2244 ? 205.459 87.195  96.151  1.00 0.00 ? 2244 SER B CA 1  
ATOM 1869   C CA . VAL B 1 2245 ? 205.451 90.831  95.046  1.00 0.00 ? 2245 VAL B CA 1  
ATOM 1870   C CA . THR B 1 2246 ? 203.160 92.712  97.430  1.00 0.00 ? 2246 THR B CA 1  
ATOM 1871   C CA . CYS B 1 2247 ? 204.011 96.334  96.575  1.00 0.00 ? 2247 CYS B CA 1  
ATOM 1872   C CA . LEU B 1 2248 ? 204.878 98.399  93.490  1.00 0.00 ? 2248 LEU B CA 1  
ATOM 1873   C CA . TYR B 1 2249 ? 205.555 102.133 93.698  1.00 0.00 ? 2249 TYR B CA 1  
ATOM 1874   C CA . CYS B 1 2250 ? 207.107 104.596 91.242  1.00 0.00 ? 2250 CYS B CA 1  
ATOM 1875   C CA . ASN B 1 2251 ? 209.355 107.157 92.928  1.00 0.00 ? 2251 ASN B CA 1  
ATOM 1876   C CA . SER B 1 2252 ? 211.588 110.092 92.018  1.00 0.00 ? 2252 SER B CA 1  
ATOM 1877   C CA . PHE B 1 2253 ? 214.700 111.630 93.573  1.00 0.00 ? 2253 PHE B CA 1  
ATOM 1878   C CA . GLN B 1 2259 ? 215.820 113.803 89.312  1.00 0.00 ? 2254 GLN B CA 1  
ATOM 1879   C CA . LYS B 1 2260 ? 216.044 110.015 88.967  1.00 0.00 ? 2260 LYS B CA 1  
ATOM 1880   C CA . ASN B 1 2261 ? 212.977 107.772 88.797  1.00 0.00 ? 2261 ASN B CA 1  
ATOM 1881   C CA . PHE B 1 2262 ? 212.794 104.346 90.423  1.00 0.00 ? 2262 PHE B CA 1  
ATOM 1882   C CA . LEU B 1 2263 ? 210.557 101.290 90.730  1.00 0.00 ? 2263 LEU B CA 1  
ATOM 1883   C CA . LEU B 1 2264 ? 210.231 100.177 94.356  1.00 0.00 ? 2264 LEU B CA 1  
ATOM 1884   C CA . VAL B 1 2265 ? 209.188 96.539  94.796  1.00 0.00 ? 2265 VAL B CA 1  
ATOM 1885   C CA . GLY B 1 2266 ? 207.991 95.316  98.191  1.00 0.00 ? 2266 GLY B CA 1  
ATOM 1886   C CA . THR B 1 2267 ? 207.929 91.550  98.702  1.00 0.00 ? 2267 THR B CA 1  
ATOM 1887   C CA . ALA B 1 2268 ? 206.200 89.178  101.108 1.00 0.00 ? 2268 ALA B CA 1  
ATOM 1888   C CA . ASP B 1 2269 ? 209.465 88.224  102.868 1.00 0.00 ? 2269 ASP B CA 1  
ATOM 1889   C CA . GLY B 1 2270 ? 210.140 91.752  104.130 1.00 0.00 ? 2270 GLY B CA 1  
ATOM 1890   C CA . LYS B 1 2271 ? 212.442 92.909  101.327 1.00 0.00 ? 2271 LYS B CA 1  
ATOM 1891   C CA . LEU B 1 2272 ? 212.345 96.036  99.156  1.00 0.00 ? 2272 LEU B CA 1  
ATOM 1892   C CA . ALA B 1 2273 ? 214.069 95.926  95.762  1.00 0.00 ? 2273 ALA B CA 1  
ATOM 1893   C CA . ILE B 1 2274 ? 214.929 99.105  93.848  1.00 0.00 ? 2274 ILE B CA 1  
ATOM 1894   C CA . PHE B 1 2275 ? 215.034 99.210  90.050  1.00 0.00 ? 2275 PHE B CA 1  
ATOM 1895   C CA . GLU B 1 2276 ? 216.215 102.247 88.146  1.00 0.00 ? 2276 GLU B CA 1  
ATOM 1896   C CA . ASP B 1 2277 ? 213.898 103.946 85.657  1.00 0.00 ? 2277 ASP B CA 1  
ATOM 1897   C CA . LYS B 1 2278 ? 215.775 102.754 82.564  1.00 0.00 ? 2278 LYS B CA 1  
ATOM 1898   C CA . THR B 1 2279 ? 216.705 99.238  83.732  1.00 0.00 ? 2279 THR B CA 1  
ATOM 1899   C CA . VAL B 1 2280 ? 213.020 98.238  83.644  1.00 0.00 ? 2280 VAL B CA 1  
ATOM 1900   C CA . LYS B 1 2281 ? 213.294 97.927  79.846  1.00 0.00 ? 2281 LYS B CA 1  
ATOM 1901   C CA . LEU B 1 2282 ? 215.915 95.163  80.094  1.00 0.00 ? 2282 LEU B CA 1  
ATOM 1902   C CA . LYS B 1 2283 ? 215.124 91.453  80.210  1.00 0.00 ? 2283 LYS B CA 1  
ATOM 1903   C CA . GLY B 1 2284 ? 216.359 89.818  83.399  1.00 0.00 ? 2284 GLY B CA 1  
ATOM 1904   C CA . ALA B 1 2285 ? 217.434 93.133  84.918  1.00 0.00 ? 2285 ALA B CA 1  
ATOM 1905   C CA . ALA B 1 2286 ? 218.616 92.972  88.528  1.00 0.00 ? 2286 ALA B CA 1  
ATOM 1906   C CA . PRO B 1 2287 ? 217.736 95.599  91.156  1.00 0.00 ? 2287 PRO B CA 1  
ATOM 1907   C CA . LEU B 1 2288 ? 220.180 98.304  92.162  1.00 0.00 ? 2288 LEU B CA 1  
ATOM 1908   C CA . LYS B 1 2289 ? 219.701 97.368  95.821  1.00 0.00 ? 2289 LYS B CA 1  
ATOM 1909   C CA . ILE B 1 2290 ? 217.636 95.035  98.005  1.00 0.00 ? 2290 ILE B CA 1  
ATOM 1910   C CA . LEU B 1 2291 ? 216.743 96.083  101.556 1.00 0.00 ? 2291 LEU B CA 1  
ATOM 1911   C CA . ASN B 1 2292 ? 216.069 93.280  104.046 1.00 0.00 ? 2292 ASN B CA 1  
ATOM 1912   C CA . ILE B 1 2293 ? 213.636 95.099  106.334 1.00 0.00 ? 2293 ILE B CA 1  
ATOM 1913   C CA . GLY B 1 2294 ? 211.803 92.073  107.788 1.00 0.00 ? 2294 GLY B CA 1  
ATOM 1914   C CA . ASN B 1 2295 ? 211.278 88.347  107.366 1.00 0.00 ? 2295 ASN B CA 1  
ATOM 1915   C CA . VAL B 1 2296 ? 208.918 85.847  105.743 1.00 0.00 ? 2296 VAL B CA 1  
ATOM 1916   C CA . SER B 1 2297 ? 206.322 86.789  108.378 1.00 0.00 ? 2297 SER B CA 1  
ATOM 1917   C CA . THR B 1 2298 ? 206.440 90.589  107.808 1.00 0.00 ? 2298 THR B CA 1  
ATOM 1918   C CA . PRO B 1 2299 ? 205.325 91.439  104.257 1.00 0.00 ? 2299 PRO B CA 1  
ATOM 1919   C CA . LEU B 1 2300 ? 206.129 94.856  102.810 1.00 0.00 ? 2300 LEU B CA 1  
ATOM 1920   C CA . MET B 1 2301 ? 202.666 95.950  101.709 1.00 0.00 ? 2301 MET B CA 1  
ATOM 1921   C CA . CYS B 1 2302 ? 202.579 99.743  101.323 1.00 0.00 ? 2302 CYS B CA 1  
ATOM 1922   C CA . LEU B 1 2303 ? 204.726 102.698 100.261 1.00 0.00 ? 2303 LEU B CA 1  
ATOM 1923   C CA . SER B 1 2304 ? 204.037 106.430 100.247 1.00 0.00 ? 2304 SER B CA 1  
ATOM 1924   C CA . GLU B 1 2305 ? 205.799 109.738 99.696  1.00 0.00 ? 2305 GLU B CA 1  
ATOM 1925   C CA . VAL B 1 2314 ? 211.707 110.898 101.567 1.00 0.00 ? 2314 VAL B CA 1  
ATOM 1926   C CA . MET B 1 2315 ? 209.775 107.617 101.483 1.00 0.00 ? 2315 MET B CA 1  
ATOM 1927   C CA . TRP B 1 2316 ? 207.768 105.931 104.232 1.00 0.00 ? 2316 TRP B CA 1  
ATOM 1928   C CA . GLY B 1 2317 ? 206.570 102.343 104.199 1.00 0.00 ? 2317 GLY B CA 1  
ATOM 1929   C CA . GLY B 1 2318 ? 204.992 99.591  106.225 1.00 0.00 ? 2318 GLY B CA 1  
ATOM 1930   C CA . CYS B 1 2319 ? 206.561 96.206  106.980 1.00 0.00 ? 2319 CYS B CA 1  
ATOM 1931   C CA . GLY B 1 2320 ? 204.646 94.113  109.485 1.00 0.00 ? 2320 GLY B CA 1  
ATOM 1932   C CA . THR B 1 2321 ? 204.043 96.347  112.488 1.00 0.00 ? 2321 THR B CA 1  
ATOM 1933   C CA . LYS B 1 2322 ? 207.024 98.598  111.672 1.00 0.00 ? 2322 LYS B CA 1  
ATOM 1934   C CA . ILE B 1 2323 ? 207.071 101.899 109.795 1.00 0.00 ? 2323 ILE B CA 1  
ATOM 1935   C CA . PHE B 1 2324 ? 210.298 102.558 107.909 1.00 0.00 ? 2324 PHE B CA 1  
ATOM 1936   C CA . SER B 1 2325 ? 211.797 105.569 106.157 1.00 0.00 ? 2325 SER B CA 1  
ATOM 1937   C CA . PHE B 1 2326 ? 214.489 106.016 103.527 1.00 0.00 ? 2326 PHE B CA 1  
ATOM 1938   C CA . SER B 1 2327 ? 215.728 108.656 101.111 1.00 0.00 ? 2327 SER B CA 1  
ATOM 1939   C CA . ASN B 1 2328 ? 218.497 108.996 98.531  1.00 0.00 ? 2328 ASN B CA 1  
ATOM 1940   C CA . ASP B 1 2329 ? 220.980 106.259 99.475  1.00 0.00 ? 2329 ASP B CA 1  
ATOM 1941   C CA . PHE B 1 2330 ? 218.295 103.645 100.320 1.00 0.00 ? 2330 PHE B CA 1  
ATOM 1942   C CA . THR B 1 2331 ? 219.598 103.217 103.852 1.00 0.00 ? 2331 THR B CA 1  
ATOM 1943   C CA . ILE B 1 2332 ? 216.788 102.755 106.360 1.00 0.00 ? 2332 ILE B CA 1  
ATOM 1944   C CA . GLN B 1 2333 ? 216.738 105.866 108.528 1.00 0.00 ? 2333 GLN B CA 1  
ATOM 1945   C CA . LYS B 1 2334 ? 213.652 105.726 110.754 1.00 0.00 ? 2334 LYS B CA 1  
ATOM 1946   C CA . LEU B 1 2335 ? 212.167 102.472 112.053 1.00 0.00 ? 2335 LEU B CA 1  
ATOM 1947   C CA . ILE B 1 2336 ? 209.157 102.756 114.379 1.00 0.00 ? 2336 ILE B CA 1  
ATOM 1948   C CA . GLU B 1 2337 ? 207.542 99.806  116.155 1.00 0.00 ? 2337 GLU B CA 1  
ATOM 1949   C CA . THR B 1 2338 ? 203.773 100.342 116.271 1.00 0.00 ? 2338 THR B CA 1  
ATOM 1950   C CA . ARG B 1 2339 ? 202.800 97.078  117.991 1.00 0.00 ? 2339 ARG B CA 1  
ATOM 1951   C CA . THR B 1 2340 ? 202.923 98.663  121.464 1.00 0.00 ? 2340 THR B CA 1  
ATOM 1952   C CA . SER B 1 2341 ? 201.657 101.927 122.956 1.00 0.00 ? 2341 SER B CA 1  
ATOM 1953   C CA . GLN B 1 2342 ? 200.192 102.573 126.401 1.00 0.00 ? 2342 GLN B CA 1  
ATOM 1954   C CA . LEU B 1 2343 ? 197.587 105.003 125.029 1.00 0.00 ? 2343 LEU B CA 1  
ATOM 1955   C CA . PHE B 1 2344 ? 196.099 102.317 122.766 1.00 0.00 ? 2344 PHE B CA 1  
ATOM 1956   C CA . SER B 1 2345 ? 192.320 102.345 123.088 1.00 0.00 ? 2345 SER B CA 1  
ATOM 1957   C CA . TYR B 1 2346 ? 192.399 98.609  122.310 1.00 0.00 ? 2346 TYR B CA 1  
ATOM 1958   C CA . ALA B 1 2347 ? 195.570 96.541  122.107 1.00 0.00 ? 2347 ALA B CA 1  
ATOM 1959   C CA . ALA B 1 2348 ? 194.669 93.651  119.788 1.00 0.00 ? 2348 ALA B CA 1  
ATOM 1960   C CA . PHE B 1 2349 ? 194.061 95.976  116.826 1.00 0.00 ? 2349 PHE B CA 1  
ATOM 1961   C CA . SER B 1 2350 ? 197.571 97.443  116.955 1.00 0.00 ? 2350 SER B CA 1  
ATOM 1962   C CA . ASP B 1 2351 ? 199.125 93.961  116.744 1.00 0.00 ? 2351 ASP B CA 1  
ATOM 1963   C CA . SER B 1 2352 ? 198.442 93.604  113.033 1.00 0.00 ? 2352 SER B CA 1  
ATOM 1964   C CA . ASN B 1 2353 ? 200.278 94.196  109.776 1.00 0.00 ? 2353 ASN B CA 1  
ATOM 1965   C CA . ILE B 1 2354 ? 200.109 97.757  108.473 1.00 0.00 ? 2354 ILE B CA 1  
ATOM 1966   C CA . ILE B 1 2355 ? 198.024 97.816  105.286 1.00 0.00 ? 2355 ILE B CA 1  
ATOM 1967   C CA . THR B 1 2356 ? 198.454 101.462 104.226 1.00 0.00 ? 2356 THR B CA 1  
ATOM 1968   C CA . VAL B 1 2357 ? 200.456 104.575 105.116 1.00 0.00 ? 2357 VAL B CA 1  
ATOM 1969   C CA . VAL B 1 2358 ? 199.518 108.150 104.192 1.00 0.00 ? 2358 VAL B CA 1  
ATOM 1970   C CA . VAL B 1 2359 ? 202.096 110.855 104.927 1.00 0.00 ? 2359 VAL B CA 1  
ATOM 1971   C CA . ASP B 1 2360 ? 201.156 114.463 105.670 1.00 0.00 ? 2360 ASP B CA 1  
ATOM 1972   C CA . THR B 1 2361 ? 202.231 116.372 108.778 1.00 0.00 ? 2361 THR B CA 1  
ATOM 1973   C CA . ALA B 1 2362 ? 202.130 113.078 110.692 1.00 0.00 ? 2362 ALA B CA 1  
ATOM 1974   C CA . LEU B 1 2363 ? 201.886 109.400 109.772 1.00 0.00 ? 2363 LEU B CA 1  
ATOM 1975   C CA . TYR B 1 2364 ? 198.352 107.991 109.488 1.00 0.00 ? 2364 TYR B CA 1  
ATOM 1976   C CA . ILE B 1 2365 ? 198.588 104.197 109.386 1.00 0.00 ? 2365 ILE B CA 1  
ATOM 1977   C CA . ALA B 1 2366 ? 195.853 101.576 109.212 1.00 0.00 ? 2366 ALA B CA 1  
ATOM 1978   C CA . LYS B 1 2367 ? 196.242 97.931  110.195 1.00 0.00 ? 2367 LYS B CA 1  
ATOM 1979   C CA . GLN B 1 2368 ? 194.615 94.728  108.992 1.00 0.00 ? 2368 GLN B CA 1  
ATOM 1980   C CA . ASN B 1 2369 ? 191.191 94.027  110.534 1.00 0.00 ? 2369 ASN B CA 1  
ATOM 1981   C CA . SER B 1 2370 ? 191.413 97.177  112.669 1.00 0.00 ? 2370 SER B CA 1  
ATOM 1982   C CA . PRO B 1 2371 ? 188.957 100.109 112.892 1.00 0.00 ? 2371 PRO B CA 1  
ATOM 1983   C CA . VAL B 1 2372 ? 191.565 102.477 114.388 1.00 0.00 ? 2372 VAL B CA 1  
ATOM 1984   C CA . VAL B 1 2373 ? 193.709 104.768 112.249 1.00 0.00 ? 2373 VAL B CA 1  
ATOM 1985   C CA . GLU B 1 2374 ? 196.853 105.339 114.304 1.00 0.00 ? 2374 GLU B CA 1  
ATOM 1986   C CA . VAL B 1 2375 ? 198.659 108.683 114.099 1.00 0.00 ? 2375 VAL B CA 1  
ATOM 1987   C CA . TRP B 1 2376 ? 202.414 108.702 114.746 1.00 0.00 ? 2376 TRP B CA 1  
ATOM 1988   C CA . ASP B 1 2377 ? 204.956 111.527 114.857 1.00 0.00 ? 2377 ASP B CA 1  
ATOM 1989   C CA . LYS B 1 2378 ? 207.888 111.469 112.442 1.00 0.00 ? 2378 LYS B CA 1  
ATOM 1990   C CA . LYS B 1 2379 ? 210.265 113.167 114.887 1.00 0.00 ? 2379 LYS B CA 1  
ATOM 1991   C CA . THR B 1 2380 ? 209.429 111.711 118.308 1.00 0.00 ? 2380 THR B CA 1  
ATOM 1992   C CA . GLU B 1 2381 ? 208.374 108.308 116.876 1.00 0.00 ? 2381 GLU B CA 1  
ATOM 1993   C CA . LYS B 1 2382 ? 205.408 108.055 119.277 1.00 0.00 ? 2382 LYS B CA 1  
ATOM 1994   C CA . LEU B 1 2383 ? 201.626 108.159 119.096 1.00 0.00 ? 2383 LEU B CA 1  
ATOM 1995   C CA . CYS B 1 2384 ? 200.296 111.493 117.901 1.00 0.00 ? 2384 CYS B CA 1  
ATOM 1996   C CA . GLY B 1 2385 ? 196.680 110.387 118.152 1.00 0.00 ? 2385 GLY B CA 1  
ATOM 1997   C CA . LEU B 1 2386 ? 193.951 107.868 117.419 1.00 0.00 ? 2386 LEU B CA 1  
ATOM 1998   C CA . ILE B 1 2387 ? 191.002 107.975 115.019 1.00 0.00 ? 2387 ILE B CA 1  
ATOM 1999   C CA . ASP B 1 2388 ? 188.366 105.359 115.898 1.00 0.00 ? 2388 ASP B CA 1  
ATOM 2000   C CA . CYS B 1 2389 ? 186.114 104.897 112.866 1.00 0.00 ? 2389 CYS B CA 1  
ATOM 2001   C CA . VAL B 1 2390 ? 183.515 102.950 114.882 1.00 0.00 ? 2390 VAL B CA 1  
ATOM 2002   C CA . HIS B 1 2391 ? 182.738 106.064 116.930 1.00 0.00 ? 2391 HIS B CA 1  
ATOM 2003   C CA . PHE B 1 2392 ? 182.690 108.369 113.897 1.00 0.00 ? 2392 PHE B CA 1  
ATOM 2004   C CA . LEU B 1 2393 ? 180.283 106.008 112.134 1.00 0.00 ? 2393 LEU B CA 1  
ATOM 2005   C CA . ARG B 1 2394 ? 177.990 105.687 115.174 1.00 0.00 ? 2394 ARG B CA 1  
ATOM 2006   C CA . GLU B 1 2395 ? 177.102 109.411 115.048 1.00 0.00 ? 2395 GLU B CA 1  
ATOM 2007   C CA . MET B 1 2408 ? 175.216 100.976 115.008 1.00 0.00 ? 2408 MET B CA 1  
ATOM 2008   C CA . SER B 1 2409 ? 176.503 97.455  114.310 1.00 0.00 ? 2409 SER B CA 1  
ATOM 2009   C CA . TYR B 1 2410 ? 179.367 98.668  112.105 1.00 0.00 ? 2410 TYR B CA 1  
ATOM 2010   C CA . SER B 1 2411 ? 182.713 96.888  112.315 1.00 0.00 ? 2411 SER B CA 1  
ATOM 2011   C CA . GLY B 1 2412 ? 184.429 100.055 111.086 1.00 0.00 ? 2412 GLY B CA 1  
ATOM 2012   C CA . ARG B 1 2413 ? 187.280 97.915  109.782 1.00 0.00 ? 2413 ARG B CA 1  
ATOM 2013   C CA . VAL B 1 2414 ? 189.519 100.283 107.830 1.00 0.00 ? 2414 VAL B CA 1  
ATOM 2014   C CA . LYS B 1 2415 ? 190.209 99.214  104.248 1.00 0.00 ? 2415 LYS B CA 1  
ATOM 2015   C CA . THR B 1 2416 ? 191.850 102.219 102.600 1.00 0.00 ? 2416 THR B CA 1  
ATOM 2016   C CA . LEU B 1 2417 ? 193.180 105.733 103.255 1.00 0.00 ? 2417 LEU B CA 1  
ATOM 2017   C CA . CYS B 1 2418 ? 193.509 108.579 100.757 1.00 0.00 ? 2418 CYS B CA 1  
ATOM 2018   C CA . LEU B 1 2419 ? 194.631 112.189 101.154 1.00 0.00 ? 2419 LEU B CA 1  
ATOM 2019   C CA . GLN B 1 2420 ? 192.608 114.994 99.575  1.00 0.00 ? 2420 GLN B CA 1  
ATOM 2020   C CA . LYS B 1 2421 ? 194.680 118.130 98.919  1.00 0.00 ? 2421 LYS B CA 1  
ATOM 2021   C CA . ASN B 1 2422 ? 196.457 119.266 102.087 1.00 0.00 ? 2422 ASN B CA 1  
ATOM 2022   C CA . THR B 1 2423 ? 193.639 119.010 104.638 1.00 0.00 ? 2423 THR B CA 1  
ATOM 2023   C CA . ALA B 1 2424 ? 191.300 116.108 104.015 1.00 0.00 ? 2424 ALA B CA 1  
ATOM 2024   C CA . LEU B 1 2425 ? 191.555 112.367 104.681 1.00 0.00 ? 2425 LEU B CA 1  
ATOM 2025   C CA . TRP B 1 2426 ? 189.242 109.813 103.056 1.00 0.00 ? 2426 TRP B CA 1  
ATOM 2026   C CA . ILE B 1 2427 ? 188.723 106.543 104.950 1.00 0.00 ? 2427 ILE B CA 1  
ATOM 2027   C CA . GLY B 1 2428 ? 187.064 103.584 103.217 1.00 0.00 ? 2428 GLY B CA 1  
ATOM 2028   C CA . THR B 1 2429 ? 185.832 101.092 105.792 1.00 0.00 ? 2429 THR B CA 1  
ATOM 2029   C CA . GLY B 1 2430 ? 184.980 97.377  105.360 1.00 0.00 ? 2430 GLY B CA 1  
ATOM 2030   C CA . GLY B 1 2431 ? 181.323 98.150  104.887 1.00 0.00 ? 2431 GLY B CA 1  
ATOM 2031   C CA . GLY B 1 2432 ? 180.288 100.470 102.116 1.00 0.00 ? 2432 GLY B CA 1  
ATOM 2032   C CA . HIS B 1 2433 ? 181.142 103.478 104.252 1.00 0.00 ? 2433 HIS B CA 1  
ATOM 2033   C CA . ILE B 1 2434 ? 183.362 106.406 103.267 1.00 0.00 ? 2434 ILE B CA 1  
ATOM 2034   C CA . LEU B 1 2435 ? 184.466 109.031 105.805 1.00 0.00 ? 2435 LEU B CA 1  
ATOM 2035   C CA . LEU B 1 2436 ? 186.036 112.437 105.143 1.00 0.00 ? 2436 LEU B CA 1  
ATOM 2036   C CA . LEU B 1 2437 ? 187.983 113.933 108.062 1.00 0.00 ? 2437 LEU B CA 1  
ATOM 2037   C CA . ASP B 1 2438 ? 189.644 117.334 108.433 1.00 0.00 ? 2438 ASP B CA 1  
ATOM 2038   C CA . LEU B 1 2439 ? 193.295 116.882 109.483 1.00 0.00 ? 2439 LEU B CA 1  
ATOM 2039   C CA . SER B 1 2440 ? 194.058 120.108 111.363 1.00 0.00 ? 2440 SER B CA 1  
ATOM 2040   C CA . THR B 1 2441 ? 191.936 121.563 114.162 1.00 0.00 ? 2441 THR B CA 1  
ATOM 2041   C CA . ARG B 1 2442 ? 188.785 119.417 113.880 1.00 0.00 ? 2442 ARG B CA 1  
ATOM 2042   C CA . ARG B 1 2443 ? 187.651 116.060 112.487 1.00 0.00 ? 2443 ARG B CA 1  
ATOM 2043   C CA . LEU B 1 2444 ? 184.567 114.905 110.572 1.00 0.00 ? 2444 LEU B CA 1  
ATOM 2044   C CA . ILE B 1 2445 ? 183.665 116.749 107.365 1.00 0.00 ? 2445 ILE B CA 1  
ATOM 2045   C CA . ARG B 1 2446 ? 181.561 114.317 105.333 1.00 0.00 ? 2446 ARG B CA 1  
ATOM 2046   C CA . VAL B 1 2447 ? 180.138 110.801 105.650 1.00 0.00 ? 2447 VAL B CA 1  
ATOM 2047   C CA . ILE B 1 2448 ? 178.509 108.641 102.982 1.00 0.00 ? 2448 ILE B CA 1  
ATOM 2048   C CA . TYR B 1 2449 ? 176.915 105.415 104.245 1.00 0.00 ? 2449 TYR B CA 1  
ATOM 2049   C CA . ASN B 1 2450 ? 176.301 102.315 102.118 1.00 0.00 ? 2450 ASN B CA 1  
ATOM 2050   C CA . PHE B 1 2451 ? 178.283 103.794 99.232  1.00 0.00 ? 2451 PHE B CA 1  
ATOM 2051   C CA . CYS B 1 2452 ? 178.780 100.117 98.364  1.00 0.00 ? 2452 CYS B CA 1  
ATOM 2052   C CA . ASN B 1 2453 ? 178.975 96.830  100.264 1.00 0.00 ? 2453 ASN B CA 1  
ATOM 2053   C CA . SER B 1 2454 ? 182.757 97.037  100.790 1.00 0.00 ? 2454 SER B CA 1  
ATOM 2054   C CA . VAL B 1 2455 ? 185.266 99.730  99.762  1.00 0.00 ? 2455 VAL B CA 1  
ATOM 2055   C CA . ARG B 1 2456 ? 188.379 97.965  98.474  1.00 0.00 ? 2456 ARG B CA 1  
ATOM 2056   C CA . VAL B 1 2457 ? 190.524 100.613 96.746  1.00 0.00 ? 2457 VAL B CA 1  
ATOM 2057   C CA . MET B 1 2458 ? 190.507 104.412 96.866  1.00 0.00 ? 2458 MET B CA 1  
ATOM 2058   C CA . MET B 1 2459 ? 193.024 106.569 95.002  1.00 0.00 ? 2459 MET B CA 1  
ATOM 2059   C CA . THR B 1 2460 ? 193.652 109.920 93.324  1.00 0.00 ? 2460 THR B CA 1  
ATOM 2060   C CA . ALA B 1 2461 ? 194.692 110.243 89.675  1.00 0.00 ? 2461 ALA B CA 1  
ATOM 2061   C CA . GLN B 1 2462 ? 195.373 112.968 87.122  1.00 0.00 ? 2462 GLN B CA 1  
ATOM 2062   C CA . ASN B 1 2468 ? 192.363 115.876 89.983  1.00 0.00 ? 2468 ASN B CA 1  
ATOM 2063   C CA . VAL B 1 2469 ? 190.140 112.785 89.877  1.00 0.00 ? 2469 VAL B CA 1  
ATOM 2064   C CA . MET B 1 2470 ? 188.882 110.357 92.531  1.00 0.00 ? 2470 MET B CA 1  
ATOM 2065   C CA . LEU B 1 2471 ? 188.584 106.596 91.956  1.00 0.00 ? 2471 LEU B CA 1  
ATOM 2066   C CA . VAL B 1 2472 ? 186.846 104.212 94.377  1.00 0.00 ? 2472 VAL B CA 1  
ATOM 2067   C CA . LEU B 1 2473 ? 186.699 100.492 93.589  1.00 0.00 ? 2473 LEU B CA 1  
ATOM 2068   C CA . GLY B 1 2474 ? 184.142 98.664  95.718  1.00 0.00 ? 2474 GLY B CA 1  
ATOM 2069   C CA . TYR B 1 2475 ? 182.568 95.241  95.411  1.00 0.00 ? 2475 TYR B CA 1  
ATOM 2070   C CA . ASN B 1 2476 ? 179.097 93.822  96.148  1.00 0.00 ? 2476 ASN B CA 1  
ATOM 2071   C CA . ARG B 1 2477 ? 178.283 90.193  96.832  1.00 0.00 ? 2477 ARG B CA 1  
ATOM 2072   C CA . GLU B 1 2488 ? 178.263 85.956  92.856  1.00 0.00 ? 2497 GLU B CA 1  
ATOM 2073   C CA . ILE B 1 2489 ? 180.386 89.121  92.959  1.00 0.00 ? 2498 ILE B CA 1  
ATOM 2074   C CA . GLN B 1 2490 ? 179.872 92.475  91.208  1.00 0.00 ? 2499 GLN B CA 1  
ATOM 2075   C CA . SER B 1 2491 ? 182.796 94.900  91.264  1.00 0.00 ? 2500 SER B CA 1  
ATOM 2076   C CA . CYS B 1 2492 ? 182.153 98.583  90.571  1.00 0.00 ? 2501 CYS B CA 1  
ATOM 2077   C CA . LEU B 1 2493 ? 184.413 101.579 89.956  1.00 0.00 ? 2502 LEU B CA 1  
ATOM 2078   C CA . THR B 1 2494 ? 183.050 104.972 91.029  1.00 0.00 ? 2503 THR B CA 1  
ATOM 2079   C CA . VAL B 1 2495 ? 184.729 108.160 89.823  1.00 0.00 ? 2504 VAL B CA 1  
ATOM 2080   C CA . TRP B 1 2496 ? 184.387 111.915 90.342  1.00 0.00 ? 2505 TRP B CA 1  
ATOM 2081   C CA . TYR A 1 1332 ? 102.959 149.190 153.310 1.00 0.00 ? 1332 TYR A CA 2  
ATOM 2082   C CA . ASN A 1 1333 ? 103.479 147.546 156.770 1.00 0.00 ? 1333 ASN A CA 2  
ATOM 2083   C CA . ARG A 1 1334 ? 104.213 144.021 155.645 1.00 0.00 ? 1334 ARG A CA 2  
ATOM 2084   C CA . MET A 1 1335 ? 107.353 141.842 155.787 1.00 0.00 ? 1335 MET A CA 2  
ATOM 2085   C CA . LYS A 1 1336 ? 108.555 138.339 154.848 1.00 0.00 ? 1336 LYS A CA 2  
ATOM 2086   C CA . LEU A 1 1337 ? 110.250 136.235 157.529 1.00 0.00 ? 1337 LEU A CA 2  
ATOM 2087   C CA . MET A 1 1338 ? 112.168 133.413 155.887 1.00 0.00 ? 1338 MET A CA 2  
ATOM 2088   C CA . ILE A 1 1339 ? 113.000 130.554 158.258 1.00 0.00 ? 1339 ILE A CA 2  
ATOM 2089   C CA . VAL A 1 1340 ? 116.376 129.086 157.235 1.00 0.00 ? 1340 VAL A CA 2  
ATOM 2090   C CA . GLY A 1 1341 ? 118.129 125.994 158.615 1.00 0.00 ? 1341 GLY A CA 2  
ATOM 2091   C CA . ASN A 1 1342 ? 118.579 122.235 158.379 1.00 0.00 ? 1342 ASN A CA 2  
ATOM 2092   C CA . THR A 1 1343 ? 115.270 120.267 158.705 1.00 0.00 ? 1343 THR A CA 2  
ATOM 2093   C CA . GLY A 1 1344 ? 114.307 120.321 162.397 1.00 0.00 ? 1344 GLY A CA 2  
ATOM 2094   C CA . SER A 1 1345 ? 116.825 122.627 164.059 1.00 0.00 ? 1345 SER A CA 2  
ATOM 2095   C CA . GLY A 1 1346 ? 113.590 123.742 165.802 1.00 0.00 ? 1346 GLY A CA 2  
ATOM 2096   C CA . LYS A 1 1347 ? 111.860 125.832 163.107 1.00 0.00 ? 1347 LYS A CA 2  
ATOM 2097   C CA . THR A 1 1348 ? 108.372 124.796 164.357 1.00 0.00 ? 1348 THR A CA 2  
ATOM 2098   C CA . THR A 1 1349 ? 109.603 125.037 168.001 1.00 0.00 ? 1349 THR A CA 2  
ATOM 2099   C CA . LEU A 1 1350 ? 110.810 128.613 167.522 1.00 0.00 ? 1350 LEU A CA 2  
ATOM 2100   C CA . LEU A 1 1351 ? 107.528 129.528 165.748 1.00 0.00 ? 1351 LEU A CA 2  
ATOM 2101   C CA . GLN A 1 1352 ? 105.316 128.032 168.516 1.00 0.00 ? 1352 GLN A CA 2  
ATOM 2102   C CA . GLN A 1 1353 ? 107.232 130.111 171.065 1.00 0.00 ? 1353 GLN A CA 2  
ATOM 2103   C CA . LEU A 1 1354 ? 107.094 133.449 169.159 1.00 0.00 ? 1354 LEU A CA 2  
ATOM 2104   C CA . MET A 1 1355 ? 103.462 133.302 168.198 1.00 0.00 ? 1355 MET A CA 2  
ATOM 2105   C CA . LYS A 1 1356 ? 101.775 133.007 171.681 1.00 0.00 ? 1356 LYS A CA 2  
ATOM 2106   C CA . THR A 1 1357 ? 98.199  132.962 170.263 1.00 0.00 ? 1357 THR A CA 2  
ATOM 2107   C CA . LYS A 1 1358 ? 95.225  130.832 171.466 1.00 0.00 ? 1358 LYS A CA 2  
ATOM 2108   C CA . LYS A 1 1359 ? 96.778  127.997 169.414 1.00 0.00 ? 1359 LYS A CA 2  
ATOM 2109   C CA . SER A 1 1360 ? 94.639  129.130 166.440 1.00 0.00 ? 1360 SER A CA 2  
ATOM 2110   C CA . ASP A 1 1361 ? 96.403  127.431 163.498 1.00 0.00 ? 1361 ASP A CA 2  
ATOM 2111   C CA . LEU A 1 1362 ? 99.581  128.044 165.542 1.00 0.00 ? 1362 LEU A CA 2  
ATOM 2112   C CA . GLY A 1 1363 ? 100.646 124.421 165.305 1.00 0.00 ? 1363 GLY A CA 2  
ATOM 2113   C CA . MET A 1 1364 ? 102.170 122.947 162.137 1.00 0.00 ? 1364 MET A CA 2  
ATOM 2114   C CA . GLN A 1 1365 ? 105.473 121.060 162.072 1.00 0.00 ? 1365 GLN A CA 2  
ATOM 2115   C CA . SER A 1 1366 ? 106.863 120.393 158.585 1.00 0.00 ? 1366 SER A CA 2  
ATOM 2116   C CA . ALA A 1 1367 ? 110.536 120.860 159.307 1.00 0.00 ? 1367 ALA A CA 2  
ATOM 2117   C CA . THR A 1 1368 ? 111.891 118.516 156.521 1.00 0.00 ? 1368 THR A CA 2  
ATOM 2118   C CA . VAL A 1 1369 ? 111.142 119.076 152.786 1.00 0.00 ? 1369 VAL A CA 2  
ATOM 2119   C CA . GLY A 1 1370 ? 107.827 120.926 153.298 1.00 0.00 ? 1370 GLY A CA 2  
ATOM 2120   C CA . ILE A 1 1371 ? 106.184 124.296 152.588 1.00 0.00 ? 1371 ILE A CA 2  
ATOM 2121   C CA . ASP A 1 1372 ? 103.838 126.589 154.570 1.00 0.00 ? 1372 ASP A CA 2  
ATOM 2122   C CA . VAL A 1 1373 ? 103.017 130.231 155.430 1.00 0.00 ? 1373 VAL A CA 2  
ATOM 2123   C CA . LYS A 1 1374 ? 101.868 131.552 158.792 1.00 0.00 ? 1374 LYS A CA 2  
ATOM 2124   C CA . ASP A 1 1375 ? 100.868 135.202 158.762 1.00 0.00 ? 1375 ASP A CA 2  
ATOM 2125   C CA . TRP A 1 1376 ? 100.522 136.915 162.162 1.00 0.00 ? 1376 TRP A CA 2  
ATOM 2126   C CA . PRO A 1 1377 ? 100.347 140.619 163.148 1.00 0.00 ? 1377 PRO A CA 2  
ATOM 2127   C CA . ILE A 1 1378 ? 103.273 140.601 165.674 1.00 0.00 ? 1378 ILE A CA 2  
ATOM 2128   C CA . GLN A 1 1379 ? 103.377 144.136 166.841 1.00 0.00 ? 1379 GLN A CA 2  
ATOM 2129   C CA . ILE A 1 1380 ? 103.885 146.765 169.519 1.00 0.00 ? 1380 ILE A CA 2  
ATOM 2130   C CA . ARG A 1 1381 ? 100.706 148.517 170.596 1.00 0.00 ? 1381 ARG A CA 2  
ATOM 2131   C CA . ASP A 1 1382 ? 100.748 152.345 170.271 1.00 0.00 ? 1382 ASP A CA 2  
ATOM 2132   C CA . LYS A 1 1383 ? 103.899 152.466 168.082 1.00 0.00 ? 1383 LYS A CA 2  
ATOM 2133   C CA . ARG A 1 1384 ? 104.659 152.399 164.299 1.00 0.00 ? 1384 ARG A CA 2  
ATOM 2134   C CA . LYS A 1 1385 ? 104.741 148.630 164.528 1.00 0.00 ? 1385 LYS A CA 2  
ATOM 2135   C CA . ARG A 1 1386 ? 100.948 148.639 165.491 1.00 0.00 ? 1386 ARG A CA 2  
ATOM 2136   C CA . ASP A 1 1387 ? 99.784  147.904 161.903 1.00 0.00 ? 1387 ASP A CA 2  
ATOM 2137   C CA . LEU A 1 1388 ? 102.679 145.522 160.924 1.00 0.00 ? 1388 LEU A CA 2  
ATOM 2138   C CA . VAL A 1 1389 ? 101.992 142.136 159.308 1.00 0.00 ? 1389 VAL A CA 2  
ATOM 2139   C CA . LEU A 1 1390 ? 104.631 139.373 159.514 1.00 0.00 ? 1390 LEU A CA 2  
ATOM 2140   C CA . ASN A 1 1391 ? 104.543 136.557 156.965 1.00 0.00 ? 1391 ASN A CA 2  
ATOM 2141   C CA . VAL A 1 1392 ? 106.530 133.511 158.132 1.00 0.00 ? 1392 VAL A CA 2  
ATOM 2142   C CA . TRP A 1 1393 ? 107.649 131.412 155.174 1.00 0.00 ? 1393 TRP A CA 2  
ATOM 2143   C CA . ASP A 1 1394 ? 109.416 128.099 155.110 1.00 0.00 ? 1394 ASP A CA 2  
ATOM 2144   C CA . PHE A 1 1395 ? 110.470 126.768 151.680 1.00 0.00 ? 1395 PHE A CA 2  
ATOM 2145   C CA . ALA A 1 1396 ? 112.702 123.999 153.111 1.00 0.00 ? 1396 ALA A CA 2  
ATOM 2146   C CA . GLY A 1 1397 ? 115.913 124.975 151.247 1.00 0.00 ? 1397 GLY A CA 2  
ATOM 2147   C CA . ARG A 1 1398 ? 114.291 125.057 147.799 1.00 0.00 ? 1398 ARG A CA 2  
ATOM 2148   C CA . GLU A 1 1399 ? 113.821 128.755 147.058 1.00 0.00 ? 1399 GLU A CA 2  
ATOM 2149   C CA . GLU A 1 1400 ? 111.006 128.285 144.472 1.00 0.00 ? 1400 GLU A CA 2  
ATOM 2150   C CA . PHE A 1 1401 ? 110.222 132.016 143.958 1.00 0.00 ? 1401 PHE A CA 2  
ATOM 2151   C CA . TYR A 1 1402 ? 113.855 132.980 143.056 1.00 0.00 ? 1402 TYR A CA 2  
ATOM 2152   C CA . SER A 1 1403 ? 113.830 132.817 139.207 1.00 0.00 ? 1403 SER A CA 2  
ATOM 2153   C CA . THR A 1 1404 ? 110.563 134.669 138.482 1.00 0.00 ? 1404 THR A CA 2  
ATOM 2154   C CA . HIS A 1 1405 ? 110.290 136.895 141.576 1.00 0.00 ? 1405 HIS A CA 2  
ATOM 2155   C CA . PRO A 1 1406 ? 113.840 138.234 142.487 1.00 0.00 ? 1406 PRO A CA 2  
ATOM 2156   C CA . HIS A 1 1407 ? 112.532 140.925 144.871 1.00 0.00 ? 1407 HIS A CA 2  
ATOM 2157   C CA . PHE A 1 1408 ? 110.530 138.389 146.938 1.00 0.00 ? 1408 PHE A CA 2  
ATOM 2158   C CA . MET A 1 1409 ? 113.897 137.170 148.272 1.00 0.00 ? 1409 MET A CA 2  
ATOM 2159   C CA . THR A 1 1410 ? 116.048 140.336 147.974 1.00 0.00 ? 1410 THR A CA 2  
ATOM 2160   C CA . GLN A 1 1411 ? 113.576 142.966 149.221 1.00 0.00 ? 1411 GLN A CA 2  
ATOM 2161   C CA . ARG A 1 1412 ? 110.810 142.976 151.847 1.00 0.00 ? 1412 ARG A CA 2  
ATOM 2162   C CA . ALA A 1 1413 ? 112.557 140.184 153.723 1.00 0.00 ? 1413 ALA A CA 2  
ATOM 2163   C CA . LEU A 1 1414 ? 114.184 139.037 156.953 1.00 0.00 ? 1414 LEU A CA 2  
ATOM 2164   C CA . TYR A 1 1415 ? 116.159 135.804 157.109 1.00 0.00 ? 1415 TYR A CA 2  
ATOM 2165   C CA . LEU A 1 1416 ? 116.041 133.895 160.397 1.00 0.00 ? 1416 LEU A CA 2  
ATOM 2166   C CA . ALA A 1 1417 ? 118.775 131.317 160.635 1.00 0.00 ? 1417 ALA A CA 2  
ATOM 2167   C CA . VAL A 1 1418 ? 117.929 128.525 163.061 1.00 0.00 ? 1418 VAL A CA 2  
ATOM 2168   C CA . TYR A 1 1419 ? 120.930 126.645 164.400 1.00 0.00 ? 1419 TYR A CA 2  
ATOM 2169   C CA . ASP A 1 1420 ? 120.653 123.849 166.855 1.00 0.00 ? 1420 ASP A CA 2  
ATOM 2170   C CA . LEU A 1 1421 ? 124.216 124.507 168.010 1.00 0.00 ? 1421 LEU A CA 2  
ATOM 2171   C CA . SER A 1 1422 ? 124.645 121.042 169.616 1.00 0.00 ? 1422 SER A CA 2  
ATOM 2172   C CA . LYS A 1 1423 ? 123.333 119.190 166.528 1.00 0.00 ? 1423 LYS A CA 2  
ATOM 2173   C CA . GLY A 1 1424 ? 122.941 121.428 163.407 1.00 0.00 ? 1424 GLY A CA 2  
ATOM 2174   C CA . GLN A 1 1425 ? 126.269 123.189 164.069 1.00 0.00 ? 1425 GLN A CA 2  
ATOM 2175   C CA . ALA A 1 1426 ? 128.053 120.301 165.867 1.00 0.00 ? 1426 ALA A CA 2  
ATOM 2176   C CA . GLU A 1 1427 ? 127.001 117.181 163.813 1.00 0.00 ? 1427 GLU A CA 2  
ATOM 2177   C CA . VAL A 1 1428 ? 126.993 118.641 160.271 1.00 0.00 ? 1428 VAL A CA 2  
ATOM 2178   C CA . ASP A 1 1429 ? 128.548 122.195 160.481 1.00 0.00 ? 1429 ASP A CA 2  
ATOM 2179   C CA . ALA A 1 1430 ? 125.776 123.477 158.224 1.00 0.00 ? 1430 ALA A CA 2  
ATOM 2180   C CA . MET A 1 1431 ? 126.157 127.024 159.552 1.00 0.00 ? 1431 MET A CA 2  
ATOM 2181   C CA . LYS A 1 1432 ? 128.644 127.998 156.803 1.00 0.00 ? 1432 LYS A CA 2  
ATOM 2182   C CA . PRO A 1 1433 ? 126.366 126.609 153.963 1.00 0.00 ? 1433 PRO A CA 2  
ATOM 2183   C CA . TRP A 1 1434 ? 123.175 128.261 155.319 1.00 0.00 ? 1434 TRP A CA 2  
ATOM 2184   C CA . LEU A 1 1435 ? 124.892 131.611 155.846 1.00 0.00 ? 1435 LEU A CA 2  
ATOM 2185   C CA . PHE A 1 1436 ? 126.114 131.639 152.186 1.00 0.00 ? 1436 PHE A CA 2  
ATOM 2186   C CA . ASN A 1 1437 ? 122.595 130.462 151.098 1.00 0.00 ? 1437 ASN A CA 2  
ATOM 2187   C CA . ILE A 1 1438 ? 121.114 133.550 152.839 1.00 0.00 ? 1438 ILE A CA 2  
ATOM 2188   C CA . LYS A 1 1439 ? 123.754 135.850 151.207 1.00 0.00 ? 1439 LYS A CA 2  
ATOM 2189   C CA . ALA A 1 1440 ? 123.128 134.632 147.617 1.00 0.00 ? 1440 ALA A CA 2  
ATOM 2190   C CA . ARG A 1 1441 ? 119.301 134.303 147.667 1.00 0.00 ? 1441 ARG A CA 2  
ATOM 2191   C CA . ALA A 1 1442 ? 118.705 137.406 149.670 1.00 0.00 ? 1442 ALA A CA 2  
ATOM 2192   C CA . SER A 1 1443 ? 120.813 140.486 148.925 1.00 0.00 ? 1443 SER A CA 2  
ATOM 2193   C CA . SER A 1 1444 ? 121.307 143.140 151.600 1.00 0.00 ? 1444 SER A CA 2  
ATOM 2194   C CA . SER A 1 1445 ? 118.355 141.583 153.499 1.00 0.00 ? 1445 SER A CA 2  
ATOM 2195   C CA . PRO A 1 1446 ? 118.962 141.238 157.318 1.00 0.00 ? 1446 PRO A CA 2  
ATOM 2196   C CA . VAL A 1 1447 ? 119.660 138.021 158.969 1.00 0.00 ? 1447 VAL A CA 2  
ATOM 2197   C CA . ILE A 1 1448 ? 119.050 137.105 162.600 1.00 0.00 ? 1448 ILE A CA 2  
ATOM 2198   C CA . LEU A 1 1449 ? 121.004 134.132 163.949 1.00 0.00 ? 1449 LEU A CA 2  
ATOM 2199   C CA . VAL A 1 1450 ? 119.113 132.060 166.529 1.00 0.00 ? 1450 VAL A CA 2  
ATOM 2200   C CA . GLY A 1 1451 ? 121.044 129.420 168.499 1.00 0.00 ? 1451 GLY A CA 2  
ATOM 2201   C CA . THR A 1 1452 ? 118.397 126.924 169.665 1.00 0.00 ? 1452 THR A CA 2  
ATOM 2202   C CA . HIS A 1 1453 ? 118.109 124.133 172.280 1.00 0.00 ? 1453 HIS A CA 2  
ATOM 2203   C CA . LEU A 1 1454 ? 120.481 125.880 174.680 1.00 0.00 ? 1454 LEU A CA 2  
ATOM 2204   C CA . ASP A 1 1455 ? 118.973 124.047 177.712 1.00 0.00 ? 1455 ASP A CA 2  
ATOM 2205   C CA . VAL A 1 1456 ? 120.441 120.702 176.489 1.00 0.00 ? 1456 VAL A CA 2  
ATOM 2206   C CA . SER A 1 1457 ? 123.877 122.328 176.118 1.00 0.00 ? 1457 SER A CA 2  
ATOM 2207   C CA . ASP A 1 1458 ? 124.193 123.917 179.609 1.00 0.00 ? 1458 ASP A CA 2  
ATOM 2208   C CA . GLU A 1 1459 ? 124.745 127.357 177.992 1.00 0.00 ? 1459 GLU A CA 2  
ATOM 2209   C CA . LYS A 1 1460 ? 128.045 126.142 176.426 1.00 0.00 ? 1460 LYS A CA 2  
ATOM 2210   C CA . GLN A 1 1461 ? 127.346 126.262 172.672 1.00 0.00 ? 1461 GLN A CA 2  
ATOM 2211   C CA . ARG A 1 1462 ? 126.600 129.985 172.759 1.00 0.00 ? 1462 ARG A CA 2  
ATOM 2212   C CA . LYS A 1 1463 ? 130.113 130.910 173.846 1.00 0.00 ? 1463 LYS A CA 2  
ATOM 2213   C CA . ALA A 1 1464 ? 132.738 132.628 171.619 1.00 0.00 ? 1464 ALA A CA 2  
ATOM 2214   C CA . CYS A 1 1465 ? 134.697 129.354 171.776 1.00 0.00 ? 1465 CYS A CA 2  
ATOM 2215   C CA . MET A 1 1466 ? 132.059 127.526 169.650 1.00 0.00 ? 1466 MET A CA 2  
ATOM 2216   C CA . SER A 1 1467 ? 129.941 130.320 168.119 1.00 0.00 ? 1467 SER A CA 2  
ATOM 2217   C CA . LYS A 1 1468 ? 132.245 132.682 166.231 1.00 0.00 ? 1468 LYS A CA 2  
ATOM 2218   C CA . ILE A 1 1469 ? 129.939 135.776 166.433 1.00 0.00 ? 1469 ILE A CA 2  
ATOM 2219   C CA . THR A 1 1470 ? 132.423 138.667 166.033 1.00 0.00 ? 1470 THR A CA 2  
ATOM 2220   C CA . LYS A 1 1471 ? 135.255 136.559 164.723 1.00 0.00 ? 1471 LYS A CA 2  
ATOM 2221   C CA . GLU A 1 1472 ? 133.467 134.899 161.690 1.00 0.00 ? 1472 GLU A CA 2  
ATOM 2222   C CA . LEU A 1 1473 ? 129.705 135.655 161.683 1.00 0.00 ? 1473 LEU A CA 2  
ATOM 2223   C CA . LEU A 1 1474 ? 129.525 139.509 161.795 1.00 0.00 ? 1474 LEU A CA 2  
ATOM 2224   C CA . ASN A 1 1475 ? 130.791 142.578 159.820 1.00 0.00 ? 1475 ASN A CA 2  
ATOM 2225   C CA . LYS A 1 1476 ? 134.475 141.999 160.790 1.00 0.00 ? 1476 LYS A CA 2  
ATOM 2226   C CA . ARG A 1 1477 ? 134.620 138.846 158.626 1.00 0.00 ? 1477 ARG A CA 2  
ATOM 2227   C CA . GLY A 1 1478 ? 132.306 139.563 155.727 1.00 0.00 ? 1478 GLY A CA 2  
ATOM 2228   C CA . PHE A 1 1479 ? 128.818 139.008 157.196 1.00 0.00 ? 1479 PHE A CA 2  
ATOM 2229   C CA . PRO A 1 1480 ? 127.463 142.600 157.273 1.00 0.00 ? 1480 PRO A CA 2  
ATOM 2230   C CA . ALA A 1 1481 ? 123.665 142.245 157.380 1.00 0.00 ? 1481 ALA A CA 2  
ATOM 2231   C CA . ILE A 1 1482 ? 123.463 140.316 160.690 1.00 0.00 ? 1482 ILE A CA 2  
ATOM 2232   C CA . ARG A 1 1483 ? 124.202 142.607 163.719 1.00 0.00 ? 1483 ARG A CA 2  
ATOM 2233   C CA . ASP A 1 1484 ? 122.036 140.332 165.949 1.00 0.00 ? 1484 ASP A CA 2  
ATOM 2234   C CA . TYR A 1 1485 ? 122.481 136.939 167.650 1.00 0.00 ? 1485 TYR A CA 2  
ATOM 2235   C CA . HIS A 1 1486 ? 120.154 135.000 169.989 1.00 0.00 ? 1486 HIS A CA 2  
ATOM 2236   C CA . PHE A 1 1487 ? 120.613 132.109 172.328 1.00 0.00 ? 1487 PHE A CA 2  
ATOM 2237   C CA . VAL A 1 1488 ? 117.295 130.539 173.247 1.00 0.00 ? 1488 VAL A CA 2  
ATOM 2238   C CA . ASN A 1 1489 ? 116.182 127.749 175.601 1.00 0.00 ? 1489 ASN A CA 2  
ATOM 2239   C CA . ALA A 1 1490 ? 112.456 127.316 175.026 1.00 0.00 ? 1490 ALA A CA 2  
ATOM 2240   C CA . THR A 1 1491 ? 111.458 124.915 177.783 1.00 0.00 ? 1491 THR A CA 2  
ATOM 2241   C CA . GLU A 1 1492 ? 113.475 126.706 180.475 1.00 0.00 ? 1492 GLU A CA 2  
ATOM 2242   C CA . GLU A 1 1493 ? 112.339 130.318 179.987 1.00 0.00 ? 1493 GLU A CA 2  
ATOM 2243   C CA . SER A 1 1494 ? 110.933 132.597 177.235 1.00 0.00 ? 1494 SER A CA 2  
ATOM 2244   C CA . ASP A 1 1495 ? 112.992 135.683 178.117 1.00 0.00 ? 1495 ASP A CA 2  
ATOM 2245   C CA . ALA A 1 1496 ? 115.536 135.320 175.272 1.00 0.00 ? 1496 ALA A CA 2  
ATOM 2246   C CA . LEU A 1 1497 ? 112.692 134.832 172.739 1.00 0.00 ? 1497 LEU A CA 2  
ATOM 2247   C CA . ALA A 1 1498 ? 111.259 138.241 173.652 1.00 0.00 ? 1498 ALA A CA 2  
ATOM 2248   C CA . LYS A 1 1499 ? 114.712 139.555 172.591 1.00 0.00 ? 1499 LYS A CA 2  
ATOM 2249   C CA . LEU A 1 1500 ? 114.125 137.972 169.124 1.00 0.00 ? 1500 LEU A CA 2  
ATOM 2250   C CA . ARG A 1 1501 ? 111.161 140.355 168.823 1.00 0.00 ? 1501 ARG A CA 2  
ATOM 2251   C CA . LYS A 1 1502 ? 113.576 143.326 169.257 1.00 0.00 ? 1502 LYS A CA 2  
ATOM 2252   C CA . THR A 1 1503 ? 115.576 142.092 166.255 1.00 0.00 ? 1503 THR A CA 2  
ATOM 2253   C CA . ILE A 1 1504 ? 112.314 141.622 164.278 1.00 0.00 ? 1504 ILE A CA 2  
ATOM 2254   C CA . ILE A 1 1505 ? 111.736 145.287 165.301 1.00 0.00 ? 1505 ILE A CA 2  
ATOM 2255   C CA . ASN A 1 1506 ? 115.296 146.289 164.126 1.00 0.00 ? 1506 ASN A CA 2  
ATOM 2256   C CA . GLU A 1 1507 ? 114.540 144.782 160.726 1.00 0.00 ? 1507 GLU A CA 2  
ATOM 2257   C CA . SER A 1 1508 ? 111.376 145.550 158.600 1.00 0.00 ? 1508 SER A CA 2  
ATOM 2258   C CA . LEU A 1 1509 ? 112.692 149.151 158.924 1.00 0.00 ? 1509 LEU A CA 2  
ATOM 2259   C CA . ASN A 1 1510 ? 114.802 149.180 155.739 1.00 0.00 ? 1510 ASN A CA 2  
ATOM 2260   C CA . PHE A 1 1511 ? 112.387 146.843 153.798 1.00 0.00 ? 1511 PHE A CA 2  
ATOM 2261   C CA . LYS A 1 1512 ? 109.017 148.467 153.907 1.00 0.00 ? 1512 LYS A CA 2  
ATOM 2262   C CA . ILE A 1 1513 ? 109.172 151.888 155.688 1.00 0.00 ? 1513 ILE A CA 2  
ATOM 2263   C CA . ARG A 1 1514 ? 111.317 153.680 153.069 1.00 0.00 ? 1514 ARG A CA 2  
ATOM 2264   C CA . PRO A 1 1524 ? 117.767 152.382 179.728 1.00 0.00 ? 1524 PRO A CA 2  
ATOM 2265   C CA . ASP A 1 1525 ? 115.043 155.047 180.280 1.00 0.00 ? 1525 ASP A CA 2  
ATOM 2266   C CA . CYS A 1 1526 ? 117.366 157.847 179.021 1.00 0.00 ? 1526 CYS A CA 2  
ATOM 2267   C CA . TYR A 1 1527 ? 117.645 156.213 175.530 1.00 0.00 ? 1527 TYR A CA 2  
ATOM 2268   C CA . VAL A 1 1528 ? 113.785 155.941 175.275 1.00 0.00 ? 1528 VAL A CA 2  
ATOM 2269   C CA . GLU A 1 1529 ? 113.345 159.542 176.580 1.00 0.00 ? 1529 GLU A CA 2  
ATOM 2270   C CA . LEU A 1 1530 ? 115.858 160.903 174.096 1.00 0.00 ? 1530 LEU A CA 2  
ATOM 2271   C CA . GLU A 1 1531 ? 114.344 158.859 171.207 1.00 0.00 ? 1531 GLU A CA 2  
ATOM 2272   C CA . LYS A 1 1532 ? 110.880 160.379 171.874 1.00 0.00 ? 1532 LYS A CA 2  
ATOM 2273   C CA . ILE A 1 1533 ? 112.230 163.963 172.073 1.00 0.00 ? 1533 ILE A CA 2  
ATOM 2274   C CA . ILE A 1 1534 ? 114.355 163.406 168.939 1.00 0.00 ? 1534 ILE A CA 2  
ATOM 2275   C CA . LEU A 1 1535 ? 111.307 162.033 167.026 1.00 0.00 ? 1535 LEU A CA 2  
ATOM 2276   C CA . SER A 1 1536 ? 109.068 164.956 168.115 1.00 0.00 ? 1536 SER A CA 2  
ATOM 2277   C CA . GLU A 1 1537 ? 111.760 167.560 167.200 1.00 0.00 ? 1537 GLU A CA 2  
ATOM 2278   C CA . ARG A 1 1538 ? 112.564 165.787 163.907 1.00 0.00 ? 1538 ARG A CA 2  
ATOM 2279   C CA . LYS A 1 1539 ? 109.031 165.251 162.533 1.00 0.00 ? 1539 LYS A CA 2  
ATOM 2280   C CA . ASN A 1 1540 ? 108.220 168.930 163.218 1.00 0.00 ? 1540 ASN A CA 2  
ATOM 2281   C CA . VAL A 1 1541 ? 110.964 169.960 160.754 1.00 0.00 ? 1541 VAL A CA 2  
ATOM 2282   C CA . PRO A 1 1542 ? 109.557 168.456 157.446 1.00 0.00 ? 1542 PRO A CA 2  
ATOM 2283   C CA . ILE A 1 1543 ? 110.042 171.683 155.557 1.00 0.00 ? 1543 ILE A CA 2  
ATOM 2284   C CA . GLU A 1 1544 ? 113.693 172.060 156.328 1.00 0.00 ? 1544 GLU A CA 2  
ATOM 2285   C CA . PHE A 1 1545 ? 116.789 169.758 156.346 1.00 0.00 ? 1545 PHE A CA 2  
ATOM 2286   C CA . PRO A 1 1546 ? 118.660 170.579 159.647 1.00 0.00 ? 1546 PRO A CA 2  
ATOM 2287   C CA . VAL A 1 1547 ? 115.911 168.821 161.412 1.00 0.00 ? 1547 VAL A CA 2  
ATOM 2288   C CA . ILE A 1 1548 ? 118.339 168.575 164.273 1.00 0.00 ? 1548 ILE A CA 2  
ATOM 2289   C CA . ASP A 1 1549 ? 121.733 170.338 164.255 1.00 0.00 ? 1549 ASP A CA 2  
ATOM 2290   C CA . ARG A 1 1550 ? 124.688 169.197 166.437 1.00 0.00 ? 1550 ARG A CA 2  
ATOM 2291   C CA . LYS A 1 1551 ? 124.037 171.737 169.224 1.00 0.00 ? 1551 LYS A CA 2  
ATOM 2292   C CA . ARG A 1 1552 ? 120.340 170.916 169.377 1.00 0.00 ? 1552 ARG A CA 2  
ATOM 2293   C CA . LEU A 1 1553 ? 120.794 167.118 169.922 1.00 0.00 ? 1553 LEU A CA 2  
ATOM 2294   C CA . LEU A 1 1554 ? 123.552 167.857 172.482 1.00 0.00 ? 1554 LEU A CA 2  
ATOM 2295   C CA . GLN A 1 1555 ? 120.973 169.976 174.345 1.00 0.00 ? 1555 GLN A CA 2  
ATOM 2296   C CA . LEU A 1 1556 ? 118.325 167.169 174.239 1.00 0.00 ? 1556 LEU A CA 2  
ATOM 2297   C CA . VAL A 1 1557 ? 120.906 164.537 175.365 1.00 0.00 ? 1557 VAL A CA 2  
ATOM 2298   C CA . ARG A 1 1558 ? 121.827 166.744 178.391 1.00 0.00 ? 1558 ARG A CA 2  
ATOM 2299   C CA . GLU A 1 1559 ? 118.185 167.182 179.471 1.00 0.00 ? 1559 GLU A CA 2  
ATOM 2300   C CA . ASN A 1 1560 ? 117.896 163.360 179.784 1.00 0.00 ? 1560 ASN A CA 2  
ATOM 2301   C CA . GLN A 1 1561 ? 121.312 163.209 181.578 1.00 0.00 ? 1561 GLN A CA 2  
ATOM 2302   C CA . LEU A 1 1562 ? 123.366 161.678 178.687 1.00 0.00 ? 1562 LEU A CA 2  
ATOM 2303   C CA . GLN A 1 1563 ? 125.867 164.557 178.105 1.00 0.00 ? 1563 GLN A CA 2  
ATOM 2304   C CA . LEU A 1 1564 ? 128.067 162.725 180.645 1.00 0.00 ? 1564 LEU A CA 2  
ATOM 2305   C CA . ASP A 1 1565 ? 129.852 160.825 177.859 1.00 0.00 ? 1565 ASP A CA 2  
ATOM 2306   C CA . GLU A 1 1566 ? 130.250 161.887 174.183 1.00 0.00 ? 1566 GLU A CA 2  
ATOM 2307   C CA . ASN A 1 1567 ? 131.070 158.249 173.488 1.00 0.00 ? 1567 ASN A CA 2  
ATOM 2308   C CA . GLU A 1 1568 ? 127.565 156.928 174.553 1.00 0.00 ? 1568 GLU A CA 2  
ATOM 2309   C CA . LEU A 1 1569 ? 125.789 159.585 172.517 1.00 0.00 ? 1569 LEU A CA 2  
ATOM 2310   C CA . PRO A 1 1570 ? 127.357 158.234 169.205 1.00 0.00 ? 1570 PRO A CA 2  
ATOM 2311   C CA . HIS A 1 1571 ? 126.292 154.755 170.337 1.00 0.00 ? 1571 HIS A CA 2  
ATOM 2312   C CA . ALA A 1 1572 ? 122.687 155.854 171.118 1.00 0.00 ? 1572 ALA A CA 2  
ATOM 2313   C CA . VAL A 1 1573 ? 122.346 157.721 167.792 1.00 0.00 ? 1573 VAL A CA 2  
ATOM 2314   C CA . HIS A 1 1574 ? 124.162 154.818 166.003 1.00 0.00 ? 1574 HIS A CA 2  
ATOM 2315   C CA . PHE A 1 1575 ? 121.437 152.529 167.486 1.00 0.00 ? 1575 PHE A CA 2  
ATOM 2316   C CA . LEU A 1 1576 ? 118.622 154.877 166.488 1.00 0.00 ? 1576 LEU A CA 2  
ATOM 2317   C CA . ASN A 1 1577 ? 120.101 155.113 162.969 1.00 0.00 ? 1577 ASN A CA 2  
ATOM 2318   C CA . GLU A 1 1578 ? 120.519 151.271 162.695 1.00 0.00 ? 1578 GLU A CA 2  
ATOM 2319   C CA . SER A 1 1579 ? 116.846 150.953 163.709 1.00 0.00 ? 1579 SER A CA 2  
ATOM 2320   C CA . GLY A 1 1580 ? 115.579 153.674 161.262 1.00 0.00 ? 1580 GLY A CA 2  
ATOM 2321   C CA . VAL A 1 1581 ? 113.907 155.717 164.013 1.00 0.00 ? 1581 VAL A CA 2  
ATOM 2322   C CA . LEU A 1 1582 ? 116.119 158.594 162.978 1.00 0.00 ? 1582 LEU A CA 2  
ATOM 2323   C CA . LEU A 1 1583 ? 118.881 158.859 160.420 1.00 0.00 ? 1583 LEU A CA 2  
ATOM 2324   C CA . HIS A 1 1584 ? 122.451 159.799 161.405 1.00 0.00 ? 1584 HIS A CA 2  
ATOM 2325   C CA . PHE A 1 1585 ? 125.215 159.618 158.857 1.00 0.00 ? 1585 PHE A CA 2  
ATOM 2326   C CA . GLN A 1 1586 ? 128.590 159.206 160.588 1.00 0.00 ? 1586 GLN A CA 2  
ATOM 2327   C CA . ASP A 1 1587 ? 130.563 159.291 157.267 1.00 0.00 ? 1587 ASP A CA 2  
ATOM 2328   C CA . PRO A 1 1588 ? 129.483 162.927 156.262 1.00 0.00 ? 1588 PRO A CA 2  
ATOM 2329   C CA . ALA A 1 1589 ? 129.473 164.001 159.974 1.00 0.00 ? 1589 ALA A CA 2  
ATOM 2330   C CA . LEU A 1 1590 ? 133.098 165.258 159.854 1.00 0.00 ? 1590 LEU A CA 2  
ATOM 2331   C CA . GLN A 1 1591 ? 132.100 168.492 158.058 1.00 0.00 ? 1591 GLN A CA 2  
ATOM 2332   C CA . LEU A 1 1592 ? 128.384 168.651 158.853 1.00 0.00 ? 1592 LEU A CA 2  
ATOM 2333   C CA . SER A 1 1593 ? 127.171 169.948 162.262 1.00 0.00 ? 1593 SER A CA 2  
ATOM 2334   C CA . ASP A 1 1594 ? 124.278 171.862 160.638 1.00 0.00 ? 1594 ASP A CA 2  
ATOM 2335   C CA . LEU A 1 1595 ? 122.567 168.665 159.475 1.00 0.00 ? 1595 LEU A CA 2  
ATOM 2336   C CA . TYR A 1 1596 ? 123.474 166.009 161.997 1.00 0.00 ? 1596 TYR A CA 2  
ATOM 2337   C CA . PHE A 1 1597 ? 120.416 163.801 162.547 1.00 0.00 ? 1597 PHE A CA 2  
ATOM 2338   C CA . VAL A 1 1598 ? 117.575 163.402 160.018 1.00 0.00 ? 1598 VAL A CA 2  
ATOM 2339   C CA . GLU A 1 1599 ? 113.811 162.549 159.690 1.00 0.00 ? 1599 GLU A CA 2  
ATOM 2340   C CA . PRO A 1 1600 ? 113.532 159.268 157.642 1.00 0.00 ? 1600 PRO A CA 2  
ATOM 2341   C CA . LYS A 1 1601 ? 110.339 160.401 155.855 1.00 0.00 ? 1601 LYS A CA 2  
ATOM 2342   C CA . TRP A 1 1602 ? 111.947 163.646 154.746 1.00 0.00 ? 1602 TRP A CA 2  
ATOM 2343   C CA . LEU A 1 1603 ? 115.010 161.757 153.365 1.00 0.00 ? 1603 LEU A CA 2  
ATOM 2344   C CA . CYS A 1 1604 ? 112.915 159.051 151.625 1.00 0.00 ? 1604 CYS A CA 2  
ATOM 2345   C CA . LYS A 1 1605 ? 110.579 161.566 149.916 1.00 0.00 ? 1605 LYS A CA 2  
ATOM 2346   C CA . ILE A 1 1606 ? 113.656 163.486 148.677 1.00 0.00 ? 1606 ILE A CA 2  
ATOM 2347   C CA . MET A 1 1607 ? 115.218 160.626 146.879 1.00 0.00 ? 1607 MET A CA 2  
ATOM 2348   C CA . ALA A 1 1608 ? 112.031 159.186 145.458 1.00 0.00 ? 1608 ALA A CA 2  
ATOM 2349   C CA . GLN A 1 1609 ? 111.413 162.633 143.854 1.00 0.00 ? 1609 GLN A CA 2  
ATOM 2350   C CA . ILE A 1 1610 ? 114.927 162.522 142.281 1.00 0.00 ? 1610 ILE A CA 2  
ATOM 2351   C CA . LEU A 1 1611 ? 114.390 158.889 141.154 1.00 0.00 ? 1611 LEU A CA 2  
ATOM 2352   C CA . THR A 1 1612 ? 110.954 159.562 139.546 1.00 0.00 ? 1612 THR A CA 2  
ATOM 2353   C CA . VAL A 1 1613 ? 111.727 162.962 138.004 1.00 0.00 ? 1613 VAL A CA 2  
ATOM 2354   C CA . LYS A 1 1614 ? 111.165 163.361 134.225 1.00 0.00 ? 1614 LYS A CA 2  
ATOM 2355   C CA . VAL A 1 1615 ? 114.480 165.254 133.906 1.00 0.00 ? 1615 VAL A CA 2  
ATOM 2356   C CA . GLU A 1 1616 ? 116.945 162.335 133.818 1.00 0.00 ? 1616 GLU A CA 2  
ATOM 2357   C CA . GLY A 1 1617 ? 119.090 163.991 131.132 1.00 0.00 ? 1617 GLY A CA 2  
ATOM 2358   C CA . CYS A 1 1618 ? 119.322 166.182 128.046 1.00 0.00 ? 1618 CYS A CA 2  
ATOM 2359   C CA . PRO A 1 1619 ? 116.107 166.346 125.842 1.00 0.00 ? 1619 PRO A CA 2  
ATOM 2360   C CA . LYS A 1 1620 ? 116.897 163.558 123.304 1.00 0.00 ? 1620 LYS A CA 2  
ATOM 2361   C CA . HIS A 1 1621 ? 118.971 161.332 125.633 1.00 0.00 ? 1621 HIS A CA 2  
ATOM 2362   C CA . PRO A 1 1622 ? 117.561 160.957 129.209 1.00 0.00 ? 1622 PRO A CA 2  
ATOM 2363   C CA . LYS A 1 1623 ? 119.387 157.822 130.419 1.00 0.00 ? 1623 LYS A CA 2  
ATOM 2364   C CA . GLY A 1 1624 ? 119.682 158.155 134.241 1.00 0.00 ? 1624 GLY A CA 2  
ATOM 2365   C CA . ILE A 1 1625 ? 121.577 161.482 134.114 1.00 0.00 ? 1625 ILE A CA 2  
ATOM 2366   C CA . ILE A 1 1626 ? 121.070 163.955 136.992 1.00 0.00 ? 1626 ILE A CA 2  
ATOM 2367   C CA . SER A 1 1627 ? 122.006 167.508 135.946 1.00 0.00 ? 1627 SER A CA 2  
ATOM 2368   C CA . ARG A 1 1628 ? 122.874 169.220 139.283 1.00 0.00 ? 1628 ARG A CA 2  
ATOM 2369   C CA . ARG A 1 1629 ? 121.341 172.602 138.260 1.00 0.00 ? 1629 ARG A CA 2  
ATOM 2370   C CA . ASP A 1 1630 ? 117.874 171.284 137.935 1.00 0.00 ? 1630 ASP A CA 2  
ATOM 2371   C CA . VAL A 1 1631 ? 117.545 169.957 141.554 1.00 0.00 ? 1631 VAL A CA 2  
ATOM 2372   C CA . GLU A 1 1632 ? 115.606 173.092 142.655 1.00 0.00 ? 1632 GLU A CA 2  
ATOM 2373   C CA . LYS A 1 1633 ? 112.840 172.305 140.152 1.00 0.00 ? 1633 LYS A CA 2  
ATOM 2374   C CA . PHE A 1 1634 ? 112.715 168.530 140.909 1.00 0.00 ? 1634 PHE A CA 2  
ATOM 2375   C CA . LEU A 1 1635 ? 112.502 168.810 144.628 1.00 0.00 ? 1635 LEU A CA 2  
ATOM 2376   C CA . SER A 1 1636 ? 110.515 172.060 145.244 1.00 0.00 ? 1636 SER A CA 2  
ATOM 2377   C CA . LYS A 1 1637 ? 107.719 173.109 146.178 1.00 0.00 ? 1637 LYS A CA 2  
ATOM 2378   C CA . LYS A 1 1638 ? 106.268 169.574 146.861 1.00 0.00 ? 1638 LYS A CA 2  
ATOM 2379   C CA . ARG A 1 1639 ? 108.905 169.454 149.515 1.00 0.00 ? 1639 ARG A CA 2  
ATOM 2380   C CA . LYS A 1 1640 ? 111.084 172.346 150.642 1.00 0.00 ? 1640 LYS A CA 2  
ATOM 2381   C CA . PHE A 1 1641 ? 114.749 171.928 149.722 1.00 0.00 ? 1641 PHE A CA 2  
ATOM 2382   C CA . PRO A 1 1642 ? 117.080 174.920 149.879 1.00 0.00 ? 1642 PRO A CA 2  
ATOM 2383   C CA . LYS A 1 1643 ? 120.506 174.837 148.139 1.00 0.00 ? 1643 LYS A CA 2  
ATOM 2384   C CA . ASN A 1 1644 ? 122.639 173.465 151.044 1.00 0.00 ? 1644 ASN A CA 2  
ATOM 2385   C CA . TYR A 1 1645 ? 119.975 170.795 151.670 1.00 0.00 ? 1645 TYR A CA 2  
ATOM 2386   C CA . MET A 1 1646 ? 120.191 170.032 147.931 1.00 0.00 ? 1646 MET A CA 2  
ATOM 2387   C CA . SER A 1 1647 ? 123.973 169.404 148.051 1.00 0.00 ? 1647 SER A CA 2  
ATOM 2388   C CA . GLN A 1 1648 ? 123.602 167.051 151.073 1.00 0.00 ? 1648 GLN A CA 2  
ATOM 2389   C CA . TYR A 1 1649 ? 120.765 164.836 149.681 1.00 0.00 ? 1649 TYR A CA 2  
ATOM 2390   C CA . PHE A 1 1650 ? 123.097 164.017 146.777 1.00 0.00 ? 1650 PHE A CA 2  
ATOM 2391   C CA . LYS A 1 1651 ? 125.620 162.775 149.375 1.00 0.00 ? 1651 LYS A CA 2  
ATOM 2392   C CA . LEU A 1 1652 ? 122.800 160.635 150.849 1.00 0.00 ? 1652 LEU A CA 2  
ATOM 2393   C CA . LEU A 1 1653 ? 122.136 159.173 147.328 1.00 0.00 ? 1653 LEU A CA 2  
ATOM 2394   C CA . GLU A 1 1654 ? 125.874 158.376 147.019 1.00 0.00 ? 1654 GLU A CA 2  
ATOM 2395   C CA . LYS A 1 1655 ? 125.810 156.759 150.469 1.00 0.00 ? 1655 LYS A CA 2  
ATOM 2396   C CA . PHE A 1 1656 ? 122.595 154.782 149.666 1.00 0.00 ? 1656 PHE A CA 2  
ATOM 2397   C CA . GLN A 1 1657 ? 124.412 153.673 146.441 1.00 0.00 ? 1657 GLN A CA 2  
ATOM 2398   C CA . ILE A 1 1658 ? 121.730 155.093 144.145 1.00 0.00 ? 1658 ILE A CA 2  
ATOM 2399   C CA . ALA A 1 1659 ? 124.053 157.392 142.195 1.00 0.00 ? 1659 ALA A CA 2  
ATOM 2400   C CA . LEU A 1 1660 ? 127.711 158.293 141.549 1.00 0.00 ? 1660 LEU A CA 2  
ATOM 2401   C CA . PRO A 1 1661 ? 129.491 161.501 140.355 1.00 0.00 ? 1661 PRO A CA 2  
ATOM 2402   C CA . ILE A 1 1662 ? 131.362 161.598 137.001 1.00 0.00 ? 1662 ILE A CA 2  
ATOM 2403   C CA . GLY A 1 1663 ? 132.685 165.136 137.645 1.00 0.00 ? 1663 GLY A CA 2  
ATOM 2404   C CA . GLU A 1 1664 ? 130.880 167.569 135.297 1.00 0.00 ? 1664 GLU A CA 2  
ATOM 2405   C CA . GLU A 1 1665 ? 127.959 168.392 137.704 1.00 0.00 ? 1665 GLU A CA 2  
ATOM 2406   C CA . TYR A 1 1666 ? 126.244 165.385 136.098 1.00 0.00 ? 1666 TYR A CA 2  
ATOM 2407   C CA . LEU A 1 1667 ? 125.525 162.222 138.103 1.00 0.00 ? 1667 LEU A CA 2  
ATOM 2408   C CA . LEU A 1 1668 ? 124.604 158.715 136.947 1.00 0.00 ? 1668 LEU A CA 2  
ATOM 2409   C CA . VAL A 1 1669 ? 121.589 156.888 138.454 1.00 0.00 ? 1669 VAL A CA 2  
ATOM 2410   C CA . ILE A 1 1690 ? 161.505 144.020 154.111 1.00 0.00 ? 1690 ILE A CA 2  
ATOM 2411   C CA . ILE A 1 1691 ? 157.674 143.682 154.537 1.00 0.00 ? 1691 ILE A CA 2  
ATOM 2412   C CA . ILE A 1 1692 ? 156.209 142.152 151.380 1.00 0.00 ? 1692 ILE A CA 2  
ATOM 2413   C CA . ARG A 1 1693 ? 152.448 141.841 150.794 1.00 0.00 ? 1693 ARG A CA 2  
ATOM 2414   C CA . LEU A 1 1694 ? 150.975 140.475 147.532 1.00 0.00 ? 1694 LEU A CA 2  
ATOM 2415   C CA . TYR A 1 1695 ? 147.389 140.853 146.167 1.00 0.00 ? 1695 TYR A CA 2  
ATOM 2416   C CA . GLU A 1 1696 ? 146.142 138.286 143.551 1.00 0.00 ? 1696 GLU A CA 2  
ATOM 2417   C CA . MET A 1 1697 ? 143.342 139.478 141.215 1.00 0.00 ? 1697 MET A CA 2  
ATOM 2418   C CA . PRO A 1 1698 ? 141.573 137.067 138.634 1.00 0.00 ? 1698 PRO A CA 2  
ATOM 2419   C CA . TYR A 1 1699 ? 141.395 140.163 136.547 1.00 0.00 ? 1699 TYR A CA 2  
ATOM 2420   C CA . PHE A 1 1700 ? 143.842 143.035 137.266 1.00 0.00 ? 1700 PHE A CA 2  
ATOM 2421   C CA . PRO A 1 1701 ? 142.350 146.320 135.822 1.00 0.00 ? 1701 PRO A CA 2  
ATOM 2422   C CA . MET A 1 1702 ? 145.011 148.274 133.916 1.00 0.00 ? 1702 MET A CA 2  
ATOM 2423   C CA . GLY A 1 1703 ? 143.654 151.425 135.571 1.00 0.00 ? 1703 GLY A CA 2  
ATOM 2424   C CA . PHE A 1 1704 ? 144.672 150.325 139.124 1.00 0.00 ? 1704 PHE A CA 2  
ATOM 2425   C CA . TRP A 1 1705 ? 148.288 151.502 139.017 1.00 0.00 ? 1705 TRP A CA 2  
ATOM 2426   C CA . SER A 1 1706 ? 147.484 154.639 137.096 1.00 0.00 ? 1706 SER A CA 2  
ATOM 2427   C CA . ARG A 1 1707 ? 144.821 155.579 139.657 1.00 0.00 ? 1707 ARG A CA 2  
ATOM 2428   C CA . LEU A 1 1708 ? 146.933 154.615 142.688 1.00 0.00 ? 1708 LEU A CA 2  
ATOM 2429   C CA . ILE A 1 1709 ? 149.777 156.764 141.257 1.00 0.00 ? 1709 ILE A CA 2  
ATOM 2430   C CA . ASN A 1 1710 ? 147.255 159.670 141.212 1.00 0.00 ? 1710 ASN A CA 2  
ATOM 2431   C CA . ARG A 1 1711 ? 146.033 159.033 144.815 1.00 0.00 ? 1711 ARG A CA 2  
ATOM 2432   C CA . LEU A 1 1712 ? 149.682 158.871 145.948 1.00 0.00 ? 1712 LEU A CA 2  
ATOM 2433   C CA . LEU A 1 1713 ? 151.265 161.591 143.688 1.00 0.00 ? 1713 LEU A CA 2  
ATOM 2434   C CA . GLU A 1 1714 ? 152.672 163.562 146.623 1.00 0.00 ? 1714 GLU A CA 2  
ATOM 2435   C CA . ILE A 1 1715 ? 154.830 160.674 147.952 1.00 0.00 ? 1715 ILE A CA 2  
ATOM 2436   C CA . SER A 1 1716 ? 156.473 159.571 144.661 1.00 0.00 ? 1716 SER A CA 2  
ATOM 2437   C CA . PRO A 1 1717 ? 159.397 162.086 144.664 1.00 0.00 ? 1717 PRO A CA 2  
ATOM 2438   C CA . TYR A 1 1718 ? 159.385 162.018 148.472 1.00 0.00 ? 1718 TYR A CA 2  
ATOM 2439   C CA . MET A 1 1719 ? 157.369 163.527 151.292 1.00 0.00 ? 1719 MET A CA 2  
ATOM 2440   C CA . LEU A 1 1720 ? 160.228 163.660 153.890 1.00 0.00 ? 1720 LEU A CA 2  
ATOM 2441   C CA . SER A 1 1721 ? 163.171 166.011 153.597 1.00 0.00 ? 1721 SER A CA 2  
ATOM 2442   C CA . GLY A 1 1722 ? 165.118 163.039 155.129 1.00 0.00 ? 1722 GLY A CA 2  
ATOM 2443   C CA . ARG A 1 1723 ? 165.888 161.088 151.999 1.00 0.00 ? 1723 ARG A CA 2  
ATOM 2444   C CA . GLU A 1 1724 ? 168.522 158.327 152.126 1.00 0.00 ? 1724 GLU A CA 2  
ATOM 2445   C CA . ARG A 1 1725 ? 168.165 156.600 148.755 1.00 0.00 ? 1725 ARG A CA 2  
ATOM 2446   C CA . ALA A 1 1726 ? 168.446 158.611 145.514 1.00 0.00 ? 1726 ALA A CA 2  
ATOM 2447   C CA . LEU A 1 1727 ? 167.067 155.830 143.290 1.00 0.00 ? 1727 LEU A CA 2  
ATOM 2448   C CA . ARG A 1 1728 ? 163.696 154.763 144.725 1.00 0.00 ? 1728 ARG A CA 2  
ATOM 2449   C CA . PRO A 1 1729 ? 161.778 158.124 145.015 1.00 0.00 ? 1729 PRO A CA 2  
ATOM 2450   C CA . ASN A 1 1730 ? 162.580 161.001 142.460 1.00 0.00 ? 1730 ASN A CA 2  
ATOM 2451   C CA . ARG A 1 1731 ? 160.102 160.579 139.585 1.00 0.00 ? 1731 ARG A CA 2  
ATOM 2452   C CA . MET A 1 1732 ? 160.515 156.877 139.938 1.00 0.00 ? 1732 MET A CA 2  
ATOM 2453   C CA . TYR A 1 1733 ? 157.274 155.819 138.589 1.00 0.00 ? 1733 TYR A CA 2  
ATOM 2454   C CA . TRP A 1 1734 ? 156.660 153.664 135.600 1.00 0.00 ? 1734 TRP A CA 2  
ATOM 2455   C CA . ARG A 1 1735 ? 153.781 151.933 133.802 1.00 0.00 ? 1735 ARG A CA 2  
ATOM 2456   C CA . GLN A 1 1736 ? 153.822 148.952 136.226 1.00 0.00 ? 1736 GLN A CA 2  
ATOM 2457   C CA . GLY A 1 1737 ? 154.771 150.655 139.528 1.00 0.00 ? 1737 GLY A CA 2  
ATOM 2458   C CA . ILE A 1 1738 ? 156.024 153.415 141.794 1.00 0.00 ? 1738 ILE A CA 2  
ATOM 2459   C CA . TYR A 1 1739 ? 158.332 154.105 144.743 1.00 0.00 ? 1739 TYR A CA 2  
ATOM 2460   C CA . LEU A 1 1740 ? 156.744 155.907 147.643 1.00 0.00 ? 1740 LEU A CA 2  
ATOM 2461   C CA . ASN A 1 1741 ? 158.392 157.744 150.566 1.00 0.00 ? 1741 ASN A CA 2  
ATOM 2462   C CA . TRP A 1 1742 ? 156.529 159.401 153.475 1.00 0.00 ? 1742 TRP A CA 2  
ATOM 2463   C CA . SER A 1 1743 ? 157.319 161.516 156.531 1.00 0.00 ? 1743 SER A CA 2  
ATOM 2464   C CA . PRO A 1 1744 ? 158.238 160.395 159.219 1.00 0.00 ? 1744 PRO A CA 2  
ATOM 2465   C CA . GLU A 1 1745 ? 160.066 158.000 159.671 1.00 0.00 ? 1745 GLU A CA 2  
ATOM 2466   C CA . ALA A 1 1746 ? 161.364 157.894 156.024 1.00 0.00 ? 1746 ALA A CA 2  
ATOM 2467   C CA . TYR A 1 1747 ? 159.878 154.598 155.079 1.00 0.00 ? 1747 TYR A CA 2  
ATOM 2468   C CA . CYS A 1 1748 ? 160.328 153.608 151.392 1.00 0.00 ? 1748 CYS A CA 2  
ATOM 2469   C CA . LEU A 1 1749 ? 157.628 151.519 149.650 1.00 0.00 ? 1749 LEU A CA 2  
ATOM 2470   C CA . VAL A 1 1750 ? 157.747 149.933 146.202 1.00 0.00 ? 1750 VAL A CA 2  
ATOM 2471   C CA . GLY A 1 1751 ? 154.463 149.063 144.610 1.00 0.00 ? 1751 GLY A CA 2  
ATOM 2472   C CA . SER A 1 1752 ? 154.722 146.881 141.501 1.00 0.00 ? 1752 SER A CA 2  
ATOM 2473   C CA . GLU A 1 1753 ? 151.685 145.049 140.076 1.00 0.00 ? 1753 GLU A CA 2  
ATOM 2474   C CA . VAL A 1 1754 ? 150.016 143.658 143.123 1.00 0.00 ? 1754 VAL A CA 2  
ATOM 2475   C CA . LEU A 1 1755 ? 153.298 143.480 145.066 1.00 0.00 ? 1755 LEU A CA 2  
ATOM 2476   C CA . ASP A 1 1756 ? 154.003 145.941 147.891 1.00 0.00 ? 1756 ASP A CA 2  
ATOM 2477   C CA . ASN A 1 1757 ? 157.544 145.756 149.396 1.00 0.00 ? 1757 ASN A CA 2  
ATOM 2478   C CA . HIS A 1 1758 ? 158.520 148.012 152.312 1.00 0.00 ? 1758 HIS A CA 2  
ATOM 2479   C CA . PRO A 1 1759 ? 161.834 148.917 154.264 1.00 0.00 ? 1759 PRO A CA 2  
ATOM 2480   C CA . GLU A 1 1760 ? 161.766 150.875 157.682 1.00 0.00 ? 1760 GLU A CA 2  
ATOM 2481   C CA . SER A 1 1761 ? 160.547 150.249 161.278 1.00 0.00 ? 1761 SER A CA 2  
ATOM 2482   C CA . PHE A 1 1762 ? 157.139 151.994 160.593 1.00 0.00 ? 1762 PHE A CA 2  
ATOM 2483   C CA . LEU A 1 1763 ? 156.293 149.326 158.031 1.00 0.00 ? 1763 LEU A CA 2  
ATOM 2484   C CA . LYS A 1 1764 ? 153.071 148.140 159.390 1.00 0.00 ? 1764 LYS A CA 2  
ATOM 2485   C CA . ILE A 1 1765 ? 151.258 151.541 159.424 1.00 0.00 ? 1765 ILE A CA 2  
ATOM 2486   C CA . THR A 1 1766 ? 152.435 152.397 155.896 1.00 0.00 ? 1766 THR A CA 2  
ATOM 2487   C CA . VAL A 1 1767 ? 151.103 149.230 154.341 1.00 0.00 ? 1767 VAL A CA 2  
ATOM 2488   C CA . PRO A 1 1768 ? 147.355 149.908 155.417 1.00 0.00 ? 1768 PRO A CA 2  
ATOM 2489   C CA . SER A 1 1769 ? 147.391 153.368 153.991 1.00 0.00 ? 1769 SER A CA 2  
ATOM 2490   C CA . CYS A 1 1770 ? 148.664 151.911 150.670 1.00 0.00 ? 1770 CYS A CA 2  
ATOM 2491   C CA . ARG A 1 1771 ? 146.410 148.804 151.132 1.00 0.00 ? 1771 ARG A CA 2  
ATOM 2492   C CA . LYS A 1 1772 ? 143.405 151.040 151.865 1.00 0.00 ? 1772 LYS A CA 2  
ATOM 2493   C CA . GLY A 1 1773 ? 144.032 153.197 148.753 1.00 0.00 ? 1773 GLY A CA 2  
ATOM 2494   C CA . CYS A 1 1774 ? 144.244 150.034 146.644 1.00 0.00 ? 1774 CYS A CA 2  
ATOM 2495   C CA . ILE A 1 1775 ? 141.031 148.623 148.219 1.00 0.00 ? 1775 ILE A CA 2  
ATOM 2496   C CA . LEU A 1 1776 ? 139.270 151.982 147.541 1.00 0.00 ? 1776 LEU A CA 2  
ATOM 2497   C CA . LEU A 1 1777 ? 140.139 151.717 143.826 1.00 0.00 ? 1777 LEU A CA 2  
ATOM 2498   C CA . GLY A 1 1778 ? 139.075 148.056 143.757 1.00 0.00 ? 1778 GLY A CA 2  
ATOM 2499   C CA . GLN A 1 1779 ? 135.584 149.021 144.997 1.00 0.00 ? 1779 GLN A CA 2  
ATOM 2500   C CA . VAL A 1 1780 ? 134.952 150.987 141.730 1.00 0.00 ? 1780 VAL A CA 2  
ATOM 2501   C CA . VAL A 1 1781 ? 134.953 147.615 139.897 1.00 0.00 ? 1781 VAL A CA 2  
ATOM 2502   C CA . ASP A 1 1782 ? 131.977 145.260 140.506 1.00 0.00 ? 1782 ASP A CA 2  
ATOM 2503   C CA . HIS A 1 1783 ? 132.743 141.534 141.192 1.00 0.00 ? 1783 HIS A CA 2  
ATOM 2504   C CA . ILE A 1 1784 ? 136.565 141.976 141.559 1.00 0.00 ? 1784 ILE A CA 2  
ATOM 2505   C CA . ASP A 1 1785 ? 138.145 139.107 143.564 1.00 0.00 ? 1785 ASP A CA 2  
ATOM 2506   C CA . SER A 1 1786 ? 141.389 139.858 145.457 1.00 0.00 ? 1786 SER A CA 2  
ATOM 2507   C CA . LEU A 1 1787 ? 143.319 137.210 147.407 1.00 0.00 ? 1787 LEU A CA 2  
ATOM 2508   C CA . MET A 1 1788 ? 146.027 138.519 149.717 1.00 0.00 ? 1788 MET A CA 2  
ATOM 2509   C CA . GLU A 1 1789 ? 149.322 136.679 150.236 1.00 0.00 ? 1789 GLU A CA 2  
ATOM 2510   C CA . GLU A 1 1790 ? 152.435 136.871 152.352 1.00 0.00 ? 1790 GLU A CA 2  
ATOM 2511   C CA . TRP A 1 1791 ? 155.799 135.399 151.416 1.00 0.00 ? 1791 TRP A CA 2  
ATOM 2512   C CA . PHE A 1 1792 ? 157.261 132.787 153.758 1.00 0.00 ? 1792 PHE A CA 2  
ATOM 2513   C CA . PRO A 1 1793 ? 160.351 133.974 155.865 1.00 0.00 ? 1793 PRO A CA 2  
ATOM 2514   C CA . GLY A 1 1794 ? 163.505 132.784 154.090 1.00 0.00 ? 1794 GLY A CA 2  
ATOM 2515   C CA . LEU A 1 1795 ? 161.528 131.678 151.011 1.00 0.00 ? 1795 LEU A CA 2  
ATOM 2516   C CA . LEU A 1 1796 ? 160.486 134.725 148.927 1.00 0.00 ? 1796 LEU A CA 2  
ATOM 2517   C CA . GLU A 1 1797 ? 158.621 132.726 146.218 1.00 0.00 ? 1797 GLU A CA 2  
ATOM 2518   C CA . ILE A 1 1798 ? 156.593 130.523 148.642 1.00 0.00 ? 1798 ILE A CA 2  
ATOM 2519   C CA . ASP A 1 1799 ? 153.355 132.299 149.547 1.00 0.00 ? 1799 ASP A CA 2  
ATOM 2520   C CA . ILE A 1 1800 ? 150.750 131.740 152.266 1.00 0.00 ? 1800 ILE A CA 2  
ATOM 2521   C CA . CYS A 1 1801 ? 147.249 133.211 152.039 1.00 0.00 ? 1801 CYS A CA 2  
ATOM 2522   C CA . GLY A 1 1802 ? 146.509 135.865 154.746 1.00 0.00 ? 1802 GLY A CA 2  
ATOM 2523   C CA . GLU A 1 1803 ? 143.010 134.389 155.097 1.00 0.00 ? 1803 GLU A CA 2  
ATOM 2524   C CA . GLY A 1 1804 ? 144.752 131.058 155.901 1.00 0.00 ? 1804 GLY A CA 2  
ATOM 2525   C CA . GLU A 1 1805 ? 146.772 132.545 158.791 1.00 0.00 ? 1805 GLU A CA 2  
ATOM 2526   C CA . THR A 1 1806 ? 143.749 134.430 160.256 1.00 0.00 ? 1806 THR A CA 2  
ATOM 2527   C CA . LEU A 1 1807 ? 141.759 131.160 160.087 1.00 0.00 ? 1807 LEU A CA 2  
ATOM 2528   C CA . LEU A 1 1808 ? 144.612 129.312 161.838 1.00 0.00 ? 1808 LEU A CA 2  
ATOM 2529   C CA . LYS A 1 1809 ? 144.502 131.968 164.644 1.00 0.00 ? 1809 LYS A CA 2  
ATOM 2530   C CA . LYS A 1 1810 ? 140.700 131.610 165.012 1.00 0.00 ? 1810 LYS A CA 2  
ATOM 2531   C CA . TRP A 1 1811 ? 141.254 127.832 165.258 1.00 0.00 ? 1811 TRP A CA 2  
ATOM 2532   C CA . ALA A 1 1812 ? 143.762 128.503 168.087 1.00 0.00 ? 1812 ALA A CA 2  
ATOM 2533   C CA . LEU A 1 1813 ? 146.772 127.183 166.128 1.00 0.00 ? 1813 LEU A CA 2  
ATOM 2534   C CA . TYR A 1 1814 ? 150.150 128.922 166.041 1.00 0.00 ? 1814 TYR A CA 2  
ATOM 2535   C CA . SER A 1 1815 ? 151.885 126.550 163.601 1.00 0.00 ? 1815 SER A CA 2  
ATOM 2536   C CA . PHE A 1 1816 ? 151.687 126.911 159.875 1.00 0.00 ? 1816 PHE A CA 2  
ATOM 2537   C CA . ASN A 1 1817 ? 153.348 123.772 158.469 1.00 0.00 ? 1817 ASN A CA 2  
ATOM 2538   C CA . ASP A 1 1818 ? 154.934 123.852 155.037 1.00 0.00 ? 1818 ASP A CA 2  
ATOM 2539   C CA . GLY A 1 1819 ? 154.889 120.217 153.832 1.00 0.00 ? 1819 GLY A CA 2  
ATOM 2540   C CA . GLU A 1 1820 ? 156.846 120.718 150.581 1.00 0.00 ? 1820 GLU A CA 2  
ATOM 2541   C CA . GLU A 1 1821 ? 159.590 122.739 152.335 1.00 0.00 ? 1821 GLU A CA 2  
ATOM 2542   C CA . HIS A 1 1822 ? 159.421 120.586 155.521 1.00 0.00 ? 1822 HIS A CA 2  
ATOM 2543   C CA . GLN A 1 1823 ? 159.636 123.696 157.761 1.00 0.00 ? 1823 GLN A CA 2  
ATOM 2544   C CA . LYS A 1 1824 ? 157.125 125.091 160.297 1.00 0.00 ? 1824 LYS A CA 2  
ATOM 2545   C CA . ILE A 1 1825 ? 156.472 128.777 160.917 1.00 0.00 ? 1825 ILE A CA 2  
ATOM 2546   C CA . LEU A 1 1826 ? 154.928 130.862 163.635 1.00 0.00 ? 1826 LEU A CA 2  
ATOM 2547   C CA . LEU A 1 1827 ? 151.553 132.125 162.464 1.00 0.00 ? 1827 LEU A CA 2  
ATOM 2548   C CA . ASP A 1 1828 ? 151.454 135.004 164.936 1.00 0.00 ? 1828 ASP A CA 2  
ATOM 2549   C CA . ASP A 1 1829 ? 155.039 136.154 164.210 1.00 0.00 ? 1829 ASP A CA 2  
ATOM 2550   C CA . LEU A 1 1830 ? 154.440 136.529 160.437 1.00 0.00 ? 1830 LEU A CA 2  
ATOM 2551   C CA . MET A 1 1831 ? 150.901 137.929 160.989 1.00 0.00 ? 1831 MET A CA 2  
ATOM 2552   C CA . LYS A 1 1832 ? 151.945 140.625 163.542 1.00 0.00 ? 1832 LYS A CA 2  
ATOM 2553   C CA . LYS A 1 1833 ? 154.791 141.916 161.305 1.00 0.00 ? 1833 LYS A CA 2  
ATOM 2554   C CA . ALA A 1 1834 ? 152.149 143.889 159.415 1.00 0.00 ? 1834 ALA A CA 2  
ATOM 2555   C CA . GLU A 1 1835 ? 149.239 146.126 160.620 1.00 0.00 ? 1835 GLU A CA 2  
ATOM 2556   C CA . GLU A 1 1836 ? 146.935 143.153 161.232 1.00 0.00 ? 1836 GLU A CA 2  
ATOM 2557   C CA . GLY A 1 1837 ? 147.917 142.759 164.907 1.00 0.00 ? 1837 GLY A CA 2  
ATOM 2558   C CA . PHE A 1 1883 ? 174.233 143.118 186.461 1.00 0.00 ? 1883 PHE A CA 2  
ATOM 2559   C CA . LEU A 1 1884 ? 170.436 142.445 186.315 1.00 0.00 ? 1884 LEU A CA 2  
ATOM 2560   C CA . LEU A 1 1885 ? 167.887 145.145 187.413 1.00 0.00 ? 1885 LEU A CA 2  
ATOM 2561   C CA . GLY A 1 1886 ? 164.816 143.851 185.533 1.00 0.00 ? 1886 GLY A CA 2  
ATOM 2562   C CA . ASP A 1 1887 ? 161.290 144.988 186.352 1.00 0.00 ? 1887 ASP A CA 2  
ATOM 2563   C CA . GLY A 1 1888 ? 160.390 144.624 182.598 1.00 0.00 ? 1888 GLY A CA 2  
ATOM 2564   C CA . SER A 1 1889 ? 157.074 144.346 180.699 1.00 0.00 ? 1889 SER A CA 2  
ATOM 2565   C CA . PHE A 1 1890 ? 158.230 141.663 178.238 1.00 0.00 ? 1890 PHE A CA 2  
ATOM 2566   C CA . GLY A 1 1891 ? 161.604 140.586 179.642 1.00 0.00 ? 1891 GLY A CA 2  
ATOM 2567   C CA . SER A 1 1892 ? 164.644 141.280 181.797 1.00 0.00 ? 1892 SER A CA 2  
ATOM 2568   C CA . VAL A 1 1893 ? 166.500 144.622 182.087 1.00 0.00 ? 1893 VAL A CA 2  
ATOM 2569   C CA . TYR A 1 1894 ? 170.309 144.569 182.518 1.00 0.00 ? 1894 TYR A CA 2  
ATOM 2570   C CA . ARG A 1 1895 ? 172.924 147.197 183.318 1.00 0.00 ? 1895 ARG A CA 2  
ATOM 2571   C CA . ALA A 1 1896 ? 176.081 147.037 181.206 1.00 0.00 ? 1896 ALA A CA 2  
ATOM 2572   C CA . ALA A 1 1897 ? 178.449 149.190 179.127 1.00 0.00 ? 1897 ALA A CA 2  
ATOM 2573   C CA . TYR A 1 1898 ? 179.355 149.690 175.426 1.00 0.00 ? 1898 TYR A CA 2  
ATOM 2574   C CA . GLU A 1 1899 ? 182.960 148.397 175.023 1.00 0.00 ? 1899 GLU A CA 2  
ATOM 2575   C CA . GLY A 1 1900 ? 184.040 151.246 172.662 1.00 0.00 ? 1900 GLY A CA 2  
ATOM 2576   C CA . GLU A 1 1901 ? 182.883 154.274 174.743 1.00 0.00 ? 1901 GLU A CA 2  
ATOM 2577   C CA . GLU A 1 1902 ? 182.531 152.976 178.341 1.00 0.00 ? 1902 GLU A CA 2  
ATOM 2578   C CA . VAL A 1 1903 ? 178.987 154.571 178.082 1.00 0.00 ? 1903 VAL A CA 2  
ATOM 2579   C CA . ALA A 1 1904 ? 176.710 153.017 180.692 1.00 0.00 ? 1904 ALA A CA 2  
ATOM 2580   C CA . VAL A 1 1905 ? 173.843 151.217 179.105 1.00 0.00 ? 1905 VAL A CA 2  
ATOM 2581   C CA . LYS A 1 1906 ? 170.472 149.618 179.900 1.00 0.00 ? 1906 LYS A CA 2  
ATOM 2582   C CA . ILE A 1 1907 ? 169.569 146.419 177.976 1.00 0.00 ? 1907 ILE A CA 2  
ATOM 2583   C CA . PHE A 1 1908 ? 165.973 145.217 177.671 1.00 0.00 ? 1908 PHE A CA 2  
ATOM 2584   C CA . ASN A 1 1909 ? 165.585 141.646 176.317 1.00 0.00 ? 1909 ASN A CA 2  
ATOM 2585   C CA . LYS A 1 1910 ? 163.295 138.664 175.476 1.00 0.00 ? 1910 LYS A CA 2  
ATOM 2586   C CA . HIS A 1 1911 ? 161.015 140.897 173.602 1.00 0.00 ? 1911 HIS A CA 2  
ATOM 2587   C CA . THR A 1 1912 ? 161.802 139.694 170.046 1.00 0.00 ? 1912 THR A CA 2  
ATOM 2588   C CA . SER A 1 1913 ? 158.469 138.380 168.838 1.00 0.00 ? 1913 SER A CA 2  
ATOM 2589   C CA . LEU A 1 1914 ? 156.246 140.970 170.496 1.00 0.00 ? 1914 LEU A CA 2  
ATOM 2590   C CA . ARG A 1 1915 ? 154.177 143.643 168.774 1.00 0.00 ? 1915 ARG A CA 2  
ATOM 2591   C CA . LEU A 1 1916 ? 154.883 146.059 171.696 1.00 0.00 ? 1916 LEU A CA 2  
ATOM 2592   C CA . LEU A 1 1917 ? 158.741 145.740 171.311 1.00 0.00 ? 1917 LEU A CA 2  
ATOM 2593   C CA . ARG A 1 1918 ? 158.441 146.275 167.619 1.00 0.00 ? 1918 ARG A CA 2  
ATOM 2594   C CA . GLN A 1 1919 ? 156.466 149.461 168.145 1.00 0.00 ? 1919 GLN A CA 2  
ATOM 2595   C CA . GLU A 1 1920 ? 158.951 150.634 170.813 1.00 0.00 ? 1920 GLU A CA 2  
ATOM 2596   C CA . LEU A 1 1921 ? 161.924 150.052 168.434 1.00 0.00 ? 1921 LEU A CA 2  
ATOM 2597   C CA . VAL A 1 1922 ? 160.102 151.762 165.500 1.00 0.00 ? 1922 VAL A CA 2  
ATOM 2598   C CA . VAL A 1 1923 ? 159.081 154.831 167.607 1.00 0.00 ? 1923 VAL A CA 2  
ATOM 2599   C CA . LEU A 1 1924 ? 162.525 155.236 169.259 1.00 0.00 ? 1924 LEU A CA 2  
ATOM 2600   C CA . CYS A 1 1925 ? 164.492 154.904 165.953 1.00 0.00 ? 1925 CYS A CA 2  
ATOM 2601   C CA . HIS A 1 1926 ? 163.515 158.440 164.802 1.00 0.00 ? 1926 HIS A CA 2  
ATOM 2602   C CA . LEU A 1 1927 ? 163.733 160.184 168.229 1.00 0.00 ? 1927 LEU A CA 2  
ATOM 2603   C CA . HIS A 1 1928 ? 166.942 162.062 169.113 1.00 0.00 ? 1928 HIS A CA 2  
ATOM 2604   C CA . HIS A 1 1929 ? 166.431 164.707 171.838 1.00 0.00 ? 1929 HIS A CA 2  
ATOM 2605   C CA . PRO A 1 1930 ? 168.211 165.296 175.208 1.00 0.00 ? 1930 PRO A CA 2  
ATOM 2606   C CA . SER A 1 1931 ? 165.043 164.913 177.314 1.00 0.00 ? 1931 SER A CA 2  
ATOM 2607   C CA . LEU A 1 1932 ? 164.036 161.595 175.695 1.00 0.00 ? 1932 LEU A CA 2  
ATOM 2608   C CA . ILE A 1 1933 ? 165.696 158.259 176.582 1.00 0.00 ? 1933 ILE A CA 2  
ATOM 2609   C CA . SER A 1 1934 ? 168.000 157.511 173.636 1.00 0.00 ? 1934 SER A CA 2  
ATOM 2610   C CA . LEU A 1 1935 ? 168.060 154.187 171.827 1.00 0.00 ? 1935 LEU A CA 2  
ATOM 2611   C CA . LEU A 1 1936 ? 171.684 153.263 171.063 1.00 0.00 ? 1936 LEU A CA 2  
ATOM 2612   C CA . ALA A 1 1937 ? 171.288 150.006 169.144 1.00 0.00 ? 1937 ALA A CA 2  
ATOM 2613   C CA . ALA A 1 1938 ? 169.502 146.681 168.660 1.00 0.00 ? 1938 ALA A CA 2  
ATOM 2614   C CA . GLY A 1 1939 ? 170.833 143.184 169.514 1.00 0.00 ? 1939 GLY A CA 2  
ATOM 2615   C CA . ILE A 1 1940 ? 169.682 139.717 168.358 1.00 0.00 ? 1940 ILE A CA 2  
ATOM 2616   C CA . ARG A 1 1941 ? 169.540 136.224 169.961 1.00 0.00 ? 1941 ARG A CA 2  
ATOM 2617   C CA . PRO A 1 1942 ? 167.593 137.246 172.014 1.00 0.00 ? 1942 PRO A CA 2  
ATOM 2618   C CA . ARG A 1 1943 ? 166.352 140.573 170.612 1.00 0.00 ? 1943 ARG A CA 2  
ATOM 2619   C CA . MET A 1 1944 ? 167.596 143.481 172.757 1.00 0.00 ? 1944 MET A CA 2  
ATOM 2620   C CA . LEU A 1 1945 ? 167.019 147.214 172.868 1.00 0.00 ? 1945 LEU A CA 2  
ATOM 2621   C CA . VAL A 1 1946 ? 170.152 148.905 174.148 1.00 0.00 ? 1946 VAL A CA 2  
ATOM 2622   C CA . MET A 1 1947 ? 169.167 152.236 175.768 1.00 0.00 ? 1947 MET A CA 2  
ATOM 2623   C CA . GLU A 1 1948 ? 171.136 154.980 177.590 1.00 0.00 ? 1948 GLU A CA 2  
ATOM 2624   C CA . LEU A 1 1949 ? 171.347 154.300 181.350 1.00 0.00 ? 1949 LEU A CA 2  
ATOM 2625   C CA . ALA A 1 1950 ? 169.591 156.981 183.413 1.00 0.00 ? 1950 ALA A CA 2  
ATOM 2626   C CA . SER A 1 1951 ? 171.205 156.898 186.840 1.00 0.00 ? 1951 SER A CA 2  
ATOM 2627   C CA . LYS A 1 1952 ? 168.925 158.469 189.492 1.00 0.00 ? 1952 LYS A CA 2  
ATOM 2628   C CA . GLY A 1 1953 ? 165.816 156.282 189.088 1.00 0.00 ? 1953 GLY A CA 2  
ATOM 2629   C CA . SER A 1 1954 ? 162.314 157.512 188.236 1.00 0.00 ? 1954 SER A CA 2  
ATOM 2630   C CA . LEU A 1 1955 ? 160.206 160.528 189.260 1.00 0.00 ? 1955 LEU A CA 2  
ATOM 2631   C CA . ASP A 1 1956 ? 157.484 158.407 190.955 1.00 0.00 ? 1956 ASP A CA 2  
ATOM 2632   C CA . ARG A 1 1957 ? 159.887 156.706 193.424 1.00 0.00 ? 1957 ARG A CA 2  
ATOM 2633   C CA . LEU A 1 1958 ? 161.721 159.961 194.186 1.00 0.00 ? 1958 LEU A CA 2  
ATOM 2634   C CA . LEU A 1 1959 ? 158.462 161.824 194.979 1.00 0.00 ? 1959 LEU A CA 2  
ATOM 2635   C CA . GLN A 1 1960 ? 157.636 159.074 197.551 1.00 0.00 ? 1960 GLN A CA 2  
ATOM 2636   C CA . GLN A 1 1961 ? 160.546 160.444 199.696 1.00 0.00 ? 1961 GLN A CA 2  
ATOM 2637   C CA . ASP A 1 1962 ? 158.440 163.017 201.689 1.00 0.00 ? 1962 ASP A CA 2  
ATOM 2638   C CA . LYS A 1 1963 ? 161.292 163.648 204.209 1.00 0.00 ? 1963 LYS A CA 2  
ATOM 2639   C CA . ALA A 1 1964 ? 163.543 164.998 201.419 1.00 0.00 ? 1964 ALA A CA 2  
ATOM 2640   C CA . SER A 1 1965 ? 161.334 167.311 199.345 1.00 0.00 ? 1965 SER A CA 2  
ATOM 2641   C CA . LEU A 1 1966 ? 162.594 168.438 195.925 1.00 0.00 ? 1966 LEU A CA 2  
ATOM 2642   C CA . THR A 1 1967 ? 163.637 172.098 196.057 1.00 0.00 ? 1967 THR A CA 2  
ATOM 2643   C CA . ARG A 1 1968 ? 161.578 174.529 193.964 1.00 0.00 ? 1968 ARG A CA 2  
ATOM 2644   C CA . THR A 1 1969 ? 164.362 175.439 191.455 1.00 0.00 ? 1969 THR A CA 2  
ATOM 2645   C CA . LEU A 1 1970 ? 164.808 171.750 190.700 1.00 0.00 ? 1970 LEU A CA 2  
ATOM 2646   C CA . GLN A 1 1971 ? 161.002 171.171 190.398 1.00 0.00 ? 1971 GLN A CA 2  
ATOM 2647   C CA . HIS A 1 1972 ? 161.002 173.902 187.699 1.00 0.00 ? 1972 HIS A CA 2  
ATOM 2648   C CA . ARG A 1 1973 ? 163.930 172.182 185.905 1.00 0.00 ? 1973 ARG A CA 2  
ATOM 2649   C CA . ILE A 1 1974 ? 161.977 168.849 185.944 1.00 0.00 ? 1974 ILE A CA 2  
ATOM 2650   C CA . ALA A 1 1975 ? 158.799 170.549 184.605 1.00 0.00 ? 1975 ALA A CA 2  
ATOM 2651   C CA . LEU A 1 1976 ? 160.667 172.246 181.707 1.00 0.00 ? 1976 LEU A CA 2  
ATOM 2652   C CA . HIS A 1 1977 ? 162.686 169.114 180.736 1.00 0.00 ? 1977 HIS A CA 2  
ATOM 2653   C CA . VAL A 1 1978 ? 159.558 166.971 180.437 1.00 0.00 ? 1978 VAL A CA 2  
ATOM 2654   C CA . ALA A 1 1979 ? 157.871 169.845 178.527 1.00 0.00 ? 1979 ALA A CA 2  
ATOM 2655   C CA . ASP A 1 1980 ? 160.773 170.071 176.002 1.00 0.00 ? 1980 ASP A CA 2  
ATOM 2656   C CA . GLY A 1 1981 ? 160.688 166.279 175.412 1.00 0.00 ? 1981 GLY A CA 2  
ATOM 2657   C CA . LEU A 1 1982 ? 156.924 166.440 174.779 1.00 0.00 ? 1982 LEU A CA 2  
ATOM 2658   C CA . ARG A 1 1983 ? 157.500 169.592 172.631 1.00 0.00 ? 1983 ARG A CA 2  
ATOM 2659   C CA . TYR A 1 1984 ? 160.060 167.692 170.492 1.00 0.00 ? 1984 TYR A CA 2  
ATOM 2660   C CA . LEU A 1 1985 ? 157.408 164.976 170.349 1.00 0.00 ? 1985 LEU A CA 2  
ATOM 2661   C CA . HIS A 1 1986 ? 154.814 167.496 169.143 1.00 0.00 ? 1986 HIS A CA 2  
ATOM 2662   C CA . SER A 1 1987 ? 157.159 168.261 166.175 1.00 0.00 ? 1987 SER A CA 2  
ATOM 2663   C CA . ALA A 1 1988 ? 157.327 164.575 165.159 1.00 0.00 ? 1988 ALA A CA 2  
ATOM 2664   C CA . MET A 1 1989 ? 153.504 164.003 165.598 1.00 0.00 ? 1989 MET A CA 2  
ATOM 2665   C CA . ILE A 1 1990 ? 153.900 161.068 168.034 1.00 0.00 ? 1990 ILE A CA 2  
ATOM 2666   C CA . ILE A 1 1991 ? 151.443 160.214 170.886 1.00 0.00 ? 1991 ILE A CA 2  
ATOM 2667   C CA . TYR A 1 1992 ? 153.060 158.556 173.949 1.00 0.00 ? 1992 TYR A CA 2  
ATOM 2668   C CA . ARG A 1 1993 ? 149.873 157.456 175.830 1.00 0.00 ? 1993 ARG A CA 2  
ATOM 2669   C CA . ASP A 1 1994 ? 151.623 156.246 179.028 1.00 0.00 ? 1994 ASP A CA 2  
ATOM 2670   C CA . LEU A 1 1995 ? 152.861 159.573 180.447 1.00 0.00 ? 1995 LEU A CA 2  
ATOM 2671   C CA . LYS A 1 1996 ? 152.958 159.099 184.238 1.00 0.00 ? 1996 LYS A CA 2  
ATOM 2672   C CA . PRO A 1 1997 ? 155.794 159.703 186.767 1.00 0.00 ? 1997 PRO A CA 2  
ATOM 2673   C CA . HIS A 1 1998 ? 157.092 156.091 186.681 1.00 0.00 ? 1998 HIS A CA 2  
ATOM 2674   C CA . ASN A 1 1999 ? 157.990 156.697 183.008 1.00 0.00 ? 1999 ASN A CA 2  
ATOM 2675   C CA . VAL A 1 2000 ? 159.925 159.907 183.770 1.00 0.00 ? 2000 VAL A CA 2  
ATOM 2676   C CA . LEU A 1 2001 ? 163.564 158.910 184.338 1.00 0.00 ? 2001 LEU A CA 2  
ATOM 2677   C CA . LEU A 1 2002 ? 165.888 161.110 186.307 1.00 0.00 ? 2002 LEU A CA 2  
ATOM 2678   C CA . PHE A 1 2003 ? 169.356 161.825 184.960 1.00 0.00 ? 2003 PHE A CA 2  
ATOM 2679   C CA . THR A 1 2004 ? 170.432 164.351 187.593 1.00 0.00 ? 2004 THR A CA 2  
ATOM 2680   C CA . LEU A 1 2005 ? 168.798 166.324 190.499 1.00 0.00 ? 2005 LEU A CA 2  
ATOM 2681   C CA . TYR A 1 2006 ? 171.420 169.133 190.642 1.00 0.00 ? 2006 TYR A CA 2  
ATOM 2682   C CA . PRO A 1 2007 ? 169.621 172.291 189.338 1.00 0.00 ? 2007 PRO A CA 2  
ATOM 2683   C CA . ASN A 1 2008 ? 172.572 173.346 187.090 1.00 0.00 ? 2008 ASN A CA 2  
ATOM 2684   C CA . ALA A 1 2009 ? 172.811 169.939 185.326 1.00 0.00 ? 2009 ALA A CA 2  
ATOM 2685   C CA . ALA A 1 2010 ? 172.588 169.793 181.519 1.00 0.00 ? 2010 ALA A CA 2  
ATOM 2686   C CA . ILE A 1 2011 ? 169.722 167.268 181.770 1.00 0.00 ? 2011 ILE A CA 2  
ATOM 2687   C CA . ILE A 1 2012 ? 167.533 166.461 184.825 1.00 0.00 ? 2012 ILE A CA 2  
ATOM 2688   C CA . ALA A 1 2013 ? 164.661 164.441 183.416 1.00 0.00 ? 2013 ALA A CA 2  
ATOM 2689   C CA . LYS A 1 2014 ? 164.024 162.270 180.395 1.00 0.00 ? 2014 LYS A CA 2  
ATOM 2690   C CA . ILE A 1 2015 ? 160.780 160.746 179.071 1.00 0.00 ? 2015 ILE A CA 2  
ATOM 2691   C CA . ALA A 1 2016 ? 160.907 156.921 178.767 1.00 0.00 ? 2016 ALA A CA 2  
ATOM 2692   C CA . ASP A 1 2017 ? 158.847 153.786 178.026 1.00 0.00 ? 2017 ASP A CA 2  
ATOM 2693   C CA . TYR A 1 2018 ? 157.273 154.354 174.629 1.00 0.00 ? 2018 TYR A CA 2  
ATOM 2694   C CA . GLY A 1 2019 ? 155.892 150.814 174.265 1.00 0.00 ? 2019 GLY A CA 2  
ATOM 2695   C CA . THR A 1 2020 ? 152.323 151.969 173.747 1.00 0.00 ? 2020 THR A CA 2  
ATOM 2696   C CA . ALA A 1 2021 ? 153.081 155.005 171.493 1.00 0.00 ? 2021 ALA A CA 2  
ATOM 2697   C CA . GLN A 1 2022 ? 151.391 155.964 168.167 1.00 0.00 ? 2022 GLN A CA 2  
ATOM 2698   C CA . TYR A 1 2023 ? 152.612 157.958 165.182 1.00 0.00 ? 2023 TYR A CA 2  
ATOM 2699   C CA . CYS A 1 2024 ? 149.892 158.048 162.546 1.00 0.00 ? 2024 CYS A CA 2  
ATOM 2700   C CA . CYS A 1 2025 ? 148.539 160.385 159.835 1.00 0.00 ? 2025 CYS A CA 2  
ATOM 2701   C CA . ARG A 1 2026 ? 145.065 159.068 160.702 1.00 0.00 ? 2026 ARG A CA 2  
ATOM 2702   C CA . MET A 1 2027 ? 143.004 159.402 163.871 1.00 0.00 ? 2027 MET A CA 2  
ATOM 2703   C CA . GLY A 1 2028 ? 144.346 157.519 166.947 1.00 0.00 ? 2028 GLY A CA 2  
ATOM 2704   C CA . ILE A 1 2029 ? 142.151 155.366 169.240 1.00 0.00 ? 2029 ILE A CA 2  
ATOM 2705   C CA . LYS A 1 2030 ? 142.611 153.204 172.437 1.00 0.00 ? 2030 LYS A CA 2  
ATOM 2706   C CA . THR A 1 2031 ? 140.780 151.441 175.420 1.00 0.00 ? 2031 THR A CA 2  
ATOM 2707   C CA . SER A 1 2032 ? 143.591 149.613 177.106 1.00 0.00 ? 2032 SER A CA 2  
ATOM 2708   C CA . GLU A 1 2033 ? 145.621 152.358 178.801 1.00 0.00 ? 2033 GLU A CA 2  
ATOM 2709   C CA . GLY A 1 2034 ? 143.285 151.710 181.742 1.00 0.00 ? 2034 GLY A CA 2  
ATOM 2710   C CA . THR A 1 2035 ? 145.205 153.828 184.358 1.00 0.00 ? 2035 THR A CA 2  
ATOM 2711   C CA . PRO A 1 2036 ? 142.763 156.757 184.216 1.00 0.00 ? 2036 PRO A CA 2  
ATOM 2712   C CA . GLY A 1 2037 ? 144.189 158.953 187.033 1.00 0.00 ? 2037 GLY A CA 2  
ATOM 2713   C CA . PHE A 1 2038 ? 146.825 160.067 184.495 1.00 0.00 ? 2038 PHE A CA 2  
ATOM 2714   C CA . ARG A 1 2039 ? 144.828 159.667 181.236 1.00 0.00 ? 2039 ARG A CA 2  
ATOM 2715   C CA . ALA A 1 2040 ? 142.650 162.072 179.251 1.00 0.00 ? 2040 ALA A CA 2  
ATOM 2716   C CA . PRO A 1 2041 ? 138.781 161.763 179.488 1.00 0.00 ? 2041 PRO A CA 2  
ATOM 2717   C CA . GLU A 1 2042 ? 138.545 159.926 176.112 1.00 0.00 ? 2042 GLU A CA 2  
ATOM 2718   C CA . VAL A 1 2043 ? 139.224 156.780 178.288 1.00 0.00 ? 2043 VAL A CA 2  
ATOM 2719   C CA . ALA A 1 2044 ? 135.480 156.192 178.169 1.00 0.00 ? 2044 ALA A CA 2  
ATOM 2720   C CA . ARG A 1 2045 ? 135.701 153.378 175.477 1.00 0.00 ? 2045 ARG A CA 2  
ATOM 2721   C CA . GLY A 1 2046 ? 137.358 152.203 172.115 1.00 0.00 ? 2046 GLY A CA 2  
ATOM 2722   C CA . ASN A 1 2047 ? 134.832 153.907 169.944 1.00 0.00 ? 2047 ASN A CA 2  
ATOM 2723   C CA . VAL A 1 2048 ? 136.317 157.447 170.327 1.00 0.00 ? 2048 VAL A CA 2  
ATOM 2724   C CA . ILE A 1 2049 ? 139.263 159.067 168.562 1.00 0.00 ? 2049 ILE A CA 2  
ATOM 2725   C CA . TYR A 1 2050 ? 141.911 161.370 169.963 1.00 0.00 ? 2050 TYR A CA 2  
ATOM 2726   C CA . ASN A 1 2051 ? 145.290 163.065 169.281 1.00 0.00 ? 2051 ASN A CA 2  
ATOM 2727   C CA . GLN A 1 2052 ? 148.561 164.264 170.982 1.00 0.00 ? 2052 GLN A CA 2  
ATOM 2728   C CA . GLN A 1 2053 ? 146.282 166.435 173.123 1.00 0.00 ? 2053 GLN A CA 2  
ATOM 2729   C CA . ALA A 1 2054 ? 145.795 163.267 175.236 1.00 0.00 ? 2054 ALA A CA 2  
ATOM 2730   C CA . ASP A 1 2055 ? 149.521 163.449 176.229 1.00 0.00 ? 2055 ASP A CA 2  
ATOM 2731   C CA . VAL A 1 2056 ? 149.059 167.201 176.985 1.00 0.00 ? 2056 VAL A CA 2  
ATOM 2732   C CA . TYR A 1 2057 ? 146.468 166.112 179.602 1.00 0.00 ? 2057 TYR A CA 2  
ATOM 2733   C CA . SER A 1 2058 ? 148.900 163.460 180.995 1.00 0.00 ? 2058 SER A CA 2  
ATOM 2734   C CA . PHE A 1 2059 ? 151.539 166.250 181.237 1.00 0.00 ? 2059 PHE A CA 2  
ATOM 2735   C CA . GLY A 1 2060 ? 149.189 168.410 183.424 1.00 0.00 ? 2060 GLY A CA 2  
ATOM 2736   C CA . LEU A 1 2061 ? 149.016 165.497 185.868 1.00 0.00 ? 2061 LEU A CA 2  
ATOM 2737   C CA . LEU A 1 2062 ? 152.868 165.265 185.775 1.00 0.00 ? 2062 LEU A CA 2  
ATOM 2738   C CA . LEU A 1 2063 ? 153.039 168.985 186.685 1.00 0.00 ? 2063 LEU A CA 2  
ATOM 2739   C CA . TYR A 1 2064 ? 150.530 168.431 189.547 1.00 0.00 ? 2064 TYR A CA 2  
ATOM 2740   C CA . ASP A 1 2065 ? 152.535 165.448 190.950 1.00 0.00 ? 2065 ASP A CA 2  
ATOM 2741   C CA . ILE A 1 2066 ? 155.857 167.469 190.783 1.00 0.00 ? 2066 ILE A CA 2  
ATOM 2742   C CA . LEU A 1 2067 ? 154.220 170.572 192.364 1.00 0.00 ? 2067 LEU A CA 2  
ATOM 2743   C CA . THR A 1 2068 ? 152.549 168.676 195.206 1.00 0.00 ? 2068 THR A CA 2  
ATOM 2744   C CA . THR A 1 2069 ? 154.641 165.478 195.738 1.00 0.00 ? 2069 THR A CA 2  
ATOM 2745   C CA . GLY A 1 2070 ? 151.234 163.670 195.720 1.00 0.00 ? 2070 GLY A CA 2  
ATOM 2746   C CA . GLY A 1 2071 ? 149.521 161.254 193.291 1.00 0.00 ? 2071 GLY A CA 2  
ATOM 2747   C CA . ARG A 1 2072 ? 146.334 159.183 192.924 1.00 0.00 ? 2072 ARG A CA 2  
ATOM 2748   C CA . ILE A 1 2073 ? 145.315 156.146 190.772 1.00 0.00 ? 2073 ILE A CA 2  
ATOM 2749   C CA . VAL A 1 2074 ? 141.590 155.460 190.499 1.00 0.00 ? 2074 VAL A CA 2  
ATOM 2750   C CA . GLU A 1 2075 ? 139.614 152.669 188.725 1.00 0.00 ? 2075 GLU A CA 2  
ATOM 2751   C CA . GLY A 1 2076 ? 135.842 151.967 188.348 1.00 0.00 ? 2076 GLY A CA 2  
ATOM 2752   C CA . LEU A 1 2077 ? 132.690 153.558 186.882 1.00 0.00 ? 2077 LEU A CA 2  
ATOM 2753   C CA . LYS A 1 2078 ? 131.769 156.532 189.102 1.00 0.00 ? 2078 LYS A CA 2  
ATOM 2754   C CA . PHE A 1 2079 ? 135.364 157.907 188.951 1.00 0.00 ? 2079 PHE A CA 2  
ATOM 2755   C CA . PRO A 1 2080 ? 135.557 157.900 185.044 1.00 0.00 ? 2080 PRO A CA 2  
ATOM 2756   C CA . ASN A 1 2081 ? 132.038 159.467 184.857 1.00 0.00 ? 2081 ASN A CA 2  
ATOM 2757   C CA . GLU A 1 2082 ? 133.197 162.153 187.310 1.00 0.00 ? 2082 GLU A CA 2  
ATOM 2758   C CA . PHE A 1 2083 ? 136.408 162.818 185.336 1.00 0.00 ? 2083 PHE A CA 2  
ATOM 2759   C CA . ASP A 1 2084 ? 134.671 162.741 181.884 1.00 0.00 ? 2084 ASP A CA 2  
ATOM 2760   C CA . GLU A 1 2085 ? 131.262 164.443 182.567 1.00 0.00 ? 2085 GLU A CA 2  
ATOM 2761   C CA . LEU A 1 2086 ? 131.694 166.430 185.851 1.00 0.00 ? 2086 LEU A CA 2  
ATOM 2762   C CA . GLU A 1 2087 ? 135.148 168.017 185.164 1.00 0.00 ? 2087 GLU A CA 2  
ATOM 2763   C CA . ILE A 1 2088 ? 136.827 166.346 188.225 1.00 0.00 ? 2088 ILE A CA 2  
ATOM 2764   C CA . GLN A 1 2089 ? 140.565 166.980 188.292 1.00 0.00 ? 2089 GLN A CA 2  
ATOM 2765   C CA . GLY A 1 2090 ? 143.226 167.160 191.011 1.00 0.00 ? 2090 GLY A CA 2  
ATOM 2766   C CA . LYS A 1 2091 ? 143.012 170.975 191.094 1.00 0.00 ? 2091 LYS A CA 2  
ATOM 2767   C CA . LEU A 1 2092 ? 139.172 171.163 191.192 1.00 0.00 ? 2092 LEU A CA 2  
ATOM 2768   C CA . PRO A 1 2093 ? 138.617 168.709 194.155 1.00 0.00 ? 2093 PRO A CA 2  
ATOM 2769   C CA . ASP A 1 2094 ? 141.296 170.423 196.280 1.00 0.00 ? 2094 ASP A CA 2  
ATOM 2770   C CA . PRO A 1 2095 ? 141.191 174.306 195.765 1.00 0.00 ? 2095 PRO A CA 2  
ATOM 2771   C CA . VAL A 1 2096 ? 142.653 174.805 199.283 1.00 0.00 ? 2096 VAL A CA 2  
ATOM 2772   C CA . LYS A 1 2097 ? 145.618 172.425 198.716 1.00 0.00 ? 2097 LYS A CA 2  
ATOM 2773   C CA . GLU A 1 2098 ? 146.801 174.341 195.669 1.00 0.00 ? 2098 GLU A CA 2  
ATOM 2774   C CA . TYR A 1 2099 ? 145.155 177.890 195.728 1.00 0.00 ? 2099 TYR A CA 2  
ATOM 2775   C CA . GLY A 1 2100 ? 145.542 178.328 199.564 1.00 0.00 ? 2100 GLY A CA 2  
ATOM 2776   C CA . CYS A 1 2101 ? 149.316 177.726 199.323 1.00 0.00 ? 2101 CYS A CA 2  
ATOM 2777   C CA . ALA A 1 2102 ? 149.478 180.263 196.448 1.00 0.00 ? 2102 ALA A CA 2  
ATOM 2778   C CA . PRO A 1 2103 ? 151.238 178.215 193.628 1.00 0.00 ? 2103 PRO A CA 2  
ATOM 2779   C CA . TRP A 1 2104 ? 152.449 180.688 190.934 1.00 0.00 ? 2104 TRP A CA 2  
ATOM 2780   C CA . PRO A 1 2105 ? 149.352 181.855 188.927 1.00 0.00 ? 2105 PRO A CA 2  
ATOM 2781   C CA . MET A 1 2106 ? 151.091 181.131 185.586 1.00 0.00 ? 2106 MET A CA 2  
ATOM 2782   C CA . VAL A 1 2107 ? 151.769 177.484 186.698 1.00 0.00 ? 2107 VAL A CA 2  
ATOM 2783   C CA . GLU A 1 2108 ? 148.132 177.222 187.826 1.00 0.00 ? 2108 GLU A CA 2  
ATOM 2784   C CA . LYS A 1 2109 ? 146.853 178.548 184.453 1.00 0.00 ? 2109 LYS A CA 2  
ATOM 2785   C CA . LEU A 1 2110 ? 149.055 176.088 182.539 1.00 0.00 ? 2110 LEU A CA 2  
ATOM 2786   C CA . ILE A 1 2111 ? 147.884 173.016 184.572 1.00 0.00 ? 2111 ILE A CA 2  
ATOM 2787   C CA . LYS A 1 2112 ? 144.213 174.091 184.149 1.00 0.00 ? 2112 LYS A CA 2  
ATOM 2788   C CA . GLN A 1 2113 ? 144.543 174.641 180.378 1.00 0.00 ? 2113 GLN A CA 2  
ATOM 2789   C CA . CYS A 1 2114 ? 146.501 171.356 179.920 1.00 0.00 ? 2114 CYS A CA 2  
ATOM 2790   C CA . LEU A 1 2115 ? 143.793 169.367 181.793 1.00 0.00 ? 2115 LEU A CA 2  
ATOM 2791   C CA . LYS A 1 2116 ? 140.839 170.856 179.863 1.00 0.00 ? 2116 LYS A CA 2  
ATOM 2792   C CA . GLU A 1 2117 ? 138.004 168.412 179.089 1.00 0.00 ? 2117 GLU A CA 2  
ATOM 2793   C CA . ASN A 1 2118 ? 137.881 169.802 175.553 1.00 0.00 ? 2118 ASN A CA 2  
ATOM 2794   C CA . PRO A 1 2119 ? 141.165 168.630 173.825 1.00 0.00 ? 2119 PRO A CA 2  
ATOM 2795   C CA . GLN A 1 2120 ? 141.268 171.760 171.599 1.00 0.00 ? 2120 GLN A CA 2  
ATOM 2796   C CA . GLU A 1 2121 ? 141.646 174.136 174.591 1.00 0.00 ? 2121 GLU A CA 2  
ATOM 2797   C CA . ARG A 1 2122 ? 144.793 172.358 175.803 1.00 0.00 ? 2122 ARG A CA 2  
ATOM 2798   C CA . PRO A 1 2123 ? 147.793 174.506 174.679 1.00 0.00 ? 2123 PRO A CA 2  
ATOM 2799   C CA . THR A 1 2124 ? 150.529 173.972 172.082 1.00 0.00 ? 2124 THR A CA 2  
ATOM 2800   C CA . SER A 1 2125 ? 153.829 173.029 173.786 1.00 0.00 ? 2125 SER A CA 2  
ATOM 2801   C CA . ALA A 1 2126 ? 155.513 176.251 172.619 1.00 0.00 ? 2126 ALA A CA 2  
ATOM 2802   C CA . GLN A 1 2127 ? 153.069 178.183 174.890 1.00 0.00 ? 2127 GLN A CA 2  
ATOM 2803   C CA . VAL A 1 2128 ? 153.688 175.616 177.675 1.00 0.00 ? 2128 VAL A CA 2  
ATOM 2804   C CA . PHE A 1 2129 ? 157.501 176.007 177.427 1.00 0.00 ? 2129 PHE A CA 2  
ATOM 2805   C CA . ASP A 1 2130 ? 157.317 179.864 177.353 1.00 0.00 ? 2130 ASP A CA 2  
ATOM 2806   C CA . ILE A 1 2131 ? 155.046 179.907 180.464 1.00 0.00 ? 2131 ILE A CA 2  
ATOM 2807   C CA . LEU A 1 2132 ? 157.223 177.391 182.442 1.00 0.00 ? 2132 LEU A CA 2  
ATOM 2808   C CA . ASN A 1 2133 ? 160.363 179.423 181.587 1.00 0.00 ? 2133 ASN A CA 2  
ATOM 2809   C CA . SER A 1 2134 ? 158.795 182.534 183.268 1.00 0.00 ? 2134 SER A CA 2  
ATOM 2810   C CA . ALA A 1 2135 ? 158.381 180.858 186.730 1.00 0.00 ? 2135 ALA A CA 2  
ATOM 2811   C CA . ARG A 1 2142 ? 149.304 192.625 181.160 1.00 0.00 ? 2142 ARG A CA 2  
ATOM 2812   C CA . ARG A 1 2143 ? 147.002 195.476 180.170 1.00 0.00 ? 2143 ARG A CA 2  
ATOM 2813   C CA . ILE A 1 2144 ? 146.226 198.342 182.557 1.00 0.00 ? 2144 ILE A CA 2  
ATOM 2814   C CA . LEU A 1 2145 ? 143.191 200.403 181.564 1.00 0.00 ? 2145 LEU A CA 2  
ATOM 2815   C CA . LEU A 1 2146 ? 143.376 204.105 182.336 1.00 0.00 ? 2146 LEU A CA 2  
ATOM 2816   C CA . PRO A 1 2147 ? 140.241 205.957 183.485 1.00 0.00 ? 2147 PRO A CA 2  
ATOM 2817   C CA . LYS A 1 2148 ? 137.768 206.562 180.687 1.00 0.00 ? 2148 LYS A CA 2  
ATOM 2818   C CA . ASN A 1 2149 ? 138.561 209.476 178.304 1.00 0.00 ? 2149 ASN A CA 2  
ATOM 2819   C CA . VAL A 1 2150 ? 142.053 210.015 179.770 1.00 0.00 ? 2150 VAL A CA 2  
ATOM 2820   C CA . ILE A 1 2151 ? 144.353 210.931 176.872 1.00 0.00 ? 2151 ILE A CA 2  
ATOM 2821   C CA . VAL A 1 2152 ? 148.106 210.579 177.412 1.00 0.00 ? 2152 VAL A CA 2  
ATOM 2822   C CA . GLU A 1 2153 ? 150.437 213.044 175.698 1.00 0.00 ? 2153 GLU A CA 2  
ATOM 2823   C CA . CYS A 1 2154 ? 153.675 211.904 177.337 1.00 0.00 ? 2154 CYS A CA 2  
ATOM 2824   C CA . MET A 1 2155 ? 154.930 209.292 179.754 1.00 0.00 ? 2155 MET A CA 2  
ATOM 2825   C CA . VAL A 1 2156 ? 157.976 208.548 181.940 1.00 0.00 ? 2156 VAL A CA 2  
ATOM 2826   C CA . ALA A 1 2157 ? 158.627 205.463 184.063 1.00 0.00 ? 2157 ALA A CA 2  
ATOM 2827   C CA . THR A 1 2158 ? 160.083 204.978 187.538 1.00 0.00 ? 2158 THR A CA 2  
ATOM 2828   C CA . ASN A 1 2164 ? 155.694 199.204 193.271 1.00 0.00 ? 2164 ASN A CA 2  
ATOM 2829   C CA . ALA A 1 2165 ? 156.765 200.507 189.882 1.00 0.00 ? 2165 ALA A CA 2  
ATOM 2830   C CA . SER A 1 2166 ? 154.840 203.507 188.615 1.00 0.00 ? 2166 SER A CA 2  
ATOM 2831   C CA . ILE A 1 2167 ? 154.583 206.005 185.778 1.00 0.00 ? 2167 ILE A CA 2  
ATOM 2832   C CA . TRP A 1 2168 ? 154.096 209.760 185.364 1.00 0.00 ? 2168 TRP A CA 2  
ATOM 2833   C CA . LEU A 1 2169 ? 151.667 210.828 182.633 1.00 0.00 ? 2169 LEU A CA 2  
ATOM 2834   C CA . GLY A 1 2170 ? 151.027 214.140 180.909 1.00 0.00 ? 2170 GLY A CA 2  
ATOM 2835   C CA . CYS A 1 2171 ? 147.384 214.539 179.957 1.00 0.00 ? 2171 CYS A CA 2  
ATOM 2836   C CA . GLY A 1 2172 ? 145.997 215.624 176.592 1.00 0.00 ? 2172 GLY A CA 2  
ATOM 2837   C CA . HIS A 1 2173 ? 142.281 215.661 177.376 1.00 0.00 ? 2173 HIS A CA 2  
ATOM 2838   C CA . THR A 1 2174 ? 142.639 219.111 178.976 1.00 0.00 ? 2174 THR A CA 2  
ATOM 2839   C CA . ASP A 1 2175 ? 143.862 222.550 177.935 1.00 0.00 ? 2175 ASP A CA 2  
ATOM 2840   C CA . ARG A 1 2176 ? 145.703 223.090 181.246 1.00 0.00 ? 2176 ARG A CA 2  
ATOM 2841   C CA . GLY A 1 2177 ? 148.637 221.316 182.865 1.00 0.00 ? 2177 GLY A CA 2  
ATOM 2842   C CA . GLN A 1 2178 ? 147.499 218.100 184.556 1.00 0.00 ? 2178 GLN A CA 2  
ATOM 2843   C CA . LEU A 1 2179 ? 150.090 215.658 185.919 1.00 0.00 ? 2179 LEU A CA 2  
ATOM 2844   C CA . SER A 1 2180 ? 148.936 212.074 186.502 1.00 0.00 ? 2180 SER A CA 2  
ATOM 2845   C CA . PHE A 1 2181 ? 150.448 209.148 188.397 1.00 0.00 ? 2181 PHE A CA 2  
ATOM 2846   C CA . LEU A 1 2182 ? 149.879 205.426 187.811 1.00 0.00 ? 2182 LEU A CA 2  
ATOM 2847   C CA . ASP A 1 2183 ? 150.951 202.646 190.187 1.00 0.00 ? 2183 ASP A CA 2  
ATOM 2848   C CA . LEU A 1 2184 ? 151.797 199.788 187.814 1.00 0.00 ? 2184 LEU A CA 2  
ATOM 2849   C CA . ASN A 1 2185 ? 151.202 197.266 190.633 1.00 0.00 ? 2185 ASN A CA 2  
ATOM 2850   C CA . THR A 1 2186 ? 147.842 198.454 192.006 1.00 0.00 ? 2186 THR A CA 2  
ATOM 2851   C CA . GLU A 1 2187 ? 146.669 200.120 188.751 1.00 0.00 ? 2187 GLU A CA 2  
ATOM 2852   C CA . GLY A 1 2188 ? 145.715 203.127 190.880 1.00 0.00 ? 2188 GLY A CA 2  
ATOM 2853   C CA . TYR A 1 2189 ? 145.480 206.471 189.099 1.00 0.00 ? 2189 TYR A CA 2  
ATOM 2854   C CA . THR A 1 2190 ? 145.749 209.968 190.576 1.00 0.00 ? 2190 THR A CA 2  
ATOM 2855   C CA . SER A 1 2191 ? 146.104 213.342 188.872 1.00 0.00 ? 2191 SER A CA 2  
ATOM 2856   C CA . GLU A 1 2192 ? 146.694 216.976 189.801 1.00 0.00 ? 2192 GLU A CA 2  
ATOM 2857   C CA . GLU A 1 2193 ? 146.285 220.191 187.803 1.00 0.00 ? 2193 GLU A CA 2  
ATOM 2858   C CA . VAL A 1 2194 ? 149.778 221.646 188.079 1.00 0.00 ? 2194 VAL A CA 2  
ATOM 2859   C CA . ALA A 1 2195 ? 150.253 224.211 185.273 1.00 0.00 ? 2195 ALA A CA 2  
ATOM 2860   C CA . ASP A 1 2196 ? 148.388 226.662 183.038 1.00 0.00 ? 2196 ASP A CA 2  
ATOM 2861   C CA . SER A 1 2197 ? 148.947 224.920 179.678 1.00 0.00 ? 2197 SER A CA 2  
ATOM 2862   C CA . ARG A 1 2198 ? 148.945 221.326 178.465 1.00 0.00 ? 2198 ARG A CA 2  
ATOM 2863   C CA . ILE A 1 2199 ? 151.891 219.230 179.630 1.00 0.00 ? 2199 ILE A CA 2  
ATOM 2864   C CA . LEU A 1 2200 ? 153.661 218.213 176.420 1.00 0.00 ? 2200 LEU A CA 2  
ATOM 2865   C CA . CYS A 1 2201 ? 156.632 216.213 177.713 1.00 0.00 ? 2201 CYS A CA 2  
ATOM 2866   C CA . LEU A 1 2202 ? 158.084 214.740 180.899 1.00 0.00 ? 2202 LEU A CA 2  
ATOM 2867   C CA . ALA A 1 2203 ? 161.604 214.032 182.132 1.00 0.00 ? 2203 ALA A CA 2  
ATOM 2868   C CA . LEU A 1 2204 ? 162.788 212.547 185.426 1.00 0.00 ? 2204 LEU A CA 2  
ATOM 2869   C CA . VAL A 1 2205 ? 165.954 214.148 186.824 1.00 0.00 ? 2205 VAL A CA 2  
ATOM 2870   C CA . HIS A 1 2206 ? 167.539 212.005 189.542 1.00 0.00 ? 2206 HIS A CA 2  
ATOM 2871   C CA . LEU A 1 2207 ? 170.240 213.399 191.826 1.00 0.00 ? 2207 LEU A CA 2  
ATOM 2872   C CA . PRO A 1 2208 ? 172.125 210.472 193.435 1.00 0.00 ? 2208 PRO A CA 2  
ATOM 2873   C CA . VAL A 1 2209 ? 173.972 212.718 195.809 1.00 0.00 ? 2209 VAL A CA 2  
ATOM 2874   C CA . GLU A 1 2210 ? 171.387 214.804 197.707 1.00 0.00 ? 2210 GLU A CA 2  
ATOM 2875   C CA . LYS A 1 2211 ? 169.078 211.784 197.186 1.00 0.00 ? 2211 LYS A CA 2  
ATOM 2876   C CA . GLU A 1 2212 ? 166.380 213.648 195.299 1.00 0.00 ? 2212 GLU A CA 2  
ATOM 2877   C CA . SER A 1 2213 ? 164.214 213.012 192.239 1.00 0.00 ? 2213 SER A CA 2  
ATOM 2878   C CA . TRP A 1 2214 ? 162.457 215.820 190.364 1.00 0.00 ? 2214 TRP A CA 2  
ATOM 2879   C CA . ILE A 1 2215 ? 159.778 215.407 187.697 1.00 0.00 ? 2215 ILE A CA 2  
ATOM 2880   C CA . VAL A 1 2216 ? 160.063 218.045 184.960 1.00 0.00 ? 2216 VAL A CA 2  
ATOM 2881   C CA . SER A 1 2217 ? 157.012 218.978 182.881 1.00 0.00 ? 2217 SER A CA 2  
ATOM 2882   C CA . GLY A 1 2218 ? 157.361 220.852 179.597 1.00 0.00 ? 2218 GLY A CA 2  
ATOM 2883   C CA . THR A 1 2219 ? 154.217 222.684 178.540 1.00 0.00 ? 2219 THR A CA 2  
ATOM 2884   C CA . GLN A 1 2220 ? 152.484 224.275 175.552 1.00 0.00 ? 2220 GLN A CA 2  
ATOM 2885   C CA . SER A 1 2221 ? 153.361 227.776 176.817 1.00 0.00 ? 2221 SER A CA 2  
ATOM 2886   C CA . GLY A 1 2222 ? 157.099 227.154 177.270 1.00 0.00 ? 2222 GLY A CA 2  
ATOM 2887   C CA . THR A 1 2223 ? 157.028 226.696 181.048 1.00 0.00 ? 2223 THR A CA 2  
ATOM 2888   C CA . LEU A 1 2224 ? 159.347 224.139 182.665 1.00 0.00 ? 2224 LEU A CA 2  
ATOM 2889   C CA . LEU A 1 2225 ? 157.652 223.059 185.901 1.00 0.00 ? 2225 LEU A CA 2  
ATOM 2890   C CA . VAL A 1 2226 ? 159.864 221.111 188.325 1.00 0.00 ? 2226 VAL A CA 2  
ATOM 2891   C CA . ILE A 1 2227 ? 158.121 219.151 191.092 1.00 0.00 ? 2227 ILE A CA 2  
ATOM 2892   C CA . ASN A 1 2228 ? 159.632 217.019 193.854 1.00 0.00 ? 2228 ASN A CA 2  
ATOM 2893   C CA . THR A 1 2229 ? 158.739 213.329 193.801 1.00 0.00 ? 2229 THR A CA 2  
ATOM 2894   C CA . GLU A 1 2230 ? 158.543 212.887 197.579 1.00 0.00 ? 2230 GLU A CA 2  
ATOM 2895   C CA . ASP A 1 2231 ? 157.049 216.259 198.619 1.00 0.00 ? 2231 ASP A CA 2  
ATOM 2896   C CA . GLY A 1 2232 ? 154.706 217.794 196.043 1.00 0.00 ? 2232 GLY A CA 2  
ATOM 2897   C CA . LYS A 1 2233 ? 154.808 221.061 197.999 1.00 0.00 ? 2233 LYS A CA 2  
ATOM 2898   C CA . LYS A 1 2234 ? 158.367 221.463 196.640 1.00 0.00 ? 2234 LYS A CA 2  
ATOM 2899   C CA . ARG A 1 2235 ? 157.906 222.870 193.142 1.00 0.00 ? 2235 ARG A CA 2  
ATOM 2900   C CA . HIS A 1 2236 ? 159.257 225.752 191.082 1.00 0.00 ? 2236 HIS A CA 2  
ATOM 2901   C CA . THR A 1 2237 ? 159.809 226.938 187.513 1.00 0.00 ? 2237 THR A CA 2  
ATOM 2902   C CA . LEU A 1 2238 ? 162.936 227.194 185.363 1.00 0.00 ? 2238 LEU A CA 2  
ATOM 2903   C CA . GLU A 1 2239 ? 163.489 229.854 182.695 1.00 0.00 ? 2239 GLU A CA 2  
ATOM 2904   C CA . LYS A 1 2240 ? 160.493 230.220 180.397 1.00 0.00 ? 2240 LYS A CA 2  
ATOM 2905   C CA . MET A 1 2241 ? 161.016 229.006 176.839 1.00 0.00 ? 2241 MET A CA 2  
ATOM 2906   C CA . THR A 1 2242 ? 160.211 231.236 173.875 1.00 0.00 ? 2242 THR A CA 2  
ATOM 2907   C CA . ASP A 1 2243 ? 157.924 228.528 172.440 1.00 0.00 ? 2243 ASP A CA 2  
ATOM 2908   C CA . SER A 1 2244 ? 156.259 225.330 173.620 1.00 0.00 ? 2244 SER A CA 2  
ATOM 2909   C CA . VAL A 1 2245 ? 158.462 222.593 175.066 1.00 0.00 ? 2245 VAL A CA 2  
ATOM 2910   C CA . THR A 1 2246 ? 158.319 219.657 172.649 1.00 0.00 ? 2246 THR A CA 2  
ATOM 2911   C CA . CYS A 1 2247 ? 161.188 217.495 173.939 1.00 0.00 ? 2247 CYS A CA 2  
ATOM 2912   C CA . LEU A 1 2248 ? 162.737 216.524 177.283 1.00 0.00 ? 2248 LEU A CA 2  
ATOM 2913   C CA . TYR A 1 2249 ? 165.703 214.157 177.512 1.00 0.00 ? 2249 TYR A CA 2  
ATOM 2914   C CA . CYS A 1 2250 ? 168.112 213.336 180.345 1.00 0.00 ? 2250 CYS A CA 2  
ATOM 2915   C CA . ASN A 1 2251 ? 171.696 212.879 179.162 1.00 0.00 ? 2251 ASN A CA 2  
ATOM 2916   C CA . SER A 1 2252 ? 175.141 212.142 180.582 1.00 0.00 ? 2252 SER A CA 2  
ATOM 2917   C CA . PHE A 1 2253 ? 178.685 213.025 179.520 1.00 0.00 ? 2253 PHE A CA 2  
ATOM 2918   C CA . GLN A 1 2259 ? 180.325 212.145 184.066 1.00 0.00 ? 2254 GLN A CA 2  
ATOM 2919   C CA . LYS A 1 2260 ? 177.977 215.146 184.063 1.00 0.00 ? 2260 LYS A CA 2  
ATOM 2920   C CA . ASN A 1 2261 ? 174.206 214.817 183.690 1.00 0.00 ? 2261 ASN A CA 2  
ATOM 2921   C CA . PHE A 1 2262 ? 172.073 217.269 181.728 1.00 0.00 ? 2262 PHE A CA 2  
ATOM 2922   C CA . LEU A 1 2263 ? 168.459 218.095 180.893 1.00 0.00 ? 2263 LEU A CA 2  
ATOM 2923   C CA . LEU A 1 2264 ? 168.011 218.704 177.161 1.00 0.00 ? 2264 LEU A CA 2  
ATOM 2924   C CA . VAL A 1 2265 ? 164.928 220.755 176.261 1.00 0.00 ? 2265 VAL A CA 2  
ATOM 2925   C CA . GLY A 1 2266 ? 163.725 220.874 172.656 1.00 0.00 ? 2266 GLY A CA 2  
ATOM 2926   C CA . THR A 1 2267 ? 161.301 223.666 171.778 1.00 0.00 ? 2267 THR A CA 2  
ATOM 2927   C CA . ALA A 1 2268 ? 158.812 224.305 168.984 1.00 0.00 ? 2268 ALA A CA 2  
ATOM 2928   C CA . ASP A 1 2269 ? 160.878 227.162 167.493 1.00 0.00 ? 2269 ASP A CA 2  
ATOM 2929   C CA . GLY A 1 2270 ? 163.857 224.946 166.658 1.00 0.00 ? 2270 GLY A CA 2  
ATOM 2930   C CA . LYS A 1 2271 ? 165.926 225.602 169.786 1.00 0.00 ? 2271 LYS A CA 2  
ATOM 2931   C CA . LEU A 1 2272 ? 167.579 223.192 172.228 1.00 0.00 ? 2272 LEU A CA 2  
ATOM 2932   C CA . ALA A 1 2273 ? 168.306 224.425 175.759 1.00 0.00 ? 2273 ALA A CA 2  
ATOM 2933   C CA . ILE A 1 2274 ? 170.743 222.606 178.052 1.00 0.00 ? 2274 ILE A CA 2  
ATOM 2934   C CA . PHE A 1 2275 ? 170.345 222.612 181.832 1.00 0.00 ? 2275 PHE A CA 2  
ATOM 2935   C CA . GLU A 1 2276 ? 172.930 221.111 184.136 1.00 0.00 ? 2276 GLU A CA 2  
ATOM 2936   C CA . ASP A 1 2277 ? 171.954 218.317 186.522 1.00 0.00 ? 2277 ASP A CA 2  
ATOM 2937   C CA . LYS A 1 2278 ? 172.134 220.463 189.664 1.00 0.00 ? 2278 LYS A CA 2  
ATOM 2938   C CA . THR A 1 2279 ? 170.705 223.716 188.262 1.00 0.00 ? 2279 THR A CA 2  
ATOM 2939   C CA . VAL A 1 2280 ? 167.293 222.046 187.866 1.00 0.00 ? 2280 VAL A CA 2  
ATOM 2940   C CA . LYS A 1 2281 ? 166.754 222.477 191.624 1.00 0.00 ? 2281 LYS A CA 2  
ATOM 2941   C CA . LEU A 1 2282 ? 166.944 226.282 191.384 1.00 0.00 ? 2282 LEU A CA 2  
ATOM 2942   C CA . LYS A 1 2283 ? 163.956 228.555 190.824 1.00 0.00 ? 2283 LYS A CA 2  
ATOM 2943   C CA . GLY A 1 2284 ? 164.270 230.584 187.639 1.00 0.00 ? 2284 GLY A CA 2  
ATOM 2944   C CA . ALA A 1 2285 ? 167.445 228.789 186.572 1.00 0.00 ? 2285 ALA A CA 2  
ATOM 2945   C CA . ALA A 1 2286 ? 168.739 229.672 183.106 1.00 0.00 ? 2286 ALA A CA 2  
ATOM 2946   C CA . PRO A 1 2287 ? 170.169 227.103 180.669 1.00 0.00 ? 2287 PRO A CA 2  
ATOM 2947   C CA . LEU A 1 2288 ? 173.896 226.672 180.194 1.00 0.00 ? 2288 LEU A CA 2  
ATOM 2948   C CA . LYS A 1 2289 ? 173.452 227.046 176.431 1.00 0.00 ? 2289 LYS A CA 2  
ATOM 2949   C CA . ILE A 1 2290 ? 170.707 227.433 173.825 1.00 0.00 ? 2290 ILE A CA 2  
ATOM 2950   C CA . LEU A 1 2291 ? 171.231 226.042 170.320 1.00 0.00 ? 2291 LEU A CA 2  
ATOM 2951   C CA . ASN A 1 2292 ? 169.260 227.696 167.512 1.00 0.00 ? 2292 ASN A CA 2  
ATOM 2952   C CA . ILE A 1 2293 ? 168.958 224.717 165.169 1.00 0.00 ? 2293 ILE A CA 2  
ATOM 2953   C CA . GLY A 1 2294 ? 165.829 225.783 163.242 1.00 0.00 ? 2294 GLY A CA 2  
ATOM 2954   C CA . ASN A 1 2295 ? 162.954 228.243 163.241 1.00 0.00 ? 2295 ASN A CA 2  
ATOM 2955   C CA . VAL A 1 2296 ? 159.333 228.581 164.358 1.00 0.00 ? 2296 VAL A CA 2  
ATOM 2956   C CA . SER A 1 2297 ? 158.387 226.150 161.569 1.00 0.00 ? 2297 SER A CA 2  
ATOM 2957   C CA . THR A 1 2298 ? 160.868 223.371 162.516 1.00 0.00 ? 2298 THR A CA 2  
ATOM 2958   C CA . PRO A 1 2299 ? 160.081 222.012 165.996 1.00 0.00 ? 2299 PRO A CA 2  
ATOM 2959   C CA . LEU A 1 2300 ? 162.699 219.975 167.846 1.00 0.00 ? 2300 LEU A CA 2  
ATOM 2960   C CA . MET A 1 2301 ? 160.671 216.877 168.679 1.00 0.00 ? 2301 MET A CA 2  
ATOM 2961   C CA . CYS A 1 2302 ? 163.020 213.965 169.421 1.00 0.00 ? 2302 CYS A CA 2  
ATOM 2962   C CA . LEU A 1 2303 ? 166.391 213.159 170.985 1.00 0.00 ? 2303 LEU A CA 2  
ATOM 2963   C CA . SER A 1 2304 ? 168.304 209.895 171.291 1.00 0.00 ? 2304 SER A CA 2  
ATOM 2964   C CA . GLU A 1 2305 ? 171.693 208.566 172.342 1.00 0.00 ? 2305 GLU A CA 2  
ATOM 2965   C CA . VAL A 1 2314 ? 177.119 211.572 171.223 1.00 0.00 ? 2314 VAL A CA 2  
ATOM 2966   C CA . MET A 1 2315 ? 173.532 212.772 170.784 1.00 0.00 ? 2315 MET A CA 2  
ATOM 2967   C CA . TRP A 1 2316 ? 171.332 212.709 167.688 1.00 0.00 ? 2316 TRP A CA 2  
ATOM 2968   C CA . GLY A 1 2317 ? 168.099 214.622 167.246 1.00 0.00 ? 2317 GLY A CA 2  
ATOM 2969   C CA . GLY A 1 2318 ? 165.422 215.647 164.808 1.00 0.00 ? 2318 GLY A CA 2  
ATOM 2970   C CA . CYS A 1 2319 ? 164.496 219.225 163.895 1.00 0.00 ? 2319 CYS A CA 2  
ATOM 2971   C CA . GLY A 1 2320 ? 162.065 219.529 161.012 1.00 0.00 ? 2320 GLY A CA 2  
ATOM 2972   C CA . THR A 1 2321 ? 163.498 217.437 158.194 1.00 0.00 ? 2321 THR A CA 2  
ATOM 2973   C CA . LYS A 1 2322 ? 167.069 217.708 159.534 1.00 0.00 ? 2322 LYS A CA 2  
ATOM 2974   C CA . ILE A 1 2323 ? 168.984 215.262 161.718 1.00 0.00 ? 2323 ILE A CA 2  
ATOM 2975   C CA . PHE A 1 2324 ? 171.549 216.898 163.986 1.00 0.00 ? 2324 PHE A CA 2  
ATOM 2976   C CA . SER A 1 2325 ? 174.376 215.624 166.171 1.00 0.00 ? 2325 SER A CA 2  
ATOM 2977   C CA . PHE A 1 2326 ? 176.298 217.071 169.099 1.00 0.00 ? 2326 PHE A CA 2  
ATOM 2978   C CA . SER A 1 2327 ? 178.594 215.908 171.878 1.00 0.00 ? 2327 SER A CA 2  
ATOM 2979   C CA . ASN A 1 2328 ? 180.511 217.486 174.755 1.00 0.00 ? 2328 ASN A CA 2  
ATOM 2980   C CA . ASP A 1 2329 ? 180.715 221.176 173.814 1.00 0.00 ? 2329 ASP A CA 2  
ATOM 2981   C CA . PHE A 1 2330 ? 177.133 221.374 172.442 1.00 0.00 ? 2330 PHE A CA 2  
ATOM 2982   C CA . THR A 1 2331 ? 178.331 222.538 169.042 1.00 0.00 ? 2331 THR A CA 2  
ATOM 2983   C CA . ILE A 1 2332 ? 176.294 221.027 166.220 1.00 0.00 ? 2332 ILE A CA 2  
ATOM 2984   C CA . GLN A 1 2333 ? 178.592 218.642 164.371 1.00 0.00 ? 2333 GLN A CA 2  
ATOM 2985   C CA . LYS A 1 2334 ? 176.519 216.707 161.831 1.00 0.00 ? 2334 LYS A CA 2  
ATOM 2986   C CA . LEU A 1 2335 ? 173.479 218.174 160.072 1.00 0.00 ? 2335 LEU A CA 2  
ATOM 2987   C CA . ILE A 1 2336 ? 171.752 215.969 157.482 1.00 0.00 ? 2336 ILE A CA 2  
ATOM 2988   C CA . GLU A 1 2337 ? 168.882 217.119 155.267 1.00 0.00 ? 2337 GLU A CA 2  
ATOM 2989   C CA . THR A 1 2338 ? 166.437 214.235 154.811 1.00 0.00 ? 2338 THR A CA 2  
ATOM 2990   C CA . ARG A 1 2339 ? 163.834 216.044 152.688 1.00 0.00 ? 2339 ARG A CA 2  
ATOM 2991   C CA . THR A 1 2340 ? 165.455 214.917 149.418 1.00 0.00 ? 2340 THR A CA 2  
ATOM 2992   C CA . SER A 1 2341 ? 166.847 211.621 148.126 1.00 0.00 ? 2341 SER A CA 2  
ATOM 2993   C CA . GLN A 1 2342 ? 166.669 210.155 144.626 1.00 0.00 ? 2342 GLN A CA 2  
ATOM 2994   C CA . LEU A 1 2343 ? 166.112 206.616 145.947 1.00 0.00 ? 2343 LEU A CA 2  
ATOM 2995   C CA . PHE A 1 2344 ? 162.931 207.669 147.770 1.00 0.00 ? 2344 PHE A CA 2  
ATOM 2996   C CA . SER A 1 2345 ? 160.178 205.159 147.057 1.00 0.00 ? 2345 SER A CA 2  
ATOM 2997   C CA . TYR A 1 2346 ? 157.694 208.029 147.471 1.00 0.00 ? 2346 TYR A CA 2  
ATOM 2998   C CA . ALA A 1 2347 ? 158.683 211.674 147.804 1.00 0.00 ? 2347 ALA A CA 2  
ATOM 2999   C CA . ALA A 1 2348 ? 155.798 213.266 149.723 1.00 0.00 ? 2348 ALA A CA 2  
ATOM 3000   C CA . PHE A 1 2349 ? 156.434 211.129 152.817 1.00 0.00 ? 2349 PHE A CA 2  
ATOM 3001   C CA . SER A 1 2350 ? 160.024 212.333 153.201 1.00 0.00 ? 2350 SER A CA 2  
ATOM 3002   C CA . ASP A 1 2351 ? 158.887 215.979 153.234 1.00 0.00 ? 2351 ASP A CA 2  
ATOM 3003   C CA . SER A 1 2352 ? 157.615 215.814 156.800 1.00 0.00 ? 2352 SER A CA 2  
ATOM 3004   C CA . ASN A 1 2353 ? 158.903 216.591 160.272 1.00 0.00 ? 2353 ASN A CA 2  
ATOM 3005   C CA . ILE A 1 2354 ? 160.908 213.803 161.892 1.00 0.00 ? 2354 ILE A CA 2  
ATOM 3006   C CA . ILE A 1 2355 ? 158.936 212.401 164.833 1.00 0.00 ? 2355 ILE A CA 2  
ATOM 3007   C CA . THR A 1 2356 ? 161.479 209.943 166.282 1.00 0.00 ? 2356 THR A CA 2  
ATOM 3008   C CA . VAL A 1 2357 ? 165.125 208.914 165.915 1.00 0.00 ? 2357 VAL A CA 2  
ATOM 3009   C CA . VAL A 1 2358 ? 166.620 205.609 167.079 1.00 0.00 ? 2358 VAL A CA 2  
ATOM 3010   C CA . VAL A 1 2359 ? 170.407 205.264 166.885 1.00 0.00 ? 2359 VAL A CA 2  
ATOM 3011   C CA . ASP A 1 2360 ? 172.162 201.927 166.403 1.00 0.00 ? 2360 ASP A CA 2  
ATOM 3012   C CA . THR A 1 2361 ? 174.650 201.183 163.625 1.00 0.00 ? 2361 THR A CA 2  
ATOM 3013   C CA . ALA A 1 2362 ? 172.705 203.589 161.399 1.00 0.00 ? 2362 ALA A CA 2  
ATOM 3014   C CA . LEU A 1 2363 ? 169.996 206.201 161.926 1.00 0.00 ? 2363 LEU A CA 2  
ATOM 3015   C CA . TYR A 1 2364 ? 166.405 204.938 161.699 1.00 0.00 ? 2364 TYR A CA 2  
ATOM 3016   C CA . ILE A 1 2365 ? 164.096 207.950 161.455 1.00 0.00 ? 2365 ILE A CA 2  
ATOM 3017   C CA . ALA A 1 2366 ? 160.326 208.124 161.086 1.00 0.00 ? 2366 ALA A CA 2  
ATOM 3018   C CA . LYS A 1 2367 ? 158.384 211.122 159.799 1.00 0.00 ? 2367 LYS A CA 2  
ATOM 3019   C CA . GLN A 1 2368 ? 154.915 212.466 160.506 1.00 0.00 ? 2368 GLN A CA 2  
ATOM 3020   C CA . ASN A 1 2369 ? 152.126 210.734 158.553 1.00 0.00 ? 2369 ASN A CA 2  
ATOM 3021   C CA . SER A 1 2370 ? 154.647 208.499 156.771 1.00 0.00 ? 2370 SER A CA 2  
ATOM 3022   C CA . PRO A 1 2371 ? 154.757 204.675 156.577 1.00 0.00 ? 2371 PRO A CA 2  
ATOM 3023   C CA . VAL A 1 2372 ? 158.457 204.601 155.601 1.00 0.00 ? 2372 VAL A CA 2  
ATOM 3024   C CA . VAL A 1 2373 ? 161.239 204.296 158.166 1.00 0.00 ? 2373 VAL A CA 2  
ATOM 3025   C CA . GLU A 1 2374 ? 164.250 205.928 156.518 1.00 0.00 ? 2374 GLU A CA 2  
ATOM 3026   C CA . VAL A 1 2375 ? 167.743 204.599 157.236 1.00 0.00 ? 2375 VAL A CA 2  
ATOM 3027   C CA . TRP A 1 2376 ? 170.647 207.053 156.990 1.00 0.00 ? 2376 TRP A CA 2  
ATOM 3028   C CA . ASP A 1 2377 ? 174.397 206.599 157.423 1.00 0.00 ? 2377 ASP A CA 2  
ATOM 3029   C CA . LYS A 1 2378 ? 176.201 208.582 160.115 1.00 0.00 ? 2378 LYS A CA 2  
ATOM 3030   C CA . LYS A 1 2379 ? 179.427 208.857 158.110 1.00 0.00 ? 2379 LYS A CA 2  
ATOM 3031   C CA . THR A 1 2380 ? 178.347 209.388 154.494 1.00 0.00 ? 2380 THR A CA 2  
ATOM 3032   C CA . GLU A 1 2381 ? 175.140 211.262 155.469 1.00 0.00 ? 2381 GLU A CA 2  
ATOM 3033   C CA . LYS A 1 2382 ? 173.107 209.491 152.758 1.00 0.00 ? 2382 LYS A CA 2  
ATOM 3034   C CA . LEU A 1 2383 ? 170.330 206.925 152.550 1.00 0.00 ? 2383 LEU A CA 2  
ATOM 3035   C CA . CYS A 1 2384 ? 171.337 203.542 153.917 1.00 0.00 ? 2384 CYS A CA 2  
ATOM 3036   C CA . GLY A 1 2385 ? 167.957 201.995 153.182 1.00 0.00 ? 2385 GLY A CA 2  
ATOM 3037   C CA . LEU A 1 2386 ? 164.177 202.100 153.376 1.00 0.00 ? 2386 LEU A CA 2  
ATOM 3038   C CA . ILE A 1 2387 ? 161.705 200.088 155.453 1.00 0.00 ? 2387 ILE A CA 2  
ATOM 3039   C CA . ASP A 1 2388 ? 158.163 200.320 154.051 1.00 0.00 ? 2388 ASP A CA 2  
ATOM 3040   C CA . CYS A 1 2389 ? 155.749 199.199 156.771 1.00 0.00 ? 2389 CYS A CA 2  
ATOM 3041   C CA . VAL A 1 2390 ? 152.832 198.945 154.314 1.00 0.00 ? 2390 VAL A CA 2  
ATOM 3042   C CA . HIS A 1 2391 ? 154.574 196.081 152.509 1.00 0.00 ? 2391 HIS A CA 2  
ATOM 3043   C CA . PHE A 1 2392 ? 155.604 194.327 155.729 1.00 0.00 ? 2392 PHE A CA 2  
ATOM 3044   C CA . LEU A 1 2393 ? 152.020 194.528 156.993 1.00 0.00 ? 2393 LEU A CA 2  
ATOM 3045   C CA . ARG A 1 2394 ? 150.535 193.248 153.711 1.00 0.00 ? 2394 ARG A CA 2  
ATOM 3046   C CA . GLU A 1 2395 ? 152.279 189.861 154.105 1.00 0.00 ? 2395 GLU A CA 2  
ATOM 3047   C CA . MET A 1 2408 ? 145.378 194.971 153.126 1.00 0.00 ? 2408 MET A CA 2  
ATOM 3048   C CA . SER A 1 2409 ? 143.945 198.472 153.610 1.00 0.00 ? 2409 SER A CA 2  
ATOM 3049   C CA . TYR A 1 2410 ? 146.557 199.452 156.211 1.00 0.00 ? 2410 TYR A CA 2  
ATOM 3050   C CA . SER A 1 2411 ? 147.922 202.994 156.180 1.00 0.00 ? 2411 SER A CA 2  
ATOM 3051   C CA . GLY A 1 2412 ? 151.086 201.743 157.885 1.00 0.00 ? 2412 GLY A CA 2  
ATOM 3052   C CA . ARG A 1 2413 ? 151.633 205.238 159.266 1.00 0.00 ? 2413 ARG A CA 2  
ATOM 3053   C CA . VAL A 1 2414 ? 154.565 204.935 161.663 1.00 0.00 ? 2414 VAL A CA 2  
ATOM 3054   C CA . LYS A 1 2415 ? 153.870 206.210 165.177 1.00 0.00 ? 2415 LYS A CA 2  
ATOM 3055   C CA . THR A 1 2416 ? 156.814 205.035 167.272 1.00 0.00 ? 2416 THR A CA 2  
ATOM 3056   C CA . LEU A 1 2417 ? 160.186 203.261 167.107 1.00 0.00 ? 2417 LEU A CA 2  
ATOM 3057   C CA . CYS A 1 2418 ? 161.927 201.345 169.890 1.00 0.00 ? 2418 CYS A CA 2  
ATOM 3058   C CA . LEU A 1 2419 ? 165.170 199.365 169.966 1.00 0.00 ? 2419 LEU A CA 2  
ATOM 3059   C CA . GLN A 1 2420 ? 165.261 195.928 171.591 1.00 0.00 ? 2420 GLN A CA 2  
ATOM 3060   C CA . LYS A 1 2421 ? 168.753 194.933 172.761 1.00 0.00 ? 2421 LYS A CA 2  
ATOM 3061   C CA . ASN A 1 2422 ? 171.272 195.233 169.923 1.00 0.00 ? 2422 ASN A CA 2  
ATOM 3062   C CA . THR A 1 2423 ? 169.368 193.561 167.078 1.00 0.00 ? 2423 THR A CA 2  
ATOM 3063   C CA . ALA A 1 2424 ? 165.646 194.209 167.167 1.00 0.00 ? 2424 ALA A CA 2  
ATOM 3064   C CA . LEU A 1 2425 ? 163.497 197.190 166.171 1.00 0.00 ? 2425 LEU A CA 2  
ATOM 3065   C CA . TRP A 1 2426 ? 159.878 197.598 167.287 1.00 0.00 ? 2426 TRP A CA 2  
ATOM 3066   C CA . ILE A 1 2427 ? 157.633 199.712 165.040 1.00 0.00 ? 2427 ILE A CA 2  
ATOM 3067   C CA . GLY A 1 2428 ? 154.222 200.854 166.294 1.00 0.00 ? 2428 GLY A CA 2  
ATOM 3068   C CA . THR A 1 2429 ? 152.050 201.909 163.372 1.00 0.00 ? 2429 THR A CA 2  
ATOM 3069   C CA . GLY A 1 2430 ? 148.935 204.148 163.348 1.00 0.00 ? 2430 GLY A CA 2  
ATOM 3070   C CA . GLY A 1 2431 ? 146.645 201.161 163.509 1.00 0.00 ? 2431 GLY A CA 2  
ATOM 3071   C CA . GLY A 1 2432 ? 146.987 198.744 166.369 1.00 0.00 ? 2432 GLY A CA 2  
ATOM 3072   C CA . HIS A 1 2433 ? 149.886 197.033 164.636 1.00 0.00 ? 2433 HIS A CA 2  
ATOM 3073   C CA . ILE A 1 2434 ? 153.306 196.293 166.130 1.00 0.00 ? 2434 ILE A CA 2  
ATOM 3074   C CA . LEU A 1 2435 ? 156.201 195.033 163.989 1.00 0.00 ? 2435 LEU A CA 2  
ATOM 3075   C CA . LEU A 1 2436 ? 159.494 193.504 165.141 1.00 0.00 ? 2436 LEU A CA 2  
ATOM 3076   C CA . LEU A 1 2437 ? 162.337 193.647 162.601 1.00 0.00 ? 2437 LEU A CA 2  
ATOM 3077   C CA . ASP A 1 2438 ? 165.841 192.178 162.741 1.00 0.00 ? 2438 ASP A CA 2  
ATOM 3078   C CA . LEU A 1 2439 ? 168.421 194.916 162.040 1.00 0.00 ? 2439 LEU A CA 2  
ATOM 3079   C CA . SER A 1 2440 ? 171.357 192.981 160.574 1.00 0.00 ? 2440 SER A CA 2  
ATOM 3080   C CA . THR A 1 2441 ? 171.123 190.477 157.722 1.00 0.00 ? 2441 THR A CA 2  
ATOM 3081   C CA . ARG A 1 2442 ? 167.336 190.020 157.462 1.00 0.00 ? 2442 ARG A CA 2  
ATOM 3082   C CA . ARG A 1 2443 ? 164.106 191.807 158.395 1.00 0.00 ? 2443 ARG A CA 2  
ATOM 3083   C CA . LEU A 1 2444 ? 160.781 190.656 159.853 1.00 0.00 ? 2444 LEU A CA 2  
ATOM 3084   C CA . ILE A 1 2445 ? 160.850 188.688 163.113 1.00 0.00 ? 2445 ILE A CA 2  
ATOM 3085   C CA . ARG A 1 2446 ? 157.408 189.143 164.667 1.00 0.00 ? 2446 ARG A CA 2  
ATOM 3086   C CA . VAL A 1 2447 ? 154.104 190.853 163.860 1.00 0.00 ? 2447 VAL A CA 2  
ATOM 3087   C CA . ILE A 1 2448 ? 151.100 191.420 166.121 1.00 0.00 ? 2448 ILE A CA 2  
ATOM 3088   C CA . TYR A 1 2449 ? 147.993 192.793 164.388 1.00 0.00 ? 2449 TYR A CA 2  
ATOM 3089   C CA . ASN A 1 2450 ? 145.214 194.733 166.127 1.00 0.00 ? 2450 ASN A CA 2  
ATOM 3090   C CA . PHE A 1 2451 ? 147.243 194.935 169.336 1.00 0.00 ? 2451 PHE A CA 2  
ATOM 3091   C CA . CYS A 1 2452 ? 145.095 198.035 169.888 1.00 0.00 ? 2452 CYS A CA 2  
ATOM 3092   C CA . ASN A 1 2453 ? 143.372 200.629 167.710 1.00 0.00 ? 2453 ASN A CA 2  
ATOM 3093   C CA . SER A 1 2454 ? 146.403 202.960 167.604 1.00 0.00 ? 2454 SER A CA 2  
ATOM 3094   C CA . VAL A 1 2455 ? 149.879 202.588 169.148 1.00 0.00 ? 2455 VAL A CA 2  
ATOM 3095   C CA . ARG A 1 2456 ? 150.867 205.972 170.577 1.00 0.00 ? 2456 ARG A CA 2  
ATOM 3096   C CA . VAL A 1 2457 ? 153.943 205.396 172.770 1.00 0.00 ? 2457 VAL A CA 2  
ATOM 3097   C CA . MET A 1 2458 ? 156.420 202.525 173.020 1.00 0.00 ? 2458 MET A CA 2  
ATOM 3098   C CA . MET A 1 2459 ? 159.434 202.565 175.339 1.00 0.00 ? 2459 MET A CA 2  
ATOM 3099   C CA . THR A 1 2460 ? 161.843 200.463 177.392 1.00 0.00 ? 2460 THR A CA 2  
ATOM 3100   C CA . ALA A 1 2461 ? 162.306 200.919 181.144 1.00 0.00 ? 2461 ALA A CA 2  
ATOM 3101   C CA . GLN A 1 2462 ? 164.223 199.327 184.009 1.00 0.00 ? 2462 GLN A CA 2  
ATOM 3102   C CA . ASN A 1 2468 ? 164.281 195.144 181.143 1.00 0.00 ? 2468 ASN A CA 2  
ATOM 3103   C CA . VAL A 1 2469 ? 160.596 196.010 180.714 1.00 0.00 ? 2469 VAL A CA 2  
ATOM 3104   C CA . MET A 1 2470 ? 158.458 196.998 177.719 1.00 0.00 ? 2470 MET A CA 2  
ATOM 3105   C CA . LEU A 1 2471 ? 155.704 199.636 177.891 1.00 0.00 ? 2471 LEU A CA 2  
ATOM 3106   C CA . VAL A 1 2472 ? 153.203 200.277 175.079 1.00 0.00 ? 2472 VAL A CA 2  
ATOM 3107   C CA . LEU A 1 2473 ? 150.560 202.984 175.482 1.00 0.00 ? 2473 LEU A CA 2  
ATOM 3108   C CA . GLY A 1 2474 ? 147.769 202.668 172.928 1.00 0.00 ? 2474 GLY A CA 2  
ATOM 3109   C CA . TYR A 1 2475 ? 144.324 204.211 172.734 1.00 0.00 ? 2475 TYR A CA 2  
ATOM 3110   C CA . ASN A 1 2476 ? 140.916 202.992 171.503 1.00 0.00 ? 2476 ASN A CA 2  
ATOM 3111   C CA . ARG A 1 2477 ? 138.045 205.186 170.386 1.00 0.00 ? 2477 ARG A CA 2  
ATOM 3112   C CA . GLU A 1 2488 ? 134.703 208.380 173.907 1.00 0.00 ? 2497 GLU A CA 2  
ATOM 3113   C CA . ILE A 1 2489 ? 138.361 207.394 174.335 1.00 0.00 ? 2498 ILE A CA 2  
ATOM 3114   C CA . GLN A 1 2490 ? 139.911 204.539 176.341 1.00 0.00 ? 2499 GLN A CA 2  
ATOM 3115   C CA . SER A 1 2491 ? 143.678 204.636 176.830 1.00 0.00 ? 2500 SER A CA 2  
ATOM 3116   C CA . CYS A 1 2492 ? 145.496 201.443 177.805 1.00 0.00 ? 2501 CYS A CA 2  
ATOM 3117   C CA . LEU A 1 2493 ? 149.043 200.678 178.944 1.00 0.00 ? 2502 LEU A CA 2  
ATOM 3118   C CA . THR A 1 2494 ? 150.389 197.221 178.068 1.00 0.00 ? 2503 THR A CA 2  
ATOM 3119   C CA . VAL A 1 2495 ? 153.543 195.930 179.749 1.00 0.00 ? 2504 VAL A CA 2  
ATOM 3120   C CA . TRP A 1 2496 ? 155.807 192.876 179.565 1.00 0.00 ? 2505 TRP A CA 2  
ATOM 3121   C CA . TYR B 1 1332 ? 110.574 112.529 106.583 1.00 0.00 ? 1332 TYR B CA 2  
ATOM 3122   C CA . ASN B 1 1333 ? 111.115 114.077 103.082 1.00 0.00 ? 1333 ASN B CA 2  
ATOM 3123   C CA . ARG B 1 1334 ? 109.505 117.438 103.665 1.00 0.00 ? 1334 ARG B CA 2  
ATOM 3124   C CA . MET B 1 1335 ? 110.891 120.998 103.823 1.00 0.00 ? 1335 MET B CA 2  
ATOM 3125   C CA . LYS B 1 1336 ? 109.721 124.598 104.337 1.00 0.00 ? 1336 LYS B CA 2  
ATOM 3126   C CA . LEU B 1 1337 ? 110.727 127.207 101.756 1.00 0.00 ? 1337 LEU B CA 2  
ATOM 3127   C CA . MET B 1 1338 ? 110.286 130.667 103.229 1.00 0.00 ? 1338 MET B CA 2  
ATOM 3128   C CA . ILE B 1 1339 ? 110.116 133.429 100.614 1.00 0.00 ? 1339 ILE B CA 2  
ATOM 3129   C CA . VAL B 1 1340 ? 111.733 136.569 102.069 1.00 0.00 ? 1340 VAL B CA 2  
ATOM 3130   C CA . GLY B 1 1341 ? 111.887 140.068 100.565 1.00 0.00 ? 1341 GLY B CA 2  
ATOM 3131   C CA . ASN B 1 1342 ? 110.184 143.436 100.191 1.00 0.00 ? 1342 ASN B CA 2  
ATOM 3132   C CA . THR B 1 1343 ? 106.596 143.195 98.777  1.00 0.00 ? 1343 THR B CA 2  
ATOM 3133   C CA . GLY B 1 1344 ? 106.921 142.498 95.039  1.00 0.00 ? 1344 GLY B CA 2  
ATOM 3134   C CA . SER B 1 1345 ? 110.630 141.955 94.437  1.00 0.00 ? 1345 SER B CA 2  
ATOM 3135   C CA . GLY B 1 1346 ? 109.146 139.166 92.257  1.00 0.00 ? 1346 GLY B CA 2  
ATOM 3136   C CA . LYS B 1 1347 ? 108.100 136.545 94.842  1.00 0.00 ? 1347 LYS B CA 2  
ATOM 3137   C CA . THR B 1 1348 ? 105.130 135.406 92.677  1.00 0.00 ? 1348 THR B CA 2  
ATOM 3138   C CA . THR B 1 1349 ? 107.289 135.788 89.507  1.00 0.00 ? 1349 THR B CA 2  
ATOM 3139   C CA . LEU B 1 1350 ? 110.010 133.523 90.899  1.00 0.00 ? 1350 LEU B CA 2  
ATOM 3140   C CA . LEU B 1 1351 ? 107.367 130.977 92.036  1.00 0.00 ? 1351 LEU B CA 2  
ATOM 3141   C CA . GLN B 1 1352 ? 105.609 130.889 88.618  1.00 0.00 ? 1352 GLN B CA 2  
ATOM 3142   C CA . GLN B 1 1353 ? 108.974 130.168 86.990  1.00 0.00 ? 1353 GLN B CA 2  
ATOM 3143   C CA . LEU B 1 1354 ? 110.086 127.388 89.406  1.00 0.00 ? 1354 LEU B CA 2  
ATOM 3144   C CA . MET B 1 1355 ? 106.836 125.499 89.493  1.00 0.00 ? 1355 MET B CA 2  
ATOM 3145   C CA . LYS B 1 1356 ? 106.339 124.690 85.727  1.00 0.00 ? 1356 LYS B CA 2  
ATOM 3146   C CA . THR B 1 1357 ? 103.056 122.763 86.282  1.00 0.00 ? 1357 THR B CA 2  
ATOM 3147   C CA . LYS B 1 1358 ? 99.903  122.818 84.071  1.00 0.00 ? 1358 LYS B CA 2  
ATOM 3148   C CA . LYS B 1 1359 ? 99.045  126.097 85.853  1.00 0.00 ? 1359 LYS B CA 2  
ATOM 3149   C CA . SER B 1 1360 ? 97.082  124.049 88.437  1.00 0.00 ? 1360 SER B CA 2  
ATOM 3150   C CA . ASP B 1 1361 ? 96.740  126.532 91.328  1.00 0.00 ? 1361 ASP B CA 2  
ATOM 3151   C CA . LEU B 1 1362 ? 100.187 127.749 90.191  1.00 0.00 ? 1362 LEU B CA 2  
ATOM 3152   C CA . GLY B 1 1363 ? 99.045  131.349 89.980  1.00 0.00 ? 1363 GLY B CA 2  
ATOM 3153   C CA . MET B 1 1364 ? 98.565  133.521 93.077  1.00 0.00 ? 1364 MET B CA 2  
ATOM 3154   C CA . GLN B 1 1365 ? 100.178 136.938 93.524  1.00 0.00 ? 1365 GLN B CA 2  
ATOM 3155   C CA . SER B 1 1366 ? 99.924  138.375 97.046  1.00 0.00 ? 1366 SER B CA 2  
ATOM 3156   C CA . ALA B 1 1367 ? 103.309 140.030 97.259  1.00 0.00 ? 1367 ALA B CA 2  
ATOM 3157   C CA . THR B 1 1368 ? 102.343 142.813 99.788  1.00 0.00 ? 1368 THR B CA 2  
ATOM 3158   C CA . VAL B 1 1369 ? 100.967 142.043 103.302 1.00 0.00 ? 1369 VAL B CA 2  
ATOM 3159   C CA . GLY B 1 1370 ? 99.454  138.636 102.418 1.00 0.00 ? 1370 GLY B CA 2  
ATOM 3160   C CA . ILE B 1 1371 ? 99.727  134.948 103.361 1.00 0.00 ? 1371 ILE B CA 2  
ATOM 3161   C CA . ASP B 1 1372 ? 99.647  131.674 101.370 1.00 0.00 ? 1372 ASP B CA 2  
ATOM 3162   C CA . VAL B 1 1373 ? 101.171 128.175 101.040 1.00 0.00 ? 1373 VAL B CA 2  
ATOM 3163   C CA . LYS B 1 1374 ? 101.926 126.337 97.814  1.00 0.00 ? 1374 LYS B CA 2  
ATOM 3164   C CA . ASP B 1 1375 ? 103.058 122.757 98.298  1.00 0.00 ? 1375 ASP B CA 2  
ATOM 3165   C CA . TRP B 1 1376 ? 104.670 121.043 95.286  1.00 0.00 ? 1376 TRP B CA 2  
ATOM 3166   C CA . PRO B 1 1377 ? 106.779 117.852 94.992  1.00 0.00 ? 1377 PRO B CA 2  
ATOM 3167   C CA . ILE B 1 1378 ? 109.832 119.434 93.222  1.00 0.00 ? 1378 ILE B CA 2  
ATOM 3168   C CA . GLN B 1 1379 ? 112.127 116.533 92.787  1.00 0.00 ? 1379 GLN B CA 2  
ATOM 3169   C CA . ILE B 1 1380 ? 114.698 114.563 90.825  1.00 0.00 ? 1380 ILE B CA 2  
ATOM 3170   C CA . ARG B 1 1381 ? 113.405 111.297 89.415  1.00 0.00 ? 1381 ARG B CA 2  
ATOM 3171   C CA . ASP B 1 1382 ? 115.376 108.165 90.444  1.00 0.00 ? 1382 ASP B CA 2  
ATOM 3172   C CA . LYS B 1 1383 ? 117.322 109.899 93.264  1.00 0.00 ? 1383 LYS B CA 2  
ATOM 3173   C CA . ARG B 1 1384 ? 116.799 110.498 97.040  1.00 0.00 ? 1384 ARG B CA 2  
ATOM 3174   C CA . LYS B 1 1385 ? 114.933 113.653 96.137  1.00 0.00 ? 1385 LYS B CA 2  
ATOM 3175   C CA . ARG B 1 1386 ? 112.191 111.487 94.377  1.00 0.00 ? 1386 ARG B CA 2  
ATOM 3176   C CA . ASP B 1 1387 ? 109.839 111.550 97.413  1.00 0.00 ? 1387 ASP B CA 2  
ATOM 3177   C CA . LEU B 1 1388 ? 110.600 115.175 98.551  1.00 0.00 ? 1388 LEU B CA 2  
ATOM 3178   C CA . VAL B 1 1389 ? 107.789 117.638 99.316  1.00 0.00 ? 1389 VAL B CA 2  
ATOM 3179   C CA . LEU B 1 1390 ? 108.486 121.398 99.191  1.00 0.00 ? 1390 LEU B CA 2  
ATOM 3180   C CA . ASN B 1 1391 ? 106.187 123.755 101.088 1.00 0.00 ? 1391 ASN B CA 2  
ATOM 3181   C CA . VAL B 1 1392 ? 106.491 127.353 99.847  1.00 0.00 ? 1392 VAL B CA 2  
ATOM 3182   C CA . TRP B 1 1393 ? 105.416 129.808 102.535 1.00 0.00 ? 1393 TRP B CA 2  
ATOM 3183   C CA . ASP B 1 1394 ? 105.049 133.541 102.374 1.00 0.00 ? 1394 ASP B CA 2  
ATOM 3184   C CA . PHE B 1 1395 ? 104.194 135.336 105.642 1.00 0.00 ? 1395 PHE B CA 2  
ATOM 3185   C CA . ALA B 1 1396 ? 104.916 138.838 104.254 1.00 0.00 ? 1396 ALA B CA 2  
ATOM 3186   C CA . GLY B 1 1397 ? 107.456 139.888 106.934 1.00 0.00 ? 1397 GLY B CA 2  
ATOM 3187   C CA . ARG B 1 1398 ? 105.213 139.016 109.888 1.00 0.00 ? 1398 ARG B CA 2  
ATOM 3188   C CA . GLU B 1 1399 ? 106.587 135.715 111.181 1.00 0.00 ? 1399 GLU B CA 2  
ATOM 3189   C CA . GLU B 1 1400 ? 103.348 134.603 112.941 1.00 0.00 ? 1400 GLU B CA 2  
ATOM 3190   C CA . PHE B 1 1401 ? 104.556 131.092 113.954 1.00 0.00 ? 1401 PHE B CA 2  
ATOM 3191   C CA . TYR B 1 1402 ? 107.702 132.363 115.804 1.00 0.00 ? 1402 TYR B CA 2  
ATOM 3192   C CA . SER B 1 1403 ? 106.485 132.599 119.451 1.00 0.00 ? 1403 SER B CA 2  
ATOM 3193   C CA . THR B 1 1404 ? 104.658 129.255 119.764 1.00 0.00 ? 1404 THR B CA 2  
ATOM 3194   C CA . HIS B 1 1405 ? 106.511 127.168 117.156 1.00 0.00 ? 1405 HIS B CA 2  
ATOM 3195   C CA . PRO B 1 1406 ? 110.314 128.026 117.324 1.00 0.00 ? 1406 PRO B CA 2  
ATOM 3196   C CA . HIS B 1 1407 ? 111.387 124.994 115.251 1.00 0.00 ? 1407 HIS B CA 2  
ATOM 3197   C CA . PHE B 1 1408 ? 109.039 125.904 112.355 1.00 0.00 ? 1408 PHE B CA 2  
ATOM 3198   C CA . MET B 1 1409 ? 111.462 128.763 111.602 1.00 0.00 ? 1409 MET B CA 2  
ATOM 3199   C CA . THR B 1 1410 ? 114.772 127.362 112.953 1.00 0.00 ? 1410 THR B CA 2  
ATOM 3200   C CA . GLN B 1 1411 ? 114.555 123.760 111.700 1.00 0.00 ? 1411 GLN B CA 2  
ATOM 3201   C CA . ARG B 1 1412 ? 113.113 122.120 108.574 1.00 0.00 ? 1412 ARG B CA 2  
ATOM 3202   C CA . ALA B 1 1413 ? 113.564 125.353 106.647 1.00 0.00 ? 1413 ALA B CA 2  
ATOM 3203   C CA . LEU B 1 1414 ? 115.184 127.115 103.704 1.00 0.00 ? 1414 LEU B CA 2  
ATOM 3204   C CA . TYR B 1 1415 ? 115.088 130.894 103.391 1.00 0.00 ? 1415 TYR B CA 2  
ATOM 3205   C CA . LEU B 1 1416 ? 114.929 132.308 99.866  1.00 0.00 ? 1416 LEU B CA 2  
ATOM 3206   C CA . ALA B 1 1417 ? 115.809 135.968 99.763  1.00 0.00 ? 1417 ALA B CA 2  
ATOM 3207   C CA . VAL B 1 1418 ? 114.351 137.728 96.734  1.00 0.00 ? 1418 VAL B CA 2  
ATOM 3208   C CA . TYR B 1 1419 ? 116.133 140.927 95.772  1.00 0.00 ? 1419 TYR B CA 2  
ATOM 3209   C CA . ASP B 1 1420 ? 115.136 143.009 92.842  1.00 0.00 ? 1420 ASP B CA 2  
ATOM 3210   C CA . LEU B 1 1421 ? 118.659 144.431 92.650  1.00 0.00 ? 1421 LEU B CA 2  
ATOM 3211   C CA . SER B 1 1422 ? 117.623 147.488 90.563  1.00 0.00 ? 1422 SER B CA 2  
ATOM 3212   C CA . LYS B 1 1423 ? 114.706 148.377 92.882  1.00 0.00 ? 1423 LYS B CA 2  
ATOM 3213   C CA . GLY B 1 1424 ? 114.681 146.400 96.198  1.00 0.00 ? 1424 GLY B CA 2  
ATOM 3214   C CA . GLN B 1 1425 ? 118.459 146.794 96.630  1.00 0.00 ? 1425 GLN B CA 2  
ATOM 3215   C CA . ALA B 1 1426 ? 118.867 150.128 94.770  1.00 0.00 ? 1426 ALA B CA 2  
ATOM 3216   C CA . GLU B 1 1427 ? 115.779 152.181 95.923  1.00 0.00 ? 1427 GLU B CA 2  
ATOM 3217   C CA . VAL B 1 1428 ? 115.528 151.076 99.584  1.00 0.00 ? 1428 VAL B CA 2  
ATOM 3218   C CA . ASP B 1 1429 ? 118.715 149.003 100.387 1.00 0.00 ? 1429 ASP B CA 2  
ATOM 3219   C CA . ALA B 1 1430 ? 116.533 146.455 102.171 1.00 0.00 ? 1430 ALA B CA 2  
ATOM 3220   C CA . MET B 1 1431 ? 119.102 143.694 101.644 1.00 0.00 ? 1431 MET B CA 2  
ATOM 3221   C CA . LYS B 1 1432 ? 120.809 144.368 105.009 1.00 0.00 ? 1432 LYS B CA 2  
ATOM 3222   C CA . PRO B 1 1433 ? 117.438 144.325 106.961 1.00 0.00 ? 1433 PRO B CA 2  
ATOM 3223   C CA . TRP B 1 1434 ? 116.161 141.126 105.262 1.00 0.00 ? 1434 TRP B CA 2  
ATOM 3224   C CA . LEU B 1 1435 ? 119.460 139.303 105.762 1.00 0.00 ? 1435 LEU B CA 2  
ATOM 3225   C CA . PHE B 1 1436 ? 119.395 140.078 109.542 1.00 0.00 ? 1436 PHE B CA 2  
ATOM 3226   C CA . ASN B 1 1437 ? 115.651 139.108 109.582 1.00 0.00 ? 1437 ASN B CA 2  
ATOM 3227   C CA . ILE B 1 1438 ? 116.609 135.670 108.162 1.00 0.00 ? 1438 ILE B CA 2  
ATOM 3228   C CA . LYS B 1 1439 ? 119.464 135.300 110.738 1.00 0.00 ? 1439 LYS B CA 2  
ATOM 3229   C CA . ALA B 1 1440 ? 117.284 136.063 113.807 1.00 0.00 ? 1440 ALA B CA 2  
ATOM 3230   C CA . ARG B 1 1441 ? 114.073 134.185 112.848 1.00 0.00 ? 1441 ARG B CA 2  
ATOM 3231   C CA . ALA B 1 1442 ? 115.824 131.224 111.376 1.00 0.00 ? 1442 ALA B CA 2  
ATOM 3232   C CA . SER B 1 1443 ? 118.923 129.884 113.130 1.00 0.00 ? 1443 SER B CA 2  
ATOM 3233   C CA . SER B 1 1444 ? 121.496 127.886 111.173 1.00 0.00 ? 1444 SER B CA 2  
ATOM 3234   C CA . SER B 1 1445 ? 118.863 127.459 108.411 1.00 0.00 ? 1445 SER B CA 2  
ATOM 3235   C CA . PRO B 1 1446 ? 120.266 127.969 104.826 1.00 0.00 ? 1446 PRO B CA 2  
ATOM 3236   C CA . VAL B 1 1447 ? 119.590 130.970 102.804 1.00 0.00 ? 1447 VAL B CA 2  
ATOM 3237   C CA . ILE B 1 1448 ? 119.666 131.278 99.022  1.00 0.00 ? 1448 ILE B CA 2  
ATOM 3238   C CA . LEU B 1 1449 ? 120.037 134.790 97.611  1.00 0.00 ? 1449 LEU B CA 2  
ATOM 3239   C CA . VAL B 1 1450 ? 118.172 135.365 94.337  1.00 0.00 ? 1450 VAL B CA 2  
ATOM 3240   C CA . GLY B 1 1451 ? 118.877 138.571 92.390  1.00 0.00 ? 1451 GLY B CA 2  
ATOM 3241   C CA . THR B 1 1452 ? 115.779 139.115 90.222  1.00 0.00 ? 1452 THR B CA 2  
ATOM 3242   C CA . HIS B 1 1453 ? 114.823 141.182 87.134  1.00 0.00 ? 1453 HIS B CA 2  
ATOM 3243   C CA . LEU B 1 1454 ? 118.333 140.996 85.691  1.00 0.00 ? 1454 LEU B CA 2  
ATOM 3244   C CA . ASP B 1 1455 ? 117.032 141.574 82.111  1.00 0.00 ? 1455 ASP B CA 2  
ATOM 3245   C CA . VAL B 1 1456 ? 116.074 145.201 82.987  1.00 0.00 ? 1456 VAL B CA 2  
ATOM 3246   C CA . SER B 1 1457 ? 119.569 145.796 84.410  1.00 0.00 ? 1457 SER B CA 2  
ATOM 3247   C CA . ASP B 1 1458 ? 121.671 144.556 81.433  1.00 0.00 ? 1458 ASP B CA 2  
ATOM 3248   C CA . GLU B 1 1459 ? 123.469 142.068 83.743  1.00 0.00 ? 1459 GLU B CA 2  
ATOM 3249   C CA . LYS B 1 1460 ? 125.004 144.971 85.751  1.00 0.00 ? 1460 LYS B CA 2  
ATOM 3250   C CA . GLN B 1 1461 ? 123.430 144.594 89.210  1.00 0.00 ? 1461 GLN B CA 2  
ATOM 3251   C CA . ARG B 1 1462 ? 124.834 141.095 89.654  1.00 0.00 ? 1462 ARG B CA 2  
ATOM 3252   C CA . LYS B 1 1463 ? 128.439 142.270 89.566  1.00 0.00 ? 1463 LYS B CA 2  
ATOM 3253   C CA . ALA B 1 1464 ? 130.801 142.390 92.599  1.00 0.00 ? 1464 ALA B CA 2  
ATOM 3254   C CA . CYS B 1 1465 ? 130.669 146.193 92.276  1.00 0.00 ? 1465 CYS B CA 2  
ATOM 3255   C CA . MET B 1 1466 ? 126.985 146.288 93.384  1.00 0.00 ? 1466 MET B CA 2  
ATOM 3256   C CA . SER B 1 1467 ? 126.336 142.834 94.898  1.00 0.00 ? 1467 SER B CA 2  
ATOM 3257   C CA . LYS B 1 1468 ? 128.884 142.233 97.658  1.00 0.00 ? 1468 LYS B CA 2  
ATOM 3258   C CA . ILE B 1 1469 ? 128.745 138.372 97.527  1.00 0.00 ? 1469 ILE B CA 2  
ATOM 3259   C CA . THR B 1 1470 ? 132.142 137.388 98.999  1.00 0.00 ? 1470 THR B CA 2  
ATOM 3260   C CA . LYS B 1 1471 ? 132.904 140.762 100.490 1.00 0.00 ? 1471 LYS B CA 2  
ATOM 3261   C CA . GLU B 1 1472 ? 129.724 141.221 102.687 1.00 0.00 ? 1472 GLU B CA 2  
ATOM 3262   C CA . LEU B 1 1473 ? 127.125 138.484 101.996 1.00 0.00 ? 1473 LEU B CA 2  
ATOM 3263   C CA . LEU B 1 1474 ? 129.059 135.195 102.569 1.00 0.00 ? 1474 LEU B CA 2  
ATOM 3264   C CA . ASN B 1 1475 ? 131.128 133.426 105.309 1.00 0.00 ? 1475 ASN B CA 2  
ATOM 3265   C CA . LYS B 1 1476 ? 134.036 135.946 105.093 1.00 0.00 ? 1476 LYS B CA 2  
ATOM 3266   C CA . ARG B 1 1477 ? 131.854 138.698 106.610 1.00 0.00 ? 1477 ARG B CA 2  
ATOM 3267   C CA . GLY B 1 1478 ? 129.552 136.895 109.005 1.00 0.00 ? 1478 GLY B CA 2  
ATOM 3268   C CA . PHE B 1 1479 ? 126.901 135.351 106.721 1.00 0.00 ? 1479 PHE B CA 2  
ATOM 3269   C CA . PRO B 1 1480 ? 127.753 131.617 107.013 1.00 0.00 ? 1480 PRO B CA 2  
ATOM 3270   C CA . ALA B 1 1481 ? 124.567 129.774 105.998 1.00 0.00 ? 1481 ALA B CA 2  
ATOM 3271   C CA . ILE B 1 1482 ? 124.336 131.157 102.428 1.00 0.00 ? 1482 ILE B CA 2  
ATOM 3272   C CA . ARG B 1 1483 ? 127.013 129.586 100.120 1.00 0.00 ? 1483 ARG B CA 2  
ATOM 3273   C CA . ASP B 1 1484 ? 124.724 130.183 97.081  1.00 0.00 ? 1484 ASP B CA 2  
ATOM 3274   C CA . TYR B 1 1485 ? 123.770 133.187 94.920  1.00 0.00 ? 1485 TYR B CA 2  
ATOM 3275   C CA . HIS B 1 1486 ? 121.558 133.412 91.805  1.00 0.00 ? 1486 HIS B CA 2  
ATOM 3276   C CA . PHE B 1 1487 ? 121.066 135.990 89.128  1.00 0.00 ? 1487 PHE B CA 2  
ATOM 3277   C CA . VAL B 1 1488 ? 117.853 135.398 87.219  1.00 0.00 ? 1488 VAL B CA 2  
ATOM 3278   C CA . ASN B 1 1489 ? 116.164 137.010 84.201  1.00 0.00 ? 1489 ASN B CA 2  
ATOM 3279   C CA . ALA B 1 1490 ? 112.798 135.292 83.843  1.00 0.00 ? 1490 ALA B CA 2  
ATOM 3280   C CA . THR B 1 1491 ? 111.523 136.633 80.535  1.00 0.00 ? 1491 THR B CA 2  
ATOM 3281   C CA . GLU B 1 1492 ? 114.856 136.203 78.740  1.00 0.00 ? 1492 GLU B CA 2  
ATOM 3282   C CA . GLU B 1 1493 ? 115.728 132.593 79.628  1.00 0.00 ? 1493 GLU B CA 2  
ATOM 3283   C CA . SER B 1 1494 ? 115.022 130.004 82.373  1.00 0.00 ? 1494 SER B CA 2  
ATOM 3284   C CA . ASP B 1 1495 ? 118.556 128.580 82.558  1.00 0.00 ? 1495 ASP B CA 2  
ATOM 3285   C CA . ALA B 1 1496 ? 119.570 130.395 85.781  1.00 0.00 ? 1496 ALA B CA 2  
ATOM 3286   C CA . LEU B 1 1497 ? 116.314 129.279 87.482  1.00 0.00 ? 1497 LEU B CA 2  
ATOM 3287   C CA . ALA B 1 1498 ? 117.244 125.627 86.923  1.00 0.00 ? 1498 ALA B CA 2  
ATOM 3288   C CA . LYS B 1 1499 ? 120.390 126.511 88.949  1.00 0.00 ? 1499 LYS B CA 2  
ATOM 3289   C CA . LEU B 1 1500 ? 118.081 127.597 91.844  1.00 0.00 ? 1500 LEU B CA 2  
ATOM 3290   C CA . ARG B 1 1501 ? 116.894 123.969 91.917  1.00 0.00 ? 1501 ARG B CA 2  
ATOM 3291   C CA . LYS B 1 1502 ? 120.522 122.857 92.591  1.00 0.00 ? 1502 LYS B CA 2  
ATOM 3292   C CA . THR B 1 1503 ? 120.596 125.090 95.679  1.00 0.00 ? 1503 THR B CA 2  
ATOM 3293   C CA . ILE B 1 1504 ? 117.177 123.707 96.758  1.00 0.00 ? 1504 ILE B CA 2  
ATOM 3294   C CA . ILE B 1 1505 ? 118.957 120.323 96.333  1.00 0.00 ? 1505 ILE B CA 2  
ATOM 3295   C CA . ASN B 1 1506 ? 121.985 121.528 98.436  1.00 0.00 ? 1506 ASN B CA 2  
ATOM 3296   C CA . GLU B 1 1507 ? 119.605 122.451 101.241 1.00 0.00 ? 1507 GLU B CA 2  
ATOM 3297   C CA . SER B 1 1508 ? 116.876 120.105 102.714 1.00 0.00 ? 1508 SER B CA 2  
ATOM 3298   C CA . LEU B 1 1509 ? 119.929 117.856 103.368 1.00 0.00 ? 1509 LEU B CA 2  
ATOM 3299   C CA . ASN B 1 1510 ? 120.709 119.110 106.890 1.00 0.00 ? 1510 ASN B CA 2  
ATOM 3300   C CA . PHE B 1 1511 ? 116.984 119.749 107.776 1.00 0.00 ? 1511 PHE B CA 2  
ATOM 3301   C CA . LYS B 1 1512 ? 115.191 116.510 107.223 1.00 0.00 ? 1512 LYS B CA 2  
ATOM 3302   C CA . ILE B 1 1513 ? 117.643 113.716 106.191 1.00 0.00 ? 1513 ILE B CA 2  
ATOM 3303   C CA . ARG B 1 1514 ? 119.549 113.518 109.507 1.00 0.00 ? 1514 ARG B CA 2  
ATOM 3304   C CA . PRO B 1 1524 ? 133.717 118.195 83.124  1.00 0.00 ? 1524 PRO B CA 2  
ATOM 3305   C CA . ASP B 1 1525 ? 135.347 114.749 82.585  1.00 0.00 ? 1525 ASP B CA 2  
ATOM 3306   C CA . CYS B 1 1526 ? 138.232 115.609 84.984  1.00 0.00 ? 1526 CYS B CA 2  
ATOM 3307   C CA . TYR B 1 1527 ? 135.795 116.034 87.955  1.00 0.00 ? 1527 TYR B CA 2  
ATOM 3308   C CA . VAL B 1 1528 ? 134.182 112.588 87.210  1.00 0.00 ? 1528 VAL B CA 2  
ATOM 3309   C CA . GLU B 1 1529 ? 137.642 110.960 86.724  1.00 0.00 ? 1529 GLU B CA 2  
ATOM 3310   C CA . LEU B 1 1530 ? 138.932 112.391 89.987  1.00 0.00 ? 1530 LEU B CA 2  
ATOM 3311   C CA . GLU B 1 1531 ? 135.715 111.420 91.866  1.00 0.00 ? 1531 GLU B CA 2  
ATOM 3312   C CA . LYS B 1 1532 ? 136.114 107.760 90.769  1.00 0.00 ? 1532 LYS B CA 2  
ATOM 3313   C CA . ILE B 1 1533 ? 139.818 107.622 91.748  1.00 0.00 ? 1533 ILE B CA 2  
ATOM 3314   C CA . ILE B 1 1534 ? 139.070 109.359 95.076  1.00 0.00 ? 1534 ILE B CA 2  
ATOM 3315   C CA . LEU B 1 1535 ? 136.237 106.860 95.827  1.00 0.00 ? 1535 LEU B CA 2  
ATOM 3316   C CA . SER B 1 1536 ? 138.425 103.826 94.958  1.00 0.00 ? 1536 SER B CA 2  
ATOM 3317   C CA . GLU B 1 1537 ? 141.364 105.145 97.075  1.00 0.00 ? 1537 GLU B CA 2  
ATOM 3318   C CA . ARG B 1 1538 ? 139.041 106.130 99.952  1.00 0.00 ? 1538 ARG B CA 2  
ATOM 3319   C CA . LYS B 1 1539 ? 136.958 102.934 100.276 1.00 0.00 ? 1539 LYS B CA 2  
ATOM 3320   C CA . ASN B 1 1540 ? 140.172 100.854 100.308 1.00 0.00 ? 1540 ASN B CA 2  
ATOM 3321   C CA . VAL B 1 1541 ? 141.250 102.627 103.524 1.00 0.00 ? 1541 VAL B CA 2  
ATOM 3322   C CA . PRO B 1 1542 ? 138.423 101.489 105.951 1.00 0.00 ? 1542 PRO B CA 2  
ATOM 3323   C CA . ILE B 1 1543 ? 140.877 100.423 108.606 1.00 0.00 ? 1543 ILE B CA 2  
ATOM 3324   C CA . GLU B 1 1544 ? 142.673 103.709 108.840 1.00 0.00 ? 1544 GLU B CA 2  
ATOM 3325   C CA . PHE B 1 1545 ? 141.665 107.428 109.019 1.00 0.00 ? 1545 PHE B CA 2  
ATOM 3326   C CA . PRO B 1 1546 ? 144.040 109.255 106.548 1.00 0.00 ? 1546 PRO B CA 2  
ATOM 3327   C CA . VAL B 1 1547 ? 142.097 107.667 103.816 1.00 0.00 ? 1547 VAL B CA 2  
ATOM 3328   C CA . ILE B 1 1548 ? 143.572 110.358 101.642 1.00 0.00 ? 1548 ILE B CA 2  
ATOM 3329   C CA . ASP B 1 1549 ? 146.274 112.763 102.885 1.00 0.00 ? 1549 ASP B CA 2  
ATOM 3330   C CA . ARG B 1 1550 ? 146.917 116.191 101.264 1.00 0.00 ? 1550 ARG B CA 2  
ATOM 3331   C CA . LYS B 1 1551 ? 149.820 114.981 99.083  1.00 0.00 ? 1551 LYS B CA 2  
ATOM 3332   C CA . ARG B 1 1552 ? 147.896 111.951 97.864  1.00 0.00 ? 1552 ARG B CA 2  
ATOM 3333   C CA . LEU B 1 1553 ? 144.835 113.916 96.562  1.00 0.00 ? 1553 LEU B CA 2  
ATOM 3334   C CA . LEU B 1 1554 ? 147.206 116.484 94.982  1.00 0.00 ? 1554 LEU B CA 2  
ATOM 3335   C CA . GLN B 1 1555 ? 148.801 113.557 93.111  1.00 0.00 ? 1555 GLN B CA 2  
ATOM 3336   C CA . LEU B 1 1556 ? 145.383 112.218 91.919  1.00 0.00 ? 1556 LEU B CA 2  
ATOM 3337   C CA . VAL B 1 1557 ? 144.251 115.748 90.851  1.00 0.00 ? 1557 VAL B CA 2  
ATOM 3338   C CA . ARG B 1 1558 ? 147.455 116.131 88.742  1.00 0.00 ? 1558 ARG B CA 2  
ATOM 3339   C CA . GLU B 1 1559 ? 146.957 112.785 86.960  1.00 0.00 ? 1559 GLU B CA 2  
ATOM 3340   C CA . ASN B 1 1560 ? 143.555 114.051 85.695  1.00 0.00 ? 1560 ASN B CA 2  
ATOM 3341   C CA . GLN B 1 1561 ? 145.117 117.463 84.782  1.00 0.00 ? 1561 GLN B CA 2  
ATOM 3342   C CA . LEU B 1 1562 ? 143.550 119.543 87.634  1.00 0.00 ? 1562 LEU B CA 2  
ATOM 3343   C CA . GLN B 1 1563 ? 146.774 120.626 89.459  1.00 0.00 ? 1563 GLN B CA 2  
ATOM 3344   C CA . LEU B 1 1564 ? 146.661 123.683 87.157  1.00 0.00 ? 1564 LEU B CA 2  
ATOM 3345   C CA . ASP B 1 1565 ? 144.709 125.677 89.760  1.00 0.00 ? 1565 ASP B CA 2  
ATOM 3346   C CA . GLU B 1 1566 ? 144.657 125.139 93.567  1.00 0.00 ? 1566 GLU B CA 2  
ATOM 3347   C CA . ASN B 1 1567 ? 141.479 127.209 93.559  1.00 0.00 ? 1567 ASN B CA 2  
ATOM 3348   C CA . GLU B 1 1568 ? 139.453 124.668 91.409  1.00 0.00 ? 1568 GLU B CA 2  
ATOM 3349   C CA . LEU B 1 1569 ? 140.599 121.746 93.531  1.00 0.00 ? 1569 LEU B CA 2  
ATOM 3350   C CA . PRO B 1 1570 ? 138.901 123.257 96.705  1.00 0.00 ? 1570 PRO B CA 2  
ATOM 3351   C CA . HIS B 1 1571 ? 135.796 123.793 94.563  1.00 0.00 ? 1571 HIS B CA 2  
ATOM 3352   C CA . ALA B 1 1572 ? 135.807 120.182 93.227  1.00 0.00 ? 1572 ALA B CA 2  
ATOM 3353   C CA . VAL B 1 1573 ? 136.334 118.702 96.721  1.00 0.00 ? 1573 VAL B CA 2  
ATOM 3354   C CA . HIS B 1 1574 ? 133.803 121.249 98.154  1.00 0.00 ? 1574 HIS B CA 2  
ATOM 3355   C CA . PHE B 1 1575 ? 131.309 119.851 95.568  1.00 0.00 ? 1575 PHE B CA 2  
ATOM 3356   C CA . LEU B 1 1576 ? 132.150 116.239 96.390  1.00 0.00 ? 1576 LEU B CA 2  
ATOM 3357   C CA . ASN B 1 1577 ? 131.771 117.028 100.114 1.00 0.00 ? 1577 ASN B CA 2  
ATOM 3358   C CA . GLU B 1 1578 ? 128.406 118.865 99.564  1.00 0.00 ? 1578 GLU B CA 2  
ATOM 3359   C CA . SER B 1 1579 ? 127.206 115.777 97.659  1.00 0.00 ? 1579 SER B CA 2  
ATOM 3360   C CA . GLY B 1 1580 ? 128.452 113.237 100.304 1.00 0.00 ? 1580 GLY B CA 2  
ATOM 3361   C CA . VAL B 1 1581 ? 130.555 111.284 97.797  1.00 0.00 ? 1581 VAL B CA 2  
ATOM 3362   C CA . LEU B 1 1582 ? 133.539 112.043 99.977  1.00 0.00 ? 1582 LEU B CA 2  
ATOM 3363   C CA . LEU B 1 1583 ? 133.914 114.118 103.108 1.00 0.00 ? 1583 LEU B CA 2  
ATOM 3364   C CA . HIS B 1 1584 ? 136.251 117.138 103.252 1.00 0.00 ? 1584 HIS B CA 2  
ATOM 3365   C CA . PHE B 1 1585 ? 136.231 119.387 106.270 1.00 0.00 ? 1585 PHE B CA 2  
ATOM 3366   C CA . GLN B 1 1586 ? 137.527 122.856 105.347 1.00 0.00 ? 1586 GLN B CA 2  
ATOM 3367   C CA . ASP B 1 1587 ? 137.241 124.178 108.965 1.00 0.00 ? 1587 ASP B CA 2  
ATOM 3368   C CA . PRO B 1 1588 ? 139.808 121.646 110.512 1.00 0.00 ? 1588 PRO B CA 2  
ATOM 3369   C CA . ALA B 1 1589 ? 141.905 121.713 107.267 1.00 0.00 ? 1589 ALA B CA 2  
ATOM 3370   C CA . LEU B 1 1590 ? 144.200 124.514 108.540 1.00 0.00 ? 1590 LEU B CA 2  
ATOM 3371   C CA . GLN B 1 1591 ? 146.194 122.105 110.759 1.00 0.00 ? 1591 GLN B CA 2  
ATOM 3372   C CA . LEU B 1 1592 ? 145.337 118.762 109.162 1.00 0.00 ? 1592 LEU B CA 2  
ATOM 3373   C CA . SER B 1 1593 ? 147.134 117.607 105.967 1.00 0.00 ? 1593 SER B CA 2  
ATOM 3374   C CA . ASP B 1 1594 ? 147.370 114.008 107.257 1.00 0.00 ? 1594 ASP B CA 2  
ATOM 3375   C CA . LEU B 1 1595 ? 143.591 113.539 107.191 1.00 0.00 ? 1595 LEU B CA 2  
ATOM 3376   C CA . TYR B 1 1596 ? 142.305 115.734 104.405 1.00 0.00 ? 1596 TYR B CA 2  
ATOM 3377   C CA . PHE B 1 1597 ? 139.485 113.878 102.637 1.00 0.00 ? 1597 PHE B CA 2  
ATOM 3378   C CA . VAL B 1 1598 ? 137.399 111.105 104.247 1.00 0.00 ? 1598 VAL B CA 2  
ATOM 3379   C CA . GLU B 1 1599 ? 135.278 107.963 103.457 1.00 0.00 ? 1599 GLU B CA 2  
ATOM 3380   C CA . PRO B 1 1600 ? 131.632 108.713 104.545 1.00 0.00 ? 1600 PRO B CA 2  
ATOM 3381   C CA . LYS B 1 1601 ? 131.020 105.123 105.736 1.00 0.00 ? 1601 LYS B CA 2  
ATOM 3382   C CA . TRP B 1 1602 ? 134.107 105.178 107.929 1.00 0.00 ? 1602 TRP B CA 2  
ATOM 3383   C CA . LEU B 1 1603 ? 133.027 108.521 109.514 1.00 0.00 ? 1603 LEU B CA 2  
ATOM 3384   C CA . CYS B 1 1604 ? 129.380 107.433 110.015 1.00 0.00 ? 1604 CYS B CA 2  
ATOM 3385   C CA . LYS B 1 1605 ? 130.311 104.098 111.662 1.00 0.00 ? 1605 LYS B CA 2  
ATOM 3386   C CA . ILE B 1 1606 ? 132.669 105.989 114.017 1.00 0.00 ? 1606 ILE B CA 2  
ATOM 3387   C CA . MET B 1 1607 ? 130.092 108.287 115.407 1.00 0.00 ? 1607 MET B CA 2  
ATOM 3388   C CA . ALA B 1 1608 ? 127.305 105.753 115.648 1.00 0.00 ? 1608 ALA B CA 2  
ATOM 3389   C CA . GLN B 1 1609 ? 129.673 103.635 117.824 1.00 0.00 ? 1609 GLN B CA 2  
ATOM 3390   C CA . ILE B 1 1610 ? 130.266 106.673 120.119 1.00 0.00 ? 1610 ILE B CA 2  
ATOM 3391   C CA . LEU B 1 1611 ? 126.505 107.444 120.193 1.00 0.00 ? 1611 LEU B CA 2  
ATOM 3392   C CA . THR B 1 1612 ? 125.459 103.836 121.048 1.00 0.00 ? 1612 THR B CA 2  
ATOM 3393   C CA . VAL B 1 1613 ? 128.271 103.011 123.487 1.00 0.00 ? 1613 VAL B CA 2  
ATOM 3394   C CA . LYS B 1 1614 ? 127.275 101.842 127.007 1.00 0.00 ? 1614 LYS B CA 2  
ATOM 3395   C CA . VAL B 1 1615 ? 129.973 104.085 128.545 1.00 0.00 ? 1615 VAL B CA 2  
ATOM 3396   C CA . GLU B 1 1616 ? 128.173 107.455 128.527 1.00 0.00 ? 1616 GLU B CA 2  
ATOM 3397   C CA . GLY B 1 1617 ? 129.538 108.409 131.960 1.00 0.00 ? 1617 GLY B CA 2  
ATOM 3398   C CA . CYS B 1 1618 ? 130.616 107.356 135.439 1.00 0.00 ? 1618 CYS B CA 2  
ATOM 3399   C CA . PRO B 1 1619 ? 129.008 104.067 136.787 1.00 0.00 ? 1619 PRO B CA 2  
ATOM 3400   C CA . LYS B 1 1620 ? 126.007 105.534 138.709 1.00 0.00 ? 1620 LYS B CA 2  
ATOM 3401   C CA . HIS B 1 1621 ? 125.438 108.601 136.484 1.00 0.00 ? 1621 HIS B CA 2  
ATOM 3402   C CA . PRO B 1 1622 ? 125.733 107.939 132.691 1.00 0.00 ? 1622 PRO B CA 2  
ATOM 3403   C CA . LYS B 1 1623 ? 123.925 110.983 131.245 1.00 0.00 ? 1623 LYS B CA 2  
ATOM 3404   C CA . GLY B 1 1624 ? 125.498 111.633 127.795 1.00 0.00 ? 1624 GLY B CA 2  
ATOM 3405   C CA . ILE B 1 1625 ? 129.056 112.047 129.153 1.00 0.00 ? 1625 ILE B CA 2  
ATOM 3406   C CA . ILE B 1 1626 ? 131.974 111.008 126.903 1.00 0.00 ? 1626 ILE B CA 2  
ATOM 3407   C CA . SER B 1 1627 ? 135.129 110.340 128.950 1.00 0.00 ? 1627 SER B CA 2  
ATOM 3408   C CA . ARG B 1 1628 ? 137.971 110.911 126.416 1.00 0.00 ? 1628 ARG B CA 2  
ATOM 3409   C CA . ARG B 1 1629 ? 140.155 108.061 127.813 1.00 0.00 ? 1629 ARG B CA 2  
ATOM 3410   C CA . ASP B 1 1630 ? 137.719 105.369 126.982 1.00 0.00 ? 1630 ASP B CA 2  
ATOM 3411   C CA . VAL B 1 1631 ? 137.541 106.069 123.180 1.00 0.00 ? 1631 VAL B CA 2  
ATOM 3412   C CA . GLU B 1 1632 ? 140.023 103.227 122.421 1.00 0.00 ? 1632 GLU B CA 2  
ATOM 3413   C CA . LYS B 1 1633 ? 137.625 100.679 123.934 1.00 0.00 ? 1633 LYS B CA 2  
ATOM 3414   C CA . PHE B 1 1634 ? 134.455 102.134 122.300 1.00 0.00 ? 1634 PHE B CA 2  
ATOM 3415   C CA . LEU B 1 1635 ? 135.777 102.326 118.813 1.00 0.00 ? 1635 LEU B CA 2  
ATOM 3416   C CA . SER B 1 1636 ? 138.195 99.334  118.525 1.00 0.00 ? 1636 SER B CA 2  
ATOM 3417   C CA . LYS B 1 1637 ? 138.480 96.502  117.227 1.00 0.00 ? 1637 LYS B CA 2  
ATOM 3418   C CA . LYS B 1 1638 ? 135.057 96.645  115.401 1.00 0.00 ? 1638 LYS B CA 2  
ATOM 3419   C CA . ARG B 1 1639 ? 136.650 99.448  113.502 1.00 0.00 ? 1639 ARG B CA 2  
ATOM 3420   C CA . LYS B 1 1640 ? 140.303 100.462 113.642 1.00 0.00 ? 1640 LYS B CA 2  
ATOM 3421   C CA . PHE B 1 1641 ? 140.876 103.843 115.285 1.00 0.00 ? 1641 PHE B CA 2  
ATOM 3422   C CA . PRO B 1 1642 ? 144.370 104.822 116.399 1.00 0.00 ? 1642 PRO B CA 2  
ATOM 3423   C CA . LYS B 1 1643 ? 144.907 107.747 118.835 1.00 0.00 ? 1643 LYS B CA 2  
ATOM 3424   C CA . ASN B 1 1644 ? 145.293 110.612 116.284 1.00 0.00 ? 1644 ASN B CA 2  
ATOM 3425   C CA . TYR B 1 1645 ? 142.217 109.306 114.428 1.00 0.00 ? 1645 TYR B CA 2  
ATOM 3426   C CA . MET B 1 1646 ? 140.458 109.301 117.822 1.00 0.00 ? 1646 MET B CA 2  
ATOM 3427   C CA . SER B 1 1647 ? 141.203 113.010 118.463 1.00 0.00 ? 1647 SER B CA 2  
ATOM 3428   C CA . GLN B 1 1648 ? 139.914 113.989 114.973 1.00 0.00 ? 1648 GLN B CA 2  
ATOM 3429   C CA . TYR B 1 1649 ? 136.564 112.080 115.084 1.00 0.00 ? 1649 TYR B CA 2  
ATOM 3430   C CA . PHE B 1 1650 ? 135.720 114.136 118.183 1.00 0.00 ? 1650 PHE B CA 2  
ATOM 3431   C CA . LYS B 1 1651 ? 136.260 117.265 116.043 1.00 0.00 ? 1651 LYS B CA 2  
ATOM 3432   C CA . LEU B 1 1652 ? 133.862 115.723 113.478 1.00 0.00 ? 1652 LEU B CA 2  
ATOM 3433   C CA . LEU B 1 1653 ? 131.255 115.216 116.292 1.00 0.00 ? 1653 LEU B CA 2  
ATOM 3434   C CA . GLU B 1 1654 ? 131.701 118.895 117.286 1.00 0.00 ? 1654 GLU B CA 2  
ATOM 3435   C CA . LYS B 1 1655 ? 131.302 119.925 113.640 1.00 0.00 ? 1655 LYS B CA 2  
ATOM 3436   C CA . PHE B 1 1656 ? 128.217 117.657 113.162 1.00 0.00 ? 1656 PHE B CA 2  
ATOM 3437   C CA . GLN B 1 1657 ? 126.846 119.314 116.372 1.00 0.00 ? 1657 GLN B CA 2  
ATOM 3438   C CA . ILE B 1 1658 ? 126.505 116.011 118.230 1.00 0.00 ? 1658 ILE B CA 2  
ATOM 3439   C CA . ALA B 1 1659 ? 128.730 116.974 121.164 1.00 0.00 ? 1659 ALA B CA 2  
ATOM 3440   C CA . LEU B 1 1660 ? 130.559 119.872 122.859 1.00 0.00 ? 1660 LEU B CA 2  
ATOM 3441   C CA . PRO B 1 1661 ? 133.644 120.087 125.163 1.00 0.00 ? 1661 PRO B CA 2  
ATOM 3442   C CA . ILE B 1 1662 ? 133.324 121.309 128.793 1.00 0.00 ? 1662 ILE B CA 2  
ATOM 3443   C CA . GLY B 1 1663 ? 137.118 121.224 129.336 1.00 0.00 ? 1663 GLY B CA 2  
ATOM 3444   C CA . GLU B 1 1664 ? 137.956 118.319 131.692 1.00 0.00 ? 1664 GLU B CA 2  
ATOM 3445   C CA . GLU B 1 1665 ? 138.452 115.656 128.922 1.00 0.00 ? 1665 GLU B CA 2  
ATOM 3446   C CA . TYR B 1 1666 ? 134.705 115.050 129.316 1.00 0.00 ? 1666 TYR B CA 2  
ATOM 3447   C CA . LEU B 1 1667 ? 132.265 115.892 126.509 1.00 0.00 ? 1667 LEU B CA 2  
ATOM 3448   C CA . LEU B 1 1668 ? 128.477 116.262 126.551 1.00 0.00 ? 1668 LEU B CA 2  
ATOM 3449   C CA . VAL B 1 1669 ? 126.303 114.427 123.983 1.00 0.00 ? 1669 VAL B CA 2  
ATOM 3450   C CA . ILE B 1 1690 ? 152.972 151.509 116.603 1.00 0.00 ? 1690 ILE B CA 2  
ATOM 3451   C CA . ILE B 1 1691 ? 149.544 150.170 115.402 1.00 0.00 ? 1691 ILE B CA 2  
ATOM 3452   C CA . ILE B 1 1692 ? 146.943 150.843 118.091 1.00 0.00 ? 1692 ILE B CA 2  
ATOM 3453   C CA . ARG B 1 1693 ? 143.378 149.487 117.895 1.00 0.00 ? 1693 ARG B CA 2  
ATOM 3454   C CA . LEU B 1 1694 ? 140.819 150.005 120.700 1.00 0.00 ? 1694 LEU B CA 2  
ATOM 3455   C CA . TYR B 1 1695 ? 137.539 148.085 121.344 1.00 0.00 ? 1695 TYR B CA 2  
ATOM 3456   C CA . GLU B 1 1696 ? 134.801 149.798 123.480 1.00 0.00 ? 1696 GLU B CA 2  
ATOM 3457   C CA . MET B 1 1697 ? 132.355 147.460 125.290 1.00 0.00 ? 1697 MET B CA 2  
ATOM 3458   C CA . PRO B 1 1698 ? 129.233 148.810 127.295 1.00 0.00 ? 1698 PRO B CA 2  
ATOM 3459   C CA . TYR B 1 1699 ? 129.960 145.889 129.513 1.00 0.00 ? 1699 TYR B CA 2  
ATOM 3460   C CA . PHE B 1 1700 ? 133.487 144.372 129.494 1.00 0.00 ? 1700 PHE B CA 2  
ATOM 3461   C CA . PRO B 1 1701 ? 133.275 140.731 130.835 1.00 0.00 ? 1701 PRO B CA 2  
ATOM 3462   C CA . MET B 1 1702 ? 136.054 140.072 133.364 1.00 0.00 ? 1702 MET B CA 2  
ATOM 3463   C CA . GLY B 1 1703 ? 136.546 136.684 131.693 1.00 0.00 ? 1703 GLY B CA 2  
ATOM 3464   C CA . PHE B 1 1704 ? 137.714 138.200 128.345 1.00 0.00 ? 1704 PHE B CA 2  
ATOM 3465   C CA . TRP B 1 1705 ? 141.377 138.697 129.247 1.00 0.00 ? 1705 TRP B CA 2  
ATOM 3466   C CA . SER B 1 1706 ? 141.608 135.473 131.183 1.00 0.00 ? 1706 SER B CA 2  
ATOM 3467   C CA . ARG B 1 1707 ? 140.199 133.540 128.214 1.00 0.00 ? 1707 ARG B CA 2  
ATOM 3468   C CA . LEU B 1 1708 ? 142.281 135.393 125.605 1.00 0.00 ? 1708 LEU B CA 2  
ATOM 3469   C CA . ILE B 1 1709 ? 145.401 134.646 127.717 1.00 0.00 ? 1709 ILE B CA 2  
ATOM 3470   C CA . ASN B 1 1710 ? 144.412 130.938 127.459 1.00 0.00 ? 1710 ASN B CA 2  
ATOM 3471   C CA . ARG B 1 1711 ? 143.817 131.070 123.650 1.00 0.00 ? 1711 ARG B CA 2  
ATOM 3472   C CA . LEU B 1 1712 ? 147.194 132.819 123.257 1.00 0.00 ? 1712 LEU B CA 2  
ATOM 3473   C CA . LEU B 1 1713 ? 149.278 130.995 125.969 1.00 0.00 ? 1713 LEU B CA 2  
ATOM 3474   C CA . GLU B 1 1714 ? 151.968 129.894 123.516 1.00 0.00 ? 1714 GLU B CA 2  
ATOM 3475   C CA . ILE B 1 1715 ? 152.915 133.462 122.444 1.00 0.00 ? 1715 ILE B CA 2  
ATOM 3476   C CA . SER B 1 1716 ? 153.203 135.087 125.913 1.00 0.00 ? 1716 SER B CA 2  
ATOM 3477   C CA . PRO B 1 1717 ? 156.849 134.078 126.663 1.00 0.00 ? 1717 PRO B CA 2  
ATOM 3478   C CA . TYR B 1 1718 ? 157.604 134.226 122.934 1.00 0.00 ? 1718 TYR B CA 2  
ATOM 3479   C CA . MET B 1 1719 ? 157.064 132.065 119.880 1.00 0.00 ? 1719 MET B CA 2  
ATOM 3480   C CA . LEU B 1 1720 ? 160.178 133.240 117.917 1.00 0.00 ? 1720 LEU B CA 2  
ATOM 3481   C CA . SER B 1 1721 ? 163.708 132.383 118.953 1.00 0.00 ? 1721 SER B CA 2  
ATOM 3482   C CA . GLY B 1 1722 ? 164.475 135.941 117.635 1.00 0.00 ? 1722 GLY B CA 2  
ATOM 3483   C CA . ARG B 1 1723 ? 163.667 137.957 120.714 1.00 0.00 ? 1723 ARG B CA 2  
ATOM 3484   C CA . GLU B 1 1724 ? 164.834 141.587 120.920 1.00 0.00 ? 1724 GLU B CA 2  
ATOM 3485   C CA . ARG B 1 1725 ? 163.078 142.908 124.028 1.00 0.00 ? 1725 ARG B CA 2  
ATOM 3486   C CA . ALA B 1 1726 ? 163.507 141.138 127.391 1.00 0.00 ? 1726 ALA B CA 2  
ATOM 3487   C CA . LEU B 1 1727 ? 160.644 142.998 129.100 1.00 0.00 ? 1727 LEU B CA 2  
ATOM 3488   C CA . ARG B 1 1728 ? 157.522 142.538 126.954 1.00 0.00 ? 1728 ARG B CA 2  
ATOM 3489   C CA . PRO B 1 1729 ? 157.327 138.687 126.520 1.00 0.00 ? 1729 PRO B CA 2  
ATOM 3490   C CA . ASN B 1 1730 ? 158.726 136.377 129.377 1.00 0.00 ? 1730 ASN B CA 2  
ATOM 3491   C CA . ARG B 1 1731 ? 155.765 135.621 131.666 1.00 0.00 ? 1731 ARG B CA 2  
ATOM 3492   C CA . MET B 1 1732 ? 154.622 139.146 131.148 1.00 0.00 ? 1732 MET B CA 2  
ATOM 3493   C CA . TYR B 1 1733 ? 151.038 138.669 131.749 1.00 0.00 ? 1733 TYR B CA 2  
ATOM 3494   C CA . TRP B 1 1734 ? 148.954 140.277 134.400 1.00 0.00 ? 1734 TRP B CA 2  
ATOM 3495   C CA . ARG B 1 1735 ? 145.307 140.550 135.467 1.00 0.00 ? 1735 ARG B CA 2  
ATOM 3496   C CA . GLN B 1 1736 ? 144.579 143.317 132.900 1.00 0.00 ? 1736 GLN B CA 2  
ATOM 3497   C CA . GLY B 1 1737 ? 146.831 142.268 129.979 1.00 0.00 ? 1737 GLY B CA 2  
ATOM 3498   C CA . ILE B 1 1738 ? 149.582 140.374 128.203 1.00 0.00 ? 1738 ILE B CA 2  
ATOM 3499   C CA . TYR B 1 1739 ? 152.522 140.819 125.825 1.00 0.00 ? 1739 TYR B CA 2  
ATOM 3500   C CA . LEU B 1 1740 ? 152.501 138.580 122.799 1.00 0.00 ? 1740 LEU B CA 2  
ATOM 3501   C CA . ASN B 1 1741 ? 155.345 137.704 120.394 1.00 0.00 ? 1741 ASN B CA 2  
ATOM 3502   C CA . TRP B 1 1742 ? 155.018 135.476 117.296 1.00 0.00 ? 1742 TRP B CA 2  
ATOM 3503   C CA . SER B 1 1743 ? 157.256 133.984 114.610 1.00 0.00 ? 1743 SER B CA 2  
ATOM 3504   C CA . PRO B 1 1744 ? 158.146 135.457 112.088 1.00 0.00 ? 1744 PRO B CA 2  
ATOM 3505   C CA . GLU B 1 1745 ? 158.829 138.417 111.844 1.00 0.00 ? 1745 GLU B CA 2  
ATOM 3506   C CA . ALA B 1 1746 ? 159.165 138.983 115.659 1.00 0.00 ? 1746 ALA B CA 2  
ATOM 3507   C CA . TYR B 1 1747 ? 156.253 141.290 116.060 1.00 0.00 ? 1747 TYR B CA 2  
ATOM 3508   C CA . CYS B 1 1748 ? 155.458 142.288 119.687 1.00 0.00 ? 1748 CYS B CA 2  
ATOM 3509   C CA . LEU B 1 1749 ? 151.826 142.966 120.710 1.00 0.00 ? 1749 LEU B CA 2  
ATOM 3510   C CA . VAL B 1 1750 ? 150.534 144.365 123.995 1.00 0.00 ? 1750 VAL B CA 2  
ATOM 3511   C CA . GLY B 1 1751 ? 146.939 143.695 124.839 1.00 0.00 ? 1751 GLY B CA 2  
ATOM 3512   C CA . SER B 1 1752 ? 145.587 145.699 127.781 1.00 0.00 ? 1752 SER B CA 2  
ATOM 3513   C CA . GLU B 1 1753 ? 141.837 146.009 128.442 1.00 0.00 ? 1753 GLU B CA 2  
ATOM 3514   C CA . VAL B 1 1754 ? 140.411 146.614 125.037 1.00 0.00 ? 1754 VAL B CA 2  
ATOM 3515   C CA . LEU B 1 1755 ? 143.628 148.238 123.778 1.00 0.00 ? 1755 LEU B CA 2  
ATOM 3516   C CA . ASP B 1 1756 ? 145.889 146.390 121.325 1.00 0.00 ? 1756 ASP B CA 2  
ATOM 3517   C CA . ASN B 1 1757 ? 149.241 148.121 120.545 1.00 0.00 ? 1757 ASN B CA 2  
ATOM 3518   C CA . HIS B 1 1758 ? 151.671 146.577 118.044 1.00 0.00 ? 1758 HIS B CA 2  
ATOM 3519   C CA . PRO B 1 1759 ? 155.379 147.238 116.856 1.00 0.00 ? 1759 PRO B CA 2  
ATOM 3520   C CA . GLU B 1 1760 ? 156.870 145.525 113.635 1.00 0.00 ? 1760 GLU B CA 2  
ATOM 3521   C CA . SER B 1 1761 ? 156.283 145.651 109.834 1.00 0.00 ? 1761 SER B CA 2  
ATOM 3522   C CA . PHE B 1 1762 ? 153.883 142.591 109.947 1.00 0.00 ? 1762 PHE B CA 2  
ATOM 3523   C CA . LEU B 1 1763 ? 151.466 144.569 112.100 1.00 0.00 ? 1763 LEU B CA 2  
ATOM 3524   C CA . LYS B 1 1764 ? 148.408 144.282 110.050 1.00 0.00 ? 1764 LYS B CA 2  
ATOM 3525   C CA . ILE B 1 1765 ? 148.270 140.434 109.890 1.00 0.00 ? 1765 ILE B CA 2  
ATOM 3526   C CA . THR B 1 1766 ? 148.933 140.085 113.632 1.00 0.00 ? 1766 THR B CA 2  
ATOM 3527   C CA . VAL B 1 1767 ? 146.087 142.330 114.669 1.00 0.00 ? 1767 VAL B CA 2  
ATOM 3528   C CA . PRO B 1 1768 ? 143.303 140.126 112.920 1.00 0.00 ? 1768 PRO B CA 2  
ATOM 3529   C CA . SER B 1 1769 ? 144.512 136.986 114.561 1.00 0.00 ? 1769 SER B CA 2  
ATOM 3530   C CA . CYS B 1 1770 ? 144.316 138.770 117.960 1.00 0.00 ? 1770 CYS B CA 2  
ATOM 3531   C CA . ARG B 1 1771 ? 141.104 140.610 116.846 1.00 0.00 ? 1771 ARG B CA 2  
ATOM 3532   C CA . LYS B 1 1772 ? 139.570 137.316 115.686 1.00 0.00 ? 1772 LYS B CA 2  
ATOM 3533   C CA . GLY B 1 1773 ? 140.390 135.566 119.001 1.00 0.00 ? 1773 GLY B CA 2  
ATOM 3534   C CA . CYS B 1 1774 ? 138.786 138.460 120.887 1.00 0.00 ? 1774 CYS B CA 2  
ATOM 3535   C CA . ILE B 1 1775 ? 135.686 138.384 118.611 1.00 0.00 ? 1775 ILE B CA 2  
ATOM 3536   C CA . LEU B 1 1776 ? 135.425 134.579 119.157 1.00 0.00 ? 1776 LEU B CA 2  
ATOM 3537   C CA . LEU B 1 1777 ? 135.303 135.104 122.944 1.00 0.00 ? 1777 LEU B CA 2  
ATOM 3538   C CA . GLY B 1 1778 ? 132.790 137.943 122.547 1.00 0.00 ? 1778 GLY B CA 2  
ATOM 3539   C CA . GLN B 1 1779 ? 130.389 135.597 120.709 1.00 0.00 ? 1779 GLN B CA 2  
ATOM 3540   C CA . VAL B 1 1780 ? 129.989 133.475 123.911 1.00 0.00 ? 1780 VAL B CA 2  
ATOM 3541   C CA . VAL B 1 1781 ? 128.168 136.471 125.473 1.00 0.00 ? 1781 VAL B CA 2  
ATOM 3542   C CA . ASP B 1 1782 ? 124.675 137.324 124.124 1.00 0.00 ? 1782 ASP B CA 2  
ATOM 3543   C CA . HIS B 1 1783 ? 123.902 141.034 123.349 1.00 0.00 ? 1783 HIS B CA 2  
ATOM 3544   C CA . ILE B 1 1784 ? 127.528 142.290 123.778 1.00 0.00 ? 1784 ILE B CA 2  
ATOM 3545   C CA . ASP B 1 1785 ? 128.116 145.610 121.935 1.00 0.00 ? 1785 ASP B CA 2  
ATOM 3546   C CA . SER B 1 1786 ? 131.685 146.376 120.780 1.00 0.00 ? 1786 SER B CA 2  
ATOM 3547   C CA . LEU B 1 1787 ? 132.662 149.644 119.076 1.00 0.00 ? 1787 LEU B CA 2  
ATOM 3548   C CA . MET B 1 1788 ? 136.086 149.687 117.446 1.00 0.00 ? 1788 MET B CA 2  
ATOM 3549   C CA . GLU B 1 1789 ? 138.308 152.780 117.465 1.00 0.00 ? 1789 GLU B CA 2  
ATOM 3550   C CA . GLU B 1 1790 ? 141.571 154.002 116.028 1.00 0.00 ? 1790 GLU B CA 2  
ATOM 3551   C CA . TRP B 1 1791 ? 143.709 156.757 117.510 1.00 0.00 ? 1791 TRP B CA 2  
ATOM 3552   C CA . PHE B 1 1792 ? 144.370 159.800 115.332 1.00 0.00 ? 1792 PHE B CA 2  
ATOM 3553   C CA . PRO B 1 1793 ? 148.037 160.113 113.967 1.00 0.00 ? 1793 PRO B CA 2  
ATOM 3554   C CA . GLY B 1 1794 ? 149.932 162.503 116.245 1.00 0.00 ? 1794 GLY B CA 2  
ATOM 3555   C CA . LEU B 1 1795 ? 147.080 162.575 118.787 1.00 0.00 ? 1795 LEU B CA 2  
ATOM 3556   C CA . LEU B 1 1796 ? 147.027 159.328 120.828 1.00 0.00 ? 1796 LEU B CA 2  
ATOM 3557   C CA . GLU B 1 1797 ? 143.968 160.260 122.968 1.00 0.00 ? 1797 GLU B CA 2  
ATOM 3558   C CA . ILE B 1 1798 ? 141.749 161.432 120.043 1.00 0.00 ? 1798 ILE B CA 2  
ATOM 3559   C CA . ASP B 1 1799 ? 139.847 158.453 118.638 1.00 0.00 ? 1799 ASP B CA 2  
ATOM 3560   C CA . ILE B 1 1800 ? 137.883 157.900 115.423 1.00 0.00 ? 1800 ILE B CA 2  
ATOM 3561   C CA . CYS B 1 1801 ? 135.382 155.058 115.052 1.00 0.00 ? 1801 CYS B CA 2  
ATOM 3562   C CA . GLY B 1 1802 ? 136.429 152.411 112.441 1.00 0.00 ? 1802 GLY B CA 2  
ATOM 3563   C CA . GLU B 1 1803 ? 132.793 152.240 111.301 1.00 0.00 ? 1803 GLU B CA 2  
ATOM 3564   C CA . GLY B 1 1804 ? 133.071 156.017 110.631 1.00 0.00 ? 1804 GLY B CA 2  
ATOM 3565   C CA . GLU B 1 1805 ? 136.089 155.615 108.308 1.00 0.00 ? 1805 GLU B CA 2  
ATOM 3566   C CA . THR B 1 1806 ? 134.538 152.647 106.406 1.00 0.00 ? 1806 THR B CA 2  
ATOM 3567   C CA . LEU B 1 1807 ? 131.357 154.733 105.951 1.00 0.00 ? 1807 LEU B CA 2  
ATOM 3568   C CA . LEU B 1 1808 ? 133.446 157.673 104.679 1.00 0.00 ? 1808 LEU B CA 2  
ATOM 3569   C CA . LYS B 1 1809 ? 135.067 155.299 102.096 1.00 0.00 ? 1809 LYS B CA 2  
ATOM 3570   C CA . LYS B 1 1810 ? 131.645 153.989 100.959 1.00 0.00 ? 1810 LYS B CA 2  
ATOM 3571   C CA . TRP B 1 1811 ? 130.572 157.642 100.566 1.00 0.00 ? 1811 TRP B CA 2  
ATOM 3572   C CA . ALA B 1 1812 ? 133.656 158.186 98.346  1.00 0.00 ? 1812 ALA B CA 2  
ATOM 3573   C CA . LEU B 1 1813 ? 135.333 160.628 100.768 1.00 0.00 ? 1813 LEU B CA 2  
ATOM 3574   C CA . TYR B 1 1814 ? 139.029 160.515 101.642 1.00 0.00 ? 1814 TYR B CA 2  
ATOM 3575   C CA . SER B 1 1815 ? 139.034 163.342 104.209 1.00 0.00 ? 1815 SER B CA 2  
ATOM 3576   C CA . PHE B 1 1816 ? 138.237 162.841 107.837 1.00 0.00 ? 1816 PHE B CA 2  
ATOM 3577   C CA . ASN B 1 1817 ? 138.067 166.356 109.327 1.00 0.00 ? 1817 ASN B CA 2  
ATOM 3578   C CA . ASP B 1 1818 ? 138.778 166.886 113.004 1.00 0.00 ? 1818 ASP B CA 2  
ATOM 3579   C CA . GLY B 1 1819 ? 136.936 170.116 113.922 1.00 0.00 ? 1819 GLY B CA 2  
ATOM 3580   C CA . GLU B 1 1820 ? 138.194 170.428 117.522 1.00 0.00 ? 1820 GLU B CA 2  
ATOM 3581   C CA . GLU B 1 1821 ? 141.837 169.833 116.492 1.00 0.00 ? 1821 GLU B CA 2  
ATOM 3582   C CA . HIS B 1 1822 ? 141.436 171.779 113.196 1.00 0.00 ? 1822 HIS B CA 2  
ATOM 3583   C CA . GLN B 1 1823 ? 143.418 169.120 111.262 1.00 0.00 ? 1823 GLN B CA 2  
ATOM 3584   C CA . LYS B 1 1824 ? 142.334 166.839 108.380 1.00 0.00 ? 1824 LYS B CA 2  
ATOM 3585   C CA . ILE B 1 1825 ? 143.462 163.249 107.899 1.00 0.00 ? 1825 ILE B CA 2  
ATOM 3586   C CA . LEU B 1 1826 ? 143.560 160.768 105.078 1.00 0.00 ? 1826 LEU B CA 2  
ATOM 3587   C CA . LEU B 1 1827 ? 140.883 158.144 105.641 1.00 0.00 ? 1827 LEU B CA 2  
ATOM 3588   C CA . ASP B 1 1828 ? 142.540 155.565 103.401 1.00 0.00 ? 1828 ASP B CA 2  
ATOM 3589   C CA . ASP B 1 1829 ? 146.034 156.057 104.902 1.00 0.00 ? 1829 ASP B CA 2  
ATOM 3590   C CA . LEU B 1 1830 ? 144.879 155.370 108.498 1.00 0.00 ? 1830 LEU B CA 2  
ATOM 3591   C CA . MET B 1 1831 ? 142.477 152.595 107.353 1.00 0.00 ? 1831 MET B CA 2  
ATOM 3592   C CA . LYS B 1 1832 ? 145.078 150.674 105.249 1.00 0.00 ? 1832 LYS B CA 2  
ATOM 3593   C CA . LYS B 1 1833 ? 147.667 150.684 108.089 1.00 0.00 ? 1833 LYS B CA 2  
ATOM 3594   C CA . ALA B 1 1834 ? 145.788 147.719 109.548 1.00 0.00 ? 1834 ALA B CA 2  
ATOM 3595   C CA . GLU B 1 1835 ? 144.434 144.475 107.947 1.00 0.00 ? 1835 GLU B CA 2  
ATOM 3596   C CA . GLU B 1 1836 ? 141.267 146.178 106.688 1.00 0.00 ? 1836 GLU B CA 2  
ATOM 3597   C CA . GLY B 1 1837 ? 142.730 147.044 103.260 1.00 0.00 ? 1837 GLY B CA 2  
ATOM 3598   C CA . PHE B 1 1883 ? 169.121 161.190 86.894  1.00 0.00 ? 1883 PHE B CA 2  
ATOM 3599   C CA . LEU B 1 1884 ? 165.815 159.214 86.631  1.00 0.00 ? 1884 LEU B CA 2  
ATOM 3600   C CA . LEU B 1 1885 ? 165.659 155.829 84.759  1.00 0.00 ? 1885 LEU B CA 2  
ATOM 3601   C CA . GLY B 1 1886 ? 162.505 154.402 86.391  1.00 0.00 ? 1886 GLY B CA 2  
ATOM 3602   C CA . ASP B 1 1887 ? 160.587 151.479 84.918  1.00 0.00 ? 1887 ASP B CA 2  
ATOM 3603   C CA . GLY B 1 1888 ? 159.694 150.358 88.521  1.00 0.00 ? 1888 GLY B CA 2  
ATOM 3604   C CA . SER B 1 1889 ? 157.025 148.022 89.968  1.00 0.00 ? 1889 SER B CA 2  
ATOM 3605   C CA . PHE B 1 1890 ? 156.152 150.208 92.979  1.00 0.00 ? 1890 PHE B CA 2  
ATOM 3606   C CA . GLY B 1 1891 ? 157.979 153.469 92.248  1.00 0.00 ? 1891 GLY B CA 2  
ATOM 3607   C CA . SER B 1 1892 ? 160.712 155.377 90.445  1.00 0.00 ? 1892 SER B CA 2  
ATOM 3608   C CA . VAL B 1 1893 ? 164.305 154.174 89.856  1.00 0.00 ? 1893 VAL B CA 2  
ATOM 3609   C CA . TYR B 1 1894 ? 167.140 156.751 89.966  1.00 0.00 ? 1894 TYR B CA 2  
ATOM 3610   C CA . ARG B 1 1895 ? 170.833 156.670 89.101  1.00 0.00 ? 1895 ARG B CA 2  
ATOM 3611   C CA . ALA B 1 1896 ? 173.122 158.361 91.625  1.00 0.00 ? 1896 ALA B CA 2  
ATOM 3612   C CA . ALA B 1 1897 ? 176.336 157.849 93.617  1.00 0.00 ? 1897 ALA B CA 2  
ATOM 3613   C CA . TYR B 1 1898 ? 177.371 157.265 97.273  1.00 0.00 ? 1898 TYR B CA 2  
ATOM 3614   C CA . GLU B 1 1899 ? 179.244 160.445 98.372  1.00 0.00 ? 1899 GLU B CA 2  
ATOM 3615   C CA . GLY B 1 1900 ? 181.947 158.534 100.351 1.00 0.00 ? 1900 GLY B CA 2  
ATOM 3616   C CA . GLU B 1 1901 ? 183.048 156.012 97.656  1.00 0.00 ? 1901 GLU B CA 2  
ATOM 3617   C CA . GLU B 1 1902 ? 181.905 157.518 94.311  1.00 0.00 ? 1902 GLU B CA 2  
ATOM 3618   C CA . VAL B 1 1903 ? 180.282 154.012 93.813  1.00 0.00 ? 1903 VAL B CA 2  
ATOM 3619   C CA . ALA B 1 1904 ? 177.527 154.256 91.212  1.00 0.00 ? 1904 ALA B CA 2  
ATOM 3620   C CA . VAL B 1 1905 ? 174.195 153.396 92.670  1.00 0.00 ? 1905 VAL B CA 2  
ATOM 3621   C CA . LYS B 1 1906 ? 170.597 152.579 91.701  1.00 0.00 ? 1906 LYS B CA 2  
ATOM 3622   C CA . ILE B 1 1907 ? 167.828 153.937 93.989  1.00 0.00 ? 1907 ILE B CA 2  
ATOM 3623   C CA . PHE B 1 1908 ? 164.327 152.443 93.998  1.00 0.00 ? 1908 PHE B CA 2  
ATOM 3624   C CA . ASN B 1 1909 ? 161.700 154.529 95.863  1.00 0.00 ? 1909 ASN B CA 2  
ATOM 3625   C CA . LYS B 1 1910 ? 158.020 155.070 96.869  1.00 0.00 ? 1910 LYS B CA 2  
ATOM 3626   C CA . HIS B 1 1911 ? 157.780 151.558 98.013  1.00 0.00 ? 1911 HIS B CA 2  
ATOM 3627   C CA . THR B 1 1912 ? 157.607 152.181 101.795 1.00 0.00 ? 1912 THR B CA 2  
ATOM 3628   C CA . SER B 1 1913 ? 154.238 150.745 102.737 1.00 0.00 ? 1913 SER B CA 2  
ATOM 3629   C CA . LEU B 1 1914 ? 154.252 147.770 100.382 1.00 0.00 ? 1914 LEU B CA 2  
ATOM 3630   C CA . ARG B 1 1915 ? 154.459 144.104 101.334 1.00 0.00 ? 1915 ARG B CA 2  
ATOM 3631   C CA . LEU B 1 1916 ? 156.558 143.411 98.172  1.00 0.00 ? 1916 LEU B CA 2  
ATOM 3632   C CA . LEU B 1 1917 ? 159.260 146.042 99.131  1.00 0.00 ? 1917 LEU B CA 2  
ATOM 3633   C CA . ARG B 1 1918 ? 159.410 144.657 102.604 1.00 0.00 ? 1918 ARG B CA 2  
ATOM 3634   C CA . GLN B 1 1919 ? 160.009 141.162 101.288 1.00 0.00 ? 1919 GLN B CA 2  
ATOM 3635   C CA . GLU B 1 1920 ? 162.636 142.470 98.827  1.00 0.00 ? 1920 GLU B CA 2  
ATOM 3636   C CA . LEU B 1 1921 ? 164.512 144.293 101.654 1.00 0.00 ? 1921 LEU B CA 2  
ATOM 3637   C CA . VAL B 1 1922 ? 164.281 141.233 103.984 1.00 0.00 ? 1922 VAL B CA 2  
ATOM 3638   C CA . VAL B 1 1923 ? 165.511 138.775 101.274 1.00 0.00 ? 1923 VAL B CA 2  
ATOM 3639   C CA . LEU B 1 1924 ? 168.364 141.046 100.063 1.00 0.00 ? 1924 LEU B CA 2  
ATOM 3640   C CA . CYS B 1 1925 ? 169.651 141.839 103.616 1.00 0.00 ? 1925 CYS B CA 2  
ATOM 3641   C CA . HIS B 1 1926 ? 171.245 138.363 104.016 1.00 0.00 ? 1926 HIS B CA 2  
ATOM 3642   C CA . LEU B 1 1927 ? 172.530 137.960 100.408 1.00 0.00 ? 1927 LEU B CA 2  
ATOM 3643   C CA . HIS B 1 1928 ? 176.180 138.829 99.670  1.00 0.00 ? 1928 HIS B CA 2  
ATOM 3644   C CA . HIS B 1 1929 ? 177.511 137.145 96.498  1.00 0.00 ? 1929 HIS B CA 2  
ATOM 3645   C CA . PRO B 1 1930 ? 179.218 138.582 93.350  1.00 0.00 ? 1930 PRO B CA 2  
ATOM 3646   C CA . SER B 1 1931 ? 176.563 137.286 90.926  1.00 0.00 ? 1931 SER B CA 2  
ATOM 3647   C CA . LEU B 1 1932 ? 173.634 138.728 92.924  1.00 0.00 ? 1932 LEU B CA 2  
ATOM 3648   C CA . ILE B 1 1933 ? 172.691 142.439 92.841  1.00 0.00 ? 1933 ILE B CA 2  
ATOM 3649   C CA . SER B 1 1934 ? 173.957 143.834 96.158  1.00 0.00 ? 1934 SER B CA 2  
ATOM 3650   C CA . LEU B 1 1935 ? 171.832 145.927 98.489  1.00 0.00 ? 1935 LEU B CA 2  
ATOM 3651   C CA . LEU B 1 1936 ? 173.962 148.768 99.886  1.00 0.00 ? 1936 LEU B CA 2  
ATOM 3652   C CA . ALA B 1 1937 ? 171.539 150.495 102.250 1.00 0.00 ? 1937 ALA B CA 2  
ATOM 3653   C CA . ALA B 1 1938 ? 168.012 151.689 103.034 1.00 0.00 ? 1938 ALA B CA 2  
ATOM 3654   C CA . GLY B 1 1939 ? 166.712 155.300 102.966 1.00 0.00 ? 1939 GLY B CA 2  
ATOM 3655   C CA . ILE B 1 1940 ? 163.575 156.861 104.517 1.00 0.00 ? 1940 ILE B CA 2  
ATOM 3656   C CA . ARG B 1 1941 ? 161.166 159.684 103.515 1.00 0.00 ? 1941 ARG B CA 2  
ATOM 3657   C CA . PRO B 1 1942 ? 160.354 158.124 101.075 1.00 0.00 ? 1942 PRO B CA 2  
ATOM 3658   C CA . ARG B 1 1943 ? 161.613 154.578 101.717 1.00 0.00 ? 1943 ARG B CA 2  
ATOM 3659   C CA . MET B 1 1944 ? 164.445 153.701 99.307  1.00 0.00 ? 1944 MET B CA 2  
ATOM 3660   C CA . LEU B 1 1945 ? 166.461 150.610 98.495  1.00 0.00 ? 1945 LEU B CA 2  
ATOM 3661   C CA . VAL B 1 1946 ? 169.926 151.656 97.393  1.00 0.00 ? 1946 VAL B CA 2  
ATOM 3662   C CA . MET B 1 1947 ? 171.360 148.922 95.119  1.00 0.00 ? 1947 MET B CA 2  
ATOM 3663   C CA . GLU B 1 1948 ? 174.633 148.562 93.151  1.00 0.00 ? 1948 GLU B CA 2  
ATOM 3664   C CA . LEU B 1 1949 ? 174.321 150.011 89.621  1.00 0.00 ? 1949 LEU B CA 2  
ATOM 3665   C CA . ALA B 1 1950 ? 174.743 147.357 86.919  1.00 0.00 ? 1950 ALA B CA 2  
ATOM 3666   C CA . SER B 1 1951 ? 175.882 149.194 83.808  1.00 0.00 ? 1951 SER B CA 2  
ATOM 3667   C CA . LYS B 1 1952 ? 175.177 147.146 80.644  1.00 0.00 ? 1952 LYS B CA 2  
ATOM 3668   C CA . GLY B 1 1953 ? 171.400 146.670 80.978  1.00 0.00 ? 1953 GLY B CA 2  
ATOM 3669   C CA . SER B 1 1954 ? 169.571 143.331 81.125  1.00 0.00 ? 1954 SER B CA 2  
ATOM 3670   C CA . LEU B 1 1955 ? 169.955 139.981 79.333  1.00 0.00 ? 1955 LEU B CA 2  
ATOM 3671   C CA . ASP B 1 1956 ? 166.499 140.158 77.660  1.00 0.00 ? 1956 ASP B CA 2  
ATOM 3672   C CA . ARG B 1 1957 ? 167.177 143.486 75.863  1.00 0.00 ? 1957 ARG B CA 2  
ATOM 3673   C CA . LEU B 1 1958 ? 170.691 142.434 74.825  1.00 0.00 ? 1958 LEU B CA 2  
ATOM 3674   C CA . LEU B 1 1959 ? 169.452 139.143 73.295  1.00 0.00 ? 1959 LEU B CA 2  
ATOM 3675   C CA . GLN B 1 1960 ? 167.006 141.189 71.129  1.00 0.00 ? 1960 GLN B CA 2  
ATOM 3676   C CA . GLN B 1 1961 ? 170.085 142.515 69.203  1.00 0.00 ? 1961 GLN B CA 2  
ATOM 3677   C CA . ASP B 1 1962 ? 170.173 139.698 66.540  1.00 0.00 ? 1962 ASP B CA 2  
ATOM 3678   C CA . LYS B 1 1963 ? 172.722 141.610 64.364  1.00 0.00 ? 1963 LYS B CA 2  
ATOM 3679   C CA . ALA B 1 1964 ? 175.324 141.462 67.171  1.00 0.00 ? 1964 ALA B CA 2  
ATOM 3680   C CA . SER B 1 1965 ? 175.192 137.894 68.507  1.00 0.00 ? 1965 SER B CA 2  
ATOM 3681   C CA . LEU B 1 1966 ? 176.905 137.135 71.829  1.00 0.00 ? 1966 LEU B CA 2  
ATOM 3682   C CA . THR B 1 1967 ? 180.093 135.144 71.233  1.00 0.00 ? 1967 THR B CA 2  
ATOM 3683   C CA . ARG B 1 1968 ? 180.151 131.582 72.588  1.00 0.00 ? 1968 ARG B CA 2  
ATOM 3684   C CA . THR B 1 1969 ? 182.865 132.159 75.267  1.00 0.00 ? 1969 THR B CA 2  
ATOM 3685   C CA . LEU B 1 1970 ? 180.785 134.994 76.682  1.00 0.00 ? 1970 LEU B CA 2  
ATOM 3686   C CA . GLN B 1 1971 ? 177.537 132.912 76.553  1.00 0.00 ? 1971 GLN B CA 2  
ATOM 3687   C CA . HIS B 1 1972 ? 179.348 130.320 78.731  1.00 0.00 ? 1972 HIS B CA 2  
ATOM 3688   C CA . ARG B 1 1973 ? 180.439 133.078 81.170  1.00 0.00 ? 1973 ARG B CA 2  
ATOM 3689   C CA . ILE B 1 1974 ? 176.776 134.283 81.423  1.00 0.00 ? 1974 ILE B CA 2  
ATOM 3690   C CA . ALA B 1 1975 ? 175.506 130.704 82.010  1.00 0.00 ? 1975 ALA B CA 2  
ATOM 3691   C CA . LEU B 1 1976 ? 178.047 130.030 84.812  1.00 0.00 ? 1976 LEU B CA 2  
ATOM 3692   C CA . HIS B 1 1977 ? 177.520 133.421 86.561  1.00 0.00 ? 1977 HIS B CA 2  
ATOM 3693   C CA . VAL B 1 1978 ? 173.756 132.922 86.783  1.00 0.00 ? 1978 VAL B CA 2  
ATOM 3694   C CA . ALA B 1 1979 ? 174.384 129.312 87.936  1.00 0.00 ? 1979 ALA B CA 2  
ATOM 3695   C CA . ASP B 1 1980 ? 176.738 130.465 90.762  1.00 0.00 ? 1980 ASP B CA 2  
ATOM 3696   C CA . GLY B 1 1981 ? 174.189 133.074 91.960  1.00 0.00 ? 1981 GLY B CA 2  
ATOM 3697   C CA . LEU B 1 1982 ? 171.460 130.400 92.035  1.00 0.00 ? 1982 LEU B CA 2  
ATOM 3698   C CA . ARG B 1 1983 ? 173.978 127.988 93.685  1.00 0.00 ? 1983 ARG B CA 2  
ATOM 3699   C CA . TYR B 1 1984 ? 174.675 130.566 96.441  1.00 0.00 ? 1984 TYR B CA 2  
ATOM 3700   C CA . LEU B 1 1985 ? 170.893 130.830 96.672  1.00 0.00 ? 1985 LEU B CA 2  
ATOM 3701   C CA . HIS B 1 1986 ? 170.600 127.051 97.074  1.00 0.00 ? 1986 HIS B CA 2  
ATOM 3702   C CA . SER B 1 1987 ? 172.891 127.355 100.164 1.00 0.00 ? 1987 SER B CA 2  
ATOM 3703   C CA . ALA B 1 1988 ? 170.603 129.953 101.796 1.00 0.00 ? 1988 ALA B CA 2  
ATOM 3704   C CA . MET B 1 1989 ? 167.343 128.013 100.939 1.00 0.00 ? 1989 MET B CA 2  
ATOM 3705   C CA . ILE B 1 1990 ? 165.698 130.952 99.105  1.00 0.00 ? 1990 ILE B CA 2  
ATOM 3706   C CA . ILE B 1 1991 ? 163.265 130.617 96.127  1.00 0.00 ? 1991 ILE B CA 2  
ATOM 3707   C CA . TYR B 1 1992 ? 163.374 133.537 93.635  1.00 0.00 ? 1992 TYR B CA 2  
ATOM 3708   C CA . ARG B 1 1993 ? 160.236 132.705 91.546  1.00 0.00 ? 1993 ARG B CA 2  
ATOM 3709   C CA . ASP B 1 1994 ? 160.739 135.409 88.865  1.00 0.00 ? 1994 ASP B CA 2  
ATOM 3710   C CA . LEU B 1 1995 ? 163.848 134.064 87.093  1.00 0.00 ? 1995 LEU B CA 2  
ATOM 3711   C CA . LYS B 1 1996 ? 163.584 135.293 83.484  1.00 0.00 ? 1996 LYS B CA 2  
ATOM 3712   C CA . PRO B 1 1997 ? 166.104 137.216 81.302  1.00 0.00 ? 1997 PRO B CA 2  
ATOM 3713   C CA . HIS B 1 1998 ? 164.710 140.689 82.168  1.00 0.00 ? 1998 HIS B CA 2  
ATOM 3714   C CA . ASN B 1 1999 ? 165.810 140.026 85.775  1.00 0.00 ? 1999 ASN B CA 2  
ATOM 3715   C CA . VAL B 1 2000 ? 169.373 139.073 84.760  1.00 0.00 ? 2000 VAL B CA 2  
ATOM 3716   C CA . LEU B 1 2001 ? 171.458 142.265 84.868  1.00 0.00 ? 2001 LEU B CA 2  
ATOM 3717   C CA . LEU B 1 2002 ? 174.642 142.566 82.896  1.00 0.00 ? 2002 LEU B CA 2  
ATOM 3718   C CA . PHE B 1 2003 ? 177.735 143.975 84.566  1.00 0.00 ? 2003 PHE B CA 2  
ATOM 3719   C CA . THR B 1 2004 ? 180.189 143.377 81.721  1.00 0.00 ? 2004 THR B CA 2  
ATOM 3720   C CA . LEU B 1 2005 ? 180.231 141.505 78.331  1.00 0.00 ? 2005 LEU B CA 2  
ATOM 3721   C CA . TYR B 1 2006 ? 184.054 141.153 78.079  1.00 0.00 ? 2006 TYR B CA 2  
ATOM 3722   C CA . PRO B 1 2007 ? 184.778 137.394 78.579  1.00 0.00 ? 2007 PRO B CA 2  
ATOM 3723   C CA . ASN B 1 2008 ? 187.711 138.030 81.001  1.00 0.00 ? 2008 ASN B CA 2  
ATOM 3724   C CA . ALA B 1 2009 ? 185.667 140.306 83.325  1.00 0.00 ? 2009 ALA B CA 2  
ATOM 3725   C CA . ALA B 1 2010 ? 185.430 139.450 87.037  1.00 0.00 ? 2010 ALA B CA 2  
ATOM 3726   C CA . ILE B 1 2011 ? 181.608 139.520 86.822  1.00 0.00 ? 2011 ILE B CA 2  
ATOM 3727   C CA . ILE B 1 2012 ? 179.406 139.367 83.674  1.00 0.00 ? 2012 ILE B CA 2  
ATOM 3728   C CA . ALA B 1 2013 ? 175.924 138.704 84.995  1.00 0.00 ? 2013 ALA B CA 2  
ATOM 3729   C CA . LYS B 1 2014 ? 174.038 139.238 88.220  1.00 0.00 ? 2014 LYS B CA 2  
ATOM 3730   C CA . ILE B 1 2015 ? 170.600 137.990 89.324  1.00 0.00 ? 2015 ILE B CA 2  
ATOM 3731   C CA . ALA B 1 2016 ? 168.186 140.819 90.278  1.00 0.00 ? 2016 ALA B CA 2  
ATOM 3732   C CA . ASP B 1 2017 ? 164.579 141.642 91.244  1.00 0.00 ? 2017 ASP B CA 2  
ATOM 3733   C CA . TYR B 1 2018 ? 163.787 139.481 94.249  1.00 0.00 ? 2018 TYR B CA 2  
ATOM 3734   C CA . GLY B 1 2019 ? 160.423 141.117 95.008  1.00 0.00 ? 2019 GLY B CA 2  
ATOM 3735   C CA . THR B 1 2020 ? 158.493 137.863 94.833  1.00 0.00 ? 2020 THR B CA 2  
ATOM 3736   C CA . ALA B 1 2021 ? 161.075 135.632 96.629  1.00 0.00 ? 2021 ALA B CA 2  
ATOM 3737   C CA . GLN B 1 2022 ? 160.452 133.122 99.485  1.00 0.00 ? 2022 GLN B CA 2  
ATOM 3738   C CA . TYR B 1 2023 ? 162.703 131.796 102.235 1.00 0.00 ? 2023 TYR B CA 2  
ATOM 3739   C CA . CYS B 1 2024 ? 160.729 129.413 104.420 1.00 0.00 ? 2024 CYS B CA 2  
ATOM 3740   C CA . CYS B 1 2025 ? 161.260 126.239 106.493 1.00 0.00 ? 2025 CYS B CA 2  
ATOM 3741   C CA . ARG B 1 2026 ? 157.771 125.166 105.390 1.00 0.00 ? 2026 ARG B CA 2  
ATOM 3742   C CA . MET B 1 2027 ? 156.415 124.280 101.958 1.00 0.00 ? 2027 MET B CA 2  
ATOM 3743   C CA . GLY B 1 2028 ? 156.168 127.190 99.453  1.00 0.00 ? 2028 GLY B CA 2  
ATOM 3744   C CA . ILE B 1 2029 ? 153.084 127.860 97.273  1.00 0.00 ? 2029 ILE B CA 2  
ATOM 3745   C CA . LYS B 1 2030 ? 151.990 130.434 94.576  1.00 0.00 ? 2030 LYS B CA 2  
ATOM 3746   C CA . THR B 1 2031 ? 149.430 131.201 91.708  1.00 0.00 ? 2031 THR B CA 2  
ATOM 3747   C CA . SER B 1 2032 ? 150.340 134.713 90.752  1.00 0.00 ? 2032 SER B CA 2  
ATOM 3748   C CA . GLU B 1 2033 ? 153.660 134.365 88.917  1.00 0.00 ? 2033 GLU B CA 2  
ATOM 3749   C CA . GLY B 1 2034 ? 151.454 133.974 85.833  1.00 0.00 ? 2034 GLY B CA 2  
ATOM 3750   C CA . THR B 1 2035 ? 154.276 134.216 83.188  1.00 0.00 ? 2035 THR B CA 2  
ATOM 3751   C CA . PRO B 1 2036 ? 154.358 130.462 82.503  1.00 0.00 ? 2036 PRO B CA 2  
ATOM 3752   C CA . GLY B 1 2037 ? 156.857 130.370 79.580  1.00 0.00 ? 2037 GLY B CA 2  
ATOM 3753   C CA . PHE B 1 2038 ? 159.592 130.697 82.233  1.00 0.00 ? 2038 PHE B CA 2  
ATOM 3754   C CA . ARG B 1 2039 ? 157.846 129.006 85.208  1.00 0.00 ? 2039 ARG B CA 2  
ATOM 3755   C CA . ALA B 1 2040 ? 157.798 125.408 86.446  1.00 0.00 ? 2040 ALA B CA 2  
ATOM 3756   C CA . PRO B 1 2041 ? 154.675 123.202 85.736  1.00 0.00 ? 2041 PRO B CA 2  
ATOM 3757   C CA . GLU B 1 2042 ? 153.312 123.673 89.309  1.00 0.00 ? 2042 GLU B CA 2  
ATOM 3758   C CA . VAL B 1 2043 ? 151.745 126.892 87.802  1.00 0.00 ? 2043 VAL B CA 2  
ATOM 3759   C CA . ALA B 1 2044 ? 148.535 124.894 87.505  1.00 0.00 ? 2044 ALA B CA 2  
ATOM 3760   C CA . ARG B 1 2045 ? 146.872 126.526 90.634  1.00 0.00 ? 2045 ARG B CA 2  
ATOM 3761   C CA . GLY B 1 2046 ? 147.372 127.727 94.339  1.00 0.00 ? 2046 GLY B CA 2  
ATOM 3762   C CA . ASN B 1 2047 ? 146.602 124.383 95.829  1.00 0.00 ? 2047 ASN B CA 2  
ATOM 3763   C CA . VAL B 1 2048 ? 150.044 122.817 95.066  1.00 0.00 ? 2048 VAL B CA 2  
ATOM 3764   C CA . ILE B 1 2049 ? 153.341 123.137 96.923  1.00 0.00 ? 2049 ILE B CA 2  
ATOM 3765   C CA . TYR B 1 2050 ? 156.841 123.445 95.531  1.00 0.00 ? 2050 TYR B CA 2  
ATOM 3766   C CA . ASN B 1 2051 ? 160.507 124.222 96.377  1.00 0.00 ? 2051 ASN B CA 2  
ATOM 3767   C CA . GLN B 1 2052 ? 163.750 125.808 94.963  1.00 0.00 ? 2052 GLN B CA 2  
ATOM 3768   C CA . GLN B 1 2053 ? 163.441 123.211 92.197  1.00 0.00 ? 2053 GLN B CA 2  
ATOM 3769   C CA . ALA B 1 2054 ? 160.980 125.683 90.597  1.00 0.00 ? 2054 ALA B CA 2  
ATOM 3770   C CA . ASP B 1 2055 ? 163.903 128.158 90.106  1.00 0.00 ? 2055 ASP B CA 2  
ATOM 3771   C CA . VAL B 1 2056 ? 166.013 125.264 88.679  1.00 0.00 ? 2056 VAL B CA 2  
ATOM 3772   C CA . TYR B 1 2057 ? 163.326 124.966 85.951  1.00 0.00 ? 2057 TYR B CA 2  
ATOM 3773   C CA . SER B 1 2058 ? 163.409 128.780 85.367  1.00 0.00 ? 2058 SER B CA 2  
ATOM 3774   C CA . PHE B 1 2059 ? 167.230 128.475 85.025  1.00 0.00 ? 2059 PHE B CA 2  
ATOM 3775   C CA . GLY B 1 2060 ? 166.862 125.847 82.208  1.00 0.00 ? 2060 GLY B CA 2  
ATOM 3776   C CA . LEU B 1 2061 ? 164.802 128.407 80.284  1.00 0.00 ? 2061 LEU B CA 2  
ATOM 3777   C CA . LEU B 1 2062 ? 167.554 131.032 80.940  1.00 0.00 ? 2062 LEU B CA 2  
ATOM 3778   C CA . LEU B 1 2063 ? 170.121 128.602 79.453  1.00 0.00 ? 2063 LEU B CA 2  
ATOM 3779   C CA . TYR B 1 2064 ? 167.843 128.016 76.409  1.00 0.00 ? 2064 TYR B CA 2  
ATOM 3780   C CA . ASP B 1 2065 ? 167.389 131.801 75.812  1.00 0.00 ? 2065 ASP B CA 2  
ATOM 3781   C CA . ILE B 1 2066 ? 171.222 132.412 76.091  1.00 0.00 ? 2066 ILE B CA 2  
ATOM 3782   C CA . LEU B 1 2067 ? 172.016 129.421 73.804  1.00 0.00 ? 2067 LEU B CA 2  
ATOM 3783   C CA . THR B 1 2068 ? 169.490 130.354 71.117  1.00 0.00 ? 2068 THR B CA 2  
ATOM 3784   C CA . THR B 1 2069 ? 168.966 134.165 71.419  1.00 0.00 ? 2069 THR B CA 2  
ATOM 3785   C CA . GLY B 1 2070 ? 165.208 133.303 71.273  1.00 0.00 ? 2070 GLY B CA 2  
ATOM 3786   C CA . GLY B 1 2071 ? 162.346 133.454 73.814  1.00 0.00 ? 2071 GLY B CA 2  
ATOM 3787   C CA . ARG B 1 2072 ? 158.585 132.852 74.082  1.00 0.00 ? 2072 ARG B CA 2  
ATOM 3788   C CA . ILE B 1 2073 ? 155.837 133.966 76.552  1.00 0.00 ? 2073 ILE B CA 2  
ATOM 3789   C CA . VAL B 1 2074 ? 152.579 132.020 76.424  1.00 0.00 ? 2074 VAL B CA 2  
ATOM 3790   C CA . GLU B 1 2075 ? 149.268 132.421 78.353  1.00 0.00 ? 2075 GLU B CA 2  
ATOM 3791   C CA . GLY B 1 2076 ? 145.965 130.431 78.322  1.00 0.00 ? 2076 GLY B CA 2  
ATOM 3792   C CA . LEU B 1 2077 ? 144.642 126.919 79.057  1.00 0.00 ? 2077 LEU B CA 2  
ATOM 3793   C CA . LYS B 1 2078 ? 145.886 124.620 76.266  1.00 0.00 ? 2078 LYS B CA 2  
ATOM 3794   C CA . PHE B 1 2079 ? 149.501 125.886 76.675  1.00 0.00 ? 2079 PHE B CA 2  
ATOM 3795   C CA . PRO B 1 2080 ? 149.668 125.171 80.517  1.00 0.00 ? 2080 PRO B CA 2  
ATOM 3796   C CA . ASN B 1 2081 ? 148.044 121.720 79.957  1.00 0.00 ? 2081 ASN B CA 2  
ATOM 3797   C CA . GLU B 1 2082 ? 150.666 121.019 77.272  1.00 0.00 ? 2082 GLU B CA 2  
ATOM 3798   C CA . PHE B 1 2083 ? 153.539 122.165 79.525  1.00 0.00 ? 2083 PHE B CA 2  
ATOM 3799   C CA . ASP B 1 2084 ? 152.201 120.361 82.672  1.00 0.00 ? 2084 ASP B CA 2  
ATOM 3800   C CA . GLU B 1 2085 ? 150.743 117.067 81.256  1.00 0.00 ? 2085 GLU B CA 2  
ATOM 3801   C CA . LEU B 1 2086 ? 152.350 116.592 77.776  1.00 0.00 ? 2086 LEU B CA 2  
ATOM 3802   C CA . GLU B 1 2087 ? 156.002 117.495 78.654  1.00 0.00 ? 2087 GLU B CA 2  
ATOM 3803   C CA . ILE B 1 2088 ? 156.151 120.463 76.172  1.00 0.00 ? 2088 ILE B CA 2  
ATOM 3804   C CA . GLN B 1 2089 ? 159.385 122.412 76.514  1.00 0.00 ? 2089 GLN B CA 2  
ATOM 3805   C CA . GLY B 1 2090 ? 161.492 124.576 74.193  1.00 0.00 ? 2090 GLY B CA 2  
ATOM 3806   C CA . LYS B 1 2091 ? 163.837 121.650 73.444  1.00 0.00 ? 2091 LYS B CA 2  
ATOM 3807   C CA . LEU B 1 2092 ? 161.062 119.066 72.792  1.00 0.00 ? 2092 LEU B CA 2  
ATOM 3808   C CA . PRO B 1 2093 ? 159.012 121.155 70.233  1.00 0.00 ? 2093 PRO B CA 2  
ATOM 3809   C CA . ASP B 1 2094 ? 162.142 122.073 68.240  1.00 0.00 ? 2094 ASP B CA 2  
ATOM 3810   C CA . PRO B 1 2095 ? 164.618 119.039 68.077  1.00 0.00 ? 2095 PRO B CA 2  
ATOM 3811   C CA . VAL B 1 2096 ? 166.025 120.371 64.760  1.00 0.00 ? 2096 VAL B CA 2  
ATOM 3812   C CA . LYS B 1 2097 ? 166.702 123.903 66.116  1.00 0.00 ? 2097 LYS B CA 2  
ATOM 3813   C CA . GLU B 1 2098 ? 168.873 122.597 68.934  1.00 0.00 ? 2098 GLU B CA 2  
ATOM 3814   C CA . TYR B 1 2099 ? 169.961 118.942 68.058  1.00 0.00 ? 2099 TYR B CA 2  
ATOM 3815   C CA . GLY B 1 2100 ? 170.514 119.695 64.291  1.00 0.00 ? 2100 GLY B CA 2  
ATOM 3816   C CA . CYS B 1 2101 ? 172.968 122.512 65.144  1.00 0.00 ? 2101 CYS B CA 2  
ATOM 3817   C CA . ALA B 1 2102 ? 174.776 120.129 67.550  1.00 0.00 ? 2102 ALA B CA 2  
ATOM 3818   C CA . PRO B 1 2103 ? 174.777 122.156 70.885  1.00 0.00 ? 2103 PRO B CA 2  
ATOM 3819   C CA . TRP B 1 2104 ? 177.331 120.535 73.269  1.00 0.00 ? 2104 TRP B CA 2  
ATOM 3820   C CA . PRO B 1 2105 ? 175.778 117.254 74.608  1.00 0.00 ? 2105 PRO B CA 2  
ATOM 3821   C CA . MET B 1 2106 ? 176.635 118.181 78.231  1.00 0.00 ? 2106 MET B CA 2  
ATOM 3822   C CA . VAL B 1 2107 ? 174.743 121.541 77.847  1.00 0.00 ? 2107 VAL B CA 2  
ATOM 3823   C CA . GLU B 1 2108 ? 171.821 119.639 76.291  1.00 0.00 ? 2108 GLU B CA 2  
ATOM 3824   C CA . LYS B 1 2109 ? 171.750 117.115 79.189  1.00 0.00 ? 2109 LYS B CA 2  
ATOM 3825   C CA . LEU B 1 2110 ? 171.808 119.924 81.770  1.00 0.00 ? 2110 LEU B CA 2  
ATOM 3826   C CA . ILE B 1 2111 ? 168.894 121.870 80.138  1.00 0.00 ? 2111 ILE B CA 2  
ATOM 3827   C CA . LYS B 1 2112 ? 166.836 118.630 79.869  1.00 0.00 ? 2112 LYS B CA 2  
ATOM 3828   C CA . GLN B 1 2113 ? 167.470 117.625 83.504  1.00 0.00 ? 2113 GLN B CA 2  
ATOM 3829   C CA . CYS B 1 2114 ? 166.792 121.199 84.768  1.00 0.00 ? 2114 CYS B CA 2  
ATOM 3830   C CA . LEU B 1 2115 ? 163.431 121.326 82.901  1.00 0.00 ? 2115 LEU B CA 2  
ATOM 3831   C CA . LYS B 1 2116 ? 162.195 117.918 84.133  1.00 0.00 ? 2116 LYS B CA 2  
ATOM 3832   C CA . GLU B 1 2117 ? 158.457 117.728 84.909  1.00 0.00 ? 2117 GLU B CA 2  
ATOM 3833   C CA . ASN B 1 2118 ? 159.300 115.862 88.113  1.00 0.00 ? 2118 ASN B CA 2  
ATOM 3834   C CA . PRO B 1 2119 ? 161.020 118.460 90.446  1.00 0.00 ? 2119 PRO B CA 2  
ATOM 3835   C CA . GLN B 1 2120 ? 163.168 115.745 92.109  1.00 0.00 ? 2120 GLN B CA 2  
ATOM 3836   C CA . GLU B 1 2121 ? 164.992 114.886 88.843  1.00 0.00 ? 2121 GLU B CA 2  
ATOM 3837   C CA . ARG B 1 2122 ? 166.190 118.477 88.386  1.00 0.00 ? 2122 ARG B CA 2  
ATOM 3838   C CA . PRO B 1 2123 ? 169.870 118.581 89.536  1.00 0.00 ? 2123 PRO B CA 2  
ATOM 3839   C CA . THR B 1 2124 ? 171.600 120.171 92.534  1.00 0.00 ? 2124 THR B CA 2  
ATOM 3840   C CA . SER B 1 2125 ? 173.460 123.351 91.481  1.00 0.00 ? 2125 SER B CA 2  
ATOM 3841   C CA . ALA B 1 2126 ? 176.854 121.811 92.311  1.00 0.00 ? 2126 ALA B CA 2  
ATOM 3842   C CA . GLN B 1 2127 ? 176.263 119.312 89.437  1.00 0.00 ? 2127 GLN B CA 2  
ATOM 3843   C CA . VAL B 1 2128 ? 175.025 122.199 87.230  1.00 0.00 ? 2128 VAL B CA 2  
ATOM 3844   C CA . PHE B 1 2129 ? 178.160 124.306 87.930  1.00 0.00 ? 2129 PHE B CA 2  
ATOM 3845   C CA . ASP B 1 2130 ? 180.554 121.335 87.333  1.00 0.00 ? 2130 ASP B CA 2  
ATOM 3846   C CA . ILE B 1 2131 ? 178.849 120.516 83.977  1.00 0.00 ? 2131 ILE B CA 2  
ATOM 3847   C CA . LEU B 1 2132 ? 178.825 124.192 82.765  1.00 0.00 ? 2132 LEU B CA 2  
ATOM 3848   C CA . ASN B 1 2133 ? 182.533 124.531 83.689  1.00 0.00 ? 2133 ASN B CA 2  
ATOM 3849   C CA . SER B 1 2134 ? 183.382 121.598 81.313  1.00 0.00 ? 2134 SER B CA 2  
ATOM 3850   C CA . ALA B 1 2135 ? 181.945 123.312 78.157  1.00 0.00 ? 2135 ALA B CA 2  
ATOM 3851   C CA . ARG B 1 2142 ? 179.789 108.506 87.507  1.00 0.00 ? 2142 ARG B CA 2  
ATOM 3852   C CA . ARG B 1 2143 ? 179.663 104.787 88.258  1.00 0.00 ? 2143 ARG B CA 2  
ATOM 3853   C CA . ILE B 1 2144 ? 181.127 102.211 85.863  1.00 0.00 ? 2144 ILE B CA 2  
ATOM 3854   C CA . LEU B 1 2145 ? 179.942 98.657  86.500  1.00 0.00 ? 2145 LEU B CA 2  
ATOM 3855   C CA . LEU B 1 2146 ? 182.479 95.921  85.853  1.00 0.00 ? 2146 LEU B CA 2  
ATOM 3856   C CA . PRO B 1 2147 ? 181.339 92.602  84.351  1.00 0.00 ? 2147 PRO B CA 2  
ATOM 3857   C CA . LYS B 1 2148 ? 179.470 90.423  86.814  1.00 0.00 ? 2148 LYS B CA 2  
ATOM 3858   C CA . ASN B 1 2149 ? 181.614 88.485  89.353  1.00 0.00 ? 2149 ASN B CA 2  
ATOM 3859   C CA . VAL B 1 2150 ? 184.825 90.318  88.371  1.00 0.00 ? 2150 VAL B CA 2  
ATOM 3860   C CA . ILE B 1 2151 ? 186.833 90.844  91.567  1.00 0.00 ? 2151 ILE B CA 2  
ATOM 3861   C CA . VAL B 1 2152 ? 189.585 93.477  91.515  1.00 0.00 ? 2152 VAL B CA 2  
ATOM 3862   C CA . GLU B 1 2153 ? 192.718 92.884  93.581  1.00 0.00 ? 2153 GLU B CA 2  
ATOM 3863   C CA . CYS B 1 2154 ? 194.709 95.884  92.353  1.00 0.00 ? 2154 CYS B CA 2  
ATOM 3864   C CA . MET B 1 2155 ? 194.342 98.856  90.056  1.00 0.00 ? 2155 MET B CA 2  
ATOM 3865   C CA . VAL B 1 2156 ? 196.497 101.460 88.270  1.00 0.00 ? 2156 VAL B CA 2  
ATOM 3866   C CA . ALA B 1 2157 ? 195.334 104.410 86.175  1.00 0.00 ? 2157 ALA B CA 2  
ATOM 3867   C CA . THR B 1 2158 ? 196.570 105.906 82.908  1.00 0.00 ? 2158 THR B CA 2  
ATOM 3868   C CA . ASN B 1 2164 ? 190.257 108.065 76.507  1.00 0.00 ? 2164 ASN B CA 2  
ATOM 3869   C CA . ALA B 1 2165 ? 191.497 107.496 80.039  1.00 0.00 ? 2165 ALA B CA 2  
ATOM 3870   C CA . SER B 1 2166 ? 191.723 103.878 81.118  1.00 0.00 ? 2166 SER B CA 2  
ATOM 3871   C CA . ILE B 1 2167 ? 192.743 101.588 83.958  1.00 0.00 ? 2167 ILE B CA 2  
ATOM 3872   C CA . TRP B 1 2168 ? 194.651 98.321  84.399  1.00 0.00 ? 2168 TRP B CA 2  
ATOM 3873   C CA . LEU B 1 2169 ? 193.112 95.811  86.814  1.00 0.00 ? 2169 LEU B CA 2  
ATOM 3874   C CA . GLY B 1 2170 ? 194.474 92.716  88.522  1.00 0.00 ? 2170 GLY B CA 2  
ATOM 3875   C CA . CYS B 1 2171 ? 191.787 90.088  88.997  1.00 0.00 ? 2171 CYS B CA 2  
ATOM 3876   C CA . GLY B 1 2172 ? 190.991 88.171  92.178  1.00 0.00 ? 2172 GLY B CA 2  
ATOM 3877   C CA . HIS B 1 2173 ? 188.231 85.889  90.915  1.00 0.00 ? 2173 HIS B CA 2  
ATOM 3878   C CA . THR B 1 2174 ? 190.842 83.510  89.463  1.00 0.00 ? 2174 THR B CA 2  
ATOM 3879   C CA . ASP B 1 2175 ? 193.804 81.512  90.741  1.00 0.00 ? 2175 ASP B CA 2  
ATOM 3880   C CA . ARG B 1 2176 ? 195.957 82.434  87.715  1.00 0.00 ? 2176 ARG B CA 2  
ATOM 3881   C CA . GLY B 1 2177 ? 197.318 85.740  86.450  1.00 0.00 ? 2177 GLY B CA 2  
ATOM 3882   C CA . GLN B 1 2178 ? 194.634 87.658  84.545  1.00 0.00 ? 2178 GLN B CA 2  
ATOM 3883   C CA . LEU B 1 2179 ? 195.283 91.258  83.471  1.00 0.00 ? 2179 LEU B CA 2  
ATOM 3884   C CA . SER B 1 2180 ? 192.229 93.385  82.653  1.00 0.00 ? 2180 SER B CA 2  
ATOM 3885   C CA . PHE B 1 2181 ? 191.804 96.728  80.899  1.00 0.00 ? 2181 PHE B CA 2  
ATOM 3886   C CA . LEU B 1 2182 ? 188.980 99.254  81.312  1.00 0.00 ? 2182 LEU B CA 2  
ATOM 3887   C CA . ASP B 1 2183 ? 188.362 102.242 79.029  1.00 0.00 ? 2183 ASP B CA 2  
ATOM 3888   C CA . LEU B 1 2184 ? 186.960 104.855 81.419  1.00 0.00 ? 2184 LEU B CA 2  
ATOM 3889   C CA . ASN B 1 2185 ? 185.263 106.636 78.484  1.00 0.00 ? 2185 ASN B CA 2  
ATOM 3890   C CA . THR B 1 2186 ? 183.563 103.710 76.713  1.00 0.00 ? 2186 THR B CA 2  
ATOM 3891   C CA . GLU B 1 2187 ? 183.306 101.479 79.827  1.00 0.00 ? 2187 GLU B CA 2  
ATOM 3892   C CA . GLY B 1 2188 ? 184.690 98.666  77.667  1.00 0.00 ? 2188 GLY B CA 2  
ATOM 3893   C CA . TYR B 1 2189 ? 186.376 95.792  79.485  1.00 0.00 ? 2189 TYR B CA 2  
ATOM 3894   C CA . THR B 1 2190 ? 188.934 93.312  78.145  1.00 0.00 ? 2190 THR B CA 2  
ATOM 3895   C CA . SER B 1 2191 ? 191.105 90.786  79.965  1.00 0.00 ? 2191 SER B CA 2  
ATOM 3896   C CA . GLU B 1 2192 ? 193.933 88.364  79.212  1.00 0.00 ? 2192 GLU B CA 2  
ATOM 3897   C CA . GLU B 1 2193 ? 195.379 85.471  81.220  1.00 0.00 ? 2193 GLU B CA 2  
ATOM 3898   C CA . VAL B 1 2194 ? 199.020 86.511  81.441  1.00 0.00 ? 2194 VAL B CA 2  
ATOM 3899   C CA . ALA B 1 2195 ? 200.652 84.624  84.348  1.00 0.00 ? 2195 ALA B CA 2  
ATOM 3900   C CA . ASP B 1 2196 ? 200.469 81.412  86.381  1.00 0.00 ? 2196 ASP B CA 2  
ATOM 3901   C CA . SER B 1 2197 ? 199.421 82.914  89.741  1.00 0.00 ? 2197 SER B CA 2  
ATOM 3902   C CA . ARG B 1 2198 ? 197.042 85.650  90.851  1.00 0.00 ? 2198 ARG B CA 2  
ATOM 3903   C CA . ILE B 1 2199 ? 198.157 89.187  90.031  1.00 0.00 ? 2199 ILE B CA 2  
ATOM 3904   C CA . LEU B 1 2200 ? 198.514 90.881  93.418  1.00 0.00 ? 2200 LEU B CA 2  
ATOM 3905   C CA . CYS B 1 2201 ? 199.724 94.365  92.476  1.00 0.00 ? 2201 CYS B CA 2  
ATOM 3906   C CA . LEU B 1 2202 ? 200.308 96.615  89.470  1.00 0.00 ? 2202 LEU B CA 2  
ATOM 3907   C CA . ALA B 1 2203 ? 202.738 99.425  88.693  1.00 0.00 ? 2203 ALA B CA 2  
ATOM 3908   C CA . LEU B 1 2204 ? 203.122 101.526 85.546  1.00 0.00 ? 2204 LEU B CA 2  
ATOM 3909   C CA . VAL B 1 2205 ? 206.733 102.320 84.616  1.00 0.00 ? 2205 VAL B CA 2  
ATOM 3910   C CA . HIS B 1 2206 ? 206.949 105.148 82.075  1.00 0.00 ? 2206 HIS B CA 2  
ATOM 3911   C CA . LEU B 1 2207 ? 210.176 105.870 80.201  1.00 0.00 ? 2207 LEU B CA 2  
ATOM 3912   C CA . PRO B 1 2208 ? 210.004 109.429 78.780  1.00 0.00 ? 2208 PRO B CA 2  
ATOM 3913   C CA . VAL B 1 2209 ? 213.112 108.962 76.726  1.00 0.00 ? 2209 VAL B CA 2  
ATOM 3914   C CA . GLU B 1 2210 ? 212.633 105.847 74.559  1.00 0.00 ? 2210 GLU B CA 2  
ATOM 3915   C CA . LYS B 1 2211 ? 208.905 106.747 74.696  1.00 0.00 ? 2211 LYS B CA 2  
ATOM 3916   C CA . GLU B 1 2212 ? 207.752 103.502 76.259  1.00 0.00 ? 2212 GLU B CA 2  
ATOM 3917   C CA . SER B 1 2213 ? 205.318 102.467 78.993  1.00 0.00 ? 2213 SER B CA 2  
ATOM 3918   C CA . TRP B 1 2214 ? 205.483 99.066  80.692  1.00 0.00 ? 2214 TRP B CA 2  
ATOM 3919   C CA . ILE B 1 2215 ? 202.837 97.564  82.973  1.00 0.00 ? 2215 ILE B CA 2  
ATOM 3920   C CA . VAL B 1 2216 ? 204.376 95.506  85.788  1.00 0.00 ? 2216 VAL B CA 2  
ATOM 3921   C CA . SER B 1 2217 ? 202.348 92.757  87.473  1.00 0.00 ? 2217 SER B CA 2  
ATOM 3922   C CA . GLY B 1 2218 ? 203.395 91.303  90.821  1.00 0.00 ? 2218 GLY B CA 2  
ATOM 3923   C CA . THR B 1 2219 ? 201.975 87.857  91.502  1.00 0.00 ? 2219 THR B CA 2  
ATOM 3924   C CA . GLN B 1 2220 ? 201.270 85.353  94.276  1.00 0.00 ? 2220 GLN B CA 2  
ATOM 3925   C CA . SER B 1 2221 ? 204.276 83.233  93.225  1.00 0.00 ? 2221 SER B CA 2  
ATOM 3926   C CA . GLY B 1 2222 ? 206.837 86.063  93.250  1.00 0.00 ? 2222 GLY B CA 2  
ATOM 3927   C CA . THR B 1 2223 ? 206.943 86.613  89.486  1.00 0.00 ? 2223 THR B CA 2  
ATOM 3928   C CA . LEU B 1 2224 ? 207.339 90.150  88.122  1.00 0.00 ? 2224 LEU B CA 2  
ATOM 3929   C CA . LEU B 1 2225 ? 205.738 90.147  84.667  1.00 0.00 ? 2225 LEU B CA 2  
ATOM 3930   C CA . VAL B 1 2226 ? 206.525 93.192  82.505  1.00 0.00 ? 2226 VAL B CA 2  
ATOM 3931   C CA . ILE B 1 2227 ? 204.282 93.818  79.485  1.00 0.00 ? 2227 ILE B CA 2  
ATOM 3932   C CA . ASN B 1 2228 ? 204.454 96.594  76.893  1.00 0.00 ? 2228 ASN B CA 2  
ATOM 3933   C CA . THR B 1 2229 ? 201.461 98.926  76.735  1.00 0.00 ? 2229 THR B CA 2  
ATOM 3934   C CA . GLU B 1 2230 ? 201.482 99.386  72.954  1.00 0.00 ? 2230 GLU B CA 2  
ATOM 3935   C CA . ASP B 1 2231 ? 202.544 95.885  71.812  1.00 0.00 ? 2231 ASP B CA 2  
ATOM 3936   C CA . GLY B 1 2232 ? 201.381 93.073  74.096  1.00 0.00 ? 2232 GLY B CA 2  
ATOM 3937   C CA . LYS B 1 2233 ? 203.723 90.700  72.254  1.00 0.00 ? 2233 LYS B CA 2  
ATOM 3938   C CA . LYS B 1 2234 ? 206.568 92.505  74.077  1.00 0.00 ? 2234 LYS B CA 2  
ATOM 3939   C CA . ARG B 1 2235 ? 206.673 90.902  77.518  1.00 0.00 ? 2235 ARG B CA 2  
ATOM 3940   C CA . HIS B 1 2236 ? 209.267 89.355  79.809  1.00 0.00 ? 2236 HIS B CA 2  
ATOM 3941   C CA . THR B 1 2237 ? 210.010 88.547  83.449  1.00 0.00 ? 2237 THR B CA 2  
ATOM 3942   C CA . LEU B 1 2238 ? 212.337 90.149  85.996  1.00 0.00 ? 2238 LEU B CA 2  
ATOM 3943   C CA . GLU B 1 2239 ? 214.104 88.244  88.779  1.00 0.00 ? 2239 GLU B CA 2  
ATOM 3944   C CA . LYS B 1 2240 ? 211.741 85.959  90.673  1.00 0.00 ? 2240 LYS B CA 2  
ATOM 3945   C CA . MET B 1 2241 ? 210.970 87.013  94.238  1.00 0.00 ? 2241 MET B CA 2  
ATOM 3946   C CA . THR B 1 2242 ? 211.384 84.584  97.125  1.00 0.00 ? 2242 THR B CA 2  
ATOM 3947   C CA . ASP B 1 2243 ? 207.760 85.199  98.180  1.00 0.00 ? 2243 ASP B CA 2  
ATOM 3948   C CA . SER B 1 2244 ? 204.621 86.745  96.713  1.00 0.00 ? 2244 SER B CA 2  
ATOM 3949   C CA . VAL B 1 2245 ? 204.795 90.341  95.499  1.00 0.00 ? 2245 VAL B CA 2  
ATOM 3950   C CA . THR B 1 2246 ? 202.574 92.400  97.801  1.00 0.00 ? 2246 THR B CA 2  
ATOM 3951   C CA . CYS B 1 2247 ? 203.602 95.950  96.846  1.00 0.00 ? 2247 CYS B CA 2  
ATOM 3952   C CA . LEU B 1 2248 ? 204.593 97.877  93.710  1.00 0.00 ? 2248 LEU B CA 2  
ATOM 3953   C CA . TYR B 1 2249 ? 205.444 101.580 93.812  1.00 0.00 ? 2249 TYR B CA 2  
ATOM 3954   C CA . CYS B 1 2250 ? 207.132 103.891 91.299  1.00 0.00 ? 2250 CYS B CA 2  
ATOM 3955   C CA . ASN B 1 2251 ? 209.483 106.394 92.930  1.00 0.00 ? 2251 ASN B CA 2  
ATOM 3956   C CA . SER B 1 2252 ? 211.860 109.192 91.955  1.00 0.00 ? 2252 SER B CA 2  
ATOM 3957   C CA . PHE B 1 2253 ? 215.027 110.629 93.495  1.00 0.00 ? 2253 PHE B CA 2  
ATOM 3958   C CA . GLN B 1 2259 ? 216.287 112.616 89.182  1.00 0.00 ? 2254 GLN B CA 2  
ATOM 3959   C CA . LYS B 1 2260 ? 216.334 108.813 88.953  1.00 0.00 ? 2260 LYS B CA 2  
ATOM 3960   C CA . ASN B 1 2261 ? 213.166 106.712 88.820  1.00 0.00 ? 2261 ASN B CA 2  
ATOM 3961   C CA . PHE B 1 2262 ? 212.809 103.350 90.546  1.00 0.00 ? 2262 PHE B CA 2  
ATOM 3962   C CA . LEU B 1 2263 ? 210.426 100.413 90.922  1.00 0.00 ? 2263 LEU B CA 2  
ATOM 3963   C CA . LEU B 1 2264 ? 210.016 99.428  94.576  1.00 0.00 ? 2264 LEU B CA 2  
ATOM 3964   C CA . VAL B 1 2265 ? 208.799 95.858  95.115  1.00 0.00 ? 2265 VAL B CA 2  
ATOM 3965   C CA . GLY B 1 2266 ? 207.517 94.796  98.533  1.00 0.00 ? 2266 GLY B CA 2  
ATOM 3966   C CA . THR B 1 2267 ? 207.271 91.055  99.157  1.00 0.00 ? 2267 THR B CA 2  
ATOM 3967   C CA . ALA B 1 2268 ? 205.411 88.841  101.615 1.00 0.00 ? 2268 ALA B CA 2  
ATOM 3968   C CA . ASP B 1 2269 ? 208.612 87.790  103.436 1.00 0.00 ? 2269 ASP B CA 2  
ATOM 3969   C CA . GLY B 1 2270 ? 209.441 91.319  104.598 1.00 0.00 ? 2270 GLY B CA 2  
ATOM 3970   C CA . LYS B 1 2271 ? 211.820 92.280  101.786 1.00 0.00 ? 2271 LYS B CA 2  
ATOM 3971   C CA . LEU B 1 2272 ? 211.890 95.341  99.521  1.00 0.00 ? 2272 LEU B CA 2  
ATOM 3972   C CA . ALA B 1 2273 ? 213.637 95.046  96.149  1.00 0.00 ? 2273 ALA B CA 2  
ATOM 3973   C CA . ILE B 1 2274 ? 214.664 98.121  94.149  1.00 0.00 ? 2274 ILE B CA 2  
ATOM 3974   C CA . PHE B 1 2275 ? 214.807 98.105  90.351  1.00 0.00 ? 2275 PHE B CA 2  
ATOM 3975   C CA . GLU B 1 2276 ? 216.146 101.024 88.369  1.00 0.00 ? 2276 GLU B CA 2  
ATOM 3976   C CA . ASP B 1 2277 ? 213.935 102.753 85.806  1.00 0.00 ? 2277 ASP B CA 2  
ATOM 3977   C CA . LYS B 1 2278 ? 215.780 101.380 82.770  1.00 0.00 ? 2278 LYS B CA 2  
ATOM 3978   C CA . THR B 1 2279 ? 216.532 97.862  84.053  1.00 0.00 ? 2279 THR B CA 2  
ATOM 3979   C CA . VAL B 1 2280 ? 212.805 97.033  83.957  1.00 0.00 ? 2280 VAL B CA 2  
ATOM 3980   C CA . LYS B 1 2281 ? 213.098 96.594  80.173  1.00 0.00 ? 2281 LYS B CA 2  
ATOM 3981   C CA . LEU B 1 2282 ? 215.583 93.719  80.531  1.00 0.00 ? 2282 LEU B CA 2  
ATOM 3982   C CA . LYS B 1 2283 ? 214.617 90.055  80.751  1.00 0.00 ? 2283 LYS B CA 2  
ATOM 3983   C CA . GLY B 1 2284 ? 215.745 88.462  84.000  1.00 0.00 ? 2284 GLY B CA 2  
ATOM 3984   C CA . ALA B 1 2285 ? 216.962 91.768  85.429  1.00 0.00 ? 2285 ALA B CA 2  
ATOM 3985   C CA . ALA B 1 2286 ? 218.104 91.663  89.055  1.00 0.00 ? 2286 ALA B CA 2  
ATOM 3986   C CA . PRO B 1 2287 ? 217.325 94.407  91.593  1.00 0.00 ? 2287 PRO B CA 2  
ATOM 3987   C CA . LEU B 1 2288 ? 219.885 97.024  92.542  1.00 0.00 ? 2288 LEU B CA 2  
ATOM 3988   C CA . LYS B 1 2289 ? 219.330 96.223  96.223  1.00 0.00 ? 2289 LYS B CA 2  
ATOM 3989   C CA . ILE B 1 2290 ? 217.138 94.058  98.455  1.00 0.00 ? 2290 ILE B CA 2  
ATOM 3990   C CA . LEU B 1 2291 ? 216.264 95.255  101.963 1.00 0.00 ? 2291 LEU B CA 2  
ATOM 3991   C CA . ASN B 1 2292 ? 215.437 92.564  104.529 1.00 0.00 ? 2292 ASN B CA 2  
ATOM 3992   C CA . ILE B 1 2293 ? 213.072 94.564  106.736 1.00 0.00 ? 2293 ILE B CA 2  
ATOM 3993   C CA . GLY B 1 2294 ? 211.085 91.673  108.262 1.00 0.00 ? 2294 GLY B CA 2  
ATOM 3994   C CA . ASN B 1 2295 ? 210.389 87.965  107.947 1.00 0.00 ? 2295 ASN B CA 2  
ATOM 3995   C CA . VAL B 1 2296 ? 207.928 85.530  106.376 1.00 0.00 ? 2296 VAL B CA 2  
ATOM 3996   C CA . SER B 1 2297 ? 205.356 86.673  108.955 1.00 0.00 ? 2297 SER B CA 2  
ATOM 3997   C CA . THR B 1 2298 ? 205.658 90.444  108.272 1.00 0.00 ? 2298 THR B CA 2  
ATOM 3998   C CA . PRO B 1 2299 ? 204.617 91.236  104.685 1.00 0.00 ? 2299 PRO B CA 2  
ATOM 3999   C CA . LEU B 1 2300 ? 205.593 94.566  103.144 1.00 0.00 ? 2300 LEU B CA 2  
ATOM 4000   C CA . MET B 1 2301 ? 202.196 95.787  101.975 1.00 0.00 ? 2301 MET B CA 2  
ATOM 4001   C CA . CYS B 1 2302 ? 202.291 99.566  101.474 1.00 0.00 ? 2302 CYS B CA 2  
ATOM 4002   C CA . LEU B 1 2303 ? 204.585 102.383 100.346 1.00 0.00 ? 2303 LEU B CA 2  
ATOM 4003   C CA . SER B 1 2304 ? 204.072 106.141 100.212 1.00 0.00 ? 2304 SER B CA 2  
ATOM 4004   C CA . GLU B 1 2305 ? 205.993 109.345 99.580  1.00 0.00 ? 2305 GLU B CA 2  
ATOM 4005   C CA . VAL B 1 2314 ? 211.932 110.283 101.476 1.00 0.00 ? 2314 VAL B CA 2  
ATOM 4006   C CA . MET B 1 2315 ? 209.849 107.095 101.471 1.00 0.00 ? 2315 MET B CA 2  
ATOM 4007   C CA . TRP B 1 2316 ? 207.741 105.590 104.249 1.00 0.00 ? 2316 TRP B CA 2  
ATOM 4008   C CA . GLY B 1 2317 ? 206.376 102.063 104.312 1.00 0.00 ? 2317 GLY B CA 2  
ATOM 4009   C CA . GLY B 1 2318 ? 204.651 99.451  106.403 1.00 0.00 ? 2318 GLY B CA 2  
ATOM 4010   C CA . CYS B 1 2319 ? 206.051 96.021  107.276 1.00 0.00 ? 2319 CYS B CA 2  
ATOM 4011   C CA . GLY B 1 2320 ? 204.018 94.098  109.823 1.00 0.00 ? 2320 GLY B CA 2  
ATOM 4012   C CA . THR B 1 2321 ? 203.495 96.448  112.751 1.00 0.00 ? 2321 THR B CA 2  
ATOM 4013   C CA . LYS B 1 2322 ? 206.585 98.531  111.898 1.00 0.00 ? 2322 LYS B CA 2  
ATOM 4014   C CA . ILE B 1 2323 ? 206.806 101.767 109.923 1.00 0.00 ? 2323 ILE B CA 2  
ATOM 4015   C CA . PHE B 1 2324 ? 210.077 102.216 108.052 1.00 0.00 ? 2324 PHE B CA 2  
ATOM 4016   C CA . SER B 1 2325 ? 211.730 105.099 106.225 1.00 0.00 ? 2325 SER B CA 2  
ATOM 4017   C CA . PHE B 1 2326 ? 214.464 105.337 103.611 1.00 0.00 ? 2326 PHE B CA 2  
ATOM 4018   C CA . SER B 1 2327 ? 215.847 107.842 101.129 1.00 0.00 ? 2327 SER B CA 2  
ATOM 4019   C CA . ASN B 1 2328 ? 218.652 107.973 98.569  1.00 0.00 ? 2328 ASN B CA 2  
ATOM 4020   C CA . ASP B 1 2329 ? 220.994 105.153 99.620  1.00 0.00 ? 2329 ASP B CA 2  
ATOM 4021   C CA . PHE B 1 2330 ? 218.182 102.694 100.516 1.00 0.00 ? 2330 PHE B CA 2  
ATOM 4022   C CA . THR B 1 2331 ? 219.432 102.314 104.072 1.00 0.00 ? 2331 THR B CA 2  
ATOM 4023   C CA . ILE B 1 2332 ? 216.581 102.061 106.564 1.00 0.00 ? 2332 ILE B CA 2  
ATOM 4024   C CA . GLN B 1 2333 ? 216.659 105.236 108.637 1.00 0.00 ? 2333 GLN B CA 2  
ATOM 4025   C CA . LYS B 1 2334 ? 213.550 105.309 110.834 1.00 0.00 ? 2334 LYS B CA 2  
ATOM 4026   C CA . LEU B 1 2335 ? 211.903 102.169 112.215 1.00 0.00 ? 2335 LEU B CA 2  
ATOM 4027   C CA . ILE B 1 2336 ? 208.888 102.665 114.501 1.00 0.00 ? 2336 ILE B CA 2  
ATOM 4028   C CA . GLU B 1 2337 ? 207.120 99.850  116.348 1.00 0.00 ? 2337 GLU B CA 2  
ATOM 4029   C CA . THR B 1 2338 ? 203.380 100.565 116.409 1.00 0.00 ? 2338 THR B CA 2  
ATOM 4030   C CA . ARG B 1 2339 ? 202.239 97.405  118.217 1.00 0.00 ? 2339 ARG B CA 2  
ATOM 4031   C CA . THR B 1 2340 ? 202.406 99.088  121.641 1.00 0.00 ? 2340 THR B CA 2  
ATOM 4032   C CA . SER B 1 2341 ? 201.282 102.451 123.021 1.00 0.00 ? 2341 SER B CA 2  
ATOM 4033   C CA . GLN B 1 2342 ? 199.818 103.270 126.430 1.00 0.00 ? 2342 GLN B CA 2  
ATOM 4034   C CA . LEU B 1 2343 ? 197.343 105.777 124.959 1.00 0.00 ? 2343 LEU B CA 2  
ATOM 4035   C CA . PHE B 1 2344 ? 195.750 103.096 122.762 1.00 0.00 ? 2344 PHE B CA 2  
ATOM 4036   C CA . SER B 1 2345 ? 191.974 103.311 123.045 1.00 0.00 ? 2345 SER B CA 2  
ATOM 4037   C CA . TYR B 1 2346 ? 191.884 99.553  122.380 1.00 0.00 ? 2346 TYR B CA 2  
ATOM 4038   C CA . ALA B 1 2347 ? 194.955 97.333  122.272 1.00 0.00 ? 2347 ALA B CA 2  
ATOM 4039   C CA . ALA B 1 2348 ? 193.939 94.419  120.032 1.00 0.00 ? 2348 ALA B CA 2  
ATOM 4040   C CA . PHE B 1 2349 ? 193.468 96.678  116.996 1.00 0.00 ? 2349 PHE B CA 2  
ATOM 4041   C CA . SER B 1 2350 ? 197.041 97.982  117.116 1.00 0.00 ? 2350 SER B CA 2  
ATOM 4042   C CA . ASP B 1 2351 ? 198.432 94.427  117.026 1.00 0.00 ? 2351 ASP B CA 2  
ATOM 4043   C CA . SER B 1 2352 ? 197.766 93.989  113.321 1.00 0.00 ? 2352 SER B CA 2  
ATOM 4044   C CA . ASN B 1 2353 ? 199.656 94.394  110.067 1.00 0.00 ? 2353 ASN B CA 2  
ATOM 4045   C CA . ILE B 1 2354 ? 199.668 97.918  108.655 1.00 0.00 ? 2354 ILE B CA 2  
ATOM 4046   C CA . ILE B 1 2355 ? 197.615 97.977  105.447 1.00 0.00 ? 2355 ILE B CA 2  
ATOM 4047   C CA . THR B 1 2356 ? 198.226 101.565 104.282 1.00 0.00 ? 2356 THR B CA 2  
ATOM 4048   C CA . VAL B 1 2357 ? 200.365 104.606 105.098 1.00 0.00 ? 2357 VAL B CA 2  
ATOM 4049   C CA . VAL B 1 2358 ? 199.605 108.191 104.057 1.00 0.00 ? 2358 VAL B CA 2  
ATOM 4050   C CA . VAL B 1 2359 ? 202.302 110.794 104.737 1.00 0.00 ? 2359 VAL B CA 2  
ATOM 4051   C CA . ASP B 1 2360 ? 201.526 114.463 105.361 1.00 0.00 ? 2360 ASP B CA 2  
ATOM 4052   C CA . THR B 1 2361 ? 202.662 116.413 108.421 1.00 0.00 ? 2361 THR B CA 2  
ATOM 4053   C CA . ALA B 1 2362 ? 202.389 113.188 110.432 1.00 0.00 ? 2362 ALA B CA 2  
ATOM 4054   C CA . LEU B 1 2363 ? 201.980 109.499 109.621 1.00 0.00 ? 2363 LEU B CA 2  
ATOM 4055   C CA . TYR B 1 2364 ? 198.386 108.249 109.343 1.00 0.00 ? 2364 TYR B CA 2  
ATOM 4056   C CA . ILE B 1 2365 ? 198.444 104.447 109.358 1.00 0.00 ? 2365 ILE B CA 2  
ATOM 4057   C CA . ALA B 1 2366 ? 195.590 101.953 109.235 1.00 0.00 ? 2366 ALA B CA 2  
ATOM 4058   C CA . LYS B 1 2367 ? 195.797 98.325  110.331 1.00 0.00 ? 2367 LYS B CA 2  
ATOM 4059   C CA . GLN B 1 2368 ? 194.033 95.167  109.209 1.00 0.00 ? 2368 GLN B CA 2  
ATOM 4060   C CA . ASN B 1 2369 ? 190.565 94.675  110.736 1.00 0.00 ? 2369 ASN B CA 2  
ATOM 4061   C CA . SER B 1 2370 ? 190.917 97.875  112.777 1.00 0.00 ? 2370 SER B CA 2  
ATOM 4062   C CA . PRO B 1 2371 ? 188.600 100.924 112.887 1.00 0.00 ? 2371 PRO B CA 2  
ATOM 4063   C CA . VAL B 1 2372 ? 191.303 103.212 114.337 1.00 0.00 ? 2372 VAL B CA 2  
ATOM 4064   C CA . VAL B 1 2373 ? 193.572 105.333 112.152 1.00 0.00 ? 2373 VAL B CA 2  
ATOM 4065   C CA . GLU B 1 2374 ? 196.721 105.819 114.221 1.00 0.00 ? 2374 GLU B CA 2  
ATOM 4066   C CA . VAL B 1 2375 ? 198.684 109.067 113.934 1.00 0.00 ? 2375 VAL B CA 2  
ATOM 4067   C CA . TRP B 1 2376 ? 202.430 108.929 114.619 1.00 0.00 ? 2376 TRP B CA 2  
ATOM 4068   C CA . ASP B 1 2377 ? 205.101 111.634 114.671 1.00 0.00 ? 2377 ASP B CA 2  
ATOM 4069   C CA . LYS B 1 2378 ? 208.049 111.365 112.289 1.00 0.00 ? 2378 LYS B CA 2  
ATOM 4070   C CA . LYS B 1 2379 ? 210.481 113.023 114.706 1.00 0.00 ? 2379 LYS B CA 2  
ATOM 4071   C CA . THR B 1 2380 ? 209.547 111.714 118.161 1.00 0.00 ? 2380 THR B CA 2  
ATOM 4072   C CA . GLU B 1 2381 ? 208.346 108.322 116.821 1.00 0.00 ? 2381 GLU B CA 2  
ATOM 4073   C CA . LYS B 1 2382 ? 205.350 108.281 119.198 1.00 0.00 ? 2382 LYS B CA 2  
ATOM 4074   C CA . LEU B 1 2383 ? 201.579 108.557 118.975 1.00 0.00 ? 2383 LEU B CA 2  
ATOM 4075   C CA . CYS B 1 2384 ? 200.418 111.912 117.667 1.00 0.00 ? 2384 CYS B CA 2  
ATOM 4076   C CA . GLY B 1 2385 ? 196.752 110.985 117.914 1.00 0.00 ? 2385 GLY B CA 2  
ATOM 4077   C CA . LEU B 1 2386 ? 193.914 108.575 117.229 1.00 0.00 ? 2386 LEU B CA 2  
ATOM 4078   C CA . ILE B 1 2387 ? 190.995 108.747 114.797 1.00 0.00 ? 2387 ILE B CA 2  
ATOM 4079   C CA . ASP B 1 2388 ? 188.230 106.285 115.727 1.00 0.00 ? 2388 ASP B CA 2  
ATOM 4080   C CA . CYS B 1 2389 ? 185.987 105.837 112.688 1.00 0.00 ? 2389 CYS B CA 2  
ATOM 4081   C CA . VAL B 1 2390 ? 183.280 104.077 114.734 1.00 0.00 ? 2390 VAL B CA 2  
ATOM 4082   C CA . HIS B 1 2391 ? 182.633 107.285 116.679 1.00 0.00 ? 2391 HIS B CA 2  
ATOM 4083   C CA . PHE B 1 2392 ? 182.721 109.496 113.578 1.00 0.00 ? 2392 PHE B CA 2  
ATOM 4084   C CA . LEU B 1 2393 ? 180.221 107.197 111.862 1.00 0.00 ? 2393 LEU B CA 2  
ATOM 4085   C CA . ARG B 1 2394 ? 177.888 107.077 114.887 1.00 0.00 ? 2394 ARG B CA 2  
ATOM 4086   C CA . GLU B 1 2395 ? 177.178 110.833 114.640 1.00 0.00 ? 2395 GLU B CA 2  
ATOM 4087   C CA . MET B 1 2408 ? 174.898 102.499 114.835 1.00 0.00 ? 2408 MET B CA 2  
ATOM 4088   C CA . SER B 1 2409 ? 176.022 98.901  114.256 1.00 0.00 ? 2409 SER B CA 2  
ATOM 4089   C CA . TYR B 1 2410 ? 178.960 99.911  112.045 1.00 0.00 ? 2410 TYR B CA 2  
ATOM 4090   C CA . SER B 1 2411 ? 182.216 97.983  112.343 1.00 0.00 ? 2411 SER B CA 2  
ATOM 4091   C CA . GLY B 1 2412 ? 184.090 101.027 111.037 1.00 0.00 ? 2412 GLY B CA 2  
ATOM 4092   C CA . ARG B 1 2413 ? 186.849 98.717  109.827 1.00 0.00 ? 2413 ARG B CA 2  
ATOM 4093   C CA . VAL B 1 2414 ? 189.214 100.917 107.828 1.00 0.00 ? 2414 VAL B CA 2  
ATOM 4094   C CA . LYS B 1 2415 ? 189.884 99.707  104.287 1.00 0.00 ? 2415 LYS B CA 2  
ATOM 4095   C CA . THR B 1 2416 ? 191.680 102.580 102.566 1.00 0.00 ? 2416 THR B CA 2  
ATOM 4096   C CA . LEU B 1 2417 ? 193.168 106.046 103.128 1.00 0.00 ? 2417 LEU B CA 2  
ATOM 4097   C CA . CYS B 1 2418 ? 193.653 108.796 100.549 1.00 0.00 ? 2418 CYS B CA 2  
ATOM 4098   C CA . LEU B 1 2419 ? 194.941 112.360 100.849 1.00 0.00 ? 2419 LEU B CA 2  
ATOM 4099   C CA . GLN B 1 2420 ? 193.066 115.207 99.165  1.00 0.00 ? 2420 GLN B CA 2  
ATOM 4100   C CA . LYS B 1 2421 ? 195.291 118.221 98.437  1.00 0.00 ? 2421 LYS B CA 2  
ATOM 4101   C CA . ASN B 1 2422 ? 197.090 119.369 101.587 1.00 0.00 ? 2422 ASN B CA 2  
ATOM 4102   C CA . THR B 1 2423 ? 194.241 119.323 104.115 1.00 0.00 ? 2423 THR B CA 2  
ATOM 4103   C CA . ALA B 1 2424 ? 191.773 116.517 103.556 1.00 0.00 ? 2424 ALA B CA 2  
ATOM 4104   C CA . LEU B 1 2425 ? 191.846 112.790 104.337 1.00 0.00 ? 2425 LEU B CA 2  
ATOM 4105   C CA . TRP B 1 2426 ? 189.429 110.299 102.767 1.00 0.00 ? 2426 TRP B CA 2  
ATOM 4106   C CA . ILE B 1 2427 ? 188.740 107.116 104.752 1.00 0.00 ? 2427 ILE B CA 2  
ATOM 4107   C CA . GLY B 1 2428 ? 186.958 104.186 103.092 1.00 0.00 ? 2428 GLY B CA 2  
ATOM 4108   C CA . THR B 1 2429 ? 185.588 101.835 105.729 1.00 0.00 ? 2429 THR B CA 2  
ATOM 4109   C CA . GLY B 1 2430 ? 184.565 98.152  105.400 1.00 0.00 ? 2430 GLY B CA 2  
ATOM 4110   C CA . GLY B 1 2431 ? 180.953 99.081  104.866 1.00 0.00 ? 2431 GLY B CA 2  
ATOM 4111   C CA . GLY B 1 2432 ? 180.053 101.361 102.016 1.00 0.00 ? 2432 GLY B CA 2  
ATOM 4112   C CA . HIS B 1 2433 ? 181.029 104.390 104.070 1.00 0.00 ? 2433 HIS B CA 2  
ATOM 4113   C CA . ILE B 1 2434 ? 183.393 107.179 103.019 1.00 0.00 ? 2434 ILE B CA 2  
ATOM 4114   C CA . LEU B 1 2435 ? 184.597 109.826 105.489 1.00 0.00 ? 2435 LEU B CA 2  
ATOM 4115   C CA . LEU B 1 2436 ? 186.332 113.133 104.740 1.00 0.00 ? 2436 LEU B CA 2  
ATOM 4116   C CA . LEU B 1 2437 ? 188.322 114.624 107.633 1.00 0.00 ? 2437 LEU B CA 2  
ATOM 4117   C CA . ASP B 1 2438 ? 190.138 117.953 107.918 1.00 0.00 ? 2438 ASP B CA 2  
ATOM 4118   C CA . LEU B 1 2439 ? 193.755 117.363 109.019 1.00 0.00 ? 2439 LEU B CA 2  
ATOM 4119   C CA . SER B 1 2440 ? 194.652 120.606 110.808 1.00 0.00 ? 2440 SER B CA 2  
ATOM 4120   C CA . THR B 1 2441 ? 192.576 122.243 113.540 1.00 0.00 ? 2441 THR B CA 2  
ATOM 4121   C CA . ARG B 1 2442 ? 189.330 120.240 113.291 1.00 0.00 ? 2442 ARG B CA 2  
ATOM 4122   C CA . ARG B 1 2443 ? 188.051 116.899 111.988 1.00 0.00 ? 2443 ARG B CA 2  
ATOM 4123   C CA . LEU B 1 2444 ? 184.933 115.832 110.077 1.00 0.00 ? 2444 LEU B CA 2  
ATOM 4124   C CA . ILE B 1 2445 ? 184.148 117.617 106.807 1.00 0.00 ? 2445 ILE B CA 2  
ATOM 4125   C CA . ARG B 1 2446 ? 181.949 115.225 104.827 1.00 0.00 ? 2446 ARG B CA 2  
ATOM 4126   C CA . VAL B 1 2447 ? 180.359 111.791 105.236 1.00 0.00 ? 2447 VAL B CA 2  
ATOM 4127   C CA . ILE B 1 2448 ? 178.654 109.629 102.617 1.00 0.00 ? 2448 ILE B CA 2  
ATOM 4128   C CA . TYR B 1 2449 ? 176.898 106.522 103.961 1.00 0.00 ? 2449 TYR B CA 2  
ATOM 4129   C CA . ASN B 1 2450 ? 176.158 103.390 101.922 1.00 0.00 ? 2450 ASN B CA 2  
ATOM 4130   C CA . PHE B 1 2451 ? 178.233 104.686 99.013  1.00 0.00 ? 2451 PHE B CA 2  
ATOM 4131   C CA . CYS B 1 2452 ? 178.563 100.965 98.262  1.00 0.00 ? 2452 CYS B CA 2  
ATOM 4132   C CA . ASN B 1 2453 ? 178.587 97.732  100.261 1.00 0.00 ? 2453 ASN B CA 2  
ATOM 4133   C CA . SER B 1 2454 ? 182.369 97.777  100.820 1.00 0.00 ? 2454 SER B CA 2  
ATOM 4134   C CA . VAL B 1 2455 ? 185.011 100.317 99.737  1.00 0.00 ? 2455 VAL B CA 2  
ATOM 4135   C CA . ARG B 1 2456 ? 188.050 98.369  98.535  1.00 0.00 ? 2456 ARG B CA 2  
ATOM 4136   C CA . VAL B 1 2457 ? 190.331 100.860 96.750  1.00 0.00 ? 2457 VAL B CA 2  
ATOM 4137   C CA . MET B 1 2458 ? 190.493 104.657 96.755  1.00 0.00 ? 2458 MET B CA 2  
ATOM 4138   C CA . MET B 1 2459 ? 193.125 106.636 94.853  1.00 0.00 ? 2459 MET B CA 2  
ATOM 4139   C CA . THR B 1 2460 ? 193.925 109.901 93.081  1.00 0.00 ? 2460 THR B CA 2  
ATOM 4140   C CA . ALA B 1 2461 ? 195.012 110.063 89.435  1.00 0.00 ? 2461 ALA B CA 2  
ATOM 4141   C CA . GLN B 1 2462 ? 195.844 112.674 86.808  1.00 0.00 ? 2462 GLN B CA 2  
ATOM 4142   C CA . ASN B 1 2468 ? 192.948 115.806 89.549  1.00 0.00 ? 2468 ASN B CA 2  
ATOM 4143   C CA . VAL B 1 2469 ? 190.584 112.821 89.514  1.00 0.00 ? 2469 VAL B CA 2  
ATOM 4144   C CA . MET B 1 2470 ? 189.188 110.537 92.227  1.00 0.00 ? 2470 MET B CA 2  
ATOM 4145   C CA . LEU B 1 2471 ? 188.718 106.778 91.762  1.00 0.00 ? 2471 LEU B CA 2  
ATOM 4146   C CA . VAL B 1 2472 ? 186.848 104.553 94.236  1.00 0.00 ? 2472 VAL B CA 2  
ATOM 4147   C CA . LEU B 1 2473 ? 186.533 100.822 93.559  1.00 0.00 ? 2473 LEU B CA 2  
ATOM 4148   C CA . GLY B 1 2474 ? 183.874 99.182  95.716  1.00 0.00 ? 2474 GLY B CA 2  
ATOM 4149   C CA . TYR B 1 2475 ? 182.143 95.829  95.496  1.00 0.00 ? 2475 TYR B CA 2  
ATOM 4150   C CA . ASN B 1 2476 ? 178.602 94.597  96.239  1.00 0.00 ? 2476 ASN B CA 2  
ATOM 4151   C CA . ARG B 1 2477 ? 177.612 91.033  97.025  1.00 0.00 ? 2477 ARG B CA 2  
ATOM 4152   C CA . GLU B 1 2488 ? 177.427 86.682  93.178  1.00 0.00 ? 2497 GLU B CA 2  
ATOM 4153   C CA . ILE B 1 2489 ? 179.696 89.745  93.208  1.00 0.00 ? 2498 ILE B CA 2  
ATOM 4154   C CA . GLN B 1 2490 ? 179.358 93.065  91.351  1.00 0.00 ? 2499 GLN B CA 2  
ATOM 4155   C CA . SER B 1 2491 ? 182.391 95.351  91.363  1.00 0.00 ? 2500 SER B CA 2  
ATOM 4156   C CA . CYS B 1 2492 ? 181.929 99.037  90.554  1.00 0.00 ? 2501 CYS B CA 2  
ATOM 4157   C CA . LEU B 1 2493 ? 184.334 101.903 89.871  1.00 0.00 ? 2502 LEU B CA 2  
ATOM 4158   C CA . THR B 1 2494 ? 183.122 105.388 90.829  1.00 0.00 ? 2503 THR B CA 2  
ATOM 4159   C CA . VAL B 1 2495 ? 184.960 108.455 89.543  1.00 0.00 ? 2504 VAL B CA 2  
ATOM 4160   C CA . TRP B 1 2496 ? 184.792 112.236 89.946  1.00 0.00 ? 2505 TRP B CA 2  
ATOM 4161   C CA . TYR A 1 1332 ? 99.561  153.894 162.564 1.00 0.00 ? 1332 TYR A CA 3  
ATOM 4162   C CA . ASN A 1 1333 ? 101.184 151.286 164.909 1.00 0.00 ? 1333 ASN A CA 3  
ATOM 4163   C CA . ARG A 1 1334 ? 100.317 148.152 162.998 1.00 0.00 ? 1334 ARG A CA 3  
ATOM 4164   C CA . MET A 1 1335 ? 102.429 145.581 161.111 1.00 0.00 ? 1335 MET A CA 3  
ATOM 4165   C CA . LYS A 1 1336 ? 102.047 142.347 159.116 1.00 0.00 ? 1336 LYS A CA 3  
ATOM 4166   C CA . LEU A 1 1337 ? 104.164 139.348 160.119 1.00 0.00 ? 1337 LEU A CA 3  
ATOM 4167   C CA . MET A 1 1338 ? 104.235 136.850 157.273 1.00 0.00 ? 1338 MET A CA 3  
ATOM 4168   C CA . ILE A 1 1339 ? 105.278 133.350 158.343 1.00 0.00 ? 1339 ILE A CA 3  
ATOM 4169   C CA . VAL A 1 1340 ? 107.233 131.746 155.477 1.00 0.00 ? 1340 VAL A CA 3  
ATOM 4170   C CA . GLY A 1 1341 ? 108.518 128.168 155.197 1.00 0.00 ? 1341 GLY A CA 3  
ATOM 4171   C CA . ASN A 1 1342 ? 107.766 124.604 154.139 1.00 0.00 ? 1342 ASN A CA 3  
ATOM 4172   C CA . THR A 1 1343 ? 104.611 123.135 155.818 1.00 0.00 ? 1343 THR A CA 3  
ATOM 4173   C CA . GLY A 1 1344 ? 105.560 122.290 159.416 1.00 0.00 ? 1344 GLY A CA 3  
ATOM 4174   C CA . SER A 1 1345 ? 109.080 123.637 159.871 1.00 0.00 ? 1345 SER A CA 3  
ATOM 4175   C CA . GLY A 1 1346 ? 107.491 124.682 163.206 1.00 0.00 ? 1346 GLY A CA 3  
ATOM 4176   C CA . LYS A 1 1347 ? 105.331 127.678 162.206 1.00 0.00 ? 1347 LYS A CA 3  
ATOM 4177   C CA . THR A 1 1348 ? 102.715 126.859 164.905 1.00 0.00 ? 1348 THR A CA 3  
ATOM 4178   C CA . THR A 1 1349 ? 105.533 125.880 167.346 1.00 0.00 ? 1349 THR A CA 3  
ATOM 4179   C CA . LEU A 1 1350 ? 107.286 129.228 166.907 1.00 0.00 ? 1350 LEU A CA 3  
ATOM 4180   C CA . LEU A 1 1351 ? 103.942 131.078 167.296 1.00 0.00 ? 1351 LEU A CA 3  
ATOM 4181   C CA . GLN A 1 1352 ? 102.988 129.209 170.518 1.00 0.00 ? 1352 GLN A CA 3  
ATOM 4182   C CA . GLN A 1 1353 ? 106.362 130.180 171.991 1.00 0.00 ? 1353 GLN A CA 3  
ATOM 4183   C CA . LEU A 1 1354 ? 106.250 133.902 171.025 1.00 0.00 ? 1354 LEU A CA 3  
ATOM 4184   C CA . MET A 1 1355 ? 102.709 134.570 172.098 1.00 0.00 ? 1355 MET A CA 3  
ATOM 4185   C CA . LYS A 1 1356 ? 102.857 133.559 175.843 1.00 0.00 ? 1356 LYS A CA 3  
ATOM 4186   C CA . THR A 1 1357 ? 99.174  134.444 176.524 1.00 0.00 ? 1357 THR A CA 3  
ATOM 4187   C CA . LYS A 1 1358 ? 96.670  132.524 178.731 1.00 0.00 ? 1358 LYS A CA 3  
ATOM 4188   C CA . LYS A 1 1359 ? 96.238  130.183 175.732 1.00 0.00 ? 1359 LYS A CA 3  
ATOM 4189   C CA . SER A 1 1360 ? 93.346  132.409 174.555 1.00 0.00 ? 1360 SER A CA 3  
ATOM 4190   C CA . ASP A 1 1361 ? 92.980  131.366 170.891 1.00 0.00 ? 1361 ASP A CA 3  
ATOM 4191   C CA . LEU A 1 1362 ? 96.776  130.902 171.038 1.00 0.00 ? 1362 LEU A CA 3  
ATOM 4192   C CA . GLY A 1 1363 ? 96.578  127.377 169.679 1.00 0.00 ? 1363 GLY A CA 3  
ATOM 4193   C CA . MET A 1 1364 ? 95.963  126.644 165.989 1.00 0.00 ? 1364 MET A CA 3  
ATOM 4194   C CA . GLN A 1 1365 ? 98.194  124.386 163.891 1.00 0.00 ? 1365 GLN A CA 3  
ATOM 4195   C CA . SER A 1 1366 ? 97.534  124.529 160.139 1.00 0.00 ? 1366 SER A CA 3  
ATOM 4196   C CA . ALA A 1 1367 ? 101.083 124.226 158.897 1.00 0.00 ? 1367 ALA A CA 3  
ATOM 4197   C CA . THR A 1 1368 ? 100.271 122.587 155.471 1.00 0.00 ? 1368 THR A CA 3  
ATOM 4198   C CA . VAL A 1 1369 ? 98.032  124.279 152.834 1.00 0.00 ? 1369 VAL A CA 3  
ATOM 4199   C CA . GLY A 1 1370 ? 95.992  126.379 155.306 1.00 0.00 ? 1370 GLY A CA 3  
ATOM 4200   C CA . ILE A 1 1371 ? 95.191  130.016 156.132 1.00 0.00 ? 1371 ILE A CA 3  
ATOM 4201   C CA . ASP A 1 1372 ? 94.778  131.981 159.397 1.00 0.00 ? 1372 ASP A CA 3  
ATOM 4202   C CA . VAL A 1 1373 ? 95.480  135.312 161.153 1.00 0.00 ? 1373 VAL A CA 3  
ATOM 4203   C CA . LYS A 1 1374 ? 96.459  135.790 164.782 1.00 0.00 ? 1374 LYS A CA 3  
ATOM 4204   C CA . ASP A 1 1375 ? 96.594  139.406 165.888 1.00 0.00 ? 1375 ASP A CA 3  
ATOM 4205   C CA . TRP A 1 1376 ? 98.372  140.126 169.196 1.00 0.00 ? 1376 TRP A CA 3  
ATOM 4206   C CA . PRO A 1 1377 ? 99.691  143.388 170.726 1.00 0.00 ? 1377 PRO A CA 3  
ATOM 4207   C CA . ILE A 1 1378 ? 103.335 142.227 171.302 1.00 0.00 ? 1378 ILE A CA 3  
ATOM 4208   C CA . GLN A 1 1379 ? 104.929 145.236 172.812 1.00 0.00 ? 1379 GLN A CA 3  
ATOM 4209   C CA . ILE A 1 1380 ? 107.330 146.901 175.221 1.00 0.00 ? 1380 ILE A CA 3  
ATOM 4210   C CA . ARG A 1 1381 ? 105.643 148.729 178.076 1.00 0.00 ? 1381 ARG A CA 3  
ATOM 4211   C CA . ASP A 1 1382 ? 106.561 152.444 178.419 1.00 0.00 ? 1382 ASP A CA 3  
ATOM 4212   C CA . LYS A 1 1383 ? 108.207 152.709 174.959 1.00 0.00 ? 1383 LYS A CA 3  
ATOM 4213   C CA . ARG A 1 1384 ? 107.041 153.596 171.389 1.00 0.00 ? 1384 ARG A CA 3  
ATOM 4214   C CA . LYS A 1 1385 ? 106.198 149.946 170.911 1.00 0.00 ? 1385 LYS A CA 3  
ATOM 4215   C CA . ARG A 1 1386 ? 103.471 150.245 173.703 1.00 0.00 ? 1386 ARG A CA 3  
ATOM 4216   C CA . ASP A 1 1387 ? 100.604 150.728 171.192 1.00 0.00 ? 1387 ASP A CA 3  
ATOM 4217   C CA . LEU A 1 1388 ? 101.927 148.317 168.462 1.00 0.00 ? 1388 LEU A CA 3  
ATOM 4218   C CA . VAL A 1 1389 ? 99.670  145.663 166.908 1.00 0.00 ? 1389 VAL A CA 3  
ATOM 4219   C CA . LEU A 1 1390 ? 101.235 142.595 165.240 1.00 0.00 ? 1390 LEU A CA 3  
ATOM 4220   C CA . ASN A 1 1391 ? 99.196  140.653 162.687 1.00 0.00 ? 1391 ASN A CA 3  
ATOM 4221   C CA . VAL A 1 1392 ? 100.591 137.145 162.116 1.00 0.00 ? 1392 VAL A CA 3  
ATOM 4222   C CA . TRP A 1 1393 ? 99.565  135.821 158.709 1.00 0.00 ? 1393 TRP A CA 3  
ATOM 4223   C CA . ASP A 1 1394 ? 100.121 132.437 157.180 1.00 0.00 ? 1394 ASP A CA 3  
ATOM 4224   C CA . PHE A 1 1395 ? 99.029  131.984 153.541 1.00 0.00 ? 1395 PHE A CA 3  
ATOM 4225   C CA . ALA A 1 1396 ? 100.826 128.624 153.107 1.00 0.00 ? 1396 ALA A CA 3  
ATOM 4226   C CA . GLY A 1 1397 ? 102.906 129.602 150.031 1.00 0.00 ? 1397 GLY A CA 3  
ATOM 4227   C CA . ARG A 1 1398 ? 99.939  130.887 148.012 1.00 0.00 ? 1398 ARG A CA 3  
ATOM 4228   C CA . GLU A 1 1399 ? 100.196 134.673 148.254 1.00 0.00 ? 1399 GLU A CA 3  
ATOM 4229   C CA . GLU A 1 1400 ? 96.487  135.369 147.488 1.00 0.00 ? 1400 GLU A CA 3  
ATOM 4230   C CA . PHE A 1 1401 ? 96.597  139.168 148.090 1.00 0.00 ? 1401 PHE A CA 3  
ATOM 4231   C CA . TYR A 1 1402 ? 99.480  139.798 145.595 1.00 0.00 ? 1402 TYR A CA 3  
ATOM 4232   C CA . SER A 1 1403 ? 97.599  140.730 142.364 1.00 0.00 ? 1403 SER A CA 3  
ATOM 4233   C CA . THR A 1 1404 ? 95.018  143.173 143.777 1.00 0.00 ? 1404 THR A CA 3  
ATOM 4234   C CA . HIS A 1 1405 ? 96.850  144.454 146.876 1.00 0.00 ? 1405 HIS A CA 3  
ATOM 4235   C CA . PRO A 1 1406 ? 100.621 144.943 146.001 1.00 0.00 ? 1406 PRO A CA 3  
ATOM 4236   C CA . HIS A 1 1407 ? 101.376 147.017 149.126 1.00 0.00 ? 1407 HIS A CA 3  
ATOM 4237   C CA . PHE A 1 1408 ? 99.985  144.326 151.478 1.00 0.00 ? 1408 PHE A CA 3  
ATOM 4238   C CA . MET A 1 1409 ? 103.110 142.299 150.628 1.00 0.00 ? 1409 MET A CA 3  
ATOM 4239   C CA . THR A 1 1410 ? 105.631 145.066 149.780 1.00 0.00 ? 1410 THR A CA 3  
ATOM 4240   C CA . GLN A 1 1411 ? 104.857 147.576 152.553 1.00 0.00 ? 1411 GLN A CA 3  
ATOM 4241   C CA . ARG A 1 1412 ? 103.777 147.255 156.197 1.00 0.00 ? 1412 ARG A CA 3  
ATOM 4242   C CA . ALA A 1 1413 ? 105.374 143.821 156.387 1.00 0.00 ? 1413 ALA A CA 3  
ATOM 4243   C CA . LEU A 1 1414 ? 107.952 141.586 158.042 1.00 0.00 ? 1414 LEU A CA 3  
ATOM 4244   C CA . TYR A 1 1415 ? 108.808 138.185 156.602 1.00 0.00 ? 1415 TYR A CA 3  
ATOM 4245   C CA . LEU A 1 1416 ? 109.744 135.468 159.093 1.00 0.00 ? 1416 LEU A CA 3  
ATOM 4246   C CA . ALA A 1 1417 ? 111.453 132.552 157.434 1.00 0.00 ? 1417 ALA A CA 3  
ATOM 4247   C CA . VAL A 1 1418 ? 111.133 129.347 159.439 1.00 0.00 ? 1418 VAL A CA 3  
ATOM 4248   C CA . TYR A 1 1419 ? 113.774 126.745 158.674 1.00 0.00 ? 1419 TYR A CA 3  
ATOM 4249   C CA . ASP A 1 1420 ? 113.942 123.445 160.405 1.00 0.00 ? 1420 ASP A CA 3  
ATOM 4250   C CA . LEU A 1 1421 ? 117.656 123.217 159.615 1.00 0.00 ? 1421 LEU A CA 3  
ATOM 4251   C CA . SER A 1 1422 ? 117.835 119.417 160.157 1.00 0.00 ? 1422 SER A CA 3  
ATOM 4252   C CA . LYS A 1 1423 ? 114.777 118.723 157.956 1.00 0.00 ? 1423 LYS A CA 3  
ATOM 4253   C CA . GLY A 1 1424 ? 113.581 121.781 155.924 1.00 0.00 ? 1424 GLY A CA 3  
ATOM 4254   C CA . GLN A 1 1425 ? 117.163 122.773 155.028 1.00 0.00 ? 1425 GLN A CA 3  
ATOM 4255   C CA . ALA A 1 1426 ? 118.727 119.266 155.116 1.00 0.00 ? 1426 ALA A CA 3  
ATOM 4256   C CA . GLU A 1 1427 ? 116.031 117.040 153.431 1.00 0.00 ? 1427 GLU A CA 3  
ATOM 4257   C CA . VAL A 1 1428 ? 114.748 119.422 150.718 1.00 0.00 ? 1428 VAL A CA 3  
ATOM 4258   C CA . ASP A 1 1429 ? 117.113 122.502 150.671 1.00 0.00 ? 1429 ASP A CA 3  
ATOM 4259   C CA . ALA A 1 1430 ? 114.069 124.763 150.449 1.00 0.00 ? 1430 ALA A CA 3  
ATOM 4260   C CA . MET A 1 1431 ? 115.974 127.697 151.950 1.00 0.00 ? 1431 MET A CA 3  
ATOM 4261   C CA . LYS A 1 1432 ? 117.029 129.025 148.513 1.00 0.00 ? 1432 LYS A CA 3  
ATOM 4262   C CA . PRO A 1 1433 ? 113.401 128.843 147.101 1.00 0.00 ? 1433 PRO A CA 3  
ATOM 4263   C CA . TRP A 1 1434 ? 111.810 130.499 150.178 1.00 0.00 ? 1434 TRP A CA 3  
ATOM 4264   C CA . LEU A 1 1435 ? 114.406 133.275 150.278 1.00 0.00 ? 1435 LEU A CA 3  
ATOM 4265   C CA . PHE A 1 1436 ? 113.713 134.150 146.585 1.00 0.00 ? 1436 PHE A CA 3  
ATOM 4266   C CA . ASN A 1 1437 ? 109.927 133.858 147.321 1.00 0.00 ? 1437 ASN A CA 3  
ATOM 4267   C CA . ILE A 1 1438 ? 110.341 136.517 150.065 1.00 0.00 ? 1438 ILE A CA 3  
ATOM 4268   C CA . LYS A 1 1439 ? 112.410 138.767 147.702 1.00 0.00 ? 1439 LYS A CA 3  
ATOM 4269   C CA . ALA A 1 1440 ? 109.861 138.713 144.827 1.00 0.00 ? 1440 ALA A CA 3  
ATOM 4270   C CA . ARG A 1 1441 ? 106.583 138.953 146.816 1.00 0.00 ? 1441 ARG A CA 3  
ATOM 4271   C CA . ALA A 1 1442 ? 107.868 141.420 149.318 1.00 0.00 ? 1442 ALA A CA 3  
ATOM 4272   C CA . SER A 1 1443 ? 110.119 144.237 148.105 1.00 0.00 ? 1443 SER A CA 3  
ATOM 4273   C CA . SER A 1 1444 ? 112.513 145.929 150.523 1.00 0.00 ? 1444 SER A CA 3  
ATOM 4274   C CA . SER A 1 1445 ? 110.511 144.355 153.397 1.00 0.00 ? 1445 SER A CA 3  
ATOM 4275   C CA . PRO A 1 1446 ? 112.730 142.865 156.213 1.00 0.00 ? 1446 PRO A CA 3  
ATOM 4276   C CA . VAL A 1 1447 ? 113.224 139.247 156.692 1.00 0.00 ? 1447 VAL A CA 3  
ATOM 4277   C CA . ILE A 1 1448 ? 114.177 137.448 159.892 1.00 0.00 ? 1448 ILE A CA 3  
ATOM 4278   C CA . LEU A 1 1449 ? 115.649 133.961 159.504 1.00 0.00 ? 1449 LEU A CA 3  
ATOM 4279   C CA . VAL A 1 1450 ? 114.719 131.549 162.304 1.00 0.00 ? 1450 VAL A CA 3  
ATOM 4280   C CA . GLY A 1 1451 ? 116.554 128.207 162.502 1.00 0.00 ? 1451 GLY A CA 3  
ATOM 4281   C CA . THR A 1 1452 ? 114.208 125.903 164.445 1.00 0.00 ? 1452 THR A CA 3  
ATOM 4282   C CA . HIS A 1 1453 ? 114.445 122.565 166.318 1.00 0.00 ? 1453 HIS A CA 3  
ATOM 4283   C CA . LEU A 1 1454 ? 118.040 123.196 167.372 1.00 0.00 ? 1454 LEU A CA 3  
ATOM 4284   C CA . ASP A 1 1455 ? 117.709 120.826 170.391 1.00 0.00 ? 1455 ASP A CA 3  
ATOM 4285   C CA . VAL A 1 1456 ? 117.458 117.783 168.043 1.00 0.00 ? 1456 VAL A CA 3  
ATOM 4286   C CA . SER A 1 1457 ? 120.607 118.922 166.205 1.00 0.00 ? 1457 SER A CA 3  
ATOM 4287   C CA . ASP A 1 1458 ? 122.949 119.400 169.221 1.00 0.00 ? 1458 ASP A CA 3  
ATOM 4288   C CA . GLU A 1 1459 ? 123.580 123.035 168.154 1.00 0.00 ? 1459 GLU A CA 3  
ATOM 4289   C CA . LYS A 1 1460 ? 125.282 121.837 164.916 1.00 0.00 ? 1460 LYS A CA 3  
ATOM 4290   C CA . GLN A 1 1461 ? 122.956 123.109 162.165 1.00 0.00 ? 1461 GLN A CA 3  
ATOM 4291   C CA . ARG A 1 1462 ? 123.379 126.725 163.246 1.00 0.00 ? 1462 ARG A CA 3  
ATOM 4292   C CA . LYS A 1 1463 ? 127.091 126.777 162.469 1.00 0.00 ? 1463 LYS A CA 3  
ATOM 4293   C CA . ALA A 1 1464 ? 128.708 128.645 159.521 1.00 0.00 ? 1464 ALA A CA 3  
ATOM 4294   C CA . CYS A 1 1465 ? 129.540 125.206 158.082 1.00 0.00 ? 1465 CYS A CA 3  
ATOM 4295   C CA . MET A 1 1466 ? 125.828 124.461 157.382 1.00 0.00 ? 1466 MET A CA 3  
ATOM 4296   C CA . SER A 1 1467 ? 124.083 127.854 157.676 1.00 0.00 ? 1467 SER A CA 3  
ATOM 4297   C CA . LYS A 1 1468 ? 125.766 130.284 155.285 1.00 0.00 ? 1468 LYS A CA 3  
ATOM 4298   C CA . ILE A 1 1469 ? 124.763 133.502 157.175 1.00 0.00 ? 1469 ILE A CA 3  
ATOM 4299   C CA . THR A 1 1470 ? 127.441 135.989 156.022 1.00 0.00 ? 1470 THR A CA 3  
ATOM 4300   C CA . LYS A 1 1471 ? 128.629 133.940 153.094 1.00 0.00 ? 1471 LYS A CA 3  
ATOM 4301   C CA . GLU A 1 1472 ? 125.249 133.483 151.219 1.00 0.00 ? 1472 GLU A CA 3  
ATOM 4302   C CA . LEU A 1 1473 ? 122.293 134.757 153.309 1.00 0.00 ? 1473 LEU A CA 3  
ATOM 4303   C CA . LEU A 1 1474 ? 123.237 138.407 154.136 1.00 0.00 ? 1474 LEU A CA 3  
ATOM 4304   C CA . ASN A 1 1475 ? 124.200 141.686 152.334 1.00 0.00 ? 1475 ASN A CA 3  
ATOM 4305   C CA . LYS A 1 1476 ? 127.592 140.319 151.120 1.00 0.00 ? 1476 LYS A CA 3  
ATOM 4306   C CA . ARG A 1 1477 ? 125.837 137.916 148.712 1.00 0.00 ? 1477 ARG A CA 3  
ATOM 4307   C CA . GLY A 1 1478 ? 122.723 139.754 147.619 1.00 0.00 ? 1478 GLY A CA 3  
ATOM 4308   C CA . PHE A 1 1479 ? 120.339 139.329 150.580 1.00 0.00 ? 1479 PHE A CA 3  
ATOM 4309   C CA . PRO A 1 1480 ? 120.210 142.914 151.951 1.00 0.00 ? 1480 PRO A CA 3  
ATOM 4310   C CA . ALA A 1 1481 ? 116.978 143.108 153.970 1.00 0.00 ? 1481 ALA A CA 3  
ATOM 4311   C CA . ILE A 1 1482 ? 117.847 140.378 156.521 1.00 0.00 ? 1482 ILE A CA 3  
ATOM 4312   C CA . ARG A 1 1483 ? 120.516 141.589 159.046 1.00 0.00 ? 1483 ARG A CA 3  
ATOM 4313   C CA . ASP A 1 1484 ? 119.136 139.125 161.666 1.00 0.00 ? 1484 ASP A CA 3  
ATOM 4314   C CA . TYR A 1 1485 ? 119.394 135.364 162.290 1.00 0.00 ? 1485 TYR A CA 3  
ATOM 4315   C CA . HIS A 1 1486 ? 118.019 133.211 165.140 1.00 0.00 ? 1486 HIS A CA 3  
ATOM 4316   C CA . PHE A 1 1487 ? 118.727 129.744 166.374 1.00 0.00 ? 1487 PHE A CA 3  
ATOM 4317   C CA . VAL A 1 1488 ? 115.951 128.486 168.617 1.00 0.00 ? 1488 VAL A CA 3  
ATOM 4318   C CA . ASN A 1 1489 ? 115.373 125.344 170.703 1.00 0.00 ? 1489 ASN A CA 3  
ATOM 4319   C CA . ALA A 1 1490 ? 111.858 125.645 172.101 1.00 0.00 ? 1490 ALA A CA 3  
ATOM 4320   C CA . THR A 1 1491 ? 111.672 122.740 174.528 1.00 0.00 ? 1491 THR A CA 3  
ATOM 4321   C CA . GLU A 1 1492 ? 115.118 123.384 176.020 1.00 0.00 ? 1492 GLU A CA 3  
ATOM 4322   C CA . GLU A 1 1493 ? 114.912 127.115 176.807 1.00 0.00 ? 1493 GLU A CA 3  
ATOM 4323   C CA . SER A 1 1494 ? 113.050 130.256 175.622 1.00 0.00 ? 1494 SER A CA 3  
ATOM 4324   C CA . ASP A 1 1495 ? 116.031 132.630 175.795 1.00 0.00 ? 1495 ASP A CA 3  
ATOM 4325   C CA . ALA A 1 1496 ? 116.723 132.711 172.025 1.00 0.00 ? 1496 ALA A CA 3  
ATOM 4326   C CA . LEU A 1 1497 ? 113.010 133.379 171.316 1.00 0.00 ? 1497 LEU A CA 3  
ATOM 4327   C CA . ALA A 1 1498 ? 113.161 136.567 173.397 1.00 0.00 ? 1498 ALA A CA 3  
ATOM 4328   C CA . LYS A 1 1499 ? 115.915 137.602 170.921 1.00 0.00 ? 1499 LYS A CA 3  
ATOM 4329   C CA . LEU A 1 1500 ? 113.358 137.162 168.068 1.00 0.00 ? 1500 LEU A CA 3  
ATOM 4330   C CA . ARG A 1 1501 ? 111.372 139.945 169.764 1.00 0.00 ? 1501 ARG A CA 3  
ATOM 4331   C CA . LYS A 1 1502 ? 114.408 142.282 169.356 1.00 0.00 ? 1502 LYS A CA 3  
ATOM 4332   C CA . THR A 1 1503 ? 114.336 141.661 165.595 1.00 0.00 ? 1503 THR A CA 3  
ATOM 4333   C CA . ILE A 1 1504 ? 110.538 142.253 165.572 1.00 0.00 ? 1504 ILE A CA 3  
ATOM 4334   C CA . ILE A 1 1505 ? 111.528 145.527 167.338 1.00 0.00 ? 1505 ILE A CA 3  
ATOM 4335   C CA . ASN A 1 1506 ? 114.232 146.281 164.661 1.00 0.00 ? 1506 ASN A CA 3  
ATOM 4336   C CA . GLU A 1 1507 ? 111.586 145.920 161.965 1.00 0.00 ? 1507 GLU A CA 3  
ATOM 4337   C CA . SER A 1 1508 ? 108.136 147.714 161.972 1.00 0.00 ? 1508 SER A CA 3  
ATOM 4338   C CA . LEU A 1 1509 ? 110.366 150.843 162.153 1.00 0.00 ? 1509 LEU A CA 3  
ATOM 4339   C CA . ASN A 1 1510 ? 110.642 151.454 158.392 1.00 0.00 ? 1510 ASN A CA 3  
ATOM 4340   C CA . PHE A 1 1511 ? 107.069 150.140 157.646 1.00 0.00 ? 1511 PHE A CA 3  
ATOM 4341   C CA . LYS A 1 1512 ? 104.731 152.147 159.770 1.00 0.00 ? 1512 LYS A CA 3  
ATOM 4342   C CA . ILE A 1 1513 ? 106.627 154.867 161.746 1.00 0.00 ? 1513 ILE A CA 3  
ATOM 4343   C CA . ARG A 1 1514 ? 107.675 156.986 158.733 1.00 0.00 ? 1514 ARG A CA 3  
ATOM 4344   C CA . PRO A 1 1524 ? 123.755 156.595 181.718 1.00 0.00 ? 1524 PRO A CA 3  
ATOM 4345   C CA . ASP A 1 1525 ? 121.425 159.555 182.507 1.00 0.00 ? 1525 ASP A CA 3  
ATOM 4346   C CA . CYS A 1 1526 ? 124.095 162.100 181.409 1.00 0.00 ? 1526 CYS A CA 3  
ATOM 4347   C CA . TYR A 1 1527 ? 124.121 160.703 177.806 1.00 0.00 ? 1527 TYR A CA 3  
ATOM 4348   C CA . VAL A 1 1528 ? 120.258 160.973 177.603 1.00 0.00 ? 1528 VAL A CA 3  
ATOM 4349   C CA . GLU A 1 1529 ? 120.321 164.495 179.168 1.00 0.00 ? 1529 GLU A CA 3  
ATOM 4350   C CA . LEU A 1 1530 ? 122.975 165.683 176.741 1.00 0.00 ? 1530 LEU A CA 3  
ATOM 4351   C CA . GLU A 1 1531 ? 121.173 164.078 173.742 1.00 0.00 ? 1531 GLU A CA 3  
ATOM 4352   C CA . LYS A 1 1532 ? 117.953 165.997 174.579 1.00 0.00 ? 1532 LYS A CA 3  
ATOM 4353   C CA . ILE A 1 1533 ? 119.778 169.342 175.008 1.00 0.00 ? 1533 ILE A CA 3  
ATOM 4354   C CA . ILE A 1 1534 ? 121.782 168.734 171.804 1.00 0.00 ? 1534 ILE A CA 3  
ATOM 4355   C CA . LEU A 1 1535 ? 118.560 167.929 169.853 1.00 0.00 ? 1535 LEU A CA 3  
ATOM 4356   C CA . SER A 1 1536 ? 116.747 171.039 171.188 1.00 0.00 ? 1536 SER A CA 3  
ATOM 4357   C CA . GLU A 1 1537 ? 119.760 173.316 170.413 1.00 0.00 ? 1537 GLU A CA 3  
ATOM 4358   C CA . ARG A 1 1538 ? 120.289 171.697 166.987 1.00 0.00 ? 1538 ARG A CA 3  
ATOM 4359   C CA . LYS A 1 1539 ? 116.704 171.743 165.643 1.00 0.00 ? 1539 LYS A CA 3  
ATOM 4360   C CA . ASN A 1 1540 ? 116.407 175.438 166.602 1.00 0.00 ? 1540 ASN A CA 3  
ATOM 4361   C CA . VAL A 1 1541 ? 119.244 176.265 164.169 1.00 0.00 ? 1541 VAL A CA 3  
ATOM 4362   C CA . PRO A 1 1542 ? 117.618 175.210 160.789 1.00 0.00 ? 1542 PRO A CA 3  
ATOM 4363   C CA . ILE A 1 1543 ? 118.520 178.471 159.125 1.00 0.00 ? 1543 ILE A CA 3  
ATOM 4364   C CA . GLU A 1 1544 ? 122.195 178.295 159.854 1.00 0.00 ? 1544 GLU A CA 3  
ATOM 4365   C CA . PHE A 1 1545 ? 124.949 175.601 159.652 1.00 0.00 ? 1545 PHE A CA 3  
ATOM 4366   C CA . PRO A 1 1546 ? 126.943 175.920 162.969 1.00 0.00 ? 1546 PRO A CA 3  
ATOM 4367   C CA . VAL A 1 1547 ? 123.995 174.426 164.654 1.00 0.00 ? 1547 VAL A CA 3  
ATOM 4368   C CA . ILE A 1 1548 ? 126.392 173.646 167.445 1.00 0.00 ? 1548 ILE A CA 3  
ATOM 4369   C CA . ASP A 1 1549 ? 129.994 174.933 167.490 1.00 0.00 ? 1549 ASP A CA 3  
ATOM 4370   C CA . ARG A 1 1550 ? 132.783 173.247 169.532 1.00 0.00 ? 1550 ARG A CA 3  
ATOM 4371   C CA . LYS A 1 1551 ? 132.506 175.642 172.504 1.00 0.00 ? 1551 LYS A CA 3  
ATOM 4372   C CA . ARG A 1 1552 ? 128.734 175.317 172.665 1.00 0.00 ? 1552 ARG A CA 3  
ATOM 4373   C CA . LEU A 1 1553 ? 128.674 171.464 172.931 1.00 0.00 ? 1553 LEU A CA 3  
ATOM 4374   C CA . LEU A 1 1554 ? 131.527 171.636 175.487 1.00 0.00 ? 1554 LEU A CA 3  
ATOM 4375   C CA . GLN A 1 1555 ? 129.275 173.941 177.542 1.00 0.00 ? 1555 GLN A CA 3  
ATOM 4376   C CA . LEU A 1 1556 ? 126.271 171.533 177.285 1.00 0.00 ? 1556 LEU A CA 3  
ATOM 4377   C CA . VAL A 1 1557 ? 128.479 168.501 178.174 1.00 0.00 ? 1557 VAL A CA 3  
ATOM 4378   C CA . ARG A 1 1558 ? 129.716 170.337 181.332 1.00 0.00 ? 1558 ARG A CA 3  
ATOM 4379   C CA . GLU A 1 1559 ? 126.178 171.182 182.506 1.00 0.00 ? 1559 GLU A CA 3  
ATOM 4380   C CA . ASN A 1 1560 ? 125.375 167.422 182.552 1.00 0.00 ? 1560 ASN A CA 3  
ATOM 4381   C CA . GLN A 1 1561 ? 128.753 166.680 184.268 1.00 0.00 ? 1561 GLN A CA 3  
ATOM 4382   C CA . LEU A 1 1562 ? 130.555 165.103 181.239 1.00 0.00 ? 1562 LEU A CA 3  
ATOM 4383   C CA . GLN A 1 1563 ? 133.420 167.653 180.818 1.00 0.00 ? 1563 GLN A CA 3  
ATOM 4384   C CA . LEU A 1 1564 ? 135.372 165.361 183.180 1.00 0.00 ? 1564 LEU A CA 3  
ATOM 4385   C CA . ASP A 1 1565 ? 136.859 163.446 180.233 1.00 0.00 ? 1565 ASP A CA 3  
ATOM 4386   C CA . GLU A 1 1566 ? 137.368 164.708 176.637 1.00 0.00 ? 1566 GLU A CA 3  
ATOM 4387   C CA . ASN A 1 1567 ? 137.681 161.053 175.671 1.00 0.00 ? 1567 ASN A CA 3  
ATOM 4388   C CA . GLU A 1 1568 ? 134.037 160.143 176.702 1.00 0.00 ? 1568 GLU A CA 3  
ATOM 4389   C CA . LEU A 1 1569 ? 132.622 163.157 174.893 1.00 0.00 ? 1569 LEU A CA 3  
ATOM 4390   C CA . PRO A 1 1570 ? 133.963 161.852 171.466 1.00 0.00 ? 1570 PRO A CA 3  
ATOM 4391   C CA . HIS A 1 1571 ? 132.446 158.475 172.367 1.00 0.00 ? 1571 HIS A CA 3  
ATOM 4392   C CA . ALA A 1 1572 ? 129.029 159.990 173.289 1.00 0.00 ? 1572 ALA A CA 3  
ATOM 4393   C CA . VAL A 1 1573 ? 128.917 162.124 170.110 1.00 0.00 ? 1573 VAL A CA 3  
ATOM 4394   C CA . HIS A 1 1574 ? 130.308 159.141 168.087 1.00 0.00 ? 1574 HIS A CA 3  
ATOM 4395   C CA . PHE A 1 1575 ? 127.310 157.138 169.453 1.00 0.00 ? 1575 PHE A CA 3  
ATOM 4396   C CA . LEU A 1 1576 ? 124.831 159.910 168.676 1.00 0.00 ? 1576 LEU A CA 3  
ATOM 4397   C CA . ASN A 1 1577 ? 126.299 160.200 165.155 1.00 0.00 ? 1577 ASN A CA 3  
ATOM 4398   C CA . GLU A 1 1578 ? 126.189 156.368 164.602 1.00 0.00 ? 1578 GLU A CA 3  
ATOM 4399   C CA . SER A 1 1579 ? 122.516 156.474 165.658 1.00 0.00 ? 1579 SER A CA 3  
ATOM 4400   C CA . GLY A 1 1580 ? 121.610 159.512 163.434 1.00 0.00 ? 1580 GLY A CA 3  
ATOM 4401   C CA . VAL A 1 1581 ? 120.253 161.555 166.352 1.00 0.00 ? 1581 VAL A CA 3  
ATOM 4402   C CA . LEU A 1 1582 ? 122.826 164.176 165.484 1.00 0.00 ? 1582 LEU A CA 3  
ATOM 4403   C CA . LEU A 1 1583 ? 125.578 164.252 162.902 1.00 0.00 ? 1583 LEU A CA 3  
ATOM 4404   C CA . HIS A 1 1584 ? 129.250 164.629 163.887 1.00 0.00 ? 1584 HIS A CA 3  
ATOM 4405   C CA . PHE A 1 1585 ? 131.942 164.263 161.282 1.00 0.00 ? 1585 PHE A CA 3  
ATOM 4406   C CA . GLN A 1 1586 ? 135.244 163.273 162.919 1.00 0.00 ? 1586 GLN A CA 3  
ATOM 4407   C CA . ASP A 1 1587 ? 137.183 163.335 159.576 1.00 0.00 ? 1587 ASP A CA 3  
ATOM 4408   C CA . PRO A 1 1588 ? 136.598 167.146 158.852 1.00 0.00 ? 1588 PRO A CA 3  
ATOM 4409   C CA . ALA A 1 1589 ? 136.764 167.939 162.631 1.00 0.00 ? 1589 ALA A CA 3  
ATOM 4410   C CA . LEU A 1 1590 ? 140.527 168.701 162.534 1.00 0.00 ? 1590 LEU A CA 3  
ATOM 4411   C CA . GLN A 1 1591 ? 139.961 172.162 160.991 1.00 0.00 ? 1591 GLN A CA 3  
ATOM 4412   C CA . LEU A 1 1592 ? 136.308 172.764 161.863 1.00 0.00 ? 1592 LEU A CA 3  
ATOM 4413   C CA . SER A 1 1593 ? 135.311 173.960 165.376 1.00 0.00 ? 1593 SER A CA 3  
ATOM 4414   C CA . ASP A 1 1594 ? 132.692 176.359 163.945 1.00 0.00 ? 1594 ASP A CA 3  
ATOM 4415   C CA . LEU A 1 1595 ? 130.553 173.514 162.590 1.00 0.00 ? 1595 LEU A CA 3  
ATOM 4416   C CA . TYR A 1 1596 ? 131.112 170.583 164.900 1.00 0.00 ? 1596 TYR A CA 3  
ATOM 4417   C CA . PHE A 1 1597 ? 127.786 168.775 165.346 1.00 0.00 ? 1597 PHE A CA 3  
ATOM 4418   C CA . VAL A 1 1598 ? 124.896 168.947 162.847 1.00 0.00 ? 1598 VAL A CA 3  
ATOM 4419   C CA . GLU A 1 1599 ? 121.049 168.636 162.529 1.00 0.00 ? 1599 GLU A CA 3  
ATOM 4420   C CA . PRO A 1 1600 ? 120.309 165.580 160.257 1.00 0.00 ? 1600 PRO A CA 3  
ATOM 4421   C CA . LYS A 1 1601 ? 117.286 167.260 158.614 1.00 0.00 ? 1601 LYS A CA 3  
ATOM 4422   C CA . TRP A 1 1602 ? 119.309 170.330 157.710 1.00 0.00 ? 1602 TRP A CA 3  
ATOM 4423   C CA . LEU A 1 1603 ? 122.077 168.152 156.143 1.00 0.00 ? 1603 LEU A CA 3  
ATOM 4424   C CA . CYS A 1 1604 ? 119.619 165.887 154.254 1.00 0.00 ? 1604 CYS A CA 3  
ATOM 4425   C CA . LYS A 1 1605 ? 117.632 168.812 152.769 1.00 0.00 ? 1605 LYS A CA 3  
ATOM 4426   C CA . ILE A 1 1606 ? 120.930 170.385 151.615 1.00 0.00 ? 1606 ILE A CA 3  
ATOM 4427   C CA . MET A 1 1607 ? 122.075 167.479 149.589 1.00 0.00 ? 1607 MET A CA 3  
ATOM 4428   C CA . ALA A 1 1608 ? 118.711 166.589 148.127 1.00 0.00 ? 1608 ALA A CA 3  
ATOM 4429   C CA . GLN A 1 1609 ? 118.552 170.196 146.785 1.00 0.00 ? 1609 GLN A CA 3  
ATOM 4430   C CA . ILE A 1 1610 ? 122.006 169.726 145.144 1.00 0.00 ? 1610 ILE A CA 3  
ATOM 4431   C CA . LEU A 1 1611 ? 120.970 166.291 143.772 1.00 0.00 ? 1611 LEU A CA 3  
ATOM 4432   C CA . THR A 1 1612 ? 117.645 167.537 142.279 1.00 0.00 ? 1612 THR A CA 3  
ATOM 4433   C CA . VAL A 1 1613 ? 118.859 170.905 140.968 1.00 0.00 ? 1613 VAL A CA 3  
ATOM 4434   C CA . LYS A 1 1614 ? 118.325 171.650 137.238 1.00 0.00 ? 1614 LYS A CA 3  
ATOM 4435   C CA . VAL A 1 1615 ? 121.863 173.098 136.994 1.00 0.00 ? 1615 VAL A CA 3  
ATOM 4436   C CA . GLU A 1 1616 ? 123.909 169.888 136.654 1.00 0.00 ? 1616 GLU A CA 3  
ATOM 4437   C CA . GLY A 1 1617 ? 126.236 171.431 134.054 1.00 0.00 ? 1617 GLY A CA 3  
ATOM 4438   C CA . CYS A 1 1618 ? 126.737 173.790 131.128 1.00 0.00 ? 1618 CYS A CA 3  
ATOM 4439   C CA . PRO A 1 1619 ? 123.555 174.545 128.999 1.00 0.00 ? 1619 PRO A CA 3  
ATOM 4440   C CA . LYS A 1 1620 ? 123.938 171.869 126.257 1.00 0.00 ? 1620 LYS A CA 3  
ATOM 4441   C CA . HIS A 1 1621 ? 125.710 169.220 128.383 1.00 0.00 ? 1621 HIS A CA 3  
ATOM 4442   C CA . PRO A 1 1622 ? 124.293 168.778 131.948 1.00 0.00 ? 1622 PRO A CA 3  
ATOM 4443   C CA . LYS A 1 1623 ? 125.686 165.347 132.899 1.00 0.00 ? 1623 LYS A CA 3  
ATOM 4444   C CA . GLY A 1 1624 ? 126.055 165.358 136.729 1.00 0.00 ? 1624 GLY A CA 3  
ATOM 4445   C CA . ILE A 1 1625 ? 128.384 168.398 136.804 1.00 0.00 ? 1625 ILE A CA 3  
ATOM 4446   C CA . ILE A 1 1626 ? 128.241 170.701 139.860 1.00 0.00 ? 1626 ILE A CA 3  
ATOM 4447   C CA . SER A 1 1627 ? 129.642 174.163 139.053 1.00 0.00 ? 1627 SER A CA 3  
ATOM 4448   C CA . ARG A 1 1628 ? 130.762 175.493 142.487 1.00 0.00 ? 1628 ARG A CA 3  
ATOM 4449   C CA . ARG A 1 1629 ? 129.694 179.116 141.735 1.00 0.00 ? 1629 ARG A CA 3  
ATOM 4450   C CA . ASP A 1 1630 ? 126.077 178.305 141.379 1.00 0.00 ? 1630 ASP A CA 3  
ATOM 4451   C CA . VAL A 1 1631 ? 125.602 176.775 144.900 1.00 0.00 ? 1631 VAL A CA 3  
ATOM 4452   C CA . GLU A 1 1632 ? 124.115 180.053 146.256 1.00 0.00 ? 1632 GLU A CA 3  
ATOM 4453   C CA . LYS A 1 1633 ? 121.249 179.832 143.755 1.00 0.00 ? 1633 LYS A CA 3  
ATOM 4454   C CA . PHE A 1 1634 ? 120.617 176.063 144.243 1.00 0.00 ? 1634 PHE A CA 3  
ATOM 4455   C CA . LEU A 1 1635 ? 120.476 176.097 147.976 1.00 0.00 ? 1635 LEU A CA 3  
ATOM 4456   C CA . SER A 1 1636 ? 118.953 179.531 148.858 1.00 0.00 ? 1636 SER A CA 3  
ATOM 4457   C CA . LYS A 1 1637 ? 116.335 180.877 149.914 1.00 0.00 ? 1637 LYS A CA 3  
ATOM 4458   C CA . LYS A 1 1638 ? 114.423 177.529 150.371 1.00 0.00 ? 1638 LYS A CA 3  
ATOM 4459   C CA . ARG A 1 1639 ? 117.040 176.862 152.961 1.00 0.00 ? 1639 ARG A CA 3  
ATOM 4460   C CA . LYS A 1 1640 ? 119.602 179.343 154.251 1.00 0.00 ? 1640 LYS A CA 3  
ATOM 4461   C CA . PHE A 1 1641 ? 123.168 178.504 153.237 1.00 0.00 ? 1641 PHE A CA 3  
ATOM 4462   C CA . PRO A 1 1642 ? 125.884 181.135 153.564 1.00 0.00 ? 1642 PRO A CA 3  
ATOM 4463   C CA . LYS A 1 1643 ? 129.253 180.718 151.760 1.00 0.00 ? 1643 LYS A CA 3  
ATOM 4464   C CA . ASN A 1 1644 ? 131.205 178.864 154.521 1.00 0.00 ? 1644 ASN A CA 3  
ATOM 4465   C CA . TYR A 1 1645 ? 128.209 176.538 155.005 1.00 0.00 ? 1645 TYR A CA 3  
ATOM 4466   C CA . MET A 1 1646 ? 128.286 176.028 151.218 1.00 0.00 ? 1646 MET A CA 3  
ATOM 4467   C CA . SER A 1 1647 ? 131.949 174.888 151.223 1.00 0.00 ? 1647 SER A CA 3  
ATOM 4468   C CA . GLN A 1 1648 ? 131.289 172.393 154.076 1.00 0.00 ? 1648 GLN A CA 3  
ATOM 4469   C CA . TYR A 1 1649 ? 128.165 170.689 152.584 1.00 0.00 ? 1649 TYR A CA 3  
ATOM 4470   C CA . PHE A 1 1650 ? 130.339 169.776 149.587 1.00 0.00 ? 1650 PHE A CA 3  
ATOM 4471   C CA . LYS A 1 1651 ? 132.692 168.019 152.043 1.00 0.00 ? 1651 LYS A CA 3  
ATOM 4472   C CA . LEU A 1 1652 ? 129.621 166.177 153.412 1.00 0.00 ? 1652 LEU A CA 3  
ATOM 4473   C CA . LEU A 1 1653 ? 128.734 165.079 149.809 1.00 0.00 ? 1653 LEU A CA 3  
ATOM 4474   C CA . GLU A 1 1654 ? 132.328 163.809 149.376 1.00 0.00 ? 1654 GLU A CA 3  
ATOM 4475   C CA . LYS A 1 1655 ? 132.073 161.969 152.702 1.00 0.00 ? 1655 LYS A CA 3  
ATOM 4476   C CA . PHE A 1 1656 ? 128.614 160.507 151.820 1.00 0.00 ? 1656 PHE A CA 3  
ATOM 4477   C CA . GLN A 1 1657 ? 130.237 159.402 148.492 1.00 0.00 ? 1657 GLN A CA 3  
ATOM 4478   C CA . ILE A 1 1658 ? 127.753 161.332 146.352 1.00 0.00 ? 1658 ILE A CA 3  
ATOM 4479   C CA . ALA A 1 1659 ? 130.349 163.435 144.528 1.00 0.00 ? 1659 ALA A CA 3  
ATOM 4480   C CA . LEU A 1 1660 ? 134.091 163.879 143.881 1.00 0.00 ? 1660 LEU A CA 3  
ATOM 4481   C CA . PRO A 1 1661 ? 136.278 166.896 142.886 1.00 0.00 ? 1661 PRO A CA 3  
ATOM 4482   C CA . ILE A 1 1662 ? 138.118 166.984 139.514 1.00 0.00 ? 1662 ILE A CA 3  
ATOM 4483   C CA . GLY A 1 1663 ? 139.914 170.255 140.385 1.00 0.00 ? 1663 GLY A CA 3  
ATOM 4484   C CA . GLU A 1 1664 ? 138.437 173.074 138.247 1.00 0.00 ? 1664 GLU A CA 3  
ATOM 4485   C CA . GLU A 1 1665 ? 135.675 174.105 140.762 1.00 0.00 ? 1665 GLU A CA 3  
ATOM 4486   C CA . TYR A 1 1666 ? 133.555 171.482 138.976 1.00 0.00 ? 1666 TYR A CA 3  
ATOM 4487   C CA . LEU A 1 1667 ? 132.429 168.307 140.763 1.00 0.00 ? 1667 LEU A CA 3  
ATOM 4488   C CA . LEU A 1 1668 ? 131.030 165.050 139.378 1.00 0.00 ? 1668 LEU A CA 3  
ATOM 4489   C CA . VAL A 1 1669 ? 127.809 163.541 140.805 1.00 0.00 ? 1669 VAL A CA 3  
ATOM 4490   C CA . ILE A 1 1690 ? 149.021 130.076 151.632 1.00 0.00 ? 1690 ILE A CA 3  
ATOM 4491   C CA . ILE A 1 1691 ? 148.974 133.025 154.137 1.00 0.00 ? 1691 ILE A CA 3  
ATOM 4492   C CA . ILE A 1 1692 ? 145.397 134.247 154.544 1.00 0.00 ? 1692 ILE A CA 3  
ATOM 4493   C CA . ARG A 1 1693 ? 144.506 137.387 156.523 1.00 0.00 ? 1693 ARG A CA 3  
ATOM 4494   C CA . LEU A 1 1694 ? 140.923 138.723 156.770 1.00 0.00 ? 1694 LEU A CA 3  
ATOM 4495   C CA . TYR A 1 1695 ? 139.731 142.237 157.813 1.00 0.00 ? 1695 TYR A CA 3  
ATOM 4496   C CA . GLU A 1 1696 ? 136.094 142.642 159.078 1.00 0.00 ? 1696 GLU A CA 3  
ATOM 4497   C CA . MET A 1 1697 ? 134.541 146.126 158.675 1.00 0.00 ? 1697 MET A CA 3  
ATOM 4498   C CA . PRO A 1 1698 ? 130.984 147.035 160.130 1.00 0.00 ? 1698 PRO A CA 3  
ATOM 4499   C CA . TYR A 1 1699 ? 130.786 149.196 157.085 1.00 0.00 ? 1699 TYR A CA 3  
ATOM 4500   C CA . PHE A 1 1700 ? 133.032 148.382 154.078 1.00 0.00 ? 1700 PHE A CA 3  
ATOM 4501   C CA . PRO A 1 1701 ? 133.402 151.586 151.909 1.00 0.00 ? 1701 PRO A CA 3  
ATOM 4502   C CA . MET A 1 1702 ? 132.943 150.761 148.215 1.00 0.00 ? 1702 MET A CA 3  
ATOM 4503   C CA . GLY A 1 1703 ? 135.900 153.056 147.503 1.00 0.00 ? 1703 GLY A CA 3  
ATOM 4504   C CA . PHE A 1 1704 ? 138.431 150.824 149.369 1.00 0.00 ? 1704 PHE A CA 3  
ATOM 4505   C CA . TRP A 1 1705 ? 139.169 148.393 146.538 1.00 0.00 ? 1705 TRP A CA 3  
ATOM 4506   C CA . SER A 1 1706 ? 139.097 151.060 143.879 1.00 0.00 ? 1706 SER A CA 3  
ATOM 4507   C CA . ARG A 1 1707 ? 141.606 153.151 145.846 1.00 0.00 ? 1707 ARG A CA 3  
ATOM 4508   C CA . LEU A 1 1708 ? 143.829 150.191 146.783 1.00 0.00 ? 1708 LEU A CA 3  
ATOM 4509   C CA . ILE A 1 1709 ? 143.890 149.199 143.073 1.00 0.00 ? 1709 ILE A CA 3  
ATOM 4510   C CA . ASN A 1 1710 ? 145.195 152.750 142.375 1.00 0.00 ? 1710 ASN A CA 3  
ATOM 4511   C CA . ARG A 1 1711 ? 147.870 152.613 145.152 1.00 0.00 ? 1711 ARG A CA 3  
ATOM 4512   C CA . LEU A 1 1712 ? 148.979 149.206 143.816 1.00 0.00 ? 1712 LEU A CA 3  
ATOM 4513   C CA . LEU A 1 1713 ? 148.548 149.745 140.004 1.00 0.00 ? 1713 LEU A CA 3  
ATOM 4514   C CA . GLU A 1 1714 ? 152.159 148.838 139.217 1.00 0.00 ? 1714 GLU A CA 3  
ATOM 4515   C CA . ILE A 1 1715 ? 151.939 145.299 140.693 1.00 0.00 ? 1715 ILE A CA 3  
ATOM 4516   C CA . SER A 1 1716 ? 148.657 144.154 139.056 1.00 0.00 ? 1716 SER A CA 3  
ATOM 4517   C CA . PRO A 1 1717 ? 150.138 142.935 135.710 1.00 0.00 ? 1717 PRO A CA 3  
ATOM 4518   C CA . TYR A 1 1718 ? 153.355 142.014 137.527 1.00 0.00 ? 1718 TYR A CA 3  
ATOM 4519   C CA . MET A 1 1719 ? 156.420 143.781 138.863 1.00 0.00 ? 1719 MET A CA 3  
ATOM 4520   C CA . LEU A 1 1720 ? 158.884 140.835 138.426 1.00 0.00 ? 1720 LEU A CA 3  
ATOM 4521   C CA . SER A 1 1721 ? 160.027 139.589 135.047 1.00 0.00 ? 1721 SER A CA 3  
ATOM 4522   C CA . GLY A 1 1722 ? 159.922 136.136 136.790 1.00 0.00 ? 1722 GLY A CA 3  
ATOM 4523   C CA . ARG A 1 1723 ? 156.290 135.271 136.297 1.00 0.00 ? 1723 ARG A CA 3  
ATOM 4524   C CA . GLU A 1 1724 ? 155.137 131.676 136.870 1.00 0.00 ? 1724 GLU A CA 3  
ATOM 4525   C CA . ARG A 1 1725 ? 151.343 131.925 136.715 1.00 0.00 ? 1725 ARG A CA 3  
ATOM 4526   C CA . ALA A 1 1726 ? 149.628 133.439 133.650 1.00 0.00 ? 1726 ALA A CA 3  
ATOM 4527   C CA . LEU A 1 1727 ? 146.207 133.754 135.320 1.00 0.00 ? 1727 LEU A CA 3  
ATOM 4528   C CA . ARG A 1 1728 ? 146.677 135.722 138.556 1.00 0.00 ? 1728 ARG A CA 3  
ATOM 4529   C CA . PRO A 1 1729 ? 148.541 138.911 137.367 1.00 0.00 ? 1729 PRO A CA 3  
ATOM 4530   C CA . ASN A 1 1730 ? 147.890 140.252 133.730 1.00 0.00 ? 1730 ASN A CA 3  
ATOM 4531   C CA . ARG A 1 1731 ? 145.063 142.801 134.035 1.00 0.00 ? 1731 ARG A CA 3  
ATOM 4532   C CA . MET A 1 1732 ? 143.481 140.555 136.576 1.00 0.00 ? 1732 MET A CA 3  
ATOM 4533   C CA . TYR A 1 1733 ? 141.583 143.074 138.447 1.00 0.00 ? 1733 TYR A CA 3  
ATOM 4534   C CA . TRP A 1 1734 ? 137.881 143.237 138.910 1.00 0.00 ? 1734 TRP A CA 3  
ATOM 4535   C CA . ARG A 1 1735 ? 135.273 145.226 140.850 1.00 0.00 ? 1735 ARG A CA 3  
ATOM 4536   C CA . GLN A 1 1736 ? 135.810 143.158 144.044 1.00 0.00 ? 1736 GLN A CA 3  
ATOM 4537   C CA . GLY A 1 1737 ? 139.568 142.418 143.862 1.00 0.00 ? 1737 GLY A CA 3  
ATOM 4538   C CA . ILE A 1 1738 ? 143.005 142.188 142.295 1.00 0.00 ? 1738 ILE A CA 3  
ATOM 4539   C CA . TYR A 1 1739 ? 146.023 139.896 141.928 1.00 0.00 ? 1739 TYR A CA 3  
ATOM 4540   C CA . LEU A 1 1740 ? 149.332 141.427 142.863 1.00 0.00 ? 1740 LEU A CA 3  
ATOM 4541   C CA . ASN A 1 1741 ? 152.879 140.256 142.035 1.00 0.00 ? 1741 ASN A CA 3  
ATOM 4542   C CA . TRP A 1 1742 ? 156.105 141.948 143.225 1.00 0.00 ? 1742 TRP A CA 3  
ATOM 4543   C CA . SER A 1 1743 ? 159.856 141.601 142.728 1.00 0.00 ? 1743 SER A CA 3  
ATOM 4544   C CA . PRO A 1 1744 ? 161.631 139.646 144.262 1.00 0.00 ? 1744 PRO A CA 3  
ATOM 4545   C CA . GLU A 1 1745 ? 160.894 136.830 145.165 1.00 0.00 ? 1745 GLU A CA 3  
ATOM 4546   C CA . ALA A 1 1746 ? 157.803 136.549 142.849 1.00 0.00 ? 1746 ALA A CA 3  
ATOM 4547   C CA . TYR A 1 1747 ? 155.205 136.403 145.530 1.00 0.00 ? 1747 TYR A CA 3  
ATOM 4548   C CA . CYS A 1 1748 ? 151.571 136.408 144.275 1.00 0.00 ? 1748 CYS A CA 3  
ATOM 4549   C CA . LEU A 1 1749 ? 148.838 138.060 146.396 1.00 0.00 ? 1749 LEU A CA 3  
ATOM 4550   C CA . VAL A 1 1750 ? 145.081 137.995 145.849 1.00 0.00 ? 1750 VAL A CA 3  
ATOM 4551   C CA . GLY A 1 1751 ? 143.071 140.698 147.500 1.00 0.00 ? 1751 GLY A CA 3  
ATOM 4552   C CA . SER A 1 1752 ? 139.304 140.143 147.453 1.00 0.00 ? 1752 SER A CA 3  
ATOM 4553   C CA . GLU A 1 1753 ? 136.956 142.128 149.724 1.00 0.00 ? 1753 GLU A CA 3  
ATOM 4554   C CA . VAL A 1 1754 ? 138.738 142.128 153.012 1.00 0.00 ? 1754 VAL A CA 3  
ATOM 4555   C CA . LEU A 1 1755 ? 140.508 138.829 152.262 1.00 0.00 ? 1755 LEU A CA 3  
ATOM 4556   C CA . ASP A 1 1756 ? 144.235 138.780 151.460 1.00 0.00 ? 1756 ASP A CA 3  
ATOM 4557   C CA . ASN A 1 1757 ? 145.644 135.362 150.372 1.00 0.00 ? 1757 ASN A CA 3  
ATOM 4558   C CA . HIS A 1 1758 ? 149.359 134.964 149.609 1.00 0.00 ? 1758 HIS A CA 3  
ATOM 4559   C CA . PRO A 1 1759 ? 151.697 132.167 148.085 1.00 0.00 ? 1759 PRO A CA 3  
ATOM 4560   C CA . GLU A 1 1760 ? 155.624 132.379 148.329 1.00 0.00 ? 1760 GLU A CA 3  
ATOM 4561   C CA . SER A 1 1761 ? 158.300 132.246 151.092 1.00 0.00 ? 1761 SER A CA 3  
ATOM 4562   C CA . PHE A 1 1762 ? 158.405 136.122 151.392 1.00 0.00 ? 1762 PHE A CA 3  
ATOM 4563   C CA . LEU A 1 1763 ? 154.787 136.127 152.538 1.00 0.00 ? 1763 LEU A CA 3  
ATOM 4564   C CA . LYS A 1 1764 ? 155.138 137.929 155.743 1.00 0.00 ? 1764 LYS A CA 3  
ATOM 4565   C CA . ILE A 1 1765 ? 156.810 141.110 154.349 1.00 0.00 ? 1765 ILE A CA 3  
ATOM 4566   C CA . THR A 1 1766 ? 154.309 141.374 151.480 1.00 0.00 ? 1766 THR A CA 3  
ATOM 4567   C CA . VAL A 1 1767 ? 151.265 141.304 153.705 1.00 0.00 ? 1767 VAL A CA 3  
ATOM 4568   C CA . PRO A 1 1768 ? 152.304 144.527 155.752 1.00 0.00 ? 1768 PRO A CA 3  
ATOM 4569   C CA . SER A 1 1769 ? 152.871 146.532 152.643 1.00 0.00 ? 1769 SER A CA 3  
ATOM 4570   C CA . CYS A 1 1770 ? 149.361 145.532 151.441 1.00 0.00 ? 1770 CYS A CA 3  
ATOM 4571   C CA . ARG A 1 1771 ? 148.014 145.790 155.055 1.00 0.00 ? 1771 ARG A CA 3  
ATOM 4572   C CA . LYS A 1 1772 ? 149.610 149.234 155.449 1.00 0.00 ? 1772 LYS A CA 3  
ATOM 4573   C CA . GLY A 1 1773 ? 148.102 150.501 152.155 1.00 0.00 ? 1773 GLY A CA 3  
ATOM 4574   C CA . CYS A 1 1774 ? 144.681 149.268 153.286 1.00 0.00 ? 1774 CYS A CA 3  
ATOM 4575   C CA . ILE A 1 1775 ? 145.101 150.899 156.743 1.00 0.00 ? 1775 ILE A CA 3  
ATOM 4576   C CA . LEU A 1 1776 ? 146.146 154.185 155.023 1.00 0.00 ? 1776 LEU A CA 3  
ATOM 4577   C CA . LEU A 1 1777 ? 142.889 154.201 153.019 1.00 0.00 ? 1777 LEU A CA 3  
ATOM 4578   C CA . GLY A 1 1778 ? 140.875 153.315 156.135 1.00 0.00 ? 1778 GLY A CA 3  
ATOM 4579   C CA . GLN A 1 1779 ? 142.218 156.424 157.917 1.00 0.00 ? 1779 GLN A CA 3  
ATOM 4580   C CA . VAL A 1 1780 ? 140.401 158.689 155.367 1.00 0.00 ? 1780 VAL A CA 3  
ATOM 4581   C CA . VAL A 1 1781 ? 137.096 157.466 156.886 1.00 0.00 ? 1781 VAL A CA 3  
ATOM 4582   C CA . ASP A 1 1782 ? 136.220 158.663 160.431 1.00 0.00 ? 1782 ASP A CA 3  
ATOM 4583   C CA . HIS A 1 1783 ? 134.930 156.031 162.951 1.00 0.00 ? 1783 HIS A CA 3  
ATOM 4584   C CA . ILE A 1 1784 ? 135.708 152.957 160.745 1.00 0.00 ? 1784 ILE A CA 3  
ATOM 4585   C CA . ASP A 1 1785 ? 136.037 149.750 162.832 1.00 0.00 ? 1785 ASP A CA 3  
ATOM 4586   C CA . SER A 1 1786 ? 138.242 146.951 161.428 1.00 0.00 ? 1786 SER A CA 3  
ATOM 4587   C CA . LEU A 1 1787 ? 138.660 143.573 163.146 1.00 0.00 ? 1787 LEU A CA 3  
ATOM 4588   C CA . MET A 1 1788 ? 141.477 141.398 161.831 1.00 0.00 ? 1788 MET A CA 3  
ATOM 4589   C CA . GLU A 1 1789 ? 141.173 137.611 161.582 1.00 0.00 ? 1789 GLU A CA 3  
ATOM 4590   C CA . GLU A 1 1790 ? 143.272 134.593 160.744 1.00 0.00 ? 1790 GLU A CA 3  
ATOM 4591   C CA . TRP A 1 1791 ? 141.920 131.270 159.525 1.00 0.00 ? 1791 TRP A CA 3  
ATOM 4592   C CA . PHE A 1 1792 ? 142.663 128.210 161.653 1.00 0.00 ? 1792 PHE A CA 3  
ATOM 4593   C CA . PRO A 1 1793 ? 145.266 125.704 160.123 1.00 0.00 ? 1793 PRO A CA 3  
ATOM 4594   C CA . GLY A 1 1794 ? 143.331 122.892 158.432 1.00 0.00 ? 1794 GLY A CA 3  
ATOM 4595   C CA . LEU A 1 1795 ? 140.008 124.733 158.852 1.00 0.00 ? 1795 LEU A CA 3  
ATOM 4596   C CA . LEU A 1 1796 ? 139.733 127.593 156.311 1.00 0.00 ? 1796 LEU A CA 3  
ATOM 4597   C CA . GLU A 1 1797 ? 136.274 128.816 157.470 1.00 0.00 ? 1797 GLU A CA 3  
ATOM 4598   C CA . ILE A 1 1798 ? 137.084 128.866 161.236 1.00 0.00 ? 1798 ILE A CA 3  
ATOM 4599   C CA . ASP A 1 1799 ? 138.573 132.240 162.158 1.00 0.00 ? 1799 ASP A CA 3  
ATOM 4600   C CA . ILE A 1 1800 ? 140.449 133.510 165.217 1.00 0.00 ? 1800 ILE A CA 3  
ATOM 4601   C CA . CYS A 1 1801 ? 140.798 137.221 165.973 1.00 0.00 ? 1801 CYS A CA 3  
ATOM 4602   C CA . GLY A 1 1802 ? 144.435 138.507 165.763 1.00 0.00 ? 1802 GLY A CA 3  
ATOM 4603   C CA . GLU A 1 1803 ? 143.757 140.635 168.854 1.00 0.00 ? 1803 GLU A CA 3  
ATOM 4604   C CA . GLY A 1 1804 ? 142.834 137.350 170.624 1.00 0.00 ? 1804 GLY A CA 3  
ATOM 4605   C CA . GLU A 1 1805 ? 146.194 135.704 169.824 1.00 0.00 ? 1805 GLU A CA 3  
ATOM 4606   C CA . THR A 1 1806 ? 148.233 138.820 170.814 1.00 0.00 ? 1806 THR A CA 3  
ATOM 4607   C CA . LEU A 1 1807 ? 146.280 138.924 174.108 1.00 0.00 ? 1807 LEU A CA 3  
ATOM 4608   C CA . LEU A 1 1808 ? 146.997 135.211 174.673 1.00 0.00 ? 1808 LEU A CA 3  
ATOM 4609   C CA . LYS A 1 1809 ? 150.759 135.944 174.167 1.00 0.00 ? 1809 LYS A CA 3  
ATOM 4610   C CA . LYS A 1 1810 ? 150.654 138.872 176.644 1.00 0.00 ? 1810 LYS A CA 3  
ATOM 4611   C CA . TRP A 1 1811 ? 148.950 136.497 179.112 1.00 0.00 ? 1811 TRP A CA 3  
ATOM 4612   C CA . ALA A 1 1812 ? 151.867 134.055 178.594 1.00 0.00 ? 1812 ALA A CA 3  
ATOM 4613   C CA . LEU A 1 1813 ? 149.697 131.344 176.987 1.00 0.00 ? 1813 LEU A CA 3  
ATOM 4614   C CA . TYR A 1 1814 ? 150.728 129.384 173.898 1.00 0.00 ? 1814 TYR A CA 3  
ATOM 4615   C CA . SER A 1 1815 ? 147.527 127.339 173.496 1.00 0.00 ? 1815 SER A CA 3  
ATOM 4616   C CA . PHE A 1 1816 ? 144.516 128.563 171.624 1.00 0.00 ? 1816 PHE A CA 3  
ATOM 4617   C CA . ASN A 1 1817 ? 141.799 125.960 172.281 1.00 0.00 ? 1817 ASN A CA 3  
ATOM 4618   C CA . ASP A 1 1818 ? 139.004 125.477 169.778 1.00 0.00 ? 1818 ASP A CA 3  
ATOM 4619   C CA . GLY A 1 1819 ? 136.098 124.015 171.798 1.00 0.00 ? 1819 GLY A CA 3  
ATOM 4620   C CA . GLU A 1 1820 ? 133.699 123.386 168.883 1.00 0.00 ? 1820 GLU A CA 3  
ATOM 4621   C CA . GLU A 1 1821 ? 136.409 121.662 166.791 1.00 0.00 ? 1821 GLU A CA 3  
ATOM 4622   C CA . HIS A 1 1822 ? 138.009 119.997 169.871 1.00 0.00 ? 1822 HIS A CA 3  
ATOM 4623   C CA . GLN A 1 1823 ? 141.541 120.815 168.606 1.00 0.00 ? 1823 GLN A CA 3  
ATOM 4624   C CA . LYS A 1 1824 ? 144.274 123.008 170.158 1.00 0.00 ? 1824 LYS A CA 3  
ATOM 4625   C CA . ILE A 1 1825 ? 146.664 125.217 168.209 1.00 0.00 ? 1825 ILE A CA 3  
ATOM 4626   C CA . LEU A 1 1826 ? 149.968 126.894 168.838 1.00 0.00 ? 1826 LEU A CA 3  
ATOM 4627   C CA . LEU A 1 1827 ? 149.411 130.621 169.235 1.00 0.00 ? 1827 LEU A CA 3  
ATOM 4628   C CA . ASP A 1 1828 ? 153.002 131.534 168.410 1.00 0.00 ? 1828 ASP A CA 3  
ATOM 4629   C CA . ASP A 1 1829 ? 153.196 129.262 165.327 1.00 0.00 ? 1829 ASP A CA 3  
ATOM 4630   C CA . LEU A 1 1830 ? 150.127 130.837 163.642 1.00 0.00 ? 1830 LEU A CA 3  
ATOM 4631   C CA . MET A 1 1831 ? 151.103 134.363 164.827 1.00 0.00 ? 1831 MET A CA 3  
ATOM 4632   C CA . LYS A 1 1832 ? 154.740 134.208 163.551 1.00 0.00 ? 1832 LYS A CA 3  
ATOM 4633   C CA . LYS A 1 1833 ? 153.670 132.981 160.070 1.00 0.00 ? 1833 LYS A CA 3  
ATOM 4634   C CA . ALA A 1 1834 ? 152.911 136.611 159.238 1.00 0.00 ? 1834 ALA A CA 3  
ATOM 4635   C CA . GLU A 1 1835 ? 154.914 139.866 159.798 1.00 0.00 ? 1835 GLU A CA 3  
ATOM 4636   C CA . GLU A 1 1836 ? 153.762 140.196 163.415 1.00 0.00 ? 1836 GLU A CA 3  
ATOM 4637   C CA . GLY A 1 1837 ? 156.760 138.312 164.862 1.00 0.00 ? 1837 GLY A CA 3  
ATOM 4638   C CA . PHE A 1 1883 ? 173.726 145.025 185.481 1.00 0.00 ? 1883 PHE A CA 3  
ATOM 4639   C CA . LEU A 1 1884 ? 169.911 144.749 184.970 1.00 0.00 ? 1884 LEU A CA 3  
ATOM 4640   C CA . LEU A 1 1885 ? 167.564 147.705 185.836 1.00 0.00 ? 1885 LEU A CA 3  
ATOM 4641   C CA . GLY A 1 1886 ? 164.569 146.730 183.663 1.00 0.00 ? 1886 GLY A CA 3  
ATOM 4642   C CA . ASP A 1 1887 ? 161.118 148.231 184.148 1.00 0.00 ? 1887 ASP A CA 3  
ATOM 4643   C CA . GLY A 1 1888 ? 160.548 147.948 180.325 1.00 0.00 ? 1888 GLY A CA 3  
ATOM 4644   C CA . SER A 1 1889 ? 157.417 148.007 178.116 1.00 0.00 ? 1889 SER A CA 3  
ATOM 4645   C CA . PHE A 1 1890 ? 158.517 145.208 175.762 1.00 0.00 ? 1890 PHE A CA 3  
ATOM 4646   C CA . GLY A 1 1891 ? 161.611 143.792 177.474 1.00 0.00 ? 1891 GLY A CA 3  
ATOM 4647   C CA . SER A 1 1892 ? 164.488 144.174 179.913 1.00 0.00 ? 1892 SER A CA 3  
ATOM 4648   C CA . VAL A 1 1893 ? 166.645 147.305 180.399 1.00 0.00 ? 1893 VAL A CA 3  
ATOM 4649   C CA . TYR A 1 1894 ? 170.370 146.859 181.190 1.00 0.00 ? 1894 TYR A CA 3  
ATOM 4650   C CA . ARG A 1 1895 ? 173.156 149.204 182.252 1.00 0.00 ? 1895 ARG A CA 3  
ATOM 4651   C CA . ALA A 1 1896 ? 176.466 148.706 180.448 1.00 0.00 ? 1896 ALA A CA 3  
ATOM 4652   C CA . ALA A 1 1897 ? 179.233 150.592 178.616 1.00 0.00 ? 1897 ALA A CA 3  
ATOM 4653   C CA . TYR A 1 1898 ? 180.534 150.978 175.021 1.00 0.00 ? 1898 TYR A CA 3  
ATOM 4654   C CA . GLU A 1 1899 ? 184.007 149.315 174.957 1.00 0.00 ? 1899 GLU A CA 3  
ATOM 4655   C CA . GLY A 1 1900 ? 185.599 152.026 172.726 1.00 0.00 ? 1900 GLY A CA 3  
ATOM 4656   C CA . GLU A 1 1901 ? 184.569 155.168 174.704 1.00 0.00 ? 1901 GLU A CA 3  
ATOM 4657   C CA . GLU A 1 1902 ? 183.742 153.929 178.245 1.00 0.00 ? 1902 GLU A CA 3  
ATOM 4658   C CA . VAL A 1 1903 ? 180.426 155.883 177.658 1.00 0.00 ? 1903 VAL A CA 3  
ATOM 4659   C CA . ALA A 1 1904 ? 177.759 154.586 180.030 1.00 0.00 ? 1904 ALA A CA 3  
ATOM 4660   C CA . VAL A 1 1905 ? 174.886 153.088 178.167 1.00 0.00 ? 1905 VAL A CA 3  
ATOM 4661   C CA . LYS A 1 1906 ? 171.306 151.852 178.629 1.00 0.00 ? 1906 LYS A CA 3  
ATOM 4662   C CA . ILE A 1 1907 ? 170.263 148.755 176.609 1.00 0.00 ? 1907 ILE A CA 3  
ATOM 4663   C CA . PHE A 1 1908 ? 166.606 147.933 175.955 1.00 0.00 ? 1908 PHE A CA 3  
ATOM 4664   C CA . ASN A 1 1909 ? 165.981 144.417 174.550 1.00 0.00 ? 1909 ASN A CA 3  
ATOM 4665   C CA . LYS A 1 1910 ? 163.483 141.686 173.477 1.00 0.00 ? 1910 LYS A CA 3  
ATOM 4666   C CA . HIS A 1 1911 ? 161.637 144.137 171.407 1.00 0.00 ? 1911 HIS A CA 3  
ATOM 4667   C CA . THR A 1 1912 ? 162.630 142.843 167.937 1.00 0.00 ? 1912 THR A CA 3  
ATOM 4668   C CA . SER A 1 1913 ? 159.309 141.878 166.408 1.00 0.00 ? 1913 SER A CA 3  
ATOM 4669   C CA . LEU A 1 1914 ? 157.220 144.692 167.863 1.00 0.00 ? 1914 LEU A CA 3  
ATOM 4670   C CA . ARG A 1 1915 ? 155.614 147.559 165.966 1.00 0.00 ? 1915 ARG A CA 3  
ATOM 4671   C CA . LEU A 1 1916 ? 156.285 149.902 168.956 1.00 0.00 ? 1916 LEU A CA 3  
ATOM 4672   C CA . LEU A 1 1917 ? 160.109 149.179 168.937 1.00 0.00 ? 1917 LEU A CA 3  
ATOM 4673   C CA . ARG A 1 1918 ? 160.219 149.727 165.237 1.00 0.00 ? 1918 ARG A CA 3  
ATOM 4674   C CA . GLN A 1 1919 ? 158.546 153.103 165.590 1.00 0.00 ? 1919 GLN A CA 3  
ATOM 4675   C CA . GLU A 1 1920 ? 160.873 154.023 168.489 1.00 0.00 ? 1920 GLU A CA 3  
ATOM 4676   C CA . LEU A 1 1921 ? 163.983 153.124 166.401 1.00 0.00 ? 1921 LEU A CA 3  
ATOM 4677   C CA . VAL A 1 1922 ? 162.637 155.001 163.318 1.00 0.00 ? 1922 VAL A CA 3  
ATOM 4678   C CA . VAL A 1 1923 ? 161.745 158.170 165.335 1.00 0.00 ? 1923 VAL A CA 3  
ATOM 4679   C CA . LEU A 1 1924 ? 165.039 158.221 167.310 1.00 0.00 ? 1924 LEU A CA 3  
ATOM 4680   C CA . CYS A 1 1925 ? 167.267 157.672 164.204 1.00 0.00 ? 1925 CYS A CA 3  
ATOM 4681   C CA . HIS A 1 1926 ? 166.778 161.285 162.985 1.00 0.00 ? 1926 HIS A CA 3  
ATOM 4682   C CA . LEU A 1 1927 ? 166.848 163.011 166.427 1.00 0.00 ? 1927 LEU A CA 3  
ATOM 4683   C CA . HIS A 1 1928 ? 170.136 164.550 167.624 1.00 0.00 ? 1928 HIS A CA 3  
ATOM 4684   C CA . HIS A 1 1929 ? 169.647 167.245 170.303 1.00 0.00 ? 1929 HIS A CA 3  
ATOM 4685   C CA . PRO A 1 1930 ? 171.148 167.659 173.830 1.00 0.00 ? 1930 PRO A CA 3  
ATOM 4686   C CA . SER A 1 1931 ? 167.771 167.617 175.623 1.00 0.00 ? 1931 SER A CA 3  
ATOM 4687   C CA . LEU A 1 1932 ? 166.582 164.416 173.897 1.00 0.00 ? 1932 LEU A CA 3  
ATOM 4688   C CA . ILE A 1 1933 ? 167.794 160.929 174.919 1.00 0.00 ? 1933 ILE A CA 3  
ATOM 4689   C CA . SER A 1 1934 ? 170.278 159.933 172.202 1.00 0.00 ? 1934 SER A CA 3  
ATOM 4690   C CA . LEU A 1 1935 ? 170.164 156.612 170.387 1.00 0.00 ? 1935 LEU A CA 3  
ATOM 4691   C CA . LEU A 1 1936 ? 173.728 155.312 169.967 1.00 0.00 ? 1936 LEU A CA 3  
ATOM 4692   C CA . ALA A 1 1937 ? 173.181 152.106 168.001 1.00 0.00 ? 1937 ALA A CA 3  
ATOM 4693   C CA . ALA A 1 1938 ? 171.112 148.983 167.331 1.00 0.00 ? 1938 ALA A CA 3  
ATOM 4694   C CA . GLY A 1 1939 ? 171.985 145.371 168.289 1.00 0.00 ? 1939 GLY A CA 3  
ATOM 4695   C CA . ILE A 1 1940 ? 170.594 142.036 167.008 1.00 0.00 ? 1940 ILE A CA 3  
ATOM 4696   C CA . ARG A 1 1941 ? 169.937 138.586 168.570 1.00 0.00 ? 1941 ARG A CA 3  
ATOM 4697   C CA . PRO A 1 1942 ? 167.920 139.813 170.434 1.00 0.00 ? 1942 PRO A CA 3  
ATOM 4698   C CA . ARG A 1 1943 ? 167.172 143.246 168.939 1.00 0.00 ? 1943 ARG A CA 3  
ATOM 4699   C CA . MET A 1 1944 ? 168.502 146.018 171.209 1.00 0.00 ? 1944 MET A CA 3  
ATOM 4700   C CA . LEU A 1 1945 ? 168.308 149.791 171.286 1.00 0.00 ? 1945 LEU A CA 3  
ATOM 4701   C CA . VAL A 1 1946 ? 171.464 151.150 172.867 1.00 0.00 ? 1946 VAL A CA 3  
ATOM 4702   C CA . MET A 1 1947 ? 170.681 154.574 174.405 1.00 0.00 ? 1947 MET A CA 3  
ATOM 4703   C CA . GLU A 1 1948 ? 172.742 157.105 176.422 1.00 0.00 ? 1948 GLU A CA 3  
ATOM 4704   C CA . LEU A 1 1949 ? 172.521 156.423 180.181 1.00 0.00 ? 1949 LEU A CA 3  
ATOM 4705   C CA . ALA A 1 1950 ? 170.865 159.281 182.083 1.00 0.00 ? 1950 ALA A CA 3  
ATOM 4706   C CA . SER A 1 1951 ? 172.127 159.045 185.648 1.00 0.00 ? 1951 SER A CA 3  
ATOM 4707   C CA . LYS A 1 1952 ? 169.780 160.857 188.078 1.00 0.00 ? 1952 LYS A CA 3  
ATOM 4708   C CA . GLY A 1 1953 ? 166.514 159.004 187.367 1.00 0.00 ? 1953 GLY A CA 3  
ATOM 4709   C CA . SER A 1 1954 ? 163.256 160.589 186.193 1.00 0.00 ? 1954 SER A CA 3  
ATOM 4710   C CA . LEU A 1 1955 ? 161.386 163.813 187.028 1.00 0.00 ? 1955 LEU A CA 3  
ATOM 4711   C CA . ASP A 1 1956 ? 158.309 161.993 188.443 1.00 0.00 ? 1956 ASP A CA 3  
ATOM 4712   C CA . ARG A 1 1957 ? 160.275 160.063 191.121 1.00 0.00 ? 1957 ARG A CA 3  
ATOM 4713   C CA . LEU A 1 1958 ? 162.356 163.112 192.072 1.00 0.00 ? 1958 LEU A CA 3  
ATOM 4714   C CA . LEU A 1 1959 ? 159.248 165.307 192.561 1.00 0.00 ? 1959 LEU A CA 3  
ATOM 4715   C CA . GLN A 1 1960 ? 157.899 162.670 195.028 1.00 0.00 ? 1960 GLN A CA 3  
ATOM 4716   C CA . GLN A 1 1961 ? 160.718 163.738 197.449 1.00 0.00 ? 1961 GLN A CA 3  
ATOM 4717   C CA . ASP A 1 1962 ? 158.712 166.526 199.246 1.00 0.00 ? 1962 ASP A CA 3  
ATOM 4718   C CA . LYS A 1 1963 ? 161.361 166.868 202.029 1.00 0.00 ? 1963 LYS A CA 3  
ATOM 4719   C CA . ALA A 1 1964 ? 163.994 167.964 199.476 1.00 0.00 ? 1964 ALA A CA 3  
ATOM 4720   C CA . SER A 1 1965 ? 162.247 170.485 197.212 1.00 0.00 ? 1965 SER A CA 3  
ATOM 4721   C CA . LEU A 1 1966 ? 163.937 171.459 193.935 1.00 0.00 ? 1966 LEU A CA 3  
ATOM 4722   C CA . THR A 1 1967 ? 165.338 174.991 194.186 1.00 0.00 ? 1967 THR A CA 3  
ATOM 4723   C CA . ARG A 1 1968 ? 163.753 177.615 191.921 1.00 0.00 ? 1968 ARG A CA 3  
ATOM 4724   C CA . THR A 1 1969 ? 166.843 178.218 189.694 1.00 0.00 ? 1969 THR A CA 3  
ATOM 4725   C CA . LEU A 1 1970 ? 166.972 174.499 188.963 1.00 0.00 ? 1970 LEU A CA 3  
ATOM 4726   C CA . GLN A 1 1971 ? 163.174 174.319 188.297 1.00 0.00 ? 1971 GLN A CA 3  
ATOM 4727   C CA . HIS A 1 1972 ? 163.716 177.025 185.625 1.00 0.00 ? 1972 HIS A CA 3  
ATOM 4728   C CA . ARG A 1 1973 ? 166.605 175.000 184.109 1.00 0.00 ? 1973 ARG A CA 3  
ATOM 4729   C CA . ILE A 1 1974 ? 164.321 171.889 183.943 1.00 0.00 ? 1974 ILE A CA 3  
ATOM 4730   C CA . ALA A 1 1975 ? 161.480 173.904 182.317 1.00 0.00 ? 1975 ALA A CA 3  
ATOM 4731   C CA . LEU A 1 1976 ? 163.783 175.386 179.620 1.00 0.00 ? 1976 LEU A CA 3  
ATOM 4732   C CA . HIS A 1 1977 ? 165.548 172.056 178.828 1.00 0.00 ? 1977 HIS A CA 3  
ATOM 4733   C CA . VAL A 1 1978 ? 162.258 170.249 178.220 1.00 0.00 ? 1978 VAL A CA 3  
ATOM 4734   C CA . ALA A 1 1979 ? 161.068 173.276 176.174 1.00 0.00 ? 1979 ALA A CA 3  
ATOM 4735   C CA . ASP A 1 1980 ? 164.206 173.186 173.938 1.00 0.00 ? 1980 ASP A CA 3  
ATOM 4736   C CA . GLY A 1 1981 ? 163.784 169.421 173.323 1.00 0.00 ? 1981 GLY A CA 3  
ATOM 4737   C CA . LEU A 1 1982 ? 160.134 169.972 172.334 1.00 0.00 ? 1982 LEU A CA 3  
ATOM 4738   C CA . ARG A 1 1983 ? 161.237 173.037 170.268 1.00 0.00 ? 1983 ARG A CA 3  
ATOM 4739   C CA . TYR A 1 1984 ? 163.779 170.871 168.372 1.00 0.00 ? 1984 TYR A CA 3  
ATOM 4740   C CA . LEU A 1 1985 ? 160.885 168.446 167.961 1.00 0.00 ? 1985 LEU A CA 3  
ATOM 4741   C CA . HIS A 1 1986 ? 158.693 171.216 166.528 1.00 0.00 ? 1986 HIS A CA 3  
ATOM 4742   C CA . SER A 1 1987 ? 161.377 171.720 163.802 1.00 0.00 ? 1987 SER A CA 3  
ATOM 4743   C CA . ALA A 1 1988 ? 161.256 168.032 162.785 1.00 0.00 ? 1988 ALA A CA 3  
ATOM 4744   C CA . MET A 1 1989 ? 157.371 167.864 162.854 1.00 0.00 ? 1989 MET A CA 3  
ATOM 4745   C CA . ILE A 1 1990 ? 157.225 164.914 165.301 1.00 0.00 ? 1990 ILE A CA 3  
ATOM 4746   C CA . ILE A 1 1991 ? 154.431 164.334 167.901 1.00 0.00 ? 1991 ILE A CA 3  
ATOM 4747   C CA . TYR A 1 1992 ? 155.567 162.529 171.095 1.00 0.00 ? 1992 TYR A CA 3  
ATOM 4748   C CA . ARG A 1 1993 ? 152.118 161.775 172.657 1.00 0.00 ? 1993 ARG A CA 3  
ATOM 4749   C CA . ASP A 1 1994 ? 153.420 160.404 176.000 1.00 0.00 ? 1994 ASP A CA 3  
ATOM 4750   C CA . LEU A 1 1995 ? 154.855 163.589 177.550 1.00 0.00 ? 1995 LEU A CA 3  
ATOM 4751   C CA . LYS A 1 1996 ? 154.541 163.125 181.329 1.00 0.00 ? 1996 LYS A CA 3  
ATOM 4752   C CA . PRO A 1 1997 ? 157.170 163.441 184.121 1.00 0.00 ? 1997 PRO A CA 3  
ATOM 4753   C CA . HIS A 1 1998 ? 158.087 159.712 184.139 1.00 0.00 ? 1998 HIS A CA 3  
ATOM 4754   C CA . ASN A 1 1999 ? 159.389 160.207 180.572 1.00 0.00 ? 1999 ASN A CA 3  
ATOM 4755   C CA . VAL A 1 2000 ? 161.567 163.201 181.533 1.00 0.00 ? 2000 VAL A CA 3  
ATOM 4756   C CA . LEU A 1 2001 ? 165.011 161.832 182.440 1.00 0.00 ? 2001 LEU A CA 3  
ATOM 4757   C CA . LEU A 1 2002 ? 167.353 163.786 184.634 1.00 0.00 ? 2002 LEU A CA 3  
ATOM 4758   C CA . PHE A 1 2003 ? 170.990 164.130 183.627 1.00 0.00 ? 2003 PHE A CA 3  
ATOM 4759   C CA . THR A 1 2004 ? 172.067 166.542 186.365 1.00 0.00 ? 2004 THR A CA 3  
ATOM 4760   C CA . LEU A 1 2005 ? 170.377 168.686 189.113 1.00 0.00 ? 2005 LEU A CA 3  
ATOM 4761   C CA . TYR A 1 2006 ? 173.251 171.208 189.522 1.00 0.00 ? 2006 TYR A CA 3  
ATOM 4762   C CA . PRO A 1 2007 ? 171.924 174.530 188.070 1.00 0.00 ? 2007 PRO A CA 3  
ATOM 4763   C CA . ASN A 1 2008 ? 175.170 175.262 186.120 1.00 0.00 ? 2008 ASN A CA 3  
ATOM 4764   C CA . ALA A 1 2009 ? 175.219 171.843 184.367 1.00 0.00 ? 2009 ALA A CA 3  
ATOM 4765   C CA . ALA A 1 2010 ? 175.347 171.704 180.555 1.00 0.00 ? 2010 ALA A CA 3  
ATOM 4766   C CA . ILE A 1 2011 ? 172.224 169.492 180.517 1.00 0.00 ? 2011 ILE A CA 3  
ATOM 4767   C CA . ILE A 1 2012 ? 169.680 168.930 183.345 1.00 0.00 ? 2012 ILE A CA 3  
ATOM 4768   C CA . ALA A 1 2013 ? 166.761 167.215 181.658 1.00 0.00 ? 2013 ALA A CA 3  
ATOM 4769   C CA . LYS A 1 2014 ? 166.192 165.109 178.578 1.00 0.00 ? 2014 LYS A CA 3  
ATOM 4770   C CA . ILE A 1 2015 ? 162.949 163.925 176.943 1.00 0.00 ? 2015 ILE A CA 3  
ATOM 4771   C CA . ALA A 1 2016 ? 162.706 160.107 176.629 1.00 0.00 ? 2016 ALA A CA 3  
ATOM 4772   C CA . ASP A 1 2017 ? 160.411 157.200 175.679 1.00 0.00 ? 2017 ASP A CA 3  
ATOM 4773   C CA . TYR A 1 2018 ? 159.236 157.914 172.149 1.00 0.00 ? 2018 TYR A CA 3  
ATOM 4774   C CA . GLY A 1 2019 ? 157.534 154.536 171.636 1.00 0.00 ? 2019 GLY A CA 3  
ATOM 4775   C CA . THR A 1 2020 ? 154.171 156.054 170.786 1.00 0.00 ? 2020 THR A CA 3  
ATOM 4776   C CA . ALA A 1 2021 ? 155.453 158.985 168.632 1.00 0.00 ? 2021 ALA A CA 3  
ATOM 4777   C CA . GLN A 1 2022 ? 154.197 160.100 165.165 1.00 0.00 ? 2022 GLN A CA 3  
ATOM 4778   C CA . TYR A 1 2023 ? 155.898 161.944 162.322 1.00 0.00 ? 2023 TYR A CA 3  
ATOM 4779   C CA . CYS A 1 2024 ? 153.466 162.304 159.439 1.00 0.00 ? 2024 CYS A CA 3  
ATOM 4780   C CA . CYS A 1 2025 ? 152.629 164.759 156.624 1.00 0.00 ? 2025 CYS A CA 3  
ATOM 4781   C CA . ARG A 1 2026 ? 148.969 163.814 157.150 1.00 0.00 ? 2026 ARG A CA 3  
ATOM 4782   C CA . MET A 1 2027 ? 146.662 164.376 160.110 1.00 0.00 ? 2027 MET A CA 3  
ATOM 4783   C CA . GLY A 1 2028 ? 147.500 162.376 163.288 1.00 0.00 ? 2028 GLY A CA 3  
ATOM 4784   C CA . ILE A 1 2029 ? 144.885 160.472 165.350 1.00 0.00 ? 2029 ILE A CA 3  
ATOM 4785   C CA . LYS A 1 2030 ? 144.809 158.290 168.563 1.00 0.00 ? 2030 LYS A CA 3  
ATOM 4786   C CA . THR A 1 2031 ? 142.529 156.739 171.349 1.00 0.00 ? 2031 THR A CA 3  
ATOM 4787   C CA . SER A 1 2032 ? 144.960 154.636 173.283 1.00 0.00 ? 2032 SER A CA 3  
ATOM 4788   C CA . GLU A 1 2033 ? 147.094 157.162 175.180 1.00 0.00 ? 2033 GLU A CA 3  
ATOM 4789   C CA . GLY A 1 2034 ? 144.433 156.772 177.881 1.00 0.00 ? 2034 GLY A CA 3  
ATOM 4790   C CA . THR A 1 2035 ? 146.307 158.691 180.681 1.00 0.00 ? 2035 THR A CA 3  
ATOM 4791   C CA . PRO A 1 2036 ? 144.206 161.858 180.322 1.00 0.00 ? 2036 PRO A CA 3  
ATOM 4792   C CA . GLY A 1 2037 ? 145.578 163.905 183.275 1.00 0.00 ? 2037 GLY A CA 3  
ATOM 4793   C CA . PHE A 1 2038 ? 148.545 164.727 181.006 1.00 0.00 ? 2038 PHE A CA 3  
ATOM 4794   C CA . ARG A 1 2039 ? 146.838 164.524 177.570 1.00 0.00 ? 2039 ARG A CA 3  
ATOM 4795   C CA . ALA A 1 2040 ? 145.123 167.133 175.399 1.00 0.00 ? 2040 ALA A CA 3  
ATOM 4796   C CA . PRO A 1 2041 ? 141.237 167.231 175.266 1.00 0.00 ? 2041 PRO A CA 3  
ATOM 4797   C CA . GLU A 1 2042 ? 141.134 165.413 171.872 1.00 0.00 ? 2042 GLU A CA 3  
ATOM 4798   C CA . VAL A 1 2043 ? 141.270 162.224 174.084 1.00 0.00 ? 2043 VAL A CA 3  
ATOM 4799   C CA . ALA A 1 2044 ? 137.514 162.027 173.606 1.00 0.00 ? 2044 ALA A CA 3  
ATOM 4800   C CA . ARG A 1 2045 ? 137.697 159.195 170.932 1.00 0.00 ? 2045 ARG A CA 3  
ATOM 4801   C CA . GLY A 1 2046 ? 139.536 157.840 167.737 1.00 0.00 ? 2046 GLY A CA 3  
ATOM 4802   C CA . ASN A 1 2047 ? 137.420 159.787 165.343 1.00 0.00 ? 2047 ASN A CA 3  
ATOM 4803   C CA . VAL A 1 2048 ? 139.222 163.155 165.887 1.00 0.00 ? 2048 VAL A CA 3  
ATOM 4804   C CA . ILE A 1 2049 ? 142.476 164.451 164.420 1.00 0.00 ? 2049 ILE A CA 3  
ATOM 4805   C CA . TYR A 1 2050 ? 145.203 166.472 166.080 1.00 0.00 ? 2050 TYR A CA 3  
ATOM 4806   C CA . ASN A 1 2051 ? 148.789 167.803 165.732 1.00 0.00 ? 2051 ASN A CA 3  
ATOM 4807   C CA . GLN A 1 2052 ? 151.991 168.663 167.744 1.00 0.00 ? 2052 GLN A CA 3  
ATOM 4808   C CA . GLN A 1 2053 ? 149.757 171.067 169.671 1.00 0.00 ? 2053 GLN A CA 3  
ATOM 4809   C CA . ALA A 1 2054 ? 148.744 167.977 171.709 1.00 0.00 ? 2054 ALA A CA 3  
ATOM 4810   C CA . ASP A 1 2055 ? 152.356 167.775 173.054 1.00 0.00 ? 2055 ASP A CA 3  
ATOM 4811   C CA . VAL A 1 2056 ? 152.217 171.557 173.784 1.00 0.00 ? 2056 VAL A CA 3  
ATOM 4812   C CA . TYR A 1 2057 ? 149.289 170.755 176.136 1.00 0.00 ? 2057 TYR A CA 3  
ATOM 4813   C CA . SER A 1 2058 ? 151.287 167.870 177.739 1.00 0.00 ? 2058 SER A CA 3  
ATOM 4814   C CA . PHE A 1 2059 ? 154.168 170.372 178.248 1.00 0.00 ? 2059 PHE A CA 3  
ATOM 4815   C CA . GLY A 1 2060 ? 151.856 172.775 180.212 1.00 0.00 ? 2060 GLY A CA 3  
ATOM 4816   C CA . LEU A 1 2061 ? 151.150 169.905 182.612 1.00 0.00 ? 2061 LEU A CA 3  
ATOM 4817   C CA . LEU A 1 2062 ? 154.947 169.273 182.887 1.00 0.00 ? 2062 LEU A CA 3  
ATOM 4818   C CA . LEU A 1 2063 ? 155.417 172.958 183.829 1.00 0.00 ? 2063 LEU A CA 3  
ATOM 4819   C CA . TYR A 1 2064 ? 152.602 172.681 186.436 1.00 0.00 ? 2064 TYR A CA 3  
ATOM 4820   C CA . ASP A 1 2065 ? 154.144 169.511 188.007 1.00 0.00 ? 2065 ASP A CA 3  
ATOM 4821   C CA . ILE A 1 2066 ? 157.657 171.175 188.168 1.00 0.00 ? 2066 ILE A CA 3  
ATOM 4822   C CA . LEU A 1 2067 ? 156.209 174.438 189.604 1.00 0.00 ? 2067 LEU A CA 3  
ATOM 4823   C CA . THR A 1 2068 ? 154.086 172.740 192.263 1.00 0.00 ? 2068 THR A CA 3  
ATOM 4824   C CA . THR A 1 2069 ? 155.774 169.343 192.973 1.00 0.00 ? 2069 THR A CA 3  
ATOM 4825   C CA . GLY A 1 2070 ? 152.215 167.900 192.621 1.00 0.00 ? 2070 GLY A CA 3  
ATOM 4826   C CA . GLY A 1 2071 ? 150.500 165.665 190.026 1.00 0.00 ? 2071 GLY A CA 3  
ATOM 4827   C CA . ARG A 1 2072 ? 147.163 163.936 189.345 1.00 0.00 ? 2072 ARG A CA 3  
ATOM 4828   C CA . ILE A 1 2073 ? 146.043 161.013 187.089 1.00 0.00 ? 2073 ILE A CA 3  
ATOM 4829   C CA . VAL A 1 2074 ? 142.311 160.716 186.458 1.00 0.00 ? 2074 VAL A CA 3  
ATOM 4830   C CA . GLU A 1 2075 ? 140.233 158.138 184.488 1.00 0.00 ? 2075 GLU A CA 3  
ATOM 4831   C CA . GLY A 1 2076 ? 136.461 157.832 183.749 1.00 0.00 ? 2076 GLY A CA 3  
ATOM 4832   C CA . LEU A 1 2077 ? 133.648 159.736 181.998 1.00 0.00 ? 2077 LEU A CA 3  
ATOM 4833   C CA . LYS A 1 2078 ? 132.833 162.801 184.136 1.00 0.00 ? 2078 LYS A CA 3  
ATOM 4834   C CA . PHE A 1 2079 ? 136.550 163.792 184.337 1.00 0.00 ? 2079 PHE A CA 3  
ATOM 4835   C CA . PRO A 1 2080 ? 137.112 163.749 180.466 1.00 0.00 ? 2080 PRO A CA 3  
ATOM 4836   C CA . ASN A 1 2081 ? 133.810 165.673 179.954 1.00 0.00 ? 2081 ASN A CA 3  
ATOM 4837   C CA . GLU A 1 2082 ? 135.002 168.234 182.520 1.00 0.00 ? 2082 GLU A CA 3  
ATOM 4838   C CA . PHE A 1 2083 ? 138.439 168.553 180.866 1.00 0.00 ? 2083 PHE A CA 3  
ATOM 4839   C CA . ASP A 1 2084 ? 137.042 168.641 177.264 1.00 0.00 ? 2084 ASP A CA 3  
ATOM 4840   C CA . GLU A 1 2085 ? 133.779 170.693 177.629 1.00 0.00 ? 2085 GLU A CA 3  
ATOM 4841   C CA . LEU A 1 2086 ? 134.099 172.638 180.949 1.00 0.00 ? 2086 LEU A CA 3  
ATOM 4842   C CA . GLU A 1 2087 ? 137.749 173.854 180.604 1.00 0.00 ? 2087 GLU A CA 3  
ATOM 4843   C CA . ILE A 1 2088 ? 138.946 172.030 183.801 1.00 0.00 ? 2088 ILE A CA 3  
ATOM 4844   C CA . GLN A 1 2089 ? 142.706 172.271 184.228 1.00 0.00 ? 2089 GLN A CA 3  
ATOM 4845   C CA . GLY A 1 2090 ? 145.100 172.184 187.189 1.00 0.00 ? 2090 GLY A CA 3  
ATOM 4846   C CA . LYS A 1 2091 ? 145.277 176.002 187.273 1.00 0.00 ? 2091 LYS A CA 3  
ATOM 4847   C CA . LEU A 1 2092 ? 141.485 176.589 187.006 1.00 0.00 ? 2092 LEU A CA 3  
ATOM 4848   C CA . PRO A 1 2093 ? 140.399 174.220 189.888 1.00 0.00 ? 2093 PRO A CA 3  
ATOM 4849   C CA . ASP A 1 2094 ? 143.026 175.653 192.268 1.00 0.00 ? 2094 ASP A CA 3  
ATOM 4850   C CA . PRO A 1 2095 ? 143.376 179.525 191.768 1.00 0.00 ? 2095 PRO A CA 3  
ATOM 4851   C CA . VAL A 1 2096 ? 144.540 179.884 195.413 1.00 0.00 ? 2096 VAL A CA 3  
ATOM 4852   C CA . LYS A 1 2097 ? 147.281 177.205 195.117 1.00 0.00 ? 2097 LYS A CA 3  
ATOM 4853   C CA . GLU A 1 2098 ? 148.943 178.974 192.208 1.00 0.00 ? 2098 GLU A CA 3  
ATOM 4854   C CA . TYR A 1 2099 ? 147.676 182.676 192.129 1.00 0.00 ? 2099 TYR A CA 3  
ATOM 4855   C CA . GLY A 1 2100 ? 147.738 183.087 195.987 1.00 0.00 ? 2100 GLY A CA 3  
ATOM 4856   C CA . CYS A 1 2101 ? 151.435 182.094 196.104 1.00 0.00 ? 2101 CYS A CA 3  
ATOM 4857   C CA . ALA A 1 2102 ? 152.134 184.589 193.271 1.00 0.00 ? 2102 ALA A CA 3  
ATOM 4858   C CA . PRO A 1 2103 ? 153.932 182.357 190.621 1.00 0.00 ? 2103 PRO A CA 3  
ATOM 4859   C CA . TRP A 1 2104 ? 155.646 184.678 188.069 1.00 0.00 ? 2104 TRP A CA 3  
ATOM 4860   C CA . PRO A 1 2105 ? 152.893 186.153 185.783 1.00 0.00 ? 2105 PRO A CA 3  
ATOM 4861   C CA . MET A 1 2106 ? 154.857 185.237 182.618 1.00 0.00 ? 2106 MET A CA 3  
ATOM 4862   C CA . VAL A 1 2107 ? 155.043 181.544 183.769 1.00 0.00 ? 2107 VAL A CA 3  
ATOM 4863   C CA . GLU A 1 2108 ? 151.308 181.668 184.544 1.00 0.00 ? 2108 GLU A CA 3  
ATOM 4864   C CA . LYS A 1 2109 ? 150.502 183.104 181.072 1.00 0.00 ? 2109 LYS A CA 3  
ATOM 4865   C CA . LEU A 1 2110 ? 152.607 180.420 179.363 1.00 0.00 ? 2110 LEU A CA 3  
ATOM 4866   C CA . ILE A 1 2111 ? 150.935 177.497 181.257 1.00 0.00 ? 2111 ILE A CA 3  
ATOM 4867   C CA . LYS A 1 2112 ? 147.454 178.945 180.492 1.00 0.00 ? 2112 LYS A CA 3  
ATOM 4868   C CA . GLN A 1 2113 ? 148.197 179.441 176.773 1.00 0.00 ? 2113 GLN A CA 3  
ATOM 4869   C CA . CYS A 1 2114 ? 149.837 175.968 176.485 1.00 0.00 ? 2114 CYS A CA 3  
ATOM 4870   C CA . LEU A 1 2115 ? 146.770 174.282 178.080 1.00 0.00 ? 2115 LEU A CA 3  
ATOM 4871   C CA . LYS A 1 2116 ? 144.185 176.061 175.886 1.00 0.00 ? 2116 LYS A CA 3  
ATOM 4872   C CA . GLU A 1 2117 ? 141.198 173.922 174.831 1.00 0.00 ? 2117 GLU A CA 3  
ATOM 4873   C CA . ASN A 1 2118 ? 141.557 175.303 171.308 1.00 0.00 ? 2118 ASN A CA 3  
ATOM 4874   C CA . PRO A 1 2119 ? 144.851 173.788 169.894 1.00 0.00 ? 2119 PRO A CA 3  
ATOM 4875   C CA . GLN A 1 2120 ? 145.492 176.879 167.706 1.00 0.00 ? 2120 GLN A CA 3  
ATOM 4876   C CA . GLU A 1 2121 ? 145.829 179.216 170.733 1.00 0.00 ? 2121 GLU A CA 3  
ATOM 4877   C CA . ARG A 1 2122 ? 148.643 177.126 172.230 1.00 0.00 ? 2122 ARG A CA 3  
ATOM 4878   C CA . PRO A 1 2123 ? 151.944 178.945 171.409 1.00 0.00 ? 2123 PRO A CA 3  
ATOM 4879   C CA . THR A 1 2124 ? 154.845 178.116 169.082 1.00 0.00 ? 2124 THR A CA 3  
ATOM 4880   C CA . SER A 1 2125 ? 157.850 176.843 171.088 1.00 0.00 ? 2125 SER A CA 3  
ATOM 4881   C CA . ALA A 1 2126 ? 159.965 179.868 170.104 1.00 0.00 ? 2126 ALA A CA 3  
ATOM 4882   C CA . GLN A 1 2127 ? 157.529 182.052 172.143 1.00 0.00 ? 2127 GLN A CA 3  
ATOM 4883   C CA . VAL A 1 2128 ? 157.610 179.447 174.960 1.00 0.00 ? 2128 VAL A CA 3  
ATOM 4884   C CA . PHE A 1 2129 ? 161.450 179.437 175.078 1.00 0.00 ? 2129 PHE A CA 3  
ATOM 4885   C CA . ASP A 1 2130 ? 161.676 183.292 175.009 1.00 0.00 ? 2130 ASP A CA 3  
ATOM 4886   C CA . ILE A 1 2131 ? 159.134 183.585 177.889 1.00 0.00 ? 2131 ILE A CA 3  
ATOM 4887   C CA . LEU A 1 2132 ? 160.839 180.865 180.052 1.00 0.00 ? 2132 LEU A CA 3  
ATOM 4888   C CA . ASN A 1 2133 ? 164.242 182.555 179.512 1.00 0.00 ? 2133 ASN A CA 3  
ATOM 4889   C CA . SER A 1 2134 ? 162.852 185.820 181.053 1.00 0.00 ? 2134 SER A CA 3  
ATOM 4890   C CA . ALA A 1 2135 ? 161.937 184.212 184.450 1.00 0.00 ? 2135 ALA A CA 3  
ATOM 4891   C CA . ARG A 1 2142 ? 149.463 192.772 181.142 1.00 0.00 ? 2142 ARG A CA 3  
ATOM 4892   C CA . ARG A 1 2143 ? 147.161 195.622 180.153 1.00 0.00 ? 2143 ARG A CA 3  
ATOM 4893   C CA . ILE A 1 2144 ? 146.385 198.489 182.540 1.00 0.00 ? 2144 ILE A CA 3  
ATOM 4894   C CA . LEU A 1 2145 ? 143.350 200.550 181.547 1.00 0.00 ? 2145 LEU A CA 3  
ATOM 4895   C CA . LEU A 1 2146 ? 143.535 204.252 182.319 1.00 0.00 ? 2146 LEU A CA 3  
ATOM 4896   C CA . PRO A 1 2147 ? 140.400 206.103 183.468 1.00 0.00 ? 2147 PRO A CA 3  
ATOM 4897   C CA . LYS A 1 2148 ? 137.927 206.708 180.670 1.00 0.00 ? 2148 LYS A CA 3  
ATOM 4898   C CA . ASN A 1 2149 ? 138.720 209.622 178.287 1.00 0.00 ? 2149 ASN A CA 3  
ATOM 4899   C CA . VAL A 1 2150 ? 142.211 210.162 179.753 1.00 0.00 ? 2150 VAL A CA 3  
ATOM 4900   C CA . ILE A 1 2151 ? 144.512 211.077 176.855 1.00 0.00 ? 2151 ILE A CA 3  
ATOM 4901   C CA . VAL A 1 2152 ? 148.265 210.726 177.394 1.00 0.00 ? 2152 VAL A CA 3  
ATOM 4902   C CA . GLU A 1 2153 ? 150.596 213.191 175.680 1.00 0.00 ? 2153 GLU A CA 3  
ATOM 4903   C CA . CYS A 1 2154 ? 153.833 212.050 177.319 1.00 0.00 ? 2154 CYS A CA 3  
ATOM 4904   C CA . MET A 1 2155 ? 155.089 209.438 179.737 1.00 0.00 ? 2155 MET A CA 3  
ATOM 4905   C CA . VAL A 1 2156 ? 158.135 208.695 181.922 1.00 0.00 ? 2156 VAL A CA 3  
ATOM 4906   C CA . ALA A 1 2157 ? 158.786 205.610 184.046 1.00 0.00 ? 2157 ALA A CA 3  
ATOM 4907   C CA . THR A 1 2158 ? 160.242 205.124 187.521 1.00 0.00 ? 2158 THR A CA 3  
ATOM 4908   C CA . ASN A 1 2164 ? 155.853 199.351 193.254 1.00 0.00 ? 2164 ASN A CA 3  
ATOM 4909   C CA . ALA A 1 2165 ? 156.923 200.654 189.865 1.00 0.00 ? 2165 ALA A CA 3  
ATOM 4910   C CA . SER A 1 2166 ? 154.999 203.653 188.597 1.00 0.00 ? 2166 SER A CA 3  
ATOM 4911   C CA . ILE A 1 2167 ? 154.742 206.151 185.761 1.00 0.00 ? 2167 ILE A CA 3  
ATOM 4912   C CA . TRP A 1 2168 ? 154.255 209.906 185.347 1.00 0.00 ? 2168 TRP A CA 3  
ATOM 4913   C CA . LEU A 1 2169 ? 151.826 210.975 182.615 1.00 0.00 ? 2169 LEU A CA 3  
ATOM 4914   C CA . GLY A 1 2170 ? 151.186 214.287 180.891 1.00 0.00 ? 2170 GLY A CA 3  
ATOM 4915   C CA . CYS A 1 2171 ? 147.543 214.686 179.940 1.00 0.00 ? 2171 CYS A CA 3  
ATOM 4916   C CA . GLY A 1 2172 ? 146.156 215.771 176.575 1.00 0.00 ? 2172 GLY A CA 3  
ATOM 4917   C CA . HIS A 1 2173 ? 142.439 215.808 177.358 1.00 0.00 ? 2173 HIS A CA 3  
ATOM 4918   C CA . THR A 1 2174 ? 142.798 219.258 178.958 1.00 0.00 ? 2174 THR A CA 3  
ATOM 4919   C CA . ASP A 1 2175 ? 144.021 222.696 177.917 1.00 0.00 ? 2175 ASP A CA 3  
ATOM 4920   C CA . ARG A 1 2176 ? 145.862 223.236 181.229 1.00 0.00 ? 2176 ARG A CA 3  
ATOM 4921   C CA . GLY A 1 2177 ? 148.796 221.463 182.848 1.00 0.00 ? 2177 GLY A CA 3  
ATOM 4922   C CA . GLN A 1 2178 ? 147.658 218.247 184.539 1.00 0.00 ? 2178 GLN A CA 3  
ATOM 4923   C CA . LEU A 1 2179 ? 150.249 215.804 185.901 1.00 0.00 ? 2179 LEU A CA 3  
ATOM 4924   C CA . SER A 1 2180 ? 149.094 212.220 186.485 1.00 0.00 ? 2180 SER A CA 3  
ATOM 4925   C CA . PHE A 1 2181 ? 150.607 209.294 188.380 1.00 0.00 ? 2181 PHE A CA 3  
ATOM 4926   C CA . LEU A 1 2182 ? 150.038 205.572 187.793 1.00 0.00 ? 2182 LEU A CA 3  
ATOM 4927   C CA . ASP A 1 2183 ? 151.110 202.793 190.170 1.00 0.00 ? 2183 ASP A CA 3  
ATOM 4928   C CA . LEU A 1 2184 ? 151.956 199.935 187.797 1.00 0.00 ? 2184 LEU A CA 3  
ATOM 4929   C CA . ASN A 1 2185 ? 151.361 197.413 190.615 1.00 0.00 ? 2185 ASN A CA 3  
ATOM 4930   C CA . THR A 1 2186 ? 148.000 198.600 191.988 1.00 0.00 ? 2186 THR A CA 3  
ATOM 4931   C CA . GLU A 1 2187 ? 146.827 200.266 188.733 1.00 0.00 ? 2187 GLU A CA 3  
ATOM 4932   C CA . GLY A 1 2188 ? 145.874 203.273 190.862 1.00 0.00 ? 2188 GLY A CA 3  
ATOM 4933   C CA . TYR A 1 2189 ? 145.639 206.617 189.081 1.00 0.00 ? 2189 TYR A CA 3  
ATOM 4934   C CA . THR A 1 2190 ? 145.907 210.114 190.558 1.00 0.00 ? 2190 THR A CA 3  
ATOM 4935   C CA . SER A 1 2191 ? 146.263 213.488 188.854 1.00 0.00 ? 2191 SER A CA 3  
ATOM 4936   C CA . GLU A 1 2192 ? 146.852 217.122 189.784 1.00 0.00 ? 2192 GLU A CA 3  
ATOM 4937   C CA . GLU A 1 2193 ? 146.444 220.337 187.786 1.00 0.00 ? 2193 GLU A CA 3  
ATOM 4938   C CA . VAL A 1 2194 ? 149.937 221.792 188.062 1.00 0.00 ? 2194 VAL A CA 3  
ATOM 4939   C CA . ALA A 1 2195 ? 150.412 224.357 185.255 1.00 0.00 ? 2195 ALA A CA 3  
ATOM 4940   C CA . ASP A 1 2196 ? 148.547 226.809 183.020 1.00 0.00 ? 2196 ASP A CA 3  
ATOM 4941   C CA . SER A 1 2197 ? 149.105 225.067 179.660 1.00 0.00 ? 2197 SER A CA 3  
ATOM 4942   C CA . ARG A 1 2198 ? 149.104 221.473 178.448 1.00 0.00 ? 2198 ARG A CA 3  
ATOM 4943   C CA . ILE A 1 2199 ? 152.050 219.377 179.613 1.00 0.00 ? 2199 ILE A CA 3  
ATOM 4944   C CA . LEU A 1 2200 ? 153.820 218.360 176.402 1.00 0.00 ? 2200 LEU A CA 3  
ATOM 4945   C CA . CYS A 1 2201 ? 156.791 216.359 177.696 1.00 0.00 ? 2201 CYS A CA 3  
ATOM 4946   C CA . LEU A 1 2202 ? 158.243 214.887 180.882 1.00 0.00 ? 2202 LEU A CA 3  
ATOM 4947   C CA . ALA A 1 2203 ? 161.763 214.179 182.114 1.00 0.00 ? 2203 ALA A CA 3  
ATOM 4948   C CA . LEU A 1 2204 ? 162.947 212.693 185.409 1.00 0.00 ? 2204 LEU A CA 3  
ATOM 4949   C CA . VAL A 1 2205 ? 166.113 214.294 186.807 1.00 0.00 ? 2205 VAL A CA 3  
ATOM 4950   C CA . HIS A 1 2206 ? 167.697 212.151 189.524 1.00 0.00 ? 2206 HIS A CA 3  
ATOM 4951   C CA . LEU A 1 2207 ? 170.398 213.546 191.809 1.00 0.00 ? 2207 LEU A CA 3  
ATOM 4952   C CA . PRO A 1 2208 ? 172.284 210.619 193.417 1.00 0.00 ? 2208 PRO A CA 3  
ATOM 4953   C CA . VAL A 1 2209 ? 174.131 212.864 195.791 1.00 0.00 ? 2209 VAL A CA 3  
ATOM 4954   C CA . GLU A 1 2210 ? 171.546 214.950 197.690 1.00 0.00 ? 2210 GLU A CA 3  
ATOM 4955   C CA . LYS A 1 2211 ? 169.236 211.930 197.168 1.00 0.00 ? 2211 LYS A CA 3  
ATOM 4956   C CA . GLU A 1 2212 ? 166.539 213.795 195.282 1.00 0.00 ? 2212 GLU A CA 3  
ATOM 4957   C CA . SER A 1 2213 ? 164.373 213.158 192.221 1.00 0.00 ? 2213 SER A CA 3  
ATOM 4958   C CA . TRP A 1 2214 ? 162.615 215.966 190.346 1.00 0.00 ? 2214 TRP A CA 3  
ATOM 4959   C CA . ILE A 1 2215 ? 159.937 215.553 187.680 1.00 0.00 ? 2215 ILE A CA 3  
ATOM 4960   C CA . VAL A 1 2216 ? 160.222 218.191 184.943 1.00 0.00 ? 2216 VAL A CA 3  
ATOM 4961   C CA . SER A 1 2217 ? 157.171 219.125 182.863 1.00 0.00 ? 2217 SER A CA 3  
ATOM 4962   C CA . GLY A 1 2218 ? 157.520 220.998 179.580 1.00 0.00 ? 2218 GLY A CA 3  
ATOM 4963   C CA . THR A 1 2219 ? 154.376 222.830 178.522 1.00 0.00 ? 2219 THR A CA 3  
ATOM 4964   C CA . GLN A 1 2220 ? 152.643 224.422 175.535 1.00 0.00 ? 2220 GLN A CA 3  
ATOM 4965   C CA . SER A 1 2221 ? 153.520 227.922 176.800 1.00 0.00 ? 2221 SER A CA 3  
ATOM 4966   C CA . GLY A 1 2222 ? 157.257 227.300 177.253 1.00 0.00 ? 2222 GLY A CA 3  
ATOM 4967   C CA . THR A 1 2223 ? 157.187 226.843 181.030 1.00 0.00 ? 2223 THR A CA 3  
ATOM 4968   C CA . LEU A 1 2224 ? 159.506 224.286 182.648 1.00 0.00 ? 2224 LEU A CA 3  
ATOM 4969   C CA . LEU A 1 2225 ? 157.811 223.205 185.883 1.00 0.00 ? 2225 LEU A CA 3  
ATOM 4970   C CA . VAL A 1 2226 ? 160.023 221.257 188.307 1.00 0.00 ? 2226 VAL A CA 3  
ATOM 4971   C CA . ILE A 1 2227 ? 158.280 219.298 191.074 1.00 0.00 ? 2227 ILE A CA 3  
ATOM 4972   C CA . ASN A 1 2228 ? 159.791 217.165 193.837 1.00 0.00 ? 2228 ASN A CA 3  
ATOM 4973   C CA . THR A 1 2229 ? 158.898 213.476 193.783 1.00 0.00 ? 2229 THR A CA 3  
ATOM 4974   C CA . GLU A 1 2230 ? 158.701 213.033 197.562 1.00 0.00 ? 2230 GLU A CA 3  
ATOM 4975   C CA . ASP A 1 2231 ? 157.208 216.405 198.602 1.00 0.00 ? 2231 ASP A CA 3  
ATOM 4976   C CA . GLY A 1 2232 ? 154.865 217.940 196.025 1.00 0.00 ? 2232 GLY A CA 3  
ATOM 4977   C CA . LYS A 1 2233 ? 154.967 221.207 197.981 1.00 0.00 ? 2233 LYS A CA 3  
ATOM 4978   C CA . LYS A 1 2234 ? 158.526 221.609 196.622 1.00 0.00 ? 2234 LYS A CA 3  
ATOM 4979   C CA . ARG A 1 2235 ? 158.064 223.017 193.124 1.00 0.00 ? 2235 ARG A CA 3  
ATOM 4980   C CA . HIS A 1 2236 ? 159.415 225.898 191.065 1.00 0.00 ? 2236 HIS A CA 3  
ATOM 4981   C CA . THR A 1 2237 ? 159.967 227.084 187.496 1.00 0.00 ? 2237 THR A CA 3  
ATOM 4982   C CA . LEU A 1 2238 ? 163.095 227.340 185.345 1.00 0.00 ? 2238 LEU A CA 3  
ATOM 4983   C CA . GLU A 1 2239 ? 163.648 230.001 182.677 1.00 0.00 ? 2239 GLU A CA 3  
ATOM 4984   C CA . LYS A 1 2240 ? 160.652 230.367 180.379 1.00 0.00 ? 2240 LYS A CA 3  
ATOM 4985   C CA . MET A 1 2241 ? 161.175 229.153 176.821 1.00 0.00 ? 2241 MET A CA 3  
ATOM 4986   C CA . THR A 1 2242 ? 160.370 231.383 173.858 1.00 0.00 ? 2242 THR A CA 3  
ATOM 4987   C CA . ASP A 1 2243 ? 158.083 228.675 172.422 1.00 0.00 ? 2243 ASP A CA 3  
ATOM 4988   C CA . SER A 1 2244 ? 156.418 225.477 173.603 1.00 0.00 ? 2244 SER A CA 3  
ATOM 4989   C CA . VAL A 1 2245 ? 158.621 222.740 175.048 1.00 0.00 ? 2245 VAL A CA 3  
ATOM 4990   C CA . THR A 1 2246 ? 158.478 219.804 172.631 1.00 0.00 ? 2246 THR A CA 3  
ATOM 4991   C CA . CYS A 1 2247 ? 161.347 217.642 173.922 1.00 0.00 ? 2247 CYS A CA 3  
ATOM 4992   C CA . LEU A 1 2248 ? 162.896 216.670 177.265 1.00 0.00 ? 2248 LEU A CA 3  
ATOM 4993   C CA . TYR A 1 2249 ? 165.862 214.303 177.495 1.00 0.00 ? 2249 TYR A CA 3  
ATOM 4994   C CA . CYS A 1 2250 ? 168.271 213.483 180.327 1.00 0.00 ? 2250 CYS A CA 3  
ATOM 4995   C CA . ASN A 1 2251 ? 171.855 213.025 179.145 1.00 0.00 ? 2251 ASN A CA 3  
ATOM 4996   C CA . SER A 1 2252 ? 175.300 212.289 180.564 1.00 0.00 ? 2252 SER A CA 3  
ATOM 4997   C CA . PHE A 1 2253 ? 178.843 213.172 179.502 1.00 0.00 ? 2253 PHE A CA 3  
ATOM 4998   C CA . GLN A 1 2259 ? 180.484 212.291 184.049 1.00 0.00 ? 2254 GLN A CA 3  
ATOM 4999   C CA . LYS A 1 2260 ? 178.136 215.293 184.046 1.00 0.00 ? 2260 LYS A CA 3  
ATOM 5000   C CA . ASN A 1 2261 ? 174.365 214.964 183.673 1.00 0.00 ? 2261 ASN A CA 3  
ATOM 5001   C CA . PHE A 1 2262 ? 172.232 217.416 181.711 1.00 0.00 ? 2262 PHE A CA 3  
ATOM 5002   C CA . LEU A 1 2263 ? 168.618 218.242 180.876 1.00 0.00 ? 2263 LEU A CA 3  
ATOM 5003   C CA . LEU A 1 2264 ? 168.170 218.850 177.144 1.00 0.00 ? 2264 LEU A CA 3  
ATOM 5004   C CA . VAL A 1 2265 ? 165.087 220.902 176.244 1.00 0.00 ? 2265 VAL A CA 3  
ATOM 5005   C CA . GLY A 1 2266 ? 163.884 221.020 172.638 1.00 0.00 ? 2266 GLY A CA 3  
ATOM 5006   C CA . THR A 1 2267 ? 161.460 223.813 171.760 1.00 0.00 ? 2267 THR A CA 3  
ATOM 5007   C CA . ALA A 1 2268 ? 158.971 224.451 168.967 1.00 0.00 ? 2268 ALA A CA 3  
ATOM 5008   C CA . ASP A 1 2269 ? 161.037 227.309 167.476 1.00 0.00 ? 2269 ASP A CA 3  
ATOM 5009   C CA . GLY A 1 2270 ? 164.016 225.092 166.640 1.00 0.00 ? 2270 GLY A CA 3  
ATOM 5010   C CA . LYS A 1 2271 ? 166.085 225.749 169.768 1.00 0.00 ? 2271 LYS A CA 3  
ATOM 5011   C CA . LEU A 1 2272 ? 167.738 223.338 172.211 1.00 0.00 ? 2272 LEU A CA 3  
ATOM 5012   C CA . ALA A 1 2273 ? 168.465 224.571 175.741 1.00 0.00 ? 2273 ALA A CA 3  
ATOM 5013   C CA . ILE A 1 2274 ? 170.902 222.752 178.035 1.00 0.00 ? 2274 ILE A CA 3  
ATOM 5014   C CA . PHE A 1 2275 ? 170.504 222.758 181.815 1.00 0.00 ? 2275 PHE A CA 3  
ATOM 5015   C CA . GLU A 1 2276 ? 173.089 221.258 184.119 1.00 0.00 ? 2276 GLU A CA 3  
ATOM 5016   C CA . ASP A 1 2277 ? 172.113 218.463 186.504 1.00 0.00 ? 2277 ASP A CA 3  
ATOM 5017   C CA . LYS A 1 2278 ? 172.293 220.610 189.646 1.00 0.00 ? 2278 LYS A CA 3  
ATOM 5018   C CA . THR A 1 2279 ? 170.864 223.862 188.245 1.00 0.00 ? 2279 THR A CA 3  
ATOM 5019   C CA . VAL A 1 2280 ? 167.452 222.192 187.849 1.00 0.00 ? 2280 VAL A CA 3  
ATOM 5020   C CA . LYS A 1 2281 ? 166.913 222.623 191.607 1.00 0.00 ? 2281 LYS A CA 3  
ATOM 5021   C CA . LEU A 1 2282 ? 167.102 226.428 191.367 1.00 0.00 ? 2282 LEU A CA 3  
ATOM 5022   C CA . LYS A 1 2283 ? 164.114 228.701 190.806 1.00 0.00 ? 2283 LYS A CA 3  
ATOM 5023   C CA . GLY A 1 2284 ? 164.429 230.730 187.622 1.00 0.00 ? 2284 GLY A CA 3  
ATOM 5024   C CA . ALA A 1 2285 ? 167.604 228.935 186.555 1.00 0.00 ? 2285 ALA A CA 3  
ATOM 5025   C CA . ALA A 1 2286 ? 168.898 229.819 183.089 1.00 0.00 ? 2286 ALA A CA 3  
ATOM 5026   C CA . PRO A 1 2287 ? 170.328 227.250 180.651 1.00 0.00 ? 2287 PRO A CA 3  
ATOM 5027   C CA . LEU A 1 2288 ? 174.055 226.818 180.176 1.00 0.00 ? 2288 LEU A CA 3  
ATOM 5028   C CA . LYS A 1 2289 ? 173.611 227.192 176.413 1.00 0.00 ? 2289 LYS A CA 3  
ATOM 5029   C CA . ILE A 1 2290 ? 170.866 227.579 173.807 1.00 0.00 ? 2290 ILE A CA 3  
ATOM 5030   C CA . LEU A 1 2291 ? 171.389 226.188 170.302 1.00 0.00 ? 2291 LEU A CA 3  
ATOM 5031   C CA . ASN A 1 2292 ? 169.419 227.843 167.494 1.00 0.00 ? 2292 ASN A CA 3  
ATOM 5032   C CA . ILE A 1 2293 ? 169.117 224.863 165.152 1.00 0.00 ? 2293 ILE A CA 3  
ATOM 5033   C CA . GLY A 1 2294 ? 165.988 225.930 163.224 1.00 0.00 ? 2294 GLY A CA 3  
ATOM 5034   C CA . ASN A 1 2295 ? 163.112 228.389 163.224 1.00 0.00 ? 2295 ASN A CA 3  
ATOM 5035   C CA . VAL A 1 2296 ? 159.492 228.728 164.341 1.00 0.00 ? 2296 VAL A CA 3  
ATOM 5036   C CA . SER A 1 2297 ? 158.545 226.296 161.551 1.00 0.00 ? 2297 SER A CA 3  
ATOM 5037   C CA . THR A 1 2298 ? 161.027 223.518 162.498 1.00 0.00 ? 2298 THR A CA 3  
ATOM 5038   C CA . PRO A 1 2299 ? 160.240 222.159 165.978 1.00 0.00 ? 2299 PRO A CA 3  
ATOM 5039   C CA . LEU A 1 2300 ? 162.858 220.121 167.828 1.00 0.00 ? 2300 LEU A CA 3  
ATOM 5040   C CA . MET A 1 2301 ? 160.830 217.023 168.662 1.00 0.00 ? 2301 MET A CA 3  
ATOM 5041   C CA . CYS A 1 2302 ? 163.179 214.111 169.403 1.00 0.00 ? 2302 CYS A CA 3  
ATOM 5042   C CA . LEU A 1 2303 ? 166.550 213.306 170.967 1.00 0.00 ? 2303 LEU A CA 3  
ATOM 5043   C CA . SER A 1 2304 ? 168.463 210.041 171.273 1.00 0.00 ? 2304 SER A CA 3  
ATOM 5044   C CA . GLU A 1 2305 ? 171.852 208.712 172.324 1.00 0.00 ? 2305 GLU A CA 3  
ATOM 5045   C CA . VAL A 1 2314 ? 177.277 211.719 171.206 1.00 0.00 ? 2314 VAL A CA 3  
ATOM 5046   C CA . MET A 1 2315 ? 173.691 212.918 170.766 1.00 0.00 ? 2315 MET A CA 3  
ATOM 5047   C CA . TRP A 1 2316 ? 171.491 212.855 167.670 1.00 0.00 ? 2316 TRP A CA 3  
ATOM 5048   C CA . GLY A 1 2317 ? 168.258 214.768 167.228 1.00 0.00 ? 2317 GLY A CA 3  
ATOM 5049   C CA . GLY A 1 2318 ? 165.581 215.793 164.791 1.00 0.00 ? 2318 GLY A CA 3  
ATOM 5050   C CA . CYS A 1 2319 ? 164.655 219.371 163.877 1.00 0.00 ? 2319 CYS A CA 3  
ATOM 5051   C CA . GLY A 1 2320 ? 162.224 219.675 160.994 1.00 0.00 ? 2320 GLY A CA 3  
ATOM 5052   C CA . THR A 1 2321 ? 163.657 217.583 158.176 1.00 0.00 ? 2321 THR A CA 3  
ATOM 5053   C CA . LYS A 1 2322 ? 167.228 217.854 159.517 1.00 0.00 ? 2322 LYS A CA 3  
ATOM 5054   C CA . ILE A 1 2323 ? 169.143 215.408 161.700 1.00 0.00 ? 2323 ILE A CA 3  
ATOM 5055   C CA . PHE A 1 2324 ? 171.708 217.044 163.969 1.00 0.00 ? 2324 PHE A CA 3  
ATOM 5056   C CA . SER A 1 2325 ? 174.534 215.770 166.153 1.00 0.00 ? 2325 SER A CA 3  
ATOM 5057   C CA . PHE A 1 2326 ? 176.457 217.217 169.082 1.00 0.00 ? 2326 PHE A CA 3  
ATOM 5058   C CA . SER A 1 2327 ? 178.753 216.055 171.861 1.00 0.00 ? 2327 SER A CA 3  
ATOM 5059   C CA . ASN A 1 2328 ? 180.670 217.633 174.737 1.00 0.00 ? 2328 ASN A CA 3  
ATOM 5060   C CA . ASP A 1 2329 ? 180.874 221.322 173.797 1.00 0.00 ? 2329 ASP A CA 3  
ATOM 5061   C CA . PHE A 1 2330 ? 177.292 221.521 172.424 1.00 0.00 ? 2330 PHE A CA 3  
ATOM 5062   C CA . THR A 1 2331 ? 178.490 222.684 169.024 1.00 0.00 ? 2331 THR A CA 3  
ATOM 5063   C CA . ILE A 1 2332 ? 176.453 221.174 166.202 1.00 0.00 ? 2332 ILE A CA 3  
ATOM 5064   C CA . GLN A 1 2333 ? 178.751 218.789 164.354 1.00 0.00 ? 2333 GLN A CA 3  
ATOM 5065   C CA . LYS A 1 2334 ? 176.678 216.854 161.814 1.00 0.00 ? 2334 LYS A CA 3  
ATOM 5066   C CA . LEU A 1 2335 ? 173.638 218.320 160.054 1.00 0.00 ? 2335 LEU A CA 3  
ATOM 5067   C CA . ILE A 1 2336 ? 171.911 216.115 157.465 1.00 0.00 ? 2336 ILE A CA 3  
ATOM 5068   C CA . GLU A 1 2337 ? 169.040 217.266 155.249 1.00 0.00 ? 2337 GLU A CA 3  
ATOM 5069   C CA . THR A 1 2338 ? 166.595 214.381 154.794 1.00 0.00 ? 2338 THR A CA 3  
ATOM 5070   C CA . ARG A 1 2339 ? 163.993 216.190 152.671 1.00 0.00 ? 2339 ARG A CA 3  
ATOM 5071   C CA . THR A 1 2340 ? 165.614 215.064 149.400 1.00 0.00 ? 2340 THR A CA 3  
ATOM 5072   C CA . SER A 1 2341 ? 167.005 211.768 148.108 1.00 0.00 ? 2341 SER A CA 3  
ATOM 5073   C CA . GLN A 1 2342 ? 166.827 210.302 144.608 1.00 0.00 ? 2342 GLN A CA 3  
ATOM 5074   C CA . LEU A 1 2343 ? 166.271 206.763 145.930 1.00 0.00 ? 2343 LEU A CA 3  
ATOM 5075   C CA . PHE A 1 2344 ? 163.089 207.815 147.752 1.00 0.00 ? 2344 PHE A CA 3  
ATOM 5076   C CA . SER A 1 2345 ? 160.336 205.305 147.040 1.00 0.00 ? 2345 SER A CA 3  
ATOM 5077   C CA . TYR A 1 2346 ? 157.852 208.176 147.453 1.00 0.00 ? 2346 TYR A CA 3  
ATOM 5078   C CA . ALA A 1 2347 ? 158.841 211.820 147.786 1.00 0.00 ? 2347 ALA A CA 3  
ATOM 5079   C CA . ALA A 1 2348 ? 155.957 213.413 149.705 1.00 0.00 ? 2348 ALA A CA 3  
ATOM 5080   C CA . PHE A 1 2349 ? 156.592 211.275 152.800 1.00 0.00 ? 2349 PHE A CA 3  
ATOM 5081   C CA . SER A 1 2350 ? 160.182 212.479 153.184 1.00 0.00 ? 2350 SER A CA 3  
ATOM 5082   C CA . ASP A 1 2351 ? 159.046 216.125 153.217 1.00 0.00 ? 2351 ASP A CA 3  
ATOM 5083   C CA . SER A 1 2352 ? 157.773 215.961 156.783 1.00 0.00 ? 2352 SER A CA 3  
ATOM 5084   C CA . ASN A 1 2353 ? 159.062 216.737 160.255 1.00 0.00 ? 2353 ASN A CA 3  
ATOM 5085   C CA . ILE A 1 2354 ? 161.067 213.950 161.874 1.00 0.00 ? 2354 ILE A CA 3  
ATOM 5086   C CA . ILE A 1 2355 ? 159.095 212.547 164.815 1.00 0.00 ? 2355 ILE A CA 3  
ATOM 5087   C CA . THR A 1 2356 ? 161.638 210.090 166.265 1.00 0.00 ? 2356 THR A CA 3  
ATOM 5088   C CA . VAL A 1 2357 ? 165.284 209.061 165.897 1.00 0.00 ? 2357 VAL A CA 3  
ATOM 5089   C CA . VAL A 1 2358 ? 166.779 205.756 167.062 1.00 0.00 ? 2358 VAL A CA 3  
ATOM 5090   C CA . VAL A 1 2359 ? 170.566 205.411 166.868 1.00 0.00 ? 2359 VAL A CA 3  
ATOM 5091   C CA . ASP A 1 2360 ? 172.321 202.074 166.386 1.00 0.00 ? 2360 ASP A CA 3  
ATOM 5092   C CA . THR A 1 2361 ? 174.808 201.329 163.608 1.00 0.00 ? 2361 THR A CA 3  
ATOM 5093   C CA . ALA A 1 2362 ? 172.864 203.735 161.381 1.00 0.00 ? 2362 ALA A CA 3  
ATOM 5094   C CA . LEU A 1 2363 ? 170.154 206.348 161.908 1.00 0.00 ? 2363 LEU A CA 3  
ATOM 5095   C CA . TYR A 1 2364 ? 166.564 205.084 161.681 1.00 0.00 ? 2364 TYR A CA 3  
ATOM 5096   C CA . ILE A 1 2365 ? 164.254 208.096 161.437 1.00 0.00 ? 2365 ILE A CA 3  
ATOM 5097   C CA . ALA A 1 2366 ? 160.485 208.270 161.069 1.00 0.00 ? 2366 ALA A CA 3  
ATOM 5098   C CA . LYS A 1 2367 ? 158.543 211.268 159.781 1.00 0.00 ? 2367 LYS A CA 3  
ATOM 5099   C CA . GLN A 1 2368 ? 155.074 212.612 160.488 1.00 0.00 ? 2368 GLN A CA 3  
ATOM 5100   C CA . ASN A 1 2369 ? 152.285 210.881 158.535 1.00 0.00 ? 2369 ASN A CA 3  
ATOM 5101   C CA . SER A 1 2370 ? 154.806 208.645 156.754 1.00 0.00 ? 2370 SER A CA 3  
ATOM 5102   C CA . PRO A 1 2371 ? 154.916 204.821 156.560 1.00 0.00 ? 2371 PRO A CA 3  
ATOM 5103   C CA . VAL A 1 2372 ? 158.616 204.747 155.583 1.00 0.00 ? 2372 VAL A CA 3  
ATOM 5104   C CA . VAL A 1 2373 ? 161.398 204.443 158.149 1.00 0.00 ? 2373 VAL A CA 3  
ATOM 5105   C CA . GLU A 1 2374 ? 164.409 206.074 156.501 1.00 0.00 ? 2374 GLU A CA 3  
ATOM 5106   C CA . VAL A 1 2375 ? 167.902 204.745 157.218 1.00 0.00 ? 2375 VAL A CA 3  
ATOM 5107   C CA . TRP A 1 2376 ? 170.805 207.199 156.972 1.00 0.00 ? 2376 TRP A CA 3  
ATOM 5108   C CA . ASP A 1 2377 ? 174.556 206.745 157.406 1.00 0.00 ? 2377 ASP A CA 3  
ATOM 5109   C CA . LYS A 1 2378 ? 176.360 208.728 160.098 1.00 0.00 ? 2378 LYS A CA 3  
ATOM 5110   C CA . LYS A 1 2379 ? 179.586 209.003 158.092 1.00 0.00 ? 2379 LYS A CA 3  
ATOM 5111   C CA . THR A 1 2380 ? 178.505 209.534 154.476 1.00 0.00 ? 2380 THR A CA 3  
ATOM 5112   C CA . GLU A 1 2381 ? 175.298 211.408 155.451 1.00 0.00 ? 2381 GLU A CA 3  
ATOM 5113   C CA . LYS A 1 2382 ? 173.266 209.637 152.740 1.00 0.00 ? 2382 LYS A CA 3  
ATOM 5114   C CA . LEU A 1 2383 ? 170.489 207.071 152.532 1.00 0.00 ? 2383 LEU A CA 3  
ATOM 5115   C CA . CYS A 1 2384 ? 171.496 203.689 153.900 1.00 0.00 ? 2384 CYS A CA 3  
ATOM 5116   C CA . GLY A 1 2385 ? 168.115 202.141 153.164 1.00 0.00 ? 2385 GLY A CA 3  
ATOM 5117   C CA . LEU A 1 2386 ? 164.335 202.246 153.358 1.00 0.00 ? 2386 LEU A CA 3  
ATOM 5118   C CA . ILE A 1 2387 ? 161.863 200.235 155.436 1.00 0.00 ? 2387 ILE A CA 3  
ATOM 5119   C CA . ASP A 1 2388 ? 158.321 200.466 154.033 1.00 0.00 ? 2388 ASP A CA 3  
ATOM 5120   C CA . CYS A 1 2389 ? 155.908 199.346 156.754 1.00 0.00 ? 2389 CYS A CA 3  
ATOM 5121   C CA . VAL A 1 2390 ? 152.990 199.091 154.297 1.00 0.00 ? 2390 VAL A CA 3  
ATOM 5122   C CA . HIS A 1 2391 ? 154.733 196.227 152.492 1.00 0.00 ? 2391 HIS A CA 3  
ATOM 5123   C CA . PHE A 1 2392 ? 155.763 194.474 155.711 1.00 0.00 ? 2392 PHE A CA 3  
ATOM 5124   C CA . LEU A 1 2393 ? 152.179 194.675 156.976 1.00 0.00 ? 2393 LEU A CA 3  
ATOM 5125   C CA . ARG A 1 2394 ? 150.694 193.394 153.693 1.00 0.00 ? 2394 ARG A CA 3  
ATOM 5126   C CA . GLU A 1 2395 ? 152.438 190.007 154.087 1.00 0.00 ? 2395 GLU A CA 3  
ATOM 5127   C CA . MET A 1 2408 ? 145.537 195.117 153.109 1.00 0.00 ? 2408 MET A CA 3  
ATOM 5128   C CA . SER A 1 2409 ? 144.103 198.618 153.593 1.00 0.00 ? 2409 SER A CA 3  
ATOM 5129   C CA . TYR A 1 2410 ? 146.716 199.599 156.193 1.00 0.00 ? 2410 TYR A CA 3  
ATOM 5130   C CA . SER A 1 2411 ? 148.081 203.140 156.162 1.00 0.00 ? 2411 SER A CA 3  
ATOM 5131   C CA . GLY A 1 2412 ? 151.245 201.889 157.868 1.00 0.00 ? 2412 GLY A CA 3  
ATOM 5132   C CA . ARG A 1 2413 ? 151.792 205.384 159.249 1.00 0.00 ? 2413 ARG A CA 3  
ATOM 5133   C CA . VAL A 1 2414 ? 154.724 205.081 161.646 1.00 0.00 ? 2414 VAL A CA 3  
ATOM 5134   C CA . LYS A 1 2415 ? 154.029 206.356 165.159 1.00 0.00 ? 2415 LYS A CA 3  
ATOM 5135   C CA . THR A 1 2416 ? 156.973 205.181 167.255 1.00 0.00 ? 2416 THR A CA 3  
ATOM 5136   C CA . LEU A 1 2417 ? 160.345 203.408 167.089 1.00 0.00 ? 2417 LEU A CA 3  
ATOM 5137   C CA . CYS A 1 2418 ? 162.086 201.492 169.873 1.00 0.00 ? 2418 CYS A CA 3  
ATOM 5138   C CA . LEU A 1 2419 ? 165.329 199.512 169.949 1.00 0.00 ? 2419 LEU A CA 3  
ATOM 5139   C CA . GLN A 1 2420 ? 165.420 196.075 171.573 1.00 0.00 ? 2420 GLN A CA 3  
ATOM 5140   C CA . LYS A 1 2421 ? 168.912 195.079 172.744 1.00 0.00 ? 2421 LYS A CA 3  
ATOM 5141   C CA . ASN A 1 2422 ? 171.431 195.379 169.906 1.00 0.00 ? 2422 ASN A CA 3  
ATOM 5142   C CA . THR A 1 2423 ? 169.527 193.708 167.060 1.00 0.00 ? 2423 THR A CA 3  
ATOM 5143   C CA . ALA A 1 2424 ? 165.805 194.355 167.149 1.00 0.00 ? 2424 ALA A CA 3  
ATOM 5144   C CA . LEU A 1 2425 ? 163.656 197.336 166.154 1.00 0.00 ? 2425 LEU A CA 3  
ATOM 5145   C CA . TRP A 1 2426 ? 160.037 197.745 167.270 1.00 0.00 ? 2426 TRP A CA 3  
ATOM 5146   C CA . ILE A 1 2427 ? 157.792 199.859 165.023 1.00 0.00 ? 2427 ILE A CA 3  
ATOM 5147   C CA . GLY A 1 2428 ? 154.380 201.000 166.276 1.00 0.00 ? 2428 GLY A CA 3  
ATOM 5148   C CA . THR A 1 2429 ? 152.208 202.056 163.354 1.00 0.00 ? 2429 THR A CA 3  
ATOM 5149   C CA . GLY A 1 2430 ? 149.094 204.295 163.330 1.00 0.00 ? 2430 GLY A CA 3  
ATOM 5150   C CA . GLY A 1 2431 ? 146.803 201.307 163.491 1.00 0.00 ? 2431 GLY A CA 3  
ATOM 5151   C CA . GLY A 1 2432 ? 147.146 198.891 166.351 1.00 0.00 ? 2432 GLY A CA 3  
ATOM 5152   C CA . HIS A 1 2433 ? 150.045 197.180 164.619 1.00 0.00 ? 2433 HIS A CA 3  
ATOM 5153   C CA . ILE A 1 2434 ? 153.465 196.439 166.113 1.00 0.00 ? 2434 ILE A CA 3  
ATOM 5154   C CA . LEU A 1 2435 ? 156.360 195.180 163.971 1.00 0.00 ? 2435 LEU A CA 3  
ATOM 5155   C CA . LEU A 1 2436 ? 159.653 193.651 165.124 1.00 0.00 ? 2436 LEU A CA 3  
ATOM 5156   C CA . LEU A 1 2437 ? 162.496 193.793 162.583 1.00 0.00 ? 2437 LEU A CA 3  
ATOM 5157   C CA . ASP A 1 2438 ? 166.000 192.325 162.723 1.00 0.00 ? 2438 ASP A CA 3  
ATOM 5158   C CA . LEU A 1 2439 ? 168.580 195.062 162.022 1.00 0.00 ? 2439 LEU A CA 3  
ATOM 5159   C CA . SER A 1 2440 ? 171.516 193.127 160.556 1.00 0.00 ? 2440 SER A CA 3  
ATOM 5160   C CA . THR A 1 2441 ? 171.282 190.623 157.704 1.00 0.00 ? 2441 THR A CA 3  
ATOM 5161   C CA . ARG A 1 2442 ? 167.495 190.167 157.444 1.00 0.00 ? 2442 ARG A CA 3  
ATOM 5162   C CA . ARG A 1 2443 ? 164.265 191.954 158.377 1.00 0.00 ? 2443 ARG A CA 3  
ATOM 5163   C CA . LEU A 1 2444 ? 160.940 190.802 159.835 1.00 0.00 ? 2444 LEU A CA 3  
ATOM 5164   C CA . ILE A 1 2445 ? 161.009 188.835 163.095 1.00 0.00 ? 2445 ILE A CA 3  
ATOM 5165   C CA . ARG A 1 2446 ? 157.567 189.290 164.649 1.00 0.00 ? 2446 ARG A CA 3  
ATOM 5166   C CA . VAL A 1 2447 ? 154.263 190.999 163.843 1.00 0.00 ? 2447 VAL A CA 3  
ATOM 5167   C CA . ILE A 1 2448 ? 151.258 191.567 166.103 1.00 0.00 ? 2448 ILE A CA 3  
ATOM 5168   C CA . TYR A 1 2449 ? 148.152 192.940 164.370 1.00 0.00 ? 2449 TYR A CA 3  
ATOM 5169   C CA . ASN A 1 2450 ? 145.372 194.879 166.109 1.00 0.00 ? 2450 ASN A CA 3  
ATOM 5170   C CA . PHE A 1 2451 ? 147.402 195.081 169.318 1.00 0.00 ? 2451 PHE A CA 3  
ATOM 5171   C CA . CYS A 1 2452 ? 145.254 198.181 169.871 1.00 0.00 ? 2452 CYS A CA 3  
ATOM 5172   C CA . ASN A 1 2453 ? 143.531 200.775 167.693 1.00 0.00 ? 2453 ASN A CA 3  
ATOM 5173   C CA . SER A 1 2454 ? 146.562 203.106 167.586 1.00 0.00 ? 2454 SER A CA 3  
ATOM 5174   C CA . VAL A 1 2455 ? 150.038 202.734 169.130 1.00 0.00 ? 2455 VAL A CA 3  
ATOM 5175   C CA . ARG A 1 2456 ? 151.025 206.119 170.560 1.00 0.00 ? 2456 ARG A CA 3  
ATOM 5176   C CA . VAL A 1 2457 ? 154.102 205.542 172.753 1.00 0.00 ? 2457 VAL A CA 3  
ATOM 5177   C CA . MET A 1 2458 ? 156.579 202.671 173.003 1.00 0.00 ? 2458 MET A CA 3  
ATOM 5178   C CA . MET A 1 2459 ? 159.593 202.712 175.322 1.00 0.00 ? 2459 MET A CA 3  
ATOM 5179   C CA . THR A 1 2460 ? 162.001 200.609 177.375 1.00 0.00 ? 2460 THR A CA 3  
ATOM 5180   C CA . ALA A 1 2461 ? 162.465 201.065 181.126 1.00 0.00 ? 2461 ALA A CA 3  
ATOM 5181   C CA . GLN A 1 2462 ? 164.382 199.474 183.992 1.00 0.00 ? 2462 GLN A CA 3  
ATOM 5182   C CA . ASN A 1 2468 ? 164.440 195.290 181.125 1.00 0.00 ? 2468 ASN A CA 3  
ATOM 5183   C CA . VAL A 1 2469 ? 160.755 196.157 180.696 1.00 0.00 ? 2469 VAL A CA 3  
ATOM 5184   C CA . MET A 1 2470 ? 158.617 197.145 177.701 1.00 0.00 ? 2470 MET A CA 3  
ATOM 5185   C CA . LEU A 1 2471 ? 155.863 199.783 177.874 1.00 0.00 ? 2471 LEU A CA 3  
ATOM 5186   C CA . VAL A 1 2472 ? 153.362 200.424 175.062 1.00 0.00 ? 2472 VAL A CA 3  
ATOM 5187   C CA . LEU A 1 2473 ? 150.719 203.131 175.465 1.00 0.00 ? 2473 LEU A CA 3  
ATOM 5188   C CA . GLY A 1 2474 ? 147.928 202.815 172.910 1.00 0.00 ? 2474 GLY A CA 3  
ATOM 5189   C CA . TYR A 1 2475 ? 144.483 204.357 172.717 1.00 0.00 ? 2475 TYR A CA 3  
ATOM 5190   C CA . ASN A 1 2476 ? 141.075 203.138 171.486 1.00 0.00 ? 2476 ASN A CA 3  
ATOM 5191   C CA . ARG A 1 2477 ? 138.204 205.332 170.369 1.00 0.00 ? 2477 ARG A CA 3  
ATOM 5192   C CA . GLU A 1 2488 ? 134.862 208.527 173.890 1.00 0.00 ? 2497 GLU A CA 3  
ATOM 5193   C CA . ILE A 1 2489 ? 138.520 207.541 174.318 1.00 0.00 ? 2498 ILE A CA 3  
ATOM 5194   C CA . GLN A 1 2490 ? 140.070 204.686 176.324 1.00 0.00 ? 2499 GLN A CA 3  
ATOM 5195   C CA . SER A 1 2491 ? 143.837 204.782 176.813 1.00 0.00 ? 2500 SER A CA 3  
ATOM 5196   C CA . CYS A 1 2492 ? 145.654 201.589 177.788 1.00 0.00 ? 2501 CYS A CA 3  
ATOM 5197   C CA . LEU A 1 2493 ? 149.201 200.825 178.926 1.00 0.00 ? 2502 LEU A CA 3  
ATOM 5198   C CA . THR A 1 2494 ? 150.548 197.367 178.050 1.00 0.00 ? 2503 THR A CA 3  
ATOM 5199   C CA . VAL A 1 2495 ? 153.702 196.076 179.732 1.00 0.00 ? 2504 VAL A CA 3  
ATOM 5200   C CA . TRP A 1 2496 ? 155.966 193.023 179.547 1.00 0.00 ? 2505 TRP A CA 3  
ATOM 5201   C CA . TYR B 1 1332 ? 116.802 108.521 103.381 1.00 0.00 ? 1332 TYR B CA 3  
ATOM 5202   C CA . ASN B 1 1333 ? 116.349 111.648 101.155 1.00 0.00 ? 1333 ASN B CA 3  
ATOM 5203   C CA . ARG B 1 1334 ? 113.510 113.293 103.015 1.00 0.00 ? 1334 ARG B CA 3  
ATOM 5204   C CA . MET B 1 1335 ? 113.250 116.526 105.044 1.00 0.00 ? 1335 MET B CA 3  
ATOM 5205   C CA . LYS B 1 1336 ? 110.701 118.570 107.021 1.00 0.00 ? 1336 LYS B CA 3  
ATOM 5206   C CA . LEU B 1 1337 ? 110.287 122.254 106.164 1.00 0.00 ? 1337 LEU B CA 3  
ATOM 5207   C CA . MET B 1 1338 ? 108.530 124.018 109.017 1.00 0.00 ? 1338 MET B CA 3  
ATOM 5208   C CA . ILE B 1 1339 ? 106.989 127.355 108.029 1.00 0.00 ? 1339 ILE B CA 3  
ATOM 5209   C CA . VAL B 1 1340 ? 107.221 129.723 111.019 1.00 0.00 ? 1340 VAL B CA 3  
ATOM 5210   C CA . GLY B 1 1341 ? 105.746 133.218 111.392 1.00 0.00 ? 1341 GLY B CA 3  
ATOM 5211   C CA . ASN B 1 1342 ? 102.744 135.300 112.412 1.00 0.00 ? 1342 ASN B CA 3  
ATOM 5212   C CA . THR B 1 1343 ? 99.501  134.340 110.540 1.00 0.00 ? 1343 THR B CA 3  
ATOM 5213   C CA . GLY B 1 1344 ? 99.794  135.766 107.013 1.00 0.00 ? 1344 GLY B CA 3  
ATOM 5214   C CA . SER B 1 1345 ? 103.319 137.157 106.780 1.00 0.00 ? 1345 SER B CA 3  
ATOM 5215   C CA . GLY B 1 1346 ? 102.999 135.471 103.346 1.00 0.00 ? 1346 GLY B CA 3  
ATOM 5216   C CA . LYS B 1 1347 ? 103.382 131.758 104.196 1.00 0.00 ? 1347 LYS B CA 3  
ATOM 5217   C CA . THR B 1 1348 ? 101.021 130.728 101.339 1.00 0.00 ? 1348 THR B CA 3  
ATOM 5218   C CA . THR B 1 1349 ? 102.550 133.456 99.086  1.00 0.00 ? 1349 THR B CA 3  
ATOM 5219   C CA . LEU B 1 1350 ? 106.077 132.142 99.624  1.00 0.00 ? 1350 LEU B CA 3  
ATOM 5220   C CA . LEU B 1 1351 ? 104.875 128.544 99.015  1.00 0.00 ? 1351 LEU B CA 3  
ATOM 5221   C CA . GLN B 1 1352 ? 103.057 129.432 95.746  1.00 0.00 ? 1352 GLN B CA 3  
ATOM 5222   C CA . GLN B 1 1353 ? 106.265 131.048 94.487  1.00 0.00 ? 1353 GLN B CA 3  
ATOM 5223   C CA . LEU B 1 1354 ? 108.648 128.177 95.433  1.00 0.00 ? 1354 LEU B CA 3  
ATOM 5224   C CA . MET B 1 1355 ? 106.533 125.353 94.134  1.00 0.00 ? 1355 MET B CA 3  
ATOM 5225   C CA . LYS B 1 1356 ? 106.131 126.369 90.408  1.00 0.00 ? 1356 LYS B CA 3  
ATOM 5226   C CA . THR B 1 1357 ? 104.040 123.272 89.492  1.00 0.00 ? 1357 THR B CA 3  
ATOM 5227   C CA . LYS B 1 1358 ? 101.000 123.109 87.134  1.00 0.00 ? 1358 LYS B CA 3  
ATOM 5228   C CA . LYS B 1 1359 ? 98.969  124.412 90.107  1.00 0.00 ? 1359 LYS B CA 3  
ATOM 5229   C CA . SER B 1 1360 ? 98.282  120.767 91.091  1.00 0.00 ? 1360 SER B CA 3  
ATOM 5230   C CA . ASP B 1 1361 ? 97.145  121.126 94.727  1.00 0.00 ? 1361 ASP B CA 3  
ATOM 5231   C CA . LEU B 1 1362 ? 99.639  124.028 94.824  1.00 0.00 ? 1362 LEU B CA 3  
ATOM 5232   C CA . GLY B 1 1363 ? 97.056  126.437 96.178  1.00 0.00 ? 1363 GLY B CA 3  
ATOM 5233   C CA . MET B 1 1364 ? 95.943  126.398 99.824  1.00 0.00 ? 1364 MET B CA 3  
ATOM 5234   C CA . GLN B 1 1365 ? 95.973  129.470 102.069 1.00 0.00 ? 1365 GLN B CA 3  
ATOM 5235   C CA . SER B 1 1366 ? 95.413  128.750 105.771 1.00 0.00 ? 1366 SER B CA 3  
ATOM 5236   C CA . ALA B 1 1367 ? 97.771  131.303 107.238 1.00 0.00 ? 1367 ALA B CA 3  
ATOM 5237   C CA . THR B 1 1368 ? 95.915  131.814 110.610 1.00 0.00 ? 1368 THR B CA 3  
ATOM 5238   C CA . VAL B 1 1369 ? 95.285  128.938 113.094 1.00 0.00 ? 1369 VAL B CA 3  
ATOM 5239   C CA . GLY B 1 1370 ? 95.306  126.127 110.489 1.00 0.00 ? 1370 GLY B CA 3  
ATOM 5240   C CA . ILE B 1 1371 ? 97.202  122.937 109.602 1.00 0.00 ? 1371 ILE B CA 3  
ATOM 5241   C CA . ASP B 1 1372 ? 98.369  121.358 106.310 1.00 0.00 ? 1372 ASP B CA 3  
ATOM 5242   C CA . VAL B 1 1373 ? 101.209 119.446 104.592 1.00 0.00 ? 1373 VAL B CA 3  
ATOM 5243   C CA . LYS B 1 1374 ? 102.416 119.918 101.031 1.00 0.00 ? 1374 LYS B CA 3  
ATOM 5244   C CA . ASP B 1 1375 ? 105.003 117.386 99.923  1.00 0.00 ? 1375 ASP B CA 3  
ATOM 5245   C CA . TRP B 1 1376 ? 106.946 118.198 96.734  1.00 0.00 ? 1376 TRP B CA 3  
ATOM 5246   C CA . PRO B 1 1377 ? 110.186 116.746 95.279  1.00 0.00 ? 1377 PRO B CA 3  
ATOM 5247   C CA . ILE B 1 1378 ? 112.118 120.078 94.941  1.00 0.00 ? 1378 ILE B CA 3  
ATOM 5248   C CA . GLN B 1 1379 ? 115.391 118.995 93.529  1.00 0.00 ? 1379 GLN B CA 3  
ATOM 5249   C CA . ILE B 1 1380 ? 118.390 119.487 91.271  1.00 0.00 ? 1380 ILE B CA 3  
ATOM 5250   C CA . ARG B 1 1381 ? 118.507 117.134 88.309  1.00 0.00 ? 1381 ARG B CA 3  
ATOM 5251   C CA . ASP B 1 1382 ? 121.703 115.023 88.010  1.00 0.00 ? 1382 ASP B CA 3  
ATOM 5252   C CA . LYS B 1 1383 ? 122.939 115.774 91.568  1.00 0.00 ? 1383 LYS B CA 3  
ATOM 5253   C CA . ARG B 1 1384 ? 122.514 114.173 95.052  1.00 0.00 ? 1384 ARG B CA 3  
ATOM 5254   C CA . LYS B 1 1385 ? 119.414 116.282 95.488  1.00 0.00 ? 1385 LYS B CA 3  
ATOM 5255   C CA . ARG B 1 1386 ? 117.729 114.355 92.528  1.00 0.00 ? 1386 ARG B CA 3  
ATOM 5256   C CA . ASP B 1 1387 ? 115.826 111.955 94.847  1.00 0.00 ? 1387 ASP B CA 3  
ATOM 5257   C CA . LEU B 1 1388 ? 115.054 114.503 97.666  1.00 0.00 ? 1388 LEU B CA 3  
ATOM 5258   C CA . VAL B 1 1389 ? 111.531 114.877 99.081  1.00 0.00 ? 1389 VAL B CA 3  
ATOM 5259   C CA . LEU B 1 1390 ? 110.544 118.118 100.857 1.00 0.00 ? 1390 LEU B CA 3  
ATOM 5260   C CA . ASN B 1 1391 ? 107.618 118.067 103.280 1.00 0.00 ? 1391 ASN B CA 3  
ATOM 5261   C CA . VAL B 1 1392 ? 106.257 121.570 103.951 1.00 0.00 ? 1392 VAL B CA 3  
ATOM 5262   C CA . TRP B 1 1393 ? 104.456 121.705 107.289 1.00 0.00 ? 1393 TRP B CA 3  
ATOM 5263   C CA . ASP B 1 1394 ? 102.518 124.511 108.864 1.00 0.00 ? 1394 ASP B CA 3  
ATOM 5264   C CA . PHE B 1 1395 ? 101.242 123.945 112.425 1.00 0.00 ? 1395 PHE B CA 3  
ATOM 5265   C CA . ALA B 1 1396 ? 100.286 127.615 112.985 1.00 0.00 ? 1396 ALA B CA 3  
ATOM 5266   C CA . GLY B 1 1397 ? 102.339 128.151 116.184 1.00 0.00 ? 1397 GLY B CA 3  
ATOM 5267   C CA . ARG B 1 1398 ? 100.928 125.117 118.005 1.00 0.00 ? 1398 ARG B CA 3  
ATOM 5268   C CA . GLU B 1 1399 ? 103.677 122.502 117.767 1.00 0.00 ? 1399 GLU B CA 3  
ATOM 5269   C CA . GLU B 1 1400 ? 101.376 119.461 118.291 1.00 0.00 ? 1400 GLU B CA 3  
ATOM 5270   C CA . PHE B 1 1401 ? 104.043 116.753 117.686 1.00 0.00 ? 1401 PHE B CA 3  
ATOM 5271   C CA . TYR B 1 1402 ? 106.482 118.112 120.358 1.00 0.00 ? 1402 TYR B CA 3  
ATOM 5272   C CA . SER B 1 1403 ? 105.577 116.012 123.457 1.00 0.00 ? 1403 SER B CA 3  
ATOM 5273   C CA . THR B 1 1404 ? 105.383 112.536 121.876 1.00 0.00 ? 1404 THR B CA 3  
ATOM 5274   C CA . HIS B 1 1405 ? 107.736 112.962 118.896 1.00 0.00 ? 1405 HIS B CA 3  
ATOM 5275   C CA . PRO B 1 1406 ? 110.808 115.094 120.010 1.00 0.00 ? 1406 PRO B CA 3  
ATOM 5276   C CA . HIS B 1 1407 ? 112.904 114.213 116.932 1.00 0.00 ? 1407 HIS B CA 3  
ATOM 5277   C CA . PHE B 1 1408 ? 110.169 115.372 114.502 1.00 0.00 ? 1408 PHE B CA 3  
ATOM 5278   C CA . MET B 1 1409 ? 111.071 118.932 115.558 1.00 0.00 ? 1409 MET B CA 3  
ATOM 5279   C CA . THR B 1 1410 ? 114.757 118.544 116.558 1.00 0.00 ? 1410 THR B CA 3  
ATOM 5280   C CA . GLN B 1 1411 ? 116.002 116.295 113.731 1.00 0.00 ? 1411 GLN B CA 3  
ATOM 5281   C CA . ARG B 1 1412 ? 115.152 115.972 110.028 1.00 0.00 ? 1412 ARG B CA 3  
ATOM 5282   C CA . ALA B 1 1413 ? 114.025 119.590 109.951 1.00 0.00 ? 1413 ALA B CA 3  
ATOM 5283   C CA . LEU B 1 1414 ? 114.497 123.051 108.470 1.00 0.00 ? 1414 LEU B CA 3  
ATOM 5284   C CA . TYR B 1 1415 ? 112.771 126.075 109.975 1.00 0.00 ? 1415 TYR B CA 3  
ATOM 5285   C CA . LEU B 1 1416 ? 111.743 128.826 107.559 1.00 0.00 ? 1416 LEU B CA 3  
ATOM 5286   C CA . ALA B 1 1417 ? 110.965 132.055 109.333 1.00 0.00 ? 1417 ALA B CA 3  
ATOM 5287   C CA . VAL B 1 1418 ? 108.659 134.298 107.322 1.00 0.00 ? 1418 VAL B CA 3  
ATOM 5288   C CA . TYR B 1 1419 ? 108.821 137.961 108.264 1.00 0.00 ? 1419 TYR B CA 3  
ATOM 5289   C CA . ASP B 1 1420 ? 106.801 140.592 106.558 1.00 0.00 ? 1420 ASP B CA 3  
ATOM 5290   C CA . LEU B 1 1421 ? 109.350 143.221 107.585 1.00 0.00 ? 1421 LEU B CA 3  
ATOM 5291   C CA . SER B 1 1422 ? 106.946 146.173 107.068 1.00 0.00 ? 1422 SER B CA 3  
ATOM 5292   C CA . LYS B 1 1423 ? 104.125 144.532 109.072 1.00 0.00 ? 1423 LYS B CA 3  
ATOM 5293   C CA . GLY B 1 1424 ? 105.209 141.376 111.011 1.00 0.00 ? 1424 GLY B CA 3  
ATOM 5294   C CA . GLN B 1 1425 ? 108.480 143.010 112.131 1.00 0.00 ? 1425 GLN B CA 3  
ATOM 5295   C CA . ALA B 1 1426 ? 107.275 146.657 112.155 1.00 0.00 ? 1426 ALA B CA 3  
ATOM 5296   C CA . GLU B 1 1427 ? 103.710 146.412 113.673 1.00 0.00 ? 1427 GLU B CA 3  
ATOM 5297   C CA . VAL B 1 1428 ? 104.247 143.666 116.291 1.00 0.00 ? 1428 VAL B CA 3  
ATOM 5298   C CA . ASP B 1 1429 ? 108.067 142.977 116.477 1.00 0.00 ? 1429 ASP B CA 3  
ATOM 5299   C CA . ALA B 1 1430 ? 107.332 139.250 116.497 1.00 0.00 ? 1430 ALA B CA 3  
ATOM 5300   C CA . MET B 1 1431 ? 110.782 138.430 115.112 1.00 0.00 ? 1431 MET B CA 3  
ATOM 5301   C CA . LYS B 1 1432 ? 112.301 138.000 118.604 1.00 0.00 ? 1432 LYS B CA 3  
ATOM 5302   C CA . PRO B 1 1433 ? 109.439 135.634 119.781 1.00 0.00 ? 1433 PRO B CA 3  
ATOM 5303   C CA . TRP B 1 1434 ? 109.518 133.480 116.603 1.00 0.00 ? 1434 TRP B CA 3  
ATOM 5304   C CA . LEU B 1 1435 ? 113.309 133.178 116.660 1.00 0.00 ? 1435 LEU B CA 3  
ATOM 5305   C CA . PHE B 1 1436 ? 113.221 131.898 120.299 1.00 0.00 ? 1436 PHE B CA 3  
ATOM 5306   C CA . ASN B 1 1437 ? 110.265 129.601 119.322 1.00 0.00 ? 1437 ASN B CA 3  
ATOM 5307   C CA . ILE B 1 1438 ? 112.484 128.040 116.602 1.00 0.00 ? 1438 ILE B CA 3  
ATOM 5308   C CA . LYS B 1 1439 ? 115.418 127.660 119.086 1.00 0.00 ? 1439 LYS B CA 3  
ATOM 5309   C CA . ALA B 1 1440 ? 113.374 125.855 121.791 1.00 0.00 ? 1440 ALA B CA 3  
ATOM 5310   C CA . ARG B 1 1441 ? 111.206 123.566 119.595 1.00 0.00 ? 1441 ARG B CA 3  
ATOM 5311   C CA . ALA B 1 1442 ? 113.931 122.721 117.172 1.00 0.00 ? 1442 ALA B CA 3  
ATOM 5312   C CA . SER B 1 1443 ? 117.435 122.096 118.517 1.00 0.00 ? 1443 SER B CA 3  
ATOM 5313   C CA . SER B 1 1444 ? 120.449 122.565 116.251 1.00 0.00 ? 1444 SER B CA 3  
ATOM 5314   C CA . SER B 1 1445 ? 118.039 122.513 113.264 1.00 0.00 ? 1445 SER B CA 3  
ATOM 5315   C CA . PRO B 1 1446 ? 118.799 125.234 110.599 1.00 0.00 ? 1446 PRO B CA 3  
ATOM 5316   C CA . VAL B 1 1447 ? 116.747 128.261 110.164 1.00 0.00 ? 1447 VAL B CA 3  
ATOM 5317   C CA . ILE B 1 1448 ? 116.383 130.379 107.037 1.00 0.00 ? 1448 ILE B CA 3  
ATOM 5318   C CA . LEU B 1 1449 ? 115.104 133.928 107.530 1.00 0.00 ? 1449 LEU B CA 3  
ATOM 5319   C CA . VAL B 1 1450 ? 112.917 135.212 104.685 1.00 0.00 ? 1450 VAL B CA 3  
ATOM 5320   C CA . GLY B 1 1451 ? 112.029 138.922 104.617 1.00 0.00 ? 1451 GLY B CA 3  
ATOM 5321   C CA . THR B 1 1452 ? 108.833 139.137 102.535 1.00 0.00 ? 1452 THR B CA 3  
ATOM 5322   C CA . HIS B 1 1453 ? 106.842 141.850 100.692 1.00 0.00 ? 1453 HIS B CA 3  
ATOM 5323   C CA . LEU B 1 1454 ? 109.968 143.848 99.868  1.00 0.00 ? 1454 LEU B CA 3  
ATOM 5324   C CA . ASP B 1 1455 ? 108.264 145.515 96.841  1.00 0.00 ? 1455 ASP B CA 3  
ATOM 5325   C CA . VAL B 1 1456 ? 105.923 147.488 99.178  1.00 0.00 ? 1456 VAL B CA 3  
ATOM 5326   C CA . SER B 1 1457 ? 108.930 148.677 101.212 1.00 0.00 ? 1457 SER B CA 3  
ATOM 5327   C CA . ASP B 1 1458 ? 111.115 150.038 98.349  1.00 0.00 ? 1458 ASP B CA 3  
ATOM 5328   C CA . GLU B 1 1459 ? 113.982 147.726 99.442  1.00 0.00 ? 1459 GLU B CA 3  
ATOM 5329   C CA . LYS B 1 1460 ? 114.284 149.607 102.787 1.00 0.00 ? 1460 LYS B CA 3  
ATOM 5330   C CA . GLN B 1 1461 ? 113.304 146.979 105.380 1.00 0.00 ? 1461 GLN B CA 3  
ATOM 5331   C CA . ARG B 1 1462 ? 116.098 144.640 104.315 1.00 0.00 ? 1462 ARG B CA 3  
ATOM 5332   C CA . LYS B 1 1463 ? 118.836 147.061 105.327 1.00 0.00 ? 1463 LYS B CA 3  
ATOM 5333   C CA . ALA B 1 1464 ? 121.155 146.634 108.366 1.00 0.00 ? 1464 ALA B CA 3  
ATOM 5334   C CA . CYS B 1 1465 ? 119.386 149.668 109.867 1.00 0.00 ? 1465 CYS B CA 3  
ATOM 5335   C CA . MET B 1 1466 ? 116.116 147.692 110.331 1.00 0.00 ? 1466 MET B CA 3  
ATOM 5336   C CA . SER B 1 1467 ? 117.127 144.025 109.914 1.00 0.00 ? 1467 SER B CA 3  
ATOM 5337   C CA . LYS B 1 1468 ? 119.900 143.253 112.401 1.00 0.00 ? 1468 LYS B CA 3  
ATOM 5338   C CA . ILE B 1 1469 ? 121.412 140.286 110.439 1.00 0.00 ? 1469 ILE B CA 3  
ATOM 5339   C CA . THR B 1 1470 ? 125.009 140.195 111.752 1.00 0.00 ? 1470 THR B CA 3  
ATOM 5340   C CA . LYS B 1 1471 ? 124.374 142.374 114.757 1.00 0.00 ? 1471 LYS B CA 3  
ATOM 5341   C CA . GLU B 1 1472 ? 121.489 140.355 116.413 1.00 0.00 ? 1472 GLU B CA 3  
ATOM 5342   C CA . LEU B 1 1473 ? 120.261 137.522 114.133 1.00 0.00 ? 1473 LEU B CA 3  
ATOM 5343   C CA . LEU B 1 1474 ? 123.454 135.498 113.358 1.00 0.00 ? 1474 LEU B CA 3  
ATOM 5344   C CA . ASN B 1 1475 ? 126.292 133.639 115.206 1.00 0.00 ? 1475 ASN B CA 3  
ATOM 5345   C CA . LYS B 1 1476 ? 127.817 136.875 116.640 1.00 0.00 ? 1476 LYS B CA 3  
ATOM 5346   C CA . ARG B 1 1477 ? 124.798 137.361 118.939 1.00 0.00 ? 1477 ARG B CA 3  
ATOM 5347   C CA . GLY B 1 1478 ? 123.686 133.860 119.824 1.00 0.00 ? 1478 GLY B CA 3  
ATOM 5348   C CA . PHE B 1 1479 ? 121.775 132.705 116.719 1.00 0.00 ? 1479 PHE B CA 3  
ATOM 5349   C CA . PRO B 1 1480 ? 124.160 130.033 115.330 1.00 0.00 ? 1480 PRO B CA 3  
ATOM 5350   C CA . ALA B 1 1481 ? 121.995 127.809 113.107 1.00 0.00 ? 1481 ALA B CA 3  
ATOM 5351   C CA . ILE B 1 1482 ? 120.912 130.527 110.626 1.00 0.00 ? 1482 ILE B CA 3  
ATOM 5352   C CA . ARG B 1 1483 ? 123.810 131.541 108.273 1.00 0.00 ? 1483 ARG B CA 3  
ATOM 5353   C CA . ASP B 1 1484 ? 121.250 132.553 105.580 1.00 0.00 ? 1484 ASP B CA 3  
ATOM 5354   C CA . TYR B 1 1485 ? 118.936 135.535 104.986 1.00 0.00 ? 1485 TYR B CA 3  
ATOM 5355   C CA . HIS B 1 1486 ? 116.599 136.331 102.061 1.00 0.00 ? 1486 HIS B CA 3  
ATOM 5356   C CA . PHE B 1 1487 ? 114.841 139.426 100.885 1.00 0.00 ? 1487 PHE B CA 3  
ATOM 5357   C CA . VAL B 1 1488 ? 112.049 138.591 98.473  1.00 0.00 ? 1488 VAL B CA 3  
ATOM 5358   C CA . ASN B 1 1489 ? 109.598 140.621 96.368  1.00 0.00 ? 1489 ASN B CA 3  
ATOM 5359   C CA . ALA B 1 1490 ? 107.271 138.098 94.746  1.00 0.00 ? 1490 ALA B CA 3  
ATOM 5360   C CA . THR B 1 1491 ? 105.286 140.229 92.319  1.00 0.00 ? 1491 THR B CA 3  
ATOM 5361   C CA . GLU B 1 1492 ? 108.328 142.139 91.051  1.00 0.00 ? 1492 GLU B CA 3  
ATOM 5362   C CA . GLU B 1 1493 ? 110.726 139.279 90.239  1.00 0.00 ? 1493 GLU B CA 3  
ATOM 5363   C CA . SER B 1 1494 ? 111.415 135.652 91.293  1.00 0.00 ? 1494 SER B CA 3  
ATOM 5364   C CA . ASP B 1 1495 ? 115.220 135.910 91.300  1.00 0.00 ? 1495 ASP B CA 3  
ATOM 5365   C CA . ALA B 1 1496 ? 115.616 136.142 95.108  1.00 0.00 ? 1496 ALA B CA 3  
ATOM 5366   C CA . LEU B 1 1497 ? 113.295 133.121 95.575  1.00 0.00 ? 1497 LEU B CA 3  
ATOM 5367   C CA . ALA B 1 1498 ? 115.648 130.962 93.498  1.00 0.00 ? 1498 ALA B CA 3  
ATOM 5368   C CA . LYS B 1 1499 ? 118.266 131.936 96.142  1.00 0.00 ? 1499 LYS B CA 3  
ATOM 5369   C CA . LEU B 1 1500 ? 115.954 130.411 98.828  1.00 0.00 ? 1500 LEU B CA 3  
ATOM 5370   C CA . ARG B 1 1501 ? 116.439 127.096 96.998  1.00 0.00 ? 1501 ARG B CA 3  
ATOM 5371   C CA . LYS B 1 1502 ? 120.237 127.391 97.592  1.00 0.00 ? 1502 LYS B CA 3  
ATOM 5372   C CA . THR B 1 1503 ? 119.595 127.631 101.342 1.00 0.00 ? 1503 THR B CA 3  
ATOM 5373   C CA . ILE B 1 1504 ? 117.192 124.640 101.119 1.00 0.00 ? 1504 ILE B CA 3  
ATOM 5374   C CA . ILE B 1 1505 ? 120.207 122.968 99.411  1.00 0.00 ? 1505 ILE B CA 3  
ATOM 5375   C CA . ASN B 1 1506 ? 122.587 124.104 102.253 1.00 0.00 ? 1506 ASN B CA 3  
ATOM 5376   C CA . GLU B 1 1507 ? 120.273 122.469 104.775 1.00 0.00 ? 1507 GLU B CA 3  
ATOM 5377   C CA . SER B 1 1508 ? 118.935 118.827 104.539 1.00 0.00 ? 1508 SER B CA 3  
ATOM 5378   C CA . LEU B 1 1509 ? 122.698 118.020 104.493 1.00 0.00 ? 1509 LEU B CA 3  
ATOM 5379   C CA . ASN B 1 1510 ? 123.145 117.582 108.261 1.00 0.00 ? 1510 ASN B CA 3  
ATOM 5380   C CA . PHE B 1 1511 ? 119.588 116.118 108.782 1.00 0.00 ? 1511 PHE B CA 3  
ATOM 5381   C CA . LYS B 1 1512 ? 119.312 113.160 106.505 1.00 0.00 ? 1512 LYS B CA 3  
ATOM 5382   C CA . ILE B 1 1513 ? 122.631 112.514 104.646 1.00 0.00 ? 1513 ILE B CA 3  
ATOM 5383   C CA . ARG B 1 1514 ? 124.698 111.517 107.713 1.00 0.00 ? 1514 ARG B CA 3  
ATOM 5384   C CA . PRO B 1 1524 ? 133.127 122.591 81.663  1.00 0.00 ? 1524 PRO B CA 3  
ATOM 5385   C CA . ASP B 1 1525 ? 133.091 118.918 80.508  1.00 0.00 ? 1525 ASP B CA 3  
ATOM 5386   C CA . CYS B 1 1526 ? 136.832 118.505 81.316  1.00 0.00 ? 1526 CYS B CA 3  
ATOM 5387   C CA . TYR B 1 1527 ? 136.228 119.248 85.061  1.00 0.00 ? 1527 TYR B CA 3  
ATOM 5388   C CA . VAL B 1 1528 ? 133.393 116.607 85.196  1.00 0.00 ? 1528 VAL B CA 3  
ATOM 5389   C CA . GLU B 1 1529 ? 135.523 114.072 83.222  1.00 0.00 ? 1529 GLU B CA 3  
ATOM 5390   C CA . LEU B 1 1530 ? 138.499 114.570 85.513  1.00 0.00 ? 1530 LEU B CA 3  
ATOM 5391   C CA . GLU B 1 1531 ? 136.298 114.392 88.667  1.00 0.00 ? 1531 GLU B CA 3  
ATOM 5392   C CA . LYS B 1 1532 ? 134.918 110.977 87.579  1.00 0.00 ? 1532 LYS B CA 3  
ATOM 5393   C CA . ILE B 1 1533 ? 138.392 109.566 86.769  1.00 0.00 ? 1533 ILE B CA 3  
ATOM 5394   C CA . ILE B 1 1534 ? 139.796 110.974 90.040  1.00 0.00 ? 1534 ILE B CA 3  
ATOM 5395   C CA . LEU B 1 1535 ? 136.911 109.394 92.045  1.00 0.00 ? 1535 LEU B CA 3  
ATOM 5396   C CA . SER B 1 1536 ? 137.337 105.983 90.333  1.00 0.00 ? 1536 SER B CA 3  
ATOM 5397   C CA . GLU B 1 1537 ? 141.156 106.024 90.856  1.00 0.00 ? 1537 GLU B CA 3  
ATOM 5398   C CA . ARG B 1 1538 ? 140.795 107.271 94.455  1.00 0.00 ? 1538 ARG B CA 3  
ATOM 5399   C CA . LYS B 1 1539 ? 138.117 104.864 95.752  1.00 0.00 ? 1539 LYS B CA 3  
ATOM 5400   C CA . ASN B 1 1540 ? 140.112 101.909 94.358  1.00 0.00 ? 1540 ASN B CA 3  
ATOM 5401   C CA . VAL B 1 1541 ? 143.006 102.800 96.699  1.00 0.00 ? 1541 VAL B CA 3  
ATOM 5402   C CA . PRO B 1 1542 ? 141.313 102.269 100.167 1.00 0.00 ? 1542 PRO B CA 3  
ATOM 5403   C CA . ILE B 1 1543 ? 144.155 100.141 101.435 1.00 0.00 ? 1543 ILE B CA 3  
ATOM 5404   C CA . GLU B 1 1544 ? 146.867 102.645 100.765 1.00 0.00 ? 1544 GLU B CA 3  
ATOM 5405   C CA . PHE B 1 1545 ? 147.359 106.432 101.311 1.00 0.00 ? 1545 PHE B CA 3  
ATOM 5406   C CA . PRO B 1 1546 ? 148.887 107.757 97.996  1.00 0.00 ? 1546 PRO B CA 3  
ATOM 5407   C CA . VAL B 1 1547 ? 145.544 107.240 96.477  1.00 0.00 ? 1547 VAL B CA 3  
ATOM 5408   C CA . ILE B 1 1548 ? 146.743 109.616 93.820  1.00 0.00 ? 1548 ILE B CA 3  
ATOM 5409   C CA . ASP B 1 1549 ? 150.352 110.873 93.652  1.00 0.00 ? 1549 ASP B CA 3  
ATOM 5410   C CA . ARG B 1 1550 ? 151.344 114.123 91.851  1.00 0.00 ? 1550 ARG B CA 3  
ATOM 5411   C CA . LYS B 1 1551 ? 152.414 112.388 88.613  1.00 0.00 ? 1551 LYS B CA 3  
ATOM 5412   C CA . ARG B 1 1552 ? 149.254 110.299 88.458  1.00 0.00 ? 1552 ARG B CA 3  
ATOM 5413   C CA . LEU B 1 1553 ? 146.797 113.274 88.654  1.00 0.00 ? 1553 LEU B CA 3  
ATOM 5414   C CA . LEU B 1 1554 ? 148.960 115.175 86.121  1.00 0.00 ? 1554 LEU B CA 3  
ATOM 5415   C CA . GLN B 1 1555 ? 148.491 112.186 83.785  1.00 0.00 ? 1555 GLN B CA 3  
ATOM 5416   C CA . LEU B 1 1556 ? 144.667 112.148 84.303  1.00 0.00 ? 1556 LEU B CA 3  
ATOM 5417   C CA . VAL B 1 1557 ? 144.450 115.965 83.801  1.00 0.00 ? 1557 VAL B CA 3  
ATOM 5418   C CA . ARG B 1 1558 ? 146.342 115.626 80.457  1.00 0.00 ? 1558 ARG B CA 3  
ATOM 5419   C CA . GLU B 1 1559 ? 144.021 112.877 79.161  1.00 0.00 ? 1559 GLU B CA 3  
ATOM 5420   C CA . ASN B 1 1560 ? 141.060 115.294 79.558  1.00 0.00 ? 1560 ASN B CA 3  
ATOM 5421   C CA . GLN B 1 1561 ? 143.122 118.148 77.971  1.00 0.00 ? 1561 GLN B CA 3  
ATOM 5422   C CA . LEU B 1 1562 ? 143.752 120.197 81.182  1.00 0.00 ? 1562 LEU B CA 3  
ATOM 5423   C CA . GLN B 1 1563 ? 147.603 119.968 81.321  1.00 0.00 ? 1563 GLN B CA 3  
ATOM 5424   C CA . LEU B 1 1564 ? 147.543 123.196 79.265  1.00 0.00 ? 1564 LEU B CA 3  
ATOM 5425   C CA . ASP B 1 1565 ? 147.716 125.318 82.432  1.00 0.00 ? 1565 ASP B CA 3  
ATOM 5426   C CA . GLU B 1 1566 ? 149.142 124.302 85.857  1.00 0.00 ? 1566 GLU B CA 3  
ATOM 5427   C CA . ASN B 1 1567 ? 147.183 127.233 87.255  1.00 0.00 ? 1567 ASN B CA 3  
ATOM 5428   C CA . GLU B 1 1568 ? 143.700 125.766 86.310  1.00 0.00 ? 1568 GLU B CA 3  
ATOM 5429   C CA . LEU B 1 1569 ? 144.591 122.369 87.733  1.00 0.00 ? 1569 LEU B CA 3  
ATOM 5430   C CA . PRO B 1 1570 ? 145.060 123.879 91.303  1.00 0.00 ? 1570 PRO B CA 3  
ATOM 5431   C CA . HIS B 1 1571 ? 141.717 125.637 90.798  1.00 0.00 ? 1571 HIS B CA 3  
ATOM 5432   C CA . ALA B 1 1572 ? 139.927 122.420 89.672  1.00 0.00 ? 1572 ALA B CA 3  
ATOM 5433   C CA . VAL B 1 1573 ? 141.382 120.384 92.571  1.00 0.00 ? 1573 VAL B CA 3  
ATOM 5434   C CA . HIS B 1 1574 ? 140.752 123.365 94.950  1.00 0.00 ? 1574 HIS B CA 3  
ATOM 5435   C CA . PHE B 1 1575 ? 137.074 123.179 93.807  1.00 0.00 ? 1575 PHE B CA 3  
ATOM 5436   C CA . LEU B 1 1576 ? 136.913 119.405 94.225  1.00 0.00 ? 1576 LEU B CA 3  
ATOM 5437   C CA . ASN B 1 1577 ? 138.477 119.751 97.699  1.00 0.00 ? 1577 ASN B CA 3  
ATOM 5438   C CA . GLU B 1 1578 ? 136.050 122.597 98.705  1.00 0.00 ? 1578 GLU B CA 3  
ATOM 5439   C CA . SER B 1 1579 ? 133.176 120.325 97.613  1.00 0.00 ? 1579 SER B CA 3  
ATOM 5440   C CA . GLY B 1 1580 ? 134.506 117.185 99.450  1.00 0.00 ? 1580 GLY B CA 3  
ATOM 5441   C CA . VAL B 1 1581 ? 134.515 115.044 96.298  1.00 0.00 ? 1581 VAL B CA 3  
ATOM 5442   C CA . LEU B 1 1582 ? 138.211 114.534 96.868  1.00 0.00 ? 1582 LEU B CA 3  
ATOM 5443   C CA . LEU B 1 1583 ? 140.582 115.938 99.445  1.00 0.00 ? 1583 LEU B CA 3  
ATOM 5444   C CA . HIS B 1 1584 ? 143.619 118.037 98.454  1.00 0.00 ? 1584 HIS B CA 3  
ATOM 5445   C CA . PHE B 1 1585 ? 145.670 119.744 101.108 1.00 0.00 ? 1585 PHE B CA 3  
ATOM 5446   C CA . GLN B 1 1586 ? 147.525 122.735 99.630  1.00 0.00 ? 1586 GLN B CA 3  
ATOM 5447   C CA . ASP B 1 1587 ? 149.302 123.568 102.957 1.00 0.00 ? 1587 ASP B CA 3  
ATOM 5448   C CA . PRO B 1 1588 ? 151.261 120.179 103.215 1.00 0.00 ? 1588 PRO B CA 3  
ATOM 5449   C CA . ALA B 1 1589 ? 151.627 120.041 99.371  1.00 0.00 ? 1589 ALA B CA 3  
ATOM 5450   C CA . LEU B 1 1590 ? 155.045 121.791 99.408  1.00 0.00 ? 1590 LEU B CA 3  
ATOM 5451   C CA . GLN B 1 1591 ? 156.857 118.602 100.522 1.00 0.00 ? 1591 GLN B CA 3  
ATOM 5452   C CA . LEU B 1 1592 ? 154.318 115.942 99.554  1.00 0.00 ? 1592 LEU B CA 3  
ATOM 5453   C CA . SER B 1 1593 ? 154.044 114.739 95.914  1.00 0.00 ? 1593 SER B CA 3  
ATOM 5454   C CA . ASP B 1 1594 ? 153.584 111.103 97.024  1.00 0.00 ? 1594 ASP B CA 3  
ATOM 5455   C CA . LEU B 1 1595 ? 150.240 111.838 98.693  1.00 0.00 ? 1595 LEU B CA 3  
ATOM 5456   C CA . TYR B 1 1596 ? 148.700 114.685 96.755  1.00 0.00 ? 1596 TYR B CA 3  
ATOM 5457   C CA . PHE B 1 1597 ? 144.950 114.054 96.498  1.00 0.00 ? 1597 PHE B CA 3  
ATOM 5458   C CA . VAL B 1 1598 ? 142.970 111.868 98.932  1.00 0.00 ? 1598 VAL B CA 3  
ATOM 5459   C CA . GLU B 1 1599 ? 139.793 109.677 99.253  1.00 0.00 ? 1599 GLU B CA 3  
ATOM 5460   C CA . PRO B 1 1600 ? 137.473 111.359 101.865 1.00 0.00 ? 1600 PRO B CA 3  
ATOM 5461   C CA . LYS B 1 1601 ? 136.265 108.007 103.272 1.00 0.00 ? 1601 LYS B CA 3  
ATOM 5462   C CA . TRP B 1 1602 ? 139.813 106.803 103.820 1.00 0.00 ? 1602 TRP B CA 3  
ATOM 5463   C CA . LEU B 1 1603 ? 140.729 110.064 105.659 1.00 0.00 ? 1603 LEU B CA 3  
ATOM 5464   C CA . CYS B 1 1604 ? 137.531 110.097 107.785 1.00 0.00 ? 1604 CYS B CA 3  
ATOM 5465   C CA . LYS B 1 1605 ? 137.896 106.445 108.892 1.00 0.00 ? 1605 LYS B CA 3  
ATOM 5466   C CA . ILE B 1 1606 ? 141.527 107.171 109.879 1.00 0.00 ? 1606 ILE B CA 3  
ATOM 5467   C CA . MET B 1 1607 ? 140.754 109.937 112.245 1.00 0.00 ? 1607 MET B CA 3  
ATOM 5468   C CA . ALA B 1 1608 ? 137.674 108.381 113.776 1.00 0.00 ? 1608 ALA B CA 3  
ATOM 5469   C CA . GLN B 1 1609 ? 139.880 105.357 114.677 1.00 0.00 ? 1609 GLN B CA 3  
ATOM 5470   C CA . ILE B 1 1610 ? 142.399 107.715 116.392 1.00 0.00 ? 1610 ILE B CA 3  
ATOM 5471   C CA . LEU B 1 1611 ? 139.549 109.594 118.154 1.00 0.00 ? 1611 LEU B CA 3  
ATOM 5472   C CA . THR B 1 1612 ? 137.827 106.405 119.460 1.00 0.00 ? 1612 THR B CA 3  
ATOM 5473   C CA . VAL B 1 1613 ? 140.954 104.423 120.369 1.00 0.00 ? 1613 VAL B CA 3  
ATOM 5474   C CA . LYS B 1 1614 ? 141.254 103.144 123.977 1.00 0.00 ? 1614 LYS B CA 3  
ATOM 5475   C CA . VAL B 1 1615 ? 144.933 104.210 124.078 1.00 0.00 ? 1615 VAL B CA 3  
ATOM 5476   C CA . GLU B 1 1616 ? 144.561 107.940 124.817 1.00 0.00 ? 1616 GLU B CA 3  
ATOM 5477   C CA . GLY B 1 1617 ? 147.513 107.942 127.233 1.00 0.00 ? 1617 GLY B CA 3  
ATOM 5478   C CA . CYS B 1 1618 ? 149.566 106.138 129.861 1.00 0.00 ? 1618 CYS B CA 3  
ATOM 5479   C CA . PRO B 1 1619 ? 147.695 103.355 131.856 1.00 0.00 ? 1619 PRO B CA 3  
ATOM 5480   C CA . LYS B 1 1620 ? 146.519 105.398 134.904 1.00 0.00 ? 1620 LYS B CA 3  
ATOM 5481   C CA . HIS B 1 1621 ? 146.115 108.766 133.124 1.00 0.00 ? 1621 HIS B CA 3  
ATOM 5482   C CA . PRO B 1 1622 ? 144.493 108.576 129.625 1.00 0.00 ? 1622 PRO B CA 3  
ATOM 5483   C CA . LYS B 1 1623 ? 143.385 112.198 129.102 1.00 0.00 ? 1623 LYS B CA 3  
ATOM 5484   C CA . GLY B 1 1624 ? 143.420 112.799 125.302 1.00 0.00 ? 1624 GLY B CA 3  
ATOM 5485   C CA . ILE B 1 1625 ? 147.122 111.902 124.885 1.00 0.00 ? 1625 ILE B CA 3  
ATOM 5486   C CA . ILE B 1 1626 ? 148.232 110.331 121.574 1.00 0.00 ? 1626 ILE B CA 3  
ATOM 5487   C CA . SER B 1 1627 ? 151.529 108.444 121.976 1.00 0.00 ? 1627 SER B CA 3  
ATOM 5488   C CA . ARG B 1 1628 ? 152.997 108.452 118.416 1.00 0.00 ? 1628 ARG B CA 3  
ATOM 5489   C CA . ARG B 1 1629 ? 154.463 104.904 118.721 1.00 0.00 ? 1629 ARG B CA 3  
ATOM 5490   C CA . ASP B 1 1630 ? 151.159 103.239 119.139 1.00 0.00 ? 1630 ASP B CA 3  
ATOM 5491   C CA . VAL B 1 1631 ? 149.598 104.475 115.822 1.00 0.00 ? 1631 VAL B CA 3  
ATOM 5492   C CA . GLU B 1 1632 ? 150.381 101.140 114.071 1.00 0.00 ? 1632 GLU B CA 3  
ATOM 5493   C CA . LYS B 1 1633 ? 148.174 99.274  116.557 1.00 0.00 ? 1633 LYS B CA 3  
ATOM 5494   C CA . PHE B 1 1634 ? 145.309 101.849 116.516 1.00 0.00 ? 1634 PHE B CA 3  
ATOM 5495   C CA . LEU B 1 1635 ? 144.965 102.102 112.806 1.00 0.00 ? 1635 LEU B CA 3  
ATOM 5496   C CA . SER B 1 1636 ? 145.849 98.578  111.507 1.00 0.00 ? 1636 SER B CA 3  
ATOM 5497   C CA . LYS B 1 1637 ? 144.567 96.004  110.275 1.00 0.00 ? 1637 LYS B CA 3  
ATOM 5498   C CA . LYS B 1 1638 ? 140.964 97.450  110.203 1.00 0.00 ? 1638 LYS B CA 3  
ATOM 5499   C CA . ARG B 1 1639 ? 142.418 99.856  107.735 1.00 0.00 ? 1639 ARG B CA 3  
ATOM 5500   C CA . LYS B 1 1640 ? 145.872 99.661  106.179 1.00 0.00 ? 1640 LYS B CA 3  
ATOM 5501   C CA . PHE B 1 1641 ? 148.206 102.439 107.317 1.00 0.00 ? 1641 PHE B CA 3  
ATOM 5502   C CA . PRO B 1 1642 ? 151.938 102.127 106.703 1.00 0.00 ? 1642 PRO B CA 3  
ATOM 5503   C CA . LYS B 1 1643 ? 154.432 104.377 108.572 1.00 0.00 ? 1643 LYS B CA 3  
ATOM 5504   C CA . ASN B 1 1644 ? 154.617 107.306 106.070 1.00 0.00 ? 1644 ASN B CA 3  
ATOM 5505   C CA . TYR B 1 1645 ? 150.802 107.283 105.841 1.00 0.00 ? 1645 TYR B CA 3  
ATOM 5506   C CA . MET B 1 1646 ? 150.803 107.354 109.663 1.00 0.00 ? 1646 MET B CA 3  
ATOM 5507   C CA . SER B 1 1647 ? 152.955 110.525 109.825 1.00 0.00 ? 1647 SER B CA 3  
ATOM 5508   C CA . GLN B 1 1648 ? 150.697 112.327 107.284 1.00 0.00 ? 1648 GLN B CA 3  
ATOM 5509   C CA . TYR B 1 1649 ? 147.302 111.550 108.944 1.00 0.00 ? 1649 TYR B CA 3  
ATOM 5510   C CA . PHE B 1 1650 ? 148.636 113.319 112.048 1.00 0.00 ? 1650 PHE B CA 3  
ATOM 5511   C CA . LYS B 1 1651 ? 149.215 116.392 109.837 1.00 0.00 ? 1651 LYS B CA 3  
ATOM 5512   C CA . LEU B 1 1652 ? 145.580 116.036 108.673 1.00 0.00 ? 1652 LEU B CA 3  
ATOM 5513   C CA . LEU B 1 1653 ? 144.452 115.977 112.373 1.00 0.00 ? 1653 LEU B CA 3  
ATOM 5514   C CA . GLU B 1 1654 ? 146.498 119.163 112.986 1.00 0.00 ? 1654 GLU B CA 3  
ATOM 5515   C CA . LYS B 1 1655 ? 144.931 120.758 109.902 1.00 0.00 ? 1655 LYS B CA 3  
ATOM 5516   C CA . PHE B 1 1656 ? 141.381 119.644 110.922 1.00 0.00 ? 1656 PHE B CA 3  
ATOM 5517   C CA . GLN B 1 1657 ? 142.189 121.184 114.372 1.00 0.00 ? 1657 GLN B CA 3  
ATOM 5518   C CA . ILE B 1 1658 ? 141.593 117.925 116.244 1.00 0.00 ? 1658 ILE B CA 3  
ATOM 5519   C CA . ALA B 1 1659 ? 145.049 117.740 117.827 1.00 0.00 ? 1659 ALA B CA 3  
ATOM 5520   C CA . LEU B 1 1660 ? 148.292 119.667 118.448 1.00 0.00 ? 1660 LEU B CA 3  
ATOM 5521   C CA . PRO B 1 1661 ? 151.941 118.598 119.094 1.00 0.00 ? 1661 PRO B CA 3  
ATOM 5522   C CA . ILE B 1 1662 ? 153.661 119.346 122.449 1.00 0.00 ? 1662 ILE B CA 3  
ATOM 5523   C CA . GLY B 1 1663 ? 157.037 118.020 121.207 1.00 0.00 ? 1663 GLY B CA 3  
ATOM 5524   C CA . GLU B 1 1664 ? 157.776 114.701 122.980 1.00 0.00 ? 1664 GLU B CA 3  
ATOM 5525   C CA . GLU B 1 1665 ? 156.090 112.424 120.338 1.00 0.00 ? 1665 GLU B CA 3  
ATOM 5526   C CA . TYR B 1 1666 ? 152.926 112.957 122.405 1.00 0.00 ? 1666 TYR B CA 3  
ATOM 5527   C CA . LEU B 1 1667 ? 149.954 114.892 121.000 1.00 0.00 ? 1667 LEU B CA 3  
ATOM 5528   C CA . LEU B 1 1668 ? 146.935 116.404 122.752 1.00 0.00 ? 1668 LEU B CA 3  
ATOM 5529   C CA . VAL B 1 1669 ? 143.385 115.703 121.487 1.00 0.00 ? 1669 VAL B CA 3  
ATOM 5530   C CA . ILE B 1 1690 ? 135.144 150.865 117.345 1.00 0.00 ? 1690 ILE B CA 3  
ATOM 5531   C CA . ILE B 1 1691 ? 137.905 149.641 114.924 1.00 0.00 ? 1691 ILE B CA 3  
ATOM 5532   C CA . ILE B 1 1692 ? 137.115 146.081 113.848 1.00 0.00 ? 1692 ILE B CA 3  
ATOM 5533   C CA . ARG B 1 1693 ? 139.535 143.970 111.780 1.00 0.00 ? 1693 ARG B CA 3  
ATOM 5534   C CA . LEU B 1 1694 ? 138.817 140.319 110.862 1.00 0.00 ? 1694 LEU B CA 3  
ATOM 5535   C CA . TYR B 1 1695 ? 141.287 137.614 109.661 1.00 0.00 ? 1695 TYR B CA 3  
ATOM 5536   C CA . GLU B 1 1696 ? 139.876 134.576 107.720 1.00 0.00 ? 1696 GLU B CA 3  
ATOM 5537   C CA . MET B 1 1697 ? 141.960 131.357 107.865 1.00 0.00 ? 1697 MET B CA 3  
ATOM 5538   C CA . PRO B 1 1698 ? 141.039 128.146 105.760 1.00 0.00 ? 1698 PRO B CA 3  
ATOM 5539   C CA . TYR B 1 1699 ? 142.406 126.348 108.741 1.00 0.00 ? 1699 TYR B CA 3  
ATOM 5540   C CA . PHE B 1 1700 ? 142.540 128.178 112.114 1.00 0.00 ? 1700 PHE B CA 3  
ATOM 5541   C CA . PRO B 1 1701 ? 145.184 126.432 114.364 1.00 0.00 ? 1701 PRO B CA 3  
ATOM 5542   C CA . MET B 1 1702 ? 143.815 125.915 117.886 1.00 0.00 ? 1702 MET B CA 3  
ATOM 5543   C CA . GLY B 1 1703 ? 147.213 127.029 119.195 1.00 0.00 ? 1703 GLY B CA 3  
ATOM 5544   C CA . PHE B 1 1704 ? 146.873 130.616 117.821 1.00 0.00 ? 1704 PHE B CA 3  
ATOM 5545   C CA . TRP B 1 1705 ? 144.872 132.089 120.704 1.00 0.00 ? 1705 TRP B CA 3  
ATOM 5546   C CA . SER B 1 1706 ? 146.775 130.186 123.340 1.00 0.00 ? 1706 SER B CA 3  
ATOM 5547   C CA . ARG B 1 1707 ? 150.082 131.458 121.932 1.00 0.00 ? 1707 ARG B CA 3  
ATOM 5548   C CA . LEU B 1 1708 ? 148.853 135.033 121.401 1.00 0.00 ? 1708 LEU B CA 3  
ATOM 5549   C CA . ILE B 1 1709 ? 147.612 135.034 125.036 1.00 0.00 ? 1709 ILE B CA 3  
ATOM 5550   C CA . ASN B 1 1710 ? 151.211 134.110 126.028 1.00 0.00 ? 1710 ASN B CA 3  
ATOM 5551   C CA . ARG B 1 1711 ? 152.820 136.836 123.826 1.00 0.00 ? 1711 ARG B CA 3  
ATOM 5552   C CA . LEU B 1 1712 ? 150.364 139.371 125.297 1.00 0.00 ? 1712 LEU B CA 3  
ATOM 5553   C CA . LEU B 1 1713 ? 150.146 138.129 128.963 1.00 0.00 ? 1713 LEU B CA 3  
ATOM 5554   C CA . GLU B 1 1714 ? 151.176 141.488 130.421 1.00 0.00 ? 1714 GLU B CA 3  
ATOM 5555   C CA . ILE B 1 1715 ? 148.243 143.432 128.876 1.00 0.00 ? 1715 ILE B CA 3  
ATOM 5556   C CA . SER B 1 1716 ? 145.371 141.064 129.826 1.00 0.00 ? 1716 SER B CA 3  
ATOM 5557   C CA . PRO B 1 1717 ? 144.724 142.421 133.376 1.00 0.00 ? 1717 PRO B CA 3  
ATOM 5558   C CA . TYR B 1 1718 ? 145.840 145.870 132.207 1.00 0.00 ? 1718 TYR B CA 3  
ATOM 5559   C CA . MET B 1 1719 ? 149.088 147.677 131.522 1.00 0.00 ? 1719 MET B CA 3  
ATOM 5560   C CA . LEU B 1 1720 ? 147.837 151.231 132.384 1.00 0.00 ? 1720 LEU B CA 3  
ATOM 5561   C CA . SER B 1 1721 ? 146.985 152.316 135.901 1.00 0.00 ? 1721 SER B CA 3  
ATOM 5562   C CA . GLY B 1 1722 ? 144.219 154.352 134.116 1.00 0.00 ? 1722 GLY B CA 3  
ATOM 5563   C CA . ARG B 1 1723 ? 141.532 151.721 133.881 1.00 0.00 ? 1723 ARG B CA 3  
ATOM 5564   C CA . GLU B 1 1724 ? 137.961 152.779 133.037 1.00 0.00 ? 1724 GLU B CA 3  
ATOM 5565   C CA . ARG B 1 1725 ? 136.170 149.471 132.454 1.00 0.00 ? 1725 ARG B CA 3  
ATOM 5566   C CA . ALA B 1 1726 ? 136.195 146.758 135.148 1.00 0.00 ? 1726 ALA B CA 3  
ATOM 5567   C CA . LEU B 1 1727 ? 134.870 144.012 132.850 1.00 0.00 ? 1727 LEU B CA 3  
ATOM 5568   C CA . ARG B 1 1728 ? 137.157 143.854 129.800 1.00 0.00 ? 1728 ARG B CA 3  
ATOM 5569   C CA . PRO B 1 1729 ? 140.685 143.508 131.378 1.00 0.00 ? 1729 PRO B CA 3  
ATOM 5570   C CA . ASN B 1 1730 ? 141.052 141.682 134.838 1.00 0.00 ? 1730 ASN B CA 3  
ATOM 5571   C CA . ARG B 1 1731 ? 141.763 138.019 134.028 1.00 0.00 ? 1731 ARG B CA 3  
ATOM 5572   C CA . MET B 1 1732 ? 139.337 138.304 131.192 1.00 0.00 ? 1732 MET B CA 3  
ATOM 5573   C CA . TYR B 1 1733 ? 140.692 135.674 129.027 1.00 0.00 ? 1733 TYR B CA 3  
ATOM 5574   C CA . TRP B 1 1734 ? 138.948 132.586 127.854 1.00 0.00 ? 1734 TRP B CA 3  
ATOM 5575   C CA . ARG B 1 1735 ? 139.496 129.660 125.475 1.00 0.00 ? 1735 ARG B CA 3  
ATOM 5576   C CA . GLN B 1 1736 ? 138.402 131.713 122.416 1.00 0.00 ? 1736 GLN B CA 3  
ATOM 5577   C CA . GLY B 1 1737 ? 139.721 135.199 123.315 1.00 0.00 ? 1737 GLY B CA 3  
ATOM 5578   C CA . ILE B 1 1738 ? 141.138 137.930 125.517 1.00 0.00 ? 1738 ILE B CA 3  
ATOM 5579   C CA . TYR B 1 1739 ? 140.736 141.604 126.429 1.00 0.00 ? 1739 TYR B CA 3  
ATOM 5580   C CA . LEU B 1 1740 ? 143.865 143.679 126.181 1.00 0.00 ? 1740 LEU B CA 3  
ATOM 5581   C CA . ASN B 1 1741 ? 144.634 147.121 127.666 1.00 0.00 ? 1741 ASN B CA 3  
ATOM 5582   C CA . TRP B 1 1742 ? 147.887 149.079 127.152 1.00 0.00 ? 1742 TRP B CA 3  
ATOM 5583   C CA . SER B 1 1743 ? 149.495 152.302 128.367 1.00 0.00 ? 1743 SER B CA 3  
ATOM 5584   C CA . PRO B 1 1744 ? 148.949 155.059 127.176 1.00 0.00 ? 1744 PRO B CA 3  
ATOM 5585   C CA . GLU B 1 1745 ? 146.293 156.097 126.103 1.00 0.00 ? 1745 GLU B CA 3  
ATOM 5586   C CA . ALA B 1 1746 ? 144.171 153.319 127.770 1.00 0.00 ? 1746 ALA B CA 3  
ATOM 5587   C CA . TYR B 1 1747 ? 143.004 151.660 124.630 1.00 0.00 ? 1747 TYR B CA 3  
ATOM 5588   C CA . CYS B 1 1748 ? 140.964 148.444 125.155 1.00 0.00 ? 1748 CYS B CA 3  
ATOM 5589   C CA . LEU B 1 1749 ? 141.178 145.623 122.567 1.00 0.00 ? 1749 LEU B CA 3  
ATOM 5590   C CA . VAL B 1 1750 ? 139.097 142.454 122.371 1.00 0.00 ? 1750 VAL B CA 3  
ATOM 5591   C CA . GLY B 1 1751 ? 140.523 139.596 120.402 1.00 0.00 ? 1751 GLY B CA 3  
ATOM 5592   C CA . SER B 1 1752 ? 138.081 136.758 119.706 1.00 0.00 ? 1752 SER B CA 3  
ATOM 5593   C CA . GLU B 1 1753 ? 138.795 134.102 117.054 1.00 0.00 ? 1753 GLU B CA 3  
ATOM 5594   C CA . VAL B 1 1754 ? 140.113 136.097 114.174 1.00 0.00 ? 1754 VAL B CA 3  
ATOM 5595   C CA . LEU B 1 1755 ? 138.164 139.213 115.204 1.00 0.00 ? 1755 LEU B CA 3  
ATOM 5596   C CA . ASP B 1 1756 ? 139.975 142.209 116.716 1.00 0.00 ? 1756 ASP B CA 3  
ATOM 5597   C CA . ASN B 1 1757 ? 137.697 145.036 118.004 1.00 0.00 ? 1757 ASN B CA 3  
ATOM 5598   C CA . HIS B 1 1758 ? 139.211 148.214 119.470 1.00 0.00 ? 1758 HIS B CA 3  
ATOM 5599   C CA . PRO B 1 1759 ? 137.894 151.413 121.375 1.00 0.00 ? 1759 PRO B CA 3  
ATOM 5600   C CA . GLU B 1 1760 ? 140.153 154.598 121.905 1.00 0.00 ? 1760 GLU B CA 3  
ATOM 5601   C CA . SER B 1 1761 ? 141.760 157.322 119.715 1.00 0.00 ? 1761 SER B CA 3  
ATOM 5602   C CA . PHE B 1 1762 ? 145.124 155.382 119.500 1.00 0.00 ? 1762 PHE B CA 3  
ATOM 5603   C CA . LEU B 1 1763 ? 143.374 152.556 117.673 1.00 0.00 ? 1763 LEU B CA 3  
ATOM 5604   C CA . LYS B 1 1764 ? 145.455 152.385 114.625 1.00 0.00 ? 1764 LYS B CA 3  
ATOM 5605   C CA . ILE B 1 1765 ? 148.851 151.852 116.366 1.00 0.00 ? 1765 ILE B CA 3  
ATOM 5606   C CA . THR B 1 1766 ? 147.431 149.185 118.697 1.00 0.00 ? 1766 THR B CA 3  
ATOM 5607   C CA . VAL B 1 1767 ? 146.043 147.044 115.922 1.00 0.00 ? 1767 VAL B CA 3  
ATOM 5608   C CA . PRO B 1 1768 ? 149.548 146.502 114.166 1.00 0.00 ? 1768 PRO B CA 3  
ATOM 5609   C CA . SER B 1 1769 ? 151.172 145.414 117.359 1.00 0.00 ? 1769 SER B CA 3  
ATOM 5610   C CA . CYS B 1 1770 ? 148.353 142.846 117.838 1.00 0.00 ? 1770 CYS B CA 3  
ATOM 5611   C CA . ARG B 1 1771 ? 148.292 142.156 114.035 1.00 0.00 ? 1771 ARG B CA 3  
ATOM 5612   C CA . LYS B 1 1772 ? 152.078 141.701 114.014 1.00 0.00 ? 1772 LYS B CA 3  
ATOM 5613   C CA . GLY B 1 1773 ? 151.975 139.255 116.969 1.00 0.00 ? 1773 GLY B CA 3  
ATOM 5614   C CA . CYS B 1 1774 ? 149.280 137.252 115.174 1.00 0.00 ? 1774 CYS B CA 3  
ATOM 5615   C CA . ILE B 1 1775 ? 151.283 137.268 111.890 1.00 0.00 ? 1775 ILE B CA 3  
ATOM 5616   C CA . LEU B 1 1776 ? 154.402 136.106 113.832 1.00 0.00 ? 1776 LEU B CA 3  
ATOM 5617   C CA . LEU B 1 1777 ? 152.478 133.081 115.164 1.00 0.00 ? 1777 LEU B CA 3  
ATOM 5618   C CA . GLY B 1 1778 ? 151.044 132.372 111.704 1.00 0.00 ? 1778 GLY B CA 3  
ATOM 5619   C CA . GLN B 1 1779 ? 154.581 132.101 110.264 1.00 0.00 ? 1779 GLN B CA 3  
ATOM 5620   C CA . VAL B 1 1780 ? 155.245 128.983 112.446 1.00 0.00 ? 1780 VAL B CA 3  
ATOM 5621   C CA . VAL B 1 1781 ? 152.664 127.129 110.293 1.00 0.00 ? 1781 VAL B CA 3  
ATOM 5622   C CA . ASP B 1 1782 ? 153.632 126.316 106.667 1.00 0.00 ? 1782 ASP B CA 3  
ATOM 5623   C CA . HIS B 1 1783 ? 151.030 127.048 103.902 1.00 0.00 ? 1783 HIS B CA 3  
ATOM 5624   C CA . ILE B 1 1784 ? 148.582 128.994 106.169 1.00 0.00 ? 1784 ILE B CA 3  
ATOM 5625   C CA . ASP B 1 1785 ? 146.288 131.311 104.136 1.00 0.00 ? 1785 ASP B CA 3  
ATOM 5626   C CA . SER B 1 1786 ? 144.914 134.418 105.899 1.00 0.00 ? 1786 SER B CA 3  
ATOM 5627   C CA . LEU B 1 1787 ? 142.480 136.842 104.244 1.00 0.00 ? 1787 LEU B CA 3  
ATOM 5628   C CA . MET B 1 1788 ? 141.960 140.138 106.049 1.00 0.00 ? 1788 MET B CA 3  
ATOM 5629   C CA . GLU B 1 1789 ? 138.574 141.875 106.173 1.00 0.00 ? 1789 GLU B CA 3  
ATOM 5630   C CA . GLU B 1 1790 ? 137.023 145.100 107.358 1.00 0.00 ? 1790 GLU B CA 3  
ATOM 5631   C CA . TRP B 1 1791 ? 133.368 145.566 108.239 1.00 0.00 ? 1791 TRP B CA 3  
ATOM 5632   C CA . PHE B 1 1792 ? 131.421 148.152 106.250 1.00 0.00 ? 1792 PHE B CA 3  
ATOM 5633   C CA . PRO B 1 1793 ? 130.483 151.417 108.218 1.00 0.00 ? 1793 PRO B CA 3  
ATOM 5634   C CA . GLY B 1 1794 ? 126.901 151.049 109.455 1.00 0.00 ? 1794 GLY B CA 3  
ATOM 5635   C CA . LEU B 1 1795 ? 126.768 147.372 108.425 1.00 0.00 ? 1795 LEU B CA 3  
ATOM 5636   C CA . LEU B 1 1796 ? 128.743 145.215 110.907 1.00 0.00 ? 1796 LEU B CA 3  
ATOM 5637   C CA . GLU B 1 1797 ? 128.104 141.871 109.116 1.00 0.00 ? 1797 GLU B CA 3  
ATOM 5638   C CA . ILE B 1 1798 ? 129.010 143.107 105.581 1.00 0.00 ? 1798 ILE B CA 3  
ATOM 5639   C CA . ASP B 1 1799 ? 132.747 142.682 105.019 1.00 0.00 ? 1799 ASP B CA 3  
ATOM 5640   C CA . ILE B 1 1800 ? 135.158 144.037 102.403 1.00 0.00 ? 1800 ILE B CA 3  
ATOM 5641   C CA . CYS B 1 1801 ? 138.564 142.457 101.789 1.00 0.00 ? 1801 CYS B CA 3  
ATOM 5642   C CA . GLY B 1 1802 ? 141.523 144.757 102.723 1.00 0.00 ? 1802 GLY B CA 3  
ATOM 5643   C CA . GLU B 1 1803 ? 143.330 143.539 99.593  1.00 0.00 ? 1803 GLU B CA 3  
ATOM 5644   C CA . GLY B 1 1804 ? 140.280 144.806 97.624  1.00 0.00 ? 1804 GLY B CA 3  
ATOM 5645   C CA . GLU B 1 1805 ? 140.552 148.354 99.039  1.00 0.00 ? 1805 GLU B CA 3  
ATOM 5646   C CA . THR B 1 1806 ? 144.364 148.532 98.513  1.00 0.00 ? 1806 THR B CA 3  
ATOM 5647   C CA . LEU B 1 1807 ? 143.817 147.371 94.904  1.00 0.00 ? 1807 LEU B CA 3  
ATOM 5648   C CA . LEU B 1 1808 ? 141.123 150.042 94.432  1.00 0.00 ? 1808 LEU B CA 3  
ATOM 5649   C CA . LYS B 1 1809 ? 143.648 152.693 95.672  1.00 0.00 ? 1809 LYS B CA 3  
ATOM 5650   C CA . LYS B 1 1810 ? 146.356 151.425 93.269  1.00 0.00 ? 1810 LYS B CA 3  
ATOM 5651   C CA . TRP B 1 1811 ? 143.749 151.668 90.478  1.00 0.00 ? 1811 TRP B CA 3  
ATOM 5652   C CA . ALA B 1 1812 ? 143.150 155.315 91.517  1.00 0.00 ? 1812 ALA B CA 3  
ATOM 5653   C CA . LEU B 1 1813 ? 139.538 154.713 92.629  1.00 0.00 ? 1813 LEU B CA 3  
ATOM 5654   C CA . TYR B 1 1814 ? 138.060 156.137 95.828  1.00 0.00 ? 1814 TYR B CA 3  
ATOM 5655   C CA . SER B 1 1815 ? 134.615 154.509 95.566  1.00 0.00 ? 1815 SER B CA 3  
ATOM 5656   C CA . PHE B 1 1816 ? 133.855 151.065 96.834  1.00 0.00 ? 1816 PHE B CA 3  
ATOM 5657   C CA . ASN B 1 1817 ? 130.313 150.302 95.623  1.00 0.00 ? 1817 ASN B CA 3  
ATOM 5658   C CA . ASP B 1 1818 ? 128.153 147.848 97.524  1.00 0.00 ? 1818 ASP B CA 3  
ATOM 5659   C CA . GLY B 1 1819 ? 125.636 146.533 94.954  1.00 0.00 ? 1819 GLY B CA 3  
ATOM 5660   C CA . GLU B 1 1820 ? 123.510 144.423 97.337  1.00 0.00 ? 1820 GLU B CA 3  
ATOM 5661   C CA . GLU B 1 1821 ? 123.225 147.269 99.889  1.00 0.00 ? 1821 GLU B CA 3  
ATOM 5662   C CA . HIS B 1 1822 ? 123.015 149.971 97.156  1.00 0.00 ? 1822 HIS B CA 3  
ATOM 5663   C CA . GLN B 1 1823 ? 125.403 152.267 99.094  1.00 0.00 ? 1823 GLN B CA 3  
ATOM 5664   C CA . LYS B 1 1824 ? 128.864 153.605 98.140  1.00 0.00 ? 1824 LYS B CA 3  
ATOM 5665   C CA . ILE B 1 1825 ? 131.749 154.102 100.553 1.00 0.00 ? 1825 ILE B CA 3  
ATOM 5666   C CA . LEU B 1 1826 ? 134.967 156.046 100.605 1.00 0.00 ? 1826 LEU B CA 3  
ATOM 5667   C CA . LEU B 1 1827 ? 137.870 153.649 100.165 1.00 0.00 ? 1827 LEU B CA 3  
ATOM 5668   C CA . ASP B 1 1828 ? 140.420 156.014 101.686 1.00 0.00 ? 1828 ASP B CA 3  
ATOM 5669   C CA . ASP B 1 1829 ? 138.243 156.909 104.713 1.00 0.00 ? 1829 ASP B CA 3  
ATOM 5670   C CA . LEU B 1 1830 ? 137.773 153.255 105.792 1.00 0.00 ? 1830 LEU B CA 3  
ATOM 5671   C CA . MET B 1 1831 ? 141.397 152.363 104.875 1.00 0.00 ? 1831 MET B CA 3  
ATOM 5672   C CA . LYS B 1 1832 ? 143.018 155.266 106.831 1.00 0.00 ? 1832 LYS B CA 3  
ATOM 5673   C CA . LYS B 1 1833 ? 141.015 154.490 110.019 1.00 0.00 ? 1833 LYS B CA 3  
ATOM 5674   C CA . ALA B 1 1834 ? 143.587 151.787 110.743 1.00 0.00 ? 1834 ALA B CA 3  
ATOM 5675   C CA . GLU B 1 1835 ? 147.448 151.797 110.635 1.00 0.00 ? 1835 GLU B CA 3  
ATOM 5676   C CA . GLU B 1 1836 ? 147.548 151.228 106.868 1.00 0.00 ? 1836 GLU B CA 3  
ATOM 5677   C CA . GLY B 1 1837 ? 147.694 154.953 106.002 1.00 0.00 ? 1837 GLY B CA 3  
ATOM 5678   C CA . PHE B 1 1883 ? 169.965 160.647 83.029  1.00 0.00 ? 1883 PHE B CA 3  
ATOM 5679   C CA . LEU B 1 1884 ? 167.029 158.143 83.122  1.00 0.00 ? 1884 LEU B CA 3  
ATOM 5680   C CA . LEU B 1 1885 ? 167.526 154.447 82.078  1.00 0.00 ? 1885 LEU B CA 3  
ATOM 5681   C CA . GLY B 1 1886 ? 164.523 152.917 83.892  1.00 0.00 ? 1886 GLY B CA 3  
ATOM 5682   C CA . ASP B 1 1887 ? 163.185 149.463 83.073  1.00 0.00 ? 1887 ASP B CA 3  
ATOM 5683   C CA . GLY B 1 1888 ? 162.228 149.039 86.806  1.00 0.00 ? 1888 GLY B CA 3  
ATOM 5684   C CA . SER B 1 1889 ? 159.856 146.676 88.666  1.00 0.00 ? 1889 SER B CA 3  
ATOM 5685   C CA . PHE B 1 1890 ? 158.451 149.300 91.061  1.00 0.00 ? 1890 PHE B CA 3  
ATOM 5686   C CA . GLY B 1 1891 ? 159.800 152.574 89.657  1.00 0.00 ? 1891 GLY B CA 3  
ATOM 5687   C CA . SER B 1 1892 ? 162.325 154.458 87.552  1.00 0.00 ? 1892 SER B CA 3  
ATOM 5688   C CA . VAL B 1 1893 ? 166.092 153.767 87.373  1.00 0.00 ? 1893 VAL B CA 3  
ATOM 5689   C CA . TYR B 1 1894 ? 168.483 156.738 86.977  1.00 0.00 ? 1894 TYR B CA 3  
ATOM 5690   C CA . ARG B 1 1895 ? 172.195 157.078 86.274  1.00 0.00 ? 1895 ARG B CA 3  
ATOM 5691   C CA . ALA B 1 1896 ? 174.016 159.644 88.412  1.00 0.00 ? 1896 ALA B CA 3  
ATOM 5692   C CA . ALA B 1 1897 ? 177.124 160.127 90.572  1.00 0.00 ? 1897 ALA B CA 3  
ATOM 5693   C CA . TYR B 1 1898 ? 177.982 160.552 94.295  1.00 0.00 ? 1898 TYR B CA 3  
ATOM 5694   C CA . GLU B 1 1899 ? 179.262 164.161 94.692  1.00 0.00 ? 1899 GLU B CA 3  
ATOM 5695   C CA . GLY B 1 1900 ? 182.083 163.213 97.144  1.00 0.00 ? 1900 GLY B CA 3  
ATOM 5696   C CA . GLU B 1 1901 ? 183.743 160.373 95.141  1.00 0.00 ? 1901 GLU B CA 3  
ATOM 5697   C CA . GLU B 1 1902 ? 182.616 160.887 91.503  1.00 0.00 ? 1902 GLU B CA 3  
ATOM 5698   C CA . VAL B 1 1903 ? 181.591 157.138 91.775  1.00 0.00 ? 1903 VAL B CA 3  
ATOM 5699   C CA . ALA B 1 1904 ? 179.018 156.338 89.101  1.00 0.00 ? 1904 ALA B CA 3  
ATOM 5700   C CA . VAL B 1 1905 ? 175.765 155.283 90.609  1.00 0.00 ? 1905 VAL B CA 3  
ATOM 5701   C CA . LYS B 1 1906 ? 172.412 153.687 89.739  1.00 0.00 ? 1906 LYS B CA 3  
ATOM 5702   C CA . ILE B 1 1907 ? 169.315 155.042 91.561  1.00 0.00 ? 1907 ILE B CA 3  
ATOM 5703   C CA . PHE B 1 1908 ? 166.094 153.029 91.801  1.00 0.00 ? 1908 PHE B CA 3  
ATOM 5704   C CA . ASN B 1 1909 ? 163.054 155.012 93.048  1.00 0.00 ? 1909 ASN B CA 3  
ATOM 5705   C CA . LYS B 1 1910 ? 159.274 155.146 93.783  1.00 0.00 ? 1910 LYS B CA 3  
ATOM 5706   C CA . HIS B 1 1911 ? 159.498 151.986 95.698  1.00 0.00 ? 1911 HIS B CA 3  
ATOM 5707   C CA . THR B 1 1912 ? 158.970 153.397 99.226  1.00 0.00 ? 1912 THR B CA 3  
ATOM 5708   C CA . SER B 1 1913 ? 155.805 151.670 100.365 1.00 0.00 ? 1913 SER B CA 3  
ATOM 5709   C CA . LEU B 1 1914 ? 156.440 148.290 98.761  1.00 0.00 ? 1914 LEU B CA 3  
ATOM 5710   C CA . ARG B 1 1915 ? 157.143 145.012 100.540 1.00 0.00 ? 1915 ARG B CA 3  
ATOM 5711   C CA . LEU B 1 1916 ? 159.537 143.992 97.693  1.00 0.00 ? 1916 LEU B CA 3  
ATOM 5712   C CA . LEU B 1 1917 ? 161.729 147.181 98.106  1.00 0.00 ? 1917 LEU B CA 3  
ATOM 5713   C CA . ARG B 1 1918 ? 161.849 146.648 101.807 1.00 0.00 ? 1918 ARG B CA 3  
ATOM 5714   C CA . GLN B 1 1919 ? 163.069 143.096 101.354 1.00 0.00 ? 1919 GLN B CA 3  
ATOM 5715   C CA . GLU B 1 1920 ? 165.627 144.240 98.744  1.00 0.00 ? 1920 GLU B CA 3  
ATOM 5716   C CA . LEU B 1 1921 ? 167.000 146.932 101.133 1.00 0.00 ? 1921 LEU B CA 3  
ATOM 5717   C CA . VAL B 1 1922 ? 167.082 144.472 104.097 1.00 0.00 ? 1922 VAL B CA 3  
ATOM 5718   C CA . VAL B 1 1923 ? 168.860 141.712 102.069 1.00 0.00 ? 1923 VAL B CA 3  
ATOM 5719   C CA . LEU B 1 1924 ? 171.406 144.097 100.460 1.00 0.00 ? 1924 LEU B CA 3  
ATOM 5720   C CA . CYS B 1 1925 ? 172.307 145.862 103.774 1.00 0.00 ? 1925 CYS B CA 3  
ATOM 5721   C CA . HIS B 1 1926 ? 174.385 142.876 105.016 1.00 0.00 ? 1926 HIS B CA 3  
ATOM 5722   C CA . LEU B 1 1927 ? 175.964 141.899 101.642 1.00 0.00 ? 1927 LEU B CA 3  
ATOM 5723   C CA . HIS B 1 1928 ? 179.479 143.174 100.842 1.00 0.00 ? 1928 HIS B CA 3  
ATOM 5724   C CA . HIS B 1 1929 ? 181.270 141.071 98.188  1.00 0.00 ? 1929 HIS B CA 3  
ATOM 5725   C CA . PRO B 1 1930 ? 182.950 142.035 94.851  1.00 0.00 ? 1930 PRO B CA 3  
ATOM 5726   C CA . SER B 1 1931 ? 180.700 139.810 92.707  1.00 0.00 ? 1931 SER B CA 3  
ATOM 5727   C CA . LEU B 1 1932 ? 177.453 141.154 94.222  1.00 0.00 ? 1932 LEU B CA 3  
ATOM 5728   C CA . ILE B 1 1933 ? 175.957 144.545 93.255  1.00 0.00 ? 1933 ILE B CA 3  
ATOM 5729   C CA . SER B 1 1934 ? 176.761 146.832 96.199  1.00 0.00 ? 1934 SER B CA 3  
ATOM 5730   C CA . LEU B 1 1935 ? 174.183 149.010 97.915  1.00 0.00 ? 1935 LEU B CA 3  
ATOM 5731   C CA . LEU B 1 1936 ? 175.747 152.403 98.686  1.00 0.00 ? 1936 LEU B CA 3  
ATOM 5732   C CA . ALA B 1 1937 ? 172.930 154.187 100.509 1.00 0.00 ? 1937 ALA B CA 3  
ATOM 5733   C CA . ALA B 1 1938 ? 169.215 154.925 100.881 1.00 0.00 ? 1938 ALA B CA 3  
ATOM 5734   C CA . GLY B 1 1939 ? 167.382 158.163 99.940  1.00 0.00 ? 1939 GLY B CA 3  
ATOM 5735   C CA . ILE B 1 1940 ? 163.943 159.489 100.986 1.00 0.00 ? 1940 ILE B CA 3  
ATOM 5736   C CA . ARG B 1 1941 ? 161.204 161.579 99.283  1.00 0.00 ? 1941 ARG B CA 3  
ATOM 5737   C CA . PRO B 1 1942 ? 160.812 159.403 97.243  1.00 0.00 ? 1942 PRO B CA 3  
ATOM 5738   C CA . ARG B 1 1943 ? 162.555 156.347 98.727  1.00 0.00 ? 1943 ARG B CA 3  
ATOM 5739   C CA . MET B 1 1944 ? 165.648 155.438 96.677  1.00 0.00 ? 1944 MET B CA 3  
ATOM 5740   C CA . LEU B 1 1945 ? 168.167 152.621 96.666  1.00 0.00 ? 1945 LEU B CA 3  
ATOM 5741   C CA . VAL B 1 1946 ? 171.498 153.956 95.465  1.00 0.00 ? 1946 VAL B CA 3  
ATOM 5742   C CA . MET B 1 1947 ? 173.490 151.060 93.931  1.00 0.00 ? 1947 MET B CA 3  
ATOM 5743   C CA . GLU B 1 1948 ? 176.908 150.819 92.206  1.00 0.00 ? 1948 GLU B CA 3  
ATOM 5744   C CA . LEU B 1 1949 ? 176.622 151.374 88.429  1.00 0.00 ? 1949 LEU B CA 3  
ATOM 5745   C CA . ALA B 1 1950 ? 177.634 148.293 86.427  1.00 0.00 ? 1950 ALA B CA 3  
ATOM 5746   C CA . SER B 1 1951 ? 178.690 149.554 83.015  1.00 0.00 ? 1951 SER B CA 3  
ATOM 5747   C CA . LYS B 1 1952 ? 178.529 146.767 80.388  1.00 0.00 ? 1952 LYS B CA 3  
ATOM 5748   C CA . GLY B 1 1953 ? 174.856 145.757 80.700  1.00 0.00 ? 1953 GLY B CA 3  
ATOM 5749   C CA . SER B 1 1954 ? 173.558 142.281 81.554  1.00 0.00 ? 1954 SER B CA 3  
ATOM 5750   C CA . LEU B 1 1955 ? 174.576 138.726 80.597  1.00 0.00 ? 1955 LEU B CA 3  
ATOM 5751   C CA . ASP B 1 1956 ? 171.258 137.951 78.818  1.00 0.00 ? 1956 ASP B CA 3  
ATOM 5752   C CA . ARG B 1 1957 ? 171.539 140.860 76.324  1.00 0.00 ? 1957 ARG B CA 3  
ATOM 5753   C CA . LEU B 1 1958 ? 175.237 140.201 75.672  1.00 0.00 ? 1958 LEU B CA 3  
ATOM 5754   C CA . LEU B 1 1959 ? 174.628 136.493 74.902  1.00 0.00 ? 1959 LEU B CA 3  
ATOM 5755   C CA . GLN B 1 1960 ? 172.052 137.574 72.244  1.00 0.00 ? 1960 GLN B CA 3  
ATOM 5756   C CA . GLN B 1 1961 ? 175.016 138.928 70.166  1.00 0.00 ? 1961 GLN B CA 3  
ATOM 5757   C CA . ASP B 1 1962 ? 175.721 135.646 68.228  1.00 0.00 ? 1962 ASP B CA 3  
ATOM 5758   C CA . LYS B 1 1963 ? 178.090 137.420 65.754  1.00 0.00 ? 1963 LYS B CA 3  
ATOM 5759   C CA . ALA B 1 1964 ? 180.484 138.334 68.602  1.00 0.00 ? 1964 ALA B CA 3  
ATOM 5760   C CA . SER B 1 1965 ? 180.809 135.181 70.720  1.00 0.00 ? 1965 SER B CA 3  
ATOM 5761   C CA . LEU B 1 1966 ? 182.385 135.475 74.181  1.00 0.00 ? 1966 LEU B CA 3  
ATOM 5762   C CA . THR B 1 1967 ? 185.875 133.957 74.164  1.00 0.00 ? 1967 THR B CA 3  
ATOM 5763   C CA . ARG B 1 1968 ? 186.386 130.845 76.306  1.00 0.00 ? 1968 ARG B CA 3  
ATOM 5764   C CA . THR B 1 1969 ? 188.787 132.445 78.866  1.00 0.00 ? 1969 THR B CA 3  
ATOM 5765   C CA . LEU B 1 1970 ? 186.201 135.140 79.520  1.00 0.00 ? 1970 LEU B CA 3  
ATOM 5766   C CA . GLN B 1 1971 ? 183.330 132.573 79.770  1.00 0.00 ? 1971 GLN B CA 3  
ATOM 5767   C CA . HIS B 1 1972 ? 185.363 130.866 82.545  1.00 0.00 ? 1972 HIS B CA 3  
ATOM 5768   C CA . ARG B 1 1973 ? 185.845 134.239 84.316  1.00 0.00 ? 1973 ARG B CA 3  
ATOM 5769   C CA . ILE B 1 1974 ? 182.031 134.848 84.165  1.00 0.00 ? 1974 ILE B CA 3  
ATOM 5770   C CA . ALA B 1 1975 ? 181.290 131.328 85.521  1.00 0.00 ? 1975 ALA B CA 3  
ATOM 5771   C CA . LEU B 1 1976 ? 183.704 131.725 88.484  1.00 0.00 ? 1976 LEU B CA 3  
ATOM 5772   C CA . HIS B 1 1977 ? 182.541 135.285 89.385  1.00 0.00 ? 1977 HIS B CA 3  
ATOM 5773   C CA . VAL B 1 1978 ? 178.894 134.231 89.594  1.00 0.00 ? 1978 VAL B CA 3  
ATOM 5774   C CA . ALA B 1 1979 ? 179.987 131.123 91.569  1.00 0.00 ? 1979 ALA B CA 3  
ATOM 5775   C CA . ASP B 1 1980 ? 181.935 133.249 94.127  1.00 0.00 ? 1980 ASP B CA 3  
ATOM 5776   C CA . GLY B 1 1981 ? 178.937 135.599 94.607  1.00 0.00 ? 1981 GLY B CA 3  
ATOM 5777   C CA . LEU B 1 1982 ? 176.653 132.595 95.210  1.00 0.00 ? 1982 LEU B CA 3  
ATOM 5778   C CA . ARG B 1 1983 ? 179.392 131.063 97.452  1.00 0.00 ? 1983 ARG B CA 3  
ATOM 5779   C CA . TYR B 1 1984 ? 179.491 134.268 99.560  1.00 0.00 ? 1984 TYR B CA 3  
ATOM 5780   C CA . LEU B 1 1985 ? 175.707 133.946 99.601  1.00 0.00 ? 1985 LEU B CA 3  
ATOM 5781   C CA . HIS B 1 1986 ? 175.973 130.356 100.855 1.00 0.00 ? 1986 HIS B CA 3  
ATOM 5782   C CA . SER B 1 1987 ? 177.969 131.716 103.863 1.00 0.00 ? 1987 SER B CA 3  
ATOM 5783   C CA . ALA B 1 1988 ? 175.201 134.197 104.777 1.00 0.00 ? 1988 ALA B CA 3  
ATOM 5784   C CA . MET B 1 1989 ? 172.346 131.601 104.286 1.00 0.00 ? 1989 MET B CA 3  
ATOM 5785   C CA . ILE B 1 1990 ? 170.399 133.744 101.771 1.00 0.00 ? 1990 ILE B CA 3  
ATOM 5786   C CA . ILE B 1 1991 ? 168.259 132.358 98.874  1.00 0.00 ? 1991 ILE B CA 3  
ATOM 5787   C CA . TYR B 1 1992 ? 168.090 134.625 95.780  1.00 0.00 ? 1992 TYR B CA 3  
ATOM 5788   C CA . ARG B 1 1993 ? 165.270 132.842 93.839  1.00 0.00 ? 1993 ARG B CA 3  
ATOM 5789   C CA . ASP B 1 1994 ? 165.535 134.927 90.624  1.00 0.00 ? 1994 ASP B CA 3  
ATOM 5790   C CA . LEU B 1 1995 ? 168.929 133.755 89.312  1.00 0.00 ? 1995 LEU B CA 3  
ATOM 5791   C CA . LYS B 1 1996 ? 168.730 134.090 85.510  1.00 0.00 ? 1996 LYS B CA 3  
ATOM 5792   C CA . PRO B 1 1997 ? 171.069 135.869 83.026  1.00 0.00 ? 1997 PRO B CA 3  
ATOM 5793   C CA . HIS B 1 1998 ? 169.100 139.167 83.021  1.00 0.00 ? 1998 HIS B CA 3  
ATOM 5794   C CA . ASN B 1 1999 ? 170.037 139.515 86.717  1.00 0.00 ? 1999 ASN B CA 3  
ATOM 5795   C CA . VAL B 1 2000 ? 173.765 138.964 86.065  1.00 0.00 ? 2000 VAL B CA 3  
ATOM 5796   C CA . LEU B 1 2001 ? 175.322 142.401 85.502  1.00 0.00 ? 2001 LEU B CA 3  
ATOM 5797   C CA . LEU B 1 2002 ? 178.551 142.779 83.618  1.00 0.00 ? 2002 LEU B CA 3  
ATOM 5798   C CA . PHE B 1 2003 ? 181.267 145.018 85.016  1.00 0.00 ? 2003 PHE B CA 3  
ATOM 5799   C CA . THR B 1 2004 ? 183.974 144.216 82.467  1.00 0.00 ? 2004 THR B CA 3  
ATOM 5800   C CA . LEU B 1 2005 ? 184.539 141.670 79.604  1.00 0.00 ? 2005 LEU B CA 3  
ATOM 5801   C CA . TYR B 1 2006 ? 188.378 141.910 79.564  1.00 0.00 ? 2006 TYR B CA 3  
ATOM 5802   C CA . PRO B 1 2007 ? 189.637 138.529 80.941  1.00 0.00 ? 2007 PRO B CA 3  
ATOM 5803   C CA . ASN B 1 2008 ? 192.262 140.165 83.244  1.00 0.00 ? 2008 ASN B CA 3  
ATOM 5804   C CA . ALA B 1 2009 ? 189.735 142.530 84.913  1.00 0.00 ? 2009 ALA B CA 3  
ATOM 5805   C CA . ALA B 1 2010 ? 189.376 142.493 88.712  1.00 0.00 ? 2010 ALA B CA 3  
ATOM 5806   C CA . ILE B 1 2011 ? 185.613 141.879 88.364  1.00 0.00 ? 2011 ILE B CA 3  
ATOM 5807   C CA . ILE B 1 2012 ? 183.685 140.668 85.267  1.00 0.00 ? 2012 ILE B CA 3  
ATOM 5808   C CA . ALA B 1 2013 ? 180.263 139.748 86.591  1.00 0.00 ? 2013 ALA B CA 3  
ATOM 5809   C CA . LYS B 1 2014 ? 178.098 140.666 89.544  1.00 0.00 ? 2014 LYS B CA 3  
ATOM 5810   C CA . ILE B 1 2015 ? 174.825 139.142 90.793  1.00 0.00 ? 2015 ILE B CA 3  
ATOM 5811   C CA . ALA B 1 2016 ? 171.945 141.673 90.990  1.00 0.00 ? 2016 ALA B CA 3  
ATOM 5812   C CA . ASP B 1 2017 ? 168.196 142.080 91.623  1.00 0.00 ? 2017 ASP B CA 3  
ATOM 5813   C CA . TYR B 1 2018 ? 167.540 140.541 95.019  1.00 0.00 ? 2018 TYR B CA 3  
ATOM 5814   C CA . GLY B 1 2019 ? 163.919 141.725 95.270  1.00 0.00 ? 2019 GLY B CA 3  
ATOM 5815   C CA . THR B 1 2020 ? 162.529 138.240 95.788  1.00 0.00 ? 2020 THR B CA 3  
ATOM 5816   C CA . ALA B 1 2021 ? 165.293 136.924 98.134  1.00 0.00 ? 2021 ALA B CA 3  
ATOM 5817   C CA . GLN B 1 2022 ? 164.868 135.044 101.469 1.00 0.00 ? 2022 GLN B CA 3  
ATOM 5818   C CA . TYR B 1 2023 ? 167.100 134.755 104.523 1.00 0.00 ? 2023 TYR B CA 3  
ATOM 5819   C CA . CYS B 1 2024 ? 165.370 132.625 107.133 1.00 0.00 ? 2024 CYS B CA 3  
ATOM 5820   C CA . CYS B 1 2025 ? 166.239 130.124 109.899 1.00 0.00 ? 2025 CYS B CA 3  
ATOM 5821   C CA . ARG B 1 2026 ? 163.041 128.270 108.961 1.00 0.00 ? 2026 ARG B CA 3  
ATOM 5822   C CA . MET B 1 2027 ? 162.079 126.430 105.785 1.00 0.00 ? 2027 MET B CA 3  
ATOM 5823   C CA . GLY B 1 2028 ? 161.561 128.628 102.669 1.00 0.00 ? 2028 GLY B CA 3  
ATOM 5824   C CA . ILE B 1 2029 ? 158.569 128.276 100.295 1.00 0.00 ? 2029 ILE B CA 3  
ATOM 5825   C CA . LYS B 1 2030 ? 157.282 129.968 97.042  1.00 0.00 ? 2030 LYS B CA 3  
ATOM 5826   C CA . THR B 1 2031 ? 154.839 129.642 93.994  1.00 0.00 ? 2031 THR B CA 3  
ATOM 5827   C CA . SER B 1 2032 ? 155.262 132.954 92.283  1.00 0.00 ? 2032 SER B CA 3  
ATOM 5828   C CA . GLU B 1 2033 ? 158.716 132.762 90.686  1.00 0.00 ? 2033 GLU B CA 3  
ATOM 5829   C CA . GLY B 1 2034 ? 156.815 131.335 87.705  1.00 0.00 ? 2034 GLY B CA 3  
ATOM 5830   C CA . THR B 1 2035 ? 159.743 131.446 85.169  1.00 0.00 ? 2035 THR B CA 3  
ATOM 5831   C CA . PRO B 1 2036 ? 160.448 127.701 85.372  1.00 0.00 ? 2036 PRO B CA 3  
ATOM 5832   C CA . GLY B 1 2037 ? 163.128 127.378 82.631  1.00 0.00 ? 2037 GLY B CA 3  
ATOM 5833   C CA . PHE B 1 2038 ? 165.590 128.734 85.225  1.00 0.00 ? 2038 PHE B CA 3  
ATOM 5834   C CA . ARG B 1 2039 ? 163.923 127.482 88.451  1.00 0.00 ? 2039 ARG B CA 3  
ATOM 5835   C CA . ALA B 1 2040 ? 164.343 124.293 90.484  1.00 0.00 ? 2040 ALA B CA 3  
ATOM 5836   C CA . PRO B 1 2041 ? 161.654 121.498 90.202  1.00 0.00 ? 2041 PRO B CA 3  
ATOM 5837   C CA . GLU B 1 2042 ? 159.991 122.520 93.523  1.00 0.00 ? 2042 GLU B CA 3  
ATOM 5838   C CA . VAL B 1 2043 ? 158.055 125.017 91.264  1.00 0.00 ? 2043 VAL B CA 3  
ATOM 5839   C CA . ALA B 1 2044 ? 155.220 122.501 91.332  1.00 0.00 ? 2044 ALA B CA 3  
ATOM 5840   C CA . ARG B 1 2045 ? 153.112 124.488 93.945  1.00 0.00 ? 2045 ARG B CA 3  
ATOM 5841   C CA . GLY B 1 2046 ? 153.163 126.549 97.287  1.00 0.00 ? 2046 GLY B CA 3  
ATOM 5842   C CA . ASN B 1 2047 ? 152.816 123.539 99.483  1.00 0.00 ? 2047 ASN B CA 3  
ATOM 5843   C CA . VAL B 1 2048 ? 156.502 122.436 99.214  1.00 0.00 ? 2048 VAL B CA 3  
ATOM 5844   C CA . ILE B 1 2049 ? 159.574 123.703 101.052 1.00 0.00 ? 2049 ILE B CA 3  
ATOM 5845   C CA . TYR B 1 2050 ? 163.073 124.270 99.741  1.00 0.00 ? 2050 TYR B CA 3  
ATOM 5846   C CA . ASN B 1 2051 ? 166.508 125.811 100.503 1.00 0.00 ? 2051 ASN B CA 3  
ATOM 5847   C CA . GLN B 1 2052 ? 169.558 127.557 98.866  1.00 0.00 ? 2052 GLN B CA 3  
ATOM 5848   C CA . GLN B 1 2053 ? 169.845 124.396 96.766  1.00 0.00 ? 2053 GLN B CA 3  
ATOM 5849   C CA . ALA B 1 2054 ? 167.150 126.007 94.560  1.00 0.00 ? 2054 ALA B CA 3  
ATOM 5850   C CA . ASP B 1 2055 ? 169.684 128.760 93.607  1.00 0.00 ? 2055 ASP B CA 3  
ATOM 5851   C CA . VAL B 1 2056 ? 172.308 126.012 92.954  1.00 0.00 ? 2056 VAL B CA 3  
ATOM 5852   C CA . TYR B 1 2057 ? 169.895 124.675 90.283  1.00 0.00 ? 2057 TYR B CA 3  
ATOM 5853   C CA . SER B 1 2058 ? 169.430 128.222 88.838  1.00 0.00 ? 2058 SER B CA 3  
ATOM 5854   C CA . PHE B 1 2059 ? 173.267 128.486 88.699  1.00 0.00 ? 2059 PHE B CA 3  
ATOM 5855   C CA . GLY B 1 2060 ? 173.504 125.273 86.554  1.00 0.00 ? 2060 GLY B CA 3  
ATOM 5856   C CA . LEU B 1 2061 ? 171.212 126.964 84.026  1.00 0.00 ? 2061 LEU B CA 3  
ATOM 5857   C CA . LEU B 1 2062 ? 173.476 130.088 84.148  1.00 0.00 ? 2062 LEU B CA 3  
ATOM 5858   C CA . LEU B 1 2063 ? 176.483 127.848 83.345  1.00 0.00 ? 2063 LEU B CA 3  
ATOM 5859   C CA . TYR B 1 2064 ? 174.540 126.230 80.446  1.00 0.00 ? 2064 TYR B CA 3  
ATOM 5860   C CA . ASP B 1 2065 ? 173.550 129.658 78.978  1.00 0.00 ? 2065 ASP B CA 3  
ATOM 5861   C CA . ILE B 1 2066 ? 177.215 130.942 79.232  1.00 0.00 ? 2066 ILE B CA 3  
ATOM 5862   C CA . LEU B 1 2067 ? 178.616 127.691 77.724  1.00 0.00 ? 2067 LEU B CA 3  
ATOM 5863   C CA . THR B 1 2068 ? 176.169 127.573 74.814  1.00 0.00 ? 2068 THR B CA 3  
ATOM 5864   C CA . THR B 1 2069 ? 175.044 131.215 74.212  1.00 0.00 ? 2069 THR B CA 3  
ATOM 5865   C CA . GLY B 1 2070 ? 171.484 129.731 74.146  1.00 0.00 ? 2070 GLY B CA 3  
ATOM 5866   C CA . GLY B 1 2071 ? 168.464 129.967 76.490  1.00 0.00 ? 2071 GLY B CA 3  
ATOM 5867   C CA . ARG B 1 2072 ? 164.831 128.825 76.768  1.00 0.00 ? 2072 ARG B CA 3  
ATOM 5868   C CA . ILE B 1 2073 ? 161.779 129.990 78.824  1.00 0.00 ? 2073 ILE B CA 3  
ATOM 5869   C CA . VAL B 1 2074 ? 158.876 127.550 79.043  1.00 0.00 ? 2074 VAL B CA 3  
ATOM 5870   C CA . GLU B 1 2075 ? 155.417 127.816 80.719  1.00 0.00 ? 2075 GLU B CA 3  
ATOM 5871   C CA . GLY B 1 2076 ? 152.470 125.351 81.041  1.00 0.00 ? 2076 GLY B CA 3  
ATOM 5872   C CA . LEU B 1 2077 ? 151.656 121.922 82.523  1.00 0.00 ? 2077 LEU B CA 3  
ATOM 5873   C CA . LYS B 1 2078 ? 153.429 119.298 80.380  1.00 0.00 ? 2078 LYS B CA 3  
ATOM 5874   C CA . PHE B 1 2079 ? 156.769 121.205 80.603  1.00 0.00 ? 2079 PHE B CA 3  
ATOM 5875   C CA . PRO B 1 2080 ? 156.778 121.400 84.509  1.00 0.00 ? 2080 PRO B CA 3  
ATOM 5876   C CA . ASN B 1 2081 ? 155.748 117.690 84.708  1.00 0.00 ? 2081 ASN B CA 3  
ATOM 5877   C CA . GLU B 1 2082 ? 158.626 116.853 82.344  1.00 0.00 ? 2082 GLU B CA 3  
ATOM 5878   C CA . PHE B 1 2083 ? 161.124 118.932 84.364  1.00 0.00 ? 2083 PHE B CA 3  
ATOM 5879   C CA . ASP B 1 2084 ? 159.865 117.678 87.797  1.00 0.00 ? 2084 ASP B CA 3  
ATOM 5880   C CA . GLU B 1 2085 ? 159.034 113.955 87.133  1.00 0.00 ? 2085 GLU B CA 3  
ATOM 5881   C CA . LEU B 1 2086 ? 160.933 112.992 83.910  1.00 0.00 ? 2086 LEU B CA 3  
ATOM 5882   C CA . GLU B 1 2087 ? 164.332 114.660 84.674  1.00 0.00 ? 2087 GLU B CA 3  
ATOM 5883   C CA . ILE B 1 2088 ? 164.194 116.983 81.581  1.00 0.00 ? 2088 ILE B CA 3  
ATOM 5884   C CA . GLN B 1 2089 ? 167.058 119.468 81.568  1.00 0.00 ? 2089 GLN B CA 3  
ATOM 5885   C CA . GLY B 1 2090 ? 168.962 121.381 78.880  1.00 0.00 ? 2090 GLY B CA 3  
ATOM 5886   C CA . LYS B 1 2091 ? 171.776 118.791 78.902  1.00 0.00 ? 2091 LYS B CA 3  
ATOM 5887   C CA . LEU B 1 2092 ? 169.483 115.704 78.774  1.00 0.00 ? 2092 LEU B CA 3  
ATOM 5888   C CA . PRO B 1 2093 ? 167.319 116.802 75.738  1.00 0.00 ? 2093 PRO B CA 3  
ATOM 5889   C CA . ASP B 1 2094 ? 170.401 117.759 73.689  1.00 0.00 ? 2094 ASP B CA 3  
ATOM 5890   C CA . PRO B 1 2095 ? 173.320 115.217 74.311  1.00 0.00 ? 2095 PRO B CA 3  
ATOM 5891   C CA . VAL B 1 2096 ? 174.733 115.993 70.823  1.00 0.00 ? 2096 VAL B CA 3  
ATOM 5892   C CA . LYS B 1 2097 ? 174.760 119.800 71.349  1.00 0.00 ? 2097 LYS B CA 3  
ATOM 5893   C CA . GLU B 1 2098 ? 176.907 119.532 74.461  1.00 0.00 ? 2098 GLU B CA 3  
ATOM 5894   C CA . TYR B 1 2099 ? 178.603 116.006 74.487  1.00 0.00 ? 2099 TYR B CA 3  
ATOM 5895   C CA . GLY B 1 2100 ? 179.292 115.984 70.668  1.00 0.00 ? 2100 GLY B CA 3  
ATOM 5896   C CA . CYS B 1 2101 ? 181.218 119.285 70.927  1.00 0.00 ? 2101 CYS B CA 3  
ATOM 5897   C CA . ALA B 1 2102 ? 183.201 117.831 73.875  1.00 0.00 ? 2102 ALA B CA 3  
ATOM 5898   C CA . PRO B 1 2103 ? 182.658 120.521 76.650  1.00 0.00 ? 2103 PRO B CA 3  
ATOM 5899   C CA . TRP B 1 2104 ? 185.260 119.916 79.426  1.00 0.00 ? 2104 TRP B CA 3  
ATOM 5900   C CA . PRO B 1 2105 ? 184.141 116.804 81.435  1.00 0.00 ? 2105 PRO B CA 3  
ATOM 5901   C CA . MET B 1 2106 ? 184.592 118.643 84.772  1.00 0.00 ? 2106 MET B CA 3  
ATOM 5902   C CA . VAL B 1 2107 ? 182.237 121.472 83.562  1.00 0.00 ? 2107 VAL B CA 3  
ATOM 5903   C CA . GLU B 1 2108 ? 179.757 118.816 82.393  1.00 0.00 ? 2108 GLU B CA 3  
ATOM 5904   C CA . LYS B 1 2109 ? 179.875 117.023 85.791  1.00 0.00 ? 2109 LYS B CA 3  
ATOM 5905   C CA . LEU B 1 2110 ? 179.321 120.306 87.655  1.00 0.00 ? 2110 LEU B CA 3  
ATOM 5906   C CA . ILE B 1 2111 ? 176.263 121.329 85.525  1.00 0.00 ? 2111 ILE B CA 3  
ATOM 5907   C CA . LYS B 1 2112 ? 174.751 117.815 85.944  1.00 0.00 ? 2112 LYS B CA 3  
ATOM 5908   C CA . GLN B 1 2113 ? 175.278 117.764 89.732  1.00 0.00 ? 2113 GLN B CA 3  
ATOM 5909   C CA . CYS B 1 2114 ? 173.972 121.367 90.114  1.00 0.00 ? 2114 CYS B CA 3  
ATOM 5910   C CA . LEU B 1 2115 ? 170.770 120.516 88.161  1.00 0.00 ? 2115 LEU B CA 3  
ATOM 5911   C CA . LYS B 1 2116 ? 169.991 117.311 90.105  1.00 0.00 ? 2116 LYS B CA 3  
ATOM 5912   C CA . GLU B 1 2117 ? 166.282 116.682 90.783  1.00 0.00 ? 2117 GLU B CA 3  
ATOM 5913   C CA . ASN B 1 2118 ? 167.178 115.742 94.356  1.00 0.00 ? 2118 ASN B CA 3  
ATOM 5914   C CA . PRO B 1 2119 ? 168.312 119.040 96.081  1.00 0.00 ? 2119 PRO B CA 3  
ATOM 5915   C CA . GLN B 1 2120 ? 170.732 117.158 98.394  1.00 0.00 ? 2120 GLN B CA 3  
ATOM 5916   C CA . GLU B 1 2121 ? 172.888 115.908 95.476  1.00 0.00 ? 2121 GLU B CA 3  
ATOM 5917   C CA . ARG B 1 2122 ? 173.547 119.456 94.242  1.00 0.00 ? 2122 ARG B CA 3  
ATOM 5918   C CA . PRO B 1 2123 ? 177.079 120.422 95.455  1.00 0.00 ? 2123 PRO B CA 3  
ATOM 5919   C CA . THR B 1 2124 ? 178.331 122.902 98.060  1.00 0.00 ? 2124 THR B CA 3  
ATOM 5920   C CA . SER B 1 2125 ? 179.748 126.031 96.361  1.00 0.00 ? 2125 SER B CA 3  
ATOM 5921   C CA . ALA B 1 2126 ? 183.273 125.299 97.634  1.00 0.00 ? 2126 ALA B CA 3  
ATOM 5922   C CA . GLN B 1 2127 ? 183.275 122.161 95.397  1.00 0.00 ? 2127 GLN B CA 3  
ATOM 5923   C CA . VAL B 1 2128 ? 181.763 124.238 92.544  1.00 0.00 ? 2128 VAL B CA 3  
ATOM 5924   C CA . PHE B 1 2129 ? 184.480 126.938 92.840  1.00 0.00 ? 2129 PHE B CA 3  
ATOM 5925   C CA . ASP B 1 2130 ? 187.338 124.348 93.023  1.00 0.00 ? 2130 ASP B CA 3  
ATOM 5926   C CA . ILE B 1 2131 ? 186.016 122.532 89.893  1.00 0.00 ? 2131 ILE B CA 3  
ATOM 5927   C CA . LEU B 1 2132 ? 185.511 125.790 87.865  1.00 0.00 ? 2132 LEU B CA 3  
ATOM 5928   C CA . ASN B 1 2133 ? 189.049 126.935 88.805  1.00 0.00 ? 2133 ASN B CA 3  
ATOM 5929   C CA . SER B 1 2134 ? 190.503 123.730 87.199  1.00 0.00 ? 2134 SER B CA 3  
ATOM 5930   C CA . ALA B 1 2135 ? 189.042 124.436 83.688  1.00 0.00 ? 2135 ALA B CA 3  
ATOM 5931   C CA . ARG B 1 2142 ? 180.001 108.488 87.548  1.00 0.00 ? 2142 ARG B CA 3  
ATOM 5932   C CA . ARG B 1 2143 ? 179.875 104.769 88.299  1.00 0.00 ? 2143 ARG B CA 3  
ATOM 5933   C CA . ILE B 1 2144 ? 181.339 102.193 85.904  1.00 0.00 ? 2144 ILE B CA 3  
ATOM 5934   C CA . LEU B 1 2145 ? 180.154 98.639  86.541  1.00 0.00 ? 2145 LEU B CA 3  
ATOM 5935   C CA . LEU B 1 2146 ? 182.690 95.903  85.894  1.00 0.00 ? 2146 LEU B CA 3  
ATOM 5936   C CA . PRO B 1 2147 ? 181.551 92.584  84.392  1.00 0.00 ? 2147 PRO B CA 3  
ATOM 5937   C CA . LYS B 1 2148 ? 179.682 90.405  86.855  1.00 0.00 ? 2148 LYS B CA 3  
ATOM 5938   C CA . ASN B 1 2149 ? 181.825 88.467  89.394  1.00 0.00 ? 2149 ASN B CA 3  
ATOM 5939   C CA . VAL B 1 2150 ? 185.037 90.300  88.412  1.00 0.00 ? 2150 VAL B CA 3  
ATOM 5940   C CA . ILE B 1 2151 ? 187.045 90.826  91.608  1.00 0.00 ? 2151 ILE B CA 3  
ATOM 5941   C CA . VAL B 1 2152 ? 189.797 93.459  91.556  1.00 0.00 ? 2152 VAL B CA 3  
ATOM 5942   C CA . GLU B 1 2153 ? 192.930 92.866  93.622  1.00 0.00 ? 2153 GLU B CA 3  
ATOM 5943   C CA . CYS B 1 2154 ? 194.921 95.866  92.394  1.00 0.00 ? 2154 CYS B CA 3  
ATOM 5944   C CA . MET B 1 2155 ? 194.554 98.838  90.097  1.00 0.00 ? 2155 MET B CA 3  
ATOM 5945   C CA . VAL B 1 2156 ? 196.709 101.442 88.312  1.00 0.00 ? 2156 VAL B CA 3  
ATOM 5946   C CA . ALA B 1 2157 ? 195.546 104.392 86.216  1.00 0.00 ? 2157 ALA B CA 3  
ATOM 5947   C CA . THR B 1 2158 ? 196.782 105.888 82.949  1.00 0.00 ? 2158 THR B CA 3  
ATOM 5948   C CA . ASN B 1 2164 ? 190.469 108.047 76.548  1.00 0.00 ? 2164 ASN B CA 3  
ATOM 5949   C CA . ALA B 1 2165 ? 191.709 107.478 80.080  1.00 0.00 ? 2165 ALA B CA 3  
ATOM 5950   C CA . SER B 1 2166 ? 191.935 103.860 81.159  1.00 0.00 ? 2166 SER B CA 3  
ATOM 5951   C CA . ILE B 1 2167 ? 192.954 101.570 83.999  1.00 0.00 ? 2167 ILE B CA 3  
ATOM 5952   C CA . TRP B 1 2168 ? 194.864 98.303  84.440  1.00 0.00 ? 2168 TRP B CA 3  
ATOM 5953   C CA . LEU B 1 2169 ? 193.323 95.793  86.855  1.00 0.00 ? 2169 LEU B CA 3  
ATOM 5954   C CA . GLY B 1 2170 ? 194.685 92.698  88.564  1.00 0.00 ? 2170 GLY B CA 3  
ATOM 5955   C CA . CYS B 1 2171 ? 191.999 90.070  89.038  1.00 0.00 ? 2171 CYS B CA 3  
ATOM 5956   C CA . GLY B 1 2172 ? 191.203 88.153  92.219  1.00 0.00 ? 2172 GLY B CA 3  
ATOM 5957   C CA . HIS B 1 2173 ? 188.442 85.871  90.956  1.00 0.00 ? 2173 HIS B CA 3  
ATOM 5958   C CA . THR B 1 2174 ? 191.054 83.492  89.504  1.00 0.00 ? 2174 THR B CA 3  
ATOM 5959   C CA . ASP B 1 2175 ? 194.015 81.494  90.782  1.00 0.00 ? 2175 ASP B CA 3  
ATOM 5960   C CA . ARG B 1 2176 ? 196.169 82.416  87.756  1.00 0.00 ? 2176 ARG B CA 3  
ATOM 5961   C CA . GLY B 1 2177 ? 197.530 85.722  86.491  1.00 0.00 ? 2177 GLY B CA 3  
ATOM 5962   C CA . GLN B 1 2178 ? 194.846 87.640  84.586  1.00 0.00 ? 2178 GLN B CA 3  
ATOM 5963   C CA . LEU B 1 2179 ? 195.495 91.240  83.512  1.00 0.00 ? 2179 LEU B CA 3  
ATOM 5964   C CA . SER B 1 2180 ? 192.441 93.367  82.694  1.00 0.00 ? 2180 SER B CA 3  
ATOM 5965   C CA . PHE B 1 2181 ? 192.016 96.710  80.940  1.00 0.00 ? 2181 PHE B CA 3  
ATOM 5966   C CA . LEU B 1 2182 ? 189.192 99.236  81.353  1.00 0.00 ? 2182 LEU B CA 3  
ATOM 5967   C CA . ASP B 1 2183 ? 188.574 102.224 79.070  1.00 0.00 ? 2183 ASP B CA 3  
ATOM 5968   C CA . LEU B 1 2184 ? 187.172 104.837 81.460  1.00 0.00 ? 2184 LEU B CA 3  
ATOM 5969   C CA . ASN B 1 2185 ? 185.475 106.618 78.525  1.00 0.00 ? 2185 ASN B CA 3  
ATOM 5970   C CA . THR B 1 2186 ? 183.775 103.692 76.754  1.00 0.00 ? 2186 THR B CA 3  
ATOM 5971   C CA . GLU B 1 2187 ? 183.518 101.461 79.868  1.00 0.00 ? 2187 GLU B CA 3  
ATOM 5972   C CA . GLY B 1 2188 ? 184.902 98.648  77.708  1.00 0.00 ? 2188 GLY B CA 3  
ATOM 5973   C CA . TYR B 1 2189 ? 186.588 95.774  79.526  1.00 0.00 ? 2189 TYR B CA 3  
ATOM 5974   C CA . THR B 1 2190 ? 189.146 93.294  78.186  1.00 0.00 ? 2190 THR B CA 3  
ATOM 5975   C CA . SER B 1 2191 ? 191.317 90.768  80.006  1.00 0.00 ? 2191 SER B CA 3  
ATOM 5976   C CA . GLU B 1 2192 ? 194.145 88.346  79.253  1.00 0.00 ? 2192 GLU B CA 3  
ATOM 5977   C CA . GLU B 1 2193 ? 195.591 85.453  81.261  1.00 0.00 ? 2193 GLU B CA 3  
ATOM 5978   C CA . VAL B 1 2194 ? 199.232 86.493  81.482  1.00 0.00 ? 2194 VAL B CA 3  
ATOM 5979   C CA . ALA B 1 2195 ? 200.865 84.606  84.390  1.00 0.00 ? 2195 ALA B CA 3  
ATOM 5980   C CA . ASP B 1 2196 ? 200.681 81.394  86.422  1.00 0.00 ? 2196 ASP B CA 3  
ATOM 5981   C CA . SER B 1 2197 ? 199.633 82.896  89.782  1.00 0.00 ? 2197 SER B CA 3  
ATOM 5982   C CA . ARG B 1 2198 ? 197.253 85.632  90.892  1.00 0.00 ? 2198 ARG B CA 3  
ATOM 5983   C CA . ILE B 1 2199 ? 198.368 89.169  90.072  1.00 0.00 ? 2199 ILE B CA 3  
ATOM 5984   C CA . LEU B 1 2200 ? 198.726 90.863  93.460  1.00 0.00 ? 2200 LEU B CA 3  
ATOM 5985   C CA . CYS B 1 2201 ? 199.936 94.347  92.518  1.00 0.00 ? 2201 CYS B CA 3  
ATOM 5986   C CA . LEU B 1 2202 ? 200.519 96.597  89.511  1.00 0.00 ? 2202 LEU B CA 3  
ATOM 5987   C CA . ALA B 1 2203 ? 202.950 99.407  88.734  1.00 0.00 ? 2203 ALA B CA 3  
ATOM 5988   C CA . LEU B 1 2204 ? 203.334 101.508 85.587  1.00 0.00 ? 2204 LEU B CA 3  
ATOM 5989   C CA . VAL B 1 2205 ? 206.944 102.302 84.657  1.00 0.00 ? 2205 VAL B CA 3  
ATOM 5990   C CA . HIS B 1 2206 ? 207.161 105.130 82.116  1.00 0.00 ? 2206 HIS B CA 3  
ATOM 5991   C CA . LEU B 1 2207 ? 210.388 105.852 80.242  1.00 0.00 ? 2207 LEU B CA 3  
ATOM 5992   C CA . PRO B 1 2208 ? 210.216 109.411 78.821  1.00 0.00 ? 2208 PRO B CA 3  
ATOM 5993   C CA . VAL B 1 2209 ? 213.324 108.944 76.767  1.00 0.00 ? 2209 VAL B CA 3  
ATOM 5994   C CA . GLU B 1 2210 ? 212.844 105.829 74.601  1.00 0.00 ? 2210 GLU B CA 3  
ATOM 5995   C CA . LYS B 1 2211 ? 209.117 106.729 74.737  1.00 0.00 ? 2211 LYS B CA 3  
ATOM 5996   C CA . GLU B 1 2212 ? 207.964 103.484 76.300  1.00 0.00 ? 2212 GLU B CA 3  
ATOM 5997   C CA . SER B 1 2213 ? 205.530 102.449 79.034  1.00 0.00 ? 2213 SER B CA 3  
ATOM 5998   C CA . TRP B 1 2214 ? 205.695 99.048  80.733  1.00 0.00 ? 2214 TRP B CA 3  
ATOM 5999   C CA . ILE B 1 2215 ? 203.049 97.546  83.014  1.00 0.00 ? 2215 ILE B CA 3  
ATOM 6000   C CA . VAL B 1 2216 ? 204.588 95.488  85.830  1.00 0.00 ? 2216 VAL B CA 3  
ATOM 6001   C CA . SER B 1 2217 ? 202.560 92.739  87.514  1.00 0.00 ? 2217 SER B CA 3  
ATOM 6002   C CA . GLY B 1 2218 ? 203.607 91.285  90.862  1.00 0.00 ? 2218 GLY B CA 3  
ATOM 6003   C CA . THR B 1 2219 ? 202.187 87.839  91.543  1.00 0.00 ? 2219 THR B CA 3  
ATOM 6004   C CA . GLN B 1 2220 ? 201.482 85.335  94.317  1.00 0.00 ? 2220 GLN B CA 3  
ATOM 6005   C CA . SER B 1 2221 ? 204.488 83.215  93.266  1.00 0.00 ? 2221 SER B CA 3  
ATOM 6006   C CA . GLY B 1 2222 ? 207.049 86.045  93.291  1.00 0.00 ? 2222 GLY B CA 3  
ATOM 6007   C CA . THR B 1 2223 ? 207.155 86.595  89.527  1.00 0.00 ? 2223 THR B CA 3  
ATOM 6008   C CA . LEU B 1 2224 ? 207.551 90.132  88.163  1.00 0.00 ? 2224 LEU B CA 3  
ATOM 6009   C CA . LEU B 1 2225 ? 205.950 90.129  84.709  1.00 0.00 ? 2225 LEU B CA 3  
ATOM 6010   C CA . VAL B 1 2226 ? 206.737 93.174  82.546  1.00 0.00 ? 2226 VAL B CA 3  
ATOM 6011   C CA . ILE B 1 2227 ? 204.494 93.800  79.527  1.00 0.00 ? 2227 ILE B CA 3  
ATOM 6012   C CA . ASN B 1 2228 ? 204.666 96.576  76.934  1.00 0.00 ? 2228 ASN B CA 3  
ATOM 6013   C CA . THR B 1 2229 ? 201.673 98.908  76.776  1.00 0.00 ? 2229 THR B CA 3  
ATOM 6014   C CA . GLU B 1 2230 ? 201.694 99.368  72.995  1.00 0.00 ? 2230 GLU B CA 3  
ATOM 6015   C CA . ASP B 1 2231 ? 202.756 95.867  71.853  1.00 0.00 ? 2231 ASP B CA 3  
ATOM 6016   C CA . GLY B 1 2232 ? 201.593 93.055  74.137  1.00 0.00 ? 2232 GLY B CA 3  
ATOM 6017   C CA . LYS B 1 2233 ? 203.935 90.682  72.295  1.00 0.00 ? 2233 LYS B CA 3  
ATOM 6018   C CA . LYS B 1 2234 ? 206.779 92.487  74.119  1.00 0.00 ? 2234 LYS B CA 3  
ATOM 6019   C CA . ARG B 1 2235 ? 206.885 90.884  77.559  1.00 0.00 ? 2235 ARG B CA 3  
ATOM 6020   C CA . HIS B 1 2236 ? 209.479 89.337  79.850  1.00 0.00 ? 2236 HIS B CA 3  
ATOM 6021   C CA . THR B 1 2237 ? 210.222 88.529  83.491  1.00 0.00 ? 2237 THR B CA 3  
ATOM 6022   C CA . LEU B 1 2238 ? 212.549 90.131  86.037  1.00 0.00 ? 2238 LEU B CA 3  
ATOM 6023   C CA . GLU B 1 2239 ? 214.315 88.226  88.821  1.00 0.00 ? 2239 GLU B CA 3  
ATOM 6024   C CA . LYS B 1 2240 ? 211.953 85.941  90.714  1.00 0.00 ? 2240 LYS B CA 3  
ATOM 6025   C CA . MET B 1 2241 ? 211.182 86.995  94.279  1.00 0.00 ? 2241 MET B CA 3  
ATOM 6026   C CA . THR B 1 2242 ? 211.596 84.566  97.167  1.00 0.00 ? 2242 THR B CA 3  
ATOM 6027   C CA . ASP B 1 2243 ? 207.972 85.181  98.221  1.00 0.00 ? 2243 ASP B CA 3  
ATOM 6028   C CA . SER B 1 2244 ? 204.833 86.727  96.755  1.00 0.00 ? 2244 SER B CA 3  
ATOM 6029   C CA . VAL B 1 2245 ? 205.007 90.323  95.541  1.00 0.00 ? 2245 VAL B CA 3  
ATOM 6030   C CA . THR B 1 2246 ? 202.786 92.382  97.842  1.00 0.00 ? 2246 THR B CA 3  
ATOM 6031   C CA . CYS B 1 2247 ? 203.814 95.932  96.887  1.00 0.00 ? 2247 CYS B CA 3  
ATOM 6032   C CA . LEU B 1 2248 ? 204.805 97.859  93.751  1.00 0.00 ? 2248 LEU B CA 3  
ATOM 6033   C CA . TYR B 1 2249 ? 205.656 101.562 93.854  1.00 0.00 ? 2249 TYR B CA 3  
ATOM 6034   C CA . CYS B 1 2250 ? 207.345 103.873 91.341  1.00 0.00 ? 2250 CYS B CA 3  
ATOM 6035   C CA . ASN B 1 2251 ? 209.695 106.376 92.971  1.00 0.00 ? 2251 ASN B CA 3  
ATOM 6036   C CA . SER B 1 2252 ? 212.072 109.174 91.996  1.00 0.00 ? 2252 SER B CA 3  
ATOM 6037   C CA . PHE B 1 2253 ? 215.239 110.611 93.536  1.00 0.00 ? 2253 PHE B CA 3  
ATOM 6038   C CA . GLN B 1 2259 ? 216.498 112.598 89.224  1.00 0.00 ? 2254 GLN B CA 3  
ATOM 6039   C CA . LYS B 1 2260 ? 216.546 108.795 88.995  1.00 0.00 ? 2260 LYS B CA 3  
ATOM 6040   C CA . ASN B 1 2261 ? 213.378 106.694 88.861  1.00 0.00 ? 2261 ASN B CA 3  
ATOM 6041   C CA . PHE B 1 2262 ? 213.020 103.332 90.587  1.00 0.00 ? 2262 PHE B CA 3  
ATOM 6042   C CA . LEU B 1 2263 ? 210.638 100.395 90.964  1.00 0.00 ? 2263 LEU B CA 3  
ATOM 6043   C CA . LEU B 1 2264 ? 210.228 99.410  94.618  1.00 0.00 ? 2264 LEU B CA 3  
ATOM 6044   C CA . VAL B 1 2265 ? 209.011 95.840  95.156  1.00 0.00 ? 2265 VAL B CA 3  
ATOM 6045   C CA . GLY B 1 2266 ? 207.729 94.778  98.575  1.00 0.00 ? 2266 GLY B CA 3  
ATOM 6046   C CA . THR B 1 2267 ? 207.483 91.037  99.198  1.00 0.00 ? 2267 THR B CA 3  
ATOM 6047   C CA . ALA B 1 2268 ? 205.623 88.823  101.657 1.00 0.00 ? 2268 ALA B CA 3  
ATOM 6048   C CA . ASP B 1 2269 ? 208.824 87.772  103.477 1.00 0.00 ? 2269 ASP B CA 3  
ATOM 6049   C CA . GLY B 1 2270 ? 209.653 91.301  104.640 1.00 0.00 ? 2270 GLY B CA 3  
ATOM 6050   C CA . LYS B 1 2271 ? 212.032 92.262  101.827 1.00 0.00 ? 2271 LYS B CA 3  
ATOM 6051   C CA . LEU B 1 2272 ? 212.103 95.323  99.562  1.00 0.00 ? 2272 LEU B CA 3  
ATOM 6052   C CA . ALA B 1 2273 ? 213.849 95.028  96.191  1.00 0.00 ? 2273 ALA B CA 3  
ATOM 6053   C CA . ILE B 1 2274 ? 214.875 98.103  94.191  1.00 0.00 ? 2274 ILE B CA 3  
ATOM 6054   C CA . PHE B 1 2275 ? 215.018 98.087  90.393  1.00 0.00 ? 2275 PHE B CA 3  
ATOM 6055   C CA . GLU B 1 2276 ? 216.358 101.006 88.411  1.00 0.00 ? 2276 GLU B CA 3  
ATOM 6056   C CA . ASP B 1 2277 ? 214.146 102.735 85.848  1.00 0.00 ? 2277 ASP B CA 3  
ATOM 6057   C CA . LYS B 1 2278 ? 215.992 101.362 82.811  1.00 0.00 ? 2278 LYS B CA 3  
ATOM 6058   C CA . THR B 1 2279 ? 216.744 97.844  84.094  1.00 0.00 ? 2279 THR B CA 3  
ATOM 6059   C CA . VAL B 1 2280 ? 213.017 97.015  83.998  1.00 0.00 ? 2280 VAL B CA 3  
ATOM 6060   C CA . LYS B 1 2281 ? 213.310 96.576  80.214  1.00 0.00 ? 2281 LYS B CA 3  
ATOM 6061   C CA . LEU B 1 2282 ? 215.795 93.701  80.573  1.00 0.00 ? 2282 LEU B CA 3  
ATOM 6062   C CA . LYS B 1 2283 ? 214.829 90.037  80.793  1.00 0.00 ? 2283 LYS B CA 3  
ATOM 6063   C CA . GLY B 1 2284 ? 215.957 88.444  84.041  1.00 0.00 ? 2284 GLY B CA 3  
ATOM 6064   C CA . ALA B 1 2285 ? 217.174 91.750  85.471  1.00 0.00 ? 2285 ALA B CA 3  
ATOM 6065   C CA . ALA B 1 2286 ? 218.315 91.645  89.096  1.00 0.00 ? 2286 ALA B CA 3  
ATOM 6066   C CA . PRO B 1 2287 ? 217.537 94.389  91.634  1.00 0.00 ? 2287 PRO B CA 3  
ATOM 6067   C CA . LEU B 1 2288 ? 220.097 97.006  92.583  1.00 0.00 ? 2288 LEU B CA 3  
ATOM 6068   C CA . LYS B 1 2289 ? 219.542 96.205  96.265  1.00 0.00 ? 2289 LYS B CA 3  
ATOM 6069   C CA . ILE B 1 2290 ? 217.351 94.040  98.497  1.00 0.00 ? 2290 ILE B CA 3  
ATOM 6070   C CA . LEU B 1 2291 ? 216.476 95.237  102.004 1.00 0.00 ? 2291 LEU B CA 3  
ATOM 6071   C CA . ASN B 1 2292 ? 215.649 92.546  104.570 1.00 0.00 ? 2292 ASN B CA 3  
ATOM 6072   C CA . ILE B 1 2293 ? 213.284 94.546  106.777 1.00 0.00 ? 2293 ILE B CA 3  
ATOM 6073   C CA . GLY B 1 2294 ? 211.297 91.655  108.303 1.00 0.00 ? 2294 GLY B CA 3  
ATOM 6074   C CA . ASN B 1 2295 ? 210.601 87.947  107.988 1.00 0.00 ? 2295 ASN B CA 3  
ATOM 6075   C CA . VAL B 1 2296 ? 208.140 85.512  106.417 1.00 0.00 ? 2296 VAL B CA 3  
ATOM 6076   C CA . SER B 1 2297 ? 205.568 86.655  108.996 1.00 0.00 ? 2297 SER B CA 3  
ATOM 6077   C CA . THR B 1 2298 ? 205.870 90.426  108.314 1.00 0.00 ? 2298 THR B CA 3  
ATOM 6078   C CA . PRO B 1 2299 ? 204.829 91.218  104.727 1.00 0.00 ? 2299 PRO B CA 3  
ATOM 6079   C CA . LEU B 1 2300 ? 205.805 94.548  103.186 1.00 0.00 ? 2300 LEU B CA 3  
ATOM 6080   C CA . MET B 1 2301 ? 202.408 95.769  102.016 1.00 0.00 ? 2301 MET B CA 3  
ATOM 6081   C CA . CYS B 1 2302 ? 202.503 99.548  101.516 1.00 0.00 ? 2302 CYS B CA 3  
ATOM 6082   C CA . LEU B 1 2303 ? 204.796 102.365 100.388 1.00 0.00 ? 2303 LEU B CA 3  
ATOM 6083   C CA . SER B 1 2304 ? 204.284 106.123 100.253 1.00 0.00 ? 2304 SER B CA 3  
ATOM 6084   C CA . GLU B 1 2305 ? 206.205 109.327 99.621  1.00 0.00 ? 2305 GLU B CA 3  
ATOM 6085   C CA . VAL B 1 2314 ? 212.144 110.265 101.518 1.00 0.00 ? 2314 VAL B CA 3  
ATOM 6086   C CA . MET B 1 2315 ? 210.061 107.077 101.512 1.00 0.00 ? 2315 MET B CA 3  
ATOM 6087   C CA . TRP B 1 2316 ? 207.953 105.572 104.290 1.00 0.00 ? 2316 TRP B CA 3  
ATOM 6088   C CA . GLY B 1 2317 ? 206.587 102.045 104.353 1.00 0.00 ? 2317 GLY B CA 3  
ATOM 6089   C CA . GLY B 1 2318 ? 204.863 99.433  106.444 1.00 0.00 ? 2318 GLY B CA 3  
ATOM 6090   C CA . CYS B 1 2319 ? 206.263 96.003  107.318 1.00 0.00 ? 2319 CYS B CA 3  
ATOM 6091   C CA . GLY B 1 2320 ? 204.231 94.080  109.865 1.00 0.00 ? 2320 GLY B CA 3  
ATOM 6092   C CA . THR B 1 2321 ? 203.706 96.430  112.792 1.00 0.00 ? 2321 THR B CA 3  
ATOM 6093   C CA . LYS B 1 2322 ? 206.798 98.513  111.939 1.00 0.00 ? 2322 LYS B CA 3  
ATOM 6094   C CA . ILE B 1 2323 ? 207.017 101.749 109.964 1.00 0.00 ? 2323 ILE B CA 3  
ATOM 6095   C CA . PHE B 1 2324 ? 210.288 102.198 108.094 1.00 0.00 ? 2324 PHE B CA 3  
ATOM 6096   C CA . SER B 1 2325 ? 211.942 105.081 106.266 1.00 0.00 ? 2325 SER B CA 3  
ATOM 6097   C CA . PHE B 1 2326 ? 214.676 105.319 103.652 1.00 0.00 ? 2326 PHE B CA 3  
ATOM 6098   C CA . SER B 1 2327 ? 216.059 107.824 101.171 1.00 0.00 ? 2327 SER B CA 3  
ATOM 6099   C CA . ASN B 1 2328 ? 218.865 107.955 98.611  1.00 0.00 ? 2328 ASN B CA 3  
ATOM 6100   C CA . ASP B 1 2329 ? 221.206 105.135 99.662  1.00 0.00 ? 2329 ASP B CA 3  
ATOM 6101   C CA . PHE B 1 2330 ? 218.394 102.676 100.557 1.00 0.00 ? 2330 PHE B CA 3  
ATOM 6102   C CA . THR B 1 2331 ? 219.644 102.296 104.114 1.00 0.00 ? 2331 THR B CA 3  
ATOM 6103   C CA . ILE B 1 2332 ? 216.793 102.043 106.605 1.00 0.00 ? 2332 ILE B CA 3  
ATOM 6104   C CA . GLN B 1 2333 ? 216.871 105.218 108.679 1.00 0.00 ? 2333 GLN B CA 3  
ATOM 6105   C CA . LYS B 1 2334 ? 213.762 105.291 110.876 1.00 0.00 ? 2334 LYS B CA 3  
ATOM 6106   C CA . LEU B 1 2335 ? 212.114 102.151 112.257 1.00 0.00 ? 2335 LEU B CA 3  
ATOM 6107   C CA . ILE B 1 2336 ? 209.100 102.647 114.543 1.00 0.00 ? 2336 ILE B CA 3  
ATOM 6108   C CA . GLU B 1 2337 ? 207.332 99.832  116.389 1.00 0.00 ? 2337 GLU B CA 3  
ATOM 6109   C CA . THR B 1 2338 ? 203.592 100.547 116.450 1.00 0.00 ? 2338 THR B CA 3  
ATOM 6110   C CA . ARG B 1 2339 ? 202.451 97.387  118.258 1.00 0.00 ? 2339 ARG B CA 3  
ATOM 6111   C CA . THR B 1 2340 ? 202.618 99.070  121.682 1.00 0.00 ? 2340 THR B CA 3  
ATOM 6112   C CA . SER B 1 2341 ? 201.494 102.433 123.062 1.00 0.00 ? 2341 SER B CA 3  
ATOM 6113   C CA . GLN B 1 2342 ? 200.030 103.252 126.472 1.00 0.00 ? 2342 GLN B CA 3  
ATOM 6114   C CA . LEU B 1 2343 ? 197.556 105.759 125.000 1.00 0.00 ? 2343 LEU B CA 3  
ATOM 6115   C CA . PHE B 1 2344 ? 195.962 103.078 122.804 1.00 0.00 ? 2344 PHE B CA 3  
ATOM 6116   C CA . SER B 1 2345 ? 192.186 103.293 123.086 1.00 0.00 ? 2345 SER B CA 3  
ATOM 6117   C CA . TYR B 1 2346 ? 192.096 99.535  122.421 1.00 0.00 ? 2346 TYR B CA 3  
ATOM 6118   C CA . ALA B 1 2347 ? 195.168 97.315  122.314 1.00 0.00 ? 2347 ALA B CA 3  
ATOM 6119   C CA . ALA B 1 2348 ? 194.152 94.401  120.073 1.00 0.00 ? 2348 ALA B CA 3  
ATOM 6120   C CA . PHE B 1 2349 ? 193.680 96.660  117.037 1.00 0.00 ? 2349 PHE B CA 3  
ATOM 6121   C CA . SER B 1 2350 ? 197.254 97.964  117.157 1.00 0.00 ? 2350 SER B CA 3  
ATOM 6122   C CA . ASP B 1 2351 ? 198.645 94.409  117.068 1.00 0.00 ? 2351 ASP B CA 3  
ATOM 6123   C CA . SER B 1 2352 ? 197.978 93.971  113.362 1.00 0.00 ? 2352 SER B CA 3  
ATOM 6124   C CA . ASN B 1 2353 ? 199.869 94.376  110.109 1.00 0.00 ? 2353 ASN B CA 3  
ATOM 6125   C CA . ILE B 1 2354 ? 199.880 97.900  108.696 1.00 0.00 ? 2354 ILE B CA 3  
ATOM 6126   C CA . ILE B 1 2355 ? 197.827 97.959  105.488 1.00 0.00 ? 2355 ILE B CA 3  
ATOM 6127   C CA . THR B 1 2356 ? 198.438 101.547 104.323 1.00 0.00 ? 2356 THR B CA 3  
ATOM 6128   C CA . VAL B 1 2357 ? 200.577 104.588 105.139 1.00 0.00 ? 2357 VAL B CA 3  
ATOM 6129   C CA . VAL B 1 2358 ? 199.817 108.173 104.098 1.00 0.00 ? 2358 VAL B CA 3  
ATOM 6130   C CA . VAL B 1 2359 ? 202.513 110.776 104.779 1.00 0.00 ? 2359 VAL B CA 3  
ATOM 6131   C CA . ASP B 1 2360 ? 201.738 114.445 105.402 1.00 0.00 ? 2360 ASP B CA 3  
ATOM 6132   C CA . THR B 1 2361 ? 202.874 116.395 108.462 1.00 0.00 ? 2361 THR B CA 3  
ATOM 6133   C CA . ALA B 1 2362 ? 202.601 113.170 110.473 1.00 0.00 ? 2362 ALA B CA 3  
ATOM 6134   C CA . LEU B 1 2363 ? 202.192 109.481 109.662 1.00 0.00 ? 2363 LEU B CA 3  
ATOM 6135   C CA . TYR B 1 2364 ? 198.598 108.231 109.384 1.00 0.00 ? 2364 TYR B CA 3  
ATOM 6136   C CA . ILE B 1 2365 ? 198.656 104.429 109.399 1.00 0.00 ? 2365 ILE B CA 3  
ATOM 6137   C CA . ALA B 1 2366 ? 195.801 101.935 109.276 1.00 0.00 ? 2366 ALA B CA 3  
ATOM 6138   C CA . LYS B 1 2367 ? 196.010 98.307  110.372 1.00 0.00 ? 2367 LYS B CA 3  
ATOM 6139   C CA . GLN B 1 2368 ? 194.245 95.149  109.250 1.00 0.00 ? 2368 GLN B CA 3  
ATOM 6140   C CA . ASN B 1 2369 ? 190.777 94.657  110.777 1.00 0.00 ? 2369 ASN B CA 3  
ATOM 6141   C CA . SER B 1 2370 ? 191.129 97.857  112.818 1.00 0.00 ? 2370 SER B CA 3  
ATOM 6142   C CA . PRO B 1 2371 ? 188.812 100.906 112.928 1.00 0.00 ? 2371 PRO B CA 3  
ATOM 6143   C CA . VAL B 1 2372 ? 191.515 103.194 114.378 1.00 0.00 ? 2372 VAL B CA 3  
ATOM 6144   C CA . VAL B 1 2373 ? 193.784 105.315 112.194 1.00 0.00 ? 2373 VAL B CA 3  
ATOM 6145   C CA . GLU B 1 2374 ? 196.933 105.801 114.263 1.00 0.00 ? 2374 GLU B CA 3  
ATOM 6146   C CA . VAL B 1 2375 ? 198.896 109.049 113.975 1.00 0.00 ? 2375 VAL B CA 3  
ATOM 6147   C CA . TRP B 1 2376 ? 202.642 108.911 114.660 1.00 0.00 ? 2376 TRP B CA 3  
ATOM 6148   C CA . ASP B 1 2377 ? 205.313 111.616 114.712 1.00 0.00 ? 2377 ASP B CA 3  
ATOM 6149   C CA . LYS B 1 2378 ? 208.261 111.347 112.331 1.00 0.00 ? 2378 LYS B CA 3  
ATOM 6150   C CA . LYS B 1 2379 ? 210.693 113.005 114.747 1.00 0.00 ? 2379 LYS B CA 3  
ATOM 6151   C CA . THR B 1 2380 ? 209.759 111.696 118.202 1.00 0.00 ? 2380 THR B CA 3  
ATOM 6152   C CA . GLU B 1 2381 ? 208.558 108.304 116.862 1.00 0.00 ? 2381 GLU B CA 3  
ATOM 6153   C CA . LYS B 1 2382 ? 205.562 108.263 119.239 1.00 0.00 ? 2382 LYS B CA 3  
ATOM 6154   C CA . LEU B 1 2383 ? 201.791 108.539 119.016 1.00 0.00 ? 2383 LEU B CA 3  
ATOM 6155   C CA . CYS B 1 2384 ? 200.630 111.894 117.709 1.00 0.00 ? 2384 CYS B CA 3  
ATOM 6156   C CA . GLY B 1 2385 ? 196.965 110.967 117.956 1.00 0.00 ? 2385 GLY B CA 3  
ATOM 6157   C CA . LEU B 1 2386 ? 194.126 108.557 117.270 1.00 0.00 ? 2386 LEU B CA 3  
ATOM 6158   C CA . ILE B 1 2387 ? 191.207 108.729 114.838 1.00 0.00 ? 2387 ILE B CA 3  
ATOM 6159   C CA . ASP B 1 2388 ? 188.443 106.267 115.768 1.00 0.00 ? 2388 ASP B CA 3  
ATOM 6160   C CA . CYS B 1 2389 ? 186.199 105.819 112.729 1.00 0.00 ? 2389 CYS B CA 3  
ATOM 6161   C CA . VAL B 1 2390 ? 183.492 104.059 114.775 1.00 0.00 ? 2390 VAL B CA 3  
ATOM 6162   C CA . HIS B 1 2391 ? 182.845 107.267 116.720 1.00 0.00 ? 2391 HIS B CA 3  
ATOM 6163   C CA . PHE B 1 2392 ? 182.933 109.478 113.619 1.00 0.00 ? 2392 PHE B CA 3  
ATOM 6164   C CA . LEU B 1 2393 ? 180.433 107.179 111.903 1.00 0.00 ? 2393 LEU B CA 3  
ATOM 6165   C CA . ARG B 1 2394 ? 178.100 107.059 114.928 1.00 0.00 ? 2394 ARG B CA 3  
ATOM 6166   C CA . GLU B 1 2395 ? 177.390 110.815 114.681 1.00 0.00 ? 2395 GLU B CA 3  
ATOM 6167   C CA . MET B 1 2408 ? 175.109 102.481 114.876 1.00 0.00 ? 2408 MET B CA 3  
ATOM 6168   C CA . SER B 1 2409 ? 176.234 98.883  114.297 1.00 0.00 ? 2409 SER B CA 3  
ATOM 6169   C CA . TYR B 1 2410 ? 179.172 99.893  112.086 1.00 0.00 ? 2410 TYR B CA 3  
ATOM 6170   C CA . SER B 1 2411 ? 182.429 97.965  112.384 1.00 0.00 ? 2411 SER B CA 3  
ATOM 6171   C CA . GLY B 1 2412 ? 184.302 101.009 111.078 1.00 0.00 ? 2412 GLY B CA 3  
ATOM 6172   C CA . ARG B 1 2413 ? 187.061 98.699  109.868 1.00 0.00 ? 2413 ARG B CA 3  
ATOM 6173   C CA . VAL B 1 2414 ? 189.426 100.899 107.869 1.00 0.00 ? 2414 VAL B CA 3  
ATOM 6174   C CA . LYS B 1 2415 ? 190.096 99.689  104.329 1.00 0.00 ? 2415 LYS B CA 3  
ATOM 6175   C CA . THR B 1 2416 ? 191.892 102.562 102.608 1.00 0.00 ? 2416 THR B CA 3  
ATOM 6176   C CA . LEU B 1 2417 ? 193.380 106.028 103.169 1.00 0.00 ? 2417 LEU B CA 3  
ATOM 6177   C CA . CYS B 1 2418 ? 193.865 108.778 100.590 1.00 0.00 ? 2418 CYS B CA 3  
ATOM 6178   C CA . LEU B 1 2419 ? 195.153 112.342 100.890 1.00 0.00 ? 2419 LEU B CA 3  
ATOM 6179   C CA . GLN B 1 2420 ? 193.278 115.189 99.206  1.00 0.00 ? 2420 GLN B CA 3  
ATOM 6180   C CA . LYS B 1 2421 ? 195.503 118.203 98.478  1.00 0.00 ? 2421 LYS B CA 3  
ATOM 6181   C CA . ASN B 1 2422 ? 197.302 119.351 101.628 1.00 0.00 ? 2422 ASN B CA 3  
ATOM 6182   C CA . THR B 1 2423 ? 194.453 119.305 104.156 1.00 0.00 ? 2423 THR B CA 3  
ATOM 6183   C CA . ALA B 1 2424 ? 191.985 116.499 103.597 1.00 0.00 ? 2424 ALA B CA 3  
ATOM 6184   C CA . LEU B 1 2425 ? 192.058 112.772 104.378 1.00 0.00 ? 2425 LEU B CA 3  
ATOM 6185   C CA . TRP B 1 2426 ? 189.641 110.281 102.808 1.00 0.00 ? 2426 TRP B CA 3  
ATOM 6186   C CA . ILE B 1 2427 ? 188.952 107.098 104.793 1.00 0.00 ? 2427 ILE B CA 3  
ATOM 6187   C CA . GLY B 1 2428 ? 187.170 104.168 103.134 1.00 0.00 ? 2428 GLY B CA 3  
ATOM 6188   C CA . THR B 1 2429 ? 185.799 101.817 105.770 1.00 0.00 ? 2429 THR B CA 3  
ATOM 6189   C CA . GLY B 1 2430 ? 184.777 98.134  105.441 1.00 0.00 ? 2430 GLY B CA 3  
ATOM 6190   C CA . GLY B 1 2431 ? 181.165 99.063  104.907 1.00 0.00 ? 2431 GLY B CA 3  
ATOM 6191   C CA . GLY B 1 2432 ? 180.265 101.343 102.057 1.00 0.00 ? 2432 GLY B CA 3  
ATOM 6192   C CA . HIS B 1 2433 ? 181.242 104.372 104.111 1.00 0.00 ? 2433 HIS B CA 3  
ATOM 6193   C CA . ILE B 1 2434 ? 183.605 107.161 103.060 1.00 0.00 ? 2434 ILE B CA 3  
ATOM 6194   C CA . LEU B 1 2435 ? 184.809 109.808 105.530 1.00 0.00 ? 2435 LEU B CA 3  
ATOM 6195   C CA . LEU B 1 2436 ? 186.544 113.115 104.781 1.00 0.00 ? 2436 LEU B CA 3  
ATOM 6196   C CA . LEU B 1 2437 ? 188.534 114.606 107.674 1.00 0.00 ? 2437 LEU B CA 3  
ATOM 6197   C CA . ASP B 1 2438 ? 190.350 117.935 107.959 1.00 0.00 ? 2438 ASP B CA 3  
ATOM 6198   C CA . LEU B 1 2439 ? 193.967 117.345 109.060 1.00 0.00 ? 2439 LEU B CA 3  
ATOM 6199   C CA . SER B 1 2440 ? 194.864 120.588 110.849 1.00 0.00 ? 2440 SER B CA 3  
ATOM 6200   C CA . THR B 1 2441 ? 192.788 122.225 113.581 1.00 0.00 ? 2441 THR B CA 3  
ATOM 6201   C CA . ARG B 1 2442 ? 189.542 120.222 113.333 1.00 0.00 ? 2442 ARG B CA 3  
ATOM 6202   C CA . ARG B 1 2443 ? 188.263 116.881 112.029 1.00 0.00 ? 2443 ARG B CA 3  
ATOM 6203   C CA . LEU B 1 2444 ? 185.145 115.814 110.118 1.00 0.00 ? 2444 LEU B CA 3  
ATOM 6204   C CA . ILE B 1 2445 ? 184.360 117.599 106.848 1.00 0.00 ? 2445 ILE B CA 3  
ATOM 6205   C CA . ARG B 1 2446 ? 182.161 115.207 104.868 1.00 0.00 ? 2446 ARG B CA 3  
ATOM 6206   C CA . VAL B 1 2447 ? 180.571 111.773 105.277 1.00 0.00 ? 2447 VAL B CA 3  
ATOM 6207   C CA . ILE B 1 2448 ? 178.866 109.611 102.658 1.00 0.00 ? 2448 ILE B CA 3  
ATOM 6208   C CA . TYR B 1 2449 ? 177.110 106.504 104.002 1.00 0.00 ? 2449 TYR B CA 3  
ATOM 6209   C CA . ASN B 1 2450 ? 176.370 103.372 101.963 1.00 0.00 ? 2450 ASN B CA 3  
ATOM 6210   C CA . PHE B 1 2451 ? 178.446 104.668 99.054  1.00 0.00 ? 2451 PHE B CA 3  
ATOM 6211   C CA . CYS B 1 2452 ? 178.775 100.947 98.303  1.00 0.00 ? 2452 CYS B CA 3  
ATOM 6212   C CA . ASN B 1 2453 ? 178.798 97.714  100.302 1.00 0.00 ? 2453 ASN B CA 3  
ATOM 6213   C CA . SER B 1 2454 ? 182.581 97.759  100.861 1.00 0.00 ? 2454 SER B CA 3  
ATOM 6214   C CA . VAL B 1 2455 ? 185.223 100.299 99.778  1.00 0.00 ? 2455 VAL B CA 3  
ATOM 6215   C CA . ARG B 1 2456 ? 188.262 98.351  98.576  1.00 0.00 ? 2456 ARG B CA 3  
ATOM 6216   C CA . VAL B 1 2457 ? 190.543 100.842 96.791  1.00 0.00 ? 2457 VAL B CA 3  
ATOM 6217   C CA . MET B 1 2458 ? 190.706 104.639 96.796  1.00 0.00 ? 2458 MET B CA 3  
ATOM 6218   C CA . MET B 1 2459 ? 193.337 106.618 94.894  1.00 0.00 ? 2459 MET B CA 3  
ATOM 6219   C CA . THR B 1 2460 ? 194.137 109.883 93.122  1.00 0.00 ? 2460 THR B CA 3  
ATOM 6220   C CA . ALA B 1 2461 ? 195.223 110.045 89.476  1.00 0.00 ? 2461 ALA B CA 3  
ATOM 6221   C CA . GLN B 1 2462 ? 196.055 112.656 86.849  1.00 0.00 ? 2462 GLN B CA 3  
ATOM 6222   C CA . ASN B 1 2468 ? 193.160 115.788 89.591  1.00 0.00 ? 2468 ASN B CA 3  
ATOM 6223   C CA . VAL B 1 2469 ? 190.795 112.803 89.555  1.00 0.00 ? 2469 VAL B CA 3  
ATOM 6224   C CA . MET B 1 2470 ? 189.400 110.519 92.268  1.00 0.00 ? 2470 MET B CA 3  
ATOM 6225   C CA . LEU B 1 2471 ? 188.930 106.760 91.803  1.00 0.00 ? 2471 LEU B CA 3  
ATOM 6226   C CA . VAL B 1 2472 ? 187.061 104.535 94.277  1.00 0.00 ? 2472 VAL B CA 3  
ATOM 6227   C CA . LEU B 1 2473 ? 186.745 100.804 93.601  1.00 0.00 ? 2473 LEU B CA 3  
ATOM 6228   C CA . GLY B 1 2474 ? 184.086 99.164  95.757  1.00 0.00 ? 2474 GLY B CA 3  
ATOM 6229   C CA . TYR B 1 2475 ? 182.355 95.811  95.537  1.00 0.00 ? 2475 TYR B CA 3  
ATOM 6230   C CA . ASN B 1 2476 ? 178.814 94.579  96.280  1.00 0.00 ? 2476 ASN B CA 3  
ATOM 6231   C CA . ARG B 1 2477 ? 177.824 91.015  97.066  1.00 0.00 ? 2477 ARG B CA 3  
ATOM 6232   C CA . GLU B 1 2488 ? 177.639 86.664  93.219  1.00 0.00 ? 2497 GLU B CA 3  
ATOM 6233   C CA . ILE B 1 2489 ? 179.908 89.727  93.249  1.00 0.00 ? 2498 ILE B CA 3  
ATOM 6234   C CA . GLN B 1 2490 ? 179.569 93.047  91.392  1.00 0.00 ? 2499 GLN B CA 3  
ATOM 6235   C CA . SER B 1 2491 ? 182.603 95.333  91.404  1.00 0.00 ? 2500 SER B CA 3  
ATOM 6236   C CA . CYS B 1 2492 ? 182.141 99.019  90.595  1.00 0.00 ? 2501 CYS B CA 3  
ATOM 6237   C CA . LEU B 1 2493 ? 184.545 101.885 89.912  1.00 0.00 ? 2502 LEU B CA 3  
ATOM 6238   C CA . THR B 1 2494 ? 183.334 105.370 90.870  1.00 0.00 ? 2503 THR B CA 3  
ATOM 6239   C CA . VAL B 1 2495 ? 185.172 108.437 89.584  1.00 0.00 ? 2504 VAL B CA 3  
ATOM 6240   C CA . TRP B 1 2496 ? 185.003 112.218 89.987  1.00 0.00 ? 2505 TRP B CA 3  
ATOM 6241   C CA . TYR A 1 1332 ? 115.076 136.554 167.891 1.00 0.00 ? 1332 TYR A CA 4  
ATOM 6242   C CA . ASN A 1 1333 ? 118.396 135.770 169.708 1.00 0.00 ? 1333 ASN A CA 4  
ATOM 6243   C CA . ARG A 1 1334 ? 119.872 133.346 167.225 1.00 0.00 ? 1334 ARG A CA 4  
ATOM 6244   C CA . MET A 1 1335 ? 122.905 133.519 164.899 1.00 0.00 ? 1335 MET A CA 4  
ATOM 6245   C CA . LYS A 1 1336 ? 124.764 131.407 162.316 1.00 0.00 ? 1336 LYS A CA 4  
ATOM 6246   C CA . LEU A 1 1337 ? 128.513 130.920 162.747 1.00 0.00 ? 1337 LEU A CA 4  
ATOM 6247   C CA . MET A 1 1338 ? 130.012 129.737 159.477 1.00 0.00 ? 1338 MET A CA 4  
ATOM 6248   C CA . ILE A 1 1339 ? 133.429 128.111 159.865 1.00 0.00 ? 1339 ILE A CA 4  
ATOM 6249   C CA . VAL A 1 1340 ? 135.510 128.923 156.764 1.00 0.00 ? 1340 VAL A CA 4  
ATOM 6250   C CA . GLY A 1 1341 ? 138.961 127.608 155.817 1.00 0.00 ? 1341 GLY A CA 4  
ATOM 6251   C CA . ASN A 1 1342 ? 140.948 124.879 154.088 1.00 0.00 ? 1342 ASN A CA 4  
ATOM 6252   C CA . THR A 1 1343 ? 140.178 121.336 155.422 1.00 0.00 ? 1343 THR A CA 4  
ATOM 6253   C CA . GLY A 1 1344 ? 141.923 121.020 158.802 1.00 0.00 ? 1344 GLY A CA 4  
ATOM 6254   C CA . SER A 1 1345 ? 143.319 124.474 159.539 1.00 0.00 ? 1345 SER A CA 4  
ATOM 6255   C CA . GLY A 1 1346 ? 141.957 123.511 162.997 1.00 0.00 ? 1346 GLY A CA 4  
ATOM 6256   C CA . LYS A 1 1347 ? 138.182 123.963 162.570 1.00 0.00 ? 1347 LYS A CA 4  
ATOM 6257   C CA . THR A 1 1348 ? 137.429 121.109 165.036 1.00 0.00 ? 1348 THR A CA 4  
ATOM 6258   C CA . THR A 1 1349 ? 140.349 122.264 167.272 1.00 0.00 ? 1349 THR A CA 4  
ATOM 6259   C CA . LEU A 1 1350 ? 138.978 125.804 167.500 1.00 0.00 ? 1350 LEU A CA 4  
ATOM 6260   C CA . LEU A 1 1351 ? 135.456 124.441 168.204 1.00 0.00 ? 1351 LEU A CA 4  
ATOM 6261   C CA . GLN A 1 1352 ? 136.649 122.084 170.998 1.00 0.00 ? 1352 GLN A CA 4  
ATOM 6262   C CA . GLN A 1 1353 ? 138.365 125.048 172.663 1.00 0.00 ? 1353 GLN A CA 4  
ATOM 6263   C CA . LEU A 1 1354 ? 135.411 127.502 172.426 1.00 0.00 ? 1354 LEU A CA 4  
ATOM 6264   C CA . MET A 1 1355 ? 132.727 125.132 173.574 1.00 0.00 ? 1355 MET A CA 4  
ATOM 6265   C CA . LYS A 1 1356 ? 134.085 124.089 177.057 1.00 0.00 ? 1356 LYS A CA 4  
ATOM 6266   C CA . THR A 1 1357 ? 131.092 121.807 177.859 1.00 0.00 ? 1357 THR A CA 4  
ATOM 6267   C CA . LYS A 1 1358 ? 131.158 118.390 179.634 1.00 0.00 ? 1358 LYS A CA 4  
ATOM 6268   C CA . LYS A 1 1359 ? 132.187 116.952 176.238 1.00 0.00 ? 1359 LYS A CA 4  
ATOM 6269   C CA . SER A 1 1360 ? 128.471 116.381 175.482 1.00 0.00 ? 1360 SER A CA 4  
ATOM 6270   C CA . ASP A 1 1361 ? 128.494 115.920 171.682 1.00 0.00 ? 1361 ASP A CA 4  
ATOM 6271   C CA . LEU A 1 1362 ? 131.365 118.449 171.774 1.00 0.00 ? 1362 LEU A CA 4  
ATOM 6272   C CA . GLY A 1 1363 ? 133.648 116.200 169.763 1.00 0.00 ? 1363 GLY A CA 4  
ATOM 6273   C CA . MET A 1 1364 ? 133.274 115.758 165.994 1.00 0.00 ? 1364 MET A CA 4  
ATOM 6274   C CA . GLN A 1 1365 ? 136.126 116.251 163.524 1.00 0.00 ? 1365 GLN A CA 4  
ATOM 6275   C CA . SER A 1 1366 ? 135.068 116.350 159.863 1.00 0.00 ? 1366 SER A CA 4  
ATOM 6276   C CA . ALA A 1 1367 ? 137.465 118.983 158.620 1.00 0.00 ? 1367 ALA A CA 4  
ATOM 6277   C CA . THR A 1 1368 ? 137.667 117.771 154.936 1.00 0.00 ? 1368 THR A CA 4  
ATOM 6278   C CA . VAL A 1 1369 ? 134.575 117.538 152.652 1.00 0.00 ? 1369 VAL A CA 4  
ATOM 6279   C CA . GLY A 1 1370 ? 132.019 117.037 155.459 1.00 0.00 ? 1370 GLY A CA 4  
ATOM 6280   C CA . ILE A 1 1371 ? 128.919 118.680 156.961 1.00 0.00 ? 1371 ILE A CA 4  
ATOM 6281   C CA . ASP A 1 1372 ? 127.647 119.204 160.538 1.00 0.00 ? 1372 ASP A CA 4  
ATOM 6282   C CA . VAL A 1 1373 ? 125.894 121.653 162.905 1.00 0.00 ? 1373 VAL A CA 4  
ATOM 6283   C CA . LYS A 1 1374 ? 126.689 122.210 166.568 1.00 0.00 ? 1374 LYS A CA 4  
ATOM 6284   C CA . ASP A 1 1375 ? 124.261 124.505 168.349 1.00 0.00 ? 1375 ASP A CA 4  
ATOM 6285   C CA . TRP A 1 1376 ? 125.360 125.863 171.750 1.00 0.00 ? 1376 TRP A CA 4  
ATOM 6286   C CA . PRO A 1 1377 ? 124.038 128.759 173.889 1.00 0.00 ? 1377 PRO A CA 4  
ATOM 6287   C CA . ILE A 1 1378 ? 127.381 130.666 174.266 1.00 0.00 ? 1378 ILE A CA 4  
ATOM 6288   C CA . GLN A 1 1379 ? 126.423 133.607 176.340 1.00 0.00 ? 1379 GLN A CA 4  
ATOM 6289   C CA . ILE A 1 1380 ? 127.112 136.166 179.047 1.00 0.00 ? 1380 ILE A CA 4  
ATOM 6290   C CA . ARG A 1 1381 ? 125.042 135.701 182.182 1.00 0.00 ? 1381 ARG A CA 4  
ATOM 6291   C CA . ASP A 1 1382 ? 122.955 138.748 183.241 1.00 0.00 ? 1382 ASP A CA 4  
ATOM 6292   C CA . LYS A 1 1383 ? 123.371 140.617 179.912 1.00 0.00 ? 1383 LYS A CA 4  
ATOM 6293   C CA . ARG A 1 1384 ? 121.454 140.793 176.567 1.00 0.00 ? 1384 ARG A CA 4  
ATOM 6294   C CA . LYS A 1 1385 ? 123.525 137.863 175.390 1.00 0.00 ? 1385 LYS A CA 4  
ATOM 6295   C CA . ARG A 1 1386 ? 121.887 135.637 178.160 1.00 0.00 ? 1386 ARG A CA 4  
ATOM 6296   C CA . ASP A 1 1387 ? 119.288 134.133 175.762 1.00 0.00 ? 1387 ASP A CA 4  
ATOM 6297   C CA . LEU A 1 1388 ? 121.566 133.930 172.633 1.00 0.00 ? 1388 LEU A CA 4  
ATOM 6298   C CA . VAL A 1 1389 ? 121.819 130.726 170.578 1.00 0.00 ? 1389 VAL A CA 4  
ATOM 6299   C CA . LEU A 1 1390 ? 124.887 130.139 168.368 1.00 0.00 ? 1390 LEU A CA 4  
ATOM 6300   C CA . ASN A 1 1391 ? 124.620 127.694 165.471 1.00 0.00 ? 1391 ASN A CA 4  
ATOM 6301   C CA . VAL A 1 1392 ? 128.051 126.545 164.251 1.00 0.00 ? 1392 VAL A CA 4  
ATOM 6302   C CA . TRP A 1 1393 ? 127.883 125.374 160.644 1.00 0.00 ? 1393 TRP A CA 4  
ATOM 6303   C CA . ASP A 1 1394 ? 130.536 123.807 158.499 1.00 0.00 ? 1394 ASP A CA 4  
ATOM 6304   C CA . PHE A 1 1395 ? 129.647 123.179 154.831 1.00 0.00 ? 1395 PHE A CA 4  
ATOM 6305   C CA . ALA A 1 1396 ? 133.254 122.413 153.779 1.00 0.00 ? 1396 ALA A CA 4  
ATOM 6306   C CA . GLY A 1 1397 ? 133.484 125.016 150.967 1.00 0.00 ? 1397 GLY A CA 4  
ATOM 6307   C CA . ARG A 1 1398 ? 130.297 123.892 149.204 1.00 0.00 ? 1398 ARG A CA 4  
ATOM 6308   C CA . GLU A 1 1399 ? 127.707 126.502 150.170 1.00 0.00 ? 1399 GLU A CA 4  
ATOM 6309   C CA . GLU A 1 1400 ? 124.638 124.272 149.516 1.00 0.00 ? 1400 GLU A CA 4  
ATOM 6310   C CA . PHE A 1 1401 ? 121.990 126.733 150.836 1.00 0.00 ? 1401 PHE A CA 4  
ATOM 6311   C CA . TYR A 1 1402 ? 123.087 129.638 148.536 1.00 0.00 ? 1402 TYR A CA 4  
ATOM 6312   C CA . SER A 1 1403 ? 120.712 129.261 145.525 1.00 0.00 ? 1403 SER A CA 4  
ATOM 6313   C CA . THR A 1 1404 ? 117.397 128.717 147.356 1.00 0.00 ? 1404 THR A CA 4  
ATOM 6314   C CA . HIS A 1 1405 ? 118.089 130.506 150.659 1.00 0.00 ? 1405 HIS A CA 4  
ATOM 6315   C CA . PRO A 1 1406 ? 120.100 133.770 149.932 1.00 0.00 ? 1406 PRO A CA 4  
ATOM 6316   C CA . HIS A 1 1407 ? 119.499 135.261 153.403 1.00 0.00 ? 1407 HIS A CA 4  
ATOM 6317   C CA . PHE A 1 1408 ? 120.888 132.162 155.182 1.00 0.00 ? 1408 PHE A CA 4  
ATOM 6318   C CA . MET A 1 1409 ? 124.333 133.308 153.989 1.00 0.00 ? 1409 MET A CA 4  
ATOM 6319   C CA . THR A 1 1410 ? 123.841 137.105 153.711 1.00 0.00 ? 1410 THR A CA 4  
ATOM 6320   C CA . GLN A 1 1411 ? 121.859 137.777 156.906 1.00 0.00 ? 1411 GLN A CA 4  
ATOM 6321   C CA . ARG A 1 1412 ? 121.884 136.271 160.410 1.00 0.00 ? 1412 ARG A CA 4  
ATOM 6322   C CA . ALA A 1 1413 ? 125.499 135.222 159.954 1.00 0.00 ? 1413 ALA A CA 4  
ATOM 6323   C CA . LEU A 1 1414 ? 129.079 135.488 161.175 1.00 0.00 ? 1414 LEU A CA 4  
ATOM 6324   C CA . TYR A 1 1415 ? 131.957 134.123 159.118 1.00 0.00 ? 1415 TYR A CA 4  
ATOM 6325   C CA . LEU A 1 1416 ? 134.923 132.733 161.050 1.00 0.00 ? 1416 LEU A CA 4  
ATOM 6326   C CA . ALA A 1 1417 ? 137.975 132.351 158.879 1.00 0.00 ? 1417 ALA A CA 4  
ATOM 6327   C CA . VAL A 1 1418 ? 140.403 129.768 160.229 1.00 0.00 ? 1418 VAL A CA 4  
ATOM 6328   C CA . TYR A 1 1419 ? 143.963 130.168 159.005 1.00 0.00 ? 1419 TYR A CA 4  
ATOM 6329   C CA . ASP A 1 1420 ? 146.747 127.927 160.073 1.00 0.00 ? 1420 ASP A CA 4  
ATOM 6330   C CA . LEU A 1 1421 ? 149.261 130.672 159.290 1.00 0.00 ? 1421 LEU A CA 4  
ATOM 6331   C CA . SER A 1 1422 ? 152.259 128.274 159.094 1.00 0.00 ? 1422 SER A CA 4  
ATOM 6332   C CA . LYS A 1 1423 ? 150.445 125.824 156.772 1.00 0.00 ? 1423 LYS A CA 4  
ATOM 6333   C CA . GLY A 1 1424 ? 147.121 127.177 155.354 1.00 0.00 ? 1424 GLY A CA 4  
ATOM 6334   C CA . GLN A 1 1425 ? 148.632 130.627 154.699 1.00 0.00 ? 1425 GLN A CA 4  
ATOM 6335   C CA . ALA A 1 1426 ? 152.265 129.519 154.128 1.00 0.00 ? 1426 ALA A CA 4  
ATOM 6336   C CA . GLU A 1 1427 ? 151.892 126.280 152.021 1.00 0.00 ? 1427 GLU A CA 4  
ATOM 6337   C CA . VAL A 1 1428 ? 148.914 127.222 149.802 1.00 0.00 ? 1428 VAL A CA 4  
ATOM 6338   C CA . ASP A 1 1429 ? 148.198 130.997 150.369 1.00 0.00 ? 1429 ASP A CA 4  
ATOM 6339   C CA . ALA A 1 1430 ? 144.488 130.206 150.557 1.00 0.00 ? 1430 ALA A CA 4  
ATOM 6340   C CA . MET A 1 1431 ? 143.789 133.334 152.610 1.00 0.00 ? 1431 MET A CA 4  
ATOM 6341   C CA . LYS A 1 1432 ? 143.033 135.445 149.502 1.00 0.00 ? 1432 LYS A CA 4  
ATOM 6342   C CA . PRO A 1 1433 ? 140.575 132.794 148.046 1.00 0.00 ? 1433 PRO A CA 4  
ATOM 6343   C CA . TRP A 1 1434 ? 138.726 132.260 151.370 1.00 0.00 ? 1434 TRP A CA 4  
ATOM 6344   C CA . LEU A 1 1435 ? 138.408 135.991 152.023 1.00 0.00 ? 1435 LEU A CA 4  
ATOM 6345   C CA . PHE A 1 1436 ? 136.795 136.531 148.559 1.00 0.00 ? 1436 PHE A CA 4  
ATOM 6346   C CA . ASN A 1 1437 ? 134.610 133.403 149.191 1.00 0.00 ? 1437 ASN A CA 4  
ATOM 6347   C CA . ILE A 1 1438 ? 133.300 135.067 152.397 1.00 0.00 ? 1438 ILE A CA 4  
ATOM 6348   C CA . LYS A 1 1439 ? 132.681 138.392 150.528 1.00 0.00 ? 1439 LYS A CA 4  
ATOM 6349   C CA . ALA A 1 1440 ? 130.640 136.829 147.673 1.00 0.00 ? 1440 ALA A CA 4  
ATOM 6350   C CA . ARG A 1 1441 ? 128.572 134.259 149.640 1.00 0.00 ? 1441 ARG A CA 4  
ATOM 6351   C CA . ALA A 1 1442 ? 127.946 136.485 152.580 1.00 0.00 ? 1442 ALA A CA 4  
ATOM 6352   C CA . SER A 1 1443 ? 127.187 140.160 151.952 1.00 0.00 ? 1443 SER A CA 4  
ATOM 6353   C CA . SER A 1 1444 ? 127.854 142.729 154.672 1.00 0.00 ? 1444 SER A CA 4  
ATOM 6354   C CA . SER A 1 1445 ? 128.087 139.822 157.169 1.00 0.00 ? 1445 SER A CA 4  
ATOM 6355   C CA . PRO A 1 1446 ? 131.041 140.147 159.669 1.00 0.00 ? 1446 PRO A CA 4  
ATOM 6356   C CA . VAL A 1 1447 ? 134.103 138.111 159.452 1.00 0.00 ? 1447 VAL A CA 4  
ATOM 6357   C CA . ILE A 1 1448 ? 136.502 137.235 162.257 1.00 0.00 ? 1448 ILE A CA 4  
ATOM 6358   C CA . LEU A 1 1449 ? 139.994 136.135 161.221 1.00 0.00 ? 1449 LEU A CA 4  
ATOM 6359   C CA . VAL A 1 1450 ? 141.543 133.501 163.498 1.00 0.00 ? 1450 VAL A CA 4  
ATOM 6360   C CA . GLY A 1 1451 ? 145.248 132.689 163.069 1.00 0.00 ? 1451 GLY A CA 4  
ATOM 6361   C CA . THR A 1 1452 ? 145.666 129.177 164.512 1.00 0.00 ? 1452 THR A CA 4  
ATOM 6362   C CA . HIS A 1 1453 ? 148.543 126.943 165.713 1.00 0.00 ? 1453 HIS A CA 4  
ATOM 6363   C CA . LEU A 1 1454 ? 150.599 129.908 166.903 1.00 0.00 ? 1454 LEU A CA 4  
ATOM 6364   C CA . ASP A 1 1455 ? 152.543 127.724 169.407 1.00 0.00 ? 1455 ASP A CA 4  
ATOM 6365   C CA . VAL A 1 1456 ? 154.300 125.879 166.517 1.00 0.00 ? 1456 VAL A CA 4  
ATOM 6366   C CA . SER A 1 1457 ? 155.287 129.225 164.962 1.00 0.00 ? 1457 SER A CA 4  
ATOM 6367   C CA . ASP A 1 1458 ? 156.898 130.888 168.036 1.00 0.00 ? 1458 ASP A CA 4  
ATOM 6368   C CA . GLU A 1 1459 ? 154.486 133.858 167.691 1.00 0.00 ? 1459 GLU A CA 4  
ATOM 6369   C CA . LYS A 1 1460 ? 156.050 134.792 164.300 1.00 0.00 ? 1460 LYS A CA 4  
ATOM 6370   C CA . GLN A 1 1461 ? 153.195 134.239 161.821 1.00 0.00 ? 1461 GLN A CA 4  
ATOM 6371   C CA . ARG A 1 1462 ? 150.955 136.752 163.580 1.00 0.00 ? 1462 ARG A CA 4  
ATOM 6372   C CA . LYS A 1 1463 ? 153.262 139.674 162.864 1.00 0.00 ? 1463 LYS A CA 4  
ATOM 6373   C CA . ALA A 1 1464 ? 152.548 142.491 160.343 1.00 0.00 ? 1464 ALA A CA 4  
ATOM 6374   C CA . CYS A 1 1465 ? 155.435 141.083 158.280 1.00 0.00 ? 1465 CYS A CA 4  
ATOM 6375   C CA . MET A 1 1466 ? 153.436 137.908 157.415 1.00 0.00 ? 1466 MET A CA 4  
ATOM 6376   C CA . SER A 1 1467 ? 149.821 138.756 158.337 1.00 0.00 ? 1467 SER A CA 4  
ATOM 6377   C CA . LYS A 1 1468 ? 148.811 141.912 156.471 1.00 0.00 ? 1468 LYS A CA 4  
ATOM 6378   C CA . ILE A 1 1469 ? 146.034 142.988 158.935 1.00 0.00 ? 1469 ILE A CA 4  
ATOM 6379   C CA . THR A 1 1470 ? 145.810 146.762 158.304 1.00 0.00 ? 1470 THR A CA 4  
ATOM 6380   C CA . LYS A 1 1471 ? 147.704 146.719 155.049 1.00 0.00 ? 1471 LYS A CA 4  
ATOM 6381   C CA . GLU A 1 1472 ? 145.549 144.137 153.090 1.00 0.00 ? 1472 GLU A CA 4  
ATOM 6382   C CA . LEU A 1 1473 ? 142.944 142.465 155.358 1.00 0.00 ? 1473 LEU A CA 4  
ATOM 6383   C CA . LEU A 1 1474 ? 140.988 145.425 156.877 1.00 0.00 ? 1474 LEU A CA 4  
ATOM 6384   C CA . ASN A 1 1475 ? 138.958 148.509 155.747 1.00 0.00 ? 1475 ASN A CA 4  
ATOM 6385   C CA . LYS A 1 1476 ? 142.040 150.333 154.325 1.00 0.00 ? 1476 LYS A CA 4  
ATOM 6386   C CA . ARG A 1 1477 ? 142.322 147.784 151.485 1.00 0.00 ? 1477 ARG A CA 4  
ATOM 6387   C CA . GLY A 1 1478 ? 138.758 146.781 150.734 1.00 0.00 ? 1478 GLY A CA 4  
ATOM 6388   C CA . PHE A 1 1479 ? 137.902 144.322 153.536 1.00 0.00 ? 1479 PHE A CA 4  
ATOM 6389   C CA . PRO A 1 1480 ? 135.363 146.362 155.569 1.00 0.00 ? 1480 PRO A CA 4  
ATOM 6390   C CA . ALA A 1 1481 ? 133.361 143.792 157.556 1.00 0.00 ? 1481 ALA A CA 4  
ATOM 6391   C CA . ILE A 1 1482 ? 136.301 142.336 159.544 1.00 0.00 ? 1482 ILE A CA 4  
ATOM 6392   C CA . ARG A 1 1483 ? 137.519 144.785 162.281 1.00 0.00 ? 1483 ARG A CA 4  
ATOM 6393   C CA . ASP A 1 1484 ? 138.785 141.804 164.365 1.00 0.00 ? 1484 ASP A CA 4  
ATOM 6394   C CA . TYR A 1 1485 ? 141.816 139.480 164.259 1.00 0.00 ? 1485 TYR A CA 4  
ATOM 6395   C CA . HIS A 1 1486 ? 142.888 136.675 166.631 1.00 0.00 ? 1486 HIS A CA 4  
ATOM 6396   C CA . PHE A 1 1487 ? 146.084 134.796 167.185 1.00 0.00 ? 1487 PHE A CA 4  
ATOM 6397   C CA . VAL A 1 1488 ? 145.487 131.599 169.118 1.00 0.00 ? 1488 VAL A CA 4  
ATOM 6398   C CA . ASN A 1 1489 ? 147.710 128.852 170.557 1.00 0.00 ? 1489 ASN A CA 4  
ATOM 6399   C CA . ALA A 1 1490 ? 145.357 126.223 171.954 1.00 0.00 ? 1490 ALA A CA 4  
ATOM 6400   C CA . THR A 1 1491 ? 147.712 123.878 173.777 1.00 0.00 ? 1491 THR A CA 4  
ATOM 6401   C CA . GLU A 1 1492 ? 149.720 126.682 175.398 1.00 0.00 ? 1492 GLU A CA 4  
ATOM 6402   C CA . GLU A 1 1493 ? 146.940 128.837 176.883 1.00 0.00 ? 1493 GLU A CA 4  
ATOM 6403   C CA . SER A 1 1494 ? 143.228 129.632 176.305 1.00 0.00 ? 1494 SER A CA 4  
ATOM 6404   C CA . ASP A 1 1495 ? 143.471 133.380 176.958 1.00 0.00 ? 1495 ASP A CA 4  
ATOM 6405   C CA . ALA A 1 1496 ? 143.350 134.457 173.280 1.00 0.00 ? 1496 ALA A CA 4  
ATOM 6406   C CA . LEU A 1 1497 ? 140.304 132.199 172.677 1.00 0.00 ? 1497 LEU A CA 4  
ATOM 6407   C CA . ALA A 1 1498 ? 138.338 134.096 175.331 1.00 0.00 ? 1498 ALA A CA 4  
ATOM 6408   C CA . LYS A 1 1499 ? 139.054 137.163 173.127 1.00 0.00 ? 1499 LYS A CA 4  
ATOM 6409   C CA . LEU A 1 1500 ? 137.296 135.342 170.217 1.00 0.00 ? 1500 LEU A CA 4  
ATOM 6410   C CA . ARG A 1 1501 ? 134.165 135.425 172.396 1.00 0.00 ? 1501 ARG A CA 4  
ATOM 6411   C CA . LYS A 1 1502 ? 134.390 139.272 172.474 1.00 0.00 ? 1502 LYS A CA 4  
ATOM 6412   C CA . THR A 1 1503 ? 134.282 139.318 168.662 1.00 0.00 ? 1503 THR A CA 4  
ATOM 6413   C CA . ILE A 1 1504 ? 131.333 136.855 168.718 1.00 0.00 ? 1504 ILE A CA 4  
ATOM 6414   C CA . ILE A 1 1505 ? 129.815 139.480 171.087 1.00 0.00 ? 1505 ILE A CA 4  
ATOM 6415   C CA . ASN A 1 1506 ? 130.677 142.355 168.631 1.00 0.00 ? 1506 ASN A CA 4  
ATOM 6416   C CA . GLU A 1 1507 ? 128.824 140.497 165.889 1.00 0.00 ? 1507 GLU A CA 4  
ATOM 6417   C CA . SER A 1 1508 ? 125.221 139.067 166.208 1.00 0.00 ? 1508 SER A CA 4  
ATOM 6418   C CA . LEU A 1 1509 ? 124.412 142.743 167.006 1.00 0.00 ? 1509 LEU A CA 4  
ATOM 6419   C CA . ASN A 1 1510 ? 123.624 143.848 163.435 1.00 0.00 ? 1510 ASN A CA 4  
ATOM 6420   C CA . PHE A 1 1511 ? 122.130 140.416 162.416 1.00 0.00 ? 1511 PHE A CA 4  
ATOM 6421   C CA . LYS A 1 1512 ? 119.396 139.676 164.864 1.00 0.00 ? 1512 LYS A CA 4  
ATOM 6422   C CA . ILE A 1 1513 ? 118.915 142.595 167.344 1.00 0.00 ? 1513 ILE A CA 4  
ATOM 6423   C CA . ARG A 1 1514 ? 117.630 145.156 164.801 1.00 0.00 ? 1514 ARG A CA 4  
ATOM 6424   C CA . PRO A 1 1524 ? 124.812 151.812 187.259 1.00 0.00 ? 1524 PRO A CA 4  
ATOM 6425   C CA . ASP A 1 1525 ? 121.103 152.725 186.779 1.00 0.00 ? 1525 ASP A CA 4  
ATOM 6426   C CA . CYS A 1 1526 ? 122.021 156.138 185.254 1.00 0.00 ? 1526 CYS A CA 4  
ATOM 6427   C CA . TYR A 1 1527 ? 123.885 154.459 182.315 1.00 0.00 ? 1527 TYR A CA 4  
ATOM 6428   C CA . VAL A 1 1528 ? 120.824 152.198 181.577 1.00 0.00 ? 1528 VAL A CA 4  
ATOM 6429   C CA . GLU A 1 1529 ? 118.408 155.180 181.934 1.00 0.00 ? 1529 GLU A CA 4  
ATOM 6430   C CA . LEU A 1 1530 ? 120.473 157.320 179.590 1.00 0.00 ? 1530 LEU A CA 4  
ATOM 6431   C CA . GLU A 1 1531 ? 120.878 154.441 177.066 1.00 0.00 ? 1531 GLU A CA 4  
ATOM 6432   C CA . LYS A 1 1532 ? 117.066 154.016 176.857 1.00 0.00 ? 1532 LYS A CA 4  
ATOM 6433   C CA . ILE A 1 1533 ? 116.435 157.772 176.412 1.00 0.00 ? 1533 ILE A CA 4  
ATOM 6434   C CA . ILE A 1 1534 ? 119.253 158.006 173.832 1.00 0.00 ? 1534 ILE A CA 4  
ATOM 6435   C CA . LEU A 1 1535 ? 117.805 155.025 171.871 1.00 0.00 ? 1535 LEU A CA 4  
ATOM 6436   C CA . SER A 1 1536 ? 114.250 156.473 171.918 1.00 0.00 ? 1536 SER A CA 4  
ATOM 6437   C CA . GLU A 1 1537 ? 115.490 159.956 170.823 1.00 0.00 ? 1537 GLU A CA 4  
ATOM 6438   C CA . ARG A 1 1538 ? 117.816 158.456 168.181 1.00 0.00 ? 1538 ARG A CA 4  
ATOM 6439   C CA . LYS A 1 1539 ? 115.427 155.998 166.475 1.00 0.00 ? 1539 LYS A CA 4  
ATOM 6440   C CA . ASN A 1 1540 ? 112.811 158.778 166.163 1.00 0.00 ? 1540 ASN A CA 4  
ATOM 6441   C CA . VAL A 1 1541 ? 115.228 160.758 163.949 1.00 0.00 ? 1541 VAL A CA 4  
ATOM 6442   C CA . PRO A 1 1542 ? 115.563 158.340 160.913 1.00 0.00 ? 1542 PRO A CA 4  
ATOM 6443   C CA . ILE A 1 1543 ? 114.878 161.082 158.418 1.00 0.00 ? 1543 ILE A CA 4  
ATOM 6444   C CA . GLU A 1 1544 ? 117.591 163.390 159.598 1.00 0.00 ? 1544 GLU A CA 4  
ATOM 6445   C CA . PHE A 1 1545 ? 121.302 163.048 160.595 1.00 0.00 ? 1545 PHE A CA 4  
ATOM 6446   C CA . PRO A 1 1546 ? 121.686 165.130 163.850 1.00 0.00 ? 1546 PRO A CA 4  
ATOM 6447   C CA . VAL A 1 1547 ? 119.784 162.442 165.559 1.00 0.00 ? 1547 VAL A CA 4  
ATOM 6448   C CA . ILE A 1 1548 ? 121.259 163.853 168.717 1.00 0.00 ? 1548 ILE A CA 4  
ATOM 6449   C CA . ASP A 1 1549 ? 123.278 167.101 168.779 1.00 0.00 ? 1549 ASP A CA 4  
ATOM 6450   C CA . ARG A 1 1550 ? 125.789 167.942 171.569 1.00 0.00 ? 1550 ARG A CA 4  
ATOM 6451   C CA . LYS A 1 1551 ? 123.345 170.106 173.567 1.00 0.00 ? 1551 LYS A CA 4  
ATOM 6452   C CA . ARG A 1 1552 ? 120.586 167.514 173.373 1.00 0.00 ? 1552 ARG A CA 4  
ATOM 6453   C CA . LEU A 1 1553 ? 122.662 164.607 174.844 1.00 0.00 ? 1553 LEU A CA 4  
ATOM 6454   C CA . LEU A 1 1554 ? 124.011 166.986 177.532 1.00 0.00 ? 1554 LEU A CA 4  
ATOM 6455   C CA . GLN A 1 1555 ? 120.369 167.676 178.461 1.00 0.00 ? 1555 GLN A CA 4  
ATOM 6456   C CA . LEU A 1 1556 ? 119.510 163.917 178.628 1.00 0.00 ? 1556 LEU A CA 4  
ATOM 6457   C CA . VAL A 1 1557 ? 122.678 163.171 180.696 1.00 0.00 ? 1557 VAL A CA 4  
ATOM 6458   C CA . ARG A 1 1558 ? 121.663 165.896 183.226 1.00 0.00 ? 1558 ARG A CA 4  
ATOM 6459   C CA . GLU A 1 1559 ? 118.120 164.515 183.640 1.00 0.00 ? 1559 GLU A CA 4  
ATOM 6460   C CA . ASN A 1 1560 ? 119.636 161.174 184.785 1.00 0.00 ? 1560 ASN A CA 4  
ATOM 6461   C CA . GLN A 1 1561 ? 122.155 163.041 187.038 1.00 0.00 ? 1561 GLN A CA 4  
ATOM 6462   C CA . LEU A 1 1562 ? 125.320 162.445 184.907 1.00 0.00 ? 1562 LEU A CA 4  
ATOM 6463   C CA . GLN A 1 1563 ? 126.187 166.103 184.040 1.00 0.00 ? 1563 GLN A CA 4  
ATOM 6464   C CA . LEU A 1 1564 ? 128.308 166.014 187.225 1.00 0.00 ? 1564 LEU A CA 4  
ATOM 6465   C CA . ASP A 1 1565 ? 131.399 164.979 185.242 1.00 0.00 ? 1565 ASP A CA 4  
ATOM 6466   C CA . GLU A 1 1566 ? 132.115 165.619 181.518 1.00 0.00 ? 1566 GLU A CA 4  
ATOM 6467   C CA . ASN A 1 1567 ? 134.722 162.879 181.812 1.00 0.00 ? 1567 ASN A CA 4  
ATOM 6468   C CA . GLU A 1 1568 ? 132.142 160.079 182.637 1.00 0.00 ? 1568 GLU A CA 4  
ATOM 6469   C CA . LEU A 1 1569 ? 129.862 161.151 179.806 1.00 0.00 ? 1569 LEU A CA 4  
ATOM 6470   C CA . PRO A 1 1570 ? 132.633 160.401 177.159 1.00 0.00 ? 1570 PRO A CA 4  
ATOM 6471   C CA . HIS A 1 1571 ? 133.133 157.049 178.902 1.00 0.00 ? 1571 HIS A CA 4  
ATOM 6472   C CA . ALA A 1 1572 ? 129.376 156.210 178.879 1.00 0.00 ? 1572 ALA A CA 4  
ATOM 6473   C CA . VAL A 1 1573 ? 128.997 157.193 175.198 1.00 0.00 ? 1573 VAL A CA 4  
ATOM 6474   C CA . HIS A 1 1574 ? 132.356 155.452 174.412 1.00 0.00 ? 1574 HIS A CA 4  
ATOM 6475   C CA . PHE A 1 1575 ? 130.798 152.291 175.976 1.00 0.00 ? 1575 PHE A CA 4  
ATOM 6476   C CA . LEU A 1 1576 ? 127.538 152.692 174.067 1.00 0.00 ? 1576 LEU A CA 4  
ATOM 6477   C CA . ASN A 1 1577 ? 129.525 153.213 170.839 1.00 0.00 ? 1577 ASN A CA 4  
ATOM 6478   C CA . GLU A 1 1578 ? 131.787 150.145 171.528 1.00 0.00 ? 1578 GLU A CA 4  
ATOM 6479   C CA . SER A 1 1579 ? 128.597 148.101 172.047 1.00 0.00 ? 1579 SER A CA 4  
ATOM 6480   C CA . GLY A 1 1580 ? 126.815 149.438 168.881 1.00 0.00 ? 1580 GLY A CA 4  
ATOM 6481   C CA . VAL A 1 1581 ? 123.759 150.646 170.812 1.00 0.00 ? 1581 VAL A CA 4  
ATOM 6482   C CA . LEU A 1 1582 ? 124.492 154.095 169.468 1.00 0.00 ? 1582 LEU A CA 4  
ATOM 6483   C CA . LEU A 1 1583 ? 127.314 155.427 167.343 1.00 0.00 ? 1583 LEU A CA 4  
ATOM 6484   C CA . HIS A 1 1584 ? 129.633 158.197 168.586 1.00 0.00 ? 1584 HIS A CA 4  
ATOM 6485   C CA . PHE A 1 1585 ? 132.667 159.153 166.574 1.00 0.00 ? 1585 PHE A CA 4  
ATOM 6486   C CA . GLN A 1 1586 ? 135.292 160.772 168.822 1.00 0.00 ? 1586 GLN A CA 4  
ATOM 6487   C CA . ASP A 1 1587 ? 137.718 161.446 165.892 1.00 0.00 ? 1587 ASP A CA 4  
ATOM 6488   C CA . PRO A 1 1588 ? 135.305 163.836 163.926 1.00 0.00 ? 1588 PRO A CA 4  
ATOM 6489   C CA . ALA A 1 1589 ? 133.882 165.208 167.246 1.00 0.00 ? 1589 ALA A CA 4  
ATOM 6490   C CA . LEU A 1 1590 ? 136.365 168.135 167.361 1.00 0.00 ? 1590 LEU A CA 4  
ATOM 6491   C CA . GLN A 1 1591 ? 134.404 170.125 164.740 1.00 0.00 ? 1591 GLN A CA 4  
ATOM 6492   C CA . LEU A 1 1592 ? 131.003 168.437 164.931 1.00 0.00 ? 1592 LEU A CA 4  
ATOM 6493   C CA . SER A 1 1593 ? 128.533 169.336 167.736 1.00 0.00 ? 1593 SER A CA 4  
ATOM 6494   C CA . ASP A 1 1594 ? 125.567 169.251 165.312 1.00 0.00 ? 1594 ASP A CA 4  
ATOM 6495   C CA . LEU A 1 1595 ? 125.942 165.513 164.691 1.00 0.00 ? 1595 LEU A CA 4  
ATOM 6496   C CA . TYR A 1 1596 ? 127.371 164.055 167.863 1.00 0.00 ? 1596 TYR A CA 4  
ATOM 6497   C CA . PHE A 1 1597 ? 125.719 160.672 168.463 1.00 0.00 ? 1597 PHE A CA 4  
ATOM 6498   C CA . VAL A 1 1598 ? 124.127 158.543 165.713 1.00 0.00 ? 1598 VAL A CA 4  
ATOM 6499   C CA . GLU A 1 1599 ? 121.443 155.830 165.055 1.00 0.00 ? 1599 GLU A CA 4  
ATOM 6500   C CA . PRO A 1 1600 ? 123.279 152.651 163.805 1.00 0.00 ? 1600 PRO A CA 4  
ATOM 6501   C CA . LYS A 1 1601 ? 120.475 151.728 161.364 1.00 0.00 ? 1601 LYS A CA 4  
ATOM 6502   C CA . TRP A 1 1602 ? 120.541 155.167 159.776 1.00 0.00 ? 1602 TRP A CA 4  
ATOM 6503   C CA . LEU A 1 1603 ? 124.365 154.982 159.327 1.00 0.00 ? 1603 LEU A CA 4  
ATOM 6504   C CA . CYS A 1 1604 ? 124.319 151.388 157.979 1.00 0.00 ? 1604 CYS A CA 4  
ATOM 6505   C CA . LYS A 1 1605 ? 121.556 152.088 155.414 1.00 0.00 ? 1605 LYS A CA 4  
ATOM 6506   C CA . ILE A 1 1606 ? 123.527 155.150 154.220 1.00 0.00 ? 1606 ILE A CA 4  
ATOM 6507   C CA . MET A 1 1607 ? 126.653 153.312 153.378 1.00 0.00 ? 1607 MET A CA 4  
ATOM 6508   C CA . ALA A 1 1608 ? 125.002 150.263 151.887 1.00 0.00 ? 1608 ALA A CA 4  
ATOM 6509   C CA . GLN A 1 1609 ? 123.213 152.657 149.456 1.00 0.00 ? 1609 GLN A CA 4  
ATOM 6510   C CA . ILE A 1 1610 ? 126.611 154.184 148.473 1.00 0.00 ? 1610 ILE A CA 4  
ATOM 6511   C CA . LEU A 1 1611 ? 128.174 150.689 148.155 1.00 0.00 ? 1611 LEU A CA 4  
ATOM 6512   C CA . THR A 1 1612 ? 125.343 149.277 145.958 1.00 0.00 ? 1612 THR A CA 4  
ATOM 6513   C CA . VAL A 1 1613 ? 124.735 152.357 143.797 1.00 0.00 ? 1613 VAL A CA 4  
ATOM 6514   C CA . LYS A 1 1614 ? 124.985 151.926 139.988 1.00 0.00 ? 1614 LYS A CA 4  
ATOM 6515   C CA . VAL A 1 1615 ? 126.947 155.205 139.719 1.00 0.00 ? 1615 VAL A CA 4  
ATOM 6516   C CA . GLU A 1 1616 ? 130.449 154.001 140.666 1.00 0.00 ? 1616 GLU A CA 4  
ATOM 6517   C CA . GLY A 1 1617 ? 132.112 156.174 138.007 1.00 0.00 ? 1617 GLY A CA 4  
ATOM 6518   C CA . CYS A 1 1618 ? 132.002 157.758 134.564 1.00 0.00 ? 1618 CYS A CA 4  
ATOM 6519   C CA . PRO A 1 1619 ? 129.746 155.952 131.942 1.00 0.00 ? 1619 PRO A CA 4  
ATOM 6520   C CA . LYS A 1 1620 ? 132.364 153.682 130.262 1.00 0.00 ? 1620 LYS A CA 4  
ATOM 6521   C CA . HIS A 1 1621 ? 134.619 153.168 133.317 1.00 0.00 ? 1621 HIS A CA 4  
ATOM 6522   C CA . PRO A 1 1622 ? 132.746 152.572 136.641 1.00 0.00 ? 1622 PRO A CA 4  
ATOM 6523   C CA . LYS A 1 1623 ? 135.497 151.019 138.795 1.00 0.00 ? 1623 LYS A CA 4  
ATOM 6524   C CA . GLY A 1 1624 ? 134.660 151.937 142.437 1.00 0.00 ? 1624 GLY A CA 4  
ATOM 6525   C CA . ILE A 1 1625 ? 134.691 155.717 141.816 1.00 0.00 ? 1625 ILE A CA 4  
ATOM 6526   C CA . ILE A 1 1626 ? 132.380 157.910 143.938 1.00 0.00 ? 1626 ILE A CA 4  
ATOM 6527   C CA . SER A 1 1627 ? 131.717 161.269 142.242 1.00 0.00 ? 1627 SER A CA 4  
ATOM 6528   C CA . ARG A 1 1628 ? 130.819 163.588 145.181 1.00 0.00 ? 1628 ARG A CA 4  
ATOM 6529   C CA . ARG A 1 1629 ? 128.150 165.525 143.192 1.00 0.00 ? 1629 ARG A CA 4  
ATOM 6530   C CA . ASP A 1 1630 ? 125.938 162.573 142.685 1.00 0.00 ? 1630 ASP A CA 4  
ATOM 6531   C CA . VAL A 1 1631 ? 125.423 161.738 146.427 1.00 0.00 ? 1631 VAL A CA 4  
ATOM 6532   C CA . GLU A 1 1632 ? 122.016 163.525 146.479 1.00 0.00 ? 1632 GLU A CA 4  
ATOM 6533   C CA . LYS A 1 1633 ? 120.668 161.110 143.857 1.00 0.00 ? 1633 LYS A CA 4  
ATOM 6534   C CA . PHE A 1 1634 ? 122.192 157.947 145.442 1.00 0.00 ? 1634 PHE A CA 4  
ATOM 6535   C CA . LEU A 1 1635 ? 120.978 158.544 148.924 1.00 0.00 ? 1635 LEU A CA 4  
ATOM 6536   C CA . SER A 1 1636 ? 117.593 160.342 148.476 1.00 0.00 ? 1636 SER A CA 4  
ATOM 6537   C CA . LYS A 1 1637 ? 114.506 159.899 148.729 1.00 0.00 ? 1637 LYS A CA 4  
ATOM 6538   C CA . LYS A 1 1638 ? 114.815 156.244 149.997 1.00 0.00 ? 1638 LYS A CA 4  
ATOM 6539   C CA . ARG A 1 1639 ? 116.453 157.843 152.958 1.00 0.00 ? 1639 ARG A CA 4  
ATOM 6540   C CA . LYS A 1 1640 ? 116.630 161.561 153.686 1.00 0.00 ? 1640 LYS A CA 4  
ATOM 6541   C CA . PHE A 1 1641 ? 120.143 162.991 153.426 1.00 0.00 ? 1641 PHE A CA 4  
ATOM 6542   C CA . PRO A 1 1642 ? 120.632 166.749 153.217 1.00 0.00 ? 1642 PRO A CA 4  
ATOM 6543   C CA . LYS A 1 1643 ? 123.983 168.233 152.056 1.00 0.00 ? 1643 LYS A CA 4  
ATOM 6544   C CA . ASN A 1 1644 ? 125.737 168.545 155.476 1.00 0.00 ? 1644 ASN A CA 4  
ATOM 6545   C CA . TYR A 1 1645 ? 124.622 164.985 156.314 1.00 0.00 ? 1645 TYR A CA 4  
ATOM 6546   C CA . MET A 1 1646 ? 126.074 163.979 152.925 1.00 0.00 ? 1646 MET A CA 4  
ATOM 6547   C CA . SER A 1 1647 ? 129.536 165.422 153.731 1.00 0.00 ? 1647 SER A CA 4  
ATOM 6548   C CA . GLN A 1 1648 ? 129.622 163.622 157.130 1.00 0.00 ? 1648 GLN A CA 4  
ATOM 6549   C CA . TYR A 1 1649 ? 128.630 160.103 155.897 1.00 0.00 ? 1649 TYR A CA 4  
ATOM 6550   C CA . PHE A 1 1650 ? 131.691 160.250 153.629 1.00 0.00 ? 1650 PHE A CA 4  
ATOM 6551   C CA . LYS A 1 1651 ? 133.787 160.835 156.779 1.00 0.00 ? 1651 LYS A CA 4  
ATOM 6552   C CA . LEU A 1 1652 ? 132.081 157.750 158.287 1.00 0.00 ? 1652 LEU A CA 4  
ATOM 6553   C CA . LEU A 1 1653 ? 133.074 155.725 155.144 1.00 0.00 ? 1653 LEU A CA 4  
ATOM 6554   C CA . GLU A 1 1654 ? 136.685 156.948 155.569 1.00 0.00 ? 1654 GLU A CA 4  
ATOM 6555   C CA . LYS A 1 1655 ? 136.571 155.983 159.255 1.00 0.00 ? 1655 LYS A CA 4  
ATOM 6556   C CA . PHE A 1 1656 ? 135.005 152.543 158.478 1.00 0.00 ? 1656 PHE A CA 4  
ATOM 6557   C CA . GLN A 1 1657 ? 137.850 152.139 155.894 1.00 0.00 ? 1657 GLN A CA 4  
ATOM 6558   C CA . ILE A 1 1658 ? 135.462 151.660 152.970 1.00 0.00 ? 1658 ILE A CA 4  
ATOM 6559   C CA . ALA A 1 1659 ? 136.788 154.561 150.895 1.00 0.00 ? 1659 ALA A CA 4  
ATOM 6560   C CA . LEU A 1 1660 ? 139.597 157.138 150.590 1.00 0.00 ? 1660 LEU A CA 4  
ATOM 6561   C CA . PRO A 1 1661 ? 139.845 160.623 148.955 1.00 0.00 ? 1661 PRO A CA 4  
ATOM 6562   C CA . ILE A 1 1662 ? 142.188 161.249 145.974 1.00 0.00 ? 1662 ILE A CA 4  
ATOM 6563   C CA . GLY A 1 1663 ? 141.448 165.011 145.964 1.00 0.00 ? 1663 GLY A CA 4  
ATOM 6564   C CA . GLU A 1 1664 ? 139.327 165.836 142.880 1.00 0.00 ? 1664 GLU A CA 4  
ATOM 6565   C CA . GLU A 1 1665 ? 135.886 165.323 144.587 1.00 0.00 ? 1665 GLU A CA 4  
ATOM 6566   C CA . TYR A 1 1666 ? 136.274 161.688 143.491 1.00 0.00 ? 1666 TYR A CA 4  
ATOM 6567   C CA . LEU A 1 1667 ? 136.701 158.892 146.050 1.00 0.00 ? 1667 LEU A CA 4  
ATOM 6568   C CA . LEU A 1 1668 ? 137.887 155.303 145.619 1.00 0.00 ? 1668 LEU A CA 4  
ATOM 6569   C CA . VAL A 1 1669 ? 135.859 152.386 147.057 1.00 0.00 ? 1669 VAL A CA 4  
ATOM 6570   C CA . ILE A 1 1690 ? 155.171 133.208 156.394 1.00 0.00 ? 1690 ILE A CA 4  
ATOM 6571   C CA . ILE A 1 1691 ? 158.692 133.888 154.935 1.00 0.00 ? 1691 ILE A CA 4  
ATOM 6572   C CA . ILE A 1 1692 ? 160.060 137.096 156.450 1.00 0.00 ? 1692 ILE A CA 4  
ATOM 6573   C CA . ARG A 1 1693 ? 163.307 138.715 155.262 1.00 0.00 ? 1693 ARG A CA 4  
ATOM 6574   C CA . LEU A 1 1694 ? 164.583 142.046 156.659 1.00 0.00 ? 1694 LEU A CA 4  
ATOM 6575   C CA . TYR A 1 1695 ? 167.198 144.443 155.151 1.00 0.00 ? 1695 TYR A CA 4  
ATOM 6576   C CA . GLU A 1 1696 ? 168.983 146.934 157.516 1.00 0.00 ? 1696 GLU A CA 4  
ATOM 6577   C CA . MET A 1 1697 ? 170.346 150.132 155.891 1.00 0.00 ? 1697 MET A CA 4  
ATOM 6578   C CA . PRO A 1 1698 ? 172.510 152.762 157.889 1.00 0.00 ? 1698 PRO A CA 4  
ATOM 6579   C CA . TYR A 1 1699 ? 170.762 155.214 155.672 1.00 0.00 ? 1699 TYR A CA 4  
ATOM 6580   C CA . PHE A 1 1700 ? 167.432 154.208 154.047 1.00 0.00 ? 1700 PHE A CA 4  
ATOM 6581   C CA . PRO A 1 1701 ? 166.843 156.462 150.938 1.00 0.00 ? 1701 PRO A CA 4  
ATOM 6582   C CA . MET A 1 1702 ? 163.255 157.750 150.878 1.00 0.00 ? 1702 MET A CA 4  
ATOM 6583   C CA . GLY A 1 1703 ? 163.225 157.016 147.140 1.00 0.00 ? 1703 GLY A CA 4  
ATOM 6584   C CA . PHE A 1 1704 ? 163.582 153.205 147.608 1.00 0.00 ? 1704 PHE A CA 4  
ATOM 6585   C CA . TRP A 1 1705 ? 159.905 152.403 148.165 1.00 0.00 ? 1705 TRP A CA 4  
ATOM 6586   C CA . SER A 1 1706 ? 158.705 154.887 145.601 1.00 0.00 ? 1706 SER A CA 4  
ATOM 6587   C CA . ARG A 1 1707 ? 161.032 153.378 142.985 1.00 0.00 ? 1707 ARG A CA 4  
ATOM 6588   C CA . LEU A 1 1708 ? 160.285 149.757 143.939 1.00 0.00 ? 1708 LEU A CA 4  
ATOM 6589   C CA . ILE A 1 1709 ? 156.541 150.567 143.664 1.00 0.00 ? 1709 ILE A CA 4  
ATOM 6590   C CA . ASN A 1 1710 ? 157.289 151.751 140.081 1.00 0.00 ? 1710 ASN A CA 4  
ATOM 6591   C CA . ARG A 1 1711 ? 159.347 148.616 139.177 1.00 0.00 ? 1711 ARG A CA 4  
ATOM 6592   C CA . LEU A 1 1712 ? 156.529 146.448 140.585 1.00 0.00 ? 1712 LEU A CA 4  
ATOM 6593   C CA . LEU A 1 1713 ? 153.425 148.493 139.492 1.00 0.00 ? 1713 LEU A CA 4  
ATOM 6594   C CA . GLU A 1 1714 ? 151.850 145.573 137.629 1.00 0.00 ? 1714 GLU A CA 4  
ATOM 6595   C CA . ILE A 1 1715 ? 151.655 143.284 140.709 1.00 0.00 ? 1715 ILE A CA 4  
ATOM 6596   C CA . SER A 1 1716 ? 150.137 145.762 143.220 1.00 0.00 ? 1716 SER A CA 4  
ATOM 6597   C CA . PRO A 1 1717 ? 146.430 145.243 142.292 1.00 0.00 ? 1717 PRO A CA 4  
ATOM 6598   C CA . TYR A 1 1718 ? 147.220 141.635 141.359 1.00 0.00 ? 1718 TYR A CA 4  
ATOM 6599   C CA . MET A 1 1719 ? 148.770 139.769 138.460 1.00 0.00 ? 1719 MET A CA 4  
ATOM 6600   C CA . LEU A 1 1720 ? 146.773 136.488 138.896 1.00 0.00 ? 1720 LEU A CA 4  
ATOM 6601   C CA . SER A 1 1721 ? 143.070 136.222 138.195 1.00 0.00 ? 1721 SER A CA 4  
ATOM 6602   C CA . GLY A 1 1722 ? 143.137 133.792 141.207 1.00 0.00 ? 1722 GLY A CA 4  
ATOM 6603   C CA . ARG A 1 1723 ? 142.803 136.257 144.036 1.00 0.00 ? 1723 ARG A CA 4  
ATOM 6604   C CA . GLU A 1 1724 ? 141.905 134.981 147.520 1.00 0.00 ? 1724 GLU A CA 4  
ATOM 6605   C CA . ARG A 1 1725 ? 142.380 138.039 149.735 1.00 0.00 ? 1725 ARG A CA 4  
ATOM 6606   C CA . ALA A 1 1726 ? 140.536 141.298 148.953 1.00 0.00 ? 1726 ALA A CA 4  
ATOM 6607   C CA . LEU A 1 1727 ? 142.615 143.425 151.348 1.00 0.00 ? 1727 LEU A CA 4  
ATOM 6608   C CA . ARG A 1 1728 ? 146.290 142.915 150.457 1.00 0.00 ? 1728 ARG A CA 4  
ATOM 6609   C CA . PRO A 1 1729 ? 146.369 143.666 146.651 1.00 0.00 ? 1729 PRO A CA 4  
ATOM 6610   C CA . ASN A 1 1730 ? 143.798 146.240 145.164 1.00 0.00 ? 1730 ASN A CA 4  
ATOM 6611   C CA . ARG A 1 1731 ? 145.554 149.632 145.214 1.00 0.00 ? 1731 ARG A CA 4  
ATOM 6612   C CA . MET A 1 1732 ? 147.052 148.668 148.505 1.00 0.00 ? 1732 MET A CA 4  
ATOM 6613   C CA . TYR A 1 1733 ? 150.065 150.753 148.382 1.00 0.00 ? 1733 TYR A CA 4  
ATOM 6614   C CA . TRP A 1 1734 ? 151.040 153.465 150.759 1.00 0.00 ? 1734 TRP A CA 4  
ATOM 6615   C CA . ARG A 1 1735 ? 153.979 155.776 151.492 1.00 0.00 ? 1735 ARG A CA 4  
ATOM 6616   C CA . GLN A 1 1736 ? 155.853 153.063 153.463 1.00 0.00 ? 1736 GLN A CA 4  
ATOM 6617   C CA . GLY A 1 1737 ? 154.871 149.894 151.539 1.00 0.00 ? 1737 GLY A CA 4  
ATOM 6618   C CA . ILE A 1 1738 ? 152.919 147.762 149.100 1.00 0.00 ? 1738 ILE A CA 4  
ATOM 6619   C CA . TYR A 1 1739 ? 151.194 144.387 148.725 1.00 0.00 ? 1739 TYR A CA 4  
ATOM 6620   C CA . LEU A 1 1740 ? 152.253 142.358 145.737 1.00 0.00 ? 1740 LEU A CA 4  
ATOM 6621   C CA . ASN A 1 1741 ? 150.535 139.361 144.094 1.00 0.00 ? 1741 ASN A CA 4  
ATOM 6622   C CA . TRP A 1 1742 ? 151.901 137.386 141.108 1.00 0.00 ? 1742 TRP A CA 4  
ATOM 6623   C CA . SER A 1 1743 ? 150.809 134.553 138.824 1.00 0.00 ? 1743 SER A CA 4  
ATOM 6624   C CA . PRO A 1 1744 ? 151.091 131.586 139.493 1.00 0.00 ? 1744 PRO A CA 4  
ATOM 6625   C CA . GLU A 1 1745 ? 150.769 130.292 142.232 1.00 0.00 ? 1745 GLU A CA 4  
ATOM 6626   C CA . ALA A 1 1746 ? 148.994 133.344 143.824 1.00 0.00 ? 1746 ALA A CA 4  
ATOM 6627   C CA . TYR A 1 1747 ? 151.665 134.223 146.286 1.00 0.00 ? 1747 TYR A CA 4  
ATOM 6628   C CA . CYS A 1 1748 ? 151.032 137.442 148.290 1.00 0.00 ? 1748 CYS A CA 4  
ATOM 6629   C CA . LEU A 1 1749 ? 154.002 139.598 149.394 1.00 0.00 ? 1749 LEU A CA 4  
ATOM 6630   C CA . VAL A 1 1750 ? 153.987 142.607 151.711 1.00 0.00 ? 1750 VAL A CA 4  
ATOM 6631   C CA . GLY A 1 1751 ? 156.899 144.960 151.471 1.00 0.00 ? 1751 GLY A CA 4  
ATOM 6632   C CA . SER A 1 1752 ? 157.117 147.525 154.276 1.00 0.00 ? 1752 SER A CA 4  
ATOM 6633   C CA . GLU A 1 1753 ? 160.313 149.515 154.932 1.00 0.00 ? 1753 GLU A CA 4  
ATOM 6634   C CA . VAL A 1 1754 ? 163.006 146.935 154.634 1.00 0.00 ? 1754 VAL A CA 4  
ATOM 6635   C CA . LEU A 1 1755 ? 160.669 144.107 155.690 1.00 0.00 ? 1755 LEU A CA 4  
ATOM 6636   C CA . ASP A 1 1756 ? 159.437 141.565 153.128 1.00 0.00 ? 1756 ASP A CA 4  
ATOM 6637   C CA . ASN A 1 1757 ? 156.796 139.073 154.415 1.00 0.00 ? 1757 ASN A CA 4  
ATOM 6638   C CA . HIS A 1 1758 ? 155.449 136.337 152.125 1.00 0.00 ? 1758 HIS A CA 4  
ATOM 6639   C CA . PRO A 1 1759 ? 152.566 133.639 152.253 1.00 0.00 ? 1759 PRO A CA 4  
ATOM 6640   C CA . GLU A 1 1760 ? 152.354 130.695 149.644 1.00 0.00 ? 1760 GLU A CA 4  
ATOM 6641   C CA . SER A 1 1761 ? 154.402 127.567 148.733 1.00 0.00 ? 1761 SER A CA 4  
ATOM 6642   C CA . PHE A 1 1762 ? 156.340 129.458 145.941 1.00 0.00 ? 1762 PHE A CA 4  
ATOM 6643   C CA . LEU A 1 1763 ? 157.843 131.764 148.553 1.00 0.00 ? 1763 LEU A CA 4  
ATOM 6644   C CA . LYS A 1 1764 ? 161.434 131.266 147.849 1.00 0.00 ? 1764 LYS A CA 4  
ATOM 6645   C CA . ILE A 1 1765 ? 161.352 132.234 144.118 1.00 0.00 ? 1765 ILE A CA 4  
ATOM 6646   C CA . THR A 1 1766 ? 159.245 135.342 144.795 1.00 0.00 ? 1766 THR A CA 4  
ATOM 6647   C CA . VAL A 1 1767 ? 161.600 136.768 147.370 1.00 0.00 ? 1767 VAL A CA 4  
ATOM 6648   C CA . PRO A 1 1768 ? 164.687 136.948 144.900 1.00 0.00 ? 1768 PRO A CA 4  
ATOM 6649   C CA . SER A 1 1769 ? 162.712 138.762 142.289 1.00 0.00 ? 1769 SER A CA 4  
ATOM 6650   C CA . CYS A 1 1770 ? 161.673 141.328 144.955 1.00 0.00 ? 1770 CYS A CA 4  
ATOM 6651   C CA . ARG A 1 1771 ? 165.185 141.128 146.561 1.00 0.00 ? 1771 ARG A CA 4  
ATOM 6652   C CA . LYS A 1 1772 ? 166.820 141.625 143.149 1.00 0.00 ? 1772 LYS A CA 4  
ATOM 6653   C CA . GLY A 1 1773 ? 164.636 144.681 142.355 1.00 0.00 ? 1773 GLY A CA 4  
ATOM 6654   C CA . CYS A 1 1774 ? 165.563 146.179 145.731 1.00 0.00 ? 1774 CYS A CA 4  
ATOM 6655   C CA . ILE A 1 1775 ? 169.296 145.442 145.170 1.00 0.00 ? 1775 ILE A CA 4  
ATOM 6656   C CA . LEU A 1 1776 ? 169.052 147.064 141.683 1.00 0.00 ? 1776 LEU A CA 4  
ATOM 6657   C CA . LEU A 1 1777 ? 167.707 150.283 143.245 1.00 0.00 ? 1777 LEU A CA 4  
ATOM 6658   C CA . GLY A 1 1778 ? 170.365 150.161 145.979 1.00 0.00 ? 1778 GLY A CA 4  
ATOM 6659   C CA . GLN A 1 1779 ? 173.126 150.148 143.328 1.00 0.00 ? 1779 GLN A CA 4  
ATOM 6660   C CA . VAL A 1 1780 ? 172.080 153.694 142.202 1.00 0.00 ? 1780 VAL A CA 4  
ATOM 6661   C CA . VAL A 1 1781 ? 173.341 154.965 145.596 1.00 0.00 ? 1781 VAL A CA 4  
ATOM 6662   C CA . ASP A 1 1782 ? 177.135 154.942 146.203 1.00 0.00 ? 1782 ASP A CA 4  
ATOM 6663   C CA . HIS A 1 1783 ? 178.408 153.556 149.581 1.00 0.00 ? 1783 HIS A CA 4  
ATOM 6664   C CA . ILE A 1 1784 ? 175.002 152.145 150.737 1.00 0.00 ? 1784 ILE A CA 4  
ATOM 6665   C CA . ASP A 1 1785 ? 175.424 149.390 153.380 1.00 0.00 ? 1785 ASP A CA 4  
ATOM 6666   C CA . SER A 1 1786 ? 172.665 146.746 153.627 1.00 0.00 ? 1786 SER A CA 4  
ATOM 6667   C CA . LEU A 1 1787 ? 172.672 143.971 156.242 1.00 0.00 ? 1787 LEU A CA 4  
ATOM 6668   C CA . MET A 1 1788 ? 170.180 141.168 155.669 1.00 0.00 ? 1788 MET A CA 4  
ATOM 6669   C CA . GLU A 1 1789 ? 168.352 139.455 158.538 1.00 0.00 ? 1789 GLU A CA 4  
ATOM 6670   C CA . GLU A 1 1790 ? 166.016 136.563 159.157 1.00 0.00 ? 1790 GLU A CA 4  
ATOM 6671   C CA . TRP A 1 1791 ? 163.666 136.255 162.113 1.00 0.00 ? 1791 TRP A CA 4  
ATOM 6672   C CA . PHE A 1 1792 ? 164.132 133.253 164.395 1.00 0.00 ? 1792 PHE A CA 4  
ATOM 6673   C CA . PRO A 1 1793 ? 161.335 130.513 164.144 1.00 0.00 ? 1793 PRO A CA 4  
ATOM 6674   C CA . GLY A 1 1794 ? 158.864 131.098 166.983 1.00 0.00 ? 1794 GLY A CA 4  
ATOM 6675   C CA . LEU A 1 1795 ? 160.479 134.441 167.891 1.00 0.00 ? 1795 LEU A CA 4  
ATOM 6676   C CA . LEU A 1 1796 ? 159.496 137.137 165.348 1.00 0.00 ? 1796 LEU A CA 4  
ATOM 6677   C CA . GLU A 1 1797 ? 161.519 139.974 166.982 1.00 0.00 ? 1797 GLU A CA 4  
ATOM 6678   C CA . ILE A 1 1798 ? 164.788 137.976 167.393 1.00 0.00 ? 1798 ILE A CA 4  
ATOM 6679   C CA . ASP A 1 1799 ? 166.878 138.317 164.235 1.00 0.00 ? 1799 ASP A CA 4  
ATOM 6680   C CA . ILE A 1 1800 ? 169.905 136.437 162.901 1.00 0.00 ? 1800 ILE A CA 4  
ATOM 6681   C CA . CYS A 1 1801 ? 172.145 137.884 160.188 1.00 0.00 ? 1801 CYS A CA 4  
ATOM 6682   C CA . GLY A 1 1802 ? 172.033 135.906 156.872 1.00 0.00 ? 1802 GLY A CA 4  
ATOM 6683   C CA . GLU A 1 1803 ? 175.801 136.402 156.562 1.00 0.00 ? 1803 GLU A CA 4  
ATOM 6684   C CA . GLY A 1 1804 ? 176.073 134.672 159.985 1.00 0.00 ? 1804 GLY A CA 4  
ATOM 6685   C CA . GLU A 1 1805 ? 174.198 131.547 158.812 1.00 0.00 ? 1805 GLU A CA 4  
ATOM 6686   C CA . THR A 1 1806 ? 176.164 131.311 155.507 1.00 0.00 ? 1806 THR A CA 4  
ATOM 6687   C CA . LEU A 1 1807 ? 179.403 131.608 157.531 1.00 0.00 ? 1807 LEU A CA 4  
ATOM 6688   C CA . LEU A 1 1808 ? 178.197 128.858 159.899 1.00 0.00 ? 1808 LEU A CA 4  
ATOM 6689   C CA . LYS A 1 1809 ? 177.565 126.601 156.826 1.00 0.00 ? 1809 LYS A CA 4  
ATOM 6690   C CA . LYS A 1 1810 ? 181.057 127.325 155.414 1.00 0.00 ? 1810 LYS A CA 4  
ATOM 6691   C CA . TRP A 1 1811 ? 182.450 126.411 158.859 1.00 0.00 ? 1811 TRP A CA 4  
ATOM 6692   C CA . ALA A 1 1812 ? 180.540 123.088 158.618 1.00 0.00 ? 1812 ALA A CA 4  
ATOM 6693   C CA . LEU A 1 1813 ? 178.218 123.874 161.557 1.00 0.00 ? 1813 LEU A CA 4  
ATOM 6694   C CA . TYR A 1 1814 ? 174.478 123.198 161.519 1.00 0.00 ? 1814 TYR A CA 4  
ATOM 6695   C CA . SER A 1 1815 ? 173.658 124.671 164.947 1.00 0.00 ? 1815 SER A CA 4  
ATOM 6696   C CA . PHE A 1 1816 ? 172.922 128.303 165.514 1.00 0.00 ? 1816 PHE A CA 4  
ATOM 6697   C CA . ASN A 1 1817 ? 172.736 128.712 169.306 1.00 0.00 ? 1817 ASN A CA 4  
ATOM 6698   C CA . ASP A 1 1818 ? 170.669 131.502 170.806 1.00 0.00 ? 1818 ASP A CA 4  
ATOM 6699   C CA . GLY A 1 1819 ? 172.220 132.156 174.246 1.00 0.00 ? 1819 GLY A CA 4  
ATOM 6700   C CA . GLU A 1 1820 ? 169.668 134.723 175.490 1.00 0.00 ? 1820 GLU A CA 4  
ATOM 6701   C CA . GLU A 1 1821 ? 166.695 132.533 174.461 1.00 0.00 ? 1821 GLU A CA 4  
ATOM 6702   C CA . HIS A 1 1822 ? 168.501 129.275 175.429 1.00 0.00 ? 1822 HIS A CA 4  
ATOM 6703   C CA . GLN A 1 1823 ? 167.262 127.520 172.247 1.00 0.00 ? 1823 GLN A CA 4  
ATOM 6704   C CA . LYS A 1 1824 ? 169.233 126.052 169.308 1.00 0.00 ? 1824 LYS A CA 4  
ATOM 6705   C CA . ILE A 1 1825 ? 168.140 126.163 165.676 1.00 0.00 ? 1825 ILE A CA 4  
ATOM 6706   C CA . LEU A 1 1826 ? 168.990 124.333 162.507 1.00 0.00 ? 1826 LEU A CA 4  
ATOM 6707   C CA . LEU A 1 1827 ? 171.037 126.608 160.272 1.00 0.00 ? 1827 LEU A CA 4  
ATOM 6708   C CA . ASP A 1 1828 ? 170.221 124.694 157.096 1.00 0.00 ? 1828 ASP A CA 4  
ATOM 6709   C CA . ASP A 1 1829 ? 166.463 124.483 157.822 1.00 0.00 ? 1829 ASP A CA 4  
ATOM 6710   C CA . LEU A 1 1830 ? 166.054 128.279 158.219 1.00 0.00 ? 1830 LEU A CA 4  
ATOM 6711   C CA . MET A 1 1831 ? 168.512 128.992 155.349 1.00 0.00 ? 1831 MET A CA 4  
ATOM 6712   C CA . LYS A 1 1832 ? 166.825 126.640 152.800 1.00 0.00 ? 1832 LYS A CA 4  
ATOM 6713   C CA . LYS A 1 1833 ? 163.333 128.094 153.479 1.00 0.00 ? 1833 LYS A CA 4  
ATOM 6714   C CA . ALA A 1 1834 ? 164.270 130.929 151.128 1.00 0.00 ? 1834 ALA A CA 4  
ATOM 6715   C CA . GLU A 1 1835 ? 165.917 130.954 147.635 1.00 0.00 ? 1835 GLU A CA 4  
ATOM 6716   C CA . GLU A 1 1836 ? 169.436 130.647 149.064 1.00 0.00 ? 1836 GLU A CA 4  
ATOM 6717   C CA . GLY A 1 1837 ? 169.508 126.827 148.874 1.00 0.00 ? 1837 GLY A CA 4  
ATOM 6718   C CA . PHE A 1 1883 ? 174.351 144.852 180.469 1.00 0.00 ? 1883 PHE A CA 4  
ATOM 6719   C CA . LEU A 1 1884 ? 170.499 144.763 180.242 1.00 0.00 ? 1884 LEU A CA 4  
ATOM 6720   C CA . LEU A 1 1885 ? 168.388 147.937 180.923 1.00 0.00 ? 1885 LEU A CA 4  
ATOM 6721   C CA . GLY A 1 1886 ? 165.195 146.925 179.073 1.00 0.00 ? 1886 GLY A CA 4  
ATOM 6722   C CA . ASP A 1 1887 ? 161.876 148.684 179.612 1.00 0.00 ? 1887 ASP A CA 4  
ATOM 6723   C CA . GLY A 1 1888 ? 161.019 148.027 175.889 1.00 0.00 ? 1888 GLY A CA 4  
ATOM 6724   C CA . SER A 1 1889 ? 157.746 148.047 173.895 1.00 0.00 ? 1889 SER A CA 4  
ATOM 6725   C CA . PHE A 1 1890 ? 158.519 144.948 171.801 1.00 0.00 ? 1890 PHE A CA 4  
ATOM 6726   C CA . GLY A 1 1891 ? 161.644 143.532 173.456 1.00 0.00 ? 1891 GLY A CA 4  
ATOM 6727   C CA . SER A 1 1892 ? 164.704 143.992 175.644 1.00 0.00 ? 1892 SER A CA 4  
ATOM 6728   C CA . VAL A 1 1893 ? 167.061 147.015 175.636 1.00 0.00 ? 1893 VAL A CA 4  
ATOM 6729   C CA . TYR A 1 1894 ? 170.802 146.422 176.228 1.00 0.00 ? 1894 TYR A CA 4  
ATOM 6730   C CA . ARG A 1 1895 ? 173.782 148.689 176.838 1.00 0.00 ? 1895 ARG A CA 4  
ATOM 6731   C CA . ALA A 1 1896 ? 176.922 147.793 174.890 1.00 0.00 ? 1896 ALA A CA 4  
ATOM 6732   C CA . ALA A 1 1897 ? 179.651 149.294 172.684 1.00 0.00 ? 1897 ALA A CA 4  
ATOM 6733   C CA . TYR A 1 1898 ? 180.711 149.210 168.991 1.00 0.00 ? 1898 TYR A CA 4  
ATOM 6734   C CA . GLU A 1 1899 ? 184.073 147.334 168.887 1.00 0.00 ? 1899 GLU A CA 4  
ATOM 6735   C CA . GLY A 1 1900 ? 185.649 149.685 166.269 1.00 0.00 ? 1900 GLY A CA 4  
ATOM 6736   C CA . GLU A 1 1901 ? 184.939 153.079 167.947 1.00 0.00 ? 1901 GLU A CA 4  
ATOM 6737   C CA . GLU A 1 1902 ? 184.300 152.281 171.651 1.00 0.00 ? 1902 GLU A CA 4  
ATOM 6738   C CA . VAL A 1 1903 ? 181.063 154.366 171.067 1.00 0.00 ? 1903 VAL A CA 4  
ATOM 6739   C CA . ALA A 1 1904 ? 178.506 153.501 173.738 1.00 0.00 ? 1904 ALA A CA 4  
ATOM 6740   C CA . VAL A 1 1905 ? 175.428 151.996 172.244 1.00 0.00 ? 1905 VAL A CA 4  
ATOM 6741   C CA . LYS A 1 1906 ? 171.828 151.044 173.072 1.00 0.00 ? 1906 LYS A CA 4  
ATOM 6742   C CA . ILE A 1 1907 ? 170.473 147.820 171.482 1.00 0.00 ? 1907 ILE A CA 4  
ATOM 6743   C CA . PHE A 1 1908 ? 166.739 147.164 171.163 1.00 0.00 ? 1908 PHE A CA 4  
ATOM 6744   C CA . ASN A 1 1909 ? 165.820 143.564 170.202 1.00 0.00 ? 1909 ASN A CA 4  
ATOM 6745   C CA . LYS A 1 1910 ? 163.105 140.896 169.604 1.00 0.00 ? 1910 LYS A CA 4  
ATOM 6746   C CA . HIS A 1 1911 ? 161.254 143.221 167.399 1.00 0.00 ? 1911 HIS A CA 4  
ATOM 6747   C CA . THR A 1 1912 ? 161.922 141.503 164.036 1.00 0.00 ? 1912 THR A CA 4  
ATOM 6748   C CA . SER A 1 1913 ? 158.452 140.590 162.845 1.00 0.00 ? 1913 SER A CA 4  
ATOM 6749   C CA . LEU A 1 1914 ? 156.632 143.671 164.109 1.00 0.00 ? 1914 LEU A CA 4  
ATOM 6750   C CA . ARG A 1 1915 ? 155.056 146.413 162.014 1.00 0.00 ? 1915 ARG A CA 4  
ATOM 6751   C CA . LEU A 1 1916 ? 156.068 149.016 164.674 1.00 0.00 ? 1916 LEU A CA 4  
ATOM 6752   C CA . LEU A 1 1917 ? 159.834 148.057 164.488 1.00 0.00 ? 1917 LEU A CA 4  
ATOM 6753   C CA . ARG A 1 1918 ? 159.710 148.197 160.750 1.00 0.00 ? 1918 ARG A CA 4  
ATOM 6754   C CA . GLN A 1 1919 ? 158.256 151.690 160.834 1.00 0.00 ? 1919 GLN A CA 4  
ATOM 6755   C CA . GLU A 1 1920 ? 160.832 152.767 163.455 1.00 0.00 ? 1920 GLU A CA 4  
ATOM 6756   C CA . LEU A 1 1921 ? 163.729 151.456 161.282 1.00 0.00 ? 1921 LEU A CA 4  
ATOM 6757   C CA . VAL A 1 1922 ? 162.272 153.072 158.102 1.00 0.00 ? 1922 VAL A CA 4  
ATOM 6758   C CA . VAL A 1 1923 ? 161.704 156.488 159.808 1.00 0.00 ? 1923 VAL A CA 4  
ATOM 6759   C CA . LEU A 1 1924 ? 165.129 156.544 161.547 1.00 0.00 ? 1924 LEU A CA 4  
ATOM 6760   C CA . CYS A 1 1925 ? 167.094 155.526 158.384 1.00 0.00 ? 1925 CYS A CA 4  
ATOM 6761   C CA . HIS A 1 1926 ? 166.721 159.011 156.804 1.00 0.00 ? 1926 HIS A CA 4  
ATOM 6762   C CA . LEU A 1 1927 ? 167.132 161.089 160.021 1.00 0.00 ? 1927 LEU A CA 4  
ATOM 6763   C CA . HIS A 1 1928 ? 170.578 162.537 160.822 1.00 0.00 ? 1928 HIS A CA 4  
ATOM 6764   C CA . HIS A 1 1929 ? 170.431 165.529 163.211 1.00 0.00 ? 1929 HIS A CA 4  
ATOM 6765   C CA . PRO A 1 1930 ? 172.202 166.224 166.565 1.00 0.00 ? 1930 PRO A CA 4  
ATOM 6766   C CA . SER A 1 1931 ? 168.965 166.587 168.567 1.00 0.00 ? 1931 SER A CA 4  
ATOM 6767   C CA . LEU A 1 1932 ? 167.480 163.300 167.288 1.00 0.00 ? 1932 LEU A CA 4  
ATOM 6768   C CA . ILE A 1 1933 ? 168.568 159.874 168.612 1.00 0.00 ? 1933 ILE A CA 4  
ATOM 6769   C CA . SER A 1 1934 ? 170.791 158.438 165.866 1.00 0.00 ? 1934 SER A CA 4  
ATOM 6770   C CA . LEU A 1 1935 ? 170.364 154.955 164.444 1.00 0.00 ? 1935 LEU A CA 4  
ATOM 6771   C CA . LEU A 1 1936 ? 173.812 153.396 163.940 1.00 0.00 ? 1936 LEU A CA 4  
ATOM 6772   C CA . ALA A 1 1937 ? 172.948 150.038 162.383 1.00 0.00 ? 1937 ALA A CA 4  
ATOM 6773   C CA . ALA A 1 1938 ? 170.667 146.998 162.200 1.00 0.00 ? 1938 ALA A CA 4  
ATOM 6774   C CA . GLY A 1 1939 ? 171.404 143.461 163.494 1.00 0.00 ? 1939 GLY A CA 4  
ATOM 6775   C CA . ILE A 1 1940 ? 169.743 140.103 162.686 1.00 0.00 ? 1940 ILE A CA 4  
ATOM 6776   C CA . ARG A 1 1941 ? 169.010 136.888 164.662 1.00 0.00 ? 1941 ARG A CA 4  
ATOM 6777   C CA . PRO A 1 1942 ? 167.202 138.433 166.505 1.00 0.00 ? 1942 PRO A CA 4  
ATOM 6778   C CA . ARG A 1 1943 ? 166.540 141.726 164.690 1.00 0.00 ? 1943 ARG A CA 4  
ATOM 6779   C CA . MET A 1 1944 ? 168.181 144.636 166.546 1.00 0.00 ? 1944 MET A CA 4  
ATOM 6780   C CA . LEU A 1 1945 ? 168.202 148.400 166.214 1.00 0.00 ? 1945 LEU A CA 4  
ATOM 6781   C CA . VAL A 1 1946 ? 171.534 149.720 167.427 1.00 0.00 ? 1946 VAL A CA 4  
ATOM 6782   C CA . MET A 1 1947 ? 171.054 153.331 168.621 1.00 0.00 ? 1947 MET A CA 4  
ATOM 6783   C CA . GLU A 1 1948 ? 173.391 155.930 170.206 1.00 0.00 ? 1948 GLU A CA 4  
ATOM 6784   C CA . LEU A 1 1949 ? 173.402 155.670 174.023 1.00 0.00 ? 1949 LEU A CA 4  
ATOM 6785   C CA . ALA A 1 1950 ? 172.047 158.814 175.699 1.00 0.00 ? 1950 ALA A CA 4  
ATOM 6786   C CA . SER A 1 1951 ? 173.547 158.882 179.178 1.00 0.00 ? 1951 SER A CA 4  
ATOM 6787   C CA . LYS A 1 1952 ? 171.484 161.088 181.540 1.00 0.00 ? 1952 LYS A CA 4  
ATOM 6788   C CA . GLY A 1 1953 ? 168.077 159.379 181.254 1.00 0.00 ? 1953 GLY A CA 4  
ATOM 6789   C CA . SER A 1 1954 ? 164.836 161.030 180.125 1.00 0.00 ? 1954 SER A CA 4  
ATOM 6790   C CA . LEU A 1 1955 ? 163.212 164.436 180.716 1.00 0.00 ? 1955 LEU A CA 4  
ATOM 6791   C CA . ASP A 1 1956 ? 160.148 162.976 182.523 1.00 0.00 ? 1956 ASP A CA 4  
ATOM 6792   C CA . ARG A 1 1957 ? 162.191 161.224 185.265 1.00 0.00 ? 1957 ARG A CA 4  
ATOM 6793   C CA . LEU A 1 1958 ? 164.501 164.221 185.733 1.00 0.00 ? 1958 LEU A CA 4  
ATOM 6794   C CA . LEU A 1 1959 ? 161.562 166.647 186.176 1.00 0.00 ? 1959 LEU A CA 4  
ATOM 6795   C CA . GLN A 1 1960 ? 160.249 164.379 189.004 1.00 0.00 ? 1960 GLN A CA 4  
ATOM 6796   C CA . GLN A 1 1961 ? 163.288 165.521 191.102 1.00 0.00 ? 1961 GLN A CA 4  
ATOM 6797   C CA . ASP A 1 1962 ? 161.573 168.605 192.704 1.00 0.00 ? 1962 ASP A CA 4  
ATOM 6798   C CA . LYS A 1 1963 ? 164.429 169.077 195.254 1.00 0.00 ? 1963 LYS A CA 4  
ATOM 6799   C CA . ALA A 1 1964 ? 166.931 169.724 192.427 1.00 0.00 ? 1964 ALA A CA 4  
ATOM 6800   C CA . SER A 1 1965 ? 165.168 172.094 190.017 1.00 0.00 ? 1965 SER A CA 4  
ATOM 6801   C CA . LEU A 1 1966 ? 166.670 172.603 186.549 1.00 0.00 ? 1966 LEU A CA 4  
ATOM 6802   C CA . THR A 1 1967 ? 168.279 176.047 186.313 1.00 0.00 ? 1967 THR A CA 4  
ATOM 6803   C CA . ARG A 1 1968 ? 166.683 178.507 183.878 1.00 0.00 ? 1968 ARG A CA 4  
ATOM 6804   C CA . THR A 1 1969 ? 169.635 178.673 181.401 1.00 0.00 ? 1969 THR A CA 4  
ATOM 6805   C CA . LEU A 1 1970 ? 169.506 174.896 181.082 1.00 0.00 ? 1970 LEU A CA 4  
ATOM 6806   C CA . GLN A 1 1971 ? 165.665 174.885 180.689 1.00 0.00 ? 1971 GLN A CA 4  
ATOM 6807   C CA . HIS A 1 1972 ? 166.162 177.248 177.703 1.00 0.00 ? 1972 HIS A CA 4  
ATOM 6808   C CA . ARG A 1 1973 ? 168.820 174.896 176.237 1.00 0.00 ? 1973 ARG A CA 4  
ATOM 6809   C CA . ILE A 1 1974 ? 166.362 171.934 176.567 1.00 0.00 ? 1974 ILE A CA 4  
ATOM 6810   C CA . ALA A 1 1975 ? 163.527 173.939 174.915 1.00 0.00 ? 1975 ALA A CA 4  
ATOM 6811   C CA . LEU A 1 1976 ? 165.709 174.974 171.926 1.00 0.00 ? 1976 LEU A CA 4  
ATOM 6812   C CA . HIS A 1 1977 ? 167.227 171.474 171.396 1.00 0.00 ? 1977 HIS A CA 4  
ATOM 6813   C CA . VAL A 1 1978 ? 163.805 169.824 171.209 1.00 0.00 ? 1978 VAL A CA 4  
ATOM 6814   C CA . ALA A 1 1979 ? 162.642 172.681 168.921 1.00 0.00 ? 1979 ALA A CA 4  
ATOM 6815   C CA . ASP A 1 1980 ? 165.602 172.156 166.509 1.00 0.00 ? 1980 ASP A CA 4  
ATOM 6816   C CA . GLY A 1 1981 ? 164.929 168.381 166.344 1.00 0.00 ? 1981 GLY A CA 4  
ATOM 6817   C CA . LEU A 1 1982 ? 161.254 169.051 165.541 1.00 0.00 ? 1982 LEU A CA 4  
ATOM 6818   C CA . ARG A 1 1983 ? 162.374 171.801 163.079 1.00 0.00 ? 1983 ARG A CA 4  
ATOM 6819   C CA . TYR A 1 1984 ? 164.649 169.289 161.275 1.00 0.00 ? 1984 TYR A CA 4  
ATOM 6820   C CA . LEU A 1 1985 ? 161.603 167.021 161.326 1.00 0.00 ? 1985 LEU A CA 4  
ATOM 6821   C CA . HIS A 1 1986 ? 159.472 169.754 159.739 1.00 0.00 ? 1986 HIS A CA 4  
ATOM 6822   C CA . SER A 1 1987 ? 161.978 169.792 156.805 1.00 0.00 ? 1987 SER A CA 4  
ATOM 6823   C CA . ALA A 1 1988 ? 161.581 166.032 156.214 1.00 0.00 ? 1988 ALA A CA 4  
ATOM 6824   C CA . MET A 1 1989 ? 157.707 166.117 156.555 1.00 0.00 ? 1989 MET A CA 4  
ATOM 6825   C CA . ILE A 1 1990 ? 157.573 163.461 159.319 1.00 0.00 ? 1990 ILE A CA 4  
ATOM 6826   C CA . ILE A 1 1991 ? 154.945 163.339 162.143 1.00 0.00 ? 1991 ILE A CA 4  
ATOM 6827   C CA . TYR A 1 1992 ? 156.205 161.820 165.437 1.00 0.00 ? 1992 TYR A CA 4  
ATOM 6828   C CA . ARG A 1 1993 ? 152.841 161.456 167.295 1.00 0.00 ? 1993 ARG A CA 4  
ATOM 6829   C CA . ASP A 1 1994 ? 154.300 160.372 170.679 1.00 0.00 ? 1994 ASP A CA 4  
ATOM 6830   C CA . LEU A 1 1995 ? 156.017 163.609 171.767 1.00 0.00 ? 1995 LEU A CA 4  
ATOM 6831   C CA . LYS A 1 1996 ? 155.949 163.573 175.587 1.00 0.00 ? 1996 LYS A CA 4  
ATOM 6832   C CA . PRO A 1 1997 ? 158.785 164.021 178.149 1.00 0.00 ? 1997 PRO A CA 4  
ATOM 6833   C CA . HIS A 1 1998 ? 159.493 160.265 178.522 1.00 0.00 ? 1998 HIS A CA 4  
ATOM 6834   C CA . ASN A 1 1999 ? 160.561 160.291 174.845 1.00 0.00 ? 1999 ASN A CA 4  
ATOM 6835   C CA . VAL A 1 2000 ? 162.965 163.227 175.323 1.00 0.00 ? 2000 VAL A CA 4  
ATOM 6836   C CA . LEU A 1 2001 ? 166.384 161.751 176.150 1.00 0.00 ? 2001 LEU A CA 4  
ATOM 6837   C CA . LEU A 1 2002 ? 168.982 163.778 177.956 1.00 0.00 ? 2002 LEU A CA 4  
ATOM 6838   C CA . PHE A 1 2003 ? 172.550 163.783 176.684 1.00 0.00 ? 2003 PHE A CA 4  
ATOM 6839   C CA . THR A 1 2004 ? 173.952 166.401 179.060 1.00 0.00 ? 2004 THR A CA 4  
ATOM 6840   C CA . LEU A 1 2005 ? 172.585 168.930 181.656 1.00 0.00 ? 2005 LEU A CA 4  
ATOM 6841   C CA . TYR A 1 2006 ? 175.617 171.296 181.594 1.00 0.00 ? 2006 TYR A CA 4  
ATOM 6842   C CA . PRO A 1 2007 ? 174.374 174.520 179.871 1.00 0.00 ? 2007 PRO A CA 4  
ATOM 6843   C CA . ASN A 1 2008 ? 177.508 174.833 177.644 1.00 0.00 ? 2008 ASN A CA 4  
ATOM 6844   C CA . ALA A 1 2009 ? 177.243 171.249 176.283 1.00 0.00 ? 2009 ALA A CA 4  
ATOM 6845   C CA . ALA A 1 2010 ? 177.090 170.694 172.510 1.00 0.00 ? 2010 ALA A CA 4  
ATOM 6846   C CA . ILE A 1 2011 ? 173.852 168.692 172.922 1.00 0.00 ? 2011 ILE A CA 4  
ATOM 6847   C CA . ILE A 1 2012 ? 171.491 168.597 175.955 1.00 0.00 ? 2012 ILE A CA 4  
ATOM 6848   C CA . ALA A 1 2013 ? 168.369 166.898 174.662 1.00 0.00 ? 2013 ALA A CA 4  
ATOM 6849   C CA . LYS A 1 2014 ? 167.465 164.514 171.879 1.00 0.00 ? 2014 LYS A CA 4  
ATOM 6850   C CA . ILE A 1 2015 ? 164.053 163.368 170.600 1.00 0.00 ? 2015 ILE A CA 4  
ATOM 6851   C CA . ALA A 1 2016 ? 163.577 159.561 170.731 1.00 0.00 ? 2016 ALA A CA 4  
ATOM 6852   C CA . ASP A 1 2017 ? 161.062 156.719 170.260 1.00 0.00 ? 2017 ASP A CA 4  
ATOM 6853   C CA . TYR A 1 2018 ? 159.679 157.123 166.758 1.00 0.00 ? 2018 TYR A CA 4  
ATOM 6854   C CA . GLY A 1 2019 ? 157.760 153.823 166.735 1.00 0.00 ? 2019 GLY A CA 4  
ATOM 6855   C CA . THR A 1 2020 ? 154.434 155.450 165.943 1.00 0.00 ? 2020 THR A CA 4  
ATOM 6856   C CA . ALA A 1 2021 ? 155.718 158.046 163.397 1.00 0.00 ? 2021 ALA A CA 4  
ATOM 6857   C CA . GLN A 1 2022 ? 154.281 158.861 159.917 1.00 0.00 ? 2022 GLN A CA 4  
ATOM 6858   C CA . TYR A 1 2023 ? 155.874 160.277 156.781 1.00 0.00 ? 2023 TYR A CA 4  
ATOM 6859   C CA . CYS A 1 2024 ? 153.266 160.479 154.041 1.00 0.00 ? 2024 CYS A CA 4  
ATOM 6860   C CA . CYS A 1 2025 ? 152.366 162.666 151.031 1.00 0.00 ? 2025 CYS A CA 4  
ATOM 6861   C CA . ARG A 1 2026 ? 148.707 162.014 151.895 1.00 0.00 ? 2026 ARG A CA 4  
ATOM 6862   C CA . MET A 1 2027 ? 146.652 163.034 154.918 1.00 0.00 ? 2027 MET A CA 4  
ATOM 6863   C CA . GLY A 1 2028 ? 147.604 161.337 158.238 1.00 0.00 ? 2028 GLY A CA 4  
ATOM 6864   C CA . ILE A 1 2029 ? 145.041 159.834 160.664 1.00 0.00 ? 2029 ILE A CA 4  
ATOM 6865   C CA . LYS A 1 2030 ? 145.076 158.017 164.099 1.00 0.00 ? 2030 LYS A CA 4  
ATOM 6866   C CA . THR A 1 2031 ? 142.918 156.921 167.182 1.00 0.00 ? 2031 THR A CA 4  
ATOM 6867   C CA . SER A 1 2032 ? 145.362 154.889 169.177 1.00 0.00 ? 2032 SER A CA 4  
ATOM 6868   C CA . GLU A 1 2033 ? 147.762 157.464 170.638 1.00 0.00 ? 2033 GLU A CA 4  
ATOM 6869   C CA . GLY A 1 2034 ? 145.284 157.536 173.533 1.00 0.00 ? 2034 GLY A CA 4  
ATOM 6870   C CA . THR A 1 2035 ? 147.456 159.621 175.973 1.00 0.00 ? 2035 THR A CA 4  
ATOM 6871   C CA . PRO A 1 2036 ? 145.514 162.857 175.402 1.00 0.00 ? 2036 PRO A CA 4  
ATOM 6872   C CA . GLY A 1 2037 ? 147.205 165.119 178.013 1.00 0.00 ? 2037 GLY A CA 4  
ATOM 6873   C CA . PHE A 1 2038 ? 150.044 165.505 175.478 1.00 0.00 ? 2038 PHE A CA 4  
ATOM 6874   C CA . ARG A 1 2039 ? 148.086 165.042 172.205 1.00 0.00 ? 2039 ARG A CA 4  
ATOM 6875   C CA . ALA A 1 2040 ? 146.366 167.507 169.874 1.00 0.00 ? 2040 ALA A CA 4  
ATOM 6876   C CA . PRO A 1 2041 ? 142.492 167.834 169.983 1.00 0.00 ? 2041 PRO A CA 4  
ATOM 6877   C CA . GLU A 1 2042 ? 142.047 165.672 166.827 1.00 0.00 ? 2042 GLU A CA 4  
ATOM 6878   C CA . VAL A 1 2043 ? 142.164 162.737 169.367 1.00 0.00 ? 2043 VAL A CA 4  
ATOM 6879   C CA . ALA A 1 2044 ? 138.379 162.727 169.159 1.00 0.00 ? 2044 ALA A CA 4  
ATOM 6880   C CA . ARG A 1 2045 ? 138.212 159.617 166.810 1.00 0.00 ? 2045 ARG A CA 4  
ATOM 6881   C CA . GLY A 1 2046 ? 139.740 157.814 163.673 1.00 0.00 ? 2046 GLY A CA 4  
ATOM 6882   C CA . ASN A 1 2047 ? 137.569 159.624 161.221 1.00 0.00 ? 2047 ASN A CA 4  
ATOM 6883   C CA . VAL A 1 2048 ? 139.589 162.910 161.268 1.00 0.00 ? 2048 VAL A CA 4  
ATOM 6884   C CA . ILE A 1 2049 ? 142.796 163.834 159.457 1.00 0.00 ? 2049 ILE A CA 4  
ATOM 6885   C CA . TYR A 1 2050 ? 145.743 165.846 160.701 1.00 0.00 ? 2050 TYR A CA 4  
ATOM 6886   C CA . ASN A 1 2051 ? 149.363 166.904 159.974 1.00 0.00 ? 2051 ASN A CA 4  
ATOM 6887   C CA . GLN A 1 2052 ? 152.743 167.772 161.665 1.00 0.00 ? 2052 GLN A CA 4  
ATOM 6888   C CA . GLN A 1 2053 ? 150.789 170.505 163.454 1.00 0.00 ? 2053 GLN A CA 4  
ATOM 6889   C CA . ALA A 1 2054 ? 149.755 167.720 165.885 1.00 0.00 ? 2054 ALA A CA 4  
ATOM 6890   C CA . ASP A 1 2055 ? 153.438 167.437 167.006 1.00 0.00 ? 2055 ASP A CA 4  
ATOM 6891   C CA . VAL A 1 2056 ? 153.560 171.277 167.318 1.00 0.00 ? 2056 VAL A CA 4  
ATOM 6892   C CA . TYR A 1 2057 ? 150.769 170.918 169.930 1.00 0.00 ? 2057 TYR A CA 4  
ATOM 6893   C CA . SER A 1 2058 ? 152.714 168.101 171.711 1.00 0.00 ? 2058 SER A CA 4  
ATOM 6894   C CA . PHE A 1 2059 ? 155.757 170.456 171.749 1.00 0.00 ? 2059 PHE A CA 4  
ATOM 6895   C CA . GLY A 1 2060 ? 153.730 173.197 173.581 1.00 0.00 ? 2060 GLY A CA 4  
ATOM 6896   C CA . LEU A 1 2061 ? 153.038 170.652 176.326 1.00 0.00 ? 2061 LEU A CA 4  
ATOM 6897   C CA . LEU A 1 2062 ? 156.805 169.814 176.421 1.00 0.00 ? 2062 LEU A CA 4  
ATOM 6898   C CA . LEU A 1 2063 ? 157.545 173.543 176.915 1.00 0.00 ? 2063 LEU A CA 4  
ATOM 6899   C CA . TYR A 1 2064 ? 154.912 173.725 179.714 1.00 0.00 ? 2064 TYR A CA 4  
ATOM 6900   C CA . ASP A 1 2065 ? 156.384 170.651 181.524 1.00 0.00 ? 2065 ASP A CA 4  
ATOM 6901   C CA . ILE A 1 2066 ? 159.988 172.098 181.270 1.00 0.00 ? 2066 ILE A CA 4  
ATOM 6902   C CA . LEU A 1 2067 ? 158.829 175.581 182.426 1.00 0.00 ? 2067 LEU A CA 4  
ATOM 6903   C CA . THR A 1 2068 ? 156.811 174.313 185.389 1.00 0.00 ? 2068 THR A CA 4  
ATOM 6904   C CA . THR A 1 2069 ? 158.355 170.914 186.362 1.00 0.00 ? 2069 THR A CA 4  
ATOM 6905   C CA . GLY A 1 2070 ? 154.704 169.667 186.405 1.00 0.00 ? 2070 GLY A CA 4  
ATOM 6906   C CA . GLY A 1 2071 ? 152.687 167.280 184.192 1.00 0.00 ? 2071 GLY A CA 4  
ATOM 6907   C CA . ARG A 1 2072 ? 149.220 165.700 183.927 1.00 0.00 ? 2072 ARG A CA 4  
ATOM 6908   C CA . ILE A 1 2073 ? 147.782 162.628 182.086 1.00 0.00 ? 2073 ILE A CA 4  
ATOM 6909   C CA . VAL A 1 2074 ? 144.003 162.502 181.737 1.00 0.00 ? 2074 VAL A CA 4  
ATOM 6910   C CA . GLU A 1 2075 ? 141.649 159.864 180.205 1.00 0.00 ? 2075 GLU A CA 4  
ATOM 6911   C CA . GLY A 1 2076 ? 137.824 159.717 179.752 1.00 0.00 ? 2076 GLY A CA 4  
ATOM 6912   C CA . LEU A 1 2077 ? 135.001 161.596 177.987 1.00 0.00 ? 2077 LEU A CA 4  
ATOM 6913   C CA . LYS A 1 2078 ? 134.513 164.916 179.820 1.00 0.00 ? 2078 LYS A CA 4  
ATOM 6914   C CA . PHE A 1 2079 ? 138.284 165.689 179.667 1.00 0.00 ? 2079 PHE A CA 4  
ATOM 6915   C CA . PRO A 1 2080 ? 138.565 165.194 175.797 1.00 0.00 ? 2080 PRO A CA 4  
ATOM 6916   C CA . ASN A 1 2081 ? 135.345 167.256 175.289 1.00 0.00 ? 2081 ASN A CA 4  
ATOM 6917   C CA . GLU A 1 2082 ? 136.859 169.998 177.472 1.00 0.00 ? 2082 GLU A CA 4  
ATOM 6918   C CA . PHE A 1 2083 ? 140.181 169.921 175.572 1.00 0.00 ? 2083 PHE A CA 4  
ATOM 6919   C CA . ASP A 1 2084 ? 138.535 169.711 172.081 1.00 0.00 ? 2084 ASP A CA 4  
ATOM 6920   C CA . GLU A 1 2085 ? 135.425 171.990 172.427 1.00 0.00 ? 2085 GLU A CA 4  
ATOM 6921   C CA . LEU A 1 2086 ? 136.090 174.256 175.483 1.00 0.00 ? 2086 LEU A CA 4  
ATOM 6922   C CA . GLU A 1 2087 ? 139.769 175.196 174.767 1.00 0.00 ? 2087 GLU A CA 4  
ATOM 6923   C CA . ILE A 1 2088 ? 141.088 173.654 178.063 1.00 0.00 ? 2088 ILE A CA 4  
ATOM 6924   C CA . GLN A 1 2089 ? 144.876 173.703 178.215 1.00 0.00 ? 2089 GLN A CA 4  
ATOM 6925   C CA . GLY A 1 2090 ? 147.468 173.784 181.005 1.00 0.00 ? 2090 GLY A CA 4  
ATOM 6926   C CA . LYS A 1 2091 ? 147.862 177.570 180.652 1.00 0.00 ? 2091 LYS A CA 4  
ATOM 6927   C CA . LEU A 1 2092 ? 144.099 178.362 180.568 1.00 0.00 ? 2092 LEU A CA 4  
ATOM 6928   C CA . PRO A 1 2093 ? 143.091 176.388 183.761 1.00 0.00 ? 2093 PRO A CA 4  
ATOM 6929   C CA . ASP A 1 2094 ? 145.958 177.901 185.791 1.00 0.00 ? 2094 ASP A CA 4  
ATOM 6930   C CA . PRO A 1 2095 ? 146.484 181.667 184.841 1.00 0.00 ? 2095 PRO A CA 4  
ATOM 6931   C CA . VAL A 1 2096 ? 147.924 182.340 188.339 1.00 0.00 ? 2096 VAL A CA 4  
ATOM 6932   C CA . LYS A 1 2097 ? 150.484 179.478 188.165 1.00 0.00 ? 2097 LYS A CA 4  
ATOM 6933   C CA . GLU A 1 2098 ? 152.029 180.818 184.976 1.00 0.00 ? 2098 GLU A CA 4  
ATOM 6934   C CA . TYR A 1 2099 ? 150.968 184.561 184.568 1.00 0.00 ? 2099 TYR A CA 4  
ATOM 6935   C CA . GLY A 1 2100 ? 151.329 185.380 188.344 1.00 0.00 ? 2100 GLY A CA 4  
ATOM 6936   C CA . CYS A 1 2101 ? 154.964 184.175 188.330 1.00 0.00 ? 2101 CYS A CA 4  
ATOM 6937   C CA . ALA A 1 2102 ? 155.596 186.302 185.198 1.00 0.00 ? 2102 ALA A CA 4  
ATOM 6938   C CA . PRO A 1 2103 ? 157.073 183.690 182.701 1.00 0.00 ? 2103 PRO A CA 4  
ATOM 6939   C CA . TRP A 1 2104 ? 158.726 185.612 179.800 1.00 0.00 ? 2104 TRP A CA 4  
ATOM 6940   C CA . PRO A 1 2105 ? 155.902 187.004 177.548 1.00 0.00 ? 2105 PRO A CA 4  
ATOM 6941   C CA . MET A 1 2106 ? 157.581 185.632 174.384 1.00 0.00 ? 2106 MET A CA 4  
ATOM 6942   C CA . VAL A 1 2107 ? 157.644 182.078 175.924 1.00 0.00 ? 2107 VAL A CA 4  
ATOM 6943   C CA . GLU A 1 2108 ? 153.986 182.519 176.922 1.00 0.00 ? 2108 GLU A CA 4  
ATOM 6944   C CA . LYS A 1 2109 ? 153.014 183.624 173.372 1.00 0.00 ? 2109 LYS A CA 4  
ATOM 6945   C CA . LEU A 1 2110 ? 154.840 180.645 171.838 1.00 0.00 ? 2110 LEU A CA 4  
ATOM 6946   C CA . ILE A 1 2111 ? 153.148 178.053 174.151 1.00 0.00 ? 2111 ILE A CA 4  
ATOM 6947   C CA . LYS A 1 2112 ? 149.706 179.627 173.458 1.00 0.00 ? 2112 LYS A CA 4  
ATOM 6948   C CA . GLN A 1 2113 ? 150.208 179.673 169.667 1.00 0.00 ? 2113 GLN A CA 4  
ATOM 6949   C CA . CYS A 1 2114 ? 151.628 176.093 169.660 1.00 0.00 ? 2114 CYS A CA 4  
ATOM 6950   C CA . LEU A 1 2115 ? 148.595 174.782 171.630 1.00 0.00 ? 2115 LEU A CA 4  
ATOM 6951   C CA . LYS A 1 2116 ? 145.962 176.476 169.424 1.00 0.00 ? 2116 LYS A CA 4  
ATOM 6952   C CA . GLU A 1 2117 ? 142.793 174.429 168.811 1.00 0.00 ? 2117 GLU A CA 4  
ATOM 6953   C CA . ASN A 1 2118 ? 142.976 175.398 165.139 1.00 0.00 ? 2118 ASN A CA 4  
ATOM 6954   C CA . PRO A 1 2119 ? 146.071 173.537 163.691 1.00 0.00 ? 2119 PRO A CA 4  
ATOM 6955   C CA . GLN A 1 2120 ? 146.723 176.329 161.136 1.00 0.00 ? 2120 GLN A CA 4  
ATOM 6956   C CA . GLU A 1 2121 ? 147.404 178.951 163.856 1.00 0.00 ? 2121 GLU A CA 4  
ATOM 6957   C CA . ARG A 1 2122 ? 150.199 176.860 165.390 1.00 0.00 ? 2122 ARG A CA 4  
ATOM 6958   C CA . PRO A 1 2123 ? 153.528 178.369 164.158 1.00 0.00 ? 2123 PRO A CA 4  
ATOM 6959   C CA . THR A 1 2124 ? 156.204 177.116 161.754 1.00 0.00 ? 2124 THR A CA 4  
ATOM 6960   C CA . SER A 1 2125 ? 159.271 175.879 163.689 1.00 0.00 ? 2125 SER A CA 4  
ATOM 6961   C CA . ALA A 1 2126 ? 161.474 178.641 162.240 1.00 0.00 ? 2126 ALA A CA 4  
ATOM 6962   C CA . GLN A 1 2127 ? 159.315 181.181 164.177 1.00 0.00 ? 2127 GLN A CA 4  
ATOM 6963   C CA . VAL A 1 2128 ? 159.453 178.893 167.255 1.00 0.00 ? 2128 VAL A CA 4  
ATOM 6964   C CA . PHE A 1 2129 ? 163.284 178.655 167.123 1.00 0.00 ? 2129 PHE A CA 4  
ATOM 6965   C CA . ASP A 1 2130 ? 163.718 182.458 166.611 1.00 0.00 ? 2130 ASP A CA 4  
ATOM 6966   C CA . ILE A 1 2131 ? 161.410 183.217 169.600 1.00 0.00 ? 2131 ILE A CA 4  
ATOM 6967   C CA . LEU A 1 2132 ? 163.111 180.642 171.937 1.00 0.00 ? 2132 LEU A CA 4  
ATOM 6968   C CA . ASN A 1 2133 ? 166.555 182.047 170.992 1.00 0.00 ? 2133 ASN A CA 4  
ATOM 6969   C CA . SER A 1 2134 ? 165.463 185.540 172.247 1.00 0.00 ? 2134 SER A CA 4  
ATOM 6970   C CA . ALA A 1 2135 ? 164.706 184.365 175.854 1.00 0.00 ? 2135 ALA A CA 4  
ATOM 6971   C CA . ARG A 1 2142 ? 149.196 192.524 181.172 1.00 0.00 ? 2142 ARG A CA 4  
ATOM 6972   C CA . ARG A 1 2143 ? 146.894 195.375 180.182 1.00 0.00 ? 2143 ARG A CA 4  
ATOM 6973   C CA . ILE A 1 2144 ? 146.118 198.241 182.569 1.00 0.00 ? 2144 ILE A CA 4  
ATOM 6974   C CA . LEU A 1 2145 ? 143.083 200.303 181.576 1.00 0.00 ? 2145 LEU A CA 4  
ATOM 6975   C CA . LEU A 1 2146 ? 143.268 204.005 182.348 1.00 0.00 ? 2146 LEU A CA 4  
ATOM 6976   C CA . PRO A 1 2147 ? 140.133 205.856 183.497 1.00 0.00 ? 2147 PRO A CA 4  
ATOM 6977   C CA . LYS A 1 2148 ? 137.660 206.461 180.699 1.00 0.00 ? 2148 LYS A CA 4  
ATOM 6978   C CA . ASN A 1 2149 ? 138.453 209.375 178.316 1.00 0.00 ? 2149 ASN A CA 4  
ATOM 6979   C CA . VAL A 1 2150 ? 141.945 209.914 179.782 1.00 0.00 ? 2150 VAL A CA 4  
ATOM 6980   C CA . ILE A 1 2151 ? 144.245 210.830 176.884 1.00 0.00 ? 2151 ILE A CA 4  
ATOM 6981   C CA . VAL A 1 2152 ? 147.998 210.478 177.424 1.00 0.00 ? 2152 VAL A CA 4  
ATOM 6982   C CA . GLU A 1 2153 ? 150.329 212.943 175.710 1.00 0.00 ? 2153 GLU A CA 4  
ATOM 6983   C CA . CYS A 1 2154 ? 153.567 211.803 177.349 1.00 0.00 ? 2154 CYS A CA 4  
ATOM 6984   C CA . MET A 1 2155 ? 154.822 209.191 179.766 1.00 0.00 ? 2155 MET A CA 4  
ATOM 6985   C CA . VAL A 1 2156 ? 157.868 208.447 181.952 1.00 0.00 ? 2156 VAL A CA 4  
ATOM 6986   C CA . ALA A 1 2157 ? 158.519 205.362 184.075 1.00 0.00 ? 2157 ALA A CA 4  
ATOM 6987   C CA . THR A 1 2158 ? 159.975 204.877 187.550 1.00 0.00 ? 2158 THR A CA 4  
ATOM 6988   C CA . ASN A 1 2164 ? 155.586 199.103 193.283 1.00 0.00 ? 2164 ASN A CA 4  
ATOM 6989   C CA . ALA A 1 2165 ? 156.657 200.406 189.894 1.00 0.00 ? 2165 ALA A CA 4  
ATOM 6990   C CA . SER A 1 2166 ? 154.732 203.406 188.627 1.00 0.00 ? 2166 SER A CA 4  
ATOM 6991   C CA . ILE A 1 2167 ? 154.475 205.904 185.790 1.00 0.00 ? 2167 ILE A CA 4  
ATOM 6992   C CA . TRP A 1 2168 ? 153.988 209.659 185.376 1.00 0.00 ? 2168 TRP A CA 4  
ATOM 6993   C CA . LEU A 1 2169 ? 151.559 210.728 182.645 1.00 0.00 ? 2169 LEU A CA 4  
ATOM 6994   C CA . GLY A 1 2170 ? 150.919 214.039 180.921 1.00 0.00 ? 2170 GLY A CA 4  
ATOM 6995   C CA . CYS A 1 2171 ? 147.276 214.438 179.969 1.00 0.00 ? 2171 CYS A CA 4  
ATOM 6996   C CA . GLY A 1 2172 ? 145.889 215.523 176.604 1.00 0.00 ? 2172 GLY A CA 4  
ATOM 6997   C CA . HIS A 1 2173 ? 142.173 215.560 177.388 1.00 0.00 ? 2173 HIS A CA 4  
ATOM 6998   C CA . THR A 1 2174 ? 142.531 219.010 178.988 1.00 0.00 ? 2174 THR A CA 4  
ATOM 6999   C CA . ASP A 1 2175 ? 143.754 222.449 177.947 1.00 0.00 ? 2175 ASP A CA 4  
ATOM 7000   C CA . ARG A 1 2176 ? 145.595 222.989 181.258 1.00 0.00 ? 2176 ARG A CA 4  
ATOM 7001   C CA . GLY A 1 2177 ? 148.529 221.215 182.877 1.00 0.00 ? 2177 GLY A CA 4  
ATOM 7002   C CA . GLN A 1 2178 ? 147.391 217.999 184.568 1.00 0.00 ? 2178 GLN A CA 4  
ATOM 7003   C CA . LEU A 1 2179 ? 149.982 215.557 185.931 1.00 0.00 ? 2179 LEU A CA 4  
ATOM 7004   C CA . SER A 1 2180 ? 148.828 211.973 186.514 1.00 0.00 ? 2180 SER A CA 4  
ATOM 7005   C CA . PHE A 1 2181 ? 150.340 209.047 188.409 1.00 0.00 ? 2181 PHE A CA 4  
ATOM 7006   C CA . LEU A 1 2182 ? 149.771 205.325 187.823 1.00 0.00 ? 2182 LEU A CA 4  
ATOM 7007   C CA . ASP A 1 2183 ? 150.843 202.545 190.199 1.00 0.00 ? 2183 ASP A CA 4  
ATOM 7008   C CA . LEU A 1 2184 ? 151.689 199.687 187.826 1.00 0.00 ? 2184 LEU A CA 4  
ATOM 7009   C CA . ASN A 1 2185 ? 151.094 197.165 190.645 1.00 0.00 ? 2185 ASN A CA 4  
ATOM 7010   C CA . THR A 1 2186 ? 147.734 198.353 192.018 1.00 0.00 ? 2186 THR A CA 4  
ATOM 7011   C CA . GLU A 1 2187 ? 146.561 200.019 188.763 1.00 0.00 ? 2187 GLU A CA 4  
ATOM 7012   C CA . GLY A 1 2188 ? 145.607 203.026 190.892 1.00 0.00 ? 2188 GLY A CA 4  
ATOM 7013   C CA . TYR A 1 2189 ? 145.372 206.370 189.111 1.00 0.00 ? 2189 TYR A CA 4  
ATOM 7014   C CA . THR A 1 2190 ? 145.641 209.867 190.588 1.00 0.00 ? 2190 THR A CA 4  
ATOM 7015   C CA . SER A 1 2191 ? 145.996 213.241 188.884 1.00 0.00 ? 2191 SER A CA 4  
ATOM 7016   C CA . GLU A 1 2192 ? 146.586 216.875 189.813 1.00 0.00 ? 2192 GLU A CA 4  
ATOM 7017   C CA . GLU A 1 2193 ? 146.177 220.090 187.815 1.00 0.00 ? 2193 GLU A CA 4  
ATOM 7018   C CA . VAL A 1 2194 ? 149.670 221.545 188.091 1.00 0.00 ? 2194 VAL A CA 4  
ATOM 7019   C CA . ALA A 1 2195 ? 150.145 224.110 185.285 1.00 0.00 ? 2195 ALA A CA 4  
ATOM 7020   C CA . ASP A 1 2196 ? 148.280 226.562 183.050 1.00 0.00 ? 2196 ASP A CA 4  
ATOM 7021   C CA . SER A 1 2197 ? 148.839 224.819 179.690 1.00 0.00 ? 2197 SER A CA 4  
ATOM 7022   C CA . ARG A 1 2198 ? 148.837 221.225 178.477 1.00 0.00 ? 2198 ARG A CA 4  
ATOM 7023   C CA . ILE A 1 2199 ? 151.783 219.129 179.642 1.00 0.00 ? 2199 ILE A CA 4  
ATOM 7024   C CA . LEU A 1 2200 ? 153.553 218.112 176.432 1.00 0.00 ? 2200 LEU A CA 4  
ATOM 7025   C CA . CYS A 1 2201 ? 156.524 216.112 177.725 1.00 0.00 ? 2201 CYS A CA 4  
ATOM 7026   C CA . LEU A 1 2202 ? 157.976 214.639 180.911 1.00 0.00 ? 2202 LEU A CA 4  
ATOM 7027   C CA . ALA A 1 2203 ? 161.496 213.931 182.144 1.00 0.00 ? 2203 ALA A CA 4  
ATOM 7028   C CA . LEU A 1 2204 ? 162.680 212.446 185.438 1.00 0.00 ? 2204 LEU A CA 4  
ATOM 7029   C CA . VAL A 1 2205 ? 165.846 214.047 186.836 1.00 0.00 ? 2205 VAL A CA 4  
ATOM 7030   C CA . HIS A 1 2206 ? 167.431 211.904 189.554 1.00 0.00 ? 2206 HIS A CA 4  
ATOM 7031   C CA . LEU A 1 2207 ? 170.132 213.299 191.838 1.00 0.00 ? 2207 LEU A CA 4  
ATOM 7032   C CA . PRO A 1 2208 ? 172.017 210.371 193.447 1.00 0.00 ? 2208 PRO A CA 4  
ATOM 7033   C CA . VAL A 1 2209 ? 173.864 212.617 195.821 1.00 0.00 ? 2209 VAL A CA 4  
ATOM 7034   C CA . GLU A 1 2210 ? 171.279 214.703 197.719 1.00 0.00 ? 2210 GLU A CA 4  
ATOM 7035   C CA . LYS A 1 2211 ? 168.970 211.683 197.198 1.00 0.00 ? 2211 LYS A CA 4  
ATOM 7036   C CA . GLU A 1 2212 ? 166.272 213.547 195.311 1.00 0.00 ? 2212 GLU A CA 4  
ATOM 7037   C CA . SER A 1 2213 ? 164.106 212.911 192.251 1.00 0.00 ? 2213 SER A CA 4  
ATOM 7038   C CA . TRP A 1 2214 ? 162.349 215.719 190.376 1.00 0.00 ? 2214 TRP A CA 4  
ATOM 7039   C CA . ILE A 1 2215 ? 159.670 215.306 187.709 1.00 0.00 ? 2215 ILE A CA 4  
ATOM 7040   C CA . VAL A 1 2216 ? 159.955 217.944 184.972 1.00 0.00 ? 2216 VAL A CA 4  
ATOM 7041   C CA . SER A 1 2217 ? 156.904 218.877 182.893 1.00 0.00 ? 2217 SER A CA 4  
ATOM 7042   C CA . GLY A 1 2218 ? 157.253 220.751 179.609 1.00 0.00 ? 2218 GLY A CA 4  
ATOM 7043   C CA . THR A 1 2219 ? 154.109 222.583 178.552 1.00 0.00 ? 2219 THR A CA 4  
ATOM 7044   C CA . GLN A 1 2220 ? 152.376 224.174 175.564 1.00 0.00 ? 2220 GLN A CA 4  
ATOM 7045   C CA . SER A 1 2221 ? 153.253 227.675 176.829 1.00 0.00 ? 2221 SER A CA 4  
ATOM 7046   C CA . GLY A 1 2222 ? 156.991 227.053 177.282 1.00 0.00 ? 2222 GLY A CA 4  
ATOM 7047   C CA . THR A 1 2223 ? 156.920 226.595 181.060 1.00 0.00 ? 2223 THR A CA 4  
ATOM 7048   C CA . LEU A 1 2224 ? 159.239 224.038 182.677 1.00 0.00 ? 2224 LEU A CA 4  
ATOM 7049   C CA . LEU A 1 2225 ? 157.544 222.958 185.913 1.00 0.00 ? 2225 LEU A CA 4  
ATOM 7050   C CA . VAL A 1 2226 ? 159.756 221.010 188.337 1.00 0.00 ? 2226 VAL A CA 4  
ATOM 7051   C CA . ILE A 1 2227 ? 158.013 219.050 191.104 1.00 0.00 ? 2227 ILE A CA 4  
ATOM 7052   C CA . ASN A 1 2228 ? 159.524 216.918 193.866 1.00 0.00 ? 2228 ASN A CA 4  
ATOM 7053   C CA . THR A 1 2229 ? 158.631 213.228 193.813 1.00 0.00 ? 2229 THR A CA 4  
ATOM 7054   C CA . GLU A 1 2230 ? 158.435 212.786 197.591 1.00 0.00 ? 2230 GLU A CA 4  
ATOM 7055   C CA . ASP A 1 2231 ? 156.941 216.158 198.631 1.00 0.00 ? 2231 ASP A CA 4  
ATOM 7056   C CA . GLY A 1 2232 ? 154.598 217.693 196.055 1.00 0.00 ? 2232 GLY A CA 4  
ATOM 7057   C CA . LYS A 1 2233 ? 154.700 220.960 198.011 1.00 0.00 ? 2233 LYS A CA 4  
ATOM 7058   C CA . LYS A 1 2234 ? 158.259 221.362 196.652 1.00 0.00 ? 2234 LYS A CA 4  
ATOM 7059   C CA . ARG A 1 2235 ? 157.798 222.769 193.154 1.00 0.00 ? 2235 ARG A CA 4  
ATOM 7060   C CA . HIS A 1 2236 ? 159.149 225.651 191.094 1.00 0.00 ? 2236 HIS A CA 4  
ATOM 7061   C CA . THR A 1 2237 ? 159.701 226.837 187.525 1.00 0.00 ? 2237 THR A CA 4  
ATOM 7062   C CA . LEU A 1 2238 ? 162.828 227.093 185.375 1.00 0.00 ? 2238 LEU A CA 4  
ATOM 7063   C CA . GLU A 1 2239 ? 163.381 229.753 182.707 1.00 0.00 ? 2239 GLU A CA 4  
ATOM 7064   C CA . LYS A 1 2240 ? 160.385 230.119 180.409 1.00 0.00 ? 2240 LYS A CA 4  
ATOM 7065   C CA . MET A 1 2241 ? 160.908 228.905 176.851 1.00 0.00 ? 2241 MET A CA 4  
ATOM 7066   C CA . THR A 1 2242 ? 160.103 231.135 173.887 1.00 0.00 ? 2242 THR A CA 4  
ATOM 7067   C CA . ASP A 1 2243 ? 157.816 228.427 172.452 1.00 0.00 ? 2243 ASP A CA 4  
ATOM 7068   C CA . SER A 1 2244 ? 156.151 225.229 173.632 1.00 0.00 ? 2244 SER A CA 4  
ATOM 7069   C CA . VAL A 1 2245 ? 158.354 222.492 175.078 1.00 0.00 ? 2245 VAL A CA 4  
ATOM 7070   C CA . THR A 1 2246 ? 158.211 219.556 172.661 1.00 0.00 ? 2246 THR A CA 4  
ATOM 7071   C CA . CYS A 1 2247 ? 161.080 217.394 173.951 1.00 0.00 ? 2247 CYS A CA 4  
ATOM 7072   C CA . LEU A 1 2248 ? 162.629 216.423 177.295 1.00 0.00 ? 2248 LEU A CA 4  
ATOM 7073   C CA . TYR A 1 2249 ? 165.595 214.056 177.524 1.00 0.00 ? 2249 TYR A CA 4  
ATOM 7074   C CA . CYS A 1 2250 ? 168.004 213.235 180.357 1.00 0.00 ? 2250 CYS A CA 4  
ATOM 7075   C CA . ASN A 1 2251 ? 171.588 212.778 179.174 1.00 0.00 ? 2251 ASN A CA 4  
ATOM 7076   C CA . SER A 1 2252 ? 175.033 212.041 180.594 1.00 0.00 ? 2252 SER A CA 4  
ATOM 7077   C CA . PHE A 1 2253 ? 178.577 212.924 179.532 1.00 0.00 ? 2253 PHE A CA 4  
ATOM 7078   C CA . GLN A 1 2259 ? 180.217 212.044 184.078 1.00 0.00 ? 2254 GLN A CA 4  
ATOM 7079   C CA . LYS A 1 2260 ? 177.869 215.045 184.075 1.00 0.00 ? 2260 LYS A CA 4  
ATOM 7080   C CA . ASN A 1 2261 ? 174.098 214.716 183.702 1.00 0.00 ? 2261 ASN A CA 4  
ATOM 7081   C CA . PHE A 1 2262 ? 171.965 217.168 181.740 1.00 0.00 ? 2262 PHE A CA 4  
ATOM 7082   C CA . LEU A 1 2263 ? 168.351 217.994 180.905 1.00 0.00 ? 2263 LEU A CA 4  
ATOM 7083   C CA . LEU A 1 2264 ? 167.903 218.603 177.173 1.00 0.00 ? 2264 LEU A CA 4  
ATOM 7084   C CA . VAL A 1 2265 ? 164.820 220.654 176.273 1.00 0.00 ? 2265 VAL A CA 4  
ATOM 7085   C CA . GLY A 1 2266 ? 163.617 220.773 172.668 1.00 0.00 ? 2266 GLY A CA 4  
ATOM 7086   C CA . THR A 1 2267 ? 161.193 223.565 171.790 1.00 0.00 ? 2267 THR A CA 4  
ATOM 7087   C CA . ALA A 1 2268 ? 158.704 224.204 168.996 1.00 0.00 ? 2268 ALA A CA 4  
ATOM 7088   C CA . ASP A 1 2269 ? 160.770 227.061 167.505 1.00 0.00 ? 2269 ASP A CA 4  
ATOM 7089   C CA . GLY A 1 2270 ? 163.749 224.845 166.670 1.00 0.00 ? 2270 GLY A CA 4  
ATOM 7090   C CA . LYS A 1 2271 ? 165.818 225.501 169.798 1.00 0.00 ? 2271 LYS A CA 4  
ATOM 7091   C CA . LEU A 1 2272 ? 167.471 223.091 172.240 1.00 0.00 ? 2272 LEU A CA 4  
ATOM 7092   C CA . ALA A 1 2273 ? 168.198 224.324 175.771 1.00 0.00 ? 2273 ALA A CA 4  
ATOM 7093   C CA . ILE A 1 2274 ? 170.635 222.505 178.064 1.00 0.00 ? 2274 ILE A CA 4  
ATOM 7094   C CA . PHE A 1 2275 ? 170.237 222.511 181.844 1.00 0.00 ? 2275 PHE A CA 4  
ATOM 7095   C CA . GLU A 1 2276 ? 172.822 221.010 184.148 1.00 0.00 ? 2276 GLU A CA 4  
ATOM 7096   C CA . ASP A 1 2277 ? 171.846 218.216 186.534 1.00 0.00 ? 2277 ASP A CA 4  
ATOM 7097   C CA . LYS A 1 2278 ? 172.026 220.362 189.676 1.00 0.00 ? 2278 LYS A CA 4  
ATOM 7098   C CA . THR A 1 2279 ? 170.597 223.615 188.274 1.00 0.00 ? 2279 THR A CA 4  
ATOM 7099   C CA . VAL A 1 2280 ? 167.185 221.945 187.878 1.00 0.00 ? 2280 VAL A CA 4  
ATOM 7100   C CA . LYS A 1 2281 ? 166.646 222.376 191.636 1.00 0.00 ? 2281 LYS A CA 4  
ATOM 7101   C CA . LEU A 1 2282 ? 166.836 226.181 191.396 1.00 0.00 ? 2282 LEU A CA 4  
ATOM 7102   C CA . LYS A 1 2283 ? 163.848 228.454 190.836 1.00 0.00 ? 2283 LYS A CA 4  
ATOM 7103   C CA . GLY A 1 2284 ? 164.162 230.483 187.651 1.00 0.00 ? 2284 GLY A CA 4  
ATOM 7104   C CA . ALA A 1 2285 ? 167.337 228.688 186.584 1.00 0.00 ? 2285 ALA A CA 4  
ATOM 7105   C CA . ALA A 1 2286 ? 168.631 229.571 183.118 1.00 0.00 ? 2286 ALA A CA 4  
ATOM 7106   C CA . PRO A 1 2287 ? 170.061 227.003 180.681 1.00 0.00 ? 2287 PRO A CA 4  
ATOM 7107   C CA . LEU A 1 2288 ? 173.788 226.571 180.206 1.00 0.00 ? 2288 LEU A CA 4  
ATOM 7108   C CA . LYS A 1 2289 ? 173.344 226.945 176.443 1.00 0.00 ? 2289 LYS A CA 4  
ATOM 7109   C CA . ILE A 1 2290 ? 170.599 227.332 173.837 1.00 0.00 ? 2290 ILE A CA 4  
ATOM 7110   C CA . LEU A 1 2291 ? 171.123 225.941 170.332 1.00 0.00 ? 2291 LEU A CA 4  
ATOM 7111   C CA . ASN A 1 2292 ? 169.152 227.596 167.524 1.00 0.00 ? 2292 ASN A CA 4  
ATOM 7112   C CA . ILE A 1 2293 ? 168.850 224.616 165.181 1.00 0.00 ? 2293 ILE A CA 4  
ATOM 7113   C CA . GLY A 1 2294 ? 165.721 225.682 163.254 1.00 0.00 ? 2294 GLY A CA 4  
ATOM 7114   C CA . ASN A 1 2295 ? 162.846 228.142 163.254 1.00 0.00 ? 2295 ASN A CA 4  
ATOM 7115   C CA . VAL A 1 2296 ? 159.225 228.480 164.370 1.00 0.00 ? 2296 VAL A CA 4  
ATOM 7116   C CA . SER A 1 2297 ? 158.279 226.049 161.581 1.00 0.00 ? 2297 SER A CA 4  
ATOM 7117   C CA . THR A 1 2298 ? 160.760 223.270 162.528 1.00 0.00 ? 2298 THR A CA 4  
ATOM 7118   C CA . PRO A 1 2299 ? 159.973 221.911 166.008 1.00 0.00 ? 2299 PRO A CA 4  
ATOM 7119   C CA . LEU A 1 2300 ? 162.591 219.874 167.858 1.00 0.00 ? 2300 LEU A CA 4  
ATOM 7120   C CA . MET A 1 2301 ? 160.563 216.776 168.691 1.00 0.00 ? 2301 MET A CA 4  
ATOM 7121   C CA . CYS A 1 2302 ? 162.912 213.864 169.433 1.00 0.00 ? 2302 CYS A CA 4  
ATOM 7122   C CA . LEU A 1 2303 ? 166.283 213.058 170.997 1.00 0.00 ? 2303 LEU A CA 4  
ATOM 7123   C CA . SER A 1 2304 ? 168.196 209.794 171.303 1.00 0.00 ? 2304 SER A CA 4  
ATOM 7124   C CA . GLU A 1 2305 ? 171.585 208.465 172.354 1.00 0.00 ? 2305 GLU A CA 4  
ATOM 7125   C CA . VAL A 1 2314 ? 177.011 211.471 171.235 1.00 0.00 ? 2314 VAL A CA 4  
ATOM 7126   C CA . MET A 1 2315 ? 173.424 212.671 170.796 1.00 0.00 ? 2315 MET A CA 4  
ATOM 7127   C CA . TRP A 1 2316 ? 171.224 212.608 167.700 1.00 0.00 ? 2316 TRP A CA 4  
ATOM 7128   C CA . GLY A 1 2317 ? 167.991 214.521 167.258 1.00 0.00 ? 2317 GLY A CA 4  
ATOM 7129   C CA . GLY A 1 2318 ? 165.314 215.546 164.820 1.00 0.00 ? 2318 GLY A CA 4  
ATOM 7130   C CA . CYS A 1 2319 ? 164.388 219.124 163.907 1.00 0.00 ? 2319 CYS A CA 4  
ATOM 7131   C CA . GLY A 1 2320 ? 161.957 219.428 161.024 1.00 0.00 ? 2320 GLY A CA 4  
ATOM 7132   C CA . THR A 1 2321 ? 163.390 217.336 158.206 1.00 0.00 ? 2321 THR A CA 4  
ATOM 7133   C CA . LYS A 1 2322 ? 166.961 217.607 159.546 1.00 0.00 ? 2322 LYS A CA 4  
ATOM 7134   C CA . ILE A 1 2323 ? 168.876 215.161 161.730 1.00 0.00 ? 2323 ILE A CA 4  
ATOM 7135   C CA . PHE A 1 2324 ? 171.441 216.797 163.998 1.00 0.00 ? 2324 PHE A CA 4  
ATOM 7136   C CA . SER A 1 2325 ? 174.268 215.523 166.183 1.00 0.00 ? 2325 SER A CA 4  
ATOM 7137   C CA . PHE A 1 2326 ? 176.190 216.970 169.111 1.00 0.00 ? 2326 PHE A CA 4  
ATOM 7138   C CA . SER A 1 2327 ? 178.486 215.807 171.890 1.00 0.00 ? 2327 SER A CA 4  
ATOM 7139   C CA . ASN A 1 2328 ? 180.403 217.385 174.767 1.00 0.00 ? 2328 ASN A CA 4  
ATOM 7140   C CA . ASP A 1 2329 ? 180.607 221.075 173.826 1.00 0.00 ? 2329 ASP A CA 4  
ATOM 7141   C CA . PHE A 1 2330 ? 177.025 221.273 172.454 1.00 0.00 ? 2330 PHE A CA 4  
ATOM 7142   C CA . THR A 1 2331 ? 178.223 222.437 169.054 1.00 0.00 ? 2331 THR A CA 4  
ATOM 7143   C CA . ILE A 1 2332 ? 176.186 220.926 166.232 1.00 0.00 ? 2332 ILE A CA 4  
ATOM 7144   C CA . GLN A 1 2333 ? 178.484 218.541 164.383 1.00 0.00 ? 2333 GLN A CA 4  
ATOM 7145   C CA . LYS A 1 2334 ? 176.411 216.606 161.843 1.00 0.00 ? 2334 LYS A CA 4  
ATOM 7146   C CA . LEU A 1 2335 ? 173.371 218.073 160.084 1.00 0.00 ? 2335 LEU A CA 4  
ATOM 7147   C CA . ILE A 1 2336 ? 171.644 215.868 157.494 1.00 0.00 ? 2336 ILE A CA 4  
ATOM 7148   C CA . GLU A 1 2337 ? 168.774 217.019 155.279 1.00 0.00 ? 2337 GLU A CA 4  
ATOM 7149   C CA . THR A 1 2338 ? 166.329 214.134 154.823 1.00 0.00 ? 2338 THR A CA 4  
ATOM 7150   C CA . ARG A 1 2339 ? 163.726 215.943 152.700 1.00 0.00 ? 2339 ARG A CA 4  
ATOM 7151   C CA . THR A 1 2340 ? 165.347 214.816 149.430 1.00 0.00 ? 2340 THR A CA 4  
ATOM 7152   C CA . SER A 1 2341 ? 166.739 211.520 148.138 1.00 0.00 ? 2341 SER A CA 4  
ATOM 7153   C CA . GLN A 1 2342 ? 166.561 210.054 144.638 1.00 0.00 ? 2342 GLN A CA 4  
ATOM 7154   C CA . LEU A 1 2343 ? 166.004 206.515 145.959 1.00 0.00 ? 2343 LEU A CA 4  
ATOM 7155   C CA . PHE A 1 2344 ? 162.823 207.568 147.782 1.00 0.00 ? 2344 PHE A CA 4  
ATOM 7156   C CA . SER A 1 2345 ? 160.070 205.058 147.069 1.00 0.00 ? 2345 SER A CA 4  
ATOM 7157   C CA . TYR A 1 2346 ? 157.586 207.928 147.483 1.00 0.00 ? 2346 TYR A CA 4  
ATOM 7158   C CA . ALA A 1 2347 ? 158.575 211.573 147.816 1.00 0.00 ? 2347 ALA A CA 4  
ATOM 7159   C CA . ALA A 1 2348 ? 155.690 213.165 149.735 1.00 0.00 ? 2348 ALA A CA 4  
ATOM 7160   C CA . PHE A 1 2349 ? 156.326 211.028 152.829 1.00 0.00 ? 2349 PHE A CA 4  
ATOM 7161   C CA . SER A 1 2350 ? 159.916 212.232 153.213 1.00 0.00 ? 2350 SER A CA 4  
ATOM 7162   C CA . ASP A 1 2351 ? 158.779 215.878 153.246 1.00 0.00 ? 2351 ASP A CA 4  
ATOM 7163   C CA . SER A 1 2352 ? 157.507 215.713 156.812 1.00 0.00 ? 2352 SER A CA 4  
ATOM 7164   C CA . ASN A 1 2353 ? 158.795 216.490 160.284 1.00 0.00 ? 2353 ASN A CA 4  
ATOM 7165   C CA . ILE A 1 2354 ? 160.800 213.702 161.904 1.00 0.00 ? 2354 ILE A CA 4  
ATOM 7166   C CA . ILE A 1 2355 ? 158.828 212.300 164.845 1.00 0.00 ? 2355 ILE A CA 4  
ATOM 7167   C CA . THR A 1 2356 ? 161.371 209.842 166.294 1.00 0.00 ? 2356 THR A CA 4  
ATOM 7168   C CA . VAL A 1 2357 ? 165.017 208.813 165.927 1.00 0.00 ? 2357 VAL A CA 4  
ATOM 7169   C CA . VAL A 1 2358 ? 166.512 205.508 167.091 1.00 0.00 ? 2358 VAL A CA 4  
ATOM 7170   C CA . VAL A 1 2359 ? 170.299 205.164 166.897 1.00 0.00 ? 2359 VAL A CA 4  
ATOM 7171   C CA . ASP A 1 2360 ? 172.054 201.826 166.415 1.00 0.00 ? 2360 ASP A CA 4  
ATOM 7172   C CA . THR A 1 2361 ? 174.542 201.082 163.637 1.00 0.00 ? 2361 THR A CA 4  
ATOM 7173   C CA . ALA A 1 2362 ? 172.597 203.488 161.411 1.00 0.00 ? 2362 ALA A CA 4  
ATOM 7174   C CA . LEU A 1 2363 ? 169.888 206.101 161.938 1.00 0.00 ? 2363 LEU A CA 4  
ATOM 7175   C CA . TYR A 1 2364 ? 166.297 204.837 161.711 1.00 0.00 ? 2364 TYR A CA 4  
ATOM 7176   C CA . ILE A 1 2365 ? 163.988 207.849 161.467 1.00 0.00 ? 2365 ILE A CA 4  
ATOM 7177   C CA . ALA A 1 2366 ? 160.218 208.023 161.098 1.00 0.00 ? 2366 ALA A CA 4  
ATOM 7178   C CA . LYS A 1 2367 ? 158.276 211.021 159.811 1.00 0.00 ? 2367 LYS A CA 4  
ATOM 7179   C CA . GLN A 1 2368 ? 154.807 212.365 160.518 1.00 0.00 ? 2368 GLN A CA 4  
ATOM 7180   C CA . ASN A 1 2369 ? 152.018 210.633 158.565 1.00 0.00 ? 2369 ASN A CA 4  
ATOM 7181   C CA . SER A 1 2370 ? 154.539 208.398 156.783 1.00 0.00 ? 2370 SER A CA 4  
ATOM 7182   C CA . PRO A 1 2371 ? 154.649 204.574 156.589 1.00 0.00 ? 2371 PRO A CA 4  
ATOM 7183   C CA . VAL A 1 2372 ? 158.349 204.500 155.613 1.00 0.00 ? 2372 VAL A CA 4  
ATOM 7184   C CA . VAL A 1 2373 ? 161.131 204.196 158.178 1.00 0.00 ? 2373 VAL A CA 4  
ATOM 7185   C CA . GLU A 1 2374 ? 164.142 205.827 156.530 1.00 0.00 ? 2374 GLU A CA 4  
ATOM 7186   C CA . VAL A 1 2375 ? 167.635 204.498 157.248 1.00 0.00 ? 2375 VAL A CA 4  
ATOM 7187   C CA . TRP A 1 2376 ? 170.539 206.952 157.002 1.00 0.00 ? 2376 TRP A CA 4  
ATOM 7188   C CA . ASP A 1 2377 ? 174.289 206.498 157.435 1.00 0.00 ? 2377 ASP A CA 4  
ATOM 7189   C CA . LYS A 1 2378 ? 176.093 208.481 160.127 1.00 0.00 ? 2378 LYS A CA 4  
ATOM 7190   C CA . LYS A 1 2379 ? 179.319 208.756 158.122 1.00 0.00 ? 2379 LYS A CA 4  
ATOM 7191   C CA . THR A 1 2380 ? 178.239 209.287 154.506 1.00 0.00 ? 2380 THR A CA 4  
ATOM 7192   C CA . GLU A 1 2381 ? 175.032 211.161 155.481 1.00 0.00 ? 2381 GLU A CA 4  
ATOM 7193   C CA . LYS A 1 2382 ? 172.999 209.390 152.770 1.00 0.00 ? 2382 LYS A CA 4  
ATOM 7194   C CA . LEU A 1 2383 ? 170.222 206.824 152.562 1.00 0.00 ? 2383 LEU A CA 4  
ATOM 7195   C CA . CYS A 1 2384 ? 171.229 203.442 153.929 1.00 0.00 ? 2384 CYS A CA 4  
ATOM 7196   C CA . GLY A 1 2385 ? 167.849 201.894 153.194 1.00 0.00 ? 2385 GLY A CA 4  
ATOM 7197   C CA . LEU A 1 2386 ? 164.069 201.999 153.388 1.00 0.00 ? 2386 LEU A CA 4  
ATOM 7198   C CA . ILE A 1 2387 ? 161.597 199.988 155.465 1.00 0.00 ? 2387 ILE A CA 4  
ATOM 7199   C CA . ASP A 1 2388 ? 158.055 200.219 154.063 1.00 0.00 ? 2388 ASP A CA 4  
ATOM 7200   C CA . CYS A 1 2389 ? 155.641 199.098 156.783 1.00 0.00 ? 2389 CYS A CA 4  
ATOM 7201   C CA . VAL A 1 2390 ? 152.724 198.844 154.326 1.00 0.00 ? 2390 VAL A CA 4  
ATOM 7202   C CA . HIS A 1 2391 ? 154.466 195.980 152.521 1.00 0.00 ? 2391 HIS A CA 4  
ATOM 7203   C CA . PHE A 1 2392 ? 155.495 194.226 155.741 1.00 0.00 ? 2392 PHE A CA 4  
ATOM 7204   C CA . LEU A 1 2393 ? 151.912 194.427 157.005 1.00 0.00 ? 2393 LEU A CA 4  
ATOM 7205   C CA . ARG A 1 2394 ? 150.427 193.147 153.723 1.00 0.00 ? 2394 ARG A CA 4  
ATOM 7206   C CA . GLU A 1 2395 ? 152.171 189.760 154.117 1.00 0.00 ? 2395 GLU A CA 4  
ATOM 7207   C CA . MET A 1 2408 ? 145.270 194.870 153.138 1.00 0.00 ? 2408 MET A CA 4  
ATOM 7208   C CA . SER A 1 2409 ? 143.837 198.371 153.622 1.00 0.00 ? 2409 SER A CA 4  
ATOM 7209   C CA . TYR A 1 2410 ? 146.449 199.352 156.223 1.00 0.00 ? 2410 TYR A CA 4  
ATOM 7210   C CA . SER A 1 2411 ? 147.814 202.893 156.192 1.00 0.00 ? 2411 SER A CA 4  
ATOM 7211   C CA . GLY A 1 2412 ? 150.978 201.642 157.897 1.00 0.00 ? 2412 GLY A CA 4  
ATOM 7212   C CA . ARG A 1 2413 ? 151.525 205.137 159.278 1.00 0.00 ? 2413 ARG A CA 4  
ATOM 7213   C CA . VAL A 1 2414 ? 154.457 204.834 161.675 1.00 0.00 ? 2414 VAL A CA 4  
ATOM 7214   C CA . LYS A 1 2415 ? 153.762 206.109 165.189 1.00 0.00 ? 2415 LYS A CA 4  
ATOM 7215   C CA . THR A 1 2416 ? 156.706 204.934 167.284 1.00 0.00 ? 2416 THR A CA 4  
ATOM 7216   C CA . LEU A 1 2417 ? 160.078 203.160 167.119 1.00 0.00 ? 2417 LEU A CA 4  
ATOM 7217   C CA . CYS A 1 2418 ? 161.819 201.244 169.902 1.00 0.00 ? 2418 CYS A CA 4  
ATOM 7218   C CA . LEU A 1 2419 ? 165.062 199.264 169.978 1.00 0.00 ? 2419 LEU A CA 4  
ATOM 7219   C CA . GLN A 1 2420 ? 165.153 195.827 171.603 1.00 0.00 ? 2420 GLN A CA 4  
ATOM 7220   C CA . LYS A 1 2421 ? 168.645 194.832 172.773 1.00 0.00 ? 2421 LYS A CA 4  
ATOM 7221   C CA . ASN A 1 2422 ? 171.164 195.132 169.935 1.00 0.00 ? 2422 ASN A CA 4  
ATOM 7222   C CA . THR A 1 2423 ? 169.260 193.461 167.090 1.00 0.00 ? 2423 THR A CA 4  
ATOM 7223   C CA . ALA A 1 2424 ? 165.538 194.108 167.179 1.00 0.00 ? 2424 ALA A CA 4  
ATOM 7224   C CA . LEU A 1 2425 ? 163.389 197.089 166.183 1.00 0.00 ? 2425 LEU A CA 4  
ATOM 7225   C CA . TRP A 1 2426 ? 159.770 197.498 167.299 1.00 0.00 ? 2426 TRP A CA 4  
ATOM 7226   C CA . ILE A 1 2427 ? 157.525 199.611 165.052 1.00 0.00 ? 2427 ILE A CA 4  
ATOM 7227   C CA . GLY A 1 2428 ? 154.114 200.753 166.306 1.00 0.00 ? 2428 GLY A CA 4  
ATOM 7228   C CA . THR A 1 2429 ? 151.942 201.808 163.384 1.00 0.00 ? 2429 THR A CA 4  
ATOM 7229   C CA . GLY A 1 2430 ? 148.827 204.047 163.360 1.00 0.00 ? 2430 GLY A CA 4  
ATOM 7230   C CA . GLY A 1 2431 ? 146.537 201.060 163.521 1.00 0.00 ? 2431 GLY A CA 4  
ATOM 7231   C CA . GLY A 1 2432 ? 146.879 198.644 166.381 1.00 0.00 ? 2432 GLY A CA 4  
ATOM 7232   C CA . HIS A 1 2433 ? 149.778 196.932 164.648 1.00 0.00 ? 2433 HIS A CA 4  
ATOM 7233   C CA . ILE A 1 2434 ? 153.198 196.192 166.142 1.00 0.00 ? 2434 ILE A CA 4  
ATOM 7234   C CA . LEU A 1 2435 ? 156.093 194.932 164.001 1.00 0.00 ? 2435 LEU A CA 4  
ATOM 7235   C CA . LEU A 1 2436 ? 159.386 193.403 165.153 1.00 0.00 ? 2436 LEU A CA 4  
ATOM 7236   C CA . LEU A 1 2437 ? 162.229 193.546 162.613 1.00 0.00 ? 2437 LEU A CA 4  
ATOM 7237   C CA . ASP A 1 2438 ? 165.733 192.077 162.753 1.00 0.00 ? 2438 ASP A CA 4  
ATOM 7238   C CA . LEU A 1 2439 ? 168.313 194.815 162.052 1.00 0.00 ? 2439 LEU A CA 4  
ATOM 7239   C CA . SER A 1 2440 ? 171.249 192.880 160.586 1.00 0.00 ? 2440 SER A CA 4  
ATOM 7240   C CA . THR A 1 2441 ? 171.015 190.376 157.734 1.00 0.00 ? 2441 THR A CA 4  
ATOM 7241   C CA . ARG A 1 2442 ? 167.228 189.919 157.474 1.00 0.00 ? 2442 ARG A CA 4  
ATOM 7242   C CA . ARG A 1 2443 ? 163.998 191.707 158.407 1.00 0.00 ? 2443 ARG A CA 4  
ATOM 7243   C CA . LEU A 1 2444 ? 160.673 190.555 159.865 1.00 0.00 ? 2444 LEU A CA 4  
ATOM 7244   C CA . ILE A 1 2445 ? 160.742 188.587 163.125 1.00 0.00 ? 2445 ILE A CA 4  
ATOM 7245   C CA . ARG A 1 2446 ? 157.300 189.042 164.679 1.00 0.00 ? 2446 ARG A CA 4  
ATOM 7246   C CA . VAL A 1 2447 ? 153.996 190.752 163.872 1.00 0.00 ? 2447 VAL A CA 4  
ATOM 7247   C CA . ILE A 1 2448 ? 150.992 191.319 166.133 1.00 0.00 ? 2448 ILE A CA 4  
ATOM 7248   C CA . TYR A 1 2449 ? 147.885 192.692 164.400 1.00 0.00 ? 2449 TYR A CA 4  
ATOM 7249   C CA . ASN A 1 2450 ? 145.106 194.632 166.139 1.00 0.00 ? 2450 ASN A CA 4  
ATOM 7250   C CA . PHE A 1 2451 ? 147.135 194.834 169.348 1.00 0.00 ? 2451 PHE A CA 4  
ATOM 7251   C CA . CYS A 1 2452 ? 144.987 197.934 169.900 1.00 0.00 ? 2452 CYS A CA 4  
ATOM 7252   C CA . ASN A 1 2453 ? 143.264 200.528 167.722 1.00 0.00 ? 2453 ASN A CA 4  
ATOM 7253   C CA . SER A 1 2454 ? 146.295 202.859 167.616 1.00 0.00 ? 2454 SER A CA 4  
ATOM 7254   C CA . VAL A 1 2455 ? 149.771 202.487 169.160 1.00 0.00 ? 2455 VAL A CA 4  
ATOM 7255   C CA . ARG A 1 2456 ? 150.759 205.871 170.589 1.00 0.00 ? 2456 ARG A CA 4  
ATOM 7256   C CA . VAL A 1 2457 ? 153.835 205.295 172.782 1.00 0.00 ? 2457 VAL A CA 4  
ATOM 7257   C CA . MET A 1 2458 ? 156.312 202.424 173.032 1.00 0.00 ? 2458 MET A CA 4  
ATOM 7258   C CA . MET A 1 2459 ? 159.326 202.464 175.351 1.00 0.00 ? 2459 MET A CA 4  
ATOM 7259   C CA . THR A 1 2460 ? 161.735 200.362 177.404 1.00 0.00 ? 2460 THR A CA 4  
ATOM 7260   C CA . ALA A 1 2461 ? 162.198 200.818 181.156 1.00 0.00 ? 2461 ALA A CA 4  
ATOM 7261   C CA . GLN A 1 2462 ? 164.115 199.226 184.021 1.00 0.00 ? 2462 GLN A CA 4  
ATOM 7262   C CA . ASN A 1 2468 ? 164.173 195.043 181.155 1.00 0.00 ? 2468 ASN A CA 4  
ATOM 7263   C CA . VAL A 1 2469 ? 160.488 195.909 180.726 1.00 0.00 ? 2469 VAL A CA 4  
ATOM 7264   C CA . MET A 1 2470 ? 158.350 196.897 177.731 1.00 0.00 ? 2470 MET A CA 4  
ATOM 7265   C CA . LEU A 1 2471 ? 155.596 199.535 177.903 1.00 0.00 ? 2471 LEU A CA 4  
ATOM 7266   C CA . VAL A 1 2472 ? 153.095 200.176 175.091 1.00 0.00 ? 2472 VAL A CA 4  
ATOM 7267   C CA . LEU A 1 2473 ? 150.452 202.883 175.494 1.00 0.00 ? 2473 LEU A CA 4  
ATOM 7268   C CA . GLY A 1 2474 ? 147.661 202.567 172.940 1.00 0.00 ? 2474 GLY A CA 4  
ATOM 7269   C CA . TYR A 1 2475 ? 144.216 204.110 172.746 1.00 0.00 ? 2475 TYR A CA 4  
ATOM 7270   C CA . ASN A 1 2476 ? 140.808 202.891 171.515 1.00 0.00 ? 2476 ASN A CA 4  
ATOM 7271   C CA . ARG A 1 2477 ? 137.937 205.085 170.398 1.00 0.00 ? 2477 ARG A CA 4  
ATOM 7272   C CA . GLU A 1 2488 ? 134.595 208.279 173.919 1.00 0.00 ? 2497 GLU A CA 4  
ATOM 7273   C CA . ILE A 1 2489 ? 138.253 207.293 174.347 1.00 0.00 ? 2498 ILE A CA 4  
ATOM 7274   C CA . GLN A 1 2490 ? 139.803 204.438 176.353 1.00 0.00 ? 2499 GLN A CA 4  
ATOM 7275   C CA . SER A 1 2491 ? 143.570 204.535 176.842 1.00 0.00 ? 2500 SER A CA 4  
ATOM 7276   C CA . CYS A 1 2492 ? 145.388 201.342 177.817 1.00 0.00 ? 2501 CYS A CA 4  
ATOM 7277   C CA . LEU A 1 2493 ? 148.935 200.577 178.956 1.00 0.00 ? 2502 LEU A CA 4  
ATOM 7278   C CA . THR A 1 2494 ? 150.281 197.120 178.080 1.00 0.00 ? 2503 THR A CA 4  
ATOM 7279   C CA . VAL A 1 2495 ? 153.435 195.829 179.761 1.00 0.00 ? 2504 VAL A CA 4  
ATOM 7280   C CA . TRP A 1 2496 ? 155.699 192.775 179.577 1.00 0.00 ? 2505 TRP A CA 4  
ATOM 7281   C CA . TYR B 1 1332 ? 115.835 129.705 91.531  1.00 0.00 ? 1332 TYR B CA 4  
ATOM 7282   C CA . ASN B 1 1333 ? 118.748 132.154 90.852  1.00 0.00 ? 1333 ASN B CA 4  
ATOM 7283   C CA . ARG B 1 1334 ? 117.580 135.059 92.954  1.00 0.00 ? 1334 ARG B CA 4  
ATOM 7284   C CA . MET B 1 1335 ? 118.930 136.673 96.150  1.00 0.00 ? 1335 MET B CA 4  
ATOM 7285   C CA . LYS B 1 1336 ? 118.163 139.536 98.557  1.00 0.00 ? 1336 LYS B CA 4  
ATOM 7286   C CA . LEU B 1 1337 ? 120.935 142.017 99.351  1.00 0.00 ? 1337 LEU B CA 4  
ATOM 7287   C CA . MET B 1 1338 ? 120.052 143.926 102.499 1.00 0.00 ? 1338 MET B CA 4  
ATOM 7288   C CA . ILE B 1 1339 ? 121.998 147.172 102.912 1.00 0.00 ? 1339 ILE B CA 4  
ATOM 7289   C CA . VAL B 1 1340 ? 122.605 147.746 106.641 1.00 0.00 ? 1340 VAL B CA 4  
ATOM 7290   C CA . GLY B 1 1341 ? 124.142 150.787 108.349 1.00 0.00 ? 1341 GLY B CA 4  
ATOM 7291   C CA . ASN B 1 1342 ? 123.544 154.209 109.872 1.00 0.00 ? 1342 ASN B CA 4  
ATOM 7292   C CA . THR B 1 1343 ? 121.808 156.682 107.462 1.00 0.00 ? 1343 THR B CA 4  
ATOM 7293   C CA . GLY B 1 1344 ? 124.447 157.820 104.952 1.00 0.00 ? 1344 GLY B CA 4  
ATOM 7294   C CA . SER B 1 1345 ? 127.516 155.711 105.694 1.00 0.00 ? 1345 SER B CA 4  
ATOM 7295   C CA . GLY B 1 1346 ? 127.533 155.654 101.856 1.00 0.00 ? 1346 GLY B CA 4  
ATOM 7296   C CA . LYS B 1 1347 ? 124.725 153.184 101.040 1.00 0.00 ? 1347 LYS B CA 4  
ATOM 7297   C CA . THR B 1 1348 ? 123.837 155.062 97.802  1.00 0.00 ? 1348 THR B CA 4  
ATOM 7298   C CA . THR B 1 1349 ? 127.581 155.668 97.121  1.00 0.00 ? 1349 THR B CA 4  
ATOM 7299   C CA . LEU B 1 1350 ? 128.388 151.960 97.378  1.00 0.00 ? 1350 LEU B CA 4  
ATOM 7300   C CA . LEU B 1 1351 ? 125.374 151.108 95.152  1.00 0.00 ? 1351 LEU B CA 4  
ATOM 7301   C CA . GLN B 1 1352 ? 126.339 153.648 92.432  1.00 0.00 ? 1352 GLN B CA 4  
ATOM 7302   C CA . GLN B 1 1353 ? 129.815 152.099 92.323  1.00 0.00 ? 1353 GLN B CA 4  
ATOM 7303   C CA . LEU B 1 1354 ? 128.692 148.423 92.156  1.00 0.00 ? 1354 LEU B CA 4  
ATOM 7304   C CA . MET B 1 1355 ? 126.010 148.858 89.558  1.00 0.00 ? 1355 MET B CA 4  
ATOM 7305   C CA . LYS B 1 1356 ? 128.047 150.382 86.625  1.00 0.00 ? 1356 LYS B CA 4  
ATOM 7306   C CA . THR B 1 1357 ? 125.024 150.585 84.253  1.00 0.00 ? 1357 THR B CA 4  
ATOM 7307   C CA . LYS B 1 1358 ? 124.174 153.405 81.773  1.00 0.00 ? 1358 LYS B CA 4  
ATOM 7308   C CA . LYS B 1 1359 ? 122.755 155.269 84.801  1.00 0.00 ? 1359 LYS B CA 4  
ATOM 7309   C CA . SER B 1 1360 ? 119.345 153.693 84.031  1.00 0.00 ? 1360 SER B CA 4  
ATOM 7310   C CA . ASP B 1 1361 ? 117.471 154.196 87.330  1.00 0.00 ? 1361 ASP B CA 4  
ATOM 7311   C CA . LEU B 1 1362 ? 120.915 153.697 88.923  1.00 0.00 ? 1362 LEU B CA 4  
ATOM 7312   C CA . GLY B 1 1363 ? 120.650 156.893 90.929  1.00 0.00 ? 1363 GLY B CA 4  
ATOM 7313   C CA . MET B 1 1364 ? 118.501 157.159 94.067  1.00 0.00 ? 1364 MET B CA 4  
ATOM 7314   C CA . GLN B 1 1365 ? 119.807 158.410 97.414  1.00 0.00 ? 1365 GLN B CA 4  
ATOM 7315   C CA . SER B 1 1366 ? 117.454 157.844 100.360 1.00 0.00 ? 1366 SER B CA 4  
ATOM 7316   C CA . ALA B 1 1367 ? 120.010 157.031 103.015 1.00 0.00 ? 1367 ALA B CA 4  
ATOM 7317   C CA . THR B 1 1368 ? 117.954 158.254 106.074 1.00 0.00 ? 1368 THR B CA 4  
ATOM 7318   C CA . VAL B 1 1369 ? 114.511 156.789 106.985 1.00 0.00 ? 1369 VAL B CA 4  
ATOM 7319   C CA . GLY B 1 1370 ? 113.568 155.700 103.435 1.00 0.00 ? 1370 GLY B CA 4  
ATOM 7320   C CA . ILE B 1 1371 ? 112.697 152.565 101.440 1.00 0.00 ? 1371 ILE B CA 4  
ATOM 7321   C CA . ASP B 1 1372 ? 113.564 151.318 97.921  1.00 0.00 ? 1372 ASP B CA 4  
ATOM 7322   C CA . VAL B 1 1373 ? 114.483 148.242 95.830  1.00 0.00 ? 1373 VAL B CA 4  
ATOM 7323   C CA . LYS B 1 1374 ? 116.960 148.117 92.967  1.00 0.00 ? 1374 LYS B CA 4  
ATOM 7324   C CA . ASP B 1 1375 ? 117.039 144.809 91.128  1.00 0.00 ? 1375 ASP B CA 4  
ATOM 7325   C CA . TRP B 1 1376 ? 120.022 144.199 88.817  1.00 0.00 ? 1376 TRP B CA 4  
ATOM 7326   C CA . PRO B 1 1377 ? 121.386 140.997 87.202  1.00 0.00 ? 1377 PRO B CA 4  
ATOM 7327   C CA . ILE B 1 1378 ? 125.004 141.268 88.537  1.00 0.00 ? 1378 ILE B CA 4  
ATOM 7328   C CA . GLN B 1 1379 ? 126.635 138.231 87.122  1.00 0.00 ? 1379 GLN B CA 4  
ATOM 7329   C CA . ILE B 1 1380 ? 129.595 136.418 85.611  1.00 0.00 ? 1380 ILE B CA 4  
ATOM 7330   C CA . ARG B 1 1381 ? 129.183 135.560 81.947  1.00 0.00 ? 1381 ARG B CA 4  
ATOM 7331   C CA . ASP B 1 1382 ? 129.572 131.837 81.076  1.00 0.00 ? 1382 ASP B CA 4  
ATOM 7332   C CA . LYS B 1 1383 ? 129.343 130.613 84.709  1.00 0.00 ? 1383 LYS B CA 4  
ATOM 7333   C CA . ARG B 1 1384 ? 126.521 129.495 87.091  1.00 0.00 ? 1384 ARG B CA 4  
ATOM 7334   C CA . LYS B 1 1385 ? 126.126 133.113 88.092  1.00 0.00 ? 1385 LYS B CA 4  
ATOM 7335   C CA . ARG B 1 1386 ? 125.013 133.969 84.441  1.00 0.00 ? 1386 ARG B CA 4  
ATOM 7336   C CA . ASP B 1 1387 ? 121.268 133.836 85.288  1.00 0.00 ? 1387 ASP B CA 4  
ATOM 7337   C CA . LEU B 1 1388 ? 121.512 135.365 88.841  1.00 0.00 ? 1388 LEU B CA 4  
ATOM 7338   C CA . VAL B 1 1389 ? 119.230 138.223 89.926  1.00 0.00 ? 1389 VAL B CA 4  
ATOM 7339   C CA . LEU B 1 1390 ? 120.283 140.484 92.826  1.00 0.00 ? 1390 LEU B CA 4  
ATOM 7340   C CA . ASN B 1 1391 ? 117.613 142.447 94.687  1.00 0.00 ? 1391 ASN B CA 4  
ATOM 7341   C CA . VAL B 1 1392 ? 119.099 145.346 96.676  1.00 0.00 ? 1392 VAL B CA 4  
ATOM 7342   C CA . TRP B 1 1393 ? 116.818 146.327 99.547  1.00 0.00 ? 1393 TRP B CA 4  
ATOM 7343   C CA . ASP B 1 1394 ? 117.107 149.169 101.986 1.00 0.00 ? 1394 ASP B CA 4  
ATOM 7344   C CA . PHE B 1 1395 ? 114.521 149.299 104.802 1.00 0.00 ? 1395 PHE B CA 4  
ATOM 7345   C CA . ALA B 1 1396 ? 116.401 151.976 106.804 1.00 0.00 ? 1396 ALA B CA 4  
ATOM 7346   C CA . GLY B 1 1397 ? 116.621 150.023 110.103 1.00 0.00 ? 1397 GLY B CA 4  
ATOM 7347   C CA . ARG B 1 1398 ? 112.898 149.230 110.276 1.00 0.00 ? 1398 ARG B CA 4  
ATOM 7348   C CA . GLU B 1 1399 ? 112.651 145.593 109.197 1.00 0.00 ? 1399 GLU B CA 4  
ATOM 7349   C CA . GLU B 1 1400 ? 108.959 145.751 108.118 1.00 0.00 ? 1400 GLU B CA 4  
ATOM 7350   C CA . PHE B 1 1401 ? 108.750 142.195 106.661 1.00 0.00 ? 1401 PHE B CA 4  
ATOM 7351   C CA . TYR B 1 1402 ? 109.994 140.462 109.885 1.00 0.00 ? 1402 TYR B CA 4  
ATOM 7352   C CA . SER B 1 1403 ? 106.702 139.537 111.657 1.00 0.00 ? 1403 SER B CA 4  
ATOM 7353   C CA . THR B 1 1404 ? 104.741 138.088 108.712 1.00 0.00 ? 1404 THR B CA 4  
ATOM 7354   C CA . HIS B 1 1405 ? 107.588 136.896 106.461 1.00 0.00 ? 1405 HIS B CA 4  
ATOM 7355   C CA . PRO B 1 1406 ? 110.384 135.330 108.685 1.00 0.00 ? 1406 PRO B CA 4  
ATOM 7356   C CA . HIS B 1 1407 ? 112.186 133.657 105.753 1.00 0.00 ? 1407 HIS B CA 4  
ATOM 7357   C CA . PHE B 1 1408 ? 112.490 136.954 103.813 1.00 0.00 ? 1408 PHE B CA 4  
ATOM 7358   C CA . MET B 1 1409 ? 115.123 137.957 106.395 1.00 0.00 ? 1409 MET B CA 4  
ATOM 7359   C CA . THR B 1 1410 ? 116.495 134.539 107.482 1.00 0.00 ? 1410 THR B CA 4  
ATOM 7360   C CA . GLN B 1 1411 ? 116.733 132.786 104.097 1.00 0.00 ? 1411 GLN B CA 4  
ATOM 7361   C CA . ARG B 1 1412 ? 117.547 133.949 100.558 1.00 0.00 ? 1412 ARG B CA 4  
ATOM 7362   C CA . ALA B 1 1413 ? 119.552 136.847 101.951 1.00 0.00 ? 1413 ALA B CA 4  
ATOM 7363   C CA . LEU B 1 1414 ? 122.917 138.586 102.175 1.00 0.00 ? 1414 LEU B CA 4  
ATOM 7364   C CA . TYR B 1 1415 ? 123.511 141.384 104.666 1.00 0.00 ? 1415 TYR B CA 4  
ATOM 7365   C CA . LEU B 1 1416 ? 125.909 144.135 103.598 1.00 0.00 ? 1416 LEU B CA 4  
ATOM 7366   C CA . ALA B 1 1417 ? 127.070 146.216 106.514 1.00 0.00 ? 1417 ALA B CA 4  
ATOM 7367   C CA . VAL B 1 1418 ? 128.221 149.675 105.461 1.00 0.00 ? 1418 VAL B CA 4  
ATOM 7368   C CA . TYR B 1 1419 ? 130.562 151.361 107.912 1.00 0.00 ? 1419 TYR B CA 4  
ATOM 7369   C CA . ASP B 1 1420 ? 132.027 154.742 107.330 1.00 0.00 ? 1420 ASP B CA 4  
ATOM 7370   C CA . LEU B 1 1421 ? 134.925 153.889 109.641 1.00 0.00 ? 1421 LEU B CA 4  
ATOM 7371   C CA . SER B 1 1422 ? 135.918 157.555 110.226 1.00 0.00 ? 1422 SER B CA 4  
ATOM 7372   C CA . LYS B 1 1423 ? 132.333 158.644 111.030 1.00 0.00 ? 1423 LYS B CA 4  
ATOM 7373   C CA . GLY B 1 1424 ? 129.873 155.708 111.501 1.00 0.00 ? 1424 GLY B CA 4  
ATOM 7374   C CA . GLN B 1 1425 ? 132.418 153.708 113.534 1.00 0.00 ? 1425 GLN B CA 4  
ATOM 7375   C CA . ALA B 1 1426 ? 134.360 156.669 115.022 1.00 0.00 ? 1426 ALA B CA 4  
ATOM 7376   C CA . GLU B 1 1427 ? 131.565 159.208 115.924 1.00 0.00 ? 1427 GLU B CA 4  
ATOM 7377   C CA . VAL B 1 1428 ? 128.814 156.830 117.129 1.00 0.00 ? 1428 VAL B CA 4  
ATOM 7378   C CA . ASP B 1 1429 ? 130.378 153.281 117.371 1.00 0.00 ? 1429 ASP B CA 4  
ATOM 7379   C CA . ALA B 1 1430 ? 127.275 151.866 115.696 1.00 0.00 ? 1430 ALA B CA 4  
ATOM 7380   C CA . MET B 1 1431 ? 129.184 148.821 114.439 1.00 0.00 ? 1431 MET B CA 4  
ATOM 7381   C CA . LYS B 1 1432 ? 128.289 146.737 117.528 1.00 0.00 ? 1432 LYS B CA 4  
ATOM 7382   C CA . PRO B 1 1433 ? 124.500 147.609 117.273 1.00 0.00 ? 1433 PRO B CA 4  
ATOM 7383   C CA . TRP B 1 1434 ? 124.301 146.926 113.499 1.00 0.00 ? 1434 TRP B CA 4  
ATOM 7384   C CA . LEU B 1 1435 ? 126.179 143.633 113.791 1.00 0.00 ? 1435 LEU B CA 4  
ATOM 7385   C CA . PHE B 1 1436 ? 123.714 142.385 116.485 1.00 0.00 ? 1436 PHE B CA 4  
ATOM 7386   C CA . ASN B 1 1437 ? 120.807 143.743 114.322 1.00 0.00 ? 1437 ASN B CA 4  
ATOM 7387   C CA . ILE B 1 1438 ? 122.042 141.542 111.426 1.00 0.00 ? 1438 ILE B CA 4  
ATOM 7388   C CA . LYS B 1 1439 ? 122.389 138.493 113.772 1.00 0.00 ? 1439 LYS B CA 4  
ATOM 7389   C CA . ALA B 1 1440 ? 118.835 138.733 115.208 1.00 0.00 ? 1440 ALA B CA 4  
ATOM 7390   C CA . ARG B 1 1441 ? 116.878 139.656 112.036 1.00 0.00 ? 1441 ARG B CA 4  
ATOM 7391   C CA . ALA B 1 1442 ? 118.788 137.374 109.766 1.00 0.00 ? 1442 ALA B CA 4  
ATOM 7392   C CA . SER B 1 1443 ? 119.745 133.920 111.044 1.00 0.00 ? 1443 SER B CA 4  
ATOM 7393   C CA . SER B 1 1444 ? 122.701 132.084 109.515 1.00 0.00 ? 1444 SER B CA 4  
ATOM 7394   C CA . SER B 1 1445 ? 122.542 134.554 106.581 1.00 0.00 ? 1445 SER B CA 4  
ATOM 7395   C CA . PRO B 1 1446 ? 126.021 135.859 105.451 1.00 0.00 ? 1446 PRO B CA 4  
ATOM 7396   C CA . VAL B 1 1447 ? 127.231 139.261 106.176 1.00 0.00 ? 1447 VAL B CA 4  
ATOM 7397   C CA . ILE B 1 1448 ? 129.837 141.246 104.262 1.00 0.00 ? 1448 ILE B CA 4  
ATOM 7398   C CA . LEU B 1 1449 ? 131.474 144.135 106.119 1.00 0.00 ? 1449 LEU B CA 4  
ATOM 7399   C CA . VAL B 1 1450 ? 132.345 147.119 103.915 1.00 0.00 ? 1450 VAL B CA 4  
ATOM 7400   C CA . GLY B 1 1451 ? 134.548 149.870 105.380 1.00 0.00 ? 1451 GLY B CA 4  
ATOM 7401   C CA . THR B 1 1452 ? 133.771 152.975 103.295 1.00 0.00 ? 1452 THR B CA 4  
ATOM 7402   C CA . HIS B 1 1453 ? 135.366 156.400 102.628 1.00 0.00 ? 1453 HIS B CA 4  
ATOM 7403   C CA . LEU B 1 1454 ? 138.892 155.050 103.066 1.00 0.00 ? 1454 LEU B CA 4  
ATOM 7404   C CA . ASP B 1 1455 ? 140.382 157.876 100.913 1.00 0.00 ? 1455 ASP B CA 4  
ATOM 7405   C CA . VAL B 1 1456 ? 139.533 160.468 103.633 1.00 0.00 ? 1456 VAL B CA 4  
ATOM 7406   C CA . SER B 1 1457 ? 141.237 158.286 106.266 1.00 0.00 ? 1457 SER B CA 4  
ATOM 7407   C CA . ASP B 1 1458 ? 144.614 157.717 104.509 1.00 0.00 ? 1458 ASP B CA 4  
ATOM 7408   C CA . GLU B 1 1459 ? 144.103 153.918 104.764 1.00 0.00 ? 1459 GLU B CA 4  
ATOM 7409   C CA . LYS B 1 1460 ? 144.253 154.110 108.606 1.00 0.00 ? 1460 LYS B CA 4  
ATOM 7410   C CA . GLN B 1 1461 ? 140.748 153.049 109.689 1.00 0.00 ? 1461 GLN B CA 4  
ATOM 7411   C CA . ARG B 1 1462 ? 141.063 149.666 107.993 1.00 0.00 ? 1462 ARG B CA 4  
ATOM 7412   C CA . LYS B 1 1463 ? 143.923 148.548 110.220 1.00 0.00 ? 1463 LYS B CA 4  
ATOM 7413   C CA . ALA B 1 1464 ? 143.663 145.885 112.983 1.00 0.00 ? 1464 ALA B CA 4  
ATOM 7414   C CA . CYS B 1 1465 ? 144.242 148.724 115.472 1.00 0.00 ? 1465 CYS B CA 4  
ATOM 7415   C CA . MET B 1 1466 ? 140.800 150.266 114.707 1.00 0.00 ? 1466 MET B CA 4  
ATOM 7416   C CA . SER B 1 1467 ? 138.896 147.522 112.840 1.00 0.00 ? 1467 SER B CA 4  
ATOM 7417   C CA . LYS B 1 1468 ? 138.869 144.393 115.003 1.00 0.00 ? 1468 LYS B CA 4  
ATOM 7418   C CA . ILE B 1 1469 ? 138.385 141.881 112.107 1.00 0.00 ? 1469 ILE B CA 4  
ATOM 7419   C CA . THR B 1 1470 ? 139.793 138.644 113.595 1.00 0.00 ? 1470 THR B CA 4  
ATOM 7420   C CA . LYS B 1 1471 ? 139.772 139.829 117.170 1.00 0.00 ? 1471 LYS B CA 4  
ATOM 7421   C CA . GLU B 1 1472 ? 136.023 140.825 117.493 1.00 0.00 ? 1472 GLU B CA 4  
ATOM 7422   C CA . LEU B 1 1473 ? 134.234 140.696 114.100 1.00 0.00 ? 1473 LEU B CA 4  
ATOM 7423   C CA . LEU B 1 1474 ? 134.880 137.107 112.839 1.00 0.00 ? 1474 LEU B CA 4  
ATOM 7424   C CA . ASN B 1 1475 ? 134.370 133.447 113.965 1.00 0.00 ? 1475 ASN B CA 4  
ATOM 7425   C CA . LYS B 1 1476 ? 136.964 133.695 116.804 1.00 0.00 ? 1476 LYS B CA 4  
ATOM 7426   C CA . ARG B 1 1477 ? 134.681 136.046 118.776 1.00 0.00 ? 1477 ARG B CA 4  
ATOM 7427   C CA . GLY B 1 1478 ? 131.174 134.915 117.940 1.00 0.00 ? 1478 GLY B CA 4  
ATOM 7428   C CA . PHE B 1 1479 ? 130.550 136.397 114.469 1.00 0.00 ? 1479 PHE B CA 4  
ATOM 7429   C CA . PRO B 1 1480 ? 130.531 133.229 112.299 1.00 0.00 ? 1480 PRO B CA 4  
ATOM 7430   C CA . ALA B 1 1481 ? 128.632 134.189 109.129 1.00 0.00 ? 1481 ALA B CA 4  
ATOM 7431   C CA . ILE B 1 1482 ? 131.003 136.979 107.984 1.00 0.00 ? 1482 ILE B CA 4  
ATOM 7432   C CA . ARG B 1 1483 ? 134.320 135.547 106.602 1.00 0.00 ? 1483 ARG B CA 4  
ATOM 7433   C CA . ASP B 1 1484 ? 134.723 138.667 104.379 1.00 0.00 ? 1484 ASP B CA 4  
ATOM 7434   C CA . TYR B 1 1485 ? 135.821 142.289 104.916 1.00 0.00 ? 1485 TYR B CA 4  
ATOM 7435   C CA . HIS B 1 1486 ? 136.288 145.146 102.413 1.00 0.00 ? 1486 HIS B CA 4  
ATOM 7436   C CA . PHE B 1 1487 ? 138.016 148.471 102.533 1.00 0.00 ? 1487 PHE B CA 4  
ATOM 7437   C CA . VAL B 1 1488 ? 136.843 150.733 99.737  1.00 0.00 ? 1488 VAL B CA 4  
ATOM 7438   C CA . ASN B 1 1489 ? 137.799 154.212 98.492  1.00 0.00 ? 1489 ASN B CA 4  
ATOM 7439   C CA . ALA B 1 1490 ? 135.347 155.042 95.716  1.00 0.00 ? 1490 ALA B CA 4  
ATOM 7440   C CA . THR B 1 1491 ? 136.768 158.246 94.275  1.00 0.00 ? 1491 THR B CA 4  
ATOM 7441   C CA . GLU B 1 1492 ? 140.366 156.994 94.267  1.00 0.00 ? 1492 GLU B CA 4  
ATOM 7442   C CA . GLU B 1 1493 ? 139.981 153.614 92.535  1.00 0.00 ? 1493 GLU B CA 4  
ATOM 7443   C CA . SER B 1 1494 ? 137.323 150.903 91.969  1.00 0.00 ? 1494 SER B CA 4  
ATOM 7444   C CA . ASP B 1 1495 ? 139.633 147.908 92.461  1.00 0.00 ? 1495 ASP B CA 4  
ATOM 7445   C CA . ALA B 1 1496 ? 138.459 147.052 96.010  1.00 0.00 ? 1496 ALA B CA 4  
ATOM 7446   C CA . LEU B 1 1497 ? 134.792 147.247 94.889  1.00 0.00 ? 1497 LEU B CA 4  
ATOM 7447   C CA . ALA B 1 1498 ? 135.408 144.500 92.321  1.00 0.00 ? 1498 ALA B CA 4  
ATOM 7448   C CA . LYS B 1 1499 ? 136.487 142.417 95.368  1.00 0.00 ? 1499 LYS B CA 4  
ATOM 7449   C CA . LEU B 1 1500 ? 132.993 143.032 96.883  1.00 0.00 ? 1500 LEU B CA 4  
ATOM 7450   C CA . ARG B 1 1501 ? 131.629 141.154 93.853  1.00 0.00 ? 1501 ARG B CA 4  
ATOM 7451   C CA . LYS B 1 1502 ? 133.722 138.086 94.884  1.00 0.00 ? 1502 LYS B CA 4  
ATOM 7452   C CA . THR B 1 1503 ? 131.994 138.096 98.284  1.00 0.00 ? 1503 THR B CA 4  
ATOM 7453   C CA . ILE B 1 1504 ? 128.589 138.495 96.549  1.00 0.00 ? 1504 ILE B CA 4  
ATOM 7454   C CA . ILE B 1 1505 ? 129.773 135.403 94.588  1.00 0.00 ? 1505 ILE B CA 4  
ATOM 7455   C CA . ASN B 1 1506 ? 130.755 133.568 97.861  1.00 0.00 ? 1506 ASN B CA 4  
ATOM 7456   C CA . GLU B 1 1507 ? 127.247 134.154 99.181  1.00 0.00 ? 1507 GLU B CA 4  
ATOM 7457   C CA . SER B 1 1508 ? 123.972 133.324 97.256  1.00 0.00 ? 1508 SER B CA 4  
ATOM 7458   C CA . LEU B 1 1509 ? 125.516 129.800 97.233  1.00 0.00 ? 1509 LEU B CA 4  
ATOM 7459   C CA . ASN B 1 1510 ? 123.903 128.545 100.460 1.00 0.00 ? 1510 ASN B CA 4  
ATOM 7460   C CA . PHE B 1 1511 ? 120.645 130.591 99.942  1.00 0.00 ? 1511 PHE B CA 4  
ATOM 7461   C CA . LYS B 1 1512 ? 119.297 129.611 96.590  1.00 0.00 ? 1512 LYS B CA 4  
ATOM 7462   C CA . ILE B 1 1513 ? 121.451 126.849 94.972  1.00 0.00 ? 1513 ILE B CA 4  
ATOM 7463   C CA . ARG B 1 1514 ? 120.630 124.080 97.487  1.00 0.00 ? 1514 ARG B CA 4  
ATOM 7464   C CA . PRO B 1 1524 ? 131.315 125.732 75.272  1.00 0.00 ? 1524 PRO B CA 4  
ATOM 7465   C CA . ASP B 1 1525 ? 129.512 122.335 75.108  1.00 0.00 ? 1525 ASP B CA 4  
ATOM 7466   C CA . CYS B 1 1526 ? 132.669 120.472 76.279  1.00 0.00 ? 1526 CYS B CA 4  
ATOM 7467   C CA . TYR B 1 1527 ? 132.689 122.371 79.647  1.00 0.00 ? 1527 TYR B CA 4  
ATOM 7468   C CA . VAL B 1 1528 ? 128.963 121.480 80.246  1.00 0.00 ? 1528 VAL B CA 4  
ATOM 7469   C CA . GLU B 1 1529 ? 129.558 117.828 79.165  1.00 0.00 ? 1529 GLU B CA 4  
ATOM 7470   C CA . LEU B 1 1530 ? 132.546 117.481 81.469  1.00 0.00 ? 1530 LEU B CA 4  
ATOM 7471   C CA . GLU B 1 1531 ? 130.692 119.182 84.383  1.00 0.00 ? 1531 GLU B CA 4  
ATOM 7472   C CA . LYS B 1 1532 ? 127.826 116.641 84.117  1.00 0.00 ? 1532 LYS B CA 4  
ATOM 7473   C CA . ILE B 1 1533 ? 130.193 113.627 83.968  1.00 0.00 ? 1533 ILE B CA 4  
ATOM 7474   C CA . ILE B 1 1534 ? 132.270 115.036 86.858  1.00 0.00 ? 1534 ILE B CA 4  
ATOM 7475   C CA . LEU B 1 1535 ? 129.097 115.562 88.978  1.00 0.00 ? 1535 LEU B CA 4  
ATOM 7476   C CA . SER B 1 1536 ? 127.793 112.026 88.248  1.00 0.00 ? 1536 SER B CA 4  
ATOM 7477   C CA . GLU B 1 1537 ? 131.215 110.434 89.032  1.00 0.00 ? 1537 GLU B CA 4  
ATOM 7478   C CA . ARG B 1 1538 ? 131.676 112.609 92.146  1.00 0.00 ? 1538 ARG B CA 4  
ATOM 7479   C CA . LYS B 1 1539 ? 128.262 112.153 93.816  1.00 0.00 ? 1539 LYS B CA 4  
ATOM 7480   C CA . ASN B 1 1540 ? 128.574 108.360 93.391  1.00 0.00 ? 1540 ASN B CA 4  
ATOM 7481   C CA . VAL B 1 1541 ? 131.675 108.397 95.635  1.00 0.00 ? 1541 VAL B CA 4  
ATOM 7482   C CA . PRO B 1 1542 ? 130.124 109.648 98.982  1.00 0.00 ? 1542 PRO B CA 4  
ATOM 7483   C CA . ILE B 1 1543 ? 131.715 106.871 100.973 1.00 0.00 ? 1543 ILE B CA 4  
ATOM 7484   C CA . GLU B 1 1544 ? 135.238 107.559 99.885  1.00 0.00 ? 1544 GLU B CA 4  
ATOM 7485   C CA . PHE B 1 1545 ? 137.465 110.682 99.466  1.00 0.00 ? 1545 PHE B CA 4  
ATOM 7486   C CA . PRO B 1 1546 ? 139.249 110.221 96.048  1.00 0.00 ? 1546 PRO B CA 4  
ATOM 7487   C CA . VAL B 1 1547 ? 135.970 110.926 94.463  1.00 0.00 ? 1547 VAL B CA 4  
ATOM 7488   C CA . ILE B 1 1548 ? 137.987 111.679 91.380  1.00 0.00 ? 1548 ILE B CA 4  
ATOM 7489   C CA . ASP B 1 1549 ? 141.751 111.032 91.169  1.00 0.00 ? 1549 ASP B CA 4  
ATOM 7490   C CA . ARG B 1 1550 ? 144.039 112.849 88.667  1.00 0.00 ? 1550 ARG B CA 4  
ATOM 7491   C CA . LYS B 1 1551 ? 143.998 110.028 86.081  1.00 0.00 ? 1551 LYS B CA 4  
ATOM 7492   C CA . ARG B 1 1552 ? 140.227 109.679 86.233  1.00 0.00 ? 1552 ARG B CA 4  
ATOM 7493   C CA . LEU B 1 1553 ? 139.449 113.384 85.462  1.00 0.00 ? 1553 LEU B CA 4  
ATOM 7494   C CA . LEU B 1 1554 ? 142.104 113.323 82.694  1.00 0.00 ? 1554 LEU B CA 4  
ATOM 7495   C CA . GLN B 1 1555 ? 140.171 110.390 81.186  1.00 0.00 ? 1555 GLN B CA 4  
ATOM 7496   C CA . LEU B 1 1556 ? 136.804 112.262 81.403  1.00 0.00 ? 1556 LEU B CA 4  
ATOM 7497   C CA . VAL B 1 1557 ? 138.359 115.461 79.912  1.00 0.00 ? 1557 VAL B CA 4  
ATOM 7498   C CA . ARG B 1 1558 ? 139.688 113.415 76.925  1.00 0.00 ? 1558 ARG B CA 4  
ATOM 7499   C CA . GLU B 1 1559 ? 136.287 111.816 76.213  1.00 0.00 ? 1559 GLU B CA 4  
ATOM 7500   C CA . ASN B 1 1560 ? 134.816 115.335 75.743  1.00 0.00 ? 1560 ASN B CA 4  
ATOM 7501   C CA . GLN B 1 1561 ? 137.877 116.378 73.631  1.00 0.00 ? 1561 GLN B CA 4  
ATOM 7502   C CA . LEU B 1 1562 ? 139.564 118.671 76.240  1.00 0.00 ? 1562 LEU B CA 4  
ATOM 7503   C CA . GLN B 1 1563 ? 142.867 116.737 76.727  1.00 0.00 ? 1563 GLN B CA 4  
ATOM 7504   C CA . LEU B 1 1564 ? 144.203 118.952 73.906  1.00 0.00 ? 1564 LEU B CA 4  
ATOM 7505   C CA . ASP B 1 1565 ? 145.517 121.507 76.417  1.00 0.00 ? 1565 ASP B CA 4  
ATOM 7506   C CA . GLU B 1 1566 ? 146.493 120.895 80.087  1.00 0.00 ? 1566 GLU B CA 4  
ATOM 7507   C CA . ASN B 1 1567 ? 146.203 124.651 80.523  1.00 0.00 ? 1567 ASN B CA 4  
ATOM 7508   C CA . GLU B 1 1568 ? 142.390 124.767 79.728  1.00 0.00 ? 1568 GLU B CA 4  
ATOM 7509   C CA . LEU B 1 1569 ? 141.676 121.857 82.048  1.00 0.00 ? 1569 LEU B CA 4  
ATOM 7510   C CA . PRO B 1 1570 ? 142.990 123.864 85.128  1.00 0.00 ? 1570 PRO B CA 4  
ATOM 7511   C CA . HIS B 1 1571 ? 140.827 126.763 83.931  1.00 0.00 ? 1571 HIS B CA 4  
ATOM 7512   C CA . ALA B 1 1572 ? 137.686 124.568 83.545  1.00 0.00 ? 1572 ALA B CA 4  
ATOM 7513   C CA . VAL B 1 1573 ? 138.186 122.940 86.976  1.00 0.00 ? 1573 VAL B CA 4  
ATOM 7514   C CA . HIS B 1 1574 ? 139.146 126.384 88.444  1.00 0.00 ? 1574 HIS B CA 4  
ATOM 7515   C CA . PHE B 1 1575 ? 135.746 127.623 87.112  1.00 0.00 ? 1575 PHE B CA 4  
ATOM 7516   C CA . LEU B 1 1576 ? 133.873 124.613 88.480  1.00 0.00 ? 1576 LEU B CA 4  
ATOM 7517   C CA . ASN B 1 1577 ? 135.609 125.103 91.854  1.00 0.00 ? 1577 ASN B CA 4  
ATOM 7518   C CA . GLU B 1 1578 ? 134.841 128.900 91.900  1.00 0.00 ? 1578 GLU B CA 4  
ATOM 7519   C CA . SER B 1 1579 ? 131.185 128.014 91.218  1.00 0.00 ? 1579 SER B CA 4  
ATOM 7520   C CA . GLY B 1 1580 ? 131.003 125.228 93.902  1.00 0.00 ? 1580 GLY B CA 4  
ATOM 7521   C CA . VAL B 1 1581 ? 129.841 122.577 91.424  1.00 0.00 ? 1581 VAL B CA 4  
ATOM 7522   C CA . LEU B 1 1582 ? 132.901 120.590 92.387  1.00 0.00 ? 1582 LEU B CA 4  
ATOM 7523   C CA . LEU B 1 1583 ? 135.793 121.366 94.686  1.00 0.00 ? 1583 LEU B CA 4  
ATOM 7524   C CA . HIS B 1 1584 ? 139.396 121.478 93.418  1.00 0.00 ? 1584 HIS B CA 4  
ATOM 7525   C CA . PHE B 1 1585 ? 142.149 122.679 95.687  1.00 0.00 ? 1585 PHE B CA 4  
ATOM 7526   C CA . GLN B 1 1586 ? 145.096 123.962 93.630  1.00 0.00 ? 1586 GLN B CA 4  
ATOM 7527   C CA . ASP B 1 1587 ? 147.238 124.727 96.752  1.00 0.00 ? 1587 ASP B CA 4  
ATOM 7528   C CA . PRO B 1 1588 ? 147.408 121.021 98.030  1.00 0.00 ? 1588 PRO B CA 4  
ATOM 7529   C CA . ALA B 1 1589 ? 147.456 119.718 94.392  1.00 0.00 ? 1589 ALA B CA 4  
ATOM 7530   C CA . LEU B 1 1590 ? 151.291 119.631 94.235  1.00 0.00 ? 1590 LEU B CA 4  
ATOM 7531   C CA . GLN B 1 1591 ? 151.472 116.389 96.274  1.00 0.00 ? 1591 GLN B CA 4  
ATOM 7532   C CA . LEU B 1 1592 ? 147.938 115.054 95.837  1.00 0.00 ? 1592 LEU B CA 4  
ATOM 7533   C CA . SER B 1 1593 ? 146.934 113.199 92.624  1.00 0.00 ? 1593 SER B CA 4  
ATOM 7534   C CA . ASP B 1 1594 ? 144.900 110.627 94.601  1.00 0.00 ? 1594 ASP B CA 4  
ATOM 7535   C CA . LEU B 1 1595 ? 142.379 113.235 95.761  1.00 0.00 ? 1595 LEU B CA 4  
ATOM 7536   C CA . TYR B 1 1596 ? 142.235 115.844 93.040  1.00 0.00 ? 1596 TYR B CA 4  
ATOM 7537   C CA . PHE B 1 1597 ? 138.613 116.973 92.669  1.00 0.00 ? 1597 PHE B CA 4  
ATOM 7538   C CA . VAL B 1 1598 ? 135.981 116.683 95.430  1.00 0.00 ? 1598 VAL B CA 4  
ATOM 7539   C CA . GLU B 1 1599 ? 132.173 116.379 96.065  1.00 0.00 ? 1599 GLU B CA 4  
ATOM 7540   C CA . PRO B 1 1600 ? 131.050 119.567 97.967  1.00 0.00 ? 1600 PRO B CA 4  
ATOM 7541   C CA . LYS B 1 1601 ? 128.502 117.658 100.098 1.00 0.00 ? 1601 LYS B CA 4  
ATOM 7542   C CA . TRP B 1 1602 ? 131.108 115.145 101.209 1.00 0.00 ? 1602 TRP B CA 4  
ATOM 7543   C CA . LEU B 1 1603 ? 133.533 117.970 102.204 1.00 0.00 ? 1603 LEU B CA 4  
ATOM 7544   C CA . CYS B 1 1604 ? 130.842 120.038 103.997 1.00 0.00 ? 1604 CYS B CA 4  
ATOM 7545   C CA . LYS B 1 1605 ? 129.527 117.071 106.038 1.00 0.00 ? 1605 LYS B CA 4  
ATOM 7546   C CA . ILE B 1 1606 ? 133.127 116.270 107.078 1.00 0.00 ? 1606 ILE B CA 4  
ATOM 7547   C CA . MET B 1 1607 ? 133.862 119.594 108.579 1.00 0.00 ? 1607 MET B CA 4  
ATOM 7548   C CA . ALA B 1 1608 ? 130.500 120.106 110.221 1.00 0.00 ? 1608 ALA B CA 4  
ATOM 7549   C CA . GLN B 1 1609 ? 131.094 116.765 112.041 1.00 0.00 ? 1609 GLN B CA 4  
ATOM 7550   C CA . ILE B 1 1610 ? 134.510 118.052 113.273 1.00 0.00 ? 1610 ILE B CA 4  
ATOM 7551   C CA . LEU B 1 1611 ? 132.964 121.426 114.264 1.00 0.00 ? 1611 LEU B CA 4  
ATOM 7552   C CA . THR B 1 1612 ? 130.031 119.866 116.217 1.00 0.00 ? 1612 THR B CA 4  
ATOM 7553   C CA . VAL B 1 1613 ? 131.924 116.985 117.845 1.00 0.00 ? 1613 VAL B CA 4  
ATOM 7554   C CA . LYS B 1 1614 ? 131.793 116.720 121.674 1.00 0.00 ? 1614 LYS B CA 4  
ATOM 7555   C CA . VAL B 1 1615 ? 135.545 115.949 121.775 1.00 0.00 ? 1615 VAL B CA 4  
ATOM 7556   C CA . GLU B 1 1616 ? 136.991 119.475 121.490 1.00 0.00 ? 1616 GLU B CA 4  
ATOM 7557   C CA . GLY B 1 1617 ? 139.733 118.753 124.041 1.00 0.00 ? 1617 GLY B CA 4  
ATOM 7558   C CA . CYS B 1 1618 ? 140.855 116.973 127.197 1.00 0.00 ? 1618 CYS B CA 4  
ATOM 7559   C CA . PRO B 1 1619 ? 138.019 116.009 129.696 1.00 0.00 ? 1619 PRO B CA 4  
ATOM 7560   C CA . LYS B 1 1620 ? 138.097 119.088 132.010 1.00 0.00 ? 1620 LYS B CA 4  
ATOM 7561   C CA . HIS B 1 1621 ? 139.207 121.655 129.392 1.00 0.00 ? 1621 HIS B CA 4  
ATOM 7562   C CA . PRO B 1 1622 ? 137.492 121.318 125.949 1.00 0.00 ? 1622 PRO B CA 4  
ATOM 7563   C CA . LYS B 1 1623 ? 138.168 124.758 124.421 1.00 0.00 ? 1623 LYS B CA 4  
ATOM 7564   C CA . GLY B 1 1624 ? 138.268 124.243 120.610 1.00 0.00 ? 1624 GLY B CA 4  
ATOM 7565   C CA . ILE B 1 1625 ? 141.099 121.664 120.723 1.00 0.00 ? 1625 ILE B CA 4  
ATOM 7566   C CA . ILE B 1 1626 ? 141.167 118.945 118.028 1.00 0.00 ? 1626 ILE B CA 4  
ATOM 7567   C CA . SER B 1 1627 ? 143.226 115.931 119.156 1.00 0.00 ? 1627 SER B CA 4  
ATOM 7568   C CA . ARG B 1 1628 ? 144.331 114.318 115.839 1.00 0.00 ? 1628 ARG B CA 4  
ATOM 7569   C CA . ARG B 1 1629 ? 143.993 110.717 117.164 1.00 0.00 ? 1629 ARG B CA 4  
ATOM 7570   C CA . ASP B 1 1630 ? 140.323 110.944 117.747 1.00 0.00 ? 1630 ASP B CA 4  
ATOM 7571   C CA . VAL B 1 1631 ? 139.335 111.834 114.114 1.00 0.00 ? 1631 VAL B CA 4  
ATOM 7572   C CA . GLU B 1 1632 ? 138.380 108.185 113.354 1.00 0.00 ? 1632 GLU B CA 4  
ATOM 7573   C CA . LYS B 1 1633 ? 135.699 108.283 116.062 1.00 0.00 ? 1633 LYS B CA 4  
ATOM 7574   C CA . PHE B 1 1634 ? 134.362 111.776 115.137 1.00 0.00 ? 1634 PHE B CA 4  
ATOM 7575   C CA . LEU B 1 1635 ? 133.971 111.166 111.472 1.00 0.00 ? 1635 LEU B CA 4  
ATOM 7576   C CA . SER B 1 1636 ? 133.042 107.431 111.203 1.00 0.00 ? 1636 SER B CA 4  
ATOM 7577   C CA . LYS B 1 1637 ? 130.645 105.518 110.588 1.00 0.00 ? 1637 LYS B CA 4  
ATOM 7578   C CA . LYS B 1 1638 ? 128.129 108.387 109.869 1.00 0.00 ? 1638 LYS B CA 4  
ATOM 7579   C CA . ARG B 1 1639 ? 130.396 109.099 106.979 1.00 0.00 ? 1639 ARG B CA 4  
ATOM 7580   C CA . LYS B 1 1640 ? 133.272 106.927 105.796 1.00 0.00 ? 1640 LYS B CA 4  
ATOM 7581   C CA . PHE B 1 1641 ? 136.689 108.501 106.348 1.00 0.00 ? 1641 PHE B CA 4  
ATOM 7582   C CA . PRO B 1 1642 ? 139.807 106.350 106.122 1.00 0.00 ? 1642 PRO B CA 4  
ATOM 7583   C CA . LYS B 1 1643 ? 143.160 107.599 107.528 1.00 0.00 ? 1643 LYS B CA 4  
ATOM 7584   C CA . ASN B 1 1644 ? 144.547 109.329 104.374 1.00 0.00 ? 1644 ASN B CA 4  
ATOM 7585   C CA . TYR B 1 1645 ? 141.152 111.012 103.868 1.00 0.00 ? 1645 TYR B CA 4  
ATOM 7586   C CA . MET B 1 1646 ? 141.397 112.084 107.529 1.00 0.00 ? 1646 MET B CA 4  
ATOM 7587   C CA . SER B 1 1647 ? 144.783 113.816 107.027 1.00 0.00 ? 1647 SER B CA 4  
ATOM 7588   C CA . GLN B 1 1648 ? 143.485 115.713 103.941 1.00 0.00 ? 1648 GLN B CA 4  
ATOM 7589   C CA . TYR B 1 1649 ? 140.215 117.063 105.481 1.00 0.00 ? 1649 TYR B CA 4  
ATOM 7590   C CA . PHE B 1 1650 ? 142.387 118.765 108.113 1.00 0.00 ? 1650 PHE B CA 4  
ATOM 7591   C CA . LYS B 1 1651 ? 144.206 120.513 105.232 1.00 0.00 ? 1651 LYS B CA 4  
ATOM 7592   C CA . LEU B 1 1652 ? 140.763 121.583 103.925 1.00 0.00 ? 1652 LEU B CA 4  
ATOM 7593   C CA . LEU B 1 1653 ? 139.943 123.034 107.417 1.00 0.00 ? 1653 LEU B CA 4  
ATOM 7594   C CA . GLU B 1 1654 ? 143.267 124.948 107.336 1.00 0.00 ? 1654 GLU B CA 4  
ATOM 7595   C CA . LYS B 1 1655 ? 142.453 126.204 103.834 1.00 0.00 ? 1655 LYS B CA 4  
ATOM 7596   C CA . PHE B 1 1656 ? 138.855 127.172 104.833 1.00 0.00 ? 1656 PHE B CA 4  
ATOM 7597   C CA . GLN B 1 1657 ? 140.474 129.016 107.817 1.00 0.00 ? 1657 GLN B CA 4  
ATOM 7598   C CA . ILE B 1 1658 ? 138.537 127.029 110.420 1.00 0.00 ? 1658 ILE B CA 4  
ATOM 7599   C CA . ALA B 1 1659 ? 141.592 125.694 112.255 1.00 0.00 ? 1659 ALA B CA 4  
ATOM 7600   C CA . LEU B 1 1660 ? 145.389 125.992 112.601 1.00 0.00 ? 1660 LEU B CA 4  
ATOM 7601   C CA . PRO B 1 1661 ? 148.151 123.573 113.778 1.00 0.00 ? 1661 PRO B CA 4  
ATOM 7602   C CA . ILE B 1 1662 ? 150.204 124.299 116.946 1.00 0.00 ? 1662 ILE B CA 4  
ATOM 7603   C CA . GLY B 1 1663 ? 152.501 121.289 116.352 1.00 0.00 ? 1663 GLY B CA 4  
ATOM 7604   C CA . GLU B 1 1664 ? 151.711 118.608 118.976 1.00 0.00 ? 1664 GLU B CA 4  
ATOM 7605   C CA . GLU B 1 1665 ? 149.016 116.760 116.894 1.00 0.00 ? 1665 GLU B CA 4  
ATOM 7606   C CA . TYR B 1 1666 ? 146.582 119.220 118.505 1.00 0.00 ? 1666 TYR B CA 4  
ATOM 7607   C CA . LEU B 1 1667 ? 144.778 121.858 116.423 1.00 0.00 ? 1667 LEU B CA 4  
ATOM 7608   C CA . LEU B 1 1668 ? 142.909 124.997 117.486 1.00 0.00 ? 1668 LEU B CA 4  
ATOM 7609   C CA . VAL B 1 1669 ? 139.377 125.709 116.181 1.00 0.00 ? 1669 VAL B CA 4  
ATOM 7610   C CA . ILE B 1 1690 ? 143.865 155.373 117.007 1.00 0.00 ? 1690 ILE B CA 4  
ATOM 7611   C CA . ILE B 1 1691 ? 146.625 156.499 119.474 1.00 0.00 ? 1691 ILE B CA 4  
ATOM 7612   C CA . ILE B 1 1692 ? 149.864 154.703 118.611 1.00 0.00 ? 1692 ILE B CA 4  
ATOM 7613   C CA . ARG B 1 1693 ? 152.988 154.928 120.794 1.00 0.00 ? 1693 ARG B CA 4  
ATOM 7614   C CA . LEU B 1 1694 ? 156.187 152.962 120.024 1.00 0.00 ? 1694 LEU B CA 4  
ATOM 7615   C CA . TYR B 1 1695 ? 159.140 152.162 122.370 1.00 0.00 ? 1695 TYR B CA 4  
ATOM 7616   C CA . GLU B 1 1696 ? 162.559 151.285 120.778 1.00 0.00 ? 1696 GLU B CA 4  
ATOM 7617   C CA . MET B 1 1697 ? 164.917 149.134 122.909 1.00 0.00 ? 1697 MET B CA 4  
ATOM 7618   C CA . PRO B 1 1698 ? 168.609 148.300 121.787 1.00 0.00 ? 1698 PRO B CA 4  
ATOM 7619   C CA . TYR B 1 1699 ? 167.927 145.060 123.524 1.00 0.00 ? 1699 TYR B CA 4  
ATOM 7620   C CA . PHE B 1 1700 ? 164.285 143.955 124.036 1.00 0.00 ? 1700 PHE B CA 4  
ATOM 7621   C CA . PRO B 1 1701 ? 164.169 141.390 126.954 1.00 0.00 ? 1701 PRO B CA 4  
ATOM 7622   C CA . MET B 1 1702 ? 161.993 138.399 126.022 1.00 0.00 ? 1702 MET B CA 4  
ATOM 7623   C CA . GLY B 1 1703 ? 160.537 138.572 129.538 1.00 0.00 ? 1703 GLY B CA 4  
ATOM 7624   C CA . PHE B 1 1704 ? 158.897 142.017 128.986 1.00 0.00 ? 1704 PHE B CA 4  
ATOM 7625   C CA . TRP B 1 1705 ? 155.695 140.809 127.324 1.00 0.00 ? 1705 TRP B CA 4  
ATOM 7626   C CA . SER B 1 1706 ? 155.367 137.790 129.554 1.00 0.00 ? 1706 SER B CA 4  
ATOM 7627   C CA . ARG B 1 1707 ? 155.678 139.993 132.652 1.00 0.00 ? 1707 ARG B CA 4  
ATOM 7628   C CA . LEU B 1 1708 ? 153.396 142.748 131.318 1.00 0.00 ? 1708 LEU B CA 4  
ATOM 7629   C CA . ILE B 1 1709 ? 150.780 140.052 130.521 1.00 0.00 ? 1709 ILE B CA 4  
ATOM 7630   C CA . ASN B 1 1710 ? 151.018 139.043 134.225 1.00 0.00 ? 1710 ASN B CA 4  
ATOM 7631   C CA . ARG B 1 1711 ? 150.713 142.663 135.522 1.00 0.00 ? 1711 ARG B CA 4  
ATOM 7632   C CA . LEU B 1 1712 ? 147.696 143.153 133.225 1.00 0.00 ? 1712 LEU B CA 4  
ATOM 7633   C CA . LEU B 1 1713 ? 146.025 139.665 133.464 1.00 0.00 ? 1713 LEU B CA 4  
ATOM 7634   C CA . GLU B 1 1714 ? 142.684 141.071 134.615 1.00 0.00 ? 1714 GLU B CA 4  
ATOM 7635   C CA . ILE B 1 1715 ? 142.148 143.246 131.492 1.00 0.00 ? 1715 ILE B CA 4  
ATOM 7636   C CA . SER B 1 1716 ? 142.973 140.646 128.786 1.00 0.00 ? 1716 SER B CA 4  
ATOM 7637   C CA . PRO B 1 1717 ? 139.488 139.012 128.550 1.00 0.00 ? 1717 PRO B CA 4  
ATOM 7638   C CA . TYR B 1 1718 ? 137.913 142.354 129.470 1.00 0.00 ? 1718 TYR B CA 4  
ATOM 7639   C CA . MET B 1 1719 ? 137.334 144.411 132.588 1.00 0.00 ? 1719 MET B CA 4  
ATOM 7640   C CA . LEU B 1 1720 ? 134.099 146.161 131.400 1.00 0.00 ? 1720 LEU B CA 4  
ATOM 7641   C CA . SER B 1 1721 ? 130.818 144.342 130.960 1.00 0.00 ? 1721 SER B CA 4  
ATOM 7642   C CA . GLY B 1 1722 ? 130.395 146.765 127.973 1.00 0.00 ? 1722 GLY B CA 4  
ATOM 7643   C CA . ARG B 1 1723 ? 132.244 144.840 125.313 1.00 0.00 ? 1723 ARG B CA 4  
ATOM 7644   C CA . GLU B 1 1724 ? 131.810 145.838 121.652 1.00 0.00 ? 1724 GLU B CA 4  
ATOM 7645   C CA . ARG B 1 1725 ? 134.451 143.773 119.851 1.00 0.00 ? 1725 ARG B CA 4  
ATOM 7646   C CA . ALA B 1 1726 ? 134.524 139.968 120.235 1.00 0.00 ? 1726 ALA B CA 4  
ATOM 7647   C CA . LEU B 1 1727 ? 137.988 139.557 118.683 1.00 0.00 ? 1727 LEU B CA 4  
ATOM 7648   C CA . ARG B 1 1728 ? 140.389 141.830 120.590 1.00 0.00 ? 1728 ARG B CA 4  
ATOM 7649   C CA . PRO B 1 1729 ? 139.800 140.804 124.286 1.00 0.00 ? 1729 PRO B CA 4  
ATOM 7650   C CA . ASN B 1 1730 ? 138.733 137.108 125.088 1.00 0.00 ? 1730 ASN B CA 4  
ATOM 7651   C CA . ARG B 1 1731 ? 141.970 135.194 125.749 1.00 0.00 ? 1731 ARG B CA 4  
ATOM 7652   C CA . MET B 1 1732 ? 143.556 137.175 122.997 1.00 0.00 ? 1732 MET B CA 4  
ATOM 7653   C CA . TYR B 1 1733 ? 147.042 137.005 124.120 1.00 0.00 ? 1733 TYR B CA 4  
ATOM 7654   C CA . TRP B 1 1734 ? 149.939 135.516 122.291 1.00 0.00 ? 1734 TRP B CA 4  
ATOM 7655   C CA . ARG B 1 1735 ? 153.725 135.215 122.592 1.00 0.00 ? 1735 ARG B CA 4  
ATOM 7656   C CA . GLN B 1 1736 ? 154.298 138.715 121.111 1.00 0.00 ? 1736 GLN B CA 4  
ATOM 7657   C CA . GLY B 1 1737 ? 151.275 140.636 122.480 1.00 0.00 ? 1737 GLY B CA 4  
ATOM 7658   C CA . ILE B 1 1738 ? 147.895 141.115 124.111 1.00 0.00 ? 1738 ILE B CA 4  
ATOM 7659   C CA . TYR B 1 1739 ? 144.602 142.993 123.771 1.00 0.00 ? 1739 TYR B CA 4  
ATOM 7660   C CA . LEU B 1 1740 ? 143.520 144.915 126.819 1.00 0.00 ? 1740 LEU B CA 4  
ATOM 7661   C CA . ASN B 1 1741 ? 140.081 146.336 127.713 1.00 0.00 ? 1741 ASN B CA 4  
ATOM 7662   C CA . TRP B 1 1742 ? 139.275 148.377 130.853 1.00 0.00 ? 1742 TRP B CA 4  
ATOM 7663   C CA . SER B 1 1743 ? 136.243 149.917 132.551 1.00 0.00 ? 1743 SER B CA 4  
ATOM 7664   C CA . PRO B 1 1744 ? 135.054 152.635 131.830 1.00 0.00 ? 1744 PRO B CA 4  
ATOM 7665   C CA . GLU B 1 1745 ? 134.861 153.867 129.050 1.00 0.00 ? 1745 GLU B CA 4  
ATOM 7666   C CA . ALA B 1 1746 ? 135.537 150.545 127.180 1.00 0.00 ? 1746 ALA B CA 4  
ATOM 7667   C CA . TYR B 1 1747 ? 138.818 151.504 125.669 1.00 0.00 ? 1747 TYR B CA 4  
ATOM 7668   C CA . CYS B 1 1748 ? 140.606 148.692 123.751 1.00 0.00 ? 1748 CYS B CA 4  
ATOM 7669   C CA . LEU B 1 1749 ? 144.437 148.582 123.694 1.00 0.00 ? 1749 LEU B CA 4  
ATOM 7670   C CA . VAL B 1 1750 ? 146.690 146.310 121.647 1.00 0.00 ? 1750 VAL B CA 4  
ATOM 7671   C CA . GLY B 1 1751 ? 150.209 145.849 122.867 1.00 0.00 ? 1751 GLY B CA 4  
ATOM 7672   C CA . SER B 1 1752 ? 152.544 144.130 120.398 1.00 0.00 ? 1752 SER B CA 4  
ATOM 7673   C CA . GLU B 1 1753 ? 156.339 144.228 120.827 1.00 0.00 ? 1753 GLU B CA 4  
ATOM 7674   C CA . VAL B 1 1754 ? 157.008 147.788 121.764 1.00 0.00 ? 1754 VAL B CA 4  
ATOM 7675   C CA . LEU B 1 1755 ? 153.918 149.046 119.909 1.00 0.00 ? 1755 LEU B CA 4  
ATOM 7676   C CA . ASP B 1 1756 ? 150.856 150.237 121.846 1.00 0.00 ? 1756 ASP B CA 4  
ATOM 7677   C CA . ASN B 1 1757 ? 147.770 151.078 119.700 1.00 0.00 ? 1757 ASN B CA 4  
ATOM 7678   C CA . HIS B 1 1758 ? 144.588 152.400 121.335 1.00 0.00 ? 1758 HIS B CA 4  
ATOM 7679   C CA . PRO B 1 1759 ? 140.878 153.155 120.211 1.00 0.00 ? 1759 PRO B CA 4  
ATOM 7680   C CA . GLU B 1 1760 ? 138.395 155.218 122.473 1.00 0.00 ? 1760 GLU B CA 4  
ATOM 7681   C CA . SER B 1 1761 ? 138.084 158.827 123.769 1.00 0.00 ? 1761 SER B CA 4  
ATOM 7682   C CA . PHE B 1 1762 ? 139.870 157.944 127.111 1.00 0.00 ? 1762 PHE B CA 4  
ATOM 7683   C CA . LEU B 1 1763 ? 143.034 157.103 125.193 1.00 0.00 ? 1763 LEU B CA 4  
ATOM 7684   C CA . LYS B 1 1764 ? 145.425 159.344 126.897 1.00 0.00 ? 1764 LYS B CA 4  
ATOM 7685   C CA . ILE B 1 1765 ? 144.848 158.060 130.484 1.00 0.00 ? 1765 ILE B CA 4  
ATOM 7686   C CA . THR B 1 1766 ? 145.035 154.408 129.390 1.00 0.00 ? 1766 THR B CA 4  
ATOM 7687   C CA . VAL B 1 1767 ? 148.392 154.752 127.709 1.00 0.00 ? 1767 VAL B CA 4  
ATOM 7688   C CA . PRO B 1 1768 ? 150.257 155.954 130.986 1.00 0.00 ? 1768 PRO B CA 4  
ATOM 7689   C CA . SER B 1 1769 ? 148.939 153.083 132.995 1.00 0.00 ? 1769 SER B CA 4  
ATOM 7690   C CA . CYS B 1 1770 ? 150.239 150.682 130.289 1.00 0.00 ? 1770 CYS B CA 4  
ATOM 7691   C CA . ARG B 1 1771 ? 153.368 152.894 129.783 1.00 0.00 ? 1771 ARG B CA 4  
ATOM 7692   C CA . LYS B 1 1772 ? 153.987 152.951 133.546 1.00 0.00 ? 1772 LYS B CA 4  
ATOM 7693   C CA . GLY B 1 1773 ? 153.679 149.138 133.830 1.00 0.00 ? 1773 GLY B CA 4  
ATOM 7694   C CA . CYS B 1 1774 ? 156.162 148.757 130.967 1.00 0.00 ? 1774 CYS B CA 4  
ATOM 7695   C CA . ILE B 1 1775 ? 158.577 151.290 132.564 1.00 0.00 ? 1775 ILE B CA 4  
ATOM 7696   C CA . LEU B 1 1776 ? 158.290 149.398 135.908 1.00 0.00 ? 1776 LEU B CA 4  
ATOM 7697   C CA . LEU B 1 1777 ? 159.391 146.158 134.199 1.00 0.00 ? 1777 LEU B CA 4  
ATOM 7698   C CA . GLY B 1 1778 ? 162.194 147.983 132.372 1.00 0.00 ? 1778 GLY B CA 4  
ATOM 7699   C CA . GLN B 1 1779 ? 163.648 149.152 135.713 1.00 0.00 ? 1779 GLN B CA 4  
ATOM 7700   C CA . VAL B 1 1780 ? 164.414 145.491 136.677 1.00 0.00 ? 1780 VAL B CA 4  
ATOM 7701   C CA . VAL B 1 1781 ? 167.046 145.479 133.883 1.00 0.00 ? 1781 VAL B CA 4  
ATOM 7702   C CA . ASP B 1 1782 ? 170.217 147.576 134.422 1.00 0.00 ? 1782 ASP B CA 4  
ATOM 7703   C CA . HIS B 1 1783 ? 171.422 149.803 131.498 1.00 0.00 ? 1783 HIS B CA 4  
ATOM 7704   C CA . ILE B 1 1784 ? 168.274 149.319 129.312 1.00 0.00 ? 1784 ILE B CA 4  
ATOM 7705   C CA . ASP B 1 1785 ? 167.857 152.161 126.761 1.00 0.00 ? 1785 ASP B CA 4  
ATOM 7706   C CA . SER B 1 1786 ? 164.306 152.947 125.563 1.00 0.00 ? 1786 SER B CA 4  
ATOM 7707   C CA . LEU B 1 1787 ? 163.541 155.582 122.916 1.00 0.00 ? 1787 LEU B CA 4  
ATOM 7708   C CA . MET B 1 1788 ? 159.890 156.552 122.570 1.00 0.00 ? 1788 MET B CA 4  
ATOM 7709   C CA . GLU B 1 1789 ? 158.310 157.353 119.200 1.00 0.00 ? 1789 GLU B CA 4  
ATOM 7710   C CA . GLU B 1 1790 ? 155.064 158.617 117.757 1.00 0.00 ? 1790 GLU B CA 4  
ATOM 7711   C CA . TRP B 1 1791 ? 153.850 157.968 114.227 1.00 0.00 ? 1791 TRP B CA 4  
ATOM 7712   C CA . PHE B 1 1792 ? 153.236 161.000 112.021 1.00 0.00 ? 1792 PHE B CA 4  
ATOM 7713   C CA . PRO B 1 1793 ? 149.463 161.792 111.282 1.00 0.00 ? 1793 PRO B CA 4  
ATOM 7714   C CA . GLY B 1 1794 ? 148.605 160.318 107.877 1.00 0.00 ? 1794 GLY B CA 4  
ATOM 7715   C CA . LEU B 1 1795 ? 151.943 158.469 107.674 1.00 0.00 ? 1795 LEU B CA 4  
ATOM 7716   C CA . LEU B 1 1796 ? 151.908 155.390 109.960 1.00 0.00 ? 1796 LEU B CA 4  
ATOM 7717   C CA . GLU B 1 1797 ? 155.499 154.266 109.158 1.00 0.00 ? 1797 GLU B CA 4  
ATOM 7718   C CA . ILE B 1 1798 ? 157.136 157.723 109.617 1.00 0.00 ? 1798 ILE B CA 4  
ATOM 7719   C CA . ASP B 1 1799 ? 158.105 158.181 113.266 1.00 0.00 ? 1799 ASP B CA 4  
ATOM 7720   C CA . ILE B 1 1800 ? 159.128 161.214 115.327 1.00 0.00 ? 1800 ILE B CA 4  
ATOM 7721   C CA . CYS B 1 1801 ? 160.937 160.871 118.658 1.00 0.00 ? 1801 CYS B CA 4  
ATOM 7722   C CA . GLY B 1 1802 ? 158.858 162.095 121.676 1.00 0.00 ? 1802 GLY B CA 4  
ATOM 7723   C CA . GLU B 1 1803 ? 162.037 163.639 123.112 1.00 0.00 ? 1803 GLU B CA 4  
ATOM 7724   C CA . GLY B 1 1804 ? 162.272 165.630 119.832 1.00 0.00 ? 1804 GLY B CA 4  
ATOM 7725   C CA . GLU B 1 1805 ? 158.769 167.128 120.221 1.00 0.00 ? 1805 GLU B CA 4  
ATOM 7726   C CA . THR B 1 1806 ? 159.287 167.988 123.940 1.00 0.00 ? 1806 THR B CA 4  
ATOM 7727   C CA . LEU B 1 1807 ? 162.585 169.686 122.982 1.00 0.00 ? 1807 LEU B CA 4  
ATOM 7728   C CA . LEU B 1 1808 ? 160.800 171.630 120.214 1.00 0.00 ? 1808 LEU B CA 4  
ATOM 7729   C CA . LYS B 1 1809 ? 158.229 172.840 122.833 1.00 0.00 ? 1809 LYS B CA 4  
ATOM 7730   C CA . LYS B 1 1810 ? 161.003 173.919 125.252 1.00 0.00 ? 1810 LYS B CA 4  
ATOM 7731   C CA . TRP B 1 1811 ? 162.575 175.822 122.326 1.00 0.00 ? 1811 TRP B CA 4  
ATOM 7732   C CA . ALA B 1 1812 ? 159.198 177.572 121.806 1.00 0.00 ? 1812 ALA B CA 4  
ATOM 7733   C CA . LEU B 1 1813 ? 158.590 176.020 118.362 1.00 0.00 ? 1813 LEU B CA 4  
ATOM 7734   C CA . TYR B 1 1814 ? 155.242 174.602 117.256 1.00 0.00 ? 1814 TYR B CA 4  
ATOM 7735   C CA . SER B 1 1815 ? 156.335 173.324 113.828 1.00 0.00 ? 1815 SER B CA 4  
ATOM 7736   C CA . PHE B 1 1816 ? 157.865 169.947 113.272 1.00 0.00 ? 1816 PHE B CA 4  
ATOM 7737   C CA . ASN B 1 1817 ? 158.991 169.939 109.622 1.00 0.00 ? 1817 ASN B CA 4  
ATOM 7738   C CA . ASP B 1 1818 ? 159.270 166.670 107.737 1.00 0.00 ? 1818 ASP B CA 4  
ATOM 7739   C CA . GLY B 1 1819 ? 161.810 167.337 104.951 1.00 0.00 ? 1819 GLY B CA 4  
ATOM 7740   C CA . GLU B 1 1820 ? 161.511 163.972 103.154 1.00 0.00 ? 1820 GLU B CA 4  
ATOM 7741   C CA . GLU B 1 1821 ? 157.679 164.119 103.137 1.00 0.00 ? 1821 GLU B CA 4  
ATOM 7742   C CA . HIS B 1 1822 ? 157.627 167.925 102.564 1.00 0.00 ? 1822 HIS B CA 4  
ATOM 7743   C CA . GLN B 1 1823 ? 154.814 168.378 105.135 1.00 0.00 ? 1823 GLN B CA 4  
ATOM 7744   C CA . LYS B 1 1824 ? 154.773 170.319 108.439 1.00 0.00 ? 1824 LYS B CA 4  
ATOM 7745   C CA . ILE B 1 1825 ? 152.955 169.228 111.585 1.00 0.00 ? 1825 ILE B CA 4  
ATOM 7746   C CA . LEU B 1 1826 ? 151.763 170.854 114.758 1.00 0.00 ? 1826 LEU B CA 4  
ATOM 7747   C CA . LEU B 1 1827 ? 153.998 169.769 117.621 1.00 0.00 ? 1827 LEU B CA 4  
ATOM 7748   C CA . ASP B 1 1828 ? 151.437 170.582 120.302 1.00 0.00 ? 1828 ASP B CA 4  
ATOM 7749   C CA . ASP B 1 1829 ? 148.534 168.852 118.489 1.00 0.00 ? 1829 ASP B CA 4  
ATOM 7750   C CA . LEU B 1 1830 ? 150.368 165.490 118.201 1.00 0.00 ? 1830 LEU B CA 4  
ATOM 7751   C CA . MET B 1 1831 ? 151.909 165.865 121.703 1.00 0.00 ? 1831 MET B CA 4  
ATOM 7752   C CA . LYS B 1 1832 ? 148.593 166.655 123.507 1.00 0.00 ? 1832 LYS B CA 4  
ATOM 7753   C CA . LYS B 1 1833 ? 146.788 163.661 121.909 1.00 0.00 ? 1833 LYS B CA 4  
ATOM 7754   C CA . ALA B 1 1834 ? 148.411 161.505 124.587 1.00 0.00 ? 1834 ALA B CA 4  
ATOM 7755   C CA . GLU B 1 1835 ? 148.763 161.956 128.407 1.00 0.00 ? 1835 GLU B CA 4  
ATOM 7756   C CA . GLU B 1 1836 ? 151.792 164.242 128.063 1.00 0.00 ? 1836 GLU B CA 4  
ATOM 7757   C CA . GLY B 1 1837 ? 149.737 167.470 128.053 1.00 0.00 ? 1837 GLY B CA 4  
ATOM 7758   C CA . PHE B 1 1883 ? 171.375 162.216 86.603  1.00 0.00 ? 1883 PHE B CA 4  
ATOM 7759   C CA . LEU B 1 1884 ? 167.962 160.420 86.769  1.00 0.00 ? 1884 LEU B CA 4  
ATOM 7760   C CA . LEU B 1 1885 ? 167.705 156.582 86.333  1.00 0.00 ? 1885 LEU B CA 4  
ATOM 7761   C CA . GLY B 1 1886 ? 164.327 156.023 88.044  1.00 0.00 ? 1886 GLY B CA 4  
ATOM 7762   C CA . ASP B 1 1887 ? 162.321 152.831 87.611  1.00 0.00 ? 1887 ASP B CA 4  
ATOM 7763   C CA . GLY B 1 1888 ? 161.050 153.236 91.252  1.00 0.00 ? 1888 GLY B CA 4  
ATOM 7764   C CA . SER B 1 1889 ? 158.102 151.750 93.192  1.00 0.00 ? 1889 SER B CA 4  
ATOM 7765   C CA . PHE B 1 1890 ? 157.150 154.965 95.024  1.00 0.00 ? 1890 PHE B CA 4  
ATOM 7766   C CA . GLY B 1 1891 ? 159.274 157.615 93.297  1.00 0.00 ? 1891 GLY B CA 4  
ATOM 7767   C CA . SER B 1 1892 ? 162.284 158.565 91.200  1.00 0.00 ? 1892 SER B CA 4  
ATOM 7768   C CA . VAL B 1 1893 ? 165.812 157.093 91.501  1.00 0.00 ? 1893 VAL B CA 4  
ATOM 7769   C CA . TYR B 1 1894 ? 168.816 159.401 90.914  1.00 0.00 ? 1894 TYR B CA 4  
ATOM 7770   C CA . ARG B 1 1895 ? 172.551 158.850 90.542  1.00 0.00 ? 1895 ARG B CA 4  
ATOM 7771   C CA . ALA B 1 1896 ? 174.743 161.301 92.451  1.00 0.00 ? 1896 ALA B CA 4  
ATOM 7772   C CA . ALA B 1 1897 ? 177.733 161.483 94.816  1.00 0.00 ? 1897 ALA B CA 4  
ATOM 7773   C CA . TYR B 1 1898 ? 178.415 162.329 98.503  1.00 0.00 ? 1898 TYR B CA 4  
ATOM 7774   C CA . GLU B 1 1899 ? 180.426 165.613 98.492  1.00 0.00 ? 1899 GLU B CA 4  
ATOM 7775   C CA . GLY B 1 1900 ? 182.802 164.521 101.326 1.00 0.00 ? 1900 GLY B CA 4  
ATOM 7776   C CA . GLU B 1 1901 ? 183.929 161.110 99.936  1.00 0.00 ? 1901 GLU B CA 4  
ATOM 7777   C CA . GLU B 1 1902 ? 183.184 161.238 96.168  1.00 0.00 ? 1902 GLU B CA 4  
ATOM 7778   C CA . VAL B 1 1903 ? 181.347 157.878 96.884  1.00 0.00 ? 1903 VAL B CA 4  
ATOM 7779   C CA . ALA B 1 1904 ? 178.843 157.196 94.113  1.00 0.00 ? 1904 ALA B CA 4  
ATOM 7780   C CA . VAL B 1 1905 ? 175.346 157.097 95.428  1.00 0.00 ? 1905 VAL B CA 4  
ATOM 7781   C CA . LYS B 1 1906 ? 171.789 156.104 94.472  1.00 0.00 ? 1906 LYS B CA 4  
ATOM 7782   C CA . ILE B 1 1907 ? 168.951 158.348 95.757  1.00 0.00 ? 1907 ILE B CA 4  
ATOM 7783   C CA . PHE B 1 1908 ? 165.359 157.110 95.967  1.00 0.00 ? 1908 PHE B CA 4  
ATOM 7784   C CA . ASN B 1 1909 ? 162.751 159.855 96.600  1.00 0.00 ? 1909 ASN B CA 4  
ATOM 7785   C CA . LYS B 1 1910 ? 159.053 160.883 96.927  1.00 0.00 ? 1910 LYS B CA 4  
ATOM 7786   C CA . HIS B 1 1911 ? 158.452 158.106 99.298  1.00 0.00 ? 1911 HIS B CA 4  
ATOM 7787   C CA . THR B 1 1912 ? 158.015 160.156 102.510 1.00 0.00 ? 1912 THR B CA 4  
ATOM 7788   C CA . SER B 1 1913 ? 154.480 159.330 103.569 1.00 0.00 ? 1913 SER B CA 4  
ATOM 7789   C CA . LEU B 1 1914 ? 154.463 155.674 102.550 1.00 0.00 ? 1914 LEU B CA 4  
ATOM 7790   C CA . ARG B 1 1915 ? 154.312 152.662 104.852 1.00 0.00 ? 1915 ARG B CA 4  
ATOM 7791   C CA . LEU B 1 1916 ? 156.607 150.715 102.438 1.00 0.00 ? 1916 LEU B CA 4  
ATOM 7792   C CA . LEU B 1 1917 ? 159.412 153.407 102.595 1.00 0.00 ? 1917 LEU B CA 4  
ATOM 7793   C CA . ARG B 1 1918 ? 159.168 153.479 106.328 1.00 0.00 ? 1918 ARG B CA 4  
ATOM 7794   C CA . GLN B 1 1919 ? 159.607 149.726 106.525 1.00 0.00 ? 1919 GLN B CA 4  
ATOM 7795   C CA . GLU B 1 1920 ? 162.522 149.873 104.044 1.00 0.00 ? 1920 GLU B CA 4  
ATOM 7796   C CA . LEU B 1 1921 ? 164.289 152.581 106.137 1.00 0.00 ? 1921 LEU B CA 4  
ATOM 7797   C CA . VAL B 1 1922 ? 163.634 150.679 109.423 1.00 0.00 ? 1922 VAL B CA 4  
ATOM 7798   C CA . VAL B 1 1923 ? 164.894 147.316 108.010 1.00 0.00 ? 1923 VAL B CA 4  
ATOM 7799   C CA . LEU B 1 1924 ? 168.002 148.827 106.330 1.00 0.00 ? 1924 LEU B CA 4  
ATOM 7800   C CA . CYS B 1 1925 ? 169.046 150.890 109.422 1.00 0.00 ? 1925 CYS B CA 4  
ATOM 7801   C CA . HIS B 1 1926 ? 170.333 147.787 111.290 1.00 0.00 ? 1926 HIS B CA 4  
ATOM 7802   C CA . LEU B 1 1927 ? 171.878 145.963 108.270 1.00 0.00 ? 1927 LEU B CA 4  
ATOM 7803   C CA . HIS B 1 1928 ? 175.632 146.339 107.646 1.00 0.00 ? 1928 HIS B CA 4  
ATOM 7804   C CA . HIS B 1 1929 ? 177.091 143.503 105.523 1.00 0.00 ? 1929 HIS B CA 4  
ATOM 7805   C CA . PRO B 1 1930 ? 179.158 143.537 102.264 1.00 0.00 ? 1930 PRO B CA 4  
ATOM 7806   C CA . SER B 1 1931 ? 176.621 141.501 100.257 1.00 0.00 ? 1931 SER B CA 4  
ATOM 7807   C CA . LEU B 1 1932 ? 173.655 143.717 101.226 1.00 0.00 ? 1932 LEU B CA 4  
ATOM 7808   C CA . ILE B 1 1933 ? 173.006 147.136 99.627  1.00 0.00 ? 1933 ILE B CA 4  
ATOM 7809   C CA . SER B 1 1934 ? 174.095 149.662 102.270 1.00 0.00 ? 1934 SER B CA 4  
ATOM 7810   C CA . LEU B 1 1935 ? 171.949 152.576 103.381 1.00 0.00 ? 1935 LEU B CA 4  
ATOM 7811   C CA . LEU B 1 1936 ? 174.166 155.654 103.798 1.00 0.00 ? 1936 LEU B CA 4  
ATOM 7812   C CA . ALA B 1 1937 ? 171.693 158.254 105.049 1.00 0.00 ? 1937 ALA B CA 4  
ATOM 7813   C CA . ALA B 1 1938 ? 168.213 159.792 104.936 1.00 0.00 ? 1938 ALA B CA 4  
ATOM 7814   C CA . GLY B 1 1939 ? 167.202 163.138 103.352 1.00 0.00 ? 1939 GLY B CA 4  
ATOM 7815   C CA . ILE B 1 1940 ? 164.075 165.297 103.844 1.00 0.00 ? 1940 ILE B CA 4  
ATOM 7816   C CA . ARG B 1 1941 ? 161.978 167.597 101.588 1.00 0.00 ? 1941 ARG B CA 4  
ATOM 7817   C CA . PRO B 1 1942 ? 161.255 165.243 99.861  1.00 0.00 ? 1942 PRO B CA 4  
ATOM 7818   C CA . ARG B 1 1943 ? 162.185 162.181 101.944 1.00 0.00 ? 1943 ARG B CA 4  
ATOM 7819   C CA . MET B 1 1944 ? 165.131 160.329 100.368 1.00 0.00 ? 1944 MET B CA 4  
ATOM 7820   C CA . LEU B 1 1945 ? 166.966 157.092 101.022 1.00 0.00 ? 1945 LEU B CA 4  
ATOM 7821   C CA . VAL B 1 1946 ? 170.580 157.495 99.976  1.00 0.00 ? 1946 VAL B CA 4  
ATOM 7822   C CA . MET B 1 1947 ? 171.987 154.040 99.090  1.00 0.00 ? 1947 MET B CA 4  
ATOM 7823   C CA . GLU B 1 1948 ? 175.376 152.818 97.769  1.00 0.00 ? 1948 GLU B CA 4  
ATOM 7824   C CA . LEU B 1 1949 ? 175.468 152.790 93.942  1.00 0.00 ? 1949 LEU B CA 4  
ATOM 7825   C CA . ALA B 1 1950 ? 175.909 149.280 92.525  1.00 0.00 ? 1950 ALA B CA 4  
ATOM 7826   C CA . SER B 1 1951 ? 177.439 149.717 89.087  1.00 0.00 ? 1951 SER B CA 4  
ATOM 7827   C CA . LYS B 1 1952 ? 176.846 146.628 86.895  1.00 0.00 ? 1952 LYS B CA 4  
ATOM 7828   C CA . GLY B 1 1953 ? 173.027 146.464 86.984  1.00 0.00 ? 1953 GLY B CA 4  
ATOM 7829   C CA . SER B 1 1954 ? 170.946 143.517 88.206  1.00 0.00 ? 1954 SER B CA 4  
ATOM 7830   C CA . LEU B 1 1955 ? 171.222 139.722 87.887  1.00 0.00 ? 1955 LEU B CA 4  
ATOM 7831   C CA . ASP B 1 1956 ? 167.940 139.365 85.919  1.00 0.00 ? 1956 ASP B CA 4  
ATOM 7832   C CA . ARG B 1 1957 ? 169.015 141.702 83.065  1.00 0.00 ? 1957 ARG B CA 4  
ATOM 7833   C CA . LEU B 1 1958 ? 172.513 140.197 82.889  1.00 0.00 ? 1958 LEU B CA 4  
ATOM 7834   C CA . LEU B 1 1959 ? 171.158 136.619 82.616  1.00 0.00 ? 1959 LEU B CA 4  
ATOM 7835   C CA . GLN B 1 1960 ? 169.063 137.753 79.584  1.00 0.00 ? 1960 GLN B CA 4  
ATOM 7836   C CA . GLN B 1 1961 ? 172.382 138.107 77.636  1.00 0.00 ? 1961 GLN B CA 4  
ATOM 7837   C CA . ASP B 1 1962 ? 172.478 134.476 76.281  1.00 0.00 ? 1962 ASP B CA 4  
ATOM 7838   C CA . LYS B 1 1963 ? 175.335 135.293 73.822  1.00 0.00 ? 1963 LYS B CA 4  
ATOM 7839   C CA . ALA B 1 1964 ? 177.677 136.149 76.729  1.00 0.00 ? 1964 ALA B CA 4  
ATOM 7840   C CA . SER B 1 1965 ? 177.164 133.390 79.309  1.00 0.00 ? 1965 SER B CA 4  
ATOM 7841   C CA . LEU B 1 1966 ? 178.534 133.920 82.829  1.00 0.00 ? 1966 LEU B CA 4  
ATOM 7842   C CA . THR B 1 1967 ? 181.599 131.733 83.384  1.00 0.00 ? 1967 THR B CA 4  
ATOM 7843   C CA . ARG B 1 1968 ? 181.275 128.980 85.999  1.00 0.00 ? 1968 ARG B CA 4  
ATOM 7844   C CA . THR B 1 1969 ? 183.794 130.450 88.523  1.00 0.00 ? 1969 THR B CA 4  
ATOM 7845   C CA . LEU B 1 1970 ? 181.824 133.690 88.513  1.00 0.00 ? 1970 LEU B CA 4  
ATOM 7846   C CA . GLN B 1 1971 ? 178.449 131.846 88.850  1.00 0.00 ? 1971 GLN B CA 4  
ATOM 7847   C CA . HIS B 1 1972 ? 179.872 130.238 92.034  1.00 0.00 ? 1972 HIS B CA 4  
ATOM 7848   C CA . ARG B 1 1973 ? 180.963 133.685 93.330  1.00 0.00 ? 1973 ARG B CA 4  
ATOM 7849   C CA . ILE B 1 1974 ? 177.394 135.032 92.711  1.00 0.00 ? 1974 ILE B CA 4  
ATOM 7850   C CA . ALA B 1 1975 ? 175.810 132.013 94.489  1.00 0.00 ? 1975 ALA B CA 4  
ATOM 7851   C CA . LEU B 1 1976 ? 178.052 132.387 97.587  1.00 0.00 ? 1976 LEU B CA 4  
ATOM 7852   C CA . HIS B 1 1977 ? 177.641 136.209 97.835  1.00 0.00 ? 1977 HIS B CA 4  
ATOM 7853   C CA . VAL B 1 1978 ? 173.845 135.978 97.832  1.00 0.00 ? 1978 VAL B CA 4  
ATOM 7854   C CA . ALA B 1 1979 ? 174.100 133.081 100.340 1.00 0.00 ? 1979 ALA B CA 4  
ATOM 7855   C CA . ASP B 1 1980 ? 176.292 135.152 102.740 1.00 0.00 ? 1980 ASP B CA 4  
ATOM 7856   C CA . GLY B 1 1981 ? 173.858 138.116 102.569 1.00 0.00 ? 1981 GLY B CA 4  
ATOM 7857   C CA . LEU B 1 1982 ? 170.937 135.787 103.375 1.00 0.00 ? 1982 LEU B CA 4  
ATOM 7858   C CA . ARG B 1 1983 ? 173.118 134.114 106.079 1.00 0.00 ? 1983 ARG B CA 4  
ATOM 7859   C CA . TYR B 1 1984 ? 173.778 137.534 107.693 1.00 0.00 ? 1984 TYR B CA 4  
ATOM 7860   C CA . LEU B 1 1985 ? 170.022 138.009 107.404 1.00 0.00 ? 1985 LEU B CA 4  
ATOM 7861   C CA . HIS B 1 1986 ? 169.411 134.698 109.191 1.00 0.00 ? 1986 HIS B CA 4  
ATOM 7862   C CA . SER B 1 1987 ? 171.454 136.093 112.151 1.00 0.00 ? 1987 SER B CA 4  
ATOM 7863   C CA . ALA B 1 1988 ? 169.242 139.207 112.410 1.00 0.00 ? 1988 ALA B CA 4  
ATOM 7864   C CA . MET B 1 1989 ? 165.927 137.211 112.023 1.00 0.00 ? 1989 MET B CA 4  
ATOM 7865   C CA . ILE B 1 1990 ? 164.666 139.264 109.040 1.00 0.00 ? 1990 ILE B CA 4  
ATOM 7866   C CA . ILE B 1 1991 ? 162.470 137.890 106.178 1.00 0.00 ? 1991 ILE B CA 4  
ATOM 7867   C CA . TYR B 1 1992 ? 163.007 139.603 102.784 1.00 0.00 ? 1992 TYR B CA 4  
ATOM 7868   C CA . ARG B 1 1993 ? 159.999 138.144 100.854 1.00 0.00 ? 1993 ARG B CA 4  
ATOM 7869   C CA . ASP B 1 1994 ? 160.927 139.570 97.410  1.00 0.00 ? 1994 ASP B CA 4  
ATOM 7870   C CA . LEU B 1 1995 ? 164.061 137.524 96.630  1.00 0.00 ? 1995 LEU B CA 4  
ATOM 7871   C CA . LYS B 1 1996 ? 164.191 137.262 92.819  1.00 0.00 ? 1996 LYS B CA 4  
ATOM 7872   C CA . PRO B 1 1997 ? 167.022 138.087 90.347  1.00 0.00 ? 1997 PRO B CA 4  
ATOM 7873   C CA . HIS B 1 1998 ? 165.828 141.673 89.662  1.00 0.00 ? 1998 HIS B CA 4  
ATOM 7874   C CA . ASN B 1 1999 ? 166.572 142.425 93.341  1.00 0.00 ? 1999 ASN B CA 4  
ATOM 7875   C CA . VAL B 1 2000 ? 170.124 141.019 93.153  1.00 0.00 ? 2000 VAL B CA 4  
ATOM 7876   C CA . LEU B 1 2001 ? 172.430 143.921 92.249  1.00 0.00 ? 2001 LEU B CA 4  
ATOM 7877   C CA . LEU B 1 2002 ? 175.780 143.309 90.661  1.00 0.00 ? 2002 LEU B CA 4  
ATOM 7878   C CA . PHE B 1 2003 ? 178.822 145.140 91.980  1.00 0.00 ? 2003 PHE B CA 4  
ATOM 7879   C CA . THR B 1 2004 ? 181.450 143.389 89.859  1.00 0.00 ? 2004 THR B CA 4  
ATOM 7880   C CA . LEU B 1 2005 ? 181.631 140.345 87.472  1.00 0.00 ? 2005 LEU B CA 4  
ATOM 7881   C CA . TYR B 1 2006 ? 185.424 139.779 87.779  1.00 0.00 ? 2006 TYR B CA 4  
ATOM 7882   C CA . PRO B 1 2007 ? 185.817 136.485 89.757  1.00 0.00 ? 2007 PRO B CA 4  
ATOM 7883   C CA . ASN B 1 2008 ? 188.579 137.902 92.045  1.00 0.00 ? 2008 ASN B CA 4  
ATOM 7884   C CA . ALA B 1 2009 ? 186.527 140.979 93.088  1.00 0.00 ? 2009 ALA B CA 4  
ATOM 7885   C CA . ALA B 1 2010 ? 185.919 141.644 96.797  1.00 0.00 ? 2010 ALA B CA 4  
ATOM 7886   C CA . ILE B 1 2011 ? 182.144 141.769 96.168  1.00 0.00 ? 2011 ILE B CA 4  
ATOM 7887   C CA . ILE B 1 2012 ? 180.205 140.487 93.106  1.00 0.00 ? 2012 ILE B CA 4  
ATOM 7888   C CA . ALA B 1 2013 ? 176.585 140.523 94.203  1.00 0.00 ? 2013 ALA B CA 4  
ATOM 7889   C CA . LYS B 1 2014 ? 174.484 142.341 96.758  1.00 0.00 ? 2014 LYS B CA 4  
ATOM 7890   C CA . ILE B 1 2015 ? 170.883 141.751 97.885  1.00 0.00 ? 2015 ILE B CA 4  
ATOM 7891   C CA . ALA B 1 2016 ? 168.619 144.817 97.420  1.00 0.00 ? 2016 ALA B CA 4  
ATOM 7892   C CA . ASP B 1 2017 ? 165.017 146.087 97.609  1.00 0.00 ? 2017 ASP B CA 4  
ATOM 7893   C CA . TYR B 1 2018 ? 163.818 145.297 101.112 1.00 0.00 ? 2018 TYR B CA 4  
ATOM 7894   C CA . GLY B 1 2019 ? 160.536 147.226 100.824 1.00 0.00 ? 2019 GLY B CA 4  
ATOM 7895   C CA . THR B 1 2020 ? 158.386 144.237 101.706 1.00 0.00 ? 2020 THR B CA 4  
ATOM 7896   C CA . ALA B 1 2021 ? 160.633 142.784 104.484 1.00 0.00 ? 2021 ALA B CA 4  
ATOM 7897   C CA . GLN B 1 2022 ? 159.588 141.608 108.000 1.00 0.00 ? 2022 GLN B CA 4  
ATOM 7898   C CA . TYR B 1 2023 ? 161.495 141.372 111.270 1.00 0.00 ? 2023 TYR B CA 4  
ATOM 7899   C CA . CYS B 1 2024 ? 159.171 140.104 113.980 1.00 0.00 ? 2024 CYS B CA 4  
ATOM 7900   C CA . CYS B 1 2025 ? 159.287 137.969 117.155 1.00 0.00 ? 2025 CYS B CA 4  
ATOM 7901   C CA . ARG B 1 2026 ? 155.830 136.684 116.185 1.00 0.00 ? 2026 ARG B CA 4  
ATOM 7902   C CA . MET B 1 2027 ? 154.700 134.584 113.233 1.00 0.00 ? 2027 MET B CA 4  
ATOM 7903   C CA . GLY B 1 2028 ? 154.883 136.298 109.792 1.00 0.00 ? 2028 GLY B CA 4  
ATOM 7904   C CA . ILE B 1 2029 ? 152.050 136.183 107.209 1.00 0.00 ? 2029 ILE B CA 4  
ATOM 7905   C CA . LYS B 1 2030 ? 151.382 137.544 103.632 1.00 0.00 ? 2030 LYS B CA 4  
ATOM 7906   C CA . THR B 1 2031 ? 149.135 137.230 100.436 1.00 0.00 ? 2031 THR B CA 4  
ATOM 7907   C CA . SER B 1 2032 ? 150.384 140.057 98.308  1.00 0.00 ? 2032 SER B CA 4  
ATOM 7908   C CA . GLU B 1 2033 ? 153.810 138.897 97.109  1.00 0.00 ? 2033 GLU B CA 4  
ATOM 7909   C CA . GLY B 1 2034 ? 151.843 137.421 94.196  1.00 0.00 ? 2034 GLY B CA 4  
ATOM 7910   C CA . THR B 1 2035 ? 154.885 136.507 91.976  1.00 0.00 ? 2035 THR B CA 4  
ATOM 7911   C CA . PRO B 1 2036 ? 154.738 132.783 92.795  1.00 0.00 ? 2036 PRO B CA 4  
ATOM 7912   C CA . GLY B 1 2037 ? 157.457 131.467 90.413  1.00 0.00 ? 2037 GLY B CA 4  
ATOM 7913   C CA . PHE B 1 2038 ? 159.979 132.697 93.012  1.00 0.00 ? 2038 PHE B CA 4  
ATOM 7914   C CA . ARG B 1 2039 ? 157.869 132.363 96.205  1.00 0.00 ? 2039 ARG B CA 4  
ATOM 7915   C CA . ALA B 1 2040 ? 157.445 129.535 98.715  1.00 0.00 ? 2040 ALA B CA 4  
ATOM 7916   C CA . PRO B 1 2041 ? 154.234 127.347 98.579  1.00 0.00 ? 2041 PRO B CA 4  
ATOM 7917   C CA . GLU B 1 2042 ? 152.619 129.222 101.532 1.00 0.00 ? 2042 GLU B CA 4  
ATOM 7918   C CA . VAL B 1 2043 ? 151.431 131.657 98.749  1.00 0.00 ? 2043 VAL B CA 4  
ATOM 7919   C CA . ALA B 1 2044 ? 148.115 129.826 98.903  1.00 0.00 ? 2044 ALA B CA 4  
ATOM 7920   C CA . ARG B 1 2045 ? 146.326 132.607 100.972 1.00 0.00 ? 2045 ARG B CA 4  
ATOM 7921   C CA . GLY B 1 2046 ? 146.608 135.135 103.964 1.00 0.00 ? 2046 GLY B CA 4  
ATOM 7922   C CA . ASN B 1 2047 ? 145.465 132.665 106.532 1.00 0.00 ? 2047 ASN B CA 4  
ATOM 7923   C CA . VAL B 1 2048 ? 148.828 130.798 106.797 1.00 0.00 ? 2048 VAL B CA 4  
ATOM 7924   C CA . ILE B 1 2049 ? 151.975 131.690 108.726 1.00 0.00 ? 2049 ILE B CA 4  
ATOM 7925   C CA . TYR B 1 2050 ? 155.592 131.300 107.702 1.00 0.00 ? 2050 TYR B CA 4  
ATOM 7926   C CA . ASN B 1 2051 ? 159.223 132.205 108.568 1.00 0.00 ? 2051 ASN B CA 4  
ATOM 7927   C CA . GLN B 1 2052 ? 162.683 132.991 107.005 1.00 0.00 ? 2052 GLN B CA 4  
ATOM 7928   C CA . GLN B 1 2053 ? 162.409 129.537 105.431 1.00 0.00 ? 2053 GLN B CA 4  
ATOM 7929   C CA . ALA B 1 2054 ? 160.284 131.283 102.754 1.00 0.00 ? 2054 ALA B CA 4  
ATOM 7930   C CA . ASP B 1 2055 ? 163.417 133.259 101.665 1.00 0.00 ? 2055 ASP B CA 4  
ATOM 7931   C CA . VAL B 1 2056 ? 165.412 129.960 101.688 1.00 0.00 ? 2056 VAL B CA 4  
ATOM 7932   C CA . TYR B 1 2057 ? 162.946 128.727 99.016  1.00 0.00 ? 2057 TYR B CA 4  
ATOM 7933   C CA . SER B 1 2058 ? 163.367 132.006 97.026  1.00 0.00 ? 2058 SER B CA 4  
ATOM 7934   C CA . PHE B 1 2059 ? 167.169 131.448 97.233  1.00 0.00 ? 2059 PHE B CA 4  
ATOM 7935   C CA . GLY B 1 2060 ? 166.836 127.948 95.617  1.00 0.00 ? 2060 GLY B CA 4  
ATOM 7936   C CA . LEU B 1 2061 ? 165.144 129.633 92.652  1.00 0.00 ? 2061 LEU B CA 4  
ATOM 7937   C CA . LEU B 1 2062 ? 168.023 132.200 92.540  1.00 0.00 ? 2062 LEU B CA 4  
ATOM 7938   C CA . LEU B 1 2063 ? 170.513 129.288 92.379  1.00 0.00 ? 2063 LEU B CA 4  
ATOM 7939   C CA . TYR B 1 2064 ? 168.458 127.650 89.569  1.00 0.00 ? 2064 TYR B CA 4  
ATOM 7940   C CA . ASP B 1 2065 ? 168.342 130.919 87.522  1.00 0.00 ? 2065 ASP B CA 4  
ATOM 7941   C CA . ILE B 1 2066 ? 172.174 131.445 87.950  1.00 0.00 ? 2066 ILE B CA 4  
ATOM 7942   C CA . LEU B 1 2067 ? 172.925 127.772 87.082  1.00 0.00 ? 2067 LEU B CA 4  
ATOM 7943   C CA . THR B 1 2068 ? 170.709 127.682 83.992  1.00 0.00 ? 2068 THR B CA 4  
ATOM 7944   C CA . THR B 1 2069 ? 170.452 131.327 82.752  1.00 0.00 ? 2069 THR B CA 4  
ATOM 7945   C CA . GLY B 1 2070 ? 166.666 130.617 82.551  1.00 0.00 ? 2070 GLY B CA 4  
ATOM 7946   C CA . GLY B 1 2071 ? 163.623 131.854 84.522  1.00 0.00 ? 2071 GLY B CA 4  
ATOM 7947   C CA . ARG B 1 2072 ? 159.817 131.546 84.600  1.00 0.00 ? 2072 ARG B CA 4  
ATOM 7948   C CA . ILE B 1 2073 ? 156.967 133.637 86.148  1.00 0.00 ? 2073 ILE B CA 4  
ATOM 7949   C CA . VAL B 1 2074 ? 153.592 131.919 86.432  1.00 0.00 ? 2074 VAL B CA 4  
ATOM 7950   C CA . GLU B 1 2075 ? 150.173 133.163 87.698  1.00 0.00 ? 2075 GLU B CA 4  
ATOM 7951   C CA . GLY B 1 2076 ? 146.743 131.445 88.083  1.00 0.00 ? 2076 GLY B CA 4  
ATOM 7952   C CA . LEU B 1 2077 ? 145.100 128.550 89.964  1.00 0.00 ? 2077 LEU B CA 4  
ATOM 7953   C CA . LYS B 1 2078 ? 146.393 125.300 88.416  1.00 0.00 ? 2078 LYS B CA 4  
ATOM 7954   C CA . PHE B 1 2079 ? 150.048 126.488 88.689  1.00 0.00 ? 2079 PHE B CA 4  
ATOM 7955   C CA . PRO B 1 2080 ? 149.842 127.318 92.505  1.00 0.00 ? 2080 PRO B CA 4  
ATOM 7956   C CA . ASN B 1 2081 ? 148.012 123.985 93.143  1.00 0.00 ? 2081 ASN B CA 4  
ATOM 7957   C CA . GLU B 1 2082 ? 150.787 122.195 91.226  1.00 0.00 ? 2082 GLU B CA 4  
ATOM 7958   C CA . PHE B 1 2083 ? 153.541 124.019 93.158  1.00 0.00 ? 2083 PHE B CA 4  
ATOM 7959   C CA . ASP B 1 2084 ? 151.814 123.634 96.595  1.00 0.00 ? 2084 ASP B CA 4  
ATOM 7960   C CA . GLU B 1 2085 ? 150.233 120.105 96.405  1.00 0.00 ? 2085 GLU B CA 4  
ATOM 7961   C CA . LEU B 1 2086 ? 152.082 118.254 93.564  1.00 0.00 ? 2086 LEU B CA 4  
ATOM 7962   C CA . GLU B 1 2087 ? 155.707 119.289 94.410  1.00 0.00 ? 2087 GLU B CA 4  
ATOM 7963   C CA . ILE B 1 2088 ? 156.286 121.048 91.011  1.00 0.00 ? 2088 ILE B CA 4  
ATOM 7964   C CA . GLN B 1 2089 ? 159.619 122.853 90.920  1.00 0.00 ? 2089 GLN B CA 4  
ATOM 7965   C CA . GLY B 1 2090 ? 162.069 123.863 88.183  1.00 0.00 ? 2090 GLY B CA 4  
ATOM 7966   C CA . LYS B 1 2091 ? 164.240 120.789 88.866  1.00 0.00 ? 2091 LYS B CA 4  
ATOM 7967   C CA . LEU B 1 2092 ? 161.340 118.263 88.965  1.00 0.00 ? 2092 LEU B CA 4  
ATOM 7968   C CA . PRO B 1 2093 ? 159.674 119.267 85.600  1.00 0.00 ? 2093 PRO B CA 4  
ATOM 7969   C CA . ASP B 1 2094 ? 163.019 119.218 83.750  1.00 0.00 ? 2094 ASP B CA 4  
ATOM 7970   C CA . PRO B 1 2095 ? 165.263 116.268 85.026  1.00 0.00 ? 2095 PRO B CA 4  
ATOM 7971   C CA . VAL B 1 2096 ? 167.037 116.150 81.621  1.00 0.00 ? 2096 VAL B CA 4  
ATOM 7972   C CA . LYS B 1 2097 ? 167.864 119.903 81.583  1.00 0.00 ? 2097 LYS B CA 4  
ATOM 7973   C CA . GLU B 1 2098 ? 169.689 119.715 84.898  1.00 0.00 ? 2098 GLU B CA 4  
ATOM 7974   C CA . TYR B 1 2099 ? 170.566 115.969 85.611  1.00 0.00 ? 2099 TYR B CA 4  
ATOM 7975   C CA . GLY B 1 2100 ? 171.485 115.177 81.925  1.00 0.00 ? 2100 GLY B CA 4  
ATOM 7976   C CA . CYS B 1 2101 ? 174.066 118.007 81.887  1.00 0.00 ? 2101 CYS B CA 4  
ATOM 7977   C CA . ALA B 1 2102 ? 175.482 116.682 85.199  1.00 0.00 ? 2102 ALA B CA 4  
ATOM 7978   C CA . PRO B 1 2103 ? 175.360 119.845 87.482  1.00 0.00 ? 2103 PRO B CA 4  
ATOM 7979   C CA . TRP B 1 2104 ? 177.578 119.183 90.561  1.00 0.00 ? 2104 TRP B CA 4  
ATOM 7980   C CA . PRO B 1 2105 ? 175.674 116.743 92.884  1.00 0.00 ? 2105 PRO B CA 4  
ATOM 7981   C CA . MET B 1 2106 ? 176.296 118.974 95.943  1.00 0.00 ? 2106 MET B CA 4  
ATOM 7982   C CA . VAL B 1 2107 ? 174.703 121.988 94.102  1.00 0.00 ? 2107 VAL B CA 4  
ATOM 7983   C CA . GLU B 1 2108 ? 171.784 119.744 93.094  1.00 0.00 ? 2108 GLU B CA 4  
ATOM 7984   C CA . LYS B 1 2109 ? 171.281 118.551 96.713  1.00 0.00 ? 2109 LYS B CA 4  
ATOM 7985   C CA . LEU B 1 2110 ? 171.339 122.138 98.011  1.00 0.00 ? 2110 LEU B CA 4  
ATOM 7986   C CA . ILE B 1 2111 ? 168.727 123.405 95.458  1.00 0.00 ? 2111 ILE B CA 4  
ATOM 7987   C CA . LYS B 1 2112 ? 166.457 120.396 96.236  1.00 0.00 ? 2112 LYS B CA 4  
ATOM 7988   C CA . GLN B 1 2113 ? 166.710 120.861 100.024 1.00 0.00 ? 2113 GLN B CA 4  
ATOM 7989   C CA . CYS B 1 2114 ? 166.202 124.669 99.741  1.00 0.00 ? 2114 CYS B CA 4  
ATOM 7990   C CA . LEU B 1 2115 ? 163.026 124.186 97.624  1.00 0.00 ? 2115 LEU B CA 4  
ATOM 7991   C CA . LYS B 1 2116 ? 161.438 121.576 99.930  1.00 0.00 ? 2116 LYS B CA 4  
ATOM 7992   C CA . GLU B 1 2117 ? 157.645 121.843 100.320 1.00 0.00 ? 2117 GLU B CA 4  
ATOM 7993   C CA . ASN B 1 2118 ? 158.076 121.341 104.064 1.00 0.00 ? 2118 ASN B CA 4  
ATOM 7994   C CA . PRO B 1 2119 ? 159.789 124.574 105.390 1.00 0.00 ? 2119 PRO B CA 4  
ATOM 7995   C CA . GLN B 1 2120 ? 161.579 122.640 108.184 1.00 0.00 ? 2120 GLN B CA 4  
ATOM 7996   C CA . GLU B 1 2121 ? 163.597 120.510 105.711 1.00 0.00 ? 2121 GLU B CA 4  
ATOM 7997   C CA . ARG B 1 2122 ? 165.098 123.593 104.041 1.00 0.00 ? 2122 ARG B CA 4  
ATOM 7998   C CA . PRO B 1 2123 ? 168.668 123.997 105.446 1.00 0.00 ? 2123 PRO B CA 4  
ATOM 7999   C CA . THR B 1 2124 ? 170.258 126.561 107.770 1.00 0.00 ? 2124 THR B CA 4  
ATOM 8000   C CA . SER B 1 2125 ? 172.434 129.008 105.781 1.00 0.00 ? 2125 SER B CA 4  
ATOM 8001   C CA . ALA B 1 2126 ? 175.621 127.785 107.492 1.00 0.00 ? 2126 ALA B CA 4  
ATOM 8002   C CA . GLN B 1 2127 ? 175.084 124.389 105.751 1.00 0.00 ? 2127 GLN B CA 4  
ATOM 8003   C CA . VAL B 1 2128 ? 174.256 126.234 102.488 1.00 0.00 ? 2128 VAL B CA 4  
ATOM 8004   C CA . PHE B 1 2129 ? 177.471 128.328 102.654 1.00 0.00 ? 2129 PHE B CA 4  
ATOM 8005   C CA . ASP B 1 2130 ? 179.675 125.270 103.499 1.00 0.00 ? 2130 ASP B CA 4  
ATOM 8006   C CA . ILE B 1 2131 ? 178.197 123.275 100.553 1.00 0.00 ? 2131 ILE B CA 4  
ATOM 8007   C CA . LEU B 1 2132 ? 178.552 126.188 98.029  1.00 0.00 ? 2132 LEU B CA 4  
ATOM 8008   C CA . ASN B 1 2133 ? 182.186 126.719 99.139  1.00 0.00 ? 2133 ASN B CA 4  
ATOM 8009   C CA . SER B 1 2134 ? 183.003 123.063 98.174  1.00 0.00 ? 2134 SER B CA 4  
ATOM 8010   C CA . ALA B 1 2135 ? 181.968 123.466 94.469  1.00 0.00 ? 2135 ALA B CA 4  
ATOM 8011   C CA . ARG B 1 2142 ? 179.644 108.518 87.478  1.00 0.00 ? 2142 ARG B CA 4  
ATOM 8012   C CA . ARG B 1 2143 ? 179.518 104.799 88.229  1.00 0.00 ? 2143 ARG B CA 4  
ATOM 8013   C CA . ILE B 1 2144 ? 180.981 102.223 85.834  1.00 0.00 ? 2144 ILE B CA 4  
ATOM 8014   C CA . LEU B 1 2145 ? 179.796 98.669  86.471  1.00 0.00 ? 2145 LEU B CA 4  
ATOM 8015   C CA . LEU B 1 2146 ? 182.333 95.933  85.824  1.00 0.00 ? 2146 LEU B CA 4  
ATOM 8016   C CA . PRO B 1 2147 ? 181.193 92.614  84.322  1.00 0.00 ? 2147 PRO B CA 4  
ATOM 8017   C CA . LYS B 1 2148 ? 179.324 90.435  86.785  1.00 0.00 ? 2148 LYS B CA 4  
ATOM 8018   C CA . ASN B 1 2149 ? 181.468 88.497  89.324  1.00 0.00 ? 2149 ASN B CA 4  
ATOM 8019   C CA . VAL B 1 2150 ? 184.680 90.330  88.342  1.00 0.00 ? 2150 VAL B CA 4  
ATOM 8020   C CA . ILE B 1 2151 ? 186.688 90.856  91.538  1.00 0.00 ? 2151 ILE B CA 4  
ATOM 8021   C CA . VAL B 1 2152 ? 189.440 93.489  91.486  1.00 0.00 ? 2152 VAL B CA 4  
ATOM 8022   C CA . GLU B 1 2153 ? 192.574 92.896  93.552  1.00 0.00 ? 2153 GLU B CA 4  
ATOM 8023   C CA . CYS B 1 2154 ? 194.564 95.896  92.324  1.00 0.00 ? 2154 CYS B CA 4  
ATOM 8024   C CA . MET B 1 2155 ? 194.197 98.868  90.027  1.00 0.00 ? 2155 MET B CA 4  
ATOM 8025   C CA . VAL B 1 2156 ? 196.352 101.472 88.241  1.00 0.00 ? 2156 VAL B CA 4  
ATOM 8026   C CA . ALA B 1 2157 ? 195.189 104.422 86.146  1.00 0.00 ? 2157 ALA B CA 4  
ATOM 8027   C CA . THR B 1 2158 ? 196.424 105.918 82.879  1.00 0.00 ? 2158 THR B CA 4  
ATOM 8028   C CA . ASN B 1 2164 ? 190.112 108.077 76.478  1.00 0.00 ? 2164 ASN B CA 4  
ATOM 8029   C CA . ALA B 1 2165 ? 191.352 107.508 80.010  1.00 0.00 ? 2165 ALA B CA 4  
ATOM 8030   C CA . SER B 1 2166 ? 191.578 103.890 81.089  1.00 0.00 ? 2166 SER B CA 4  
ATOM 8031   C CA . ILE B 1 2167 ? 192.597 101.600 83.929  1.00 0.00 ? 2167 ILE B CA 4  
ATOM 8032   C CA . TRP B 1 2168 ? 194.506 98.333  84.370  1.00 0.00 ? 2168 TRP B CA 4  
ATOM 8033   C CA . LEU B 1 2169 ? 192.966 95.823  86.785  1.00 0.00 ? 2169 LEU B CA 4  
ATOM 8034   C CA . GLY B 1 2170 ? 194.329 92.728  88.493  1.00 0.00 ? 2170 GLY B CA 4  
ATOM 8035   C CA . CYS B 1 2171 ? 191.642 90.100  88.968  1.00 0.00 ? 2171 CYS B CA 4  
ATOM 8036   C CA . GLY B 1 2172 ? 190.846 88.183  92.149  1.00 0.00 ? 2172 GLY B CA 4  
ATOM 8037   C CA . HIS B 1 2173 ? 188.086 85.901  90.886  1.00 0.00 ? 2173 HIS B CA 4  
ATOM 8038   C CA . THR B 1 2174 ? 190.697 83.522  89.434  1.00 0.00 ? 2174 THR B CA 4  
ATOM 8039   C CA . ASP B 1 2175 ? 193.659 81.524  90.712  1.00 0.00 ? 2175 ASP B CA 4  
ATOM 8040   C CA . ARG B 1 2176 ? 195.812 82.446  87.686  1.00 0.00 ? 2176 ARG B CA 4  
ATOM 8041   C CA . GLY B 1 2177 ? 197.173 85.752  86.421  1.00 0.00 ? 2177 GLY B CA 4  
ATOM 8042   C CA . GLN B 1 2178 ? 194.489 87.670  84.516  1.00 0.00 ? 2178 GLN B CA 4  
ATOM 8043   C CA . LEU B 1 2179 ? 195.138 91.270  83.442  1.00 0.00 ? 2179 LEU B CA 4  
ATOM 8044   C CA . SER B 1 2180 ? 192.084 93.397  82.624  1.00 0.00 ? 2180 SER B CA 4  
ATOM 8045   C CA . PHE B 1 2181 ? 191.660 96.740  80.870  1.00 0.00 ? 2181 PHE B CA 4  
ATOM 8046   C CA . LEU B 1 2182 ? 188.835 99.266  81.283  1.00 0.00 ? 2182 LEU B CA 4  
ATOM 8047   C CA . ASP B 1 2183 ? 188.217 102.254 79.000  1.00 0.00 ? 2183 ASP B CA 4  
ATOM 8048   C CA . LEU B 1 2184 ? 186.815 104.867 81.390  1.00 0.00 ? 2184 LEU B CA 4  
ATOM 8049   C CA . ASN B 1 2185 ? 185.118 106.648 78.455  1.00 0.00 ? 2185 ASN B CA 4  
ATOM 8050   C CA . THR B 1 2186 ? 183.418 103.722 76.684  1.00 0.00 ? 2186 THR B CA 4  
ATOM 8051   C CA . GLU B 1 2187 ? 183.161 101.491 79.798  1.00 0.00 ? 2187 GLU B CA 4  
ATOM 8052   C CA . GLY B 1 2188 ? 184.545 98.678  77.638  1.00 0.00 ? 2188 GLY B CA 4  
ATOM 8053   C CA . TYR B 1 2189 ? 186.231 95.804  79.456  1.00 0.00 ? 2189 TYR B CA 4  
ATOM 8054   C CA . THR B 1 2190 ? 188.790 93.324  78.116  1.00 0.00 ? 2190 THR B CA 4  
ATOM 8055   C CA . SER B 1 2191 ? 190.960 90.798  79.936  1.00 0.00 ? 2191 SER B CA 4  
ATOM 8056   C CA . GLU B 1 2192 ? 193.788 88.376  79.183  1.00 0.00 ? 2192 GLU B CA 4  
ATOM 8057   C CA . GLU B 1 2193 ? 195.234 85.483  81.191  1.00 0.00 ? 2193 GLU B CA 4  
ATOM 8058   C CA . VAL B 1 2194 ? 198.875 86.523  81.412  1.00 0.00 ? 2194 VAL B CA 4  
ATOM 8059   C CA . ALA B 1 2195 ? 200.507 84.636  84.319  1.00 0.00 ? 2195 ALA B CA 4  
ATOM 8060   C CA . ASP B 1 2196 ? 200.324 81.424  86.352  1.00 0.00 ? 2196 ASP B CA 4  
ATOM 8061   C CA . SER B 1 2197 ? 199.276 82.926  89.712  1.00 0.00 ? 2197 SER B CA 4  
ATOM 8062   C CA . ARG B 1 2198 ? 196.897 85.662  90.822  1.00 0.00 ? 2198 ARG B CA 4  
ATOM 8063   C CA . ILE B 1 2199 ? 198.012 89.199  90.002  1.00 0.00 ? 2199 ILE B CA 4  
ATOM 8064   C CA . LEU B 1 2200 ? 198.369 90.893  93.389  1.00 0.00 ? 2200 LEU B CA 4  
ATOM 8065   C CA . CYS B 1 2201 ? 199.579 94.377  92.447  1.00 0.00 ? 2201 CYS B CA 4  
ATOM 8066   C CA . LEU B 1 2202 ? 200.163 96.627  89.441  1.00 0.00 ? 2202 LEU B CA 4  
ATOM 8067   C CA . ALA B 1 2203 ? 202.593 99.437  88.664  1.00 0.00 ? 2203 ALA B CA 4  
ATOM 8068   C CA . LEU B 1 2204 ? 202.977 101.538 85.517  1.00 0.00 ? 2204 LEU B CA 4  
ATOM 8069   C CA . VAL B 1 2205 ? 206.587 102.332 84.587  1.00 0.00 ? 2205 VAL B CA 4  
ATOM 8070   C CA . HIS B 1 2206 ? 206.804 105.160 82.046  1.00 0.00 ? 2206 HIS B CA 4  
ATOM 8071   C CA . LEU B 1 2207 ? 210.032 105.882 80.172  1.00 0.00 ? 2207 LEU B CA 4  
ATOM 8072   C CA . PRO B 1 2208 ? 209.859 109.441 78.751  1.00 0.00 ? 2208 PRO B CA 4  
ATOM 8073   C CA . VAL B 1 2209 ? 212.967 108.974 76.697  1.00 0.00 ? 2209 VAL B CA 4  
ATOM 8074   C CA . GLU B 1 2210 ? 212.487 105.859 74.530  1.00 0.00 ? 2210 GLU B CA 4  
ATOM 8075   C CA . LYS B 1 2211 ? 208.760 106.759 74.667  1.00 0.00 ? 2211 LYS B CA 4  
ATOM 8076   C CA . GLU B 1 2212 ? 207.607 103.514 76.230  1.00 0.00 ? 2212 GLU B CA 4  
ATOM 8077   C CA . SER B 1 2213 ? 205.174 102.479 78.964  1.00 0.00 ? 2213 SER B CA 4  
ATOM 8078   C CA . TRP B 1 2214 ? 205.338 99.078  80.663  1.00 0.00 ? 2214 TRP B CA 4  
ATOM 8079   C CA . ILE B 1 2215 ? 202.691 97.576  82.944  1.00 0.00 ? 2215 ILE B CA 4  
ATOM 8080   C CA . VAL B 1 2216 ? 204.231 95.518  85.759  1.00 0.00 ? 2216 VAL B CA 4  
ATOM 8081   C CA . SER B 1 2217 ? 202.203 92.769  87.444  1.00 0.00 ? 2217 SER B CA 4  
ATOM 8082   C CA . GLY B 1 2218 ? 203.250 91.315  90.792  1.00 0.00 ? 2218 GLY B CA 4  
ATOM 8083   C CA . THR B 1 2219 ? 201.830 87.869  91.473  1.00 0.00 ? 2219 THR B CA 4  
ATOM 8084   C CA . GLN B 1 2220 ? 201.125 85.365  94.247  1.00 0.00 ? 2220 GLN B CA 4  
ATOM 8085   C CA . SER B 1 2221 ? 204.131 83.245  93.196  1.00 0.00 ? 2221 SER B CA 4  
ATOM 8086   C CA . GLY B 1 2222 ? 206.692 86.075  93.221  1.00 0.00 ? 2222 GLY B CA 4  
ATOM 8087   C CA . THR B 1 2223 ? 206.798 86.625  89.457  1.00 0.00 ? 2223 THR B CA 4  
ATOM 8088   C CA . LEU B 1 2224 ? 207.194 90.162  88.093  1.00 0.00 ? 2224 LEU B CA 4  
ATOM 8089   C CA . LEU B 1 2225 ? 205.593 90.159  84.638  1.00 0.00 ? 2225 LEU B CA 4  
ATOM 8090   C CA . VAL B 1 2226 ? 206.380 93.204  82.476  1.00 0.00 ? 2226 VAL B CA 4  
ATOM 8091   C CA . ILE B 1 2227 ? 204.137 93.830  79.456  1.00 0.00 ? 2227 ILE B CA 4  
ATOM 8092   C CA . ASN B 1 2228 ? 204.309 96.606  76.864  1.00 0.00 ? 2228 ASN B CA 4  
ATOM 8093   C CA . THR B 1 2229 ? 201.316 98.938  76.706  1.00 0.00 ? 2229 THR B CA 4  
ATOM 8094   C CA . GLU B 1 2230 ? 201.337 99.398  72.925  1.00 0.00 ? 2230 GLU B CA 4  
ATOM 8095   C CA . ASP B 1 2231 ? 202.399 95.897  71.783  1.00 0.00 ? 2231 ASP B CA 4  
ATOM 8096   C CA . GLY B 1 2232 ? 201.236 93.085  74.067  1.00 0.00 ? 2232 GLY B CA 4  
ATOM 8097   C CA . LYS B 1 2233 ? 203.578 90.712  72.225  1.00 0.00 ? 2233 LYS B CA 4  
ATOM 8098   C CA . LYS B 1 2234 ? 206.422 92.517  74.048  1.00 0.00 ? 2234 LYS B CA 4  
ATOM 8099   C CA . ARG B 1 2235 ? 206.528 90.914  77.489  1.00 0.00 ? 2235 ARG B CA 4  
ATOM 8100   C CA . HIS B 1 2236 ? 209.122 89.367  79.780  1.00 0.00 ? 2236 HIS B CA 4  
ATOM 8101   C CA . THR B 1 2237 ? 209.865 88.559  83.420  1.00 0.00 ? 2237 THR B CA 4  
ATOM 8102   C CA . LEU B 1 2238 ? 212.191 90.161  85.967  1.00 0.00 ? 2238 LEU B CA 4  
ATOM 8103   C CA . GLU B 1 2239 ? 213.958 88.256  88.750  1.00 0.00 ? 2239 GLU B CA 4  
ATOM 8104   C CA . LYS B 1 2240 ? 211.596 85.971  90.644  1.00 0.00 ? 2240 LYS B CA 4  
ATOM 8105   C CA . MET B 1 2241 ? 210.825 87.025  94.209  1.00 0.00 ? 2241 MET B CA 4  
ATOM 8106   C CA . THR B 1 2242 ? 211.238 84.596  97.096  1.00 0.00 ? 2242 THR B CA 4  
ATOM 8107   C CA . ASP B 1 2243 ? 207.614 85.211  98.151  1.00 0.00 ? 2243 ASP B CA 4  
ATOM 8108   C CA . SER B 1 2244 ? 204.475 86.757  96.684  1.00 0.00 ? 2244 SER B CA 4  
ATOM 8109   C CA . VAL B 1 2245 ? 204.650 90.353  95.470  1.00 0.00 ? 2245 VAL B CA 4  
ATOM 8110   C CA . THR B 1 2246 ? 202.428 92.412  97.772  1.00 0.00 ? 2246 THR B CA 4  
ATOM 8111   C CA . CYS B 1 2247 ? 203.457 95.962  96.817  1.00 0.00 ? 2247 CYS B CA 4  
ATOM 8112   C CA . LEU B 1 2248 ? 204.448 97.889  93.681  1.00 0.00 ? 2248 LEU B CA 4  
ATOM 8113   C CA . TYR B 1 2249 ? 205.299 101.592 93.783  1.00 0.00 ? 2249 TYR B CA 4  
ATOM 8114   C CA . CYS B 1 2250 ? 206.988 103.903 91.270  1.00 0.00 ? 2250 CYS B CA 4  
ATOM 8115   C CA . ASN B 1 2251 ? 209.338 106.406 92.901  1.00 0.00 ? 2251 ASN B CA 4  
ATOM 8116   C CA . SER B 1 2252 ? 211.715 109.204 91.926  1.00 0.00 ? 2252 SER B CA 4  
ATOM 8117   C CA . PHE B 1 2253 ? 214.882 110.641 93.466  1.00 0.00 ? 2253 PHE B CA 4  
ATOM 8118   C CA . GLN B 1 2259 ? 216.141 112.628 89.153  1.00 0.00 ? 2254 GLN B CA 4  
ATOM 8119   C CA . LYS B 1 2260 ? 216.189 108.825 88.924  1.00 0.00 ? 2260 LYS B CA 4  
ATOM 8120   C CA . ASN B 1 2261 ? 213.021 106.724 88.791  1.00 0.00 ? 2261 ASN B CA 4  
ATOM 8121   C CA . PHE B 1 2262 ? 212.664 103.362 90.517  1.00 0.00 ? 2262 PHE B CA 4  
ATOM 8122   C CA . LEU B 1 2263 ? 210.281 100.425 90.893  1.00 0.00 ? 2263 LEU B CA 4  
ATOM 8123   C CA . LEU B 1 2264 ? 209.871 99.440  94.547  1.00 0.00 ? 2264 LEU B CA 4  
ATOM 8124   C CA . VAL B 1 2265 ? 208.654 95.870  95.086  1.00 0.00 ? 2265 VAL B CA 4  
ATOM 8125   C CA . GLY B 1 2266 ? 207.371 94.808  98.504  1.00 0.00 ? 2266 GLY B CA 4  
ATOM 8126   C CA . THR B 1 2267 ? 207.126 91.067  99.128  1.00 0.00 ? 2267 THR B CA 4  
ATOM 8127   C CA . ALA B 1 2268 ? 205.266 88.853  101.586 1.00 0.00 ? 2268 ALA B CA 4  
ATOM 8128   C CA . ASP B 1 2269 ? 208.467 87.802  103.407 1.00 0.00 ? 2269 ASP B CA 4  
ATOM 8129   C CA . GLY B 1 2270 ? 209.296 91.331  104.569 1.00 0.00 ? 2270 GLY B CA 4  
ATOM 8130   C CA . LYS B 1 2271 ? 211.675 92.292  101.757 1.00 0.00 ? 2271 LYS B CA 4  
ATOM 8131   C CA . LEU B 1 2272 ? 211.745 95.353  99.492  1.00 0.00 ? 2272 LEU B CA 4  
ATOM 8132   C CA . ALA B 1 2273 ? 213.492 95.058  96.120  1.00 0.00 ? 2273 ALA B CA 4  
ATOM 8133   C CA . ILE B 1 2274 ? 214.518 98.133  94.120  1.00 0.00 ? 2274 ILE B CA 4  
ATOM 8134   C CA . PHE B 1 2275 ? 214.661 98.117  90.322  1.00 0.00 ? 2275 PHE B CA 4  
ATOM 8135   C CA . GLU B 1 2276 ? 216.001 101.036 88.340  1.00 0.00 ? 2276 GLU B CA 4  
ATOM 8136   C CA . ASP B 1 2277 ? 213.789 102.765 85.777  1.00 0.00 ? 2277 ASP B CA 4  
ATOM 8137   C CA . LYS B 1 2278 ? 215.635 101.392 82.741  1.00 0.00 ? 2278 LYS B CA 4  
ATOM 8138   C CA . THR B 1 2279 ? 216.386 97.874  84.024  1.00 0.00 ? 2279 THR B CA 4  
ATOM 8139   C CA . VAL B 1 2280 ? 212.659 97.045  83.928  1.00 0.00 ? 2280 VAL B CA 4  
ATOM 8140   C CA . LYS B 1 2281 ? 212.954 96.606  80.144  1.00 0.00 ? 2281 LYS B CA 4  
ATOM 8141   C CA . LEU B 1 2282 ? 215.438 93.731  80.502  1.00 0.00 ? 2282 LEU B CA 4  
ATOM 8142   C CA . LYS B 1 2283 ? 214.472 90.067  80.722  1.00 0.00 ? 2283 LYS B CA 4  
ATOM 8143   C CA . GLY B 1 2284 ? 215.600 88.474  83.971  1.00 0.00 ? 2284 GLY B CA 4  
ATOM 8144   C CA . ALA B 1 2285 ? 216.816 91.780  85.400  1.00 0.00 ? 2285 ALA B CA 4  
ATOM 8145   C CA . ALA B 1 2286 ? 217.958 91.675  89.026  1.00 0.00 ? 2286 ALA B CA 4  
ATOM 8146   C CA . PRO B 1 2287 ? 217.180 94.419  91.564  1.00 0.00 ? 2287 PRO B CA 4  
ATOM 8147   C CA . LEU B 1 2288 ? 219.740 97.036  92.513  1.00 0.00 ? 2288 LEU B CA 4  
ATOM 8148   C CA . LYS B 1 2289 ? 219.185 96.235  96.194  1.00 0.00 ? 2289 LYS B CA 4  
ATOM 8149   C CA . ILE B 1 2290 ? 216.993 94.070  98.426  1.00 0.00 ? 2290 ILE B CA 4  
ATOM 8150   C CA . LEU B 1 2291 ? 216.119 95.267  101.934 1.00 0.00 ? 2291 LEU B CA 4  
ATOM 8151   C CA . ASN B 1 2292 ? 215.292 92.576  104.500 1.00 0.00 ? 2292 ASN B CA 4  
ATOM 8152   C CA . ILE B 1 2293 ? 212.927 94.576  106.707 1.00 0.00 ? 2293 ILE B CA 4  
ATOM 8153   C CA . GLY B 1 2294 ? 210.940 91.685  108.233 1.00 0.00 ? 2294 GLY B CA 4  
ATOM 8154   C CA . ASN B 1 2295 ? 210.245 87.977  107.918 1.00 0.00 ? 2295 ASN B CA 4  
ATOM 8155   C CA . VAL B 1 2296 ? 207.784 85.542  106.347 1.00 0.00 ? 2296 VAL B CA 4  
ATOM 8156   C CA . SER B 1 2297 ? 205.211 86.685  108.926 1.00 0.00 ? 2297 SER B CA 4  
ATOM 8157   C CA . THR B 1 2298 ? 205.513 90.456  108.243 1.00 0.00 ? 2298 THR B CA 4  
ATOM 8158   C CA . PRO B 1 2299 ? 204.471 91.248  104.656 1.00 0.00 ? 2299 PRO B CA 4  
ATOM 8159   C CA . LEU B 1 2300 ? 205.448 94.578  103.115 1.00 0.00 ? 2300 LEU B CA 4  
ATOM 8160   C CA . MET B 1 2301 ? 202.051 95.799  101.946 1.00 0.00 ? 2301 MET B CA 4  
ATOM 8161   C CA . CYS B 1 2302 ? 202.146 99.578  101.445 1.00 0.00 ? 2302 CYS B CA 4  
ATOM 8162   C CA . LEU B 1 2303 ? 204.439 102.395 100.317 1.00 0.00 ? 2303 LEU B CA 4  
ATOM 8163   C CA . SER B 1 2304 ? 203.927 106.153 100.183 1.00 0.00 ? 2304 SER B CA 4  
ATOM 8164   C CA . GLU B 1 2305 ? 205.848 109.357 99.551  1.00 0.00 ? 2305 GLU B CA 4  
ATOM 8165   C CA . VAL B 1 2314 ? 211.787 110.295 101.447 1.00 0.00 ? 2314 VAL B CA 4  
ATOM 8166   C CA . MET B 1 2315 ? 209.704 107.107 101.442 1.00 0.00 ? 2315 MET B CA 4  
ATOM 8167   C CA . TRP B 1 2316 ? 207.596 105.602 104.220 1.00 0.00 ? 2316 TRP B CA 4  
ATOM 8168   C CA . GLY B 1 2317 ? 206.230 102.075 104.283 1.00 0.00 ? 2317 GLY B CA 4  
ATOM 8169   C CA . GLY B 1 2318 ? 204.506 99.463  106.374 1.00 0.00 ? 2318 GLY B CA 4  
ATOM 8170   C CA . CYS B 1 2319 ? 205.907 96.033  107.247 1.00 0.00 ? 2319 CYS B CA 4  
ATOM 8171   C CA . GLY B 1 2320 ? 203.873 94.110  109.794 1.00 0.00 ? 2320 GLY B CA 4  
ATOM 8172   C CA . THR B 1 2321 ? 203.350 96.460  112.722 1.00 0.00 ? 2321 THR B CA 4  
ATOM 8173   C CA . LYS B 1 2322 ? 206.441 98.543  111.869 1.00 0.00 ? 2322 LYS B CA 4  
ATOM 8174   C CA . ILE B 1 2323 ? 206.660 101.779 109.894 1.00 0.00 ? 2323 ILE B CA 4  
ATOM 8175   C CA . PHE B 1 2324 ? 209.932 102.228 108.023 1.00 0.00 ? 2324 PHE B CA 4  
ATOM 8176   C CA . SER B 1 2325 ? 211.585 105.111 106.196 1.00 0.00 ? 2325 SER B CA 4  
ATOM 8177   C CA . PHE B 1 2326 ? 214.319 105.349 103.582 1.00 0.00 ? 2326 PHE B CA 4  
ATOM 8178   C CA . SER B 1 2327 ? 215.702 107.854 101.100 1.00 0.00 ? 2327 SER B CA 4  
ATOM 8179   C CA . ASN B 1 2328 ? 218.507 107.985 98.540  1.00 0.00 ? 2328 ASN B CA 4  
ATOM 8180   C CA . ASP B 1 2329 ? 220.849 105.165 99.591  1.00 0.00 ? 2329 ASP B CA 4  
ATOM 8181   C CA . PHE B 1 2330 ? 218.037 102.706 100.487 1.00 0.00 ? 2330 PHE B CA 4  
ATOM 8182   C CA . THR B 1 2331 ? 219.287 102.326 104.043 1.00 0.00 ? 2331 THR B CA 4  
ATOM 8183   C CA . ILE B 1 2332 ? 216.436 102.073 106.535 1.00 0.00 ? 2332 ILE B CA 4  
ATOM 8184   C CA . GLN B 1 2333 ? 216.514 105.248 108.608 1.00 0.00 ? 2333 GLN B CA 4  
ATOM 8185   C CA . LYS B 1 2334 ? 213.405 105.321 110.805 1.00 0.00 ? 2334 LYS B CA 4  
ATOM 8186   C CA . LEU B 1 2335 ? 211.758 102.181 112.186 1.00 0.00 ? 2335 LEU B CA 4  
ATOM 8187   C CA . ILE B 1 2336 ? 208.743 102.677 114.472 1.00 0.00 ? 2336 ILE B CA 4  
ATOM 8188   C CA . GLU B 1 2337 ? 206.975 99.862  116.319 1.00 0.00 ? 2337 GLU B CA 4  
ATOM 8189   C CA . THR B 1 2338 ? 203.235 100.577 116.380 1.00 0.00 ? 2338 THR B CA 4  
ATOM 8190   C CA . ARG B 1 2339 ? 202.093 97.417  118.188 1.00 0.00 ? 2339 ARG B CA 4  
ATOM 8191   C CA . THR B 1 2340 ? 202.261 99.100  121.612 1.00 0.00 ? 2340 THR B CA 4  
ATOM 8192   C CA . SER B 1 2341 ? 201.137 102.463 122.992 1.00 0.00 ? 2341 SER B CA 4  
ATOM 8193   C CA . GLN B 1 2342 ? 199.673 103.282 126.401 1.00 0.00 ? 2342 GLN B CA 4  
ATOM 8194   C CA . LEU B 1 2343 ? 197.198 105.789 124.930 1.00 0.00 ? 2343 LEU B CA 4  
ATOM 8195   C CA . PHE B 1 2344 ? 195.606 103.108 122.733 1.00 0.00 ? 2344 PHE B CA 4  
ATOM 8196   C CA . SER B 1 2345 ? 191.830 103.323 123.016 1.00 0.00 ? 2345 SER B CA 4  
ATOM 8197   C CA . TYR B 1 2346 ? 191.739 99.565  122.351 1.00 0.00 ? 2346 TYR B CA 4  
ATOM 8198   C CA . ALA B 1 2347 ? 194.810 97.345  122.243 1.00 0.00 ? 2347 ALA B CA 4  
ATOM 8199   C CA . ALA B 1 2348 ? 193.795 94.431  120.003 1.00 0.00 ? 2348 ALA B CA 4  
ATOM 8200   C CA . PHE B 1 2349 ? 193.323 96.690  116.967 1.00 0.00 ? 2349 PHE B CA 4  
ATOM 8201   C CA . SER B 1 2350 ? 196.896 97.994  117.087 1.00 0.00 ? 2350 SER B CA 4  
ATOM 8202   C CA . ASP B 1 2351 ? 198.287 94.439  116.997 1.00 0.00 ? 2351 ASP B CA 4  
ATOM 8203   C CA . SER B 1 2352 ? 197.621 94.001  113.292 1.00 0.00 ? 2352 SER B CA 4  
ATOM 8204   C CA . ASN B 1 2353 ? 199.511 94.406  110.038 1.00 0.00 ? 2353 ASN B CA 4  
ATOM 8205   C CA . ILE B 1 2354 ? 199.522 97.930  108.626 1.00 0.00 ? 2354 ILE B CA 4  
ATOM 8206   C CA . ILE B 1 2355 ? 197.470 97.989  105.418 1.00 0.00 ? 2355 ILE B CA 4  
ATOM 8207   C CA . THR B 1 2356 ? 198.081 101.577 104.253 1.00 0.00 ? 2356 THR B CA 4  
ATOM 8208   C CA . VAL B 1 2357 ? 200.220 104.618 105.069 1.00 0.00 ? 2357 VAL B CA 4  
ATOM 8209   C CA . VAL B 1 2358 ? 199.460 108.203 104.028 1.00 0.00 ? 2358 VAL B CA 4  
ATOM 8210   C CA . VAL B 1 2359 ? 202.156 110.806 104.708 1.00 0.00 ? 2359 VAL B CA 4  
ATOM 8211   C CA . ASP B 1 2360 ? 201.381 114.475 105.332 1.00 0.00 ? 2360 ASP B CA 4  
ATOM 8212   C CA . THR B 1 2361 ? 202.517 116.425 108.392 1.00 0.00 ? 2361 THR B CA 4  
ATOM 8213   C CA . ALA B 1 2362 ? 202.244 113.200 110.403 1.00 0.00 ? 2362 ALA B CA 4  
ATOM 8214   C CA . LEU B 1 2363 ? 201.835 109.511 109.592 1.00 0.00 ? 2363 LEU B CA 4  
ATOM 8215   C CA . TYR B 1 2364 ? 198.241 108.261 109.314 1.00 0.00 ? 2364 TYR B CA 4  
ATOM 8216   C CA . ILE B 1 2365 ? 198.299 104.459 109.329 1.00 0.00 ? 2365 ILE B CA 4  
ATOM 8217   C CA . ALA B 1 2366 ? 195.444 101.965 109.206 1.00 0.00 ? 2366 ALA B CA 4  
ATOM 8218   C CA . LYS B 1 2367 ? 195.652 98.337  110.302 1.00 0.00 ? 2367 LYS B CA 4  
ATOM 8219   C CA . GLN B 1 2368 ? 193.887 95.179  109.180 1.00 0.00 ? 2368 GLN B CA 4  
ATOM 8220   C CA . ASN B 1 2369 ? 190.420 94.687  110.707 1.00 0.00 ? 2369 ASN B CA 4  
ATOM 8221   C CA . SER B 1 2370 ? 190.772 97.887  112.748 1.00 0.00 ? 2370 SER B CA 4  
ATOM 8222   C CA . PRO B 1 2371 ? 188.455 100.936 112.858 1.00 0.00 ? 2371 PRO B CA 4  
ATOM 8223   C CA . VAL B 1 2372 ? 191.158 103.224 114.308 1.00 0.00 ? 2372 VAL B CA 4  
ATOM 8224   C CA . VAL B 1 2373 ? 193.428 105.345 112.123 1.00 0.00 ? 2373 VAL B CA 4  
ATOM 8225   C CA . GLU B 1 2374 ? 196.576 105.831 114.192 1.00 0.00 ? 2374 GLU B CA 4  
ATOM 8226   C CA . VAL B 1 2375 ? 198.539 109.079 113.905 1.00 0.00 ? 2375 VAL B CA 4  
ATOM 8227   C CA . TRP B 1 2376 ? 202.285 108.941 114.590 1.00 0.00 ? 2376 TRP B CA 4  
ATOM 8228   C CA . ASP B 1 2377 ? 204.956 111.646 114.642 1.00 0.00 ? 2377 ASP B CA 4  
ATOM 8229   C CA . LYS B 1 2378 ? 207.904 111.377 112.260 1.00 0.00 ? 2378 LYS B CA 4  
ATOM 8230   C CA . LYS B 1 2379 ? 210.336 113.035 114.677 1.00 0.00 ? 2379 LYS B CA 4  
ATOM 8231   C CA . THR B 1 2380 ? 209.402 111.726 118.132 1.00 0.00 ? 2380 THR B CA 4  
ATOM 8232   C CA . GLU B 1 2381 ? 208.201 108.334 116.792 1.00 0.00 ? 2381 GLU B CA 4  
ATOM 8233   C CA . LYS B 1 2382 ? 205.205 108.293 119.169 1.00 0.00 ? 2382 LYS B CA 4  
ATOM 8234   C CA . LEU B 1 2383 ? 201.434 108.569 118.946 1.00 0.00 ? 2383 LEU B CA 4  
ATOM 8235   C CA . CYS B 1 2384 ? 200.273 111.924 117.638 1.00 0.00 ? 2384 CYS B CA 4  
ATOM 8236   C CA . GLY B 1 2385 ? 196.607 110.997 117.885 1.00 0.00 ? 2385 GLY B CA 4  
ATOM 8237   C CA . LEU B 1 2386 ? 193.769 108.587 117.200 1.00 0.00 ? 2386 LEU B CA 4  
ATOM 8238   C CA . ILE B 1 2387 ? 190.850 108.759 114.768 1.00 0.00 ? 2387 ILE B CA 4  
ATOM 8239   C CA . ASP B 1 2388 ? 188.085 106.297 115.698 1.00 0.00 ? 2388 ASP B CA 4  
ATOM 8240   C CA . CYS B 1 2389 ? 185.842 105.849 112.659 1.00 0.00 ? 2389 CYS B CA 4  
ATOM 8241   C CA . VAL B 1 2390 ? 183.136 104.089 114.705 1.00 0.00 ? 2390 VAL B CA 4  
ATOM 8242   C CA . HIS B 1 2391 ? 182.488 107.297 116.650 1.00 0.00 ? 2391 HIS B CA 4  
ATOM 8243   C CA . PHE B 1 2392 ? 182.576 109.508 113.549 1.00 0.00 ? 2392 PHE B CA 4  
ATOM 8244   C CA . LEU B 1 2393 ? 180.076 107.209 111.833 1.00 0.00 ? 2393 LEU B CA 4  
ATOM 8245   C CA . ARG B 1 2394 ? 177.743 107.089 114.858 1.00 0.00 ? 2394 ARG B CA 4  
ATOM 8246   C CA . GLU B 1 2395 ? 177.033 110.845 114.611 1.00 0.00 ? 2395 GLU B CA 4  
ATOM 8247   C CA . MET B 1 2408 ? 174.753 102.511 114.806 1.00 0.00 ? 2408 MET B CA 4  
ATOM 8248   C CA . SER B 1 2409 ? 175.877 98.913  114.227 1.00 0.00 ? 2409 SER B CA 4  
ATOM 8249   C CA . TYR B 1 2410 ? 178.815 99.923  112.016 1.00 0.00 ? 2410 TYR B CA 4  
ATOM 8250   C CA . SER B 1 2411 ? 182.072 97.995  112.314 1.00 0.00 ? 2411 SER B CA 4  
ATOM 8251   C CA . GLY B 1 2412 ? 183.945 101.039 111.008 1.00 0.00 ? 2412 GLY B CA 4  
ATOM 8252   C CA . ARG B 1 2413 ? 186.704 98.729  109.798 1.00 0.00 ? 2413 ARG B CA 4  
ATOM 8253   C CA . VAL B 1 2414 ? 189.069 100.929 107.799 1.00 0.00 ? 2414 VAL B CA 4  
ATOM 8254   C CA . LYS B 1 2415 ? 189.739 99.719  104.258 1.00 0.00 ? 2415 LYS B CA 4  
ATOM 8255   C CA . THR B 1 2416 ? 191.535 102.592 102.537 1.00 0.00 ? 2416 THR B CA 4  
ATOM 8256   C CA . LEU B 1 2417 ? 193.023 106.058 103.099 1.00 0.00 ? 2417 LEU B CA 4  
ATOM 8257   C CA . CYS B 1 2418 ? 193.508 108.808 100.520 1.00 0.00 ? 2418 CYS B CA 4  
ATOM 8258   C CA . LEU B 1 2419 ? 194.796 112.372 100.820 1.00 0.00 ? 2419 LEU B CA 4  
ATOM 8259   C CA . GLN B 1 2420 ? 192.921 115.219 99.136  1.00 0.00 ? 2420 GLN B CA 4  
ATOM 8260   C CA . LYS B 1 2421 ? 195.145 118.233 98.408  1.00 0.00 ? 2421 LYS B CA 4  
ATOM 8261   C CA . ASN B 1 2422 ? 196.945 119.381 101.558 1.00 0.00 ? 2422 ASN B CA 4  
ATOM 8262   C CA . THR B 1 2423 ? 194.096 119.335 104.086 1.00 0.00 ? 2423 THR B CA 4  
ATOM 8263   C CA . ALA B 1 2424 ? 191.628 116.529 103.527 1.00 0.00 ? 2424 ALA B CA 4  
ATOM 8264   C CA . LEU B 1 2425 ? 191.701 112.802 104.308 1.00 0.00 ? 2425 LEU B CA 4  
ATOM 8265   C CA . TRP B 1 2426 ? 189.284 110.311 102.738 1.00 0.00 ? 2426 TRP B CA 4  
ATOM 8266   C CA . ILE B 1 2427 ? 188.595 107.128 104.723 1.00 0.00 ? 2427 ILE B CA 4  
ATOM 8267   C CA . GLY B 1 2428 ? 186.813 104.198 103.063 1.00 0.00 ? 2428 GLY B CA 4  
ATOM 8268   C CA . THR B 1 2429 ? 185.442 101.847 105.700 1.00 0.00 ? 2429 THR B CA 4  
ATOM 8269   C CA . GLY B 1 2430 ? 184.420 98.164  105.371 1.00 0.00 ? 2430 GLY B CA 4  
ATOM 8270   C CA . GLY B 1 2431 ? 180.808 99.093  104.837 1.00 0.00 ? 2431 GLY B CA 4  
ATOM 8271   C CA . GLY B 1 2432 ? 179.908 101.373 101.987 1.00 0.00 ? 2432 GLY B CA 4  
ATOM 8272   C CA . HIS B 1 2433 ? 180.885 104.402 104.041 1.00 0.00 ? 2433 HIS B CA 4  
ATOM 8273   C CA . ILE B 1 2434 ? 183.248 107.191 102.990 1.00 0.00 ? 2434 ILE B CA 4  
ATOM 8274   C CA . LEU B 1 2435 ? 184.452 109.838 105.460 1.00 0.00 ? 2435 LEU B CA 4  
ATOM 8275   C CA . LEU B 1 2436 ? 186.187 113.145 104.711 1.00 0.00 ? 2436 LEU B CA 4  
ATOM 8276   C CA . LEU B 1 2437 ? 188.177 114.636 107.604 1.00 0.00 ? 2437 LEU B CA 4  
ATOM 8277   C CA . ASP B 1 2438 ? 189.993 117.965 107.889 1.00 0.00 ? 2438 ASP B CA 4  
ATOM 8278   C CA . LEU B 1 2439 ? 193.609 117.375 108.990 1.00 0.00 ? 2439 LEU B CA 4  
ATOM 8279   C CA . SER B 1 2440 ? 194.507 120.618 110.779 1.00 0.00 ? 2440 SER B CA 4  
ATOM 8280   C CA . THR B 1 2441 ? 192.431 122.255 113.511 1.00 0.00 ? 2441 THR B CA 4  
ATOM 8281   C CA . ARG B 1 2442 ? 189.185 120.252 113.262 1.00 0.00 ? 2442 ARG B CA 4  
ATOM 8282   C CA . ARG B 1 2443 ? 187.906 116.911 111.959 1.00 0.00 ? 2443 ARG B CA 4  
ATOM 8283   C CA . LEU B 1 2444 ? 184.788 115.844 110.048 1.00 0.00 ? 2444 LEU B CA 4  
ATOM 8284   C CA . ILE B 1 2445 ? 184.003 117.629 106.778 1.00 0.00 ? 2445 ILE B CA 4  
ATOM 8285   C CA . ARG B 1 2446 ? 181.804 115.237 104.798 1.00 0.00 ? 2446 ARG B CA 4  
ATOM 8286   C CA . VAL B 1 2447 ? 180.214 111.803 105.207 1.00 0.00 ? 2447 VAL B CA 4  
ATOM 8287   C CA . ILE B 1 2448 ? 178.509 109.641 102.588 1.00 0.00 ? 2448 ILE B CA 4  
ATOM 8288   C CA . TYR B 1 2449 ? 176.753 106.534 103.932 1.00 0.00 ? 2449 TYR B CA 4  
ATOM 8289   C CA . ASN B 1 2450 ? 176.013 103.402 101.893 1.00 0.00 ? 2450 ASN B CA 4  
ATOM 8290   C CA . PHE B 1 2451 ? 178.088 104.698 98.984  1.00 0.00 ? 2451 PHE B CA 4  
ATOM 8291   C CA . CYS B 1 2452 ? 178.418 100.977 98.233  1.00 0.00 ? 2452 CYS B CA 4  
ATOM 8292   C CA . ASN B 1 2453 ? 178.441 97.744  100.232 1.00 0.00 ? 2453 ASN B CA 4  
ATOM 8293   C CA . SER B 1 2454 ? 182.224 97.789  100.791 1.00 0.00 ? 2454 SER B CA 4  
ATOM 8294   C CA . VAL B 1 2455 ? 184.866 100.329 99.708  1.00 0.00 ? 2455 VAL B CA 4  
ATOM 8295   C CA . ARG B 1 2456 ? 187.904 98.381  98.506  1.00 0.00 ? 2456 ARG B CA 4  
ATOM 8296   C CA . VAL B 1 2457 ? 190.186 100.872 96.721  1.00 0.00 ? 2457 VAL B CA 4  
ATOM 8297   C CA . MET B 1 2458 ? 190.348 104.669 96.726  1.00 0.00 ? 2458 MET B CA 4  
ATOM 8298   C CA . MET B 1 2459 ? 192.980 106.648 94.824  1.00 0.00 ? 2459 MET B CA 4  
ATOM 8299   C CA . THR B 1 2460 ? 193.780 109.913 93.052  1.00 0.00 ? 2460 THR B CA 4  
ATOM 8300   C CA . ALA B 1 2461 ? 194.867 110.075 89.406  1.00 0.00 ? 2461 ALA B CA 4  
ATOM 8301   C CA . GLN B 1 2462 ? 195.698 112.686 86.779  1.00 0.00 ? 2462 GLN B CA 4  
ATOM 8302   C CA . ASN B 1 2468 ? 192.803 115.818 89.520  1.00 0.00 ? 2468 ASN B CA 4  
ATOM 8303   C CA . VAL B 1 2469 ? 190.438 112.833 89.485  1.00 0.00 ? 2469 VAL B CA 4  
ATOM 8304   C CA . MET B 1 2470 ? 189.043 110.549 92.198  1.00 0.00 ? 2470 MET B CA 4  
ATOM 8305   C CA . LEU B 1 2471 ? 188.573 106.790 91.733  1.00 0.00 ? 2471 LEU B CA 4  
ATOM 8306   C CA . VAL B 1 2472 ? 186.703 104.565 94.207  1.00 0.00 ? 2472 VAL B CA 4  
ATOM 8307   C CA . LEU B 1 2473 ? 186.388 100.834 93.530  1.00 0.00 ? 2473 LEU B CA 4  
ATOM 8308   C CA . GLY B 1 2474 ? 183.729 99.194  95.687  1.00 0.00 ? 2474 GLY B CA 4  
ATOM 8309   C CA . TYR B 1 2475 ? 181.998 95.841  95.467  1.00 0.00 ? 2475 TYR B CA 4  
ATOM 8310   C CA . ASN B 1 2476 ? 178.457 94.609  96.210  1.00 0.00 ? 2476 ASN B CA 4  
ATOM 8311   C CA . ARG B 1 2477 ? 177.467 91.045  96.996  1.00 0.00 ? 2477 ARG B CA 4  
ATOM 8312   C CA . GLU B 1 2488 ? 177.282 86.694  93.149  1.00 0.00 ? 2497 GLU B CA 4  
ATOM 8313   C CA . ILE B 1 2489 ? 179.551 89.757  93.179  1.00 0.00 ? 2498 ILE B CA 4  
ATOM 8314   C CA . GLN B 1 2490 ? 179.213 93.077  91.322  1.00 0.00 ? 2499 GLN B CA 4  
ATOM 8315   C CA . SER B 1 2491 ? 182.246 95.363  91.334  1.00 0.00 ? 2500 SER B CA 4  
ATOM 8316   C CA . CYS B 1 2492 ? 181.784 99.049  90.525  1.00 0.00 ? 2501 CYS B CA 4  
ATOM 8317   C CA . LEU B 1 2493 ? 184.188 101.915 89.842  1.00 0.00 ? 2502 LEU B CA 4  
ATOM 8318   C CA . THR B 1 2494 ? 182.977 105.400 90.800  1.00 0.00 ? 2503 THR B CA 4  
ATOM 8319   C CA . VAL B 1 2495 ? 184.815 108.467 89.514  1.00 0.00 ? 2504 VAL B CA 4  
ATOM 8320   C CA . TRP B 1 2496 ? 184.646 112.248 89.917  1.00 0.00 ? 2505 TRP B CA 4  
ATOM 8321   C CA . TYR A 1 1332 ? 99.930  154.332 171.091 1.00 0.00 ? 1332 TYR A CA 5  
ATOM 8322   C CA . ASN A 1 1333 ? 102.069 151.287 172.133 1.00 0.00 ? 1333 ASN A CA 5  
ATOM 8323   C CA . ARG A 1 1334 ? 102.065 149.412 168.860 1.00 0.00 ? 1334 ARG A CA 5  
ATOM 8324   C CA . MET A 1 1335 ? 104.808 148.595 166.322 1.00 0.00 ? 1335 MET A CA 5  
ATOM 8325   C CA . LYS A 1 1336 ? 105.303 146.775 163.001 1.00 0.00 ? 1336 LYS A CA 5  
ATOM 8326   C CA . LEU A 1 1337 ? 108.060 144.163 162.768 1.00 0.00 ? 1337 LEU A CA 5  
ATOM 8327   C CA . MET A 1 1338 ? 108.840 143.478 159.126 1.00 0.00 ? 1338 MET A CA 5  
ATOM 8328   C CA . ILE A 1 1339 ? 110.678 140.196 158.552 1.00 0.00 ? 1339 ILE A CA 5  
ATOM 8329   C CA . VAL A 1 1340 ? 113.061 140.650 155.600 1.00 0.00 ? 1340 VAL A CA 5  
ATOM 8330   C CA . GLY A 1 1341 ? 115.199 138.018 153.855 1.00 0.00 ? 1341 GLY A CA 5  
ATOM 8331   C CA . ASN A 1 1342 ? 115.387 135.381 151.135 1.00 0.00 ? 1342 ASN A CA 5  
ATOM 8332   C CA . THR A 1 1343 ? 112.638 132.681 151.421 1.00 0.00 ? 1343 THR A CA 5  
ATOM 8333   C CA . GLY A 1 1344 ? 113.648 130.370 154.285 1.00 0.00 ? 1344 GLY A CA 5  
ATOM 8334   C CA . SER A 1 1345 ? 116.708 131.982 155.848 1.00 0.00 ? 1345 SER A CA 5  
ATOM 8335   C CA . GLY A 1 1346 ? 114.801 130.896 158.997 1.00 0.00 ? 1346 GLY A CA 5  
ATOM 8336   C CA . LYS A 1 1347 ? 112.003 133.495 159.225 1.00 0.00 ? 1347 LYS A CA 5  
ATOM 8337   C CA . THR A 1 1348 ? 109.583 130.944 160.786 1.00 0.00 ? 1348 THR A CA 5  
ATOM 8338   C CA . THR A 1 1349 ? 112.473 129.466 162.863 1.00 0.00 ? 1349 THR A CA 5  
ATOM 8339   C CA . LEU A 1 1350 ? 113.360 132.861 164.333 1.00 0.00 ? 1350 LEU A CA 5  
ATOM 8340   C CA . LEU A 1 1351 ? 109.651 133.569 165.044 1.00 0.00 ? 1351 LEU A CA 5  
ATOM 8341   C CA . GLN A 1 1352 ? 109.082 130.201 166.810 1.00 0.00 ? 1352 GLN A CA 5  
ATOM 8342   C CA . GLN A 1 1353 ? 112.062 130.961 169.056 1.00 0.00 ? 1353 GLN A CA 5  
ATOM 8343   C CA . LEU A 1 1354 ? 111.066 134.565 169.965 1.00 0.00 ? 1354 LEU A CA 5  
ATOM 8344   C CA . MET A 1 1355 ? 107.437 133.893 170.680 1.00 0.00 ? 1355 MET A CA 5  
ATOM 8345   C CA . LYS A 1 1356 ? 107.706 131.210 173.473 1.00 0.00 ? 1356 LYS A CA 5  
ATOM 8346   C CA . THR A 1 1357 ? 103.898 130.889 173.928 1.00 0.00 ? 1357 THR A CA 5  
ATOM 8347   C CA . LYS A 1 1358 ? 101.875 127.675 174.558 1.00 0.00 ? 1358 LYS A CA 5  
ATOM 8348   C CA . LYS A 1 1359 ? 102.133 127.097 170.782 1.00 0.00 ? 1359 LYS A CA 5  
ATOM 8349   C CA . SER A 1 1360 ? 98.822  128.989 170.381 1.00 0.00 ? 1360 SER A CA 5  
ATOM 8350   C CA . ASP A 1 1361 ? 98.845  129.852 166.652 1.00 0.00 ? 1361 ASP A CA 5  
ATOM 8351   C CA . LEU A 1 1362 ? 102.630 130.140 167.130 1.00 0.00 ? 1362 LEU A CA 5  
ATOM 8352   C CA . GLY A 1 1363 ? 103.353 127.795 164.251 1.00 0.00 ? 1363 GLY A CA 5  
ATOM 8353   C CA . MET A 1 1364 ? 103.062 128.884 160.610 1.00 0.00 ? 1364 MET A CA 5  
ATOM 8354   C CA . GLN A 1 1365 ? 105.848 128.459 158.055 1.00 0.00 ? 1365 GLN A CA 5  
ATOM 8355   C CA . SER A 1 1366 ? 105.297 130.310 154.768 1.00 0.00 ? 1366 SER A CA 5  
ATOM 8356   C CA . ALA A 1 1367 ? 108.851 131.374 154.080 1.00 0.00 ? 1367 ALA A CA 5  
ATOM 8357   C CA . THR A 1 1368 ? 108.582 131.528 150.208 1.00 0.00 ? 1368 THR A CA 5  
ATOM 8358   C CA . VAL A 1 1369 ? 106.082 133.820 148.385 1.00 0.00 ? 1369 VAL A CA 5  
ATOM 8359   C CA . GLY A 1 1370 ? 103.507 133.964 151.218 1.00 0.00 ? 1370 GLY A CA 5  
ATOM 8360   C CA . ILE A 1 1371 ? 101.806 136.470 153.539 1.00 0.00 ? 1371 ILE A CA 5  
ATOM 8361   C CA . ASP A 1 1372 ? 100.813 136.429 157.240 1.00 0.00 ? 1372 ASP A CA 5  
ATOM 8362   C CA . VAL A 1 1373 ? 100.612 138.515 160.448 1.00 0.00 ? 1373 VAL A CA 5  
ATOM 8363   C CA . LYS A 1 1374 ? 101.323 137.311 163.971 1.00 0.00 ? 1374 LYS A CA 5  
ATOM 8364   C CA . ASP A 1 1375 ? 100.524 139.847 166.664 1.00 0.00 ? 1375 ASP A CA 5  
ATOM 8365   C CA . TRP A 1 1376 ? 101.958 139.169 170.143 1.00 0.00 ? 1376 TRP A CA 5  
ATOM 8366   C CA . PRO A 1 1377 ? 102.381 141.427 173.214 1.00 0.00 ? 1377 PRO A CA 5  
ATOM 8367   C CA . ILE A 1 1378 ? 106.178 140.885 173.712 1.00 0.00 ? 1378 ILE A CA 5  
ATOM 8368   C CA . GLN A 1 1379 ? 106.930 142.996 176.687 1.00 0.00 ? 1379 GLN A CA 5  
ATOM 8369   C CA . ILE A 1 1380 ? 108.764 143.685 179.927 1.00 0.00 ? 1380 ILE A CA 5  
ATOM 8370   C CA . ARG A 1 1381 ? 106.585 143.479 183.017 1.00 0.00 ? 1381 ARG A CA 5  
ATOM 8371   C CA . ASP A 1 1382 ? 106.546 146.632 185.214 1.00 0.00 ? 1382 ASP A CA 5  
ATOM 8372   C CA . LYS A 1 1383 ? 108.188 148.898 182.584 1.00 0.00 ? 1383 LYS A CA 5  
ATOM 8373   C CA . ARG A 1 1384 ? 106.957 151.187 179.731 1.00 0.00 ? 1384 ARG A CA 5  
ATOM 8374   C CA . LYS A 1 1385 ? 107.058 148.173 177.460 1.00 0.00 ? 1385 LYS A CA 5  
ATOM 8375   C CA . ARG A 1 1386 ? 104.252 146.499 179.614 1.00 0.00 ? 1386 ARG A CA 5  
ATOM 8376   C CA . ASP A 1 1387 ? 101.437 147.583 177.234 1.00 0.00 ? 1387 ASP A CA 5  
ATOM 8377   C CA . LEU A 1 1388 ? 103.404 147.162 173.921 1.00 0.00 ? 1388 LEU A CA 5  
ATOM 8378   C CA . VAL A 1 1389 ? 101.925 145.241 170.976 1.00 0.00 ? 1389 VAL A CA 5  
ATOM 8379   C CA . LEU A 1 1390 ? 104.253 143.786 168.310 1.00 0.00 ? 1390 LEU A CA 5  
ATOM 8380   C CA . ASN A 1 1391 ? 102.842 143.006 164.869 1.00 0.00 ? 1391 ASN A CA 5  
ATOM 8381   C CA . VAL A 1 1392 ? 105.077 140.601 162.920 1.00 0.00 ? 1392 VAL A CA 5  
ATOM 8382   C CA . TRP A 1 1393 ? 104.524 140.967 159.182 1.00 0.00 ? 1393 TRP A CA 5  
ATOM 8383   C CA . ASP A 1 1394 ? 105.948 138.976 156.336 1.00 0.00 ? 1394 ASP A CA 5  
ATOM 8384   C CA . PHE A 1 1395 ? 105.121 140.181 152.799 1.00 0.00 ? 1395 PHE A CA 5  
ATOM 8385   C CA . ALA A 1 1396 ? 107.707 137.913 151.102 1.00 0.00 ? 1396 ALA A CA 5  
ATOM 8386   C CA . GLY A 1 1397 ? 109.580 140.678 149.208 1.00 0.00 ? 1397 GLY A CA 5  
ATOM 8387   C CA . ARG A 1 1398 ? 106.456 142.177 147.620 1.00 0.00 ? 1398 ARG A CA 5  
ATOM 8388   C CA . GLU A 1 1399 ? 105.763 145.308 149.662 1.00 0.00 ? 1399 GLU A CA 5  
ATOM 8389   C CA . GLU A 1 1400 ? 102.024 145.539 148.770 1.00 0.00 ? 1400 GLU A CA 5  
ATOM 8390   C CA . PHE A 1 1401 ? 101.172 148.474 151.109 1.00 0.00 ? 1401 PHE A CA 5  
ATOM 8391   C CA . TYR A 1 1402 ? 103.892 150.817 149.675 1.00 0.00 ? 1402 TYR A CA 5  
ATOM 8392   C CA . SER A 1 1403 ? 101.946 152.833 147.032 1.00 0.00 ? 1403 SER A CA 5  
ATOM 8393   C CA . THR A 1 1404 ? 98.795  153.685 149.026 1.00 0.00 ? 1404 THR A CA 5  
ATOM 8394   C CA . HIS A 1 1405 ? 100.152 153.594 152.597 1.00 0.00 ? 1405 HIS A CA 5  
ATOM 8395   C CA . PRO A 1 1406 ? 103.712 155.192 152.638 1.00 0.00 ? 1406 PRO A CA 5  
ATOM 8396   C CA . HIS A 1 1407 ? 103.828 155.544 156.445 1.00 0.00 ? 1407 HIS A CA 5  
ATOM 8397   C CA . PHE A 1 1408 ? 103.068 151.827 157.002 1.00 0.00 ? 1408 PHE A CA 5  
ATOM 8398   C CA . MET A 1 1409 ? 106.623 151.155 155.773 1.00 0.00 ? 1409 MET A CA 5  
ATOM 8399   C CA . THR A 1 1410 ? 108.410 154.417 156.728 1.00 0.00 ? 1410 THR A CA 5  
ATOM 8400   C CA . GLN A 1 1411 ? 106.949 155.008 160.207 1.00 0.00 ? 1411 GLN A CA 5  
ATOM 8401   C CA . ARG A 1 1412 ? 105.862 152.715 163.054 1.00 0.00 ? 1412 ARG A CA 5  
ATOM 8402   C CA . ALA A 1 1413 ? 108.250 150.036 161.832 1.00 0.00 ? 1413 ALA A CA 5  
ATOM 8403   C CA . LEU A 1 1414 ? 111.244 147.837 162.596 1.00 0.00 ? 1414 LEU A CA 5  
ATOM 8404   C CA . TYR A 1 1415 ? 112.961 145.847 159.864 1.00 0.00 ? 1415 TYR A CA 5  
ATOM 8405   C CA . LEU A 1 1416 ? 114.456 142.500 160.878 1.00 0.00 ? 1416 LEU A CA 5  
ATOM 8406   C CA . ALA A 1 1417 ? 116.886 141.198 158.314 1.00 0.00 ? 1417 ALA A CA 5  
ATOM 8407   C CA . VAL A 1 1418 ? 117.301 137.431 158.487 1.00 0.00 ? 1418 VAL A CA 5  
ATOM 8408   C CA . TYR A 1 1419 ? 120.527 136.135 156.988 1.00 0.00 ? 1419 TYR A CA 5  
ATOM 8409   C CA . ASP A 1 1420 ? 121.448 132.521 156.951 1.00 0.00 ? 1420 ASP A CA 5  
ATOM 8410   C CA . LEU A 1 1421 ? 125.126 133.458 156.716 1.00 0.00 ? 1421 LEU A CA 5  
ATOM 8411   C CA . SER A 1 1422 ? 126.221 130.013 155.412 1.00 0.00 ? 1422 SER A CA 5  
ATOM 8412   C CA . LYS A 1 1423 ? 123.502 129.911 152.714 1.00 0.00 ? 1423 LYS A CA 5  
ATOM 8413   C CA . GLY A 1 1424 ? 121.657 133.265 152.220 1.00 0.00 ? 1424 GLY A CA 5  
ATOM 8414   C CA . GLN A 1 1425 ? 124.910 135.260 152.452 1.00 0.00 ? 1425 GLN A CA 5  
ATOM 8415   C CA . ALA A 1 1426 ? 127.288 132.561 151.101 1.00 0.00 ? 1426 ALA A CA 5  
ATOM 8416   C CA . GLU A 1 1427 ? 125.281 130.981 148.178 1.00 0.00 ? 1427 GLU A CA 5  
ATOM 8417   C CA . VAL A 1 1428 ? 123.539 134.085 146.760 1.00 0.00 ? 1428 VAL A CA 5  
ATOM 8418   C CA . ASP A 1 1429 ? 125.071 137.182 148.535 1.00 0.00 ? 1429 ASP A CA 5  
ATOM 8419   C CA . ALA A 1 1430 ? 121.572 138.598 148.956 1.00 0.00 ? 1430 ALA A CA 5  
ATOM 8420   C CA . MET A 1 1431 ? 122.644 140.713 151.935 1.00 0.00 ? 1431 MET A CA 5  
ATOM 8421   C CA . LYS A 1 1432 ? 123.450 143.750 149.741 1.00 0.00 ? 1432 LYS A CA 5  
ATOM 8422   C CA . PRO A 1 1433 ? 120.028 143.576 147.884 1.00 0.00 ? 1433 PRO A CA 5  
ATOM 8423   C CA . TRP A 1 1434 ? 117.978 143.133 151.100 1.00 0.00 ? 1434 TRP A CA 5  
ATOM 8424   C CA . LEU A 1 1435 ? 119.803 145.945 152.892 1.00 0.00 ? 1435 LEU A CA 5  
ATOM 8425   C CA . PHE A 1 1436 ? 119.036 148.379 149.996 1.00 0.00 ? 1436 PHE A CA 5  
ATOM 8426   C CA . ASN A 1 1437 ? 115.418 147.016 149.929 1.00 0.00 ? 1437 ASN A CA 5  
ATOM 8427   C CA . ILE A 1 1438 ? 115.072 147.983 153.632 1.00 0.00 ? 1438 ILE A CA 5  
ATOM 8428   C CA . LYS A 1 1439 ? 116.597 151.469 152.958 1.00 0.00 ? 1439 LYS A CA 5  
ATOM 8429   C CA . ALA A 1 1440 ? 114.237 152.343 150.056 1.00 0.00 ? 1440 ALA A CA 5  
ATOM 8430   C CA . ARG A 1 1441 ? 110.939 150.907 151.403 1.00 0.00 ? 1441 ARG A CA 5  
ATOM 8431   C CA . ALA A 1 1442 ? 111.492 152.007 154.935 1.00 0.00 ? 1442 ALA A CA 5  
ATOM 8432   C CA . SER A 1 1443 ? 113.016 155.438 155.556 1.00 0.00 ? 1443 SER A CA 5  
ATOM 8433   C CA . SER A 1 1444 ? 114.837 156.144 158.816 1.00 0.00 ? 1444 SER A CA 5  
ATOM 8434   C CA . SER A 1 1445 ? 113.192 152.991 160.262 1.00 0.00 ? 1445 SER A CA 5  
ATOM 8435   C CA . PRO A 1 1446 ? 115.616 150.775 162.333 1.00 0.00 ? 1446 PRO A CA 5  
ATOM 8436   C CA . VAL A 1 1447 ? 116.972 147.577 161.109 1.00 0.00 ? 1447 VAL A CA 5  
ATOM 8437   C CA . ILE A 1 1448 ? 118.234 144.658 163.177 1.00 0.00 ? 1448 ILE A CA 5  
ATOM 8438   C CA . LEU A 1 1449 ? 120.534 142.196 161.409 1.00 0.00 ? 1449 LEU A CA 5  
ATOM 8439   C CA . VAL A 1 1450 ? 120.136 138.584 162.555 1.00 0.00 ? 1450 VAL A CA 5  
ATOM 8440   C CA . GLY A 1 1451 ? 122.732 136.025 161.419 1.00 0.00 ? 1451 GLY A CA 5  
ATOM 8441   C CA . THR A 1 1452 ? 120.964 132.647 161.662 1.00 0.00 ? 1452 THR A CA 5  
ATOM 8442   C CA . HIS A 1 1453 ? 121.956 128.944 161.739 1.00 0.00 ? 1453 HIS A CA 5  
ATOM 8443   C CA . LEU A 1 1454 ? 125.248 129.668 163.494 1.00 0.00 ? 1454 LEU A CA 5  
ATOM 8444   C CA . ASP A 1 1455 ? 125.413 126.103 164.941 1.00 0.00 ? 1455 ASP A CA 5  
ATOM 8445   C CA . VAL A 1 1456 ? 126.000 124.645 161.424 1.00 0.00 ? 1456 VAL A CA 5  
ATOM 8446   C CA . SER A 1 1457 ? 128.828 127.145 160.843 1.00 0.00 ? 1457 SER A CA 5  
ATOM 8447   C CA . ASP A 1 1458 ? 130.879 126.518 164.038 1.00 0.00 ? 1458 ASP A CA 5  
ATOM 8448   C CA . GLU A 1 1459 ? 130.628 130.245 164.929 1.00 0.00 ? 1459 GLU A CA 5  
ATOM 8449   C CA . LYS A 1 1460 ? 132.678 131.177 161.807 1.00 0.00 ? 1460 LYS A CA 5  
ATOM 8450   C CA . GLN A 1 1461 ? 130.203 133.155 159.674 1.00 0.00 ? 1461 GLN A CA 5  
ATOM 8451   C CA . ARG A 1 1462 ? 129.683 135.758 162.389 1.00 0.00 ? 1462 ARG A CA 5  
ATOM 8452   C CA . LYS A 1 1463 ? 133.291 136.925 162.298 1.00 0.00 ? 1463 LYS A CA 5  
ATOM 8453   C CA . ALA A 1 1464 ? 134.492 140.288 160.868 1.00 0.00 ? 1464 ALA A CA 5  
ATOM 8454   C CA . CYS A 1 1465 ? 136.195 138.260 158.114 1.00 0.00 ? 1465 CYS A CA 5  
ATOM 8455   C CA . MET A 1 1466 ? 132.808 137.240 156.596 1.00 0.00 ? 1466 MET A CA 5  
ATOM 8456   C CA . SER A 1 1467 ? 130.270 139.616 158.196 1.00 0.00 ? 1467 SER A CA 5  
ATOM 8457   C CA . LYS A 1 1468 ? 131.379 143.190 157.527 1.00 0.00 ? 1468 LYS A CA 5  
ATOM 8458   C CA . ILE A 1 1469 ? 129.551 144.773 160.540 1.00 0.00 ? 1469 ILE A CA 5  
ATOM 8459   C CA . THR A 1 1470 ? 131.568 147.980 161.120 1.00 0.00 ? 1470 THR A CA 5  
ATOM 8460   C CA . LYS A 1 1471 ? 133.321 147.937 157.788 1.00 0.00 ? 1471 LYS A CA 5  
ATOM 8461   C CA . GLU A 1 1472 ? 130.221 147.808 155.437 1.00 0.00 ? 1472 GLU A CA 5  
ATOM 8462   C CA . LEU A 1 1473 ? 126.976 147.262 157.409 1.00 0.00 ? 1473 LEU A CA 5  
ATOM 8463   C CA . LEU A 1 1474 ? 126.962 150.123 159.999 1.00 0.00 ? 1474 LEU A CA 5  
ATOM 8464   C CA . ASN A 1 1475 ? 127.143 153.980 160.133 1.00 0.00 ? 1475 ASN A CA 5  
ATOM 8465   C CA . LYS A 1 1476 ? 130.805 154.101 158.942 1.00 0.00 ? 1476 LYS A CA 5  
ATOM 8466   C CA . ARG A 1 1477 ? 129.779 152.917 155.450 1.00 0.00 ? 1477 ARG A CA 5  
ATOM 8467   C CA . GLY A 1 1478 ? 126.345 154.393 154.903 1.00 0.00 ? 1478 GLY A CA 5  
ATOM 8468   C CA . PHE A 1 1479 ? 124.043 152.092 156.914 1.00 0.00 ? 1479 PHE A CA 5  
ATOM 8469   C CA . PRO A 1 1480 ? 122.989 154.416 159.783 1.00 0.00 ? 1480 PRO A CA 5  
ATOM 8470   C CA . ALA A 1 1481 ? 119.744 152.936 161.141 1.00 0.00 ? 1481 ALA A CA 5  
ATOM 8471   C CA . ILE A 1 1482 ? 121.177 149.536 162.192 1.00 0.00 ? 1482 ILE A CA 5  
ATOM 8472   C CA . ARG A 1 1483 ? 123.379 149.838 165.358 1.00 0.00 ? 1483 ARG A CA 5  
ATOM 8473   C CA . ASP A 1 1484 ? 122.564 146.182 166.255 1.00 0.00 ? 1484 ASP A CA 5  
ATOM 8474   C CA . TYR A 1 1485 ? 123.723 142.744 165.054 1.00 0.00 ? 1485 TYR A CA 5  
ATOM 8475   C CA . HIS A 1 1486 ? 122.829 139.238 166.299 1.00 0.00 ? 1486 HIS A CA 5  
ATOM 8476   C CA . PHE A 1 1487 ? 124.330 135.836 165.835 1.00 0.00 ? 1487 PHE A CA 5  
ATOM 8477   C CA . VAL A 1 1488 ? 121.878 133.109 166.767 1.00 0.00 ? 1488 VAL A CA 5  
ATOM 8478   C CA . ASN A 1 1489 ? 122.025 129.302 167.001 1.00 0.00 ? 1489 ASN A CA 5  
ATOM 8479   C CA . ALA A 1 1490 ? 118.500 128.165 167.829 1.00 0.00 ? 1490 ALA A CA 5  
ATOM 8480   C CA . THR A 1 1491 ? 118.957 124.469 168.531 1.00 0.00 ? 1491 THR A CA 5  
ATOM 8481   C CA . GLU A 1 1492 ? 122.088 124.958 170.648 1.00 0.00 ? 1492 GLU A CA 5  
ATOM 8482   C CA . GLU A 1 1493 ? 120.940 127.680 173.067 1.00 0.00 ? 1493 GLU A CA 5  
ATOM 8483   C CA . SER A 1 1494 ? 118.401 130.553 173.249 1.00 0.00 ? 1494 SER A CA 5  
ATOM 8484   C CA . ASP A 1 1495 ? 120.695 133.066 174.971 1.00 0.00 ? 1495 ASP A CA 5  
ATOM 8485   C CA . ALA A 1 1496 ? 121.471 135.142 171.843 1.00 0.00 ? 1496 ALA A CA 5  
ATOM 8486   C CA . LEU A 1 1497 ? 117.732 135.321 170.986 1.00 0.00 ? 1497 LEU A CA 5  
ATOM 8487   C CA . ALA A 1 1498 ? 117.023 137.014 174.324 1.00 0.00 ? 1498 ALA A CA 5  
ATOM 8488   C CA . LYS A 1 1499 ? 119.516 139.663 173.080 1.00 0.00 ? 1499 LYS A CA 5  
ATOM 8489   C CA . LEU A 1 1500 ? 117.242 140.199 170.011 1.00 0.00 ? 1500 LEU A CA 5  
ATOM 8490   C CA . ARG A 1 1501 ? 114.576 141.315 172.503 1.00 0.00 ? 1501 ARG A CA 5  
ATOM 8491   C CA . LYS A 1 1502 ? 116.953 144.097 173.714 1.00 0.00 ? 1502 LYS A CA 5  
ATOM 8492   C CA . THR A 1 1503 ? 117.160 145.423 170.144 1.00 0.00 ? 1503 THR A CA 5  
ATOM 8493   C CA . ILE A 1 1504 ? 113.337 145.180 169.835 1.00 0.00 ? 1504 ILE A CA 5  
ATOM 8494   C CA . ILE A 1 1505 ? 113.429 147.267 173.068 1.00 0.00 ? 1505 ILE A CA 5  
ATOM 8495   C CA . ASN A 1 1506 ? 115.950 149.770 171.508 1.00 0.00 ? 1506 ASN A CA 5  
ATOM 8496   C CA . GLU A 1 1507 ? 113.564 150.277 168.600 1.00 0.00 ? 1507 GLU A CA 5  
ATOM 8497   C CA . SER A 1 1508 ? 109.780 151.104 168.937 1.00 0.00 ? 1508 SER A CA 5  
ATOM 8498   C CA . LEU A 1 1509 ? 111.162 154.102 170.913 1.00 0.00 ? 1509 LEU A CA 5  
ATOM 8499   C CA . ASN A 1 1510 ? 111.402 156.540 167.981 1.00 0.00 ? 1510 ASN A CA 5  
ATOM 8500   C CA . PHE A 1 1511 ? 108.289 155.089 166.172 1.00 0.00 ? 1511 PHE A CA 5  
ATOM 8501   C CA . LYS A 1 1512 ? 105.460 155.268 168.616 1.00 0.00 ? 1512 LYS A CA 5  
ATOM 8502   C CA . ILE A 1 1513 ? 106.560 156.963 171.904 1.00 0.00 ? 1513 ILE A CA 5  
ATOM 8503   C CA . ARG A 1 1514 ? 107.151 160.457 170.451 1.00 0.00 ? 1514 ARG A CA 5  
ATOM 8504   C CA . PRO A 1 1524 ? 132.563 149.540 185.610 1.00 0.00 ? 1524 PRO A CA 5  
ATOM 8505   C CA . ASP A 1 1525 ? 128.850 149.502 186.627 1.00 0.00 ? 1525 ASP A CA 5  
ATOM 8506   C CA . CYS A 1 1526 ? 128.679 153.346 186.585 1.00 0.00 ? 1526 CYS A CA 5  
ATOM 8507   C CA . TYR A 1 1527 ? 129.543 153.465 182.819 1.00 0.00 ? 1527 TYR A CA 5  
ATOM 8508   C CA . VAL A 1 1528 ? 126.756 150.886 182.031 1.00 0.00 ? 1528 VAL A CA 5  
ATOM 8509   C CA . GLU A 1 1529 ? 124.264 152.729 184.322 1.00 0.00 ? 1529 GLU A CA 5  
ATOM 8510   C CA . LEU A 1 1530 ? 125.018 156.068 182.702 1.00 0.00 ? 1530 LEU A CA 5  
ATOM 8511   C CA . GLU A 1 1531 ? 124.851 154.564 179.163 1.00 0.00 ? 1531 GLU A CA 5  
ATOM 8512   C CA . LYS A 1 1532 ? 121.322 153.210 179.845 1.00 0.00 ? 1532 LYS A CA 5  
ATOM 8513   C CA . ILE A 1 1533 ? 120.075 156.530 181.303 1.00 0.00 ? 1533 ILE A CA 5  
ATOM 8514   C CA . ILE A 1 1534 ? 121.692 158.474 178.431 1.00 0.00 ? 1534 ILE A CA 5  
ATOM 8515   C CA . LEU A 1 1535 ? 120.038 156.159 175.836 1.00 0.00 ? 1535 LEU A CA 5  
ATOM 8516   C CA . SER A 1 1536 ? 116.588 156.441 177.497 1.00 0.00 ? 1536 SER A CA 5  
ATOM 8517   C CA . GLU A 1 1537 ? 116.863 160.278 177.763 1.00 0.00 ? 1537 GLU A CA 5  
ATOM 8518   C CA . ARG A 1 1538 ? 118.235 160.573 174.204 1.00 0.00 ? 1538 ARG A CA 5  
ATOM 8519   C CA . LYS A 1 1539 ? 115.740 158.366 172.318 1.00 0.00 ? 1539 LYS A CA 5  
ATOM 8520   C CA . ASN A 1 1540 ? 112.846 160.222 174.004 1.00 0.00 ? 1540 ASN A CA 5  
ATOM 8521   C CA . VAL A 1 1541 ? 113.992 163.467 172.328 1.00 0.00 ? 1541 VAL A CA 5  
ATOM 8522   C CA . PRO A 1 1542 ? 113.512 162.543 168.574 1.00 0.00 ? 1542 PRO A CA 5  
ATOM 8523   C CA . ILE A 1 1543 ? 111.599 165.710 167.848 1.00 0.00 ? 1543 ILE A CA 5  
ATOM 8524   C CA . GLU A 1 1544 ? 114.220 168.068 169.130 1.00 0.00 ? 1544 GLU A CA 5  
ATOM 8525   C CA . PHE A 1 1545 ? 118.047 168.423 168.807 1.00 0.00 ? 1545 PHE A CA 5  
ATOM 8526   C CA . PRO A 1 1546 ? 119.317 169.167 172.401 1.00 0.00 ? 1546 PRO A CA 5  
ATOM 8527   C CA . VAL A 1 1547 ? 118.553 165.624 173.192 1.00 0.00 ? 1547 VAL A CA 5  
ATOM 8528   C CA . ILE A 1 1548 ? 120.880 166.111 176.106 1.00 0.00 ? 1548 ILE A CA 5  
ATOM 8529   C CA . ASP A 1 1549 ? 122.326 169.525 177.042 1.00 0.00 ? 1549 ASP A CA 5  
ATOM 8530   C CA . ARG A 1 1550 ? 125.548 169.930 179.102 1.00 0.00 ? 1550 ARG A CA 5  
ATOM 8531   C CA . LYS A 1 1551 ? 123.742 170.431 182.439 1.00 0.00 ? 1551 LYS A CA 5  
ATOM 8532   C CA . ARG A 1 1552 ? 121.477 167.442 181.885 1.00 0.00 ? 1552 ARG A CA 5  
ATOM 8533   C CA . LEU A 1 1553 ? 124.317 164.893 181.280 1.00 0.00 ? 1553 LEU A CA 5  
ATOM 8534   C CA . LEU A 1 1554 ? 126.228 166.378 184.255 1.00 0.00 ? 1554 LEU A CA 5  
ATOM 8535   C CA . GLN A 1 1555 ? 123.122 165.637 186.357 1.00 0.00 ? 1555 GLN A CA 5  
ATOM 8536   C CA . LEU A 1 1556 ? 122.896 162.005 185.071 1.00 0.00 ? 1556 LEU A CA 5  
ATOM 8537   C CA . VAL A 1 1557 ? 126.671 161.452 185.630 1.00 0.00 ? 1557 VAL A CA 5  
ATOM 8538   C CA . ARG A 1 1558 ? 126.298 162.649 189.278 1.00 0.00 ? 1558 ARG A CA 5  
ATOM 8539   C CA . GLU A 1 1559 ? 123.374 160.292 189.994 1.00 0.00 ? 1559 GLU A CA 5  
ATOM 8540   C CA . ASN A 1 1560 ? 125.637 157.324 189.072 1.00 0.00 ? 1560 ASN A CA 5  
ATOM 8541   C CA . GLN A 1 1561 ? 128.533 158.840 191.128 1.00 0.00 ? 1561 GLN A CA 5  
ATOM 8542   C CA . LEU A 1 1562 ? 130.745 159.979 188.175 1.00 0.00 ? 1562 LEU A CA 5  
ATOM 8543   C CA . GLN A 1 1563 ? 130.735 163.783 188.817 1.00 0.00 ? 1563 GLN A CA 5  
ATOM 8544   C CA . LEU A 1 1564 ? 133.867 163.109 190.910 1.00 0.00 ? 1564 LEU A CA 5  
ATOM 8545   C CA . ASP A 1 1565 ? 136.125 163.784 187.909 1.00 0.00 ? 1565 ASP A CA 5  
ATOM 8546   C CA . GLU A 1 1566 ? 135.333 165.930 184.818 1.00 0.00 ? 1566 GLU A CA 5  
ATOM 8547   C CA . ASN A 1 1567 ? 138.207 164.114 183.137 1.00 0.00 ? 1567 ASN A CA 5  
ATOM 8548   C CA . GLU A 1 1568 ? 136.510 160.612 183.310 1.00 0.00 ? 1568 GLU A CA 5  
ATOM 8549   C CA . LEU A 1 1569 ? 133.229 161.981 181.998 1.00 0.00 ? 1569 LEU A CA 5  
ATOM 8550   C CA . PRO A 1 1570 ? 134.909 163.066 178.645 1.00 0.00 ? 1570 PRO A CA 5  
ATOM 8551   C CA . HIS A 1 1571 ? 136.457 159.585 178.510 1.00 0.00 ? 1571 HIS A CA 5  
ATOM 8552   C CA . ALA A 1 1572 ? 133.103 157.811 179.152 1.00 0.00 ? 1572 ALA A CA 5  
ATOM 8553   C CA . VAL A 1 1573 ? 131.272 159.943 176.551 1.00 0.00 ? 1573 VAL A CA 5  
ATOM 8554   C CA . HIS A 1 1574 ? 134.308 159.621 174.184 1.00 0.00 ? 1574 HIS A CA 5  
ATOM 8555   C CA . PHE A 1 1575 ? 133.872 155.808 174.547 1.00 0.00 ? 1575 PHE A CA 5  
ATOM 8556   C CA . LEU A 1 1576 ? 130.117 155.970 173.994 1.00 0.00 ? 1576 LEU A CA 5  
ATOM 8557   C CA . ASN A 1 1577 ? 130.692 158.179 170.924 1.00 0.00 ? 1577 ASN A CA 5  
ATOM 8558   C CA . GLU A 1 1578 ? 133.438 155.830 169.529 1.00 0.00 ? 1578 GLU A CA 5  
ATOM 8559   C CA . SER A 1 1579 ? 130.966 152.943 169.946 1.00 0.00 ? 1579 SER A CA 5  
ATOM 8560   C CA . GLY A 1 1580 ? 127.985 154.809 168.327 1.00 0.00 ? 1580 GLY A CA 5  
ATOM 8561   C CA . VAL A 1 1581 ? 125.718 154.318 171.351 1.00 0.00 ? 1581 VAL A CA 5  
ATOM 8562   C CA . LEU A 1 1582 ? 125.438 158.077 171.530 1.00 0.00 ? 1582 LEU A CA 5  
ATOM 8563   C CA . LEU A 1 1583 ? 127.078 160.827 169.532 1.00 0.00 ? 1583 LEU A CA 5  
ATOM 8564   C CA . HIS A 1 1584 ? 129.298 163.463 171.181 1.00 0.00 ? 1584 HIS A CA 5  
ATOM 8565   C CA . PHE A 1 1585 ? 131.225 165.896 169.053 1.00 0.00 ? 1585 PHE A CA 5  
ATOM 8566   C CA . GLN A 1 1586 ? 134.250 167.224 170.964 1.00 0.00 ? 1586 GLN A CA 5  
ATOM 8567   C CA . ASP A 1 1587 ? 135.317 169.580 168.094 1.00 0.00 ? 1587 ASP A CA 5  
ATOM 8568   C CA . PRO A 1 1588 ? 132.056 171.760 168.141 1.00 0.00 ? 1588 PRO A CA 5  
ATOM 8569   C CA . ALA A 1 1589 ? 131.779 171.350 171.975 1.00 0.00 ? 1589 ALA A CA 5  
ATOM 8570   C CA . LEU A 1 1590 ? 133.716 174.590 172.685 1.00 0.00 ? 1590 LEU A CA 5  
ATOM 8571   C CA . GLN A 1 1591 ? 130.682 176.784 171.871 1.00 0.00 ? 1591 GLN A CA 5  
ATOM 8572   C CA . LEU A 1 1592 ? 127.848 174.275 172.224 1.00 0.00 ? 1592 LEU A CA 5  
ATOM 8573   C CA . SER A 1 1593 ? 126.481 173.347 175.694 1.00 0.00 ? 1593 SER A CA 5  
ATOM 8574   C CA . ASP A 1 1594 ? 122.874 173.351 174.406 1.00 0.00 ? 1594 ASP A CA 5  
ATOM 8575   C CA . LEU A 1 1595 ? 123.492 170.372 172.116 1.00 0.00 ? 1595 LEU A CA 5  
ATOM 8576   C CA . TYR A 1 1596 ? 126.166 168.298 173.782 1.00 0.00 ? 1596 TYR A CA 5  
ATOM 8577   C CA . PHE A 1 1597 ? 125.319 164.620 173.250 1.00 0.00 ? 1597 PHE A CA 5  
ATOM 8578   C CA . VAL A 1 1598 ? 123.130 163.312 170.399 1.00 0.00 ? 1598 VAL A CA 5  
ATOM 8579   C CA . GLU A 1 1599 ? 120.780 160.408 169.375 1.00 0.00 ? 1599 GLU A CA 5  
ATOM 8580   C CA . PRO A 1 1600 ? 122.437 158.562 166.395 1.00 0.00 ? 1600 PRO A CA 5  
ATOM 8581   C CA . LYS A 1 1601 ? 119.084 157.875 164.675 1.00 0.00 ? 1601 LYS A CA 5  
ATOM 8582   C CA . TRP A 1 1602 ? 118.102 161.529 164.827 1.00 0.00 ? 1602 TRP A CA 5  
ATOM 8583   C CA . LEU A 1 1603 ? 121.482 162.591 163.308 1.00 0.00 ? 1603 LEU A CA 5  
ATOM 8584   C CA . CYS A 1 1604 ? 121.427 159.892 160.578 1.00 0.00 ? 1604 CYS A CA 5  
ATOM 8585   C CA . LYS A 1 1605 ? 117.848 160.700 159.461 1.00 0.00 ? 1605 LYS A CA 5  
ATOM 8586   C CA . ILE A 1 1606 ? 118.816 164.402 159.256 1.00 0.00 ? 1606 ILE A CA 5  
ATOM 8587   C CA . MET A 1 1607 ? 121.630 163.951 156.863 1.00 0.00 ? 1607 MET A CA 5  
ATOM 8588   C CA . ALA A 1 1608 ? 119.972 161.345 154.694 1.00 0.00 ? 1608 ALA A CA 5  
ATOM 8589   C CA . GLN A 1 1609 ? 117.113 163.873 154.173 1.00 0.00 ? 1609 GLN A CA 5  
ATOM 8590   C CA . ILE A 1 1610 ? 119.676 166.532 153.077 1.00 0.00 ? 1610 ILE A CA 5  
ATOM 8591   C CA . LEU A 1 1611 ? 121.466 163.985 150.826 1.00 0.00 ? 1611 LEU A CA 5  
ATOM 8592   C CA . THR A 1 1612 ? 118.243 162.765 149.105 1.00 0.00 ? 1612 THR A CA 5  
ATOM 8593   C CA . VAL A 1 1613 ? 116.479 166.129 148.795 1.00 0.00 ? 1613 VAL A CA 5  
ATOM 8594   C CA . LYS A 1 1614 ? 115.369 167.229 145.286 1.00 0.00 ? 1614 LYS A CA 5  
ATOM 8595   C CA . VAL A 1 1615 ? 116.638 170.779 145.968 1.00 0.00 ? 1615 VAL A CA 5  
ATOM 8596   C CA . GLU A 1 1616 ? 120.371 170.330 145.278 1.00 0.00 ? 1616 GLU A CA 5  
ATOM 8597   C CA . GLY A 1 1617 ? 120.636 173.702 143.514 1.00 0.00 ? 1617 GLY A CA 5  
ATOM 8598   C CA . CYS A 1 1618 ? 119.059 176.354 141.308 1.00 0.00 ? 1618 CYS A CA 5  
ATOM 8599   C CA . PRO A 1 1619 ? 116.262 175.100 138.893 1.00 0.00 ? 1619 PRO A CA 5  
ATOM 8600   C CA . LYS A 1 1620 ? 118.361 174.437 135.732 1.00 0.00 ? 1620 LYS A CA 5  
ATOM 8601   C CA . HIS A 1 1621 ? 121.626 173.472 137.491 1.00 0.00 ? 1621 HIS A CA 5  
ATOM 8602   C CA . PRO A 1 1622 ? 121.199 171.192 140.578 1.00 0.00 ? 1622 PRO A CA 5  
ATOM 8603   C CA . LYS A 1 1623 ? 124.730 169.777 140.970 1.00 0.00 ? 1623 LYS A CA 5  
ATOM 8604   C CA . GLY A 1 1624 ? 125.174 169.008 144.714 1.00 0.00 ? 1624 GLY A CA 5  
ATOM 8605   C CA . ILE A 1 1625 ? 124.468 172.598 145.851 1.00 0.00 ? 1625 ILE A CA 5  
ATOM 8606   C CA . ILE A 1 1626 ? 122.826 173.115 149.270 1.00 0.00 ? 1626 ILE A CA 5  
ATOM 8607   C CA . SER A 1 1627 ? 121.143 176.538 149.494 1.00 0.00 ? 1627 SER A CA 5  
ATOM 8608   C CA . ARG A 1 1628 ? 121.083 177.254 153.276 1.00 0.00 ? 1628 ARG A CA 5  
ATOM 8609   C CA . ARG A 1 1629 ? 117.638 178.971 153.173 1.00 0.00 ? 1629 ARG A CA 5  
ATOM 8610   C CA . ASP A 1 1630 ? 115.810 175.930 152.041 1.00 0.00 ? 1630 ASP A CA 5  
ATOM 8611   C CA . VAL A 1 1631 ? 116.820 173.658 155.005 1.00 0.00 ? 1631 VAL A CA 5  
ATOM 8612   C CA . GLU A 1 1632 ? 113.464 174.280 156.781 1.00 0.00 ? 1632 GLU A CA 5  
ATOM 8613   C CA . LYS A 1 1633 ? 111.584 172.740 153.844 1.00 0.00 ? 1633 LYS A CA 5  
ATOM 8614   C CA . PHE A 1 1634 ? 113.992 169.769 153.375 1.00 0.00 ? 1634 PHE A CA 5  
ATOM 8615   C CA . LEU A 1 1635 ? 114.072 168.670 156.945 1.00 0.00 ? 1635 LEU A CA 5  
ATOM 8616   C CA . SER A 1 1636 ? 110.551 169.493 158.292 1.00 0.00 ? 1636 SER A CA 5  
ATOM 8617   C CA . LYS A 1 1637 ? 107.861 168.154 159.161 1.00 0.00 ? 1637 LYS A CA 5  
ATOM 8618   C CA . LYS A 1 1638 ? 109.099 164.528 158.539 1.00 0.00 ? 1638 LYS A CA 5  
ATOM 8619   C CA . ARG A 1 1639 ? 111.479 165.300 161.323 1.00 0.00 ? 1639 ARG A CA 5  
ATOM 8620   C CA . LYS A 1 1640 ? 111.411 168.375 163.541 1.00 0.00 ? 1640 LYS A CA 5  
ATOM 8621   C CA . PHE A 1 1641 ? 114.358 170.710 162.985 1.00 0.00 ? 1641 PHE A CA 5  
ATOM 8622   C CA . PRO A 1 1642 ? 114.230 174.254 164.337 1.00 0.00 ? 1642 PRO A CA 5  
ATOM 8623   C CA . LYS A 1 1643 ? 116.690 176.929 163.081 1.00 0.00 ? 1643 LYS A CA 5  
ATOM 8624   C CA . ASN A 1 1644 ? 119.517 176.422 165.654 1.00 0.00 ? 1644 ASN A CA 5  
ATOM 8625   C CA . TYR A 1 1645 ? 119.274 172.648 165.101 1.00 0.00 ? 1645 TYR A CA 5  
ATOM 8626   C CA . MET A 1 1646 ? 119.502 173.414 161.363 1.00 0.00 ? 1646 MET A CA 5  
ATOM 8627   C CA . SER A 1 1647 ? 122.792 175.352 161.736 1.00 0.00 ? 1647 SER A CA 5  
ATOM 8628   C CA . GLN A 1 1648 ? 124.360 172.519 163.815 1.00 0.00 ? 1648 GLN A CA 5  
ATOM 8629   C CA . TYR A 1 1649 ? 123.466 169.583 161.476 1.00 0.00 ? 1649 TYR A CA 5  
ATOM 8630   C CA . PHE A 1 1650 ? 125.432 171.402 158.763 1.00 0.00 ? 1650 PHE A CA 5  
ATOM 8631   C CA . LYS A 1 1651 ? 128.438 171.332 161.133 1.00 0.00 ? 1651 LYS A CA 5  
ATOM 8632   C CA . LEU A 1 1652 ? 127.834 167.566 161.523 1.00 0.00 ? 1652 LEU A CA 5  
ATOM 8633   C CA . LEU A 1 1653 ? 127.867 167.212 157.669 1.00 0.00 ? 1653 LEU A CA 5  
ATOM 8634   C CA . GLU A 1 1654 ? 131.183 169.136 157.580 1.00 0.00 ? 1654 GLU A CA 5  
ATOM 8635   C CA . LYS A 1 1655 ? 132.560 166.883 160.327 1.00 0.00 ? 1655 LYS A CA 5  
ATOM 8636   C CA . PHE A 1 1656 ? 131.293 163.689 158.572 1.00 0.00 ? 1656 PHE A CA 5  
ATOM 8637   C CA . GLN A 1 1657 ? 133.018 165.076 155.406 1.00 0.00 ? 1657 GLN A CA 5  
ATOM 8638   C CA . ILE A 1 1658 ? 129.812 165.076 153.357 1.00 0.00 ? 1658 ILE A CA 5  
ATOM 8639   C CA . ALA A 1 1659 ? 129.883 168.785 152.507 1.00 0.00 ? 1659 ALA A CA 5  
ATOM 8640   C CA . LEU A 1 1660 ? 132.012 171.958 152.615 1.00 0.00 ? 1660 LEU A CA 5  
ATOM 8641   C CA . PRO A 1 1661 ? 131.174 175.723 152.694 1.00 0.00 ? 1661 PRO A CA 5  
ATOM 8642   C CA . ILE A 1 1662 ? 132.154 178.033 149.786 1.00 0.00 ? 1662 ILE A CA 5  
ATOM 8643   C CA . GLY A 1 1663 ? 130.966 181.166 151.647 1.00 0.00 ? 1663 GLY A CA 5  
ATOM 8644   C CA . GLU A 1 1664 ? 127.771 182.455 149.967 1.00 0.00 ? 1664 GLU A CA 5  
ATOM 8645   C CA . GLU A 1 1665 ? 125.298 180.415 152.142 1.00 0.00 ? 1665 GLU A CA 5  
ATOM 8646   C CA . TYR A 1 1666 ? 125.739 177.706 149.489 1.00 0.00 ? 1666 TYR A CA 5  
ATOM 8647   C CA . LEU A 1 1667 ? 127.445 174.398 150.317 1.00 0.00 ? 1667 LEU A CA 5  
ATOM 8648   C CA . LEU A 1 1668 ? 128.860 171.703 148.032 1.00 0.00 ? 1668 LEU A CA 5  
ATOM 8649   C CA . VAL A 1 1669 ? 127.911 168.023 148.526 1.00 0.00 ? 1669 VAL A CA 5  
ATOM 8650   C CA . ILE A 1 1690 ? 145.044 147.859 143.937 1.00 0.00 ? 1690 ILE A CA 5  
ATOM 8651   C CA . ILE A 1 1691 ? 147.316 148.539 146.994 1.00 0.00 ? 1691 ILE A CA 5  
ATOM 8652   C CA . ILE A 1 1692 ? 149.845 145.717 147.309 1.00 0.00 ? 1692 ILE A CA 5  
ATOM 8653   C CA . ARG A 1 1693 ? 152.207 145.390 150.290 1.00 0.00 ? 1693 ARG A CA 5  
ATOM 8654   C CA . LEU A 1 1694 ? 154.620 142.442 150.697 1.00 0.00 ? 1694 LEU A CA 5  
ATOM 8655   C CA . TYR A 1 1695 ? 156.435 141.239 153.878 1.00 0.00 ? 1695 TYR A CA 5  
ATOM 8656   C CA . GLU A 1 1696 ? 159.626 139.085 153.467 1.00 0.00 ? 1696 GLU A CA 5  
ATOM 8657   C CA . MET A 1 1697 ? 160.488 136.763 156.396 1.00 0.00 ? 1697 MET A CA 5  
ATOM 8658   C CA . PRO A 1 1698 ? 163.824 134.652 156.509 1.00 0.00 ? 1698 PRO A CA 5  
ATOM 8659   C CA . TYR A 1 1699 ? 161.660 132.159 158.264 1.00 0.00 ? 1699 TYR A CA 5  
ATOM 8660   C CA . PHE A 1 1700 ? 157.855 132.327 157.772 1.00 0.00 ? 1700 PHE A CA 5  
ATOM 8661   C CA . PRO A 1 1701 ? 156.143 130.517 160.752 1.00 0.00 ? 1701 PRO A CA 5  
ATOM 8662   C CA . MET A 1 1702 ? 153.377 128.208 159.507 1.00 0.00 ? 1702 MET A CA 5  
ATOM 8663   C CA . GLY A 1 1703 ? 151.241 129.472 162.397 1.00 0.00 ? 1703 GLY A CA 5  
ATOM 8664   C CA . PHE A 1 1704 ? 151.078 133.083 161.054 1.00 0.00 ? 1704 PHE A CA 5  
ATOM 8665   C CA . TRP A 1 1705 ? 148.176 132.610 158.640 1.00 0.00 ? 1705 TRP A CA 5  
ATOM 8666   C CA . SER A 1 1706 ? 146.288 130.310 160.949 1.00 0.00 ? 1706 SER A CA 5  
ATOM 8667   C CA . ARG A 1 1707 ? 146.554 132.856 163.774 1.00 0.00 ? 1707 ARG A CA 5  
ATOM 8668   C CA . LEU A 1 1708 ? 145.769 135.872 161.568 1.00 0.00 ? 1708 LEU A CA 5  
ATOM 8669   C CA . ILE A 1 1709 ? 142.672 133.994 160.289 1.00 0.00 ? 1709 ILE A CA 5  
ATOM 8670   C CA . ASN A 1 1710 ? 141.618 133.678 163.976 1.00 0.00 ? 1710 ASN A CA 5  
ATOM 8671   C CA . ARG A 1 1711 ? 142.265 137.396 164.771 1.00 0.00 ? 1711 ARG A CA 5  
ATOM 8672   C CA . LEU A 1 1712 ? 140.272 138.336 161.645 1.00 0.00 ? 1712 LEU A CA 5  
ATOM 8673   C CA . LEU A 1 1713 ? 137.501 135.630 161.709 1.00 0.00 ? 1713 LEU A CA 5  
ATOM 8674   C CA . GLU A 1 1714 ? 134.670 138.173 161.673 1.00 0.00 ? 1714 GLU A CA 5  
ATOM 8675   C CA . ILE A 1 1715 ? 135.712 139.776 158.342 1.00 0.00 ? 1715 ILE A CA 5  
ATOM 8676   C CA . SER A 1 1716 ? 136.239 136.589 156.264 1.00 0.00 ? 1716 SER A CA 5  
ATOM 8677   C CA . PRO A 1 1717 ? 132.581 136.074 155.157 1.00 0.00 ? 1717 PRO A CA 5  
ATOM 8678   C CA . TYR A 1 1718 ? 132.075 139.848 155.246 1.00 0.00 ? 1718 TYR A CA 5  
ATOM 8679   C CA . MET A 1 1719 ? 131.482 142.533 157.840 1.00 0.00 ? 1719 MET A CA 5  
ATOM 8680   C CA . LEU A 1 1720 ? 129.449 144.922 155.584 1.00 0.00 ? 1720 LEU A CA 5  
ATOM 8681   C CA . SER A 1 1721 ? 125.962 144.135 154.363 1.00 0.00 ? 1721 SER A CA 5  
ATOM 8682   C CA . GLY A 1 1722 ? 127.157 145.964 151.169 1.00 0.00 ? 1722 GLY A CA 5  
ATOM 8683   C CA . ARG A 1 1723 ? 128.832 143.106 149.376 1.00 0.00 ? 1723 ARG A CA 5  
ATOM 8684   C CA . GLU A 1 1724 ? 129.692 143.478 145.674 1.00 0.00 ? 1724 GLU A CA 5  
ATOM 8685   C CA . ARG A 1 1725 ? 131.822 140.411 144.943 1.00 0.00 ? 1725 ARG A CA 5  
ATOM 8686   C CA . ALA A 1 1726 ? 130.485 136.906 145.693 1.00 0.00 ? 1726 ALA A CA 5  
ATOM 8687   C CA . LEU A 1 1727 ? 133.867 135.179 145.287 1.00 0.00 ? 1727 LEU A CA 5  
ATOM 8688   C CA . ARG A 1 1728 ? 136.347 136.935 147.595 1.00 0.00 ? 1728 ARG A CA 5  
ATOM 8689   C CA . PRO A 1 1729 ? 134.541 136.851 151.028 1.00 0.00 ? 1729 PRO A CA 5  
ATOM 8690   C CA . ASN A 1 1730 ? 132.103 133.873 151.825 1.00 0.00 ? 1730 ASN A CA 5  
ATOM 8691   C CA . ARG A 1 1731 ? 134.213 131.229 153.597 1.00 0.00 ? 1731 ARG A CA 5  
ATOM 8692   C CA . MET A 1 1732 ? 137.013 132.081 151.266 1.00 0.00 ? 1732 MET A CA 5  
ATOM 8693   C CA . TYR A 1 1733 ? 139.833 131.077 153.386 1.00 0.00 ? 1733 TYR A CA 5  
ATOM 8694   C CA . TRP A 1 1734 ? 142.398 128.463 152.652 1.00 0.00 ? 1734 TRP A CA 5  
ATOM 8695   C CA . ARG A 1 1735 ? 145.649 127.091 154.090 1.00 0.00 ? 1735 ARG A CA 5  
ATOM 8696   C CA . GLN A 1 1736 ? 147.741 129.907 152.523 1.00 0.00 ? 1736 GLN A CA 5  
ATOM 8697   C CA . GLY A 1 1737 ? 145.323 132.877 152.741 1.00 0.00 ? 1737 GLY A CA 5  
ATOM 8698   C CA . ILE A 1 1738 ? 142.020 134.655 153.241 1.00 0.00 ? 1738 ILE A CA 5  
ATOM 8699   C CA . TYR A 1 1739 ? 139.769 137.344 151.758 1.00 0.00 ? 1739 TYR A CA 5  
ATOM 8700   C CA . LEU A 1 1740 ? 138.692 140.042 154.152 1.00 0.00 ? 1740 LEU A CA 5  
ATOM 8701   C CA . ASN A 1 1741 ? 135.844 142.579 153.842 1.00 0.00 ? 1741 ASN A CA 5  
ATOM 8702   C CA . TRP A 1 1742 ? 135.034 145.322 156.392 1.00 0.00 ? 1742 TRP A CA 5  
ATOM 8703   C CA . SER A 1 1743 ? 132.397 147.998 156.958 1.00 0.00 ? 1743 SER A CA 5  
ATOM 8704   C CA . PRO A 1 1744 ? 132.434 150.763 155.662 1.00 0.00 ? 1744 PRO A CA 5  
ATOM 8705   C CA . GLU A 1 1745 ? 133.374 151.448 152.845 1.00 0.00 ? 1745 GLU A CA 5  
ATOM 8706   C CA . ALA A 1 1746 ? 133.311 147.787 151.585 1.00 0.00 ? 1746 ALA A CA 5  
ATOM 8707   C CA . TYR A 1 1747 ? 136.986 147.404 151.034 1.00 0.00 ? 1747 TYR A CA 5  
ATOM 8708   C CA . CYS A 1 1748 ? 138.117 143.875 150.010 1.00 0.00 ? 1748 CYS A CA 5  
ATOM 8709   C CA . LEU A 1 1749 ? 141.562 142.599 151.106 1.00 0.00 ? 1749 LEU A CA 5  
ATOM 8710   C CA . VAL A 1 1750 ? 143.330 139.410 150.048 1.00 0.00 ? 1750 VAL A CA 5  
ATOM 8711   C CA . GLY A 1 1751 ? 146.053 138.143 152.296 1.00 0.00 ? 1751 GLY A CA 5  
ATOM 8712   C CA . SER A 1 1752 ? 148.189 135.365 150.809 1.00 0.00 ? 1752 SER A CA 5  
ATOM 8713   C CA . GLU A 1 1753 ? 151.554 134.386 152.336 1.00 0.00 ? 1753 GLU A CA 5  
ATOM 8714   C CA . VAL A 1 1754 ? 153.150 137.685 153.085 1.00 0.00 ? 1754 VAL A CA 5  
ATOM 8715   C CA . LEU A 1 1755 ? 151.246 139.449 150.284 1.00 0.00 ? 1755 LEU A CA 5  
ATOM 8716   C CA . ASP A 1 1756 ? 148.402 141.853 151.101 1.00 0.00 ? 1756 ASP A CA 5  
ATOM 8717   C CA . ASN A 1 1757 ? 146.432 143.171 148.065 1.00 0.00 ? 1757 ASN A CA 5  
ATOM 8718   C CA . HIS A 1 1758 ? 143.598 145.679 148.547 1.00 0.00 ? 1758 HIS A CA 5  
ATOM 8719   C CA . PRO A 1 1759 ? 140.778 147.296 146.302 1.00 0.00 ? 1759 PRO A CA 5  
ATOM 8720   C CA . GLU A 1 1760 ? 138.677 150.400 147.519 1.00 0.00 ? 1760 GLU A CA 5  
ATOM 8721   C CA . SER A 1 1761 ? 139.313 154.111 148.315 1.00 0.00 ? 1761 SER A CA 5  
ATOM 8722   C CA . PHE A 1 1762 ? 139.795 153.375 152.103 1.00 0.00 ? 1762 PHE A CA 5  
ATOM 8723   C CA . LEU A 1 1763 ? 142.848 151.268 151.303 1.00 0.00 ? 1763 LEU A CA 5  
ATOM 8724   C CA . LYS A 1 1764 ? 145.359 152.957 153.418 1.00 0.00 ? 1764 LYS A CA 5  
ATOM 8725   C CA . ILE A 1 1765 ? 143.501 152.608 156.777 1.00 0.00 ? 1765 ILE A CA 5  
ATOM 8726   C CA . THR A 1 1766 ? 142.687 148.936 156.141 1.00 0.00 ? 1766 THR A CA 5  
ATOM 8727   C CA . VAL A 1 1767 ? 146.263 147.922 155.509 1.00 0.00 ? 1767 VAL A CA 5  
ATOM 8728   C CA . PRO A 1 1768 ? 147.550 149.097 159.063 1.00 0.00 ? 1768 PRO A CA 5  
ATOM 8729   C CA . SER A 1 1769 ? 144.870 147.193 160.854 1.00 0.00 ? 1769 SER A CA 5  
ATOM 8730   C CA . CYS A 1 1770 ? 145.894 144.048 158.897 1.00 0.00 ? 1770 CYS A CA 5  
ATOM 8731   C CA . ARG A 1 1771 ? 149.614 145.070 159.135 1.00 0.00 ? 1771 ARG A CA 5  
ATOM 8732   C CA . LYS A 1 1772 ? 149.259 145.644 162.892 1.00 0.00 ? 1772 LYS A CA 5  
ATOM 8733   C CA . GLY A 1 1773 ? 147.596 142.227 163.431 1.00 0.00 ? 1773 GLY A CA 5  
ATOM 8734   C CA . CYS A 1 1774 ? 150.426 140.581 161.486 1.00 0.00 ? 1774 CYS A CA 5  
ATOM 8735   C CA . ILE A 1 1775 ? 153.086 142.514 163.478 1.00 0.00 ? 1775 ILE A CA 5  
ATOM 8736   C CA . LEU A 1 1776 ? 151.343 141.465 166.751 1.00 0.00 ? 1776 LEU A CA 5  
ATOM 8737   C CA . LEU A 1 1777 ? 151.650 137.784 165.763 1.00 0.00 ? 1777 LEU A CA 5  
ATOM 8738   C CA . GLY A 1 1778 ? 155.274 138.294 164.686 1.00 0.00 ? 1778 GLY A CA 5  
ATOM 8739   C CA . GLN A 1 1779 ? 156.160 139.575 168.182 1.00 0.00 ? 1779 GLN A CA 5  
ATOM 8740   C CA . VAL A 1 1780 ? 155.354 136.102 169.674 1.00 0.00 ? 1780 VAL A CA 5  
ATOM 8741   C CA . VAL A 1 1781 ? 158.428 134.769 167.802 1.00 0.00 ? 1781 VAL A CA 5  
ATOM 8742   C CA . ASP A 1 1782 ? 161.888 135.871 169.058 1.00 0.00 ? 1782 ASP A CA 5  
ATOM 8743   C CA . HIS A 1 1783 ? 164.471 137.035 166.427 1.00 0.00 ? 1783 HIS A CA 5  
ATOM 8744   C CA . ILE A 1 1784 ? 161.997 137.124 163.459 1.00 0.00 ? 1784 ILE A CA 5  
ATOM 8745   C CA . ASP A 1 1785 ? 163.232 139.425 160.643 1.00 0.00 ? 1785 ASP A CA 5  
ATOM 8746   C CA . SER A 1 1786 ? 160.587 141.009 158.374 1.00 0.00 ? 1786 SER A CA 5  
ATOM 8747   C CA . LEU A 1 1787 ? 161.459 143.206 155.382 1.00 0.00 ? 1787 LEU A CA 5  
ATOM 8748   C CA . MET A 1 1788 ? 158.573 145.153 153.876 1.00 0.00 ? 1788 MET A CA 5  
ATOM 8749   C CA . GLU A 1 1789 ? 158.256 145.745 150.127 1.00 0.00 ? 1789 GLU A CA 5  
ATOM 8750   C CA . GLU A 1 1790 ? 156.111 147.637 147.671 1.00 0.00 ? 1790 GLU A CA 5  
ATOM 8751   C CA . TRP A 1 1791 ? 155.668 146.735 144.018 1.00 0.00 ? 1791 TRP A CA 5  
ATOM 8752   C CA . PHE A 1 1792 ? 156.703 149.338 141.451 1.00 0.00 ? 1792 PHE A CA 5  
ATOM 8753   C CA . PRO A 1 1793 ? 153.745 151.081 139.552 1.00 0.00 ? 1793 PRO A CA 5  
ATOM 8754   C CA . GLY A 1 1794 ? 153.305 149.322 136.203 1.00 0.00 ? 1794 GLY A CA 5  
ATOM 8755   C CA . LEU A 1 1795 ? 155.744 146.546 137.178 1.00 0.00 ? 1795 LEU A CA 5  
ATOM 8756   C CA . LEU A 1 1796 ? 154.085 144.111 139.633 1.00 0.00 ? 1796 LEU A CA 5  
ATOM 8757   C CA . GLU A 1 1797 ? 157.150 141.821 140.045 1.00 0.00 ? 1797 GLU A CA 5  
ATOM 8758   C CA . ILE A 1 1798 ? 159.706 144.642 140.639 1.00 0.00 ? 1798 ILE A CA 5  
ATOM 8759   C CA . ASP A 1 1799 ? 159.833 145.463 144.350 1.00 0.00 ? 1799 ASP A CA 5  
ATOM 8760   C CA . ILE A 1 1800 ? 161.288 148.373 146.324 1.00 0.00 ? 1800 ILE A CA 5  
ATOM 8761   C CA . CYS A 1 1801 ? 161.979 148.134 150.058 1.00 0.00 ? 1801 CYS A CA 5  
ATOM 8762   C CA . GLY A 1 1802 ? 159.768 150.474 152.193 1.00 0.00 ? 1802 GLY A CA 5  
ATOM 8763   C CA . GLU A 1 1803 ? 162.819 151.224 154.354 1.00 0.00 ? 1803 GLU A CA 5  
ATOM 8764   C CA . GLY A 1 1804 ? 164.531 152.395 151.118 1.00 0.00 ? 1804 GLY A CA 5  
ATOM 8765   C CA . GLU A 1 1805 ? 161.780 154.928 150.305 1.00 0.00 ? 1805 GLU A CA 5  
ATOM 8766   C CA . THR A 1 1806 ? 161.618 156.275 153.910 1.00 0.00 ? 1806 THR A CA 5  
ATOM 8767   C CA . LEU A 1 1807 ? 165.426 156.683 153.820 1.00 0.00 ? 1807 LEU A CA 5  
ATOM 8768   C CA . LEU A 1 1808 ? 165.170 158.518 150.474 1.00 0.00 ? 1808 LEU A CA 5  
ATOM 8769   C CA . LYS A 1 1809 ? 162.604 160.921 152.083 1.00 0.00 ? 1809 LYS A CA 5  
ATOM 8770   C CA . LYS A 1 1810 ? 164.886 161.544 155.102 1.00 0.00 ? 1810 LYS A CA 5  
ATOM 8771   C CA . TRP A 1 1811 ? 167.689 162.294 152.609 1.00 0.00 ? 1811 TRP A CA 5  
ATOM 8772   C CA . ALA A 1 1812 ? 165.364 164.855 150.943 1.00 0.00 ? 1812 ALA A CA 5  
ATOM 8773   C CA . LEU A 1 1813 ? 165.139 162.940 147.639 1.00 0.00 ? 1813 LEU A CA 5  
ATOM 8774   C CA . TYR A 1 1814 ? 161.894 162.421 145.728 1.00 0.00 ? 1814 TYR A CA 5  
ATOM 8775   C CA . SER A 1 1815 ? 163.298 160.250 142.917 1.00 0.00 ? 1815 SER A CA 5  
ATOM 8776   C CA . PHE A 1 1816 ? 163.660 156.526 143.166 1.00 0.00 ? 1816 PHE A CA 5  
ATOM 8777   C CA . ASN A 1 1817 ? 165.586 155.491 140.034 1.00 0.00 ? 1817 ASN A CA 5  
ATOM 8778   C CA . ASP A 1 1818 ? 165.182 152.000 138.636 1.00 0.00 ? 1818 ASP A CA 5  
ATOM 8779   C CA . GLY A 1 1819 ? 168.404 151.328 136.680 1.00 0.00 ? 1819 GLY A CA 5  
ATOM 8780   C CA . GLU A 1 1820 ? 167.424 147.936 135.204 1.00 0.00 ? 1820 GLU A CA 5  
ATOM 8781   C CA . GLU A 1 1821 ? 164.011 149.231 134.035 1.00 0.00 ? 1821 GLU A CA 5  
ATOM 8782   C CA . HIS A 1 1822 ? 165.415 152.695 133.115 1.00 0.00 ? 1822 HIS A CA 5  
ATOM 8783   C CA . GLN A 1 1823 ? 162.381 154.454 134.677 1.00 0.00 ? 1823 GLN A CA 5  
ATOM 8784   C CA . LYS A 1 1824 ? 162.191 156.902 137.618 1.00 0.00 ? 1824 LYS A CA 5  
ATOM 8785   C CA . ILE A 1 1825 ? 159.387 157.028 140.172 1.00 0.00 ? 1825 ILE A CA 5  
ATOM 8786   C CA . LEU A 1 1826 ? 158.078 159.504 142.677 1.00 0.00 ? 1826 LEU A CA 5  
ATOM 8787   C CA . LEU A 1 1827 ? 159.015 158.353 146.165 1.00 0.00 ? 1827 LEU A CA 5  
ATOM 8788   C CA . ASP A 1 1828 ? 156.307 160.393 147.872 1.00 0.00 ? 1828 ASP A CA 5  
ATOM 8789   C CA . ASP A 1 1829 ? 153.537 159.314 145.451 1.00 0.00 ? 1829 ASP A CA 5  
ATOM 8790   C CA . LEU A 1 1830 ? 154.112 155.565 146.043 1.00 0.00 ? 1830 LEU A CA 5  
ATOM 8791   C CA . MET A 1 1831 ? 154.765 156.107 149.794 1.00 0.00 ? 1831 MET A CA 5  
ATOM 8792   C CA . LYS A 1 1832 ? 151.584 158.190 150.444 1.00 0.00 ? 1832 LYS A CA 5  
ATOM 8793   C CA . LYS A 1 1833 ? 149.319 155.639 148.676 1.00 0.00 ? 1833 LYS A CA 5  
ATOM 8794   C CA . ALA A 1 1834 ? 149.380 153.637 151.906 1.00 0.00 ? 1834 ALA A CA 5  
ATOM 8795   C CA . GLU A 1 1835 ? 148.903 154.671 155.597 1.00 0.00 ? 1835 GLU A CA 5  
ATOM 8796   C CA . GLU A 1 1836 ? 152.517 155.825 155.955 1.00 0.00 ? 1836 GLU A CA 5  
ATOM 8797   C CA . GLY A 1 1837 ? 151.769 159.459 155.026 1.00 0.00 ? 1837 GLY A CA 5  
ATOM 8798   C CA . PHE A 1 1883 ? 174.723 144.815 183.471 1.00 0.00 ? 1883 PHE A CA 5  
ATOM 8799   C CA . LEU A 1 1884 ? 170.895 144.328 183.406 1.00 0.00 ? 1884 LEU A CA 5  
ATOM 8800   C CA . LEU A 1 1885 ? 168.496 147.277 184.137 1.00 0.00 ? 1885 LEU A CA 5  
ATOM 8801   C CA . GLY A 1 1886 ? 165.353 145.912 182.434 1.00 0.00 ? 1886 GLY A CA 5  
ATOM 8802   C CA . ASP A 1 1887 ? 161.895 147.330 183.089 1.00 0.00 ? 1887 ASP A CA 5  
ATOM 8803   C CA . GLY A 1 1888 ? 160.961 146.527 179.413 1.00 0.00 ? 1888 GLY A CA 5  
ATOM 8804   C CA . SER A 1 1889 ? 157.625 146.178 177.559 1.00 0.00 ? 1889 SER A CA 5  
ATOM 8805   C CA . PHE A 1 1890 ? 158.629 143.141 175.472 1.00 0.00 ? 1890 PHE A CA 5  
ATOM 8806   C CA . GLY A 1 1891 ? 161.948 142.081 177.012 1.00 0.00 ? 1891 GLY A CA 5  
ATOM 8807   C CA . SER A 1 1892 ? 165.030 142.889 179.065 1.00 0.00 ? 1892 SER A CA 5  
ATOM 8808   C CA . VAL A 1 1893 ? 167.059 146.138 178.920 1.00 0.00 ? 1893 VAL A CA 5  
ATOM 8809   C CA . TYR A 1 1894 ? 170.863 145.943 179.363 1.00 0.00 ? 1894 TYR A CA 5  
ATOM 8810   C CA . ARG A 1 1895 ? 173.616 148.513 179.820 1.00 0.00 ? 1895 ARG A CA 5  
ATOM 8811   C CA . ALA A 1 1896 ? 176.749 147.913 177.754 1.00 0.00 ? 1896 ALA A CA 5  
ATOM 8812   C CA . ALA A 1 1897 ? 179.218 149.650 175.417 1.00 0.00 ? 1897 ALA A CA 5  
ATOM 8813   C CA . TYR A 1 1898 ? 180.131 149.615 171.684 1.00 0.00 ? 1898 TYR A CA 5  
ATOM 8814   C CA . GLU A 1 1899 ? 183.661 148.093 171.462 1.00 0.00 ? 1899 GLU A CA 5  
ATOM 8815   C CA . GLY A 1 1900 ? 184.878 150.550 168.752 1.00 0.00 ? 1900 GLY A CA 5  
ATOM 8816   C CA . GLU A 1 1901 ? 183.890 153.880 170.418 1.00 0.00 ? 1901 GLU A CA 5  
ATOM 8817   C CA . GLU A 1 1902 ? 183.487 153.082 174.154 1.00 0.00 ? 1902 GLU A CA 5  
ATOM 8818   C CA . VAL A 1 1903 ? 180.031 154.813 173.681 1.00 0.00 ? 1903 VAL A CA 5  
ATOM 8819   C CA . ALA A 1 1904 ? 177.687 153.734 176.467 1.00 0.00 ? 1904 ALA A CA 5  
ATOM 8820   C CA . VAL A 1 1905 ? 174.723 151.896 175.121 1.00 0.00 ? 1905 VAL A CA 5  
ATOM 8821   C CA . LYS A 1 1906 ? 171.277 150.593 176.111 1.00 0.00 ? 1906 LYS A CA 5  
ATOM 8822   C CA . ILE A 1 1907 ? 170.199 147.221 174.618 1.00 0.00 ? 1907 ILE A CA 5  
ATOM 8823   C CA . PHE A 1 1908 ? 166.543 146.180 174.463 1.00 0.00 ? 1908 PHE A CA 5  
ATOM 8824   C CA . ASN A 1 1909 ? 165.964 142.488 173.586 1.00 0.00 ? 1909 ASN A CA 5  
ATOM 8825   C CA . LYS A 1 1910 ? 163.517 139.546 173.135 1.00 0.00 ? 1910 LYS A CA 5  
ATOM 8826   C CA . HIS A 1 1911 ? 161.348 141.632 170.981 1.00 0.00 ? 1911 HIS A CA 5  
ATOM 8827   C CA . THR A 1 1912 ? 162.055 139.937 167.615 1.00 0.00 ? 1912 THR A CA 5  
ATOM 8828   C CA . SER A 1 1913 ? 158.652 138.652 166.580 1.00 0.00 ? 1913 SER A CA 5  
ATOM 8829   C CA . LEU A 1 1914 ? 156.575 141.550 167.882 1.00 0.00 ? 1914 LEU A CA 5  
ATOM 8830   C CA . ARG A 1 1915 ? 154.641 144.081 165.821 1.00 0.00 ? 1915 ARG A CA 5  
ATOM 8831   C CA . LEU A 1 1916 ? 155.486 146.816 168.405 1.00 0.00 ? 1916 LEU A CA 5  
ATOM 8832   C CA . LEU A 1 1917 ? 159.320 146.247 168.073 1.00 0.00 ? 1917 LEU A CA 5  
ATOM 8833   C CA . ARG A 1 1918 ? 159.031 146.313 164.342 1.00 0.00 ? 1918 ARG A CA 5  
ATOM 8834   C CA . GLN A 1 1919 ? 157.228 149.638 164.444 1.00 0.00 ? 1919 GLN A CA 5  
ATOM 8835   C CA . GLU A 1 1920 ? 159.783 151.018 166.941 1.00 0.00 ? 1920 GLU A CA 5  
ATOM 8836   C CA . LEU A 1 1921 ? 162.710 149.976 164.665 1.00 0.00 ? 1921 LEU A CA 5  
ATOM 8837   C CA . VAL A 1 1922 ? 160.967 151.382 161.530 1.00 0.00 ? 1922 VAL A CA 5  
ATOM 8838   C CA . VAL A 1 1923 ? 160.118 154.748 163.217 1.00 0.00 ? 1923 VAL A CA 5  
ATOM 8839   C CA . LEU A 1 1924 ? 163.585 155.185 164.810 1.00 0.00 ? 1924 LEU A CA 5  
ATOM 8840   C CA . CYS A 1 1925 ? 165.517 154.322 161.579 1.00 0.00 ? 1925 CYS A CA 5  
ATOM 8841   C CA . HIS A 1 1926 ? 164.721 157.724 159.975 1.00 0.00 ? 1926 HIS A CA 5  
ATOM 8842   C CA . LEU A 1 1927 ? 165.045 159.885 163.146 1.00 0.00 ? 1927 LEU A CA 5  
ATOM 8843   C CA . HIS A 1 1928 ? 168.352 161.692 163.784 1.00 0.00 ? 1928 HIS A CA 5  
ATOM 8844   C CA . HIS A 1 1929 ? 167.993 164.693 166.141 1.00 0.00 ? 1929 HIS A CA 5  
ATOM 8845   C CA . PRO A 1 1930 ? 169.817 165.622 169.409 1.00 0.00 ? 1930 PRO A CA 5  
ATOM 8846   C CA . SER A 1 1931 ? 166.643 165.683 171.540 1.00 0.00 ? 1931 SER A CA 5  
ATOM 8847   C CA . LEU A 1 1932 ? 165.456 162.240 170.364 1.00 0.00 ? 1932 LEU A CA 5  
ATOM 8848   C CA . ILE A 1 1933 ? 166.944 158.966 171.683 1.00 0.00 ? 1933 ILE A CA 5  
ATOM 8849   C CA . SER A 1 1934 ? 169.192 157.720 168.865 1.00 0.00 ? 1934 SER A CA 5  
ATOM 8850   C CA . LEU A 1 1935 ? 169.070 154.190 167.505 1.00 0.00 ? 1935 LEU A CA 5  
ATOM 8851   C CA . LEU A 1 1936 ? 172.637 152.986 166.876 1.00 0.00 ? 1936 LEU A CA 5  
ATOM 8852   C CA . ALA A 1 1937 ? 172.063 149.532 165.397 1.00 0.00 ? 1937 ALA A CA 5  
ATOM 8853   C CA . ALA A 1 1938 ? 170.103 146.271 165.347 1.00 0.00 ? 1938 ALA A CA 5  
ATOM 8854   C CA . GLY A 1 1939 ? 171.254 142.850 166.653 1.00 0.00 ? 1939 GLY A CA 5  
ATOM 8855   C CA . ILE A 1 1940 ? 169.917 139.326 165.956 1.00 0.00 ? 1940 ILE A CA 5  
ATOM 8856   C CA . ARG A 1 1941 ? 169.601 136.086 168.000 1.00 0.00 ? 1941 ARG A CA 5  
ATOM 8857   C CA . PRO A 1 1942 ? 167.719 137.467 169.897 1.00 0.00 ? 1942 PRO A CA 5  
ATOM 8858   C CA . ARG A 1 1943 ? 166.647 140.642 168.071 1.00 0.00 ? 1943 ARG A CA 5  
ATOM 8859   C CA . MET A 1 1944 ? 168.051 143.736 169.822 1.00 0.00 ? 1944 MET A CA 5  
ATOM 8860   C CA . LEU A 1 1945 ? 167.671 147.476 169.444 1.00 0.00 ? 1945 LEU A CA 5  
ATOM 8861   C CA . VAL A 1 1946 ? 170.894 149.153 170.499 1.00 0.00 ? 1946 VAL A CA 5  
ATOM 8862   C CA . MET A 1 1947 ? 170.092 152.715 171.668 1.00 0.00 ? 1947 MET A CA 5  
ATOM 8863   C CA . GLU A 1 1948 ? 172.209 155.565 173.122 1.00 0.00 ? 1948 GLU A CA 5  
ATOM 8864   C CA . LEU A 1 1949 ? 172.402 155.371 176.939 1.00 0.00 ? 1949 LEU A CA 5  
ATOM 8865   C CA . ALA A 1 1950 ? 170.798 158.386 178.631 1.00 0.00 ? 1950 ALA A CA 5  
ATOM 8866   C CA . SER A 1 1951 ? 172.421 158.666 182.044 1.00 0.00 ? 1951 SER A CA 5  
ATOM 8867   C CA . LYS A 1 1952 ? 170.238 160.686 184.462 1.00 0.00 ? 1952 LYS A CA 5  
ATOM 8868   C CA . GLY A 1 1953 ? 167.018 158.632 184.340 1.00 0.00 ? 1953 GLY A CA 5  
ATOM 8869   C CA . SER A 1 1954 ? 163.581 159.922 183.327 1.00 0.00 ? 1954 SER A CA 5  
ATOM 8870   C CA . LEU A 1 1955 ? 161.638 163.152 183.945 1.00 0.00 ? 1955 LEU A CA 5  
ATOM 8871   C CA . ASP A 1 1956 ? 158.817 161.415 185.895 1.00 0.00 ? 1956 ASP A CA 5  
ATOM 8872   C CA . ARG A 1 1957 ? 161.139 159.927 188.571 1.00 0.00 ? 1957 ARG A CA 5  
ATOM 8873   C CA . LEU A 1 1958 ? 163.144 163.153 188.905 1.00 0.00 ? 1958 LEU A CA 5  
ATOM 8874   C CA . LEU A 1 1959 ? 159.990 165.271 189.441 1.00 0.00 ? 1959 LEU A CA 5  
ATOM 8875   C CA . GLN A 1 1960 ? 159.034 162.927 192.348 1.00 0.00 ? 1960 GLN A CA 5  
ATOM 8876   C CA . GLN A 1 1961 ? 162.021 164.410 194.303 1.00 0.00 ? 1961 GLN A CA 5  
ATOM 8877   C CA . ASP A 1 1962 ? 160.062 167.328 195.939 1.00 0.00 ? 1962 ASP A CA 5  
ATOM 8878   C CA . LYS A 1 1963 ? 162.955 168.132 198.361 1.00 0.00 ? 1963 LYS A CA 5  
ATOM 8879   C CA . ALA A 1 1964 ? 165.260 168.987 195.425 1.00 0.00 ? 1964 ALA A CA 5  
ATOM 8880   C CA . SER A 1 1965 ? 163.165 171.122 193.061 1.00 0.00 ? 1965 SER A CA 5  
ATOM 8881   C CA . LEU A 1 1966 ? 164.466 171.727 189.527 1.00 0.00 ? 1966 LEU A CA 5  
ATOM 8882   C CA . THR A 1 1967 ? 165.700 175.312 189.182 1.00 0.00 ? 1967 THR A CA 5  
ATOM 8883   C CA . ARG A 1 1968 ? 163.761 177.555 186.786 1.00 0.00 ? 1968 ARG A CA 5  
ATOM 8884   C CA . THR A 1 1969 ? 166.577 177.982 184.186 1.00 0.00 ? 1969 THR A CA 5  
ATOM 8885   C CA . LEU A 1 1970 ? 166.826 174.208 183.919 1.00 0.00 ? 1970 LEU A CA 5  
ATOM 8886   C CA . GLN A 1 1971 ? 162.994 173.796 183.687 1.00 0.00 ? 1971 GLN A CA 5  
ATOM 8887   C CA . HIS A 1 1972 ? 163.124 176.148 180.654 1.00 0.00 ? 1972 HIS A CA 5  
ATOM 8888   C CA . ARG A 1 1973 ? 165.950 174.058 179.107 1.00 0.00 ? 1973 ARG A CA 5  
ATOM 8889   C CA . ILE A 1 1974 ? 163.826 170.865 179.576 1.00 0.00 ? 1974 ILE A CA 5  
ATOM 8890   C CA . ALA A 1 1975 ? 160.735 172.540 178.019 1.00 0.00 ? 1975 ALA A CA 5  
ATOM 8891   C CA . LEU A 1 1976 ? 162.677 173.745 174.930 1.00 0.00 ? 1976 LEU A CA 5  
ATOM 8892   C CA . HIS A 1 1977 ? 164.524 170.411 174.379 1.00 0.00 ? 1977 HIS A CA 5  
ATOM 8893   C CA . VAL A 1 1978 ? 161.288 168.415 174.355 1.00 0.00 ? 1978 VAL A CA 5  
ATOM 8894   C CA . ALA A 1 1979 ? 159.743 171.100 172.083 1.00 0.00 ? 1979 ALA A CA 5  
ATOM 8895   C CA . ASP A 1 1980 ? 162.642 170.842 169.556 1.00 0.00 ? 1980 ASP A CA 5  
ATOM 8896   C CA . GLY A 1 1981 ? 162.357 167.016 169.466 1.00 0.00 ? 1981 GLY A CA 5  
ATOM 8897   C CA . LEU A 1 1982 ? 158.602 167.291 168.809 1.00 0.00 ? 1982 LEU A CA 5  
ATOM 8898   C CA . ARG A 1 1983 ? 159.332 170.100 166.269 1.00 0.00 ? 1983 ARG A CA 5  
ATOM 8899   C CA . TYR A 1 1984 ? 161.781 167.806 164.402 1.00 0.00 ? 1984 TYR A CA 5  
ATOM 8900   C CA . LEU A 1 1985 ? 158.990 165.238 164.608 1.00 0.00 ? 1985 LEU A CA 5  
ATOM 8901   C CA . HIS A 1 1986 ? 156.525 167.711 163.078 1.00 0.00 ? 1986 HIS A CA 5  
ATOM 8902   C CA . SER A 1 1987 ? 158.893 167.959 160.042 1.00 0.00 ? 1987 SER A CA 5  
ATOM 8903   C CA . ALA A 1 1988 ? 158.863 164.168 159.515 1.00 0.00 ? 1988 ALA A CA 5  
ATOM 8904   C CA . MET A 1 1989 ? 155.018 163.860 160.016 1.00 0.00 ? 1989 MET A CA 5  
ATOM 8905   C CA . ILE A 1 1990 ? 155.272 161.251 162.815 1.00 0.00 ? 1990 ILE A CA 5  
ATOM 8906   C CA . ILE A 1 1991 ? 152.787 160.906 165.748 1.00 0.00 ? 1991 ILE A CA 5  
ATOM 8907   C CA . TYR A 1 1992 ? 154.329 159.578 169.005 1.00 0.00 ? 1992 TYR A CA 5  
ATOM 8908   C CA . ARG A 1 1993 ? 151.097 158.902 171.006 1.00 0.00 ? 1993 ARG A CA 5  
ATOM 8909   C CA . ASP A 1 1994 ? 152.796 158.029 174.339 1.00 0.00 ? 1994 ASP A CA 5  
ATOM 8910   C CA . LEU A 1 1995 ? 154.212 161.442 175.315 1.00 0.00 ? 1995 LEU A CA 5  
ATOM 8911   C CA . LYS A 1 1996 ? 154.302 161.462 179.135 1.00 0.00 ? 1996 LYS A CA 5  
ATOM 8912   C CA . PRO A 1 1997 ? 157.178 162.242 181.570 1.00 0.00 ? 1997 PRO A CA 5  
ATOM 8913   C CA . HIS A 1 1998 ? 158.285 158.585 181.959 1.00 0.00 ? 1998 HIS A CA 5  
ATOM 8914   C CA . ASN A 1 1999 ? 159.196 158.661 178.240 1.00 0.00 ? 1999 ASN A CA 5  
ATOM 8915   C CA . VAL A 1 2000 ? 161.300 161.836 178.582 1.00 0.00 ? 2000 VAL A CA 5  
ATOM 8916   C CA . LEU A 1 2001 ? 164.884 160.732 179.284 1.00 0.00 ? 2001 LEU A CA 5  
ATOM 8917   C CA . LEU A 1 2002 ? 167.329 163.045 180.954 1.00 0.00 ? 2002 LEU A CA 5  
ATOM 8918   C CA . PHE A 1 2003 ? 170.823 163.396 179.534 1.00 0.00 ? 2003 PHE A CA 5  
ATOM 8919   C CA . THR A 1 2004 ? 172.042 166.184 181.816 1.00 0.00 ? 2004 THR A CA 5  
ATOM 8920   C CA . LEU A 1 2005 ? 170.526 168.601 184.436 1.00 0.00 ? 2005 LEU A CA 5  
ATOM 8921   C CA . TYR A 1 2006 ? 173.293 171.264 184.218 1.00 0.00 ? 2006 TYR A CA 5  
ATOM 8922   C CA . PRO A 1 2007 ? 171.656 174.315 182.509 1.00 0.00 ? 2007 PRO A CA 5  
ATOM 8923   C CA . ASN A 1 2008 ? 174.647 174.912 180.150 1.00 0.00 ? 2008 ASN A CA 5  
ATOM 8924   C CA . ALA A 1 2009 ? 174.699 171.298 178.845 1.00 0.00 ? 2009 ALA A CA 5  
ATOM 8925   C CA . ALA A 1 2010 ? 174.452 170.668 175.089 1.00 0.00 ? 2010 ALA A CA 5  
ATOM 8926   C CA . ILE A 1 2011 ? 171.459 168.350 175.661 1.00 0.00 ? 2011 ILE A CA 5  
ATOM 8927   C CA . ILE A 1 2012 ? 169.244 168.064 178.790 1.00 0.00 ? 2012 ILE A CA 5  
ATOM 8928   C CA . ALA A 1 2013 ? 166.264 166.031 177.650 1.00 0.00 ? 2013 ALA A CA 5  
ATOM 8929   C CA . LYS A 1 2014 ? 165.501 163.522 174.938 1.00 0.00 ? 2014 LYS A CA 5  
ATOM 8930   C CA . ILE A 1 2015 ? 162.176 162.010 173.816 1.00 0.00 ? 2015 ILE A CA 5  
ATOM 8931   C CA . ALA A 1 2016 ? 162.102 158.177 174.012 1.00 0.00 ? 2016 ALA A CA 5  
ATOM 8932   C CA . ASP A 1 2017 ? 159.877 155.084 173.683 1.00 0.00 ? 2017 ASP A CA 5  
ATOM 8933   C CA . TYR A 1 2018 ? 158.320 155.286 170.237 1.00 0.00 ? 2018 TYR A CA 5  
ATOM 8934   C CA . GLY A 1 2019 ? 156.753 151.806 170.334 1.00 0.00 ? 2019 GLY A CA 5  
ATOM 8935   C CA . THR A 1 2020 ? 153.247 153.069 169.662 1.00 0.00 ? 2020 THR A CA 5  
ATOM 8936   C CA . ALA A 1 2021 ? 154.153 155.741 167.033 1.00 0.00 ? 2021 ALA A CA 5  
ATOM 8937   C CA . GLN A 1 2022 ? 152.500 156.346 163.606 1.00 0.00 ? 2022 GLN A CA 5  
ATOM 8938   C CA . TYR A 1 2023 ? 153.810 157.868 160.389 1.00 0.00 ? 2023 TYR A CA 5  
ATOM 8939   C CA . CYS A 1 2024 ? 151.086 157.755 157.758 1.00 0.00 ? 2024 CYS A CA 5  
ATOM 8940   C CA . CYS A 1 2025 ? 149.845 159.788 154.763 1.00 0.00 ? 2025 CYS A CA 5  
ATOM 8941   C CA . ARG A 1 2026 ? 146.311 158.778 155.787 1.00 0.00 ? 2026 ARG A CA 5  
ATOM 8942   C CA . MET A 1 2027 ? 144.285 159.631 158.880 1.00 0.00 ? 2027 MET A CA 5  
ATOM 8943   C CA . GLY A 1 2028 ? 145.540 158.096 162.178 1.00 0.00 ? 2028 GLY A CA 5  
ATOM 8944   C CA . ILE A 1 2029 ? 143.247 156.378 164.728 1.00 0.00 ? 2029 ILE A CA 5  
ATOM 8945   C CA . LYS A 1 2030 ? 143.607 154.630 168.180 1.00 0.00 ? 2030 LYS A CA 5  
ATOM 8946   C CA . THR A 1 2031 ? 141.700 153.369 171.363 1.00 0.00 ? 2031 THR A CA 5  
ATOM 8947   C CA . SER A 1 2032 ? 144.419 151.633 173.279 1.00 0.00 ? 2032 SER A CA 5  
ATOM 8948   C CA . GLU A 1 2033 ? 146.598 154.464 174.607 1.00 0.00 ? 2033 GLU A CA 5  
ATOM 8949   C CA . GLY A 1 2034 ? 144.245 154.328 177.602 1.00 0.00 ? 2034 GLY A CA 5  
ATOM 8950   C CA . THR A 1 2035 ? 146.286 156.666 179.925 1.00 0.00 ? 2035 THR A CA 5  
ATOM 8951   C CA . PRO A 1 2036 ? 143.998 159.675 179.395 1.00 0.00 ? 2036 PRO A CA 5  
ATOM 8952   C CA . GLY A 1 2037 ? 145.551 162.142 181.905 1.00 0.00 ? 2037 GLY A CA 5  
ATOM 8953   C CA . PHE A 1 2038 ? 148.229 162.775 179.249 1.00 0.00 ? 2038 PHE A CA 5  
ATOM 8954   C CA . ARG A 1 2039 ? 146.199 162.060 176.066 1.00 0.00 ? 2039 ARG A CA 5  
ATOM 8955   C CA . ALA A 1 2040 ? 144.141 164.296 173.780 1.00 0.00 ? 2040 ALA A CA 5  
ATOM 8956   C CA . PRO A 1 2041 ? 140.262 164.225 174.047 1.00 0.00 ? 2041 PRO A CA 5  
ATOM 8957   C CA . GLU A 1 2042 ? 139.915 161.977 170.938 1.00 0.00 ? 2042 GLU A CA 5  
ATOM 8958   C CA . VAL A 1 2043 ? 140.438 159.112 173.507 1.00 0.00 ? 2043 VAL A CA 5  
ATOM 8959   C CA . ALA A 1 2044 ? 136.669 158.709 173.458 1.00 0.00 ? 2044 ALA A CA 5  
ATOM 8960   C CA . ARG A 1 2045 ? 136.730 155.560 171.156 1.00 0.00 ? 2045 ARG A CA 5  
ATOM 8961   C CA . GLY A 1 2046 ? 138.308 153.873 167.981 1.00 0.00 ? 2046 GLY A CA 5  
ATOM 8962   C CA . ASN A 1 2047 ? 135.864 155.409 165.599 1.00 0.00 ? 2047 ASN A CA 5  
ATOM 8963   C CA . VAL A 1 2048 ? 137.534 158.886 165.521 1.00 0.00 ? 2048 VAL A CA 5  
ATOM 8964   C CA . ILE A 1 2049 ? 140.553 160.105 163.566 1.00 0.00 ? 2049 ILE A CA 5  
ATOM 8965   C CA . TYR A 1 2050 ? 143.324 162.429 164.661 1.00 0.00 ? 2050 TYR A CA 5  
ATOM 8966   C CA . ASN A 1 2051 ? 146.783 163.842 163.771 1.00 0.00 ? 2051 ASN A CA 5  
ATOM 8967   C CA . GLN A 1 2052 ? 150.120 165.080 165.308 1.00 0.00 ? 2052 GLN A CA 5  
ATOM 8968   C CA . GLN A 1 2053 ? 147.968 167.627 167.145 1.00 0.00 ? 2053 GLN A CA 5  
ATOM 8969   C CA . ALA A 1 2054 ? 147.327 164.791 169.650 1.00 0.00 ? 2054 ALA A CA 5  
ATOM 8970   C CA . ASP A 1 2055 ? 151.062 164.906 170.619 1.00 0.00 ? 2055 ASP A CA 5  
ATOM 8971   C CA . VAL A 1 2056 ? 150.799 168.743 170.879 1.00 0.00 ? 2056 VAL A CA 5  
ATOM 8972   C CA . TYR A 1 2057 ? 148.167 168.142 173.610 1.00 0.00 ? 2057 TYR A CA 5  
ATOM 8973   C CA . SER A 1 2058 ? 150.463 165.569 175.342 1.00 0.00 ? 2058 SER A CA 5  
ATOM 8974   C CA . PHE A 1 2059 ? 153.246 168.226 175.224 1.00 0.00 ? 2059 PHE A CA 5  
ATOM 8975   C CA . GLY A 1 2060 ? 151.021 170.773 177.105 1.00 0.00 ? 2060 GLY A CA 5  
ATOM 8976   C CA . LEU A 1 2061 ? 150.708 168.216 179.908 1.00 0.00 ? 2061 LEU A CA 5  
ATOM 8977   C CA . LEU A 1 2062 ? 154.542 167.772 179.856 1.00 0.00 ? 2062 LEU A CA 5  
ATOM 8978   C CA . LEU A 1 2063 ? 154.911 171.564 180.273 1.00 0.00 ? 2063 LEU A CA 5  
ATOM 8979   C CA . TYR A 1 2064 ? 152.389 171.521 183.177 1.00 0.00 ? 2064 TYR A CA 5  
ATOM 8980   C CA . ASP A 1 2065 ? 154.243 168.645 184.962 1.00 0.00 ? 2065 ASP A CA 5  
ATOM 8981   C CA . ILE A 1 2066 ? 157.664 170.449 184.539 1.00 0.00 ? 2066 ILE A CA 5  
ATOM 8982   C CA . LEU A 1 2067 ? 156.199 173.814 185.699 1.00 0.00 ? 2067 LEU A CA 5  
ATOM 8983   C CA . THR A 1 2068 ? 154.444 172.394 188.760 1.00 0.00 ? 2068 THR A CA 5  
ATOM 8984   C CA . THR A 1 2069 ? 156.369 169.188 189.709 1.00 0.00 ? 2069 THR A CA 5  
ATOM 8985   C CA . GLY A 1 2070 ? 152.873 167.574 189.920 1.00 0.00 ? 2070 GLY A CA 5  
ATOM 8986   C CA . GLY A 1 2071 ? 151.025 164.956 187.822 1.00 0.00 ? 2071 GLY A CA 5  
ATOM 8987   C CA . ARG A 1 2072 ? 147.731 163.024 187.721 1.00 0.00 ? 2072 ARG A CA 5  
ATOM 8988   C CA . ILE A 1 2073 ? 146.545 159.790 185.982 1.00 0.00 ? 2073 ILE A CA 5  
ATOM 8989   C CA . VAL A 1 2074 ? 142.789 159.270 185.792 1.00 0.00 ? 2074 VAL A CA 5  
ATOM 8990   C CA . GLU A 1 2075 ? 140.661 156.380 184.392 1.00 0.00 ? 2075 GLU A CA 5  
ATOM 8991   C CA . GLY A 1 2076 ? 136.856 155.833 184.101 1.00 0.00 ? 2076 GLY A CA 5  
ATOM 8992   C CA . LEU A 1 2077 ? 133.785 157.383 182.433 1.00 0.00 ? 2077 LEU A CA 5  
ATOM 8993   C CA . LYS A 1 2078 ? 133.031 160.665 184.244 1.00 0.00 ? 2078 LYS A CA 5  
ATOM 8994   C CA . PHE A 1 2079 ? 136.692 161.818 183.923 1.00 0.00 ? 2079 PHE A CA 5  
ATOM 8995   C CA . PRO A 1 2080 ? 136.866 161.292 180.051 1.00 0.00 ? 2080 PRO A CA 5  
ATOM 8996   C CA . ASN A 1 2081 ? 133.433 163.003 179.654 1.00 0.00 ? 2081 ASN A CA 5  
ATOM 8997   C CA . GLU A 1 2082 ? 134.742 165.922 181.738 1.00 0.00 ? 2082 GLU A CA 5  
ATOM 8998   C CA . PHE A 1 2083 ? 137.974 166.155 179.702 1.00 0.00 ? 2083 PHE A CA 5  
ATOM 8999   C CA . ASP A 1 2084 ? 136.220 165.719 176.286 1.00 0.00 ? 2084 ASP A CA 5  
ATOM 9000   C CA . GLU A 1 2085 ? 132.909 167.672 176.734 1.00 0.00 ? 2085 GLU A CA 5  
ATOM 9001   C CA . LEU A 1 2086 ? 133.458 170.045 179.730 1.00 0.00 ? 2086 LEU A CA 5  
ATOM 9002   C CA . GLU A 1 2087 ? 136.987 171.346 178.850 1.00 0.00 ? 2087 GLU A CA 5  
ATOM 9003   C CA . ILE A 1 2088 ? 138.591 170.002 182.107 1.00 0.00 ? 2088 ILE A CA 5  
ATOM 9004   C CA . GLN A 1 2089 ? 142.356 170.443 182.099 1.00 0.00 ? 2089 GLN A CA 5  
ATOM 9005   C CA . GLY A 1 2090 ? 145.036 170.835 184.777 1.00 0.00 ? 2090 GLY A CA 5  
ATOM 9006   C CA . LYS A 1 2091 ? 145.022 174.635 184.362 1.00 0.00 ? 2091 LYS A CA 5  
ATOM 9007   C CA . LEU A 1 2092 ? 141.197 175.035 184.426 1.00 0.00 ? 2092 LEU A CA 5  
ATOM 9008   C CA . PRO A 1 2093 ? 140.529 173.021 187.682 1.00 0.00 ? 2093 PRO A CA 5  
ATOM 9009   C CA . ASP A 1 2094 ? 143.303 174.854 189.571 1.00 0.00 ? 2094 ASP A CA 5  
ATOM 9010   C CA . PRO A 1 2095 ? 143.400 178.638 188.554 1.00 0.00 ? 2095 PRO A CA 5  
ATOM 9011   C CA . VAL A 1 2096 ? 144.901 179.513 191.981 1.00 0.00 ? 2096 VAL A CA 5  
ATOM 9012   C CA . LYS A 1 2097 ? 147.734 176.927 191.735 1.00 0.00 ? 2097 LYS A CA 5  
ATOM 9013   C CA . GLU A 1 2098 ? 149.004 178.366 188.468 1.00 0.00 ? 2098 GLU A CA 5  
ATOM 9014   C CA . TYR A 1 2099 ? 147.544 181.973 188.059 1.00 0.00 ? 2099 TYR A CA 5  
ATOM 9015   C CA . GLY A 1 2100 ? 147.971 182.886 191.806 1.00 0.00 ? 2100 GLY A CA 5  
ATOM 9016   C CA . CYS A 1 2101 ? 151.708 182.061 191.656 1.00 0.00 ? 2101 CYS A CA 5  
ATOM 9017   C CA . ALA A 1 2102 ? 151.989 184.190 188.473 1.00 0.00 ? 2102 ALA A CA 5  
ATOM 9018   C CA . PRO A 1 2103 ? 153.626 181.703 185.949 1.00 0.00 ? 2103 PRO A CA 5  
ATOM 9019   C CA . TRP A 1 2104 ? 154.953 183.737 182.958 1.00 0.00 ? 2104 TRP A CA 5  
ATOM 9020   C CA . PRO A 1 2105 ? 151.912 184.794 180.809 1.00 0.00 ? 2105 PRO A CA 5  
ATOM 9021   C CA . MET A 1 2106 ? 153.595 183.550 177.595 1.00 0.00 ? 2106 MET A CA 5  
ATOM 9022   C CA . VAL A 1 2107 ? 154.087 180.047 179.174 1.00 0.00 ? 2107 VAL A CA 5  
ATOM 9023   C CA . GLU A 1 2108 ? 150.446 180.126 180.319 1.00 0.00 ? 2108 GLU A CA 5  
ATOM 9024   C CA . LYS A 1 2109 ? 149.223 181.066 176.799 1.00 0.00 ? 2109 LYS A CA 5  
ATOM 9025   C CA . LEU A 1 2110 ? 151.284 178.266 175.227 1.00 0.00 ? 2110 LEU A CA 5  
ATOM 9026   C CA . ILE A 1 2111 ? 149.964 175.551 177.640 1.00 0.00 ? 2111 ILE A CA 5  
ATOM 9027   C CA . LYS A 1 2112 ? 146.353 176.752 177.073 1.00 0.00 ? 2112 LYS A CA 5  
ATOM 9028   C CA . GLN A 1 2113 ? 146.693 176.788 173.263 1.00 0.00 ? 2113 GLN A CA 5  
ATOM 9029   C CA . CYS A 1 2114 ? 148.474 173.373 173.241 1.00 0.00 ? 2114 CYS A CA 5  
ATOM 9030   C CA . LEU A 1 2115 ? 145.675 171.790 175.352 1.00 0.00 ? 2115 LEU A CA 5  
ATOM 9031   C CA . LYS A 1 2116 ? 142.794 173.168 173.238 1.00 0.00 ? 2116 LYS A CA 5  
ATOM 9032   C CA . GLU A 1 2117 ? 139.832 170.796 172.782 1.00 0.00 ? 2117 GLU A CA 5  
ATOM 9033   C CA . ASN A 1 2118 ? 139.765 171.718 169.095 1.00 0.00 ? 2118 ASN A CA 5  
ATOM 9034   C CA . PRO A 1 2119 ? 142.975 170.161 167.542 1.00 0.00 ? 2119 PRO A CA 5  
ATOM 9035   C CA . GLN A 1 2120 ? 143.232 172.963 164.927 1.00 0.00 ? 2120 GLN A CA 5  
ATOM 9036   C CA . GLU A 1 2121 ? 143.748 175.686 167.584 1.00 0.00 ? 2121 GLU A CA 5  
ATOM 9037   C CA . ARG A 1 2122 ? 146.803 173.918 169.025 1.00 0.00 ? 2122 ARG A CA 5  
ATOM 9038   C CA . PRO A 1 2123 ? 149.906 175.742 167.637 1.00 0.00 ? 2123 PRO A CA 5  
ATOM 9039   C CA . THR A 1 2124 ? 152.598 174.731 165.139 1.00 0.00 ? 2124 THR A CA 5  
ATOM 9040   C CA . SER A 1 2125 ? 155.852 173.847 166.958 1.00 0.00 ? 2125 SER A CA 5  
ATOM 9041   C CA . ALA A 1 2126 ? 157.697 176.798 165.384 1.00 0.00 ? 2126 ALA A CA 5  
ATOM 9042   C CA . GLN A 1 2127 ? 155.367 179.133 167.380 1.00 0.00 ? 2127 GLN A CA 5  
ATOM 9043   C CA . VAL A 1 2128 ? 155.864 176.922 170.477 1.00 0.00 ? 2128 VAL A CA 5  
ATOM 9044   C CA . PHE A 1 2129 ? 159.691 177.077 170.188 1.00 0.00 ? 2129 PHE A CA 5  
ATOM 9045   C CA . ASP A 1 2130 ? 159.709 180.896 169.611 1.00 0.00 ? 2130 ASP A CA 5  
ATOM 9046   C CA . ILE A 1 2131 ? 157.457 181.463 172.685 1.00 0.00 ? 2131 ILE A CA 5  
ATOM 9047   C CA . LEU A 1 2132 ? 159.508 179.115 174.979 1.00 0.00 ? 2132 LEU A CA 5  
ATOM 9048   C CA . ASN A 1 2133 ? 162.747 180.851 173.874 1.00 0.00 ? 2133 ASN A CA 5  
ATOM 9049   C CA . SER A 1 2134 ? 161.351 184.233 175.131 1.00 0.00 ? 2134 SER A CA 5  
ATOM 9050   C CA . ALA A 1 2135 ? 160.866 183.046 178.781 1.00 0.00 ? 2135 ALA A CA 5  
ATOM 9051   C CA . ARG A 1 2142 ? 149.690 191.897 181.134 1.00 0.00 ? 2142 ARG A CA 5  
ATOM 9052   C CA . ARG A 1 2143 ? 147.255 194.664 180.225 1.00 0.00 ? 2143 ARG A CA 5  
ATOM 9053   C CA . ILE A 1 2144 ? 146.417 197.472 182.659 1.00 0.00 ? 2144 ILE A CA 5  
ATOM 9054   C CA . LEU A 1 2145 ? 143.282 199.420 181.754 1.00 0.00 ? 2145 LEU A CA 5  
ATOM 9055   C CA . LEU A 1 2146 ? 143.336 203.118 182.563 1.00 0.00 ? 2146 LEU A CA 5  
ATOM 9056   C CA . PRO A 1 2147 ? 140.156 204.832 183.798 1.00 0.00 ? 2147 PRO A CA 5  
ATOM 9057   C CA . LYS A 1 2148 ? 137.601 205.366 181.060 1.00 0.00 ? 2148 LYS A CA 5  
ATOM 9058   C CA . ASN A 1 2149 ? 138.225 208.333 178.693 1.00 0.00 ? 2149 ASN A CA 5  
ATOM 9059   C CA . VAL A 1 2150 ? 141.724 208.996 180.091 1.00 0.00 ? 2150 VAL A CA 5  
ATOM 9060   C CA . ILE A 1 2151 ? 143.923 210.033 177.155 1.00 0.00 ? 2151 ILE A CA 5  
ATOM 9061   C CA . VAL A 1 2152 ? 147.697 209.826 177.610 1.00 0.00 ? 2152 VAL A CA 5  
ATOM 9062   C CA . GLU A 1 2153 ? 149.891 212.399 175.874 1.00 0.00 ? 2153 GLU A CA 5  
ATOM 9063   C CA . CYS A 1 2154 ? 153.206 211.373 177.431 1.00 0.00 ? 2154 CYS A CA 5  
ATOM 9064   C CA . MET A 1 2155 ? 154.616 208.789 179.793 1.00 0.00 ? 2155 MET A CA 5  
ATOM 9065   C CA . VAL A 1 2156 ? 157.736 208.145 181.905 1.00 0.00 ? 2156 VAL A CA 5  
ATOM 9066   C CA . ALA A 1 2157 ? 158.556 205.067 183.980 1.00 0.00 ? 2157 ALA A CA 5  
ATOM 9067   C CA . THR A 1 2158 ? 160.104 204.606 187.418 1.00 0.00 ? 2158 THR A CA 5  
ATOM 9068   C CA . ASN A 1 2164 ? 156.073 198.603 193.179 1.00 0.00 ? 2164 ASN A CA 5  
ATOM 9069   C CA . ALA A 1 2165 ? 157.018 199.982 189.783 1.00 0.00 ? 2165 ALA A CA 5  
ATOM 9070   C CA . SER A 1 2166 ? 154.949 202.915 188.590 1.00 0.00 ? 2166 SER A CA 5  
ATOM 9071   C CA . ILE A 1 2167 ? 154.531 205.429 185.787 1.00 0.00 ? 2167 ILE A CA 5  
ATOM 9072   C CA . TRP A 1 2168 ? 153.886 209.166 185.425 1.00 0.00 ? 2168 TRP A CA 5  
ATOM 9073   C CA . LEU A 1 2169 ? 151.358 210.165 182.758 1.00 0.00 ? 2169 LEU A CA 5  
ATOM 9074   C CA . GLY A 1 2170 ? 150.550 213.465 181.083 1.00 0.00 ? 2170 GLY A CA 5  
ATOM 9075   C CA . CYS A 1 2171 ? 146.874 213.728 180.214 1.00 0.00 ? 2171 CYS A CA 5  
ATOM 9076   C CA . GLY A 1 2172 ? 145.372 214.791 176.891 1.00 0.00 ? 2172 GLY A CA 5  
ATOM 9077   C CA . HIS A 1 2173 ? 141.675 214.671 177.754 1.00 0.00 ? 2173 HIS A CA 5  
ATOM 9078   C CA . THR A 1 2174 ? 141.931 218.116 179.383 1.00 0.00 ? 2174 THR A CA 5  
ATOM 9079   C CA . ASP A 1 2175 ? 142.993 221.612 178.355 1.00 0.00 ? 2175 ASP A CA 5  
ATOM 9080   C CA . ARG A 1 2176 ? 144.882 222.191 181.633 1.00 0.00 ? 2176 ARG A CA 5  
ATOM 9081   C CA . GLY A 1 2177 ? 147.919 220.520 183.169 1.00 0.00 ? 2177 GLY A CA 5  
ATOM 9082   C CA . GLN A 1 2178 ? 146.947 217.244 184.849 1.00 0.00 ? 2178 GLN A CA 5  
ATOM 9083   C CA . LEU A 1 2179 ? 149.661 214.893 186.128 1.00 0.00 ? 2179 LEU A CA 5  
ATOM 9084   C CA . SER A 1 2180 ? 148.664 211.260 186.697 1.00 0.00 ? 2180 SER A CA 5  
ATOM 9085   C CA . PHE A 1 2181 ? 150.332 208.378 188.527 1.00 0.00 ? 2181 PHE A CA 5  
ATOM 9086   C CA . LEU A 1 2182 ? 149.899 204.643 187.913 1.00 0.00 ? 2182 LEU A CA 5  
ATOM 9087   C CA . ASP A 1 2183 ? 151.131 201.884 190.235 1.00 0.00 ? 2183 ASP A CA 5  
ATOM 9088   C CA . LEU A 1 2184 ? 152.039 199.086 187.813 1.00 0.00 ? 2184 LEU A CA 5  
ATOM 9089   C CA . ASN A 1 2185 ? 151.606 196.514 190.616 1.00 0.00 ? 2185 ASN A CA 5  
ATOM 9090   C CA . THR A 1 2186 ? 148.232 197.552 192.072 1.00 0.00 ? 2186 THR A CA 5  
ATOM 9091   C CA . GLU A 1 2187 ? 146.923 199.203 188.861 1.00 0.00 ? 2187 GLU A CA 5  
ATOM 9092   C CA . GLY A 1 2188 ? 145.897 202.148 191.043 1.00 0.00 ? 2188 GLY A CA 5  
ATOM 9093   C CA . TYR A 1 2189 ? 145.490 205.498 189.304 1.00 0.00 ? 2189 TYR A CA 5  
ATOM 9094   C CA . THR A 1 2190 ? 145.652 208.987 190.813 1.00 0.00 ? 2190 THR A CA 5  
ATOM 9095   C CA . SER A 1 2191 ? 145.836 212.390 189.140 1.00 0.00 ? 2191 SER A CA 5  
ATOM 9096   C CA . GLU A 1 2192 ? 146.301 216.035 190.097 1.00 0.00 ? 2192 GLU A CA 5  
ATOM 9097   C CA . GLU A 1 2193 ? 145.721 219.251 188.143 1.00 0.00 ? 2193 GLU A CA 5  
ATOM 9098   C CA . VAL A 1 2194 ? 149.158 220.842 188.361 1.00 0.00 ? 2194 VAL A CA 5  
ATOM 9099   C CA . ALA A 1 2195 ? 149.471 223.452 185.573 1.00 0.00 ? 2195 ALA A CA 5  
ATOM 9100   C CA . ASP A 1 2196 ? 147.461 225.849 183.405 1.00 0.00 ? 2196 ASP A CA 5  
ATOM 9101   C CA . SER A 1 2197 ? 148.016 224.165 180.015 1.00 0.00 ? 2197 SER A CA 5  
ATOM 9102   C CA . ARG A 1 2198 ? 148.131 220.587 178.764 1.00 0.00 ? 2198 ARG A CA 5  
ATOM 9103   C CA . ILE A 1 2199 ? 151.183 218.598 179.843 1.00 0.00 ? 2199 ILE A CA 5  
ATOM 9104   C CA . LEU A 1 2200 ? 152.922 217.686 176.584 1.00 0.00 ? 2200 LEU A CA 5  
ATOM 9105   C CA . CYS A 1 2201 ? 155.997 215.793 177.793 1.00 0.00 ? 2201 CYS A CA 5  
ATOM 9106   C CA . LEU A 1 2202 ? 157.576 214.347 180.931 1.00 0.00 ? 2202 LEU A CA 5  
ATOM 9107   C CA . ALA A 1 2203 ? 161.147 213.768 182.080 1.00 0.00 ? 2203 ALA A CA 5  
ATOM 9108   C CA . LEU A 1 2204 ? 162.460 212.298 185.333 1.00 0.00 ? 2204 LEU A CA 5  
ATOM 9109   C CA . VAL A 1 2205 ? 165.589 214.010 186.681 1.00 0.00 ? 2205 VAL A CA 5  
ATOM 9110   C CA . HIS A 1 2206 ? 167.316 211.905 189.340 1.00 0.00 ? 2206 HIS A CA 5  
ATOM 9111   C CA . LEU A 1 2207 ? 170.009 213.382 191.582 1.00 0.00 ? 2207 LEU A CA 5  
ATOM 9112   C CA . PRO A 1 2208 ? 172.043 210.517 193.118 1.00 0.00 ? 2208 PRO A CA 5  
ATOM 9113   C CA . VAL A 1 2209 ? 173.850 212.811 195.476 1.00 0.00 ? 2209 VAL A CA 5  
ATOM 9114   C CA . GLU A 1 2210 ? 171.226 214.772 197.453 1.00 0.00 ? 2210 GLU A CA 5  
ATOM 9115   C CA . LYS A 1 2211 ? 169.028 211.668 196.947 1.00 0.00 ? 2211 LYS A CA 5  
ATOM 9116   C CA . GLU A 1 2212 ? 166.218 213.441 195.139 1.00 0.00 ? 2212 GLU A CA 5  
ATOM 9117   C CA . SER A 1 2213 ? 164.013 212.750 192.118 1.00 0.00 ? 2213 SER A CA 5  
ATOM 9118   C CA . TRP A 1 2214 ? 162.106 215.505 190.311 1.00 0.00 ? 2214 TRP A CA 5  
ATOM 9119   C CA . ILE A 1 2215 ? 159.388 215.012 187.698 1.00 0.00 ? 2215 ILE A CA 5  
ATOM 9120   C CA . VAL A 1 2216 ? 159.509 217.687 184.985 1.00 0.00 ? 2216 VAL A CA 5  
ATOM 9121   C CA . SER A 1 2217 ? 156.379 218.518 182.981 1.00 0.00 ? 2217 SER A CA 5  
ATOM 9122   C CA . GLY A 1 2218 ? 156.582 220.438 179.712 1.00 0.00 ? 2218 GLY A CA 5  
ATOM 9123   C CA . THR A 1 2219 ? 153.345 222.153 178.742 1.00 0.00 ? 2219 THR A CA 5  
ATOM 9124   C CA . GLN A 1 2220 ? 151.486 223.704 175.809 1.00 0.00 ? 2220 GLN A CA 5  
ATOM 9125   C CA . SER A 1 2221 ? 152.250 227.224 177.094 1.00 0.00 ? 2221 SER A CA 5  
ATOM 9126   C CA . GLY A 1 2222 ? 156.019 226.748 177.461 1.00 0.00 ? 2222 GLY A CA 5  
ATOM 9127   C CA . THR A 1 2223 ? 156.048 226.249 181.233 1.00 0.00 ? 2223 THR A CA 5  
ATOM 9128   C CA . LEU A 1 2224 ? 158.502 223.771 182.773 1.00 0.00 ? 2224 LEU A CA 5  
ATOM 9129   C CA . LEU A 1 2225 ? 156.921 222.591 186.032 1.00 0.00 ? 2225 LEU A CA 5  
ATOM 9130   C CA . VAL A 1 2226 ? 159.262 220.708 188.386 1.00 0.00 ? 2226 VAL A CA 5  
ATOM 9131   C CA . ILE A 1 2227 ? 157.657 218.652 191.168 1.00 0.00 ? 2227 ILE A CA 5  
ATOM 9132   C CA . ASN A 1 2228 ? 159.311 216.554 193.875 1.00 0.00 ? 2228 ASN A CA 5  
ATOM 9133   C CA . THR A 1 2229 ? 158.565 212.832 193.799 1.00 0.00 ? 2229 THR A CA 5  
ATOM 9134   C CA . GLU A 1 2230 ? 158.468 212.344 197.576 1.00 0.00 ? 2230 GLU A CA 5  
ATOM 9135   C CA . ASP A 1 2231 ? 156.864 215.643 198.685 1.00 0.00 ? 2231 ASP A CA 5  
ATOM 9136   C CA . GLY A 1 2232 ? 154.407 217.109 196.175 1.00 0.00 ? 2232 GLY A CA 5  
ATOM 9137   C CA . LYS A 1 2233 ? 154.422 220.358 198.164 1.00 0.00 ? 2233 LYS A CA 5  
ATOM 9138   C CA . LYS A 1 2234 ? 157.931 220.916 196.735 1.00 0.00 ? 2234 LYS A CA 5  
ATOM 9139   C CA . ARG A 1 2235 ? 157.339 222.339 193.263 1.00 0.00 ? 2235 ARG A CA 5  
ATOM 9140   C CA . HIS A 1 2236 ? 158.529 225.293 191.208 1.00 0.00 ? 2236 HIS A CA 5  
ATOM 9141   C CA . THR A 1 2237 ? 158.956 226.536 187.641 1.00 0.00 ? 2237 THR A CA 5  
ATOM 9142   C CA . LEU A 1 2238 ? 162.024 226.939 185.427 1.00 0.00 ? 2238 LEU A CA 5  
ATOM 9143   C CA . GLU A 1 2239 ? 162.412 229.646 182.777 1.00 0.00 ? 2239 GLU A CA 5  
ATOM 9144   C CA . LYS A 1 2240 ? 159.355 229.915 180.549 1.00 0.00 ? 2240 LYS A CA 5  
ATOM 9145   C CA . MET A 1 2241 ? 159.849 228.759 176.966 1.00 0.00 ? 2241 MET A CA 5  
ATOM 9146   C CA . THR A 1 2242 ? 158.892 230.985 174.046 1.00 0.00 ? 2242 THR A CA 5  
ATOM 9147   C CA . ASP A 1 2243 ? 156.684 228.203 172.629 1.00 0.00 ? 2243 ASP A CA 5  
ATOM 9148   C CA . SER A 1 2244 ? 155.173 224.929 173.809 1.00 0.00 ? 2244 SER A CA 5  
ATOM 9149   C CA . VAL A 1 2245 ? 157.514 222.268 175.177 1.00 0.00 ? 2245 VAL A CA 5  
ATOM 9150   C CA . THR A 1 2246 ? 157.436 219.353 172.732 1.00 0.00 ? 2246 THR A CA 5  
ATOM 9151   C CA . CYS A 1 2247 ? 160.416 217.294 173.938 1.00 0.00 ? 2247 CYS A CA 5  
ATOM 9152   C CA . LEU A 1 2248 ? 162.074 216.352 177.236 1.00 0.00 ? 2248 LEU A CA 5  
ATOM 9153   C CA . TYR A 1 2249 ? 165.136 214.104 177.377 1.00 0.00 ? 2249 TYR A CA 5  
ATOM 9154   C CA . CYS A 1 2250 ? 167.637 213.351 180.148 1.00 0.00 ? 2250 CYS A CA 5  
ATOM 9155   C CA . ASN A 1 2251 ? 171.210 213.050 178.885 1.00 0.00 ? 2251 ASN A CA 5  
ATOM 9156   C CA . SER A 1 2252 ? 174.711 212.437 180.223 1.00 0.00 ? 2252 SER A CA 5  
ATOM 9157   C CA . PHE A 1 2253 ? 178.193 213.471 179.095 1.00 0.00 ? 2253 PHE A CA 5  
ATOM 9158   C CA . GLN A 1 2259 ? 179.965 212.611 183.597 1.00 0.00 ? 2254 GLN A CA 5  
ATOM 9159   C CA . LYS A 1 2260 ? 177.500 215.516 183.676 1.00 0.00 ? 2260 LYS A CA 5  
ATOM 9160   C CA . ASN A 1 2261 ? 173.738 215.040 183.380 1.00 0.00 ? 2261 ASN A CA 5  
ATOM 9161   C CA . PHE A 1 2262 ? 171.468 217.425 181.490 1.00 0.00 ? 2262 PHE A CA 5  
ATOM 9162   C CA . LEU A 1 2263 ? 167.806 218.114 180.742 1.00 0.00 ? 2263 LEU A CA 5  
ATOM 9163   C CA . LEU A 1 2264 ? 167.253 218.743 177.027 1.00 0.00 ? 2264 LEU A CA 5  
ATOM 9164   C CA . VAL A 1 2265 ? 164.073 220.678 176.215 1.00 0.00 ? 2265 VAL A CA 5  
ATOM 9165   C CA . GLY A 1 2266 ? 162.788 220.785 172.638 1.00 0.00 ? 2266 GLY A CA 5  
ATOM 9166   C CA . THR A 1 2267 ? 160.237 223.487 171.843 1.00 0.00 ? 2267 THR A CA 5  
ATOM 9167   C CA . ALA A 1 2268 ? 157.664 224.054 169.109 1.00 0.00 ? 2268 ALA A CA 5  
ATOM 9168   C CA . ASP A 1 2269 ? 159.582 227.006 167.606 1.00 0.00 ? 2269 ASP A CA 5  
ATOM 9169   C CA . GLY A 1 2270 ? 162.628 224.920 166.684 1.00 0.00 ? 2270 GLY A CA 5  
ATOM 9170   C CA . LYS A 1 2271 ? 164.737 225.626 169.773 1.00 0.00 ? 2271 LYS A CA 5  
ATOM 9171   C CA . LEU A 1 2272 ? 166.537 223.260 172.154 1.00 0.00 ? 2272 LEU A CA 5  
ATOM 9172   C CA . ALA A 1 2273 ? 167.290 224.485 175.682 1.00 0.00 ? 2273 ALA A CA 5  
ATOM 9173   C CA . ILE A 1 2274 ? 169.847 222.741 177.903 1.00 0.00 ? 2274 ILE A CA 5  
ATOM 9174   C CA . PHE A 1 2275 ? 169.531 222.693 181.690 1.00 0.00 ? 2275 PHE A CA 5  
ATOM 9175   C CA . GLU A 1 2276 ? 172.224 221.273 183.922 1.00 0.00 ? 2276 GLU A CA 5  
ATOM 9176   C CA . ASP A 1 2277 ? 171.410 218.418 186.297 1.00 0.00 ? 2277 ASP A CA 5  
ATOM 9177   C CA . LYS A 1 2278 ? 171.573 220.538 189.457 1.00 0.00 ? 2278 LYS A CA 5  
ATOM 9178   C CA . THR A 1 2279 ? 169.986 223.745 188.123 1.00 0.00 ? 2279 THR A CA 5  
ATOM 9179   C CA . VAL A 1 2280 ? 166.635 221.944 187.781 1.00 0.00 ? 2280 VAL A CA 5  
ATOM 9180   C CA . LYS A 1 2281 ? 166.161 222.315 191.554 1.00 0.00 ? 2281 LYS A CA 5  
ATOM 9181   C CA . LEU A 1 2282 ? 166.194 226.127 191.352 1.00 0.00 ? 2282 LEU A CA 5  
ATOM 9182   C CA . LYS A 1 2283 ? 163.107 228.284 190.880 1.00 0.00 ? 2283 LYS A CA 5  
ATOM 9183   C CA . GLY A 1 2284 ? 163.271 230.356 187.712 1.00 0.00 ? 2284 GLY A CA 5  
ATOM 9184   C CA . ALA A 1 2285 ? 166.491 228.701 186.558 1.00 0.00 ? 2285 ALA A CA 5  
ATOM 9185   C CA . ALA A 1 2286 ? 167.673 229.670 183.076 1.00 0.00 ? 2286 ALA A CA 5  
ATOM 9186   C CA . PRO A 1 2287 ? 169.151 227.186 180.580 1.00 0.00 ? 2287 PRO A CA 5  
ATOM 9187   C CA . LEU A 1 2288 ? 172.881 226.908 180.021 1.00 0.00 ? 2288 LEU A CA 5  
ATOM 9188   C CA . LYS A 1 2289 ? 172.341 227.302 176.273 1.00 0.00 ? 2289 LYS A CA 5  
ATOM 9189   C CA . ILE A 1 2290 ? 169.527 227.606 173.730 1.00 0.00 ? 2290 ILE A CA 5  
ATOM 9190   C CA . LEU A 1 2291 ? 170.030 226.273 170.201 1.00 0.00 ? 2291 LEU A CA 5  
ATOM 9191   C CA . ASN A 1 2292 ? 167.935 227.876 167.452 1.00 0.00 ? 2292 ASN A CA 5  
ATOM 9192   C CA . ILE A 1 2293 ? 167.701 224.910 165.085 1.00 0.00 ? 2293 ILE A CA 5  
ATOM 9193   C CA . GLY A 1 2294 ? 164.491 225.870 163.236 1.00 0.00 ? 2294 GLY A CA 5  
ATOM 9194   C CA . ASN A 1 2295 ? 161.521 228.213 163.323 1.00 0.00 ? 2295 ASN A CA 5  
ATOM 9195   C CA . VAL A 1 2296 ? 157.915 228.394 164.521 1.00 0.00 ? 2296 VAL A CA 5  
ATOM 9196   C CA . SER A 1 2297 ? 157.006 225.956 161.725 1.00 0.00 ? 2297 SER A CA 5  
ATOM 9197   C CA . THR A 1 2298 ? 159.615 223.269 162.588 1.00 0.00 ? 2298 THR A CA 5  
ATOM 9198   C CA . PRO A 1 2299 ? 158.958 221.844 166.069 1.00 0.00 ? 2299 PRO A CA 5  
ATOM 9199   C CA . LEU A 1 2300 ? 161.695 219.895 167.841 1.00 0.00 ? 2300 LEU A CA 5  
ATOM 9200   C CA . MET A 1 2301 ? 159.810 216.710 168.683 1.00 0.00 ? 2301 MET A CA 5  
ATOM 9201   C CA . CYS A 1 2302 ? 162.288 213.887 169.342 1.00 0.00 ? 2302 CYS A CA 5  
ATOM 9202   C CA . LEU A 1 2303 ? 165.722 213.200 170.825 1.00 0.00 ? 2303 LEU A CA 5  
ATOM 9203   C CA . SER A 1 2304 ? 167.769 210.012 171.055 1.00 0.00 ? 2304 SER A CA 5  
ATOM 9204   C CA . GLU A 1 2305 ? 171.231 208.809 172.019 1.00 0.00 ? 2305 GLU A CA 5  
ATOM 9205   C CA . VAL A 1 2314 ? 176.507 212.041 170.819 1.00 0.00 ? 2314 VAL A CA 5  
ATOM 9206   C CA . MET A 1 2315 ? 172.867 213.101 170.468 1.00 0.00 ? 2315 MET A CA 5  
ATOM 9207   C CA . TRP A 1 2316 ? 170.604 212.982 167.420 1.00 0.00 ? 2316 TRP A CA 5  
ATOM 9208   C CA . GLY A 1 2317 ? 167.289 214.768 167.068 1.00 0.00 ? 2317 GLY A CA 5  
ATOM 9209   C CA . GLY A 1 2318 ? 164.521 215.710 164.699 1.00 0.00 ? 2318 GLY A CA 5  
ATOM 9210   C CA . CYS A 1 2319 ? 163.434 219.257 163.844 1.00 0.00 ? 2319 CYS A CA 5  
ATOM 9211   C CA . GLY A 1 2320 ? 160.931 219.493 161.018 1.00 0.00 ? 2320 GLY A CA 5  
ATOM 9212   C CA . THR A 1 2321 ? 162.385 217.489 158.147 1.00 0.00 ? 2321 THR A CA 5  
ATOM 9213   C CA . LYS A 1 2322 ? 165.971 217.889 159.414 1.00 0.00 ? 2322 LYS A CA 5  
ATOM 9214   C CA . ILE A 1 2323 ? 168.028 215.499 161.530 1.00 0.00 ? 2323 ILE A CA 5  
ATOM 9215   C CA . PHE A 1 2324 ? 170.575 217.213 163.761 1.00 0.00 ? 2324 PHE A CA 5  
ATOM 9216   C CA . SER A 1 2325 ? 173.497 216.031 165.870 1.00 0.00 ? 2325 SER A CA 5  
ATOM 9217   C CA . PHE A 1 2326 ? 175.422 217.524 168.774 1.00 0.00 ? 2326 PHE A CA 5  
ATOM 9218   C CA . SER A 1 2327 ? 177.822 216.426 171.490 1.00 0.00 ? 2327 SER A CA 5  
ATOM 9219   C CA . ASN A 1 2328 ? 179.737 218.050 174.342 1.00 0.00 ? 2328 ASN A CA 5  
ATOM 9220   C CA . ASP A 1 2329 ? 179.774 221.754 173.439 1.00 0.00 ? 2329 ASP A CA 5  
ATOM 9221   C CA . PHE A 1 2330 ? 176.159 221.823 172.145 1.00 0.00 ? 2330 PHE A CA 5  
ATOM 9222   C CA . THR A 1 2331 ? 177.235 223.068 168.733 1.00 0.00 ? 2331 THR A CA 5  
ATOM 9223   C CA . ILE A 1 2332 ? 175.199 221.506 165.939 1.00 0.00 ? 2332 ILE A CA 5  
ATOM 9224   C CA . GLN A 1 2333 ? 177.549 219.234 164.016 1.00 0.00 ? 2333 GLN A CA 5  
ATOM 9225   C CA . LYS A 1 2334 ? 175.500 217.243 161.499 1.00 0.00 ? 2334 LYS A CA 5  
ATOM 9226   C CA . LEU A 1 2335 ? 172.367 218.605 159.820 1.00 0.00 ? 2335 LEU A CA 5  
ATOM 9227   C CA . ILE A 1 2336 ? 170.674 216.359 157.244 1.00 0.00 ? 2336 ILE A CA 5  
ATOM 9228   C CA . GLU A 1 2337 ? 167.713 217.417 155.103 1.00 0.00 ? 2337 GLU A CA 5  
ATOM 9229   C CA . THR A 1 2338 ? 165.375 214.441 154.668 1.00 0.00 ? 2338 THR A CA 5  
ATOM 9230   C CA . ARG A 1 2339 ? 162.657 216.166 152.620 1.00 0.00 ? 2339 ARG A CA 5  
ATOM 9231   C CA . THR A 1 2340 ? 164.250 215.138 149.305 1.00 0.00 ? 2340 THR A CA 5  
ATOM 9232   C CA . SER A 1 2341 ? 165.744 211.914 147.946 1.00 0.00 ? 2341 SER A CA 5  
ATOM 9233   C CA . GLN A 1 2342 ? 165.549 210.478 144.435 1.00 0.00 ? 2342 GLN A CA 5  
ATOM 9234   C CA . LEU A 1 2343 ? 165.162 206.906 145.729 1.00 0.00 ? 2343 LEU A CA 5  
ATOM 9235   C CA . PHE A 1 2344 ? 161.981 207.812 147.631 1.00 0.00 ? 2344 PHE A CA 5  
ATOM 9236   C CA . SER A 1 2345 ? 159.316 205.202 146.949 1.00 0.00 ? 2345 SER A CA 5  
ATOM 9237   C CA . TYR A 1 2346 ? 156.729 207.966 147.447 1.00 0.00 ? 2346 TYR A CA 5  
ATOM 9238   C CA . ALA A 1 2347 ? 157.579 211.644 147.799 1.00 0.00 ? 2347 ALA A CA 5  
ATOM 9239   C CA . ALA A 1 2348 ? 154.675 213.099 149.795 1.00 0.00 ? 2348 ALA A CA 5  
ATOM 9240   C CA . PHE A 1 2349 ? 155.463 210.958 152.852 1.00 0.00 ? 2349 PHE A CA 5  
ATOM 9241   C CA . SER A 1 2350 ? 159.009 212.301 153.173 1.00 0.00 ? 2350 SER A CA 5  
ATOM 9242   C CA . ASP A 1 2351 ? 157.729 215.898 153.271 1.00 0.00 ? 2351 ASP A CA 5  
ATOM 9243   C CA . SER A 1 2352 ? 156.542 215.646 156.861 1.00 0.00 ? 2352 SER A CA 5  
ATOM 9244   C CA . ASN A 1 2353 ? 157.873 216.439 160.313 1.00 0.00 ? 2353 ASN A CA 5  
ATOM 9245   C CA . ILE A 1 2354 ? 160.022 213.717 161.858 1.00 0.00 ? 2354 ILE A CA 5  
ATOM 9246   C CA . ILE A 1 2355 ? 158.172 212.207 164.825 1.00 0.00 ? 2355 ILE A CA 5  
ATOM 9247   C CA . THR A 1 2356 ? 160.841 209.838 166.193 1.00 0.00 ? 2356 THR A CA 5  
ATOM 9248   C CA . VAL A 1 2357 ? 164.516 208.960 165.737 1.00 0.00 ? 2357 VAL A CA 5  
ATOM 9249   C CA . VAL A 1 2358 ? 166.166 205.705 166.833 1.00 0.00 ? 2358 VAL A CA 5  
ATOM 9250   C CA . VAL A 1 2359 ? 169.959 205.515 166.555 1.00 0.00 ? 2359 VAL A CA 5  
ATOM 9251   C CA . ASP A 1 2360 ? 171.835 202.255 165.999 1.00 0.00 ? 2360 ASP A CA 5  
ATOM 9252   C CA . THR A 1 2361 ? 174.289 201.639 163.161 1.00 0.00 ? 2361 THR A CA 5  
ATOM 9253   C CA . ALA A 1 2362 ? 172.203 203.988 161.004 1.00 0.00 ? 2362 ALA A CA 5  
ATOM 9254   C CA . LEU A 1 2363 ? 169.404 206.485 161.617 1.00 0.00 ? 2363 LEU A CA 5  
ATOM 9255   C CA . TYR A 1 2364 ? 165.862 205.081 161.452 1.00 0.00 ? 2364 TYR A CA 5  
ATOM 9256   C CA . ILE A 1 2365 ? 163.430 208.001 161.289 1.00 0.00 ? 2365 ILE A CA 5  
ATOM 9257   C CA . ALA A 1 2366 ? 159.649 208.027 161.003 1.00 0.00 ? 2366 ALA A CA 5  
ATOM 9258   C CA . LYS A 1 2367 ? 157.562 210.958 159.790 1.00 0.00 ? 2367 LYS A CA 5  
ATOM 9259   C CA . GLN A 1 2368 ? 154.058 212.155 160.585 1.00 0.00 ? 2368 GLN A CA 5  
ATOM 9260   C CA . ASN A 1 2369 ? 151.299 210.333 158.673 1.00 0.00 ? 2369 ASN A CA 5  
ATOM 9261   C CA . SER A 1 2370 ? 153.868 208.219 156.814 1.00 0.00 ? 2370 SER A CA 5  
ATOM 9262   C CA . PRO A 1 2371 ? 154.125 204.404 156.576 1.00 0.00 ? 2371 PRO A CA 5  
ATOM 9263   C CA . VAL A 1 2372 ? 157.803 204.488 155.520 1.00 0.00 ? 2372 VAL A CA 5  
ATOM 9264   C CA . VAL A 1 2373 ? 160.650 204.270 158.023 1.00 0.00 ? 2373 VAL A CA 5  
ATOM 9265   C CA . GLU A 1 2374 ? 163.558 206.037 156.329 1.00 0.00 ? 2374 GLU A CA 5  
ATOM 9266   C CA . VAL A 1 2375 ? 167.115 204.841 156.958 1.00 0.00 ? 2375 VAL A CA 5  
ATOM 9267   C CA . TRP A 1 2376 ? 169.914 207.412 156.677 1.00 0.00 ? 2376 TRP A CA 5  
ATOM 9268   C CA . ASP A 1 2377 ? 173.687 207.104 157.026 1.00 0.00 ? 2377 ASP A CA 5  
ATOM 9269   C CA . LYS A 1 2378 ? 175.469 209.130 159.701 1.00 0.00 ? 2378 LYS A CA 5  
ATOM 9270   C CA . LYS A 1 2379 ? 178.637 209.554 157.630 1.00 0.00 ? 2379 LYS A CA 5  
ATOM 9271   C CA . THR A 1 2380 ? 177.459 210.078 154.044 1.00 0.00 ? 2380 THR A CA 5  
ATOM 9272   C CA . GLU A 1 2381 ? 174.202 211.812 155.107 1.00 0.00 ? 2381 GLU A CA 5  
ATOM 9273   C CA . LYS A 1 2382 ? 172.182 209.989 152.421 1.00 0.00 ? 2382 LYS A CA 5  
ATOM 9274   C CA . LEU A 1 2383 ? 169.506 207.316 152.243 1.00 0.00 ? 2383 LEU A CA 5  
ATOM 9275   C CA . CYS A 1 2384 ? 170.676 203.964 153.552 1.00 0.00 ? 2384 CYS A CA 5  
ATOM 9276   C CA . GLY A 1 2385 ? 167.345 202.289 152.871 1.00 0.00 ? 2385 GLY A CA 5  
ATOM 9277   C CA . LEU A 1 2386 ? 163.569 202.241 153.146 1.00 0.00 ? 2386 LEU A CA 5  
ATOM 9278   C CA . ILE A 1 2387 ? 161.224 200.112 155.254 1.00 0.00 ? 2387 ILE A CA 5  
ATOM 9279   C CA . ASP A 1 2388 ? 157.646 200.215 153.930 1.00 0.00 ? 2388 ASP A CA 5  
ATOM 9280   C CA . CYS A 1 2389 ? 155.338 198.971 156.688 1.00 0.00 ? 2389 CYS A CA 5  
ATOM 9281   C CA . VAL A 1 2390 ? 152.381 198.625 154.291 1.00 0.00 ? 2390 VAL A CA 5  
ATOM 9282   C CA . HIS A 1 2391 ? 154.196 195.852 152.418 1.00 0.00 ? 2391 HIS A CA 5  
ATOM 9283   C CA . PHE A 1 2392 ? 155.365 194.108 155.595 1.00 0.00 ? 2392 PHE A CA 5  
ATOM 9284   C CA . LEU A 1 2393 ? 151.804 194.152 156.938 1.00 0.00 ? 2393 LEU A CA 5  
ATOM 9285   C CA . ARG A 1 2394 ? 150.300 192.847 153.673 1.00 0.00 ? 2394 ARG A CA 5  
ATOM 9286   C CA . GLU A 1 2395 ? 152.186 189.529 153.993 1.00 0.00 ? 2395 GLU A CA 5  
ATOM 9287   C CA . MET A 1 2408 ? 145.067 194.369 153.217 1.00 0.00 ? 2408 MET A CA 5  
ATOM 9288   C CA . SER A 1 2409 ? 143.507 197.805 153.771 1.00 0.00 ? 2409 SER A CA 5  
ATOM 9289   C CA . TYR A 1 2410 ? 146.134 198.862 156.325 1.00 0.00 ? 2410 TYR A CA 5  
ATOM 9290   C CA . SER A 1 2411 ? 147.356 202.456 156.304 1.00 0.00 ? 2411 SER A CA 5  
ATOM 9291   C CA . GLY A 1 2412 ? 150.603 201.315 157.929 1.00 0.00 ? 2412 GLY A CA 5  
ATOM 9292   C CA . ARG A 1 2413 ? 151.040 204.815 159.336 1.00 0.00 ? 2413 ARG A CA 5  
ATOM 9293   C CA . VAL A 1 2414 ? 154.033 204.605 161.667 1.00 0.00 ? 2414 VAL A CA 5  
ATOM 9294   C CA . LYS A 1 2415 ? 153.364 205.815 165.209 1.00 0.00 ? 2415 LYS A CA 5  
ATOM 9295   C CA . THR A 1 2416 ? 156.397 204.738 167.228 1.00 0.00 ? 2416 THR A CA 5  
ATOM 9296   C CA . LEU A 1 2417 ? 159.833 203.102 166.971 1.00 0.00 ? 2417 LEU A CA 5  
ATOM 9297   C CA . CYS A 1 2418 ? 161.709 201.229 169.696 1.00 0.00 ? 2418 CYS A CA 5  
ATOM 9298   C CA . LEU A 1 2419 ? 165.029 199.379 169.681 1.00 0.00 ? 2419 LEU A CA 5  
ATOM 9299   C CA . GLN A 1 2420 ? 165.291 195.933 171.265 1.00 0.00 ? 2420 GLN A CA 5  
ATOM 9300   C CA . LYS A 1 2421 ? 168.845 195.066 172.351 1.00 0.00 ? 2421 LYS A CA 5  
ATOM 9301   C CA . ASN A 1 2422 ? 171.288 195.495 169.464 1.00 0.00 ? 2422 ASN A CA 5  
ATOM 9302   C CA . THR A 1 2423 ? 169.391 193.779 166.640 1.00 0.00 ? 2423 THR A CA 5  
ATOM 9303   C CA . ALA A 1 2424 ? 165.649 194.275 166.815 1.00 0.00 ? 2424 ALA A CA 5  
ATOM 9304   C CA . LEU A 1 2425 ? 163.362 197.178 165.899 1.00 0.00 ? 2425 LEU A CA 5  
ATOM 9305   C CA . TRP A 1 2426 ? 159.754 197.431 167.096 1.00 0.00 ? 2426 TRP A CA 5  
ATOM 9306   C CA . ILE A 1 2427 ? 157.379 199.475 164.921 1.00 0.00 ? 2427 ILE A CA 5  
ATOM 9307   C CA . GLY A 1 2428 ? 153.953 200.467 166.259 1.00 0.00 ? 2428 GLY A CA 5  
ATOM 9308   C CA . THR A 1 2429 ? 151.678 201.464 163.395 1.00 0.00 ? 2429 THR A CA 5  
ATOM 9309   C CA . GLY A 1 2430 ? 148.477 203.576 163.463 1.00 0.00 ? 2430 GLY A CA 5  
ATOM 9310   C CA . GLY A 1 2431 ? 146.311 200.499 163.638 1.00 0.00 ? 2431 GLY A CA 5  
ATOM 9311   C CA . GLY A 1 2432 ? 146.811 198.069 166.465 1.00 0.00 ? 2432 GLY A CA 5  
ATOM 9312   C CA . HIS A 1 2433 ? 149.739 196.492 164.652 1.00 0.00 ? 2433 HIS A CA 5  
ATOM 9313   C CA . ILE A 1 2434 ? 153.216 195.875 166.064 1.00 0.00 ? 2434 ILE A CA 5  
ATOM 9314   C CA . LEU A 1 2435 ? 156.112 194.753 163.848 1.00 0.00 ? 2435 LEU A CA 5  
ATOM 9315   C CA . LEU A 1 2436 ? 159.488 193.346 164.914 1.00 0.00 ? 2436 LEU A CA 5  
ATOM 9316   C CA . LEU A 1 2437 ? 162.267 193.628 162.315 1.00 0.00 ? 2437 LEU A CA 5  
ATOM 9317   C CA . ASP A 1 2438 ? 165.828 192.299 162.365 1.00 0.00 ? 2438 ASP A CA 5  
ATOM 9318   C CA . LEU A 1 2439 ? 168.282 195.145 161.639 1.00 0.00 ? 2439 LEU A CA 5  
ATOM 9319   C CA . SER A 1 2440 ? 171.260 193.344 160.090 1.00 0.00 ? 2440 SER A CA 5  
ATOM 9320   C CA . THR A 1 2441 ? 171.064 190.861 157.216 1.00 0.00 ? 2441 THR A CA 5  
ATOM 9321   C CA . ARG A 1 2442 ? 167.293 190.256 157.031 1.00 0.00 ? 2442 ARG A CA 5  
ATOM 9322   C CA . ARG A 1 2443 ? 164.017 191.904 158.052 1.00 0.00 ? 2443 ARG A CA 5  
ATOM 9323   C CA . LEU A 1 2444 ? 160.772 190.605 159.568 1.00 0.00 ? 2444 LEU A CA 5  
ATOM 9324   C CA . ILE A 1 2445 ? 160.989 188.608 162.804 1.00 0.00 ? 2445 ILE A CA 5  
ATOM 9325   C CA . ARG A 1 2446 ? 157.567 188.910 164.435 1.00 0.00 ? 2446 ARG A CA 5  
ATOM 9326   C CA . VAL A 1 2447 ? 154.180 190.494 163.718 1.00 0.00 ? 2447 VAL A CA 5  
ATOM 9327   C CA . ILE A 1 2448 ? 151.206 190.918 166.048 1.00 0.00 ? 2448 ILE A CA 5  
ATOM 9328   C CA . TYR A 1 2449 ? 148.011 192.183 164.397 1.00 0.00 ? 2449 TYR A CA 5  
ATOM 9329   C CA . ASN A 1 2450 ? 145.194 193.992 166.215 1.00 0.00 ? 2450 ASN A CA 5  
ATOM 9330   C CA . PHE A 1 2451 ? 147.283 194.243 169.382 1.00 0.00 ? 2451 PHE A CA 5  
ATOM 9331   C CA . CYS A 1 2452 ? 145.025 197.249 170.015 1.00 0.00 ? 2452 CYS A CA 5  
ATOM 9332   C CA . ASN A 1 2453 ? 143.154 199.794 167.903 1.00 0.00 ? 2453 ASN A CA 5  
ATOM 9333   C CA . SER A 1 2454 ? 146.087 202.245 167.757 1.00 0.00 ? 2454 SER A CA 5  
ATOM 9334   C CA . VAL A 1 2455 ? 149.607 201.997 169.223 1.00 0.00 ? 2455 VAL A CA 5  
ATOM 9335   C CA . ARG A 1 2456 ? 150.491 205.403 170.669 1.00 0.00 ? 2456 ARG A CA 5  
ATOM 9336   C CA . VAL A 1 2457 ? 153.635 204.928 172.789 1.00 0.00 ? 2457 VAL A CA 5  
ATOM 9337   C CA . MET A 1 2458 ? 156.228 202.156 172.955 1.00 0.00 ? 2458 MET A CA 5  
ATOM 9338   C CA . MET A 1 2459 ? 159.288 202.293 175.210 1.00 0.00 ? 2459 MET A CA 5  
ATOM 9339   C CA . THR A 1 2460 ? 161.822 200.268 177.188 1.00 0.00 ? 2460 THR A CA 5  
ATOM 9340   C CA . ALA A 1 2461 ? 162.348 200.704 180.933 1.00 0.00 ? 2461 ALA A CA 5  
ATOM 9341   C CA . GLN A 1 2462 ? 164.388 199.161 183.740 1.00 0.00 ? 2462 GLN A CA 5  
ATOM 9342   C CA . ASN A 1 2468 ? 164.550 195.013 180.827 1.00 0.00 ? 2468 ASN A CA 5  
ATOM 9343   C CA . VAL A 1 2469 ? 160.825 195.735 180.486 1.00 0.00 ? 2469 VAL A CA 5  
ATOM 9344   C CA . MET A 1 2470 ? 158.585 196.667 177.548 1.00 0.00 ? 2470 MET A CA 5  
ATOM 9345   C CA . LEU A 1 2471 ? 155.733 199.191 177.808 1.00 0.00 ? 2471 LEU A CA 5  
ATOM 9346   C CA . VAL A 1 2472 ? 153.148 199.760 175.057 1.00 0.00 ? 2472 VAL A CA 5  
ATOM 9347   C CA . LEU A 1 2473 ? 150.409 202.355 175.546 1.00 0.00 ? 2473 LEU A CA 5  
ATOM 9348   C CA . GLY A 1 2474 ? 147.578 201.954 173.047 1.00 0.00 ? 2474 GLY A CA 5  
ATOM 9349   C CA . TYR A 1 2475 ? 144.071 203.360 172.944 1.00 0.00 ? 2475 TYR A CA 5  
ATOM 9350   C CA . ASN A 1 2476 ? 140.689 202.018 171.773 1.00 0.00 ? 2476 ASN A CA 5  
ATOM 9351   C CA . ARG A 1 2477 ? 137.709 204.106 170.741 1.00 0.00 ? 2477 ARG A CA 5  
ATOM 9352   C CA . GLU A 1 2488 ? 134.320 207.128 174.367 1.00 0.00 ? 2497 GLU A CA 5  
ATOM 9353   C CA . ILE A 1 2489 ? 138.022 206.285 174.707 1.00 0.00 ? 2498 ILE A CA 5  
ATOM 9354   C CA . GLN A 1 2490 ? 139.728 203.474 176.648 1.00 0.00 ? 2499 GLN A CA 5  
ATOM 9355   C CA . SER A 1 2491 ? 143.498 203.717 177.058 1.00 0.00 ? 2500 SER A CA 5  
ATOM 9356   C CA . CYS A 1 2492 ? 145.462 200.589 177.959 1.00 0.00 ? 2501 CYS A CA 5  
ATOM 9357   C CA . LEU A 1 2493 ? 149.060 199.955 179.013 1.00 0.00 ? 2502 LEU A CA 5  
ATOM 9358   C CA . THR A 1 2494 ? 150.523 196.564 178.070 1.00 0.00 ? 2503 THR A CA 5  
ATOM 9359   C CA . VAL A 1 2495 ? 153.762 195.383 179.671 1.00 0.00 ? 2504 VAL A CA 5  
ATOM 9360   C CA . TRP A 1 2496 ? 156.141 192.424 179.404 1.00 0.00 ? 2505 TRP A CA 5  
ATOM 9361   C CA . TYR B 1 1332 ? 116.563 107.277 90.054  1.00 0.00 ? 1332 TYR B CA 5  
ATOM 9362   C CA . ASN B 1 1333 ? 116.450 111.052 89.225  1.00 0.00 ? 1333 ASN B CA 5  
ATOM 9363   C CA . ARG B 1 1334 ? 114.894 112.313 92.421  1.00 0.00 ? 1334 ARG B CA 5  
ATOM 9364   C CA . MET B 1 1335 ? 116.209 114.492 95.277  1.00 0.00 ? 1335 MET B CA 5  
ATOM 9365   C CA . LYS B 1 1336 ? 115.068 116.017 98.587  1.00 0.00 ? 1336 LYS B CA 5  
ATOM 9366   C CA . LEU B 1 1337 ? 115.550 119.755 99.111  1.00 0.00 ? 1337 LEU B CA 5  
ATOM 9367   C CA . MET B 1 1338 ? 115.299 120.549 102.806 1.00 0.00 ? 1338 MET B CA 5  
ATOM 9368   C CA . ILE B 1 1339 ? 114.613 124.221 103.534 1.00 0.00 ? 1339 ILE B CA 5  
ATOM 9369   C CA . VAL B 1 1340 ? 116.391 125.158 106.784 1.00 0.00 ? 1340 VAL B CA 5  
ATOM 9370   C CA . GLY B 1 1341 ? 116.203 128.432 108.727 1.00 0.00 ? 1341 GLY B CA 5  
ATOM 9371   C CA . ASN B 1 1342 ? 114.388 130.444 111.380 1.00 0.00 ? 1342 ASN B CA 5  
ATOM 9372   C CA . THR B 1 1343 ? 110.614 130.874 110.669 1.00 0.00 ? 1343 THR B CA 5  
ATOM 9373   C CA . GLY B 1 1344 ? 110.297 133.484 107.905 1.00 0.00 ? 1344 GLY B CA 5  
ATOM 9374   C CA . SER B 1 1345 ? 113.855 134.215 106.799 1.00 0.00 ? 1345 SER B CA 5  
ATOM 9375   C CA . GLY B 1 1346 ? 112.074 134.081 103.401 1.00 0.00 ? 1346 GLY B CA 5  
ATOM 9376   C CA . LYS B 1 1347 ? 111.552 130.328 102.872 1.00 0.00 ? 1347 LYS B CA 5  
ATOM 9377   C CA . THR B 1 1348 ? 108.277 130.922 100.944 1.00 0.00 ? 1348 THR B CA 5  
ATOM 9378   C CA . THR B 1 1349 ? 109.840 133.997 99.227  1.00 0.00 ? 1349 THR B CA 5  
ATOM 9379   C CA . LEU B 1 1350 ? 112.810 131.981 97.973  1.00 0.00 ? 1350 LEU B CA 5  
ATOM 9380   C CA . LEU B 1 1351 ? 110.463 129.175 96.798  1.00 0.00 ? 1351 LEU B CA 5  
ATOM 9381   C CA . GLN B 1 1352 ? 108.137 131.568 94.889  1.00 0.00 ? 1352 GLN B CA 5  
ATOM 9382   C CA . GLN B 1 1353 ? 111.181 132.958 93.073  1.00 0.00 ? 1353 GLN B CA 5  
ATOM 9383   C CA . LEU B 1 1354 ? 112.759 129.575 92.133  1.00 0.00 ? 1354 LEU B CA 5  
ATOM 9384   C CA . MET B 1 1355 ? 109.616 127.898 90.932  1.00 0.00 ? 1355 MET B CA 5  
ATOM 9385   C CA . LYS B 1 1356 ? 108.486 130.338 88.130  1.00 0.00 ? 1356 LYS B CA 5  
ATOM 9386   C CA . THR B 1 1357 ? 105.393 128.261 87.173  1.00 0.00 ? 1357 THR B CA 5  
ATOM 9387   C CA . LYS B 1 1358 ? 101.901 129.564 86.202  1.00 0.00 ? 1358 LYS B CA 5  
ATOM 9388   C CA . LYS B 1 1359 ? 101.297 129.941 89.964  1.00 0.00 ? 1359 LYS B CA 5  
ATOM 9389   C CA . SER B 1 1360 ? 99.862  126.383 89.976  1.00 0.00 ? 1360 SER B CA 5  
ATOM 9390   C CA . ASP B 1 1361 ? 99.975  125.491 93.695  1.00 0.00 ? 1361 ASP B CA 5  
ATOM 9391   C CA . LEU B 1 1362 ? 103.143 127.640 93.725  1.00 0.00 ? 1362 LEU B CA 5  
ATOM 9392   C CA . GLY B 1 1363 ? 101.903 129.745 96.613  1.00 0.00 ? 1363 GLY B CA 5  
ATOM 9393   C CA . MET B 1 1364 ? 101.924 128.485 100.212 1.00 0.00 ? 1364 MET B CA 5  
ATOM 9394   C CA . GLN B 1 1365 ? 103.515 130.384 103.099 1.00 0.00 ? 1365 GLN B CA 5  
ATOM 9395   C CA . SER B 1 1366 ? 103.850 128.390 106.331 1.00 0.00 ? 1366 SER B CA 5  
ATOM 9396   C CA . ALA B 1 1367 ? 107.182 129.715 107.505 1.00 0.00 ? 1367 ALA B CA 5  
ATOM 9397   C CA . THR B 1 1368 ? 106.613 129.190 111.310 1.00 0.00 ? 1368 THR B CA 5  
ATOM 9398   C CA . VAL B 1 1369 ? 105.889 125.734 112.847 1.00 0.00 ? 1369 VAL B CA 5  
ATOM 9399   C CA . GLY B 1 1370 ? 104.320 124.202 109.706 1.00 0.00 ? 1370 GLY B CA 5  
ATOM 9400   C CA . ILE B 1 1371 ? 104.833 121.330 107.246 1.00 0.00 ? 1371 ILE B CA 5  
ATOM 9401   C CA . ASP B 1 1372 ? 104.478 120.978 103.446 1.00 0.00 ? 1372 ASP B CA 5  
ATOM 9402   C CA . VAL B 1 1373 ? 105.997 119.420 100.293 1.00 0.00 ? 1373 VAL B CA 5  
ATOM 9403   C CA . LYS B 1 1374 ? 106.217 121.020 96.866  1.00 0.00 ? 1374 LYS B CA 5  
ATOM 9404   C CA . ASP B 1 1375 ? 107.494 118.709 94.154  1.00 0.00 ? 1375 ASP B CA 5  
ATOM 9405   C CA . TRP B 1 1376 ? 108.592 120.344 90.879  1.00 0.00 ? 1376 TRP B CA 5  
ATOM 9406   C CA . PRO B 1 1377 ? 110.687 119.029 87.946  1.00 0.00 ? 1377 PRO B CA 5  
ATOM 9407   C CA . ILE B 1 1378 ? 113.348 121.834 87.937  1.00 0.00 ? 1378 ILE B CA 5  
ATOM 9408   C CA . GLN B 1 1379 ? 115.596 120.831 85.141  1.00 0.00 ? 1379 GLN B CA 5  
ATOM 9409   C CA . ILE B 1 1380 ? 117.826 121.629 82.188  1.00 0.00 ? 1380 ILE B CA 5  
ATOM 9410   C CA . ARG B 1 1381 ? 116.378 120.633 78.835  1.00 0.00 ? 1381 ARG B CA 5  
ATOM 9411   C CA . ASP B 1 1382 ? 118.567 118.279 76.731  1.00 0.00 ? 1382 ASP B CA 5  
ATOM 9412   C CA . LYS B 1 1383 ? 120.937 117.357 79.608  1.00 0.00 ? 1383 LYS B CA 5  
ATOM 9413   C CA . ARG B 1 1384 ? 121.070 114.627 82.332  1.00 0.00 ? 1384 ARG B CA 5  
ATOM 9414   C CA . LYS B 1 1385 ? 119.005 116.909 84.520  1.00 0.00 ? 1385 LYS B CA 5  
ATOM 9415   C CA . ARG B 1 1386 ? 116.046 116.614 81.977  1.00 0.00 ? 1386 ARG B CA 5  
ATOM 9416   C CA . ASP B 1 1387 ? 114.259 113.875 83.994  1.00 0.00 ? 1387 ASP B CA 5  
ATOM 9417   C CA . LEU B 1 1388 ? 115.129 115.217 87.524  1.00 0.00 ? 1388 LEU B CA 5  
ATOM 9418   C CA . VAL B 1 1389 ? 112.441 115.622 90.201  1.00 0.00 ? 1389 VAL B CA 5  
ATOM 9419   C CA . LEU B 1 1390 ? 113.023 118.036 93.112  1.00 0.00 ? 1390 LEU B CA 5  
ATOM 9420   C CA . ASN B 1 1391 ? 111.040 117.559 96.318  1.00 0.00 ? 1391 ASN B CA 5  
ATOM 9421   C CA . VAL B 1 1392 ? 111.044 120.704 98.480  1.00 0.00 ? 1392 VAL B CA 5  
ATOM 9422   C CA . TRP B 1 1393 ? 110.402 119.844 102.122 1.00 0.00 ? 1393 TRP B CA 5  
ATOM 9423   C CA . ASP B 1 1394 ? 109.931 122.107 105.081 1.00 0.00 ? 1394 ASP B CA 5  
ATOM 9424   C CA . PHE B 1 1395 ? 109.621 120.434 108.506 1.00 0.00 ? 1395 PHE B CA 5  
ATOM 9425   C CA . ALA B 1 1396 ? 110.012 123.703 110.471 1.00 0.00 ? 1396 ALA B CA 5  
ATOM 9426   C CA . GLY B 1 1397 ? 112.958 122.583 112.662 1.00 0.00 ? 1397 GLY B CA 5  
ATOM 9427   C CA . ARG B 1 1398 ? 111.285 119.377 113.865 1.00 0.00 ? 1398 ARG B CA 5  
ATOM 9428   C CA . GLU B 1 1399 ? 112.936 116.622 111.828 1.00 0.00 ? 1399 GLU B CA 5  
ATOM 9429   C CA . GLU B 1 1400 ? 110.080 114.071 112.228 1.00 0.00 ? 1400 GLU B CA 5  
ATOM 9430   C CA . PHE B 1 1401 ? 111.521 111.391 109.873 1.00 0.00 ? 1401 PHE B CA 5  
ATOM 9431   C CA . TYR B 1 1402 ? 114.914 111.153 111.709 1.00 0.00 ? 1402 TYR B CA 5  
ATOM 9432   C CA . SER B 1 1403 ? 114.349 108.205 114.124 1.00 0.00 ? 1403 SER B CA 5  
ATOM 9433   C CA . THR B 1 1404 ? 112.677 105.712 111.756 1.00 0.00 ? 1404 THR B CA 5  
ATOM 9434   C CA . HIS B 1 1405 ? 114.091 106.845 108.393 1.00 0.00 ? 1405 HIS B CA 5  
ATOM 9435   C CA . PRO B 1 1406 ? 117.845 107.801 108.861 1.00 0.00 ? 1406 PRO B CA 5  
ATOM 9436   C CA . HIS B 1 1407 ? 118.606 107.834 105.111 1.00 0.00 ? 1407 HIS B CA 5  
ATOM 9437   C CA . PHE B 1 1408 ? 115.769 110.308 104.364 1.00 0.00 ? 1408 PHE B CA 5  
ATOM 9438   C CA . MET B 1 1409 ? 117.959 112.958 106.031 1.00 0.00 ? 1409 MET B CA 5  
ATOM 9439   C CA . THR B 1 1410 ? 121.484 111.571 105.402 1.00 0.00 ? 1410 THR B CA 5  
ATOM 9440   C CA . GLN B 1 1411 ? 121.132 110.419 101.778 1.00 0.00 ? 1411 GLN B CA 5  
ATOM 9441   C CA . ARG B 1 1412 ? 119.201 111.718 98.756  1.00 0.00 ? 1412 ARG B CA 5  
ATOM 9442   C CA . ALA B 1 1413 ? 119.238 115.217 100.213 1.00 0.00 ? 1413 ALA B CA 5  
ATOM 9443   C CA . LEU B 1 1414 ? 120.280 118.840 99.790  1.00 0.00 ? 1414 LEU B CA 5  
ATOM 9444   C CA . TYR B 1 1415 ? 120.049 121.293 102.675 1.00 0.00 ? 1415 TYR B CA 5  
ATOM 9445   C CA . LEU B 1 1416 ? 119.245 124.900 101.783 1.00 0.00 ? 1416 LEU B CA 5  
ATOM 9446   C CA . ALA B 1 1417 ? 120.014 127.266 104.610 1.00 0.00 ? 1417 ALA B CA 5  
ATOM 9447   C CA . VAL B 1 1418 ? 118.011 130.481 104.397 1.00 0.00 ? 1418 VAL B CA 5  
ATOM 9448   C CA . TYR B 1 1419 ? 119.527 133.399 106.274 1.00 0.00 ? 1419 TYR B CA 5  
ATOM 9449   C CA . ASP B 1 1420 ? 117.988 136.797 106.340 1.00 0.00 ? 1420 ASP B CA 5  
ATOM 9450   C CA . LEU B 1 1421 ? 121.391 138.328 107.079 1.00 0.00 ? 1421 LEU B CA 5  
ATOM 9451   C CA . SER B 1 1422 ? 119.940 141.620 108.428 1.00 0.00 ? 1422 SER B CA 5  
ATOM 9452   C CA . LYS B 1 1423 ? 117.455 139.851 110.744 1.00 0.00 ? 1423 LYS B CA 5  
ATOM 9453   C CA . GLY B 1 1424 ? 118.052 136.052 111.074 1.00 0.00 ? 1424 GLY B CA 5  
ATOM 9454   C CA . GLN B 1 1425 ? 121.838 136.520 111.322 1.00 0.00 ? 1425 GLN B CA 5  
ATOM 9455   C CA . ALA B 1 1426 ? 121.843 140.020 112.904 1.00 0.00 ? 1426 ALA B CA 5  
ATOM 9456   C CA . GLU B 1 1427 ? 118.960 139.833 115.498 1.00 0.00 ? 1427 GLU B CA 5  
ATOM 9457   C CA . VAL B 1 1428 ? 119.375 136.236 116.754 1.00 0.00 ? 1428 VAL B CA 5  
ATOM 9458   C CA . ASP B 1 1429 ? 122.698 134.871 115.272 1.00 0.00 ? 1429 ASP B CA 5  
ATOM 9459   C CA . ALA B 1 1430 ? 120.918 131.622 114.433 1.00 0.00 ? 1430 ALA B CA 5  
ATOM 9460   C CA . MET B 1 1431 ? 123.414 130.814 111.675 1.00 0.00 ? 1431 MET B CA 5  
ATOM 9461   C CA . LYS B 1 1432 ? 125.668 128.800 114.030 1.00 0.00 ? 1432 LYS B CA 5  
ATOM 9462   C CA . PRO B 1 1433 ? 122.692 126.704 115.417 1.00 0.00 ? 1433 PRO B CA 5  
ATOM 9463   C CA . TRP B 1 1434 ? 121.209 125.979 111.951 1.00 0.00 ? 1434 TRP B CA 5  
ATOM 9464   C CA . LEU B 1 1435 ? 124.583 125.019 110.484 1.00 0.00 ? 1435 LEU B CA 5  
ATOM 9465   C CA . PHE B 1 1436 ? 125.162 122.460 113.314 1.00 0.00 ? 1436 PHE B CA 5  
ATOM 9466   C CA . ASN B 1 1437 ? 121.504 121.282 112.871 1.00 0.00 ? 1437 ASN B CA 5  
ATOM 9467   C CA . ILE B 1 1438 ? 122.274 120.540 109.183 1.00 0.00 ? 1438 ILE B CA 5  
ATOM 9468   C CA . LYS B 1 1439 ? 125.542 118.715 110.138 1.00 0.00 ? 1439 LYS B CA 5  
ATOM 9469   C CA . ALA B 1 1440 ? 123.916 116.389 112.726 1.00 0.00 ? 1440 ALA B CA 5  
ATOM 9470   C CA . ARG B 1 1441 ? 120.629 115.553 110.923 1.00 0.00 ? 1441 ARG B CA 5  
ATOM 9471   C CA . ALA B 1 1442 ? 122.161 115.254 107.521 1.00 0.00 ? 1442 ALA B CA 5  
ATOM 9472   C CA . SER B 1 1443 ? 125.547 113.550 107.192 1.00 0.00 ? 1443 SER B CA 5  
ATOM 9473   C CA . SER B 1 1444 ? 127.782 114.329 104.218 1.00 0.00 ? 1444 SER B CA 5  
ATOM 9474   C CA . SER B 1 1445 ? 124.717 115.867 102.492 1.00 0.00 ? 1445 SER B CA 5  
ATOM 9475   C CA . PRO B 1 1446 ? 125.460 119.231 100.700 1.00 0.00 ? 1446 PRO B CA 5  
ATOM 9476   C CA . VAL B 1 1447 ? 124.376 122.497 102.010 1.00 0.00 ? 1447 VAL B CA 5  
ATOM 9477   C CA . ILE B 1 1448 ? 123.783 125.695 100.054 1.00 0.00 ? 1448 ILE B CA 5  
ATOM 9478   C CA . LEU B 1 1449 ? 123.825 128.935 102.045 1.00 0.00 ? 1449 LEU B CA 5  
ATOM 9479   C CA . VAL B 1 1450 ? 121.404 131.588 100.766 1.00 0.00 ? 1450 VAL B CA 5  
ATOM 9480   C CA . GLY B 1 1451 ? 121.689 135.126 102.167 1.00 0.00 ? 1451 GLY B CA 5  
ATOM 9481   C CA . THR B 1 1452 ? 118.249 136.691 101.611 1.00 0.00 ? 1452 THR B CA 5  
ATOM 9482   C CA . HIS B 1 1453 ? 116.722 140.211 101.571 1.00 0.00 ? 1453 HIS B CA 5  
ATOM 9483   C CA . LEU B 1 1454 ? 119.930 141.790 100.282 1.00 0.00 ? 1454 LEU B CA 5  
ATOM 9484   C CA . ASP B 1 1455 ? 118.011 144.773 98.779  1.00 0.00 ? 1455 ASP B CA 5  
ATOM 9485   C CA . VAL B 1 1456 ? 117.143 146.059 102.304 1.00 0.00 ? 1456 VAL B CA 5  
ATOM 9486   C CA . SER B 1 1457 ? 120.819 145.816 103.315 1.00 0.00 ? 1457 SER B CA 5  
ATOM 9487   C CA . ASP B 1 1458 ? 122.394 147.778 100.402 1.00 0.00 ? 1458 ASP B CA 5  
ATOM 9488   C CA . GLU B 1 1459 ? 124.622 144.758 99.579  1.00 0.00 ? 1459 GLU B CA 5  
ATOM 9489   C CA . LYS B 1 1460 ? 126.420 145.104 102.965 1.00 0.00 ? 1460 LYS B CA 5  
ATOM 9490   C CA . GLN B 1 1461 ? 125.484 141.891 104.804 1.00 0.00 ? 1461 GLN B CA 5  
ATOM 9491   C CA . ARG B 1 1462 ? 127.020 139.700 102.112 1.00 0.00 ? 1462 ARG B CA 5  
ATOM 9492   C CA . LYS B 1 1463 ? 130.527 141.015 102.704 1.00 0.00 ? 1463 LYS B CA 5  
ATOM 9493   C CA . ALA B 1 1464 ? 133.379 139.040 104.363 1.00 0.00 ? 1464 ALA B CA 5  
ATOM 9494   C CA . CYS B 1 1465 ? 133.110 141.509 107.264 1.00 0.00 ? 1465 CYS B CA 5  
ATOM 9495   C CA . MET B 1 1466 ? 129.675 140.116 108.299 1.00 0.00 ? 1466 MET B CA 5  
ATOM 9496   C CA . SER B 1 1467 ? 129.375 136.784 106.440 1.00 0.00 ? 1467 SER B CA 5  
ATOM 9497   C CA . LYS B 1 1468 ? 132.380 134.631 107.340 1.00 0.00 ? 1468 LYS B CA 5  
ATOM 9498   C CA . ILE B 1 1469 ? 132.304 132.447 104.153 1.00 0.00 ? 1469 ILE B CA 5  
ATOM 9499   C CA . THR B 1 1470 ? 135.927 131.223 103.923 1.00 0.00 ? 1470 THR B CA 5  
ATOM 9500   C CA . LYS B 1 1471 ? 136.863 132.136 107.455 1.00 0.00 ? 1471 LYS B CA 5  
ATOM 9501   C CA . GLU B 1 1472 ? 134.107 130.170 109.375 1.00 0.00 ? 1472 GLU B CA 5  
ATOM 9502   C CA . LEU B 1 1473 ? 131.488 128.712 106.979 1.00 0.00 ? 1473 LEU B CA 5  
ATOM 9503   C CA . LEU B 1 1474 ? 133.563 126.623 104.486 1.00 0.00 ? 1474 LEU B CA 5  
ATOM 9504   C CA . ASN B 1 1475 ? 136.118 123.725 104.471 1.00 0.00 ? 1475 ASN B CA 5  
ATOM 9505   C CA . LYS B 1 1476 ? 138.886 125.826 106.136 1.00 0.00 ? 1476 LYS B CA 5  
ATOM 9506   C CA . ARG B 1 1477 ? 136.944 125.900 109.432 1.00 0.00 ? 1477 ARG B CA 5  
ATOM 9507   C CA . GLY B 1 1478 ? 135.137 122.584 109.562 1.00 0.00 ? 1478 GLY B CA 5  
ATOM 9508   C CA . PHE B 1 1479 ? 132.162 123.084 107.209 1.00 0.00 ? 1479 PHE B CA 5  
ATOM 9509   C CA . PRO B 1 1480 ? 133.132 120.790 104.286 1.00 0.00 ? 1480 PRO B CA 5  
ATOM 9510   C CA . ALA B 1 1481 ? 129.858 120.023 102.477 1.00 0.00 ? 1481 ALA B CA 5  
ATOM 9511   C CA . ILE B 1 1482 ? 128.978 123.637 101.539 1.00 0.00 ? 1482 ILE B CA 5  
ATOM 9512   C CA . ARG B 1 1483 ? 131.244 124.961 98.698  1.00 0.00 ? 1483 ARG B CA 5  
ATOM 9513   C CA . ASP B 1 1484 ? 128.446 127.373 97.610  1.00 0.00 ? 1484 ASP B CA 5  
ATOM 9514   C CA . TYR B 1 1485 ? 127.065 130.708 98.865  1.00 0.00 ? 1485 TYR B CA 5  
ATOM 9515   C CA . HIS B 1 1486 ? 124.339 132.975 97.424  1.00 0.00 ? 1486 HIS B CA 5  
ATOM 9516   C CA . PHE B 1 1487 ? 123.330 136.540 97.996  1.00 0.00 ? 1487 PHE B CA 5  
ATOM 9517   C CA . VAL B 1 1488 ? 119.847 137.213 96.681  1.00 0.00 ? 1488 VAL B CA 5  
ATOM 9518   C CA . ASN B 1 1489 ? 117.622 140.298 96.375  1.00 0.00 ? 1489 ASN B CA 5  
ATOM 9519   C CA . ALA B 1 1490 ? 114.283 139.056 95.064  1.00 0.00 ? 1490 ALA B CA 5  
ATOM 9520   C CA . THR B 1 1491 ? 112.421 142.276 94.333  1.00 0.00 ? 1491 THR B CA 5  
ATOM 9521   C CA . GLU B 1 1492 ? 115.398 143.963 92.659  1.00 0.00 ? 1492 GLU B CA 5  
ATOM 9522   C CA . GLU B 1 1493 ? 116.490 141.272 90.180  1.00 0.00 ? 1493 GLU B CA 5  
ATOM 9523   C CA . SER B 1 1494 ? 116.331 137.461 89.741  1.00 0.00 ? 1494 SER B CA 5  
ATOM 9524   C CA . ASP B 1 1495 ? 119.873 137.024 88.394  1.00 0.00 ? 1495 ASP B CA 5  
ATOM 9525   C CA . ALA B 1 1496 ? 121.394 135.684 91.651  1.00 0.00 ? 1496 ALA B CA 5  
ATOM 9526   C CA . LEU B 1 1497 ? 118.511 133.176 92.014  1.00 0.00 ? 1497 LEU B CA 5  
ATOM 9527   C CA . ALA B 1 1498 ? 119.410 131.620 88.655  1.00 0.00 ? 1498 ALA B CA 5  
ATOM 9528   C CA . LYS B 1 1499 ? 122.841 131.012 90.280  1.00 0.00 ? 1499 LYS B CA 5  
ATOM 9529   C CA . LEU B 1 1500 ? 121.050 128.993 93.039  1.00 0.00 ? 1500 LEU B CA 5  
ATOM 9530   C CA . ARG B 1 1501 ? 119.974 126.621 90.246  1.00 0.00 ? 1501 ARG B CA 5  
ATOM 9531   C CA . LYS B 1 1502 ? 123.687 125.993 89.428  1.00 0.00 ? 1502 LYS B CA 5  
ATOM 9532   C CA . THR B 1 1503 ? 124.250 124.862 93.026  1.00 0.00 ? 1503 THR B CA 5  
ATOM 9533   C CA . ILE B 1 1504 ? 121.103 122.665 92.825  1.00 0.00 ? 1504 ILE B CA 5  
ATOM 9534   C CA . ILE B 1 1505 ? 122.855 121.290 89.688  1.00 0.00 ? 1505 ILE B CA 5  
ATOM 9535   C CA . ASN B 1 1506 ? 126.177 120.793 91.626  1.00 0.00 ? 1506 ASN B CA 5  
ATOM 9536   C CA . GLU B 1 1507 ? 124.303 118.739 94.207  1.00 0.00 ? 1507 GLU B CA 5  
ATOM 9537   C CA . SER B 1 1508 ? 121.926 115.771 93.397  1.00 0.00 ? 1508 SER B CA 5  
ATOM 9538   C CA . LEU B 1 1509 ? 125.095 114.401 91.698  1.00 0.00 ? 1509 LEU B CA 5  
ATOM 9539   C CA . ASN B 1 1510 ? 126.451 112.459 94.694  1.00 0.00 ? 1510 ASN B CA 5  
ATOM 9540   C CA . PHE B 1 1511 ? 122.925 111.557 96.044  1.00 0.00 ? 1511 PHE B CA 5  
ATOM 9541   C CA . LYS B 1 1512 ? 121.134 109.817 93.255  1.00 0.00 ? 1512 LYS B CA 5  
ATOM 9542   C CA . ILE B 1 1513 ? 123.427 109.374 90.184  1.00 0.00 ? 1513 ILE B CA 5  
ATOM 9543   C CA . ARG B 1 1514 ? 125.889 106.917 91.789  1.00 0.00 ? 1514 ARG B CA 5  
ATOM 9544   C CA . PRO B 1 1524 ? 140.562 132.139 79.820  1.00 0.00 ? 1524 PRO B CA 5  
ATOM 9545   C CA . ASP B 1 1525 ? 137.784 129.932 78.325  1.00 0.00 ? 1525 ASP B CA 5  
ATOM 9546   C CA . CYS B 1 1526 ? 140.037 126.814 78.441  1.00 0.00 ? 1526 CYS B CA 5  
ATOM 9547   C CA . TYR B 1 1527 ? 140.334 127.021 82.289  1.00 0.00 ? 1527 TYR B CA 5  
ATOM 9548   C CA . VAL B 1 1528 ? 136.481 127.266 82.639  1.00 0.00 ? 1528 VAL B CA 5  
ATOM 9549   C CA . GLU B 1 1529 ? 135.967 124.423 80.088  1.00 0.00 ? 1529 GLU B CA 5  
ATOM 9550   C CA . LEU B 1 1530 ? 138.438 122.176 81.877  1.00 0.00 ? 1530 LEU B CA 5  
ATOM 9551   C CA . GLU B 1 1531 ? 136.954 123.029 85.326  1.00 0.00 ? 1531 GLU B CA 5  
ATOM 9552   C CA . LYS B 1 1532 ? 133.462 121.946 84.153  1.00 0.00 ? 1532 LYS B CA 5  
ATOM 9553   C CA . ILE B 1 1533 ? 134.732 118.665 82.627  1.00 0.00 ? 1533 ILE B CA 5  
ATOM 9554   C CA . ILE B 1 1534 ? 136.853 117.967 85.735  1.00 0.00 ? 1534 ILE B CA 5  
ATOM 9555   C CA . LEU B 1 1535 ? 133.826 118.596 88.033  1.00 0.00 ? 1535 LEU B CA 5  
ATOM 9556   C CA . SER B 1 1536 ? 131.529 116.339 85.942  1.00 0.00 ? 1536 SER B CA 5  
ATOM 9557   C CA . GLU B 1 1537 ? 134.158 113.523 85.810  1.00 0.00 ? 1537 GLU B CA 5  
ATOM 9558   C CA . ARG B 1 1538 ? 134.984 113.922 89.524  1.00 0.00 ? 1538 ARG B CA 5  
ATOM 9559   C CA . LYS B 1 1539 ? 131.458 113.987 91.010  1.00 0.00 ? 1539 LYS B CA 5  
ATOM 9560   C CA . ASN B 1 1540 ? 130.569 110.847 89.008  1.00 0.00 ? 1540 ASN B CA 5  
ATOM 9561   C CA . VAL B 1 1541 ? 133.277 108.912 90.900  1.00 0.00 ? 1541 VAL B CA 5  
ATOM 9562   C CA . PRO B 1 1542 ? 131.888 109.105 94.535  1.00 0.00 ? 1542 PRO B CA 5  
ATOM 9563   C CA . ILE B 1 1543 ? 132.290 105.397 95.082  1.00 0.00 ? 1543 ILE B CA 5  
ATOM 9564   C CA . GLU B 1 1544 ? 135.937 105.252 94.214  1.00 0.00 ? 1544 GLU B CA 5  
ATOM 9565   C CA . PHE B 1 1545 ? 139.083 107.326 95.045  1.00 0.00 ? 1545 PHE B CA 5  
ATOM 9566   C CA . PRO B 1 1546 ? 140.952 107.753 91.669  1.00 0.00 ? 1546 PRO B CA 5  
ATOM 9567   C CA . VAL B 1 1547 ? 138.251 110.101 90.695  1.00 0.00 ? 1547 VAL B CA 5  
ATOM 9568   C CA . ILE B 1 1548 ? 140.699 111.342 88.124  1.00 0.00 ? 1548 ILE B CA 5  
ATOM 9569   C CA . ASP B 1 1549 ? 144.053 109.622 87.472  1.00 0.00 ? 1549 ASP B CA 5  
ATOM 9570   C CA . ARG B 1 1550 ? 147.042 111.431 85.863  1.00 0.00 ? 1550 ARG B CA 5  
ATOM 9571   C CA . LYS B 1 1551 ? 146.350 110.126 82.332  1.00 0.00 ? 1551 LYS B CA 5  
ATOM 9572   C CA . ARG B 1 1552 ? 142.673 111.029 82.509  1.00 0.00 ? 1552 ARG B CA 5  
ATOM 9573   C CA . LEU B 1 1553 ? 143.214 114.745 83.417  1.00 0.00 ? 1553 LEU B CA 5  
ATOM 9574   C CA . LEU B 1 1554 ? 145.968 114.950 80.756  1.00 0.00 ? 1554 LEU B CA 5  
ATOM 9575   C CA . GLN B 1 1555 ? 143.352 113.739 78.247  1.00 0.00 ? 1555 GLN B CA 5  
ATOM 9576   C CA . LEU B 1 1556 ? 140.765 116.360 79.400  1.00 0.00 ? 1556 LEU B CA 5  
ATOM 9577   C CA . VAL B 1 1557 ? 143.411 119.165 79.327  1.00 0.00 ? 1557 VAL B CA 5  
ATOM 9578   C CA . ARG B 1 1558 ? 144.297 118.225 75.693  1.00 0.00 ? 1558 ARG B CA 5  
ATOM 9579   C CA . GLU B 1 1559 ? 140.652 118.303 74.541  1.00 0.00 ? 1559 GLU B CA 5  
ATOM 9580   C CA . ASN B 1 1560 ? 140.450 121.970 75.676  1.00 0.00 ? 1560 ASN B CA 5  
ATOM 9581   C CA . GLN B 1 1561 ? 143.878 122.703 74.056  1.00 0.00 ? 1561 GLN B CA 5  
ATOM 9582   C CA . LEU B 1 1562 ? 145.948 123.000 77.301  1.00 0.00 ? 1562 LEU B CA 5  
ATOM 9583   C CA . GLN B 1 1563 ? 148.383 120.055 76.760  1.00 0.00 ? 1563 GLN B CA 5  
ATOM 9584   C CA . LEU B 1 1564 ? 150.636 122.653 75.077  1.00 0.00 ? 1564 LEU B CA 5  
ATOM 9585   C CA . ASP B 1 1565 ? 152.448 123.337 78.365  1.00 0.00 ? 1565 ASP B CA 5  
ATOM 9586   C CA . GLU B 1 1566 ? 152.805 120.974 81.378  1.00 0.00 ? 1566 GLU B CA 5  
ATOM 9587   C CA . ASN B 1 1567 ? 153.702 124.071 83.375  1.00 0.00 ? 1567 ASN B CA 5  
ATOM 9588   C CA . GLU B 1 1568 ? 150.231 125.773 82.895  1.00 0.00 ? 1568 GLU B CA 5  
ATOM 9589   C CA . LEU B 1 1569 ? 148.388 122.588 83.798  1.00 0.00 ? 1569 LEU B CA 5  
ATOM 9590   C CA . PRO B 1 1570 ? 149.966 122.572 87.370  1.00 0.00 ? 1570 PRO B CA 5  
ATOM 9591   C CA . HIS B 1 1571 ? 148.986 126.246 87.620  1.00 0.00 ? 1571 HIS B CA 5  
ATOM 9592   C CA . ALA B 1 1572 ? 145.360 125.597 86.497  1.00 0.00 ? 1572 ALA B CA 5  
ATOM 9593   C CA . VAL B 1 1573 ? 144.963 122.632 88.889  1.00 0.00 ? 1573 VAL B CA 5  
ATOM 9594   C CA . HIS B 1 1574 ? 146.834 124.620 91.626  1.00 0.00 ? 1574 HIS B CA 5  
ATOM 9595   C CA . PHE B 1 1575 ? 144.167 127.356 91.113  1.00 0.00 ? 1575 PHE B CA 5  
ATOM 9596   C CA . LEU B 1 1576 ? 141.295 124.868 91.172  1.00 0.00 ? 1576 LEU B CA 5  
ATOM 9597   C CA . ASN B 1 1577 ? 142.752 123.306 94.346  1.00 0.00 ? 1577 ASN B CA 5  
ATOM 9598   C CA . GLU B 1 1578 ? 143.252 126.759 96.031  1.00 0.00 ? 1578 GLU B CA 5  
ATOM 9599   C CA . SER B 1 1579 ? 139.593 127.513 95.221  1.00 0.00 ? 1579 SER B CA 5  
ATOM 9600   C CA . GLY B 1 1580 ? 138.254 124.105 96.481  1.00 0.00 ? 1580 GLY B CA 5  
ATOM 9601   C CA . VAL B 1 1581 ? 136.550 123.275 93.175  1.00 0.00 ? 1581 VAL B CA 5  
ATOM 9602   C CA . LEU B 1 1582 ? 138.692 120.170 93.054  1.00 0.00 ? 1582 LEU B CA 5  
ATOM 9603   C CA . LEU B 1 1583 ? 141.436 118.909 95.318  1.00 0.00 ? 1583 LEU B CA 5  
ATOM 9604   C CA . HIS B 1 1584 ? 144.989 118.322 94.041  1.00 0.00 ? 1584 HIS B CA 5  
ATOM 9605   C CA . PHE B 1 1585 ? 147.742 117.479 96.464  1.00 0.00 ? 1585 PHE B CA 5  
ATOM 9606   C CA . GLN B 1 1586 ? 151.135 118.432 95.000  1.00 0.00 ? 1586 GLN B CA 5  
ATOM 9607   C CA . ASP B 1 1587 ? 153.088 117.071 98.042  1.00 0.00 ? 1587 ASP B CA 5  
ATOM 9608   C CA . PRO B 1 1588 ? 151.924 113.348 97.623  1.00 0.00 ? 1588 PRO B CA 5  
ATOM 9609   C CA . ALA B 1 1589 ? 151.909 113.734 93.778  1.00 0.00 ? 1589 ALA B CA 5  
ATOM 9610   C CA . LEU B 1 1590 ? 155.505 112.443 93.408  1.00 0.00 ? 1590 LEU B CA 5  
ATOM 9611   C CA . GLN B 1 1591 ? 154.425 108.795 93.874  1.00 0.00 ? 1591 GLN B CA 5  
ATOM 9612   C CA . LEU B 1 1592 ? 150.712 109.026 93.090  1.00 0.00 ? 1592 LEU B CA 5  
ATOM 9613   C CA . SER B 1 1593 ? 149.488 109.120 89.448  1.00 0.00 ? 1593 SER B CA 5  
ATOM 9614   C CA . ASP B 1 1594 ? 146.545 106.805 90.251  1.00 0.00 ? 1594 ASP B CA 5  
ATOM 9615   C CA . LEU B 1 1595 ? 144.900 109.377 92.529  1.00 0.00 ? 1595 LEU B CA 5  
ATOM 9616   C CA . TYR B 1 1596 ? 145.878 112.761 91.175  1.00 0.00 ? 1596 TYR B CA 5  
ATOM 9617   C CA . PHE B 1 1597 ? 142.872 115.081 91.498  1.00 0.00 ? 1597 PHE B CA 5  
ATOM 9618   C CA . VAL B 1 1598 ? 140.026 114.572 94.004  1.00 0.00 ? 1598 VAL B CA 5  
ATOM 9619   C CA . GLU B 1 1599 ? 136.281 115.325 94.638  1.00 0.00 ? 1599 GLU B CA 5  
ATOM 9620   C CA . PRO B 1 1600 ? 136.064 117.613 97.763  1.00 0.00 ? 1600 PRO B CA 5  
ATOM 9621   C CA . LYS B 1 1601 ? 132.839 115.967 99.012  1.00 0.00 ? 1601 LYS B CA 5  
ATOM 9622   C CA . TRP B 1 1602 ? 134.369 112.508 98.824  1.00 0.00 ? 1602 TRP B CA 5  
ATOM 9623   C CA . LEU B 1 1603 ? 137.466 113.677 100.798 1.00 0.00 ? 1603 LEU B CA 5  
ATOM 9624   C CA . CYS B 1 1604 ? 135.422 115.586 103.429 1.00 0.00 ? 1604 CYS B CA 5  
ATOM 9625   C CA . LYS B 1 1605 ? 133.024 112.668 104.087 1.00 0.00 ? 1605 LYS B CA 5  
ATOM 9626   C CA . ILE B 1 1606 ? 136.050 110.356 104.510 1.00 0.00 ? 1606 ILE B CA 5  
ATOM 9627   C CA . MET B 1 1607 ? 137.666 112.304 107.238 1.00 0.00 ? 1607 MET B CA 5  
ATOM 9628   C CA . ALA B 1 1608 ? 134.504 113.182 109.106 1.00 0.00 ? 1608 ALA B CA 5  
ATOM 9629   C CA . GLN B 1 1609 ? 133.803 109.401 109.311 1.00 0.00 ? 1609 GLN B CA 5  
ATOM 9630   C CA . ILE B 1 1610 ? 137.312 108.839 110.801 1.00 0.00 ? 1610 ILE B CA 5  
ATOM 9631   C CA . LEU B 1 1611 ? 136.848 111.802 113.200 1.00 0.00 ? 1611 LEU B CA 5  
ATOM 9632   C CA . THR B 1 1612 ? 133.390 110.654 114.455 1.00 0.00 ? 1612 THR B CA 5  
ATOM 9633   C CA . VAL B 1 1613 ? 134.078 106.907 114.615 1.00 0.00 ? 1613 VAL B CA 5  
ATOM 9634   C CA . LYS B 1 1614 ? 133.490 105.143 117.975 1.00 0.00 ? 1614 LYS B CA 5  
ATOM 9635   C CA . VAL B 1 1615 ? 136.761 103.193 117.554 1.00 0.00 ? 1615 VAL B CA 5  
ATOM 9636   C CA . GLU B 1 1616 ? 139.289 105.812 118.715 1.00 0.00 ? 1616 GLU B CA 5  
ATOM 9637   C CA . GLY B 1 1617 ? 141.384 103.227 120.583 1.00 0.00 ? 1617 GLY B CA 5  
ATOM 9638   C CA . CYS B 1 1618 ? 141.550 100.039 122.629 1.00 0.00 ? 1618 CYS B CA 5  
ATOM 9639   C CA . PRO B 1 1619 ? 138.321 99.138  124.625 1.00 0.00 ? 1619 PRO B CA 5  
ATOM 9640   C CA . LYS B 1 1620 ? 139.159 100.761 128.016 1.00 0.00 ? 1620 LYS B CA 5  
ATOM 9641   C CA . HIS B 1 1621 ? 141.295 103.647 126.678 1.00 0.00 ? 1621 HIS B CA 5  
ATOM 9642   C CA . PRO B 1 1622 ? 139.914 105.359 123.504 1.00 0.00 ? 1622 PRO B CA 5  
ATOM 9643   C CA . LYS B 1 1623 ? 141.812 108.678 123.542 1.00 0.00 ? 1623 LYS B CA 5  
ATOM 9644   C CA . GLY B 1 1624 ? 142.120 109.786 119.870 1.00 0.00 ? 1624 GLY B CA 5  
ATOM 9645   C CA . ILE B 1 1625 ? 143.939 106.609 118.743 1.00 0.00 ? 1625 ILE B CA 5  
ATOM 9646   C CA . ILE B 1 1626 ? 143.393 105.399 115.151 1.00 0.00 ? 1626 ILE B CA 5  
ATOM 9647   C CA . SER B 1 1627 ? 144.244 101.693 114.795 1.00 0.00 ? 1627 SER B CA 5  
ATOM 9648   C CA . ARG B 1 1628 ? 145.092 101.330 111.056 1.00 0.00 ? 1628 ARG B CA 5  
ATOM 9649   C CA . ARG B 1 1629 ? 143.479 97.846  110.750 1.00 0.00 ? 1629 ARG B CA 5  
ATOM 9650   C CA . ASP B 1 1630 ? 140.041 99.025  111.557 1.00 0.00 ? 1630 ASP B CA 5  
ATOM 9651   C CA . VAL B 1 1631 ? 139.759 101.612 108.694 1.00 0.00 ? 1631 VAL B CA 5  
ATOM 9652   C CA . GLU B 1 1632 ? 137.757 99.156  106.511 1.00 0.00 ? 1632 GLU B CA 5  
ATOM 9653   C CA . LYS B 1 1633 ? 134.997 99.015  109.136 1.00 0.00 ? 1633 LYS B CA 5  
ATOM 9654   C CA . PHE B 1 1634 ? 134.958 102.802 109.841 1.00 0.00 ? 1634 PHE B CA 5  
ATOM 9655   C CA . LEU B 1 1635 ? 134.758 103.934 106.287 1.00 0.00 ? 1635 LEU B CA 5  
ATOM 9656   C CA . SER B 1 1636 ? 132.703 101.193 104.511 1.00 0.00 ? 1636 SER B CA 5  
ATOM 9657   C CA . LYS B 1 1637 ? 129.890 100.630 103.264 1.00 0.00 ? 1637 LYS B CA 5  
ATOM 9658   C CA . LYS B 1 1638 ? 128.521 104.198 103.951 1.00 0.00 ? 1638 LYS B CA 5  
ATOM 9659   C CA . ARG B 1 1639 ? 131.172 105.239 101.525 1.00 0.00 ? 1639 ARG B CA 5  
ATOM 9660   C CA . LYS B 1 1640 ? 133.294 102.928 99.393  1.00 0.00 ? 1640 LYS B CA 5  
ATOM 9661   C CA . PHE B 1 1641 ? 136.963 102.889 100.389 1.00 0.00 ? 1641 PHE B CA 5  
ATOM 9662   C CA . PRO B 1 1642 ? 139.226 100.120 99.121  1.00 0.00 ? 1642 PRO B CA 5  
ATOM 9663   C CA . LYS B 1 1643 ? 142.645 99.472  100.755 1.00 0.00 ? 1643 LYS B CA 5  
ATOM 9664   C CA . ASN B 1 1644 ? 144.823 101.780 98.563  1.00 0.00 ? 1644 ASN B CA 5  
ATOM 9665   C CA . TYR B 1 1645 ? 142.222 104.549 98.984  1.00 0.00 ? 1645 TYR B CA 5  
ATOM 9666   C CA . MET B 1 1646 ? 142.435 103.859 102.739 1.00 0.00 ? 1646 MET B CA 5  
ATOM 9667   C CA . SER B 1 1647 ? 146.231 104.402 102.848 1.00 0.00 ? 1647 SER B CA 5  
ATOM 9668   C CA . GLN B 1 1648 ? 145.929 107.718 100.922 1.00 0.00 ? 1648 GLN B CA 5  
ATOM 9669   C CA . TYR B 1 1649 ? 143.134 109.318 103.049 1.00 0.00 ? 1649 TYR B CA 5  
ATOM 9670   C CA . PHE B 1 1650 ? 145.467 108.943 106.042 1.00 0.00 ? 1650 PHE B CA 5  
ATOM 9671   C CA . LYS B 1 1651 ? 148.031 111.008 104.083 1.00 0.00 ? 1651 LYS B CA 5  
ATOM 9672   C CA . LEU B 1 1652 ? 145.266 113.605 103.525 1.00 0.00 ? 1652 LEU B CA 5  
ATOM 9673   C CA . LEU B 1 1653 ? 144.617 113.663 107.338 1.00 0.00 ? 1653 LEU B CA 5  
ATOM 9674   C CA . GLU B 1 1654 ? 148.370 114.206 107.910 1.00 0.00 ? 1654 GLU B CA 5  
ATOM 9675   C CA . LYS B 1 1655 ? 148.359 116.992 105.312 1.00 0.00 ? 1655 LYS B CA 5  
ATOM 9676   C CA . PHE B 1 1656 ? 145.186 118.599 106.804 1.00 0.00 ? 1656 PHE B CA 5  
ATOM 9677   C CA . GLN B 1 1657 ? 147.009 118.385 110.204 1.00 0.00 ? 1657 GLN B CA 5  
ATOM 9678   C CA . ILE B 1 1658 ? 144.285 116.273 111.815 1.00 0.00 ? 1658 ILE B CA 5  
ATOM 9679   C CA . ALA B 1 1659 ? 146.547 113.361 112.760 1.00 0.00 ? 1659 ALA B CA 5  
ATOM 9680   C CA . LEU B 1 1660 ? 150.181 112.200 113.010 1.00 0.00 ? 1660 LEU B CA 5  
ATOM 9681   C CA . PRO B 1 1661 ? 151.882 108.741 112.916 1.00 0.00 ? 1661 PRO B CA 5  
ATOM 9682   C CA . ILE B 1 1662 ? 153.735 107.360 115.986 1.00 0.00 ? 1662 ILE B CA 5  
ATOM 9683   C CA . GLY B 1 1663 ? 154.984 104.288 114.063 1.00 0.00 ? 1663 GLY B CA 5  
ATOM 9684   C CA . GLU B 1 1664 ? 153.112 101.196 115.343 1.00 0.00 ? 1664 GLU B CA 5  
ATOM 9685   C CA . GLU B 1 1665 ? 150.186 101.394 112.813 1.00 0.00 ? 1665 GLU B CA 5  
ATOM 9686   C CA . TYR B 1 1666 ? 148.530 103.624 115.430 1.00 0.00 ? 1666 TYR B CA 5  
ATOM 9687   C CA . LEU B 1 1667 ? 147.891 107.322 114.751 1.00 0.00 ? 1667 LEU B CA 5  
ATOM 9688   C CA . LEU B 1 1668 ? 147.041 110.165 117.133 1.00 0.00 ? 1668 LEU B CA 5  
ATOM 9689   C CA . VAL B 1 1669 ? 144.077 112.490 116.429 1.00 0.00 ? 1669 VAL B CA 5  
ATOM 9690   C CA . ILE B 1 1690 ? 144.255 138.596 122.714 1.00 0.00 ? 1690 ILE B CA 5  
ATOM 9691   C CA . ILE B 1 1691 ? 146.800 139.661 119.997 1.00 0.00 ? 1691 ILE B CA 5  
ATOM 9692   C CA . ILE B 1 1692 ? 147.040 143.454 119.947 1.00 0.00 ? 1692 ILE B CA 5  
ATOM 9693   C CA . ARG B 1 1693 ? 149.018 145.359 117.294 1.00 0.00 ? 1693 ARG B CA 5  
ATOM 9694   C CA . LEU B 1 1694 ? 149.100 149.187 117.134 1.00 0.00 ? 1694 LEU B CA 5  
ATOM 9695   C CA . TYR B 1 1695 ? 150.133 151.448 114.188 1.00 0.00 ? 1695 TYR B CA 5  
ATOM 9696   C CA . GLU B 1 1696 ? 151.215 155.085 114.960 1.00 0.00 ? 1696 GLU B CA 5  
ATOM 9697   C CA . MET B 1 1697 ? 150.785 157.620 112.112 1.00 0.00 ? 1697 MET B CA 5  
ATOM 9698   C CA . PRO B 1 1698 ? 152.068 161.343 112.385 1.00 0.00 ? 1698 PRO B CA 5  
ATOM 9699   C CA . TYR B 1 1699 ? 149.050 162.064 110.299 1.00 0.00 ? 1699 TYR B CA 5  
ATOM 9700   C CA . PHE B 1 1700 ? 146.150 159.546 110.292 1.00 0.00 ? 1700 PHE B CA 5  
ATOM 9701   C CA . PRO B 1 1701 ? 144.050 160.087 107.067 1.00 0.00 ? 1701 PRO B CA 5  
ATOM 9702   C CA . MET B 1 1702 ? 140.325 160.105 107.883 1.00 0.00 ? 1702 MET B CA 5  
ATOM 9703   C CA . GLY B 1 1703 ? 139.800 157.973 104.770 1.00 0.00 ? 1703 GLY B CA 5  
ATOM 9704   C CA . PHE B 1 1704 ? 141.761 154.962 106.167 1.00 0.00 ? 1704 PHE B CA 5  
ATOM 9705   C CA . TRP B 1 1705 ? 138.937 153.384 108.170 1.00 0.00 ? 1705 TRP B CA 5  
ATOM 9706   C CA . SER B 1 1706 ? 136.317 154.157 105.577 1.00 0.00 ? 1706 SER B CA 5  
ATOM 9707   C CA . ARG B 1 1707 ? 138.441 152.506 102.875 1.00 0.00 ? 1707 ARG B CA 5  
ATOM 9708   C CA . LEU B 1 1708 ? 139.446 149.523 105.035 1.00 0.00 ? 1708 LEU B CA 5  
ATOM 9709   C CA . ILE B 1 1709 ? 135.729 148.994 105.850 1.00 0.00 ? 1709 ILE B CA 5  
ATOM 9710   C CA . ASN B 1 1710 ? 135.152 148.818 102.051 1.00 0.00 ? 1710 ASN B CA 5  
ATOM 9711   C CA . ARG B 1 1711 ? 138.059 146.358 101.439 1.00 0.00 ? 1711 ARG B CA 5  
ATOM 9712   C CA . LEU B 1 1712 ? 136.733 144.194 104.300 1.00 0.00 ? 1712 LEU B CA 5  
ATOM 9713   C CA . LEU B 1 1713 ? 132.910 144.601 103.807 1.00 0.00 ? 1713 LEU B CA 5  
ATOM 9714   C CA . GLU B 1 1714 ? 132.297 140.857 103.533 1.00 0.00 ? 1714 GLU B CA 5  
ATOM 9715   C CA . ILE B 1 1715 ? 133.708 140.036 107.013 1.00 0.00 ? 1715 ILE B CA 5  
ATOM 9716   C CA . SER B 1 1716 ? 131.888 142.730 109.061 1.00 0.00 ? 1716 SER B CA 5  
ATOM 9717   C CA . PRO B 1 1717 ? 128.605 140.799 109.665 1.00 0.00 ? 1717 PRO B CA 5  
ATOM 9718   C CA . TYR B 1 1718 ? 130.571 137.538 109.606 1.00 0.00 ? 1718 TYR B CA 5  
ATOM 9719   C CA . MET B 1 1719 ? 132.086 135.231 107.024 1.00 0.00 ? 1719 MET B CA 5  
ATOM 9720   C CA . LEU B 1 1720 ? 131.734 131.961 109.054 1.00 0.00 ? 1720 LEU B CA 5  
ATOM 9721   C CA . SER B 1 1721 ? 128.401 130.342 109.787 1.00 0.00 ? 1721 SER B CA 5  
ATOM 9722   C CA . GLY B 1 1722 ? 130.086 129.452 113.155 1.00 0.00 ? 1722 GLY B CA 5  
ATOM 9723   C CA . ARG B 1 1723 ? 129.392 132.615 115.081 1.00 0.00 ? 1723 ARG B CA 5  
ATOM 9724   C CA . GLU B 1 1724 ? 129.854 132.626 118.872 1.00 0.00 ? 1724 GLU B CA 5  
ATOM 9725   C CA . ARG B 1 1725 ? 129.508 136.301 119.798 1.00 0.00 ? 1725 ARG B CA 5  
ATOM 9726   C CA . ALA B 1 1726 ? 126.383 138.263 118.792 1.00 0.00 ? 1726 ALA B CA 5  
ATOM 9727   C CA . LEU B 1 1727 ? 127.879 141.683 119.594 1.00 0.00 ? 1727 LEU B CA 5  
ATOM 9728   C CA . ARG B 1 1728 ? 131.163 141.987 117.674 1.00 0.00 ? 1728 ARG B CA 5  
ATOM 9729   C CA . PRO B 1 1729 ? 130.119 141.149 114.032 1.00 0.00 ? 1729 PRO B CA 5  
ATOM 9730   C CA . ASN B 1 1730 ? 126.473 142.020 112.848 1.00 0.00 ? 1730 ASN B CA 5  
ATOM 9731   C CA . ARG B 1 1731 ? 126.671 145.505 111.304 1.00 0.00 ? 1731 ARG B CA 5  
ATOM 9732   C CA . MET B 1 1732 ? 129.094 146.429 114.001 1.00 0.00 ? 1732 MET B CA 5  
ATOM 9733   C CA . TYR B 1 1733 ? 130.902 149.092 112.246 1.00 0.00 ? 1733 TYR B CA 5  
ATOM 9734   C CA . TRP B 1 1734 ? 131.177 152.681 113.244 1.00 0.00 ? 1734 TRP B CA 5  
ATOM 9735   C CA . ARG B 1 1735 ? 133.009 155.856 112.210 1.00 0.00 ? 1735 ARG B CA 5  
ATOM 9736   C CA . GLN B 1 1736 ? 136.195 154.849 114.110 1.00 0.00 ? 1736 GLN B CA 5  
ATOM 9737   C CA . GLY B 1 1737 ? 136.195 151.043 113.650 1.00 0.00 ? 1737 GLY B CA 5  
ATOM 9738   C CA . ILE B 1 1738 ? 134.804 147.637 112.765 1.00 0.00 ? 1738 ILE B CA 5  
ATOM 9739   C CA . TYR B 1 1739 ? 134.558 144.046 114.006 1.00 0.00 ? 1739 TYR B CA 5  
ATOM 9740   C CA . LEU B 1 1740 ? 135.684 141.416 111.563 1.00 0.00 ? 1740 LEU B CA 5  
ATOM 9741   C CA . ASN B 1 1741 ? 135.022 137.647 111.558 1.00 0.00 ? 1741 ASN B CA 5  
ATOM 9742   C CA . TRP B 1 1742 ? 136.401 135.157 108.994 1.00 0.00 ? 1742 TRP B CA 5  
ATOM 9743   C CA . SER B 1 1743 ? 136.090 131.463 108.157 1.00 0.00 ? 1743 SER B CA 5  
ATOM 9744   C CA . PRO B 1 1744 ? 137.686 129.244 109.516 1.00 0.00 ? 1744 PRO B CA 5  
ATOM 9745   C CA . GLU B 1 1745 ? 138.507 129.114 112.447 1.00 0.00 ? 1745 GLU B CA 5  
ATOM 9746   C CA . ALA B 1 1746 ? 136.032 131.860 113.595 1.00 0.00 ? 1746 ALA B CA 5  
ATOM 9747   C CA . TYR B 1 1747 ? 138.575 134.402 114.613 1.00 0.00 ? 1747 TYR B CA 5  
ATOM 9748   C CA . CYS B 1 1748 ? 137.134 137.802 115.687 1.00 0.00 ? 1748 CYS B CA 5  
ATOM 9749   C CA . LEU B 1 1749 ? 139.137 141.002 115.021 1.00 0.00 ? 1749 LEU B CA 5  
ATOM 9750   C CA . VAL B 1 1750 ? 138.398 144.527 116.221 1.00 0.00 ? 1750 VAL B CA 5  
ATOM 9751   C CA . GLY B 1 1751 ? 139.984 147.345 114.318 1.00 0.00 ? 1751 GLY B CA 5  
ATOM 9752   C CA . SER B 1 1752 ? 139.734 150.751 116.003 1.00 0.00 ? 1752 SER B CA 5  
ATOM 9753   C CA . GLU B 1 1753 ? 141.910 153.695 114.906 1.00 0.00 ? 1753 GLU B CA 5  
ATOM 9754   C CA . VAL B 1 1754 ? 145.287 152.146 114.455 1.00 0.00 ? 1754 VAL B CA 5  
ATOM 9755   C CA . LEU B 1 1755 ? 144.579 149.414 117.025 1.00 0.00 ? 1755 LEU B CA 5  
ATOM 9756   C CA . ASP B 1 1756 ? 143.968 145.821 115.903 1.00 0.00 ? 1756 ASP B CA 5  
ATOM 9757   C CA . ASN B 1 1757 ? 142.903 143.382 118.687 1.00 0.00 ? 1757 ASN B CA 5  
ATOM 9758   C CA . HIS B 1 1758 ? 142.326 139.694 117.901 1.00 0.00 ? 1758 HIS B CA 5  
ATOM 9759   C CA . PRO B 1 1759 ? 140.884 136.543 119.795 1.00 0.00 ? 1759 PRO B CA 5  
ATOM 9760   C CA . GLU B 1 1760 ? 141.331 132.887 118.393 1.00 0.00 ? 1760 GLU B CA 5  
ATOM 9761   C CA . SER B 1 1761 ? 144.225 130.426 117.781 1.00 0.00 ? 1761 SER B CA 5  
ATOM 9762   C CA . PHE B 1 1762 ? 144.588 131.537 114.071 1.00 0.00 ? 1762 PHE B CA 5  
ATOM 9763   C CA . LEU B 1 1763 ? 145.546 135.024 115.212 1.00 0.00 ? 1763 LEU B CA 5  
ATOM 9764   C CA . LYS B 1 1764 ? 148.792 135.388 113.486 1.00 0.00 ? 1764 LYS B CA 5  
ATOM 9765   C CA . ILE B 1 1765 ? 147.534 134.721 109.906 1.00 0.00 ? 1765 ILE B CA 5  
ATOM 9766   C CA . THR B 1 1766 ? 144.544 137.053 110.337 1.00 0.00 ? 1766 THR B CA 5  
ATOM 9767   C CA . VAL B 1 1767 ? 146.608 140.021 111.406 1.00 0.00 ? 1767 VAL B CA 5  
ATOM 9768   C CA . PRO B 1 1768 ? 148.754 140.118 108.083 1.00 0.00 ? 1768 PRO B CA 5  
ATOM 9769   C CA . SER B 1 1769 ? 145.706 140.060 105.909 1.00 0.00 ? 1769 SER B CA 5  
ATOM 9770   C CA . CYS B 1 1770 ? 144.312 143.036 107.904 1.00 0.00 ? 1770 CYS B CA 5  
ATOM 9771   C CA . ARG B 1 1771 ? 147.855 144.553 108.180 1.00 0.00 ? 1771 ARG B CA 5  
ATOM 9772   C CA . LYS B 1 1772 ? 148.380 144.116 104.427 1.00 0.00 ? 1772 LYS B CA 5  
ATOM 9773   C CA . GLY B 1 1773 ? 145.034 145.795 103.588 1.00 0.00 ? 1773 GLY B CA 5  
ATOM 9774   C CA . CYS B 1 1774 ? 145.970 148.715 105.845 1.00 0.00 ? 1774 CYS B CA 5  
ATOM 9775   C CA . ILE B 1 1775 ? 149.469 148.972 104.266 1.00 0.00 ? 1775 ILE B CA 5  
ATOM 9776   C CA . LEU B 1 1776 ? 147.853 148.918 100.769 1.00 0.00 ? 1776 LEU B CA 5  
ATOM 9777   C CA . LEU B 1 1777 ? 145.684 151.930 101.697 1.00 0.00 ? 1777 LEU B CA 5  
ATOM 9778   C CA . GLY B 1 1778 ? 148.679 153.706 103.251 1.00 0.00 ? 1778 GLY B CA 5  
ATOM 9779   C CA . GLN B 1 1779 ? 150.574 153.469 99.933  1.00 0.00 ? 1779 GLN B CA 5  
ATOM 9780   C CA . VAL B 1 1780 ? 147.968 155.780 98.264  1.00 0.00 ? 1780 VAL B CA 5  
ATOM 9781   C CA . VAL B 1 1781 ? 149.297 158.612 100.487 1.00 0.00 ? 1781 VAL B CA 5  
ATOM 9782   C CA . ASP B 1 1782 ? 152.807 159.970 99.724  1.00 0.00 ? 1782 ASP B CA 5  
ATOM 9783   C CA . HIS B 1 1783 ? 155.221 160.495 102.700 1.00 0.00 ? 1783 HIS B CA 5  
ATOM 9784   C CA . ILE B 1 1784 ? 153.012 158.710 105.317 1.00 0.00 ? 1784 ILE B CA 5  
ATOM 9785   C CA . ASP B 1 1785 ? 155.067 157.499 108.330 1.00 0.00 ? 1785 ASP B CA 5  
ATOM 9786   C CA . SER B 1 1786 ? 153.736 154.479 110.270 1.00 0.00 ? 1786 SER B CA 5  
ATOM 9787   C CA . LEU B 1 1787 ? 155.422 153.115 113.406 1.00 0.00 ? 1787 LEU B CA 5  
ATOM 9788   C CA . MET B 1 1788 ? 154.220 149.710 114.570 1.00 0.00 ? 1788 MET B CA 5  
ATOM 9789   C CA . GLU B 1 1789 ? 153.902 148.817 118.257 1.00 0.00 ? 1789 GLU B CA 5  
ATOM 9790   C CA . GLU B 1 1790 ? 153.128 145.856 120.457 1.00 0.00 ? 1790 GLU B CA 5  
ATOM 9791   C CA . TRP B 1 1791 ? 151.792 146.061 123.997 1.00 0.00 ? 1791 TRP B CA 5  
ATOM 9792   C CA . PHE B 1 1792 ? 153.909 144.506 126.742 1.00 0.00 ? 1792 PHE B CA 5  
ATOM 9793   C CA . PRO B 1 1793 ? 152.478 141.190 128.280 1.00 0.00 ? 1793 PRO B CA 5  
ATOM 9794   C CA . GLY B 1 1794 ? 150.650 142.087 131.498 1.00 0.00 ? 1794 GLY B CA 5  
ATOM 9795   C CA . LEU B 1 1795 ? 150.927 145.831 130.782 1.00 0.00 ? 1795 LEU B CA 5  
ATOM 9796   C CA . LEU B 1 1796 ? 148.417 146.863 128.070 1.00 0.00 ? 1796 LEU B CA 5  
ATOM 9797   C CA . GLU B 1 1797 ? 149.415 150.579 128.007 1.00 0.00 ? 1797 GLU B CA 5  
ATOM 9798   C CA . ILE B 1 1798 ? 153.218 149.990 127.824 1.00 0.00 ? 1798 ILE B CA 5  
ATOM 9799   C CA . ASP B 1 1799 ? 154.265 149.655 124.182 1.00 0.00 ? 1799 ASP B CA 5  
ATOM 9800   C CA . ILE B 1 1800 ? 157.436 148.402 122.489 1.00 0.00 ? 1800 ILE B CA 5  
ATOM 9801   C CA . CYS B 1 1801 ? 158.261 149.249 118.874 1.00 0.00 ? 1801 CYS B CA 5  
ATOM 9802   C CA . GLY B 1 1802 ? 158.256 146.181 116.528 1.00 0.00 ? 1802 GLY B CA 5  
ATOM 9803   C CA . GLU B 1 1803 ? 161.341 147.617 114.804 1.00 0.00 ? 1803 GLU B CA 5  
ATOM 9804   C CA . GLY B 1 1804 ? 163.013 147.561 118.266 1.00 0.00 ? 1804 GLY B CA 5  
ATOM 9805   C CA . GLU B 1 1805 ? 162.362 143.822 118.773 1.00 0.00 ? 1805 GLU B CA 5  
ATOM 9806   C CA . THR B 1 1806 ? 163.500 142.892 115.213 1.00 0.00 ? 1806 THR B CA 5  
ATOM 9807   C CA . LEU B 1 1807 ? 166.691 144.925 115.812 1.00 0.00 ? 1807 LEU B CA 5  
ATOM 9808   C CA . LEU B 1 1808 ? 167.237 143.122 119.140 1.00 0.00 ? 1808 LEU B CA 5  
ATOM 9809   C CA . LYS B 1 1809 ? 166.937 139.752 117.271 1.00 0.00 ? 1809 LYS B CA 5  
ATOM 9810   C CA . LYS B 1 1810 ? 169.447 140.865 114.591 1.00 0.00 ? 1810 LYS B CA 5  
ATOM 9811   C CA . TRP B 1 1811 ? 171.791 141.860 117.449 1.00 0.00 ? 1811 TRP B CA 5  
ATOM 9812   C CA . ALA B 1 1812 ? 171.385 138.313 118.858 1.00 0.00 ? 1812 ALA B CA 5  
ATOM 9813   C CA . LEU B 1 1813 ? 169.629 139.466 122.055 1.00 0.00 ? 1813 LEU B CA 5  
ATOM 9814   C CA . TYR B 1 1814 ? 166.570 137.745 123.512 1.00 0.00 ? 1814 TYR B CA 5  
ATOM 9815   C CA . SER B 1 1815 ? 165.974 140.138 126.427 1.00 0.00 ? 1815 SER B CA 5  
ATOM 9816   C CA . PHE B 1 1816 ? 163.970 143.291 126.134 1.00 0.00 ? 1816 PHE B CA 5  
ATOM 9817   C CA . ASN B 1 1817 ? 164.444 145.101 129.466 1.00 0.00 ? 1817 ASN B CA 5  
ATOM 9818   C CA . ASP B 1 1818 ? 161.797 147.499 130.710 1.00 0.00 ? 1818 ASP B CA 5  
ATOM 9819   C CA . GLY B 1 1819 ? 163.643 149.899 133.053 1.00 0.00 ? 1819 GLY B CA 5  
ATOM 9820   C CA . GLU B 1 1820 ? 160.600 151.854 134.303 1.00 0.00 ? 1820 GLU B CA 5  
ATOM 9821   C CA . GLU B 1 1821 ? 158.625 148.654 135.046 1.00 0.00 ? 1821 GLU B CA 5  
ATOM 9822   C CA . HIS B 1 1822 ? 161.756 146.756 136.231 1.00 0.00 ? 1822 HIS B CA 5  
ATOM 9823   C CA . GLN B 1 1823 ? 160.688 143.598 134.328 1.00 0.00 ? 1823 GLN B CA 5  
ATOM 9824   C CA . LYS B 1 1824 ? 162.410 141.745 131.449 1.00 0.00 ? 1824 LYS B CA 5  
ATOM 9825   C CA . ILE B 1 1825 ? 160.617 140.070 128.555 1.00 0.00 ? 1825 ILE B CA 5  
ATOM 9826   C CA . LEU B 1 1826 ? 161.440 137.476 125.962 1.00 0.00 ? 1826 LEU B CA 5  
ATOM 9827   C CA . LEU B 1 1827 ? 161.862 139.174 122.600 1.00 0.00 ? 1827 LEU B CA 5  
ATOM 9828   C CA . ASP B 1 1828 ? 161.238 136.007 120.604 1.00 0.00 ? 1828 ASP B CA 5  
ATOM 9829   C CA . ASP B 1 1829 ? 158.135 134.983 122.612 1.00 0.00 ? 1829 ASP B CA 5  
ATOM 9830   C CA . LEU B 1 1830 ? 156.319 138.311 122.008 1.00 0.00 ? 1830 LEU B CA 5  
ATOM 9831   C CA . MET B 1 1831 ? 157.603 138.525 118.391 1.00 0.00 ? 1831 MET B CA 5  
ATOM 9832   C CA . LYS B 1 1832 ? 156.515 134.965 117.381 1.00 0.00 ? 1832 LYS B CA 5  
ATOM 9833   C CA . LYS B 1 1833 ? 152.964 135.449 118.773 1.00 0.00 ? 1833 LYS B CA 5  
ATOM 9834   C CA . ALA B 1 1834 ? 152.150 137.253 115.529 1.00 0.00 ? 1834 ALA B CA 5  
ATOM 9835   C CA . GLU B 1 1835 ? 152.858 136.378 111.835 1.00 0.00 ? 1835 GLU B CA 5  
ATOM 9836   C CA . GLU B 1 1836 ? 156.416 137.736 111.984 1.00 0.00 ? 1836 GLU B CA 5  
ATOM 9837   C CA . GLY B 1 1837 ? 157.988 134.369 112.895 1.00 0.00 ? 1837 GLY B CA 5  
ATOM 9838   C CA . PHE B 1 1883 ? 170.012 161.812 87.347  1.00 0.00 ? 1883 PHE B CA 5  
ATOM 9839   C CA . LEU B 1 1884 ? 166.737 159.818 86.898  1.00 0.00 ? 1884 LEU B CA 5  
ATOM 9840   C CA . LEU B 1 1885 ? 166.801 156.069 85.933  1.00 0.00 ? 1885 LEU B CA 5  
ATOM 9841   C CA . GLY B 1 1886 ? 163.316 155.086 87.174  1.00 0.00 ? 1886 GLY B CA 5  
ATOM 9842   C CA . ASP B 1 1887 ? 161.598 151.876 86.106  1.00 0.00 ? 1887 ASP B CA 5  
ATOM 9843   C CA . GLY B 1 1888 ? 159.941 151.697 89.607  1.00 0.00 ? 1888 GLY B CA 5  
ATOM 9844   C CA . SER B 1 1889 ? 156.924 149.790 90.999  1.00 0.00 ? 1889 SER B CA 5  
ATOM 9845   C CA . PHE B 1 1890 ? 155.566 152.659 93.124  1.00 0.00 ? 1890 PHE B CA 5  
ATOM 9846   C CA . GLY B 1 1891 ? 157.658 155.640 92.005  1.00 0.00 ? 1891 GLY B CA 5  
ATOM 9847   C CA . SER B 1 1892 ? 160.788 157.043 90.396  1.00 0.00 ? 1892 SER B CA 5  
ATOM 9848   C CA . VAL B 1 1893 ? 164.364 155.748 90.885  1.00 0.00 ? 1893 VAL B CA 5  
ATOM 9849   C CA . TYR B 1 1894 ? 167.239 158.283 90.940  1.00 0.00 ? 1894 TYR B CA 5  
ATOM 9850   C CA . ARG B 1 1895 ? 171.021 158.003 90.911  1.00 0.00 ? 1895 ARG B CA 5  
ATOM 9851   C CA . ALA B 1 1896 ? 172.830 160.287 93.357  1.00 0.00 ? 1896 ALA B CA 5  
ATOM 9852   C CA . ALA B 1 1897 ? 175.545 160.309 96.038  1.00 0.00 ? 1897 ALA B CA 5  
ATOM 9853   C CA . TYR B 1 1898 ? 175.788 160.671 99.857  1.00 0.00 ? 1898 TYR B CA 5  
ATOM 9854   C CA . GLU B 1 1899 ? 177.551 164.035 100.500 1.00 0.00 ? 1899 GLU B CA 5  
ATOM 9855   C CA . GLY B 1 1900 ? 179.702 162.697 103.408 1.00 0.00 ? 1900 GLY B CA 5  
ATOM 9856   C CA . GLU B 1 1901 ? 181.203 159.582 101.712 1.00 0.00 ? 1901 GLU B CA 5  
ATOM 9857   C CA . GLU B 1 1902 ? 180.836 160.190 97.936  1.00 0.00 ? 1902 GLU B CA 5  
ATOM 9858   C CA . VAL B 1 1903 ? 179.181 156.664 97.995  1.00 0.00 ? 1903 VAL B CA 5  
ATOM 9859   C CA . ALA B 1 1904 ? 177.024 156.232 94.901  1.00 0.00 ? 1904 ALA B CA 5  
ATOM 9860   C CA . VAL B 1 1905 ? 173.429 155.751 95.799  1.00 0.00 ? 1905 VAL B CA 5  
ATOM 9861   C CA . LYS B 1 1906 ? 170.067 154.699 94.336  1.00 0.00 ? 1906 LYS B CA 5  
ATOM 9862   C CA . ILE B 1 1907 ? 166.960 156.577 95.587  1.00 0.00 ? 1907 ILE B CA 5  
ATOM 9863   C CA . PHE B 1 1908 ? 163.463 155.118 95.237  1.00 0.00 ? 1908 PHE B CA 5  
ATOM 9864   C CA . ASN B 1 1909 ? 160.615 157.596 95.937  1.00 0.00 ? 1909 ASN B CA 5  
ATOM 9865   C CA . LYS B 1 1910 ? 156.839 158.354 95.990  1.00 0.00 ? 1910 LYS B CA 5  
ATOM 9866   C CA . HIS B 1 1911 ? 156.203 155.244 97.892  1.00 0.00 ? 1911 HIS B CA 5  
ATOM 9867   C CA . THR B 1 1912 ? 155.297 156.800 101.280 1.00 0.00 ? 1912 THR B CA 5  
ATOM 9868   C CA . SER B 1 1913 ? 151.742 155.634 101.826 1.00 0.00 ? 1913 SER B CA 5  
ATOM 9869   C CA . LEU B 1 1914 ? 152.090 152.161 100.337 1.00 0.00 ? 1914 LEU B CA 5  
ATOM 9870   C CA . ARG B 1 1915 ? 151.924 148.853 102.190 1.00 0.00 ? 1915 ARG B CA 5  
ATOM 9871   C CA . LEU B 1 1916 ? 154.584 147.395 99.807  1.00 0.00 ? 1916 LEU B CA 5  
ATOM 9872   C CA . LEU B 1 1917 ? 157.158 150.195 100.624 1.00 0.00 ? 1917 LEU B CA 5  
ATOM 9873   C CA . ARG B 1 1918 ? 156.535 149.733 104.285 1.00 0.00 ? 1918 ARG B CA 5  
ATOM 9874   C CA . GLN B 1 1919 ? 157.219 146.021 104.031 1.00 0.00 ? 1919 GLN B CA 5  
ATOM 9875   C CA . GLU B 1 1920 ? 160.350 146.678 101.925 1.00 0.00 ? 1920 GLU B CA 5  
ATOM 9876   C CA . LEU B 1 1921 ? 161.700 149.165 104.539 1.00 0.00 ? 1921 LEU B CA 5  
ATOM 9877   C CA . VAL B 1 1922 ? 160.855 146.790 107.453 1.00 0.00 ? 1922 VAL B CA 5  
ATOM 9878   C CA . VAL B 1 1923 ? 162.488 143.734 105.755 1.00 0.00 ? 1923 VAL B CA 5  
ATOM 9879   C CA . LEU B 1 1924 ? 165.633 145.639 104.640 1.00 0.00 ? 1924 LEU B CA 5  
ATOM 9880   C CA . CYS B 1 1925 ? 166.210 147.309 108.074 1.00 0.00 ? 1925 CYS B CA 5  
ATOM 9881   C CA . HIS B 1 1926 ? 167.521 144.055 109.645 1.00 0.00 ? 1926 HIS B CA 5  
ATOM 9882   C CA . LEU B 1 1927 ? 169.490 142.760 106.599 1.00 0.00 ? 1927 LEU B CA 5  
ATOM 9883   C CA . HIS B 1 1928 ? 173.251 143.432 106.445 1.00 0.00 ? 1928 HIS B CA 5  
ATOM 9884   C CA . HIS B 1 1929 ? 175.115 141.007 104.138 1.00 0.00 ? 1929 HIS B CA 5  
ATOM 9885   C CA . PRO B 1 1930 ? 177.491 141.613 101.160 1.00 0.00 ? 1930 PRO B CA 5  
ATOM 9886   C CA . SER B 1 1931 ? 175.324 139.734 98.634  1.00 0.00 ? 1931 SER B CA 5  
ATOM 9887   C CA . LEU B 1 1932 ? 172.124 141.620 99.557  1.00 0.00 ? 1932 LEU B CA 5  
ATOM 9888   C CA . ILE B 1 1933 ? 171.396 145.186 98.363  1.00 0.00 ? 1933 ILE B CA 5  
ATOM 9889   C CA . SER B 1 1934 ? 172.029 147.377 101.419 1.00 0.00 ? 1934 SER B CA 5  
ATOM 9890   C CA . LEU B 1 1935 ? 169.580 149.982 102.664 1.00 0.00 ? 1935 LEU B CA 5  
ATOM 9891   C CA . LEU B 1 1936 ? 171.516 153.093 103.725 1.00 0.00 ? 1936 LEU B CA 5  
ATOM 9892   C CA . ALA B 1 1937 ? 168.751 155.349 105.029 1.00 0.00 ? 1937 ALA B CA 5  
ATOM 9893   C CA . ALA B 1 1938 ? 165.199 156.687 104.740 1.00 0.00 ? 1938 ALA B CA 5  
ATOM 9894   C CA . GLY B 1 1939 ? 164.115 160.156 103.511 1.00 0.00 ? 1939 GLY B CA 5  
ATOM 9895   C CA . ILE B 1 1940 ? 160.808 162.044 103.938 1.00 0.00 ? 1940 ILE B CA 5  
ATOM 9896   C CA . ARG B 1 1941 ? 158.790 164.511 101.790 1.00 0.00 ? 1941 ARG B CA 5  
ATOM 9897   C CA . PRO B 1 1942 ? 158.414 162.383 99.698  1.00 0.00 ? 1942 PRO B CA 5  
ATOM 9898   C CA . ARG B 1 1943 ? 159.346 159.118 101.447 1.00 0.00 ? 1943 ARG B CA 5  
ATOM 9899   C CA . MET B 1 1944 ? 162.563 157.675 99.973  1.00 0.00 ? 1944 MET B CA 5  
ATOM 9900   C CA . LEU B 1 1945 ? 164.550 154.489 100.390 1.00 0.00 ? 1945 LEU B CA 5  
ATOM 9901   C CA . VAL B 1 1946 ? 168.213 155.239 99.810  1.00 0.00 ? 1946 VAL B CA 5  
ATOM 9902   C CA . MET B 1 1947 ? 169.945 152.028 98.634  1.00 0.00 ? 1947 MET B CA 5  
ATOM 9903   C CA . GLU B 1 1948 ? 173.528 151.197 97.543  1.00 0.00 ? 1948 GLU B CA 5  
ATOM 9904   C CA . LEU B 1 1949 ? 174.007 151.706 93.779  1.00 0.00 ? 1949 LEU B CA 5  
ATOM 9905   C CA . ALA B 1 1950 ? 174.840 148.458 91.968  1.00 0.00 ? 1950 ALA B CA 5  
ATOM 9906   C CA . SER B 1 1951 ? 176.673 149.456 88.807  1.00 0.00 ? 1951 SER B CA 5  
ATOM 9907   C CA . LYS B 1 1952 ? 176.526 146.673 86.174  1.00 0.00 ? 1952 LYS B CA 5  
ATOM 9908   C CA . GLY B 1 1953 ? 172.741 146.280 85.821  1.00 0.00 ? 1953 GLY B CA 5  
ATOM 9909   C CA . SER B 1 1954 ? 170.763 143.078 86.407  1.00 0.00 ? 1954 SER B CA 5  
ATOM 9910   C CA . LEU B 1 1955 ? 171.340 139.386 85.621  1.00 0.00 ? 1955 LEU B CA 5  
ATOM 9911   C CA . ASP B 1 1956 ? 168.307 139.119 83.275  1.00 0.00 ? 1956 ASP B CA 5  
ATOM 9912   C CA . ARG B 1 1957 ? 169.494 141.888 80.891  1.00 0.00 ? 1957 ARG B CA 5  
ATOM 9913   C CA . LEU B 1 1958 ? 173.091 140.625 80.902  1.00 0.00 ? 1958 LEU B CA 5  
ATOM 9914   C CA . LEU B 1 1959 ? 172.031 137.048 80.011  1.00 0.00 ? 1959 LEU B CA 5  
ATOM 9915   C CA . GLN B 1 1960 ? 170.176 138.470 76.945  1.00 0.00 ? 1960 GLN B CA 5  
ATOM 9916   C CA . GLN B 1 1961 ? 173.642 139.281 75.436  1.00 0.00 ? 1961 GLN B CA 5  
ATOM 9917   C CA . ASP B 1 1962 ? 174.132 135.885 73.632  1.00 0.00 ? 1962 ASP B CA 5  
ATOM 9918   C CA . LYS B 1 1963 ? 177.158 137.198 71.631  1.00 0.00 ? 1963 LYS B CA 5  
ATOM 9919   C CA . ALA B 1 1964 ? 179.127 137.774 74.865  1.00 0.00 ? 1964 ALA B CA 5  
ATOM 9920   C CA . SER B 1 1965 ? 178.555 134.658 76.985  1.00 0.00 ? 1965 SER B CA 5  
ATOM 9921   C CA . LEU B 1 1966 ? 179.522 134.771 80.673  1.00 0.00 ? 1966 LEU B CA 5  
ATOM 9922   C CA . THR B 1 1967 ? 182.665 132.708 81.267  1.00 0.00 ? 1967 THR B CA 5  
ATOM 9923   C CA . ARG B 1 1968 ? 182.275 129.603 83.444  1.00 0.00 ? 1968 ARG B CA 5  
ATOM 9924   C CA . THR B 1 1969 ? 184.415 130.850 86.400  1.00 0.00 ? 1969 THR B CA 5  
ATOM 9925   C CA . LEU B 1 1970 ? 182.229 133.942 86.603  1.00 0.00 ? 1970 LEU B CA 5  
ATOM 9926   C CA . GLN B 1 1971 ? 178.979 131.879 86.321  1.00 0.00 ? 1971 GLN B CA 5  
ATOM 9927   C CA . HIS B 1 1972 ? 180.184 129.928 89.401  1.00 0.00 ? 1972 HIS B CA 5  
ATOM 9928   C CA . ARG B 1 1973 ? 180.889 133.218 91.253  1.00 0.00 ? 1973 ARG B CA 5  
ATOM 9929   C CA . ILE B 1 1974 ? 177.314 134.432 90.431  1.00 0.00 ? 1974 ILE B CA 5  
ATOM 9930   C CA . ALA B 1 1975 ? 175.780 131.110 91.609  1.00 0.00 ? 1975 ALA B CA 5  
ATOM 9931   C CA . LEU B 1 1976 ? 177.665 131.176 94.956  1.00 0.00 ? 1976 LEU B CA 5  
ATOM 9932   C CA . HIS B 1 1977 ? 176.959 134.897 95.661  1.00 0.00 ? 1977 HIS B CA 5  
ATOM 9933   C CA . VAL B 1 1978 ? 173.209 134.452 95.211  1.00 0.00 ? 1978 VAL B CA 5  
ATOM 9934   C CA . ALA B 1 1979 ? 173.415 131.254 97.327  1.00 0.00 ? 1979 ALA B CA 5  
ATOM 9935   C CA . ASP B 1 1980 ? 175.200 133.093 100.205 1.00 0.00 ? 1980 ASP B CA 5  
ATOM 9936   C CA . GLY B 1 1981 ? 172.589 135.907 100.161 1.00 0.00 ? 1981 GLY B CA 5  
ATOM 9937   C CA . LEU B 1 1982 ? 169.776 133.326 100.327 1.00 0.00 ? 1982 LEU B CA 5  
ATOM 9938   C CA . ARG B 1 1983 ? 171.788 131.421 103.010 1.00 0.00 ? 1983 ARG B CA 5  
ATOM 9939   C CA . TYR B 1 1984 ? 172.036 134.615 105.124 1.00 0.00 ? 1984 TYR B CA 5  
ATOM 9940   C CA . LEU B 1 1985 ? 168.303 134.910 104.490 1.00 0.00 ? 1985 LEU B CA 5  
ATOM 9941   C CA . HIS B 1 1986 ? 167.754 131.354 105.746 1.00 0.00 ? 1986 HIS B CA 5  
ATOM 9942   C CA . SER B 1 1987 ? 169.382 132.438 109.070 1.00 0.00 ? 1987 SER B CA 5  
ATOM 9943   C CA . ALA B 1 1988 ? 166.939 135.354 109.495 1.00 0.00 ? 1988 ALA B CA 5  
ATOM 9944   C CA . MET B 1 1989 ? 163.830 133.246 108.486 1.00 0.00 ? 1989 MET B CA 5  
ATOM 9945   C CA . ILE B 1 1990 ? 162.734 135.617 105.680 1.00 0.00 ? 1990 ILE B CA 5  
ATOM 9946   C CA . ILE B 1 1991 ? 160.942 134.532 102.439 1.00 0.00 ? 1991 ILE B CA 5  
ATOM 9947   C CA . TYR B 1 1992 ? 161.695 136.727 99.380  1.00 0.00 ? 1992 TYR B CA 5  
ATOM 9948   C CA . ARG B 1 1993 ? 159.009 135.382 96.956  1.00 0.00 ? 1993 ARG B CA 5  
ATOM 9949   C CA . ASP B 1 1994 ? 160.174 137.323 93.854  1.00 0.00 ? 1994 ASP B CA 5  
ATOM 9950   C CA . LEU B 1 1995 ? 163.509 135.588 93.158  1.00 0.00 ? 1995 LEU B CA 5  
ATOM 9951   C CA . LYS B 1 1996 ? 164.042 135.866 89.384  1.00 0.00 ? 1996 LYS B CA 5  
ATOM 9952   C CA . PRO B 1 1997 ? 167.041 137.188 87.368  1.00 0.00 ? 1997 PRO B CA 5  
ATOM 9953   C CA . HIS B 1 1998 ? 165.669 140.761 87.036  1.00 0.00 ? 1998 HIS B CA 5  
ATOM 9954   C CA . ASN B 1 1999 ? 165.982 141.036 90.842  1.00 0.00 ? 1999 ASN B CA 5  
ATOM 9955   C CA . VAL B 1 2000 ? 169.627 139.873 90.860  1.00 0.00 ? 2000 VAL B CA 5  
ATOM 9956   C CA . LEU B 1 2001 ? 171.798 143.000 90.606  1.00 0.00 ? 2001 LEU B CA 5  
ATOM 9957   C CA . LEU B 1 2002 ? 175.326 142.807 89.328  1.00 0.00 ? 2002 LEU B CA 5  
ATOM 9958   C CA . PHE B 1 2003 ? 178.081 144.608 91.203  1.00 0.00 ? 2003 PHE B CA 5  
ATOM 9959   C CA . THR B 1 2004 ? 181.028 143.322 89.170  1.00 0.00 ? 2004 THR B CA 5  
ATOM 9960   C CA . LEU B 1 2005 ? 181.667 140.655 86.436  1.00 0.00 ? 2005 LEU B CA 5  
ATOM 9961   C CA . TYR B 1 2006 ? 185.440 140.270 87.080  1.00 0.00 ? 2006 TYR B CA 5  
ATOM 9962   C CA . PRO B 1 2007 ? 185.866 136.761 88.636  1.00 0.00 ? 2007 PRO B CA 5  
ATOM 9963   C CA . ASN B 1 2008 ? 188.275 138.002 91.380  1.00 0.00 ? 2008 ASN B CA 5  
ATOM 9964   C CA . ALA B 1 2009 ? 185.914 140.780 92.589  1.00 0.00 ? 2009 ALA B CA 5  
ATOM 9965   C CA . ALA B 1 2010 ? 184.888 140.888 96.264  1.00 0.00 ? 2010 ALA B CA 5  
ATOM 9966   C CA . ILE B 1 2011 ? 181.197 140.883 95.248  1.00 0.00 ? 2011 ILE B CA 5  
ATOM 9967   C CA . ILE B 1 2012 ? 179.674 139.932 91.849  1.00 0.00 ? 2012 ILE B CA 5  
ATOM 9968   C CA . ALA B 1 2013 ? 175.969 139.606 92.537  1.00 0.00 ? 2013 ALA B CA 5  
ATOM 9969   C CA . LYS B 1 2014 ? 173.496 140.928 95.064  1.00 0.00 ? 2014 LYS B CA 5  
ATOM 9970   C CA . ILE B 1 2015 ? 169.850 139.983 95.702  1.00 0.00 ? 2015 ILE B CA 5  
ATOM 9971   C CA . ALA B 1 2016 ? 167.432 142.949 95.401  1.00 0.00 ? 2016 ALA B CA 5  
ATOM 9972   C CA . ASP B 1 2017 ? 163.748 143.973 95.360  1.00 0.00 ? 2017 ASP B CA 5  
ATOM 9973   C CA . TYR B 1 2018 ? 162.260 142.636 98.574  1.00 0.00 ? 2018 TYR B CA 5  
ATOM 9974   C CA . GLY B 1 2019 ? 158.895 144.396 98.186  1.00 0.00 ? 2019 GLY B CA 5  
ATOM 9975   C CA . THR B 1 2020 ? 156.886 141.194 98.424  1.00 0.00 ? 2020 THR B CA 5  
ATOM 9976   C CA . ALA B 1 2021 ? 158.939 139.501 101.215 1.00 0.00 ? 2021 ALA B CA 5  
ATOM 9977   C CA . GLN B 1 2022 ? 157.632 137.789 104.409 1.00 0.00 ? 2022 GLN B CA 5  
ATOM 9978   C CA . TYR B 1 2023 ? 159.211 137.210 107.808 1.00 0.00 ? 2023 TYR B CA 5  
ATOM 9979   C CA . CYS B 1 2024 ? 156.723 135.447 110.055 1.00 0.00 ? 2024 CYS B CA 5  
ATOM 9980   C CA . CYS B 1 2025 ? 156.671 132.902 112.913 1.00 0.00 ? 2025 CYS B CA 5  
ATOM 9981   C CA . ARG B 1 2026 ? 153.429 131.568 111.409 1.00 0.00 ? 2026 ARG B CA 5  
ATOM 9982   C CA . MET B 1 2027 ? 152.756 129.838 108.099 1.00 0.00 ? 2027 MET B CA 5  
ATOM 9983   C CA . GLY B 1 2028 ? 153.162 132.022 104.956 1.00 0.00 ? 2028 GLY B CA 5  
ATOM 9984   C CA . ILE B 1 2029 ? 150.620 132.105 102.086 1.00 0.00 ? 2029 ILE B CA 5  
ATOM 9985   C CA . LYS B 1 2030 ? 150.220 133.909 98.668  1.00 0.00 ? 2030 LYS B CA 5  
ATOM 9986   C CA . THR B 1 2031 ? 148.335 133.915 95.232  1.00 0.00 ? 2031 THR B CA 5  
ATOM 9987   C CA . SER B 1 2032 ? 149.587 137.077 93.646  1.00 0.00 ? 2032 SER B CA 5  
ATOM 9988   C CA . GLU B 1 2033 ? 153.191 136.292 92.687  1.00 0.00 ? 2033 GLU B CA 5  
ATOM 9989   C CA . GLY B 1 2034 ? 151.639 135.126 89.407  1.00 0.00 ? 2034 GLY B CA 5  
ATOM 9990   C CA . THR B 1 2035 ? 154.946 134.705 87.432  1.00 0.00 ? 2035 THR B CA 5  
ATOM 9991   C CA . PRO B 1 2036 ? 154.984 130.901 87.731  1.00 0.00 ? 2036 PRO B CA 5  
ATOM 9992   C CA . GLY B 1 2037 ? 158.017 130.087 85.509  1.00 0.00 ? 2037 GLY B CA 5  
ATOM 9993   C CA . PHE B 1 2038 ? 160.169 131.085 88.508  1.00 0.00 ? 2038 PHE B CA 5  
ATOM 9994   C CA . ARG B 1 2039 ? 157.778 130.191 91.378  1.00 0.00 ? 2039 ARG B CA 5  
ATOM 9995   C CA . ALA B 1 2040 ? 157.307 127.022 93.431  1.00 0.00 ? 2040 ALA B CA 5  
ATOM 9996   C CA . PRO B 1 2041 ? 154.290 124.694 92.655  1.00 0.00 ? 2041 PRO B CA 5  
ATOM 9997   C CA . GLU B 1 2042 ? 152.256 126.045 95.635  1.00 0.00 ? 2042 GLU B CA 5  
ATOM 9998   C CA . VAL B 1 2043 ? 151.183 128.771 93.085  1.00 0.00 ? 2043 VAL B CA 5  
ATOM 9999   C CA . ALA B 1 2044 ? 148.009 126.749 92.631  1.00 0.00 ? 2044 ALA B CA 5  
ATOM 10000  C CA . ARG B 1 2045 ? 145.825 129.109 94.841  1.00 0.00 ? 2045 ARG B CA 5  
ATOM 10001  C CA . GLY B 1 2046 ? 145.622 131.209 98.154  1.00 0.00 ? 2046 GLY B CA 5  
ATOM 10002  C CA . ASN B 1 2047 ? 144.406 128.345 100.231 1.00 0.00 ? 2047 ASN B CA 5  
ATOM 10003  C CA . VAL B 1 2048 ? 147.851 126.653 100.614 1.00 0.00 ? 2048 VAL B CA 5  
ATOM 10004  C CA . ILE B 1 2049 ? 150.715 127.447 102.978 1.00 0.00 ? 2049 ILE B CA 5  
ATOM 10005  C CA . TYR B 1 2050 ? 154.435 127.411 102.314 1.00 0.00 ? 2050 TYR B CA 5  
ATOM 10006  C CA . ASN B 1 2051 ? 157.887 128.393 103.685 1.00 0.00 ? 2051 ASN B CA 5  
ATOM 10007  C CA . GLN B 1 2052 ? 161.421 129.585 102.629 1.00 0.00 ? 2052 GLN B CA 5  
ATOM 10008  C CA . GLN B 1 2053 ? 161.555 126.373 100.591 1.00 0.00 ? 2053 GLN B CA 5  
ATOM 10009  C CA . ALA B 1 2054 ? 159.591 128.351 97.952  1.00 0.00 ? 2054 ALA B CA 5  
ATOM 10010  C CA . ASP B 1 2055 ? 162.669 130.635 97.484  1.00 0.00 ? 2055 ASP B CA 5  
ATOM 10011  C CA . VAL B 1 2056 ? 164.882 127.484 97.289  1.00 0.00 ? 2056 VAL B CA 5  
ATOM 10012  C CA . TYR B 1 2057 ? 162.793 126.495 94.223  1.00 0.00 ? 2057 TYR B CA 5  
ATOM 10013  C CA . SER B 1 2058 ? 163.176 130.038 92.743  1.00 0.00 ? 2058 SER B CA 5  
ATOM 10014  C CA . PHE B 1 2059 ? 166.968 129.676 93.290  1.00 0.00 ? 2059 PHE B CA 5  
ATOM 10015  C CA . GLY B 1 2060 ? 167.052 126.420 91.199  1.00 0.00 ? 2060 GLY B CA 5  
ATOM 10016  C CA . LEU B 1 2061 ? 165.550 128.402 88.315  1.00 0.00 ? 2061 LEU B CA 5  
ATOM 10017  C CA . LEU B 1 2062 ? 168.235 131.121 88.860  1.00 0.00 ? 2062 LEU B CA 5  
ATOM 10018  C CA . LEU B 1 2063 ? 170.930 128.406 88.589  1.00 0.00 ? 2063 LEU B CA 5  
ATOM 10019  C CA . TYR B 1 2064 ? 169.292 127.059 85.379  1.00 0.00 ? 2064 TYR B CA 5  
ATOM 10020  C CA . ASP B 1 2065 ? 169.150 130.569 83.782  1.00 0.00 ? 2065 ASP B CA 5  
ATOM 10021  C CA . ILE B 1 2066 ? 172.872 131.249 84.693  1.00 0.00 ? 2066 ILE B CA 5  
ATOM 10022  C CA . LEU B 1 2067 ? 173.968 127.781 83.436  1.00 0.00 ? 2067 LEU B CA 5  
ATOM 10023  C CA . THR B 1 2068 ? 172.087 127.995 80.136  1.00 0.00 ? 2068 THR B CA 5  
ATOM 10024  C CA . THR B 1 2069 ? 171.696 131.756 79.369  1.00 0.00 ? 2069 THR B CA 5  
ATOM 10025  C CA . GLY B 1 2070 ? 168.009 130.867 78.661  1.00 0.00 ? 2070 GLY B CA 5  
ATOM 10026  C CA . GLY B 1 2071 ? 164.702 131.641 80.432  1.00 0.00 ? 2071 GLY B CA 5  
ATOM 10027  C CA . ARG B 1 2072 ? 160.941 131.108 80.052  1.00 0.00 ? 2072 ARG B CA 5  
ATOM 10028  C CA . ILE B 1 2073 ? 157.806 132.797 81.541  1.00 0.00 ? 2073 ILE B CA 5  
ATOM 10029  C CA . VAL B 1 2074 ? 154.551 130.865 81.223  1.00 0.00 ? 2074 VAL B CA 5  
ATOM 10030  C CA . GLU B 1 2075 ? 150.941 131.724 82.259  1.00 0.00 ? 2075 GLU B CA 5  
ATOM 10031  C CA . GLY B 1 2076 ? 147.621 129.777 82.035  1.00 0.00 ? 2076 GLY B CA 5  
ATOM 10032  C CA . LEU B 1 2077 ? 146.010 126.558 83.325  1.00 0.00 ? 2077 LEU B CA 5  
ATOM 10033  C CA . LYS B 1 2078 ? 147.681 123.635 81.513  1.00 0.00 ? 2078 LYS B CA 5  
ATOM 10034  C CA . PHE B 1 2079 ? 151.195 124.980 82.339  1.00 0.00 ? 2079 PHE B CA 5  
ATOM 10035  C CA . PRO B 1 2080 ? 150.546 125.258 86.186  1.00 0.00 ? 2080 PRO B CA 5  
ATOM 10036  C CA . ASN B 1 2081 ? 148.905 121.770 86.173  1.00 0.00 ? 2081 ASN B CA 5  
ATOM 10037  C CA . GLU B 1 2082 ? 151.980 120.425 84.353  1.00 0.00 ? 2082 GLU B CA 5  
ATOM 10038  C CA . PHE B 1 2083 ? 154.387 122.118 86.799  1.00 0.00 ? 2083 PHE B CA 5  
ATOM 10039  C CA . ASP B 1 2084 ? 152.355 121.160 89.945  1.00 0.00 ? 2084 ASP B CA 5  
ATOM 10040  C CA . GLU B 1 2085 ? 151.057 117.608 89.117  1.00 0.00 ? 2085 GLU B CA 5  
ATOM 10041  C CA . LEU B 1 2086 ? 153.311 116.278 86.277  1.00 0.00 ? 2086 LEU B CA 5  
ATOM 10042  C CA . GLU B 1 2087 ? 156.749 117.391 87.645  1.00 0.00 ? 2087 GLU B CA 5  
ATOM 10043  C CA . ILE B 1 2088 ? 157.540 119.636 84.592  1.00 0.00 ? 2088 ILE B CA 5  
ATOM 10044  C CA . GLN B 1 2089 ? 160.728 121.624 85.106  1.00 0.00 ? 2089 GLN B CA 5  
ATOM 10045  C CA . GLY B 1 2090 ? 163.363 123.142 82.813  1.00 0.00 ? 2090 GLY B CA 5  
ATOM 10046  C CA . LYS B 1 2091 ? 165.668 120.133 83.317  1.00 0.00 ? 2091 LYS B CA 5  
ATOM 10047  C CA . LEU B 1 2092 ? 162.961 117.456 82.762  1.00 0.00 ? 2092 LEU B CA 5  
ATOM 10048  C CA . PRO B 1 2093 ? 161.575 118.821 79.397  1.00 0.00 ? 2093 PRO B CA 5  
ATOM 10049  C CA . ASP B 1 2094 ? 165.085 119.221 77.935  1.00 0.00 ? 2094 ASP B CA 5  
ATOM 10050  C CA . PRO B 1 2095 ? 167.394 116.256 79.049  1.00 0.00 ? 2095 PRO B CA 5  
ATOM 10051  C CA . VAL B 1 2096 ? 169.506 116.713 75.874  1.00 0.00 ? 2096 VAL B CA 5  
ATOM 10052  C CA . LYS B 1 2097 ? 170.063 120.477 76.422  1.00 0.00 ? 2097 LYS B CA 5  
ATOM 10053  C CA . GLU B 1 2098 ? 171.552 119.935 79.864  1.00 0.00 ? 2098 GLU B CA 5  
ATOM 10054  C CA . TYR B 1 2099 ? 172.619 116.182 80.167  1.00 0.00 ? 2099 TYR B CA 5  
ATOM 10055  C CA . GLY B 1 2100 ? 173.959 115.963 76.532  1.00 0.00 ? 2100 GLY B CA 5  
ATOM 10056  C CA . CYS B 1 2101 ? 176.322 118.915 77.152  1.00 0.00 ? 2101 CYS B CA 5  
ATOM 10057  C CA . ALA B 1 2102 ? 177.488 117.225 80.395  1.00 0.00 ? 2102 ALA B CA 5  
ATOM 10058  C CA . PRO B 1 2103 ? 176.910 120.028 83.048  1.00 0.00 ? 2103 PRO B CA 5  
ATOM 10059  C CA . TRP B 1 2104 ? 178.848 119.072 86.238  1.00 0.00 ? 2104 TRP B CA 5  
ATOM 10060  C CA . PRO B 1 2105 ? 176.899 116.228 87.995  1.00 0.00 ? 2105 PRO B CA 5  
ATOM 10061  C CA . MET B 1 2106 ? 177.048 118.044 91.371  1.00 0.00 ? 2106 MET B CA 5  
ATOM 10062  C CA . VAL B 1 2107 ? 175.437 121.189 89.782  1.00 0.00 ? 2107 VAL B CA 5  
ATOM 10063  C CA . GLU B 1 2108 ? 172.803 118.944 88.172  1.00 0.00 ? 2108 GLU B CA 5  
ATOM 10064  C CA . LYS B 1 2109 ? 172.024 117.231 91.524  1.00 0.00 ? 2109 LYS B CA 5  
ATOM 10065  C CA . LEU B 1 2110 ? 171.694 120.601 93.283  1.00 0.00 ? 2110 LEU B CA 5  
ATOM 10066  C CA . ILE B 1 2111 ? 169.268 122.059 90.649  1.00 0.00 ? 2111 ILE B CA 5  
ATOM 10067  C CA . LYS B 1 2112 ? 167.153 118.847 90.769  1.00 0.00 ? 2112 LYS B CA 5  
ATOM 10068  C CA . GLN B 1 2113 ? 166.988 118.794 94.589  1.00 0.00 ? 2113 GLN B CA 5  
ATOM 10069  C CA . CYS B 1 2114 ? 166.241 122.569 94.759  1.00 0.00 ? 2114 CYS B CA 5  
ATOM 10070  C CA . LEU B 1 2115 ? 163.338 122.205 92.261  1.00 0.00 ? 2115 LEU B CA 5  
ATOM 10071  C CA . LYS B 1 2116 ? 161.716 119.212 94.013  1.00 0.00 ? 2116 LYS B CA 5  
ATOM 10072  C CA . GLU B 1 2117 ? 157.893 119.206 94.017  1.00 0.00 ? 2117 GLU B CA 5  
ATOM 10073  C CA . ASN B 1 2118 ? 157.979 118.213 97.686  1.00 0.00 ? 2118 ASN B CA 5  
ATOM 10074  C CA . PRO B 1 2119 ? 159.313 121.323 99.608  1.00 0.00 ? 2119 PRO B CA 5  
ATOM 10075  C CA . GLN B 1 2120 ? 160.947 119.125 102.301 1.00 0.00 ? 2120 GLN B CA 5  
ATOM 10076  C CA . GLU B 1 2121 ? 163.351 117.478 99.804  1.00 0.00 ? 2121 GLU B CA 5  
ATOM 10077  C CA . ARG B 1 2122 ? 164.788 120.844 98.731  1.00 0.00 ? 2122 ARG B CA 5  
ATOM 10078  C CA . PRO B 1 2123 ? 168.160 121.252 100.560 1.00 0.00 ? 2123 PRO B CA 5  
ATOM 10079  C CA . THR B 1 2124 ? 169.320 123.555 103.363 1.00 0.00 ? 2124 THR B CA 5  
ATOM 10080  C CA . SER B 1 2125 ? 171.506 126.375 101.965 1.00 0.00 ? 2125 SER B CA 5  
ATOM 10081  C CA . ALA B 1 2126 ? 174.583 125.111 103.839 1.00 0.00 ? 2126 ALA B CA 5  
ATOM 10082  C CA . GLN B 1 2127 ? 174.468 121.964 101.617 1.00 0.00 ? 2127 GLN B CA 5  
ATOM 10083  C CA . VAL B 1 2128 ? 173.843 124.195 98.555  1.00 0.00 ? 2128 VAL B CA 5  
ATOM 10084  C CA . PHE B 1 2129 ? 176.868 126.426 99.348  1.00 0.00 ? 2129 PHE B CA 5  
ATOM 10085  C CA . ASP B 1 2130 ? 179.188 123.412 100.018 1.00 0.00 ? 2130 ASP B CA 5  
ATOM 10086  C CA . ILE B 1 2131 ? 178.161 121.764 96.690  1.00 0.00 ? 2131 ILE B CA 5  
ATOM 10087  C CA . LEU B 1 2132 ? 178.560 125.015 94.627  1.00 0.00 ? 2132 LEU B CA 5  
ATOM 10088  C CA . ASN B 1 2133 ? 182.016 125.593 96.190  1.00 0.00 ? 2133 ASN B CA 5  
ATOM 10089  C CA . SER B 1 2134 ? 183.187 122.160 94.845  1.00 0.00 ? 2134 SER B CA 5  
ATOM 10090  C CA . ALA B 1 2135 ? 182.504 123.014 91.135  1.00 0.00 ? 2135 ALA B CA 5  
ATOM 10091  C CA . ARG B 1 2142 ? 179.633 109.312 87.564  1.00 0.00 ? 2142 ARG B CA 5  
ATOM 10092  C CA . ARG B 1 2143 ? 179.361 105.582 88.216  1.00 0.00 ? 2143 ARG B CA 5  
ATOM 10093  C CA . ILE B 1 2144 ? 180.746 103.016 85.764  1.00 0.00 ? 2144 ILE B CA 5  
ATOM 10094  C CA . LEU B 1 2145 ? 179.424 99.494  86.299  1.00 0.00 ? 2145 LEU B CA 5  
ATOM 10095  C CA . LEU B 1 2146 ? 181.861 96.682  85.598  1.00 0.00 ? 2146 LEU B CA 5  
ATOM 10096  C CA . PRO B 1 2147 ? 180.610 93.449  84.001  1.00 0.00 ? 2147 PRO B CA 5  
ATOM 10097  C CA . LYS B 1 2148 ? 178.641 91.278  86.392  1.00 0.00 ? 2148 LYS B CA 5  
ATOM 10098  C CA . ASN B 1 2149 ? 180.689 89.195  88.895  1.00 0.00 ? 2149 ASN B CA 5  
ATOM 10099  C CA . VAL B 1 2150 ? 183.976 90.931  87.985  1.00 0.00 ? 2150 VAL B CA 5  
ATOM 10100  C CA . ILE B 1 2151 ? 185.976 91.297  91.208  1.00 0.00 ? 2151 ILE B CA 5  
ATOM 10101  C CA . VAL B 1 2152 ? 188.825 93.825  91.245  1.00 0.00 ? 2152 VAL B CA 5  
ATOM 10102  C CA . GLU B 1 2153 ? 191.916 93.061  93.318  1.00 0.00 ? 2153 GLU B CA 5  
ATOM 10103  C CA . CYS B 1 2154 ? 194.027 96.015  92.184  1.00 0.00 ? 2154 CYS B CA 5  
ATOM 10104  C CA . MET B 1 2155 ? 193.792 99.057  89.963  1.00 0.00 ? 2155 MET B CA 5  
ATOM 10105  C CA . VAL B 1 2156 ? 196.058 101.624 88.262  1.00 0.00 ? 2156 VAL B CA 5  
ATOM 10106  C CA . ALA B 1 2157 ? 195.023 104.669 86.237  1.00 0.00 ? 2157 ALA B CA 5  
ATOM 10107  C CA . THR B 1 2158 ? 196.341 106.202 83.020  1.00 0.00 ? 2158 THR B CA 5  
ATOM 10108  C CA . ASN B 1 2164 ? 190.167 108.764 76.632  1.00 0.00 ? 2164 ASN B CA 5  
ATOM 10109  C CA . ALA B 1 2165 ? 191.356 108.057 80.157  1.00 0.00 ? 2165 ALA B CA 5  
ATOM 10110  C CA . SER B 1 2166 ? 191.437 104.406 81.142  1.00 0.00 ? 2166 SER B CA 5  
ATOM 10111  C CA . ILE B 1 2167 ? 192.346 102.006 83.928  1.00 0.00 ? 2167 ILE B CA 5  
ATOM 10112  C CA . TRP B 1 2168 ? 194.127 98.659  84.296  1.00 0.00 ? 2168 TRP B CA 5  
ATOM 10113  C CA . LEU B 1 2169 ? 192.475 96.146  86.633  1.00 0.00 ? 2169 LEU B CA 5  
ATOM 10114  C CA . GLY B 1 2170 ? 193.705 92.959  88.269  1.00 0.00 ? 2170 GLY B CA 5  
ATOM 10115  C CA . CYS B 1 2171 ? 190.919 90.422  88.655  1.00 0.00 ? 2171 CYS B CA 5  
ATOM 10116  C CA . GLY B 1 2172 ? 190.025 88.455  91.778  1.00 0.00 ? 2172 GLY B CA 5  
ATOM 10117  C CA . HIS B 1 2173 ? 187.191 86.312  90.436  1.00 0.00 ? 2173 HIS B CA 5  
ATOM 10118  C CA . THR B 1 2174 ? 189.723 83.876  88.940  1.00 0.00 ? 2174 THR B CA 5  
ATOM 10119  C CA . ASP B 1 2175 ? 192.598 81.734  90.187  1.00 0.00 ? 2175 ASP B CA 5  
ATOM 10120  C CA . ARG B 1 2176 ? 194.809 82.653  87.202  1.00 0.00 ? 2176 ARG B CA 5  
ATOM 10121  C CA . GLY B 1 2177 ? 196.303 85.937  86.034  1.00 0.00 ? 2177 GLY B CA 5  
ATOM 10122  C CA . GLN B 1 2178 ? 193.709 88.004  84.161  1.00 0.00 ? 2178 GLN B CA 5  
ATOM 10123  C CA . LEU B 1 2179 ? 194.502 91.604  83.187  1.00 0.00 ? 2179 LEU B CA 5  
ATOM 10124  C CA . SER B 1 2180 ? 191.537 93.865  82.403  1.00 0.00 ? 2180 SER B CA 5  
ATOM 10125  C CA . PHE B 1 2181 ? 191.252 97.266  80.735  1.00 0.00 ? 2181 PHE B CA 5  
ATOM 10126  C CA . LEU B 1 2182 ? 188.520 99.885  81.194  1.00 0.00 ? 2182 LEU B CA 5  
ATOM 10127  C CA . ASP B 1 2183 ? 188.034 102.953 78.986  1.00 0.00 ? 2183 ASP B CA 5  
ATOM 10128  C CA . LEU B 1 2184 ? 186.711 105.553 81.434  1.00 0.00 ? 2184 LEU B CA 5  
ATOM 10129  C CA . ASN B 1 2185 ? 185.106 107.473 78.535  1.00 0.00 ? 2185 ASN B CA 5  
ATOM 10130  C CA . THR B 1 2186 ? 183.313 104.660 76.675  1.00 0.00 ? 2186 THR B CA 5  
ATOM 10131  C CA . GLU B 1 2187 ? 182.947 102.360 79.727  1.00 0.00 ? 2187 GLU B CA 5  
ATOM 10132  C CA . GLY B 1 2188 ? 184.242 99.554  77.504  1.00 0.00 ? 2188 GLY B CA 5  
ATOM 10133  C CA . TYR B 1 2189 ? 185.804 96.573  79.258  1.00 0.00 ? 2189 TYR B CA 5  
ATOM 10134  C CA . THR B 1 2190 ? 188.278 94.034  77.871  1.00 0.00 ? 2190 THR B CA 5  
ATOM 10135  C CA . SER B 1 2191 ? 190.338 91.381  79.640  1.00 0.00 ? 2191 SER B CA 5  
ATOM 10136  C CA . GLU B 1 2192 ? 193.079 88.874  78.844  1.00 0.00 ? 2192 GLU B CA 5  
ATOM 10137  C CA . GLU B 1 2193 ? 194.399 85.878  80.785  1.00 0.00 ? 2193 GLU B CA 5  
ATOM 10138  C CA . VAL B 1 2194 ? 198.075 86.774  81.060  1.00 0.00 ? 2194 VAL B CA 5  
ATOM 10139  C CA . ALA B 1 2195 ? 199.611 84.752  83.928  1.00 0.00 ? 2195 ALA B CA 5  
ATOM 10140  C CA . ASP B 1 2196 ? 199.290 81.498  85.874  1.00 0.00 ? 2196 ASP B CA 5  
ATOM 10141  C CA . SER B 1 2197 ? 198.271 82.949  89.265  1.00 0.00 ? 2197 SER B CA 5  
ATOM 10142  C CA . ARG B 1 2198 ? 195.987 85.744  90.429  1.00 0.00 ? 2198 ARG B CA 5  
ATOM 10143  C CA . ILE B 1 2199 ? 197.241 89.255  89.711  1.00 0.00 ? 2199 ILE B CA 5  
ATOM 10144  C CA . LEU B 1 2200 ? 197.634 90.846  93.144  1.00 0.00 ? 2200 LEU B CA 5  
ATOM 10145  C CA . CYS B 1 2201 ? 198.982 94.305  92.303  1.00 0.00 ? 2201 CYS B CA 5  
ATOM 10146  C CA . LEU B 1 2202 ? 199.674 96.610  89.362  1.00 0.00 ? 2202 LEU B CA 5  
ATOM 10147  C CA . ALA B 1 2203 ? 202.214 99.345  88.677  1.00 0.00 ? 2203 ALA B CA 5  
ATOM 10148  C CA . LEU B 1 2204 ? 202.702 101.511 85.589  1.00 0.00 ? 2204 LEU B CA 5  
ATOM 10149  C CA . VAL B 1 2205 ? 206.348 102.193 84.706  1.00 0.00 ? 2205 VAL B CA 5  
ATOM 10150  C CA . HIS B 1 2206 ? 206.691 105.076 82.242  1.00 0.00 ? 2206 HIS B CA 5  
ATOM 10151  C CA . LEU B 1 2207 ? 209.959 105.724 80.412  1.00 0.00 ? 2207 LEU B CA 5  
ATOM 10152  C CA . PRO B 1 2208 ? 209.931 109.323 79.084  1.00 0.00 ? 2208 PRO B CA 5  
ATOM 10153  C CA . VAL B 1 2209 ? 213.036 108.793 77.041  1.00 0.00 ? 2209 VAL B CA 5  
ATOM 10154  C CA . GLU B 1 2210 ? 212.458 105.756 74.789  1.00 0.00 ? 2210 GLU B CA 5  
ATOM 10155  C CA . LYS B 1 2211 ? 208.766 106.792 74.923  1.00 0.00 ? 2211 LYS B CA 5  
ATOM 10156  C CA . GLU B 1 2212 ? 207.480 103.553 76.391  1.00 0.00 ? 2212 GLU B CA 5  
ATOM 10157  C CA . SER B 1 2213 ? 204.987 102.539 79.079  1.00 0.00 ? 2213 SER B CA 5  
ATOM 10158  C CA . TRP B 1 2214 ? 205.010 99.091  80.689  1.00 0.00 ? 2214 TRP B CA 5  
ATOM 10159  C CA . ILE B 1 2215 ? 202.290 97.631  82.910  1.00 0.00 ? 2215 ILE B CA 5  
ATOM 10160  C CA . VAL B 1 2216 ? 203.727 95.444  85.681  1.00 0.00 ? 2216 VAL B CA 5  
ATOM 10161  C CA . SER B 1 2217 ? 201.584 92.730  87.278  1.00 0.00 ? 2217 SER B CA 5  
ATOM 10162  C CA . GLY B 1 2218 ? 202.549 91.151  90.594  1.00 0.00 ? 2218 GLY B CA 5  
ATOM 10163  C CA . THR B 1 2219 ? 200.995 87.745  91.174  1.00 0.00 ? 2219 THR B CA 5  
ATOM 10164  C CA . GLN B 1 2220 ? 200.174 85.197  93.876  1.00 0.00 ? 2220 GLN B CA 5  
ATOM 10165  C CA . SER B 1 2221 ? 203.106 82.995  92.791  1.00 0.00 ? 2221 SER B CA 5  
ATOM 10166  C CA . GLY B 1 2222 ? 205.771 85.724  92.909  1.00 0.00 ? 2222 GLY B CA 5  
ATOM 10167  C CA . THR B 1 2223 ? 205.929 86.368  89.162  1.00 0.00 ? 2223 THR B CA 5  
ATOM 10168  C CA . LEU B 1 2224 ? 206.469 89.921  87.895  1.00 0.00 ? 2224 LEU B CA 5  
ATOM 10169  C CA . LEU B 1 2225 ? 204.898 90.068  84.429  1.00 0.00 ? 2225 LEU B CA 5  
ATOM 10170  C CA . VAL B 1 2226 ? 205.816 93.138  82.354  1.00 0.00 ? 2226 VAL B CA 5  
ATOM 10171  C CA . ILE B 1 2227 ? 203.623 93.927  79.335  1.00 0.00 ? 2227 ILE B CA 5  
ATOM 10172  C CA . ASN B 1 2228 ? 203.920 96.760  76.819  1.00 0.00 ? 2228 ASN B CA 5  
ATOM 10173  C CA . THR B 1 2229 ? 201.018 99.206  76.701  1.00 0.00 ? 2229 THR B CA 5  
ATOM 10174  C CA . GLU B 1 2230 ? 201.088 99.764  72.933  1.00 0.00 ? 2230 GLU B CA 5  
ATOM 10175  C CA . ASP B 1 2231 ? 202.027 96.256  71.707  1.00 0.00 ? 2231 ASP B CA 5  
ATOM 10176  C CA . GLY B 1 2232 ? 200.741 93.431  73.908  1.00 0.00 ? 2232 GLY B CA 5  
ATOM 10177  C CA . LYS B 1 2233 ? 203.007 91.020  72.021  1.00 0.00 ? 2233 LYS B CA 5  
ATOM 10178  C CA . LYS B 1 2234 ? 205.902 92.670  73.911  1.00 0.00 ? 2234 LYS B CA 5  
ATOM 10179  C CA . ARG B 1 2235 ? 205.919 90.974  77.310  1.00 0.00 ? 2235 ARG B CA 5  
ATOM 10180  C CA . HIS B 1 2236 ? 208.433 89.271  79.578  1.00 0.00 ? 2236 HIS B CA 5  
ATOM 10181  C CA . THR B 1 2237 ? 209.116 88.341  83.201  1.00 0.00 ? 2237 THR B CA 5  
ATOM 10182  C CA . LEU B 1 2238 ? 211.480 89.787  85.806  1.00 0.00 ? 2238 LEU B CA 5  
ATOM 10183  C CA . GLU B 1 2239 ? 213.151 87.745  88.550  1.00 0.00 ? 2239 GLU B CA 5  
ATOM 10184  C CA . LYS B 1 2240 ? 210.689 85.502  90.366  1.00 0.00 ? 2240 LYS B CA 5  
ATOM 10185  C CA . MET B 1 2241 ? 209.929 86.491  93.952  1.00 0.00 ? 2241 MET B CA 5  
ATOM 10186  C CA . THR B 1 2242 ? 210.227 83.974  96.777  1.00 0.00 ? 2242 THR B CA 5  
ATOM 10187  C CA . ASP B 1 2243 ? 206.620 84.697  97.821  1.00 0.00 ? 2243 ASP B CA 5  
ATOM 10188  C CA . SER B 1 2244 ? 203.554 86.398  96.373  1.00 0.00 ? 2244 SER B CA 5  
ATOM 10189  C CA . VAL B 1 2245 ? 203.873 90.015  95.255  1.00 0.00 ? 2245 VAL B CA 5  
ATOM 10190  C CA . THR B 1 2246 ? 201.711 92.096  97.595  1.00 0.00 ? 2246 THR B CA 5  
ATOM 10191  C CA . CYS B 1 2247 ? 202.880 95.628  96.741  1.00 0.00 ? 2247 CYS B CA 5  
ATOM 10192  C CA . LEU B 1 2248 ? 203.969 97.598  93.664  1.00 0.00 ? 2248 LEU B CA 5  
ATOM 10193  C CA . TYR B 1 2249 ? 204.957 101.262 93.870  1.00 0.00 ? 2249 TYR B CA 5  
ATOM 10194  C CA . CYS B 1 2250 ? 206.751 103.573 91.431  1.00 0.00 ? 2250 CYS B CA 5  
ATOM 10195  C CA . ASN B 1 2251 ? 209.181 105.942 93.145  1.00 0.00 ? 2251 ASN B CA 5  
ATOM 10196  C CA . SER B 1 2252 ? 211.669 108.673 92.261  1.00 0.00 ? 2252 SER B CA 5  
ATOM 10197  C CA . PHE B 1 2253 ? 214.875 109.949 93.861  1.00 0.00 ? 2253 PHE B CA 5  
ATOM 10198  C CA . GLN B 1 2259 ? 216.243 111.999 89.611  1.00 0.00 ? 2254 GLN B CA 5  
ATOM 10199  C CA . LYS B 1 2260 ? 216.150 108.204 89.283  1.00 0.00 ? 2260 LYS B CA 5  
ATOM 10200  C CA . ASN B 1 2261 ? 212.907 106.228 89.071  1.00 0.00 ? 2261 ASN B CA 5  
ATOM 10201  C CA . PHE B 1 2262 ? 212.409 102.838 90.705  1.00 0.00 ? 2262 PHE B CA 5  
ATOM 10202  C CA . LEU B 1 2263 ? 209.914 99.984  90.987  1.00 0.00 ? 2263 LEU B CA 5  
ATOM 10203  C CA . LEU B 1 2264 ? 209.438 98.920  94.610  1.00 0.00 ? 2264 LEU B CA 5  
ATOM 10204  C CA . VAL B 1 2265 ? 208.084 95.386  95.046  1.00 0.00 ? 2265 VAL B CA 5  
ATOM 10205  C CA . GLY B 1 2266 ? 206.734 94.284  98.426  1.00 0.00 ? 2266 GLY B CA 5  
ATOM 10206  C CA . THR B 1 2267 ? 206.344 90.540  98.949  1.00 0.00 ? 2267 THR B CA 5  
ATOM 10207  C CA . ALA B 1 2268 ? 204.382 88.334  101.334 1.00 0.00 ? 2268 ALA B CA 5  
ATOM 10208  C CA . ASP B 1 2269 ? 207.526 87.116  103.150 1.00 0.00 ? 2269 ASP B CA 5  
ATOM 10209  C CA . GLY B 1 2270 ? 208.478 90.580  104.411 1.00 0.00 ? 2270 GLY B CA 5  
ATOM 10210  C CA . LYS B 1 2271 ? 210.914 91.524  101.642 1.00 0.00 ? 2271 LYS B CA 5  
ATOM 10211  C CA . LEU B 1 2272 ? 211.117 94.638  99.459  1.00 0.00 ? 2272 LEU B CA 5  
ATOM 10212  C CA . ALA B 1 2273 ? 212.880 94.365  96.093  1.00 0.00 ? 2273 ALA B CA 5  
ATOM 10213  C CA . ILE B 1 2274 ? 214.037 97.450  94.183  1.00 0.00 ? 2274 ILE B CA 5  
ATOM 10214  C CA . PHE B 1 2275 ? 214.210 97.528  90.387  1.00 0.00 ? 2275 PHE B CA 5  
ATOM 10215  C CA . GLU B 1 2276 ? 215.674 100.445 88.492  1.00 0.00 ? 2276 GLU B CA 5  
ATOM 10216  C CA . ASP B 1 2277 ? 213.551 102.323 85.960  1.00 0.00 ? 2277 ASP B CA 5  
ATOM 10217  C CA . LYS B 1 2278 ? 215.369 100.962 82.902  1.00 0.00 ? 2278 LYS B CA 5  
ATOM 10218  C CA . THR B 1 2279 ? 215.977 97.385  84.097  1.00 0.00 ? 2279 THR B CA 5  
ATOM 10219  C CA . VAL B 1 2280 ? 212.222 96.699  83.952  1.00 0.00 ? 2280 VAL B CA 5  
ATOM 10220  C CA . LYS B 1 2281 ? 212.531 96.348  80.160  1.00 0.00 ? 2281 LYS B CA 5  
ATOM 10221  C CA . LEU B 1 2282 ? 214.903 93.373  80.460  1.00 0.00 ? 2282 LEU B CA 5  
ATOM 10222  C CA . LYS B 1 2283 ? 213.798 89.745  80.577  1.00 0.00 ? 2283 LYS B CA 5  
ATOM 10223  C CA . GLY B 1 2284 ? 214.840 88.025  83.791  1.00 0.00 ? 2284 GLY B CA 5  
ATOM 10224  C CA . ALA B 1 2285 ? 216.167 91.245  85.315  1.00 0.00 ? 2285 ALA B CA 5  
ATOM 10225  C CA . ALA B 1 2286 ? 217.274 91.002  88.945  1.00 0.00 ? 2286 ALA B CA 5  
ATOM 10226  C CA . PRO B 1 2287 ? 216.579 93.707  91.549  1.00 0.00 ? 2287 PRO B CA 5  
ATOM 10227  C CA . LEU B 1 2288 ? 219.227 96.200  92.585  1.00 0.00 ? 2288 LEU B CA 5  
ATOM 10228  C CA . LYS B 1 2289 ? 218.612 95.326  96.240  1.00 0.00 ? 2289 LYS B CA 5  
ATOM 10229  C CA . ILE B 1 2290 ? 216.322 93.186  98.398  1.00 0.00 ? 2290 ILE B CA 5  
ATOM 10230  C CA . LEU B 1 2291 ? 215.465 94.323  101.930 1.00 0.00 ? 2291 LEU B CA 5  
ATOM 10231  C CA . ASN B 1 2292 ? 214.515 91.600  104.418 1.00 0.00 ? 2292 ASN B CA 5  
ATOM 10232  C CA . ILE B 1 2293 ? 212.210 93.629  106.660 1.00 0.00 ? 2293 ILE B CA 5  
ATOM 10233  C CA . GLY B 1 2294 ? 210.103 90.776  108.094 1.00 0.00 ? 2294 GLY B CA 5  
ATOM 10234  C CA . ASN B 1 2295 ? 209.271 87.107  107.677 1.00 0.00 ? 2295 ASN B CA 5  
ATOM 10235  C CA . VAL B 1 2296 ? 206.734 84.808  106.024 1.00 0.00 ? 2296 VAL B CA 5  
ATOM 10236  C CA . SER B 1 2297 ? 204.184 85.979  108.614 1.00 0.00 ? 2297 SER B CA 5  
ATOM 10237  C CA . THR B 1 2298 ? 204.634 89.753  108.033 1.00 0.00 ? 2298 THR B CA 5  
ATOM 10238  C CA . PRO B 1 2299 ? 203.652 90.677  104.460 1.00 0.00 ? 2299 PRO B CA 5  
ATOM 10239  C CA . LEU B 1 2300 ? 204.766 94.007  103.015 1.00 0.00 ? 2300 LEU B CA 5  
ATOM 10240  C CA . MET B 1 2301 ? 201.426 95.385  101.854 1.00 0.00 ? 2301 MET B CA 5  
ATOM 10241  C CA . CYS B 1 2302 ? 201.667 99.169  101.453 1.00 0.00 ? 2302 CYS B CA 5  
ATOM 10242  C CA . LEU B 1 2303 ? 204.074 101.926 100.417 1.00 0.00 ? 2303 LEU B CA 5  
ATOM 10243  C CA . SER B 1 2304 ? 203.704 105.703 100.378 1.00 0.00 ? 2304 SER B CA 5  
ATOM 10244  C CA . GLU B 1 2305 ? 205.749 108.848 99.845  1.00 0.00 ? 2305 GLU B CA 5  
ATOM 10245  C CA . VAL B 1 2314 ? 211.703 109.512 101.808 1.00 0.00 ? 2314 VAL B CA 5  
ATOM 10246  C CA . MET B 1 2315 ? 209.501 106.406 101.704 1.00 0.00 ? 2315 MET B CA 5  
ATOM 10247  C CA . TRP B 1 2316 ? 207.316 104.909 104.426 1.00 0.00 ? 2316 TRP B CA 5  
ATOM 10248  C CA . GLY B 1 2317 ? 205.819 101.436 104.386 1.00 0.00 ? 2317 GLY B CA 5  
ATOM 10249  C CA . GLY B 1 2318 ? 203.980 98.837  106.394 1.00 0.00 ? 2318 GLY B CA 5  
ATOM 10250  C CA . CYS B 1 2319 ? 205.244 95.335  107.187 1.00 0.00 ? 2319 CYS B CA 5  
ATOM 10251  C CA . GLY B 1 2320 ? 203.120 93.424  109.668 1.00 0.00 ? 2320 GLY B CA 5  
ATOM 10252  C CA . THR B 1 2321 ? 202.660 95.715  112.653 1.00 0.00 ? 2321 THR B CA 5  
ATOM 10253  C CA . LYS B 1 2322 ? 205.834 97.702  111.877 1.00 0.00 ? 2322 LYS B CA 5  
ATOM 10254  C CA . ILE B 1 2323 ? 206.191 100.978 109.990 1.00 0.00 ? 2323 ILE B CA 5  
ATOM 10255  C CA . PHE B 1 2324 ? 209.492 101.352 108.155 1.00 0.00 ? 2324 PHE B CA 5  
ATOM 10256  C CA . SER B 1 2325 ? 211.268 104.217 106.417 1.00 0.00 ? 2325 SER B CA 5  
ATOM 10257  C CA . PHE B 1 2326 ? 214.030 104.421 103.830 1.00 0.00 ? 2326 PHE B CA 5  
ATOM 10258  C CA . SER B 1 2327 ? 215.526 106.935 101.425 1.00 0.00 ? 2327 SER B CA 5  
ATOM 10259  C CA . ASN B 1 2328 ? 218.356 107.027 98.890  1.00 0.00 ? 2328 ASN B CA 5  
ATOM 10260  C CA . ASP B 1 2329 ? 220.582 104.094 99.883  1.00 0.00 ? 2329 ASP B CA 5  
ATOM 10261  C CA . PHE B 1 2330 ? 217.672 101.720 100.693 1.00 0.00 ? 2330 PHE B CA 5  
ATOM 10262  C CA . THR B 1 2331 ? 218.877 101.201 104.247 1.00 0.00 ? 2331 THR B CA 5  
ATOM 10263  C CA . ILE B 1 2332 ? 215.999 100.990 106.711 1.00 0.00 ? 2332 ILE B CA 5  
ATOM 10264  C CA . GLN B 1 2333 ? 216.179 104.105 108.867 1.00 0.00 ? 2333 GLN B CA 5  
ATOM 10265  C CA . LYS B 1 2334 ? 213.057 104.238 111.043 1.00 0.00 ? 2334 LYS B CA 5  
ATOM 10266  C CA . LEU B 1 2335 ? 211.281 101.127 112.329 1.00 0.00 ? 2335 LEU B CA 5  
ATOM 10267  C CA . ILE B 1 2336 ? 208.269 101.677 114.605 1.00 0.00 ? 2336 ILE B CA 5  
ATOM 10268  C CA . GLU B 1 2337 ? 206.381 98.883  116.364 1.00 0.00 ? 2337 GLU B CA 5  
ATOM 10269  C CA . THR B 1 2338 ? 202.670 99.737  116.417 1.00 0.00 ? 2338 THR B CA 5  
ATOM 10270  C CA . ARG B 1 2339 ? 201.396 96.576  118.133 1.00 0.00 ? 2339 ARG B CA 5  
ATOM 10271  C CA . THR B 1 2340 ? 201.598 98.162  121.601 1.00 0.00 ? 2340 THR B CA 5  
ATOM 10272  C CA . SER B 1 2341 ? 200.589 101.528 123.061 1.00 0.00 ? 2341 SER B CA 5  
ATOM 10273  C CA . GLN B 1 2342 ? 199.130 102.312 126.480 1.00 0.00 ? 2342 GLN B CA 5  
ATOM 10274  C CA . LEU B 1 2343 ? 196.763 104.948 125.057 1.00 0.00 ? 2343 LEU B CA 5  
ATOM 10275  C CA . PHE B 1 2344 ? 195.088 102.387 122.779 1.00 0.00 ? 2344 PHE B CA 5  
ATOM 10276  C CA . SER B 1 2345 ? 191.321 102.737 123.040 1.00 0.00 ? 2345 SER B CA 5  
ATOM 10277  C CA . TYR B 1 2346 ? 191.096 99.004  122.276 1.00 0.00 ? 2346 TYR B CA 5  
ATOM 10278  C CA . ALA B 1 2347 ? 194.082 96.673  122.131 1.00 0.00 ? 2347 ALA B CA 5  
ATOM 10279  C CA . ALA B 1 2348 ? 192.976 93.859  119.808 1.00 0.00 ? 2348 ALA B CA 5  
ATOM 10280  C CA . PHE B 1 2349 ? 192.614 96.213  116.829 1.00 0.00 ? 2349 PHE B CA 5  
ATOM 10281  C CA . SER B 1 2350 ? 196.233 97.378  117.010 1.00 0.00 ? 2350 SER B CA 5  
ATOM 10282  C CA . ASP B 1 2351 ? 197.491 93.776  116.836 1.00 0.00 ? 2351 ASP B CA 5  
ATOM 10283  C CA . SER B 1 2352 ? 196.839 93.460  113.116 1.00 0.00 ? 2352 SER B CA 5  
ATOM 10284  C CA . ASN B 1 2353 ? 198.770 93.878  109.888 1.00 0.00 ? 2353 ASN B CA 5  
ATOM 10285  C CA . ILE B 1 2354 ? 198.925 97.435  108.569 1.00 0.00 ? 2354 ILE B CA 5  
ATOM 10286  C CA . ILE B 1 2355 ? 196.903 97.655  105.349 1.00 0.00 ? 2355 ILE B CA 5  
ATOM 10287  C CA . THR B 1 2356 ? 197.657 101.246 104.283 1.00 0.00 ? 2356 THR B CA 5  
ATOM 10288  C CA . VAL B 1 2357 ? 199.902 104.183 105.195 1.00 0.00 ? 2357 VAL B CA 5  
ATOM 10289  C CA . VAL B 1 2358 ? 199.286 107.819 104.243 1.00 0.00 ? 2358 VAL B CA 5  
ATOM 10290  C CA . VAL B 1 2359 ? 202.072 110.300 105.011 1.00 0.00 ? 2359 VAL B CA 5  
ATOM 10291  C CA . ASP B 1 2360 ? 201.430 113.978 105.726 1.00 0.00 ? 2360 ASP B CA 5  
ATOM 10292  C CA . THR B 1 2361 ? 202.613 115.803 108.844 1.00 0.00 ? 2361 THR B CA 5  
ATOM 10293  C CA . ALA B 1 2362 ? 202.202 112.540 110.768 1.00 0.00 ? 2362 ALA B CA 5  
ATOM 10294  C CA . LEU B 1 2363 ? 201.662 108.891 109.857 1.00 0.00 ? 2363 LEU B CA 5  
ATOM 10295  C CA . TYR B 1 2364 ? 198.026 107.785 109.520 1.00 0.00 ? 2364 TYR B CA 5  
ATOM 10296  C CA . ILE B 1 2365 ? 197.941 103.985 109.435 1.00 0.00 ? 2365 ILE B CA 5  
ATOM 10297  C CA . ALA B 1 2366 ? 194.996 101.604 109.226 1.00 0.00 ? 2366 ALA B CA 5  
ATOM 10298  C CA . LYS B 1 2367 ? 195.059 97.943  110.227 1.00 0.00 ? 2367 LYS B CA 5  
ATOM 10299  C CA . GLN B 1 2368 ? 193.186 94.885  109.009 1.00 0.00 ? 2368 GLN B CA 5  
ATOM 10300  C CA . ASN B 1 2369 ? 189.691 94.484  110.498 1.00 0.00 ? 2369 ASN B CA 5  
ATOM 10301  C CA . SER B 1 2370 ? 190.145 97.614  112.625 1.00 0.00 ? 2370 SER B CA 5  
ATOM 10302  C CA . PRO B 1 2371 ? 187.944 100.744 112.798 1.00 0.00 ? 2371 PRO B CA 5  
ATOM 10303  C CA . VAL B 1 2372 ? 190.718 102.890 114.328 1.00 0.00 ? 2372 VAL B CA 5  
ATOM 10304  C CA . VAL B 1 2373 ? 193.083 104.980 112.216 1.00 0.00 ? 2373 VAL B CA 5  
ATOM 10305  C CA . GLU B 1 2374 ? 196.230 105.293 114.320 1.00 0.00 ? 2374 GLU B CA 5  
ATOM 10306  C CA . VAL B 1 2375 ? 198.316 108.471 114.133 1.00 0.00 ? 2375 VAL B CA 5  
ATOM 10307  C CA . TRP B 1 2376 ? 202.048 108.175 114.841 1.00 0.00 ? 2376 TRP B CA 5  
ATOM 10308  C CA . ASP B 1 2377 ? 204.818 110.775 114.984 1.00 0.00 ? 2377 ASP B CA 5  
ATOM 10309  C CA . LYS B 1 2378 ? 207.775 110.457 112.617 1.00 0.00 ? 2378 LYS B CA 5  
ATOM 10310  C CA . LYS B 1 2379 ? 210.246 111.959 115.094 1.00 0.00 ? 2379 LYS B CA 5  
ATOM 10311  C CA . THR B 1 2380 ? 209.236 110.596 118.507 1.00 0.00 ? 2380 THR B CA 5  
ATOM 10312  C CA . GLU B 1 2381 ? 207.920 107.288 117.069 1.00 0.00 ? 2381 GLU B CA 5  
ATOM 10313  C CA . LYS B 1 2382 ? 204.905 107.298 119.423 1.00 0.00 ? 2382 LYS B CA 5  
ATOM 10314  C CA . LEU B 1 2383 ? 201.149 107.721 119.180 1.00 0.00 ? 2383 LEU B CA 5  
ATOM 10315  C CA . CYS B 1 2384 ? 200.125 111.152 117.952 1.00 0.00 ? 2384 CYS B CA 5  
ATOM 10316  C CA . GLY B 1 2385 ? 196.425 110.356 118.148 1.00 0.00 ? 2385 GLY B CA 5  
ATOM 10317  C CA . LEU B 1 2386 ? 193.505 108.074 117.379 1.00 0.00 ? 2386 LEU B CA 5  
ATOM 10318  C CA . ILE B 1 2387 ? 190.613 108.419 114.931 1.00 0.00 ? 2387 ILE B CA 5  
ATOM 10319  C CA . ASP B 1 2388 ? 187.751 106.040 115.776 1.00 0.00 ? 2388 ASP B CA 5  
ATOM 10320  C CA . CYS B 1 2389 ? 185.517 105.756 112.710 1.00 0.00 ? 2389 CYS B CA 5  
ATOM 10321  C CA . VAL B 1 2390 ? 182.730 104.046 114.689 1.00 0.00 ? 2390 VAL B CA 5  
ATOM 10322  C CA . HIS B 1 2391 ? 182.188 107.225 116.713 1.00 0.00 ? 2391 HIS B CA 5  
ATOM 10323  C CA . PHE B 1 2392 ? 182.384 109.511 113.672 1.00 0.00 ? 2392 PHE B CA 5  
ATOM 10324  C CA . LEU B 1 2393 ? 179.814 107.353 111.878 1.00 0.00 ? 2393 LEU B CA 5  
ATOM 10325  C CA . ARG B 1 2394 ? 177.453 107.242 114.882 1.00 0.00 ? 2394 ARG B CA 5  
ATOM 10326  C CA . GLU B 1 2395 ? 176.887 111.028 114.729 1.00 0.00 ? 2395 GLU B CA 5  
ATOM 10327  C CA . MET B 1 2408 ? 174.294 102.783 114.688 1.00 0.00 ? 2408 MET B CA 5  
ATOM 10328  C CA . SER B 1 2409 ? 175.287 99.162  114.022 1.00 0.00 ? 2409 SER B CA 5  
ATOM 10329  C CA . TYR B 1 2410 ? 178.280 100.118 111.860 1.00 0.00 ? 2410 TYR B CA 5  
ATOM 10330  C CA . SER B 1 2411 ? 181.459 98.061  112.131 1.00 0.00 ? 2411 SER B CA 5  
ATOM 10331  C CA . GLY B 1 2412 ? 183.455 101.065 110.919 1.00 0.00 ? 2412 GLY B CA 5  
ATOM 10332  C CA . ARG B 1 2413 ? 186.136 98.685  109.669 1.00 0.00 ? 2413 ARG B CA 5  
ATOM 10333  C CA . VAL B 1 2414 ? 188.599 100.846 107.746 1.00 0.00 ? 2414 VAL B CA 5  
ATOM 10334  C CA . LYS B 1 2415 ? 189.252 99.704  104.179 1.00 0.00 ? 2415 LYS B CA 5  
ATOM 10335  C CA . THR B 1 2416 ? 191.168 102.552 102.547 1.00 0.00 ? 2416 THR B CA 5  
ATOM 10336  C CA . LEU B 1 2417 ? 192.781 105.943 103.211 1.00 0.00 ? 2417 LEU B CA 5  
ATOM 10337  C CA . CYS B 1 2418 ? 193.389 108.739 100.709 1.00 0.00 ? 2418 CYS B CA 5  
ATOM 10338  C CA . LEU B 1 2419 ? 194.807 112.243 101.112 1.00 0.00 ? 2419 LEU B CA 5  
ATOM 10339  C CA . GLN B 1 2420 ? 193.055 115.202 99.491  1.00 0.00 ? 2420 GLN B CA 5  
ATOM 10340  C CA . LYS B 1 2421 ? 195.396 118.148 98.858  1.00 0.00 ? 2421 LYS B CA 5  
ATOM 10341  C CA . ASN B 1 2422 ? 197.212 119.145 102.051 1.00 0.00 ? 2422 ASN B CA 5  
ATOM 10342  C CA . THR B 1 2423 ? 194.342 119.140 104.556 1.00 0.00 ? 2423 THR B CA 5  
ATOM 10343  C CA . ALA B 1 2424 ? 191.776 116.445 103.905 1.00 0.00 ? 2424 ALA B CA 5  
ATOM 10344  C CA . LEU B 1 2425 ? 191.703 112.698 104.588 1.00 0.00 ? 2425 LEU B CA 5  
ATOM 10345  C CA . TRP B 1 2426 ? 189.207 110.342 102.935 1.00 0.00 ? 2426 TRP B CA 5  
ATOM 10346  C CA . ILE B 1 2427 ? 188.383 107.137 104.831 1.00 0.00 ? 2427 ILE B CA 5  
ATOM 10347  C CA . GLY B 1 2428 ? 186.506 104.320 103.081 1.00 0.00 ? 2428 GLY B CA 5  
ATOM 10348  C CA . THR B 1 2429 ? 185.026 101.955 105.645 1.00 0.00 ? 2429 THR B CA 5  
ATOM 10349  C CA . GLY B 1 2430 ? 183.869 98.323  105.212 1.00 0.00 ? 2430 GLY B CA 5  
ATOM 10350  C CA . GLY B 1 2431 ? 180.299 99.402  104.676 1.00 0.00 ? 2431 GLY B CA 5  
ATOM 10351  C CA . GLY B 1 2432 ? 179.509 101.786 101.881 1.00 0.00 ? 2432 GLY B CA 5  
ATOM 10352  C CA . HIS B 1 2433 ? 180.581 104.722 104.021 1.00 0.00 ? 2433 HIS B CA 5  
ATOM 10353  C CA . ILE B 1 2434 ? 183.055 107.446 103.061 1.00 0.00 ? 2434 ILE B CA 5  
ATOM 10354  C CA . LEU B 1 2435 ? 184.338 109.981 105.609 1.00 0.00 ? 2435 LEU B CA 5  
ATOM 10355  C CA . LEU B 1 2436 ? 186.202 113.238 104.960 1.00 0.00 ? 2436 LEU B CA 5  
ATOM 10356  C CA . LEU B 1 2437 ? 188.223 114.577 107.906 1.00 0.00 ? 2437 LEU B CA 5  
ATOM 10357  C CA . ASP B 1 2438 ? 190.160 117.827 108.291 1.00 0.00 ? 2438 ASP B CA 5  
ATOM 10358  C CA . LEU B 1 2439 ? 193.742 117.073 109.403 1.00 0.00 ? 2439 LEU B CA 5  
ATOM 10359  C CA . SER B 1 2440 ? 194.745 120.232 111.283 1.00 0.00 ? 2440 SER B CA 5  
ATOM 10360  C CA . THR B 1 2441 ? 192.709 121.874 114.042 1.00 0.00 ? 2441 THR B CA 5  
ATOM 10361  C CA . ARG B 1 2442 ? 189.394 120.002 113.717 1.00 0.00 ? 2442 ARG B CA 5  
ATOM 10362  C CA . ARG B 1 2443 ? 188.001 116.747 112.317 1.00 0.00 ? 2443 ARG B CA 5  
ATOM 10363  C CA . LEU B 1 2444 ? 184.861 115.848 110.356 1.00 0.00 ? 2444 LEU B CA 5  
ATOM 10364  C CA . ILE B 1 2445 ? 184.171 117.746 107.128 1.00 0.00 ? 2445 ILE B CA 5  
ATOM 10365  C CA . ARG B 1 2446 ? 181.900 115.491 105.070 1.00 0.00 ? 2446 ARG B CA 5  
ATOM 10366  C CA . VAL B 1 2447 ? 180.179 112.110 105.377 1.00 0.00 ? 2447 VAL B CA 5  
ATOM 10367  C CA . ILE B 1 2448 ? 178.416 110.083 102.690 1.00 0.00 ? 2448 ILE B CA 5  
ATOM 10368  C CA . TYR B 1 2449 ? 176.534 107.010 103.938 1.00 0.00 ? 2449 TYR B CA 5  
ATOM 10369  C CA . ASN B 1 2450 ? 175.694 103.963 101.812 1.00 0.00 ? 2450 ASN B CA 5  
ATOM 10370  C CA . PHE B 1 2451 ? 177.840 105.255 98.954  1.00 0.00 ? 2451 PHE B CA 5  
ATOM 10371  C CA . CYS B 1 2452 ? 178.036 101.545 98.107  1.00 0.00 ? 2452 CYS B CA 5  
ATOM 10372  C CA . ASN B 1 2453 ? 177.921 98.262  100.020 1.00 0.00 ? 2453 ASN B CA 5  
ATOM 10373  C CA . SER B 1 2454 ? 181.699 98.150  100.608 1.00 0.00 ? 2454 SER B CA 5  
ATOM 10374  C CA . VAL B 1 2455 ? 184.442 100.616 99.611  1.00 0.00 ? 2455 VAL B CA 5  
ATOM 10375  C CA . ARG B 1 2456 ? 187.416 98.587  98.380  1.00 0.00 ? 2456 ARG B CA 5  
ATOM 10376  C CA . VAL B 1 2457 ? 189.804 101.036 96.678  1.00 0.00 ? 2457 VAL B CA 5  
ATOM 10377  C CA . MET B 1 2458 ? 190.108 104.823 96.785  1.00 0.00 ? 2458 MET B CA 5  
ATOM 10378  C CA . MET B 1 2459 ? 192.828 106.750 94.955  1.00 0.00 ? 2459 MET B CA 5  
ATOM 10379  C CA . THR B 1 2460 ? 193.764 110.028 93.275  1.00 0.00 ? 2460 THR B CA 5  
ATOM 10380  C CA . ALA B 1 2461 ? 194.886 110.245 89.643  1.00 0.00 ? 2461 ALA B CA 5  
ATOM 10381  C CA . GLN B 1 2462 ? 195.837 112.889 87.091  1.00 0.00 ? 2462 GLN B CA 5  
ATOM 10382  C CA . ASN B 1 2468 ? 193.039 116.055 89.893  1.00 0.00 ? 2468 ASN B CA 5  
ATOM 10383  C CA . VAL B 1 2469 ? 190.564 113.164 89.762  1.00 0.00 ? 2469 VAL B CA 5  
ATOM 10384  C CA . MET B 1 2470 ? 189.062 110.864 92.404  1.00 0.00 ? 2470 MET B CA 5  
ATOM 10385  C CA . LEU B 1 2471 ? 188.454 107.139 91.837  1.00 0.00 ? 2471 LEU B CA 5  
ATOM 10386  C CA . VAL B 1 2472 ? 186.483 104.922 94.237  1.00 0.00 ? 2472 VAL B CA 5  
ATOM 10387  C CA . LEU B 1 2473 ? 186.033 101.224 93.460  1.00 0.00 ? 2473 LEU B CA 5  
ATOM 10388  C CA . GLY B 1 2474 ? 183.297 99.630  95.554  1.00 0.00 ? 2474 GLY B CA 5  
ATOM 10389  C CA . TYR B 1 2475 ? 181.444 96.351  95.233  1.00 0.00 ? 2475 TYR B CA 5  
ATOM 10390  C CA . ASN B 1 2476 ? 177.853 95.235  95.917  1.00 0.00 ? 2476 ASN B CA 5  
ATOM 10391  C CA . ARG B 1 2477 ? 176.724 91.691  96.602  1.00 0.00 ? 2477 ARG B CA 5  
ATOM 10392  C CA . GLU B 1 2488 ? 176.406 87.452  92.640  1.00 0.00 ? 2497 GLU B CA 5  
ATOM 10393  C CA . ILE B 1 2489 ? 178.789 90.426  92.767  1.00 0.00 ? 2498 ILE B CA 5  
ATOM 10394  C CA . GLN B 1 2490 ? 178.590 93.803  90.996  1.00 0.00 ? 2499 GLN B CA 5  
ATOM 10395  C CA . SER B 1 2491 ? 181.708 95.972  91.090  1.00 0.00 ? 2500 SER B CA 5  
ATOM 10396  C CA . CYS B 1 2492 ? 181.391 99.693  90.376  1.00 0.00 ? 2501 CYS B CA 5  
ATOM 10397  C CA . LEU B 1 2493 ? 183.906 102.483 89.786  1.00 0.00 ? 2502 LEU B CA 5  
ATOM 10398  C CA . THR B 1 2494 ? 182.819 105.985 90.827  1.00 0.00 ? 2503 THR B CA 5  
ATOM 10399  C CA . VAL B 1 2495 ? 184.781 109.013 89.635  1.00 0.00 ? 2504 VAL B CA 5  
ATOM 10400  C CA . TRP B 1 2496 ? 184.751 112.786 90.137  1.00 0.00 ? 2505 TRP B CA 5  
ATOM 10401  C CA . TYR A 1 1332 ? 105.036 152.785 169.095 1.00 0.00 ? 1332 TYR A CA 6  
ATOM 10402  C CA . ASN A 1 1333 ? 106.229 149.450 170.644 1.00 0.00 ? 1333 ASN A CA 6  
ATOM 10403  C CA . ARG A 1 1334 ? 106.037 147.269 167.573 1.00 0.00 ? 1334 ARG A CA 6  
ATOM 10404  C CA . MET A 1 1335 ? 108.694 145.521 165.448 1.00 0.00 ? 1335 MET A CA 6  
ATOM 10405  C CA . LYS A 1 1336 ? 108.999 143.264 162.381 1.00 0.00 ? 1336 LYS A CA 6  
ATOM 10406  C CA . LEU A 1 1337 ? 111.010 140.049 162.701 1.00 0.00 ? 1337 LEU A CA 6  
ATOM 10407  C CA . MET A 1 1338 ? 111.906 138.779 159.247 1.00 0.00 ? 1338 MET A CA 6  
ATOM 10408  C CA . ILE A 1 1339 ? 112.893 135.103 159.184 1.00 0.00 ? 1339 ILE A CA 6  
ATOM 10409  C CA . VAL A 1 1340 ? 115.564 134.618 156.494 1.00 0.00 ? 1340 VAL A CA 6  
ATOM 10410  C CA . GLY A 1 1341 ? 117.105 131.363 155.248 1.00 0.00 ? 1341 GLY A CA 6  
ATOM 10411  C CA . ASN A 1 1342 ? 116.853 128.463 152.814 1.00 0.00 ? 1342 ASN A CA 6  
ATOM 10412  C CA . THR A 1 1343 ? 113.494 126.566 153.025 1.00 0.00 ? 1343 THR A CA 6  
ATOM 10413  C CA . GLY A 1 1344 ? 113.626 124.426 156.182 1.00 0.00 ? 1344 GLY A CA 6  
ATOM 10414  C CA . SER A 1 1345 ? 116.846 125.411 157.932 1.00 0.00 ? 1345 SER A CA 6  
ATOM 10415  C CA . GLY A 1 1346 ? 114.456 125.194 160.928 1.00 0.00 ? 1346 GLY A CA 6  
ATOM 10416  C CA . LYS A 1 1347 ? 112.403 128.406 160.601 1.00 0.00 ? 1347 LYS A CA 6  
ATOM 10417  C CA . THR A 1 1348 ? 109.285 126.720 162.097 1.00 0.00 ? 1348 THR A CA 6  
ATOM 10418  C CA . THR A 1 1349 ? 111.509 124.832 164.616 1.00 0.00 ? 1349 THR A CA 6  
ATOM 10419  C CA . LEU A 1 1350 ? 113.098 128.054 165.866 1.00 0.00 ? 1350 LEU A CA 6  
ATOM 10420  C CA . LEU A 1 1351 ? 109.644 129.722 166.083 1.00 0.00 ? 1351 LEU A CA 6  
ATOM 10421  C CA . GLN A 1 1352 ? 108.083 126.821 168.068 1.00 0.00 ? 1352 GLN A CA 6  
ATOM 10422  C CA . GLN A 1 1353 ? 110.948 127.086 170.562 1.00 0.00 ? 1353 GLN A CA 6  
ATOM 10423  C CA . LEU A 1 1354 ? 110.827 130.904 171.024 1.00 0.00 ? 1354 LEU A CA 6  
ATOM 10424  C CA . MET A 1 1355 ? 107.097 131.226 171.378 1.00 0.00 ? 1355 MET A CA 6  
ATOM 10425  C CA . LYS A 1 1356 ? 106.429 128.899 174.412 1.00 0.00 ? 1356 LYS A CA 6  
ATOM 10426  C CA . THR A 1 1357 ? 102.639 129.571 174.457 1.00 0.00 ? 1357 THR A CA 6  
ATOM 10427  C CA . LYS A 1 1358 ? 99.816  127.043 175.137 1.00 0.00 ? 1358 LYS A CA 6  
ATOM 10428  C CA . LYS A 1 1359 ? 100.251 125.989 171.482 1.00 0.00 ? 1359 LYS A CA 6  
ATOM 10429  C CA . SER A 1 1360 ? 97.579  128.571 170.538 1.00 0.00 ? 1360 SER A CA 6  
ATOM 10430  C CA . ASP A 1 1361 ? 98.149  128.966 166.773 1.00 0.00 ? 1361 ASP A CA 6  
ATOM 10431  C CA . LEU A 1 1362 ? 101.826 128.375 167.653 1.00 0.00 ? 1362 LEU A CA 6  
ATOM 10432  C CA . GLY A 1 1363 ? 102.179 125.609 165.097 1.00 0.00 ? 1363 GLY A CA 6  
ATOM 10433  C CA . MET A 1 1364 ? 102.495 126.308 161.363 1.00 0.00 ? 1364 MET A CA 6  
ATOM 10434  C CA . GLN A 1 1365 ? 105.296 124.924 159.192 1.00 0.00 ? 1365 GLN A CA 6  
ATOM 10435  C CA . SER A 1 1366 ? 105.526 126.461 155.711 1.00 0.00 ? 1366 SER A CA 6  
ATOM 10436  C CA . ALA A 1 1367 ? 109.280 126.540 155.341 1.00 0.00 ? 1367 ALA A CA 6  
ATOM 10437  C CA . THR A 1 1368 ? 109.401 126.306 151.466 1.00 0.00 ? 1368 THR A CA 6  
ATOM 10438  C CA . VAL A 1 1369 ? 107.738 128.913 149.171 1.00 0.00 ? 1369 VAL A CA 6  
ATOM 10439  C CA . GLY A 1 1370 ? 105.046 130.008 151.668 1.00 0.00 ? 1370 GLY A CA 6  
ATOM 10440  C CA . ILE A 1 1371 ? 103.840 133.103 153.543 1.00 0.00 ? 1371 ILE A CA 6  
ATOM 10441  C CA . ASP A 1 1372 ? 102.548 133.733 157.096 1.00 0.00 ? 1372 ASP A CA 6  
ATOM 10442  C CA . VAL A 1 1373 ? 102.603 136.160 160.060 1.00 0.00 ? 1373 VAL A CA 6  
ATOM 10443  C CA . LYS A 1 1374 ? 102.672 135.234 163.735 1.00 0.00 ? 1374 LYS A CA 6  
ATOM 10444  C CA . ASP A 1 1375 ? 102.310 138.182 166.081 1.00 0.00 ? 1375 ASP A CA 6  
ATOM 10445  C CA . TRP A 1 1376 ? 103.213 137.580 169.747 1.00 0.00 ? 1376 TRP A CA 6  
ATOM 10446  C CA . PRO A 1 1377 ? 103.925 140.006 172.632 1.00 0.00 ? 1377 PRO A CA 6  
ATOM 10447  C CA . ILE A 1 1378 ? 107.399 138.615 173.607 1.00 0.00 ? 1378 ILE A CA 6  
ATOM 10448  C CA . GLN A 1 1379 ? 108.399 140.807 176.447 1.00 0.00 ? 1379 GLN A CA 6  
ATOM 10449  C CA . ILE A 1 1380 ? 110.055 141.397 179.801 1.00 0.00 ? 1380 ILE A CA 6  
ATOM 10450  C CA . ARG A 1 1381 ? 107.633 142.087 182.628 1.00 0.00 ? 1381 ARG A CA 6  
ATOM 10451  C CA . ASP A 1 1382 ? 108.204 145.385 184.514 1.00 0.00 ? 1382 ASP A CA 6  
ATOM 10452  C CA . LYS A 1 1383 ? 110.594 146.865 181.897 1.00 0.00 ? 1383 LYS A CA 6  
ATOM 10453  C CA . ARG A 1 1384 ? 110.243 149.039 178.728 1.00 0.00 ? 1384 ARG A CA 6  
ATOM 10454  C CA . LYS A 1 1385 ? 109.772 145.849 176.763 1.00 0.00 ? 1385 LYS A CA 6  
ATOM 10455  C CA . ARG A 1 1386 ? 106.454 145.171 178.724 1.00 0.00 ? 1386 ARG A CA 6  
ATOM 10456  C CA . ASP A 1 1387 ? 104.229 146.628 175.950 1.00 0.00 ? 1387 ASP A CA 6  
ATOM 10457  C CA . LEU A 1 1388 ? 106.308 145.360 172.935 1.00 0.00 ? 1388 LEU A CA 6  
ATOM 10458  C CA . VAL A 1 1389 ? 104.653 143.530 170.024 1.00 0.00 ? 1389 VAL A CA 6  
ATOM 10459  C CA . LEU A 1 1390 ? 106.759 141.254 167.784 1.00 0.00 ? 1390 LEU A CA 6  
ATOM 10460  C CA . ASN A 1 1391 ? 105.505 140.450 164.287 1.00 0.00 ? 1391 ASN A CA 6  
ATOM 10461  C CA . VAL A 1 1392 ? 107.217 137.365 162.829 1.00 0.00 ? 1392 VAL A CA 6  
ATOM 10462  C CA . TRP A 1 1393 ? 107.106 137.421 159.035 1.00 0.00 ? 1393 TRP A CA 6  
ATOM 10463  C CA . ASP A 1 1394 ? 108.222 134.828 156.560 1.00 0.00 ? 1394 ASP A CA 6  
ATOM 10464  C CA . PHE A 1 1395 ? 108.043 135.781 152.859 1.00 0.00 ? 1395 PHE A CA 6  
ATOM 10465  C CA . ALA A 1 1396 ? 110.105 132.772 151.678 1.00 0.00 ? 1396 ALA A CA 6  
ATOM 10466  C CA . GLY A 1 1397 ? 112.781 134.758 149.770 1.00 0.00 ? 1397 GLY A CA 6  
ATOM 10467  C CA . ARG A 1 1398 ? 110.293 136.781 147.707 1.00 0.00 ? 1398 ARG A CA 6  
ATOM 10468  C CA . GLU A 1 1399 ? 110.243 140.200 149.368 1.00 0.00 ? 1399 GLU A CA 6  
ATOM 10469  C CA . GLU A 1 1400 ? 106.781 141.232 148.038 1.00 0.00 ? 1400 GLU A CA 6  
ATOM 10470  C CA . PHE A 1 1401 ? 106.501 144.536 149.991 1.00 0.00 ? 1401 PHE A CA 6  
ATOM 10471  C CA . TYR A 1 1402 ? 109.843 145.963 148.674 1.00 0.00 ? 1402 TYR A CA 6  
ATOM 10472  C CA . SER A 1 1403 ? 108.716 148.074 145.655 1.00 0.00 ? 1403 SER A CA 6  
ATOM 10473  C CA . THR A 1 1404 ? 105.723 149.893 147.193 1.00 0.00 ? 1404 THR A CA 6  
ATOM 10474  C CA . HIS A 1 1405 ? 106.692 149.886 150.889 1.00 0.00 ? 1405 HIS A CA 6  
ATOM 10475  C CA . PRO A 1 1406 ? 110.523 150.560 151.192 1.00 0.00 ? 1406 PRO A CA 6  
ATOM 10476  C CA . HIS A 1 1407 ? 110.389 151.311 154.940 1.00 0.00 ? 1407 HIS A CA 6  
ATOM 10477  C CA . PHE A 1 1408 ? 108.662 147.981 155.739 1.00 0.00 ? 1408 PHE A CA 6  
ATOM 10478  C CA . MET A 1 1409 ? 112.022 146.325 154.989 1.00 0.00 ? 1409 MET A CA 6  
ATOM 10479  C CA . THR A 1 1410 ? 114.490 149.139 155.845 1.00 0.00 ? 1410 THR A CA 6  
ATOM 10480  C CA . GLN A 1 1411 ? 112.927 150.467 159.067 1.00 0.00 ? 1411 GLN A CA 6  
ATOM 10481  C CA . ARG A 1 1412 ? 111.045 148.853 161.965 1.00 0.00 ? 1412 ARG A CA 6  
ATOM 10482  C CA . ALA A 1 1413 ? 112.771 145.550 161.269 1.00 0.00 ? 1413 ALA A CA 6  
ATOM 10483  C CA . LEU A 1 1414 ? 115.027 142.789 162.565 1.00 0.00 ? 1414 LEU A CA 6  
ATOM 10484  C CA . TYR A 1 1415 ? 116.414 140.139 160.235 1.00 0.00 ? 1415 TYR A CA 6  
ATOM 10485  C CA . LEU A 1 1416 ? 116.913 136.669 161.710 1.00 0.00 ? 1416 LEU A CA 6  
ATOM 10486  C CA . ALA A 1 1417 ? 119.147 134.526 159.566 1.00 0.00 ? 1417 ALA A CA 6  
ATOM 10487  C CA . VAL A 1 1418 ? 118.572 130.817 160.123 1.00 0.00 ? 1418 VAL A CA 6  
ATOM 10488  C CA . TYR A 1 1419 ? 121.481 128.610 159.124 1.00 0.00 ? 1419 TYR A CA 6  
ATOM 10489  C CA . ASP A 1 1420 ? 121.450 124.900 159.517 1.00 0.00 ? 1420 ASP A CA 6  
ATOM 10490  C CA . LEU A 1 1421 ? 125.252 124.877 159.621 1.00 0.00 ? 1421 LEU A CA 6  
ATOM 10491  C CA . SER A 1 1422 ? 125.544 121.143 158.764 1.00 0.00 ? 1422 SER A CA 6  
ATOM 10492  C CA . LYS A 1 1423 ? 123.137 121.397 155.793 1.00 0.00 ? 1423 LYS A CA 6  
ATOM 10493  C CA . GLY A 1 1424 ? 122.257 125.020 154.793 1.00 0.00 ? 1424 GLY A CA 6  
ATOM 10494  C CA . GLN A 1 1425 ? 125.878 126.174 155.214 1.00 0.00 ? 1425 GLN A CA 6  
ATOM 10495  C CA . ALA A 1 1426 ? 127.599 122.840 154.392 1.00 0.00 ? 1426 ALA A CA 6  
ATOM 10496  C CA . GLU A 1 1427 ? 125.522 121.471 151.414 1.00 0.00 ? 1427 GLU A CA 6  
ATOM 10497  C CA . VAL A 1 1428 ? 124.760 124.720 149.533 1.00 0.00 ? 1428 VAL A CA 6  
ATOM 10498  C CA . ASP A 1 1429 ? 126.868 127.533 151.186 1.00 0.00 ? 1429 ASP A CA 6  
ATOM 10499  C CA . ALA A 1 1430 ? 123.822 129.799 151.076 1.00 0.00 ? 1430 ALA A CA 6  
ATOM 10500  C CA . MET A 1 1431 ? 125.130 131.917 153.956 1.00 0.00 ? 1431 MET A CA 6  
ATOM 10501  C CA . LYS A 1 1432 ? 126.873 134.392 151.606 1.00 0.00 ? 1432 LYS A CA 6  
ATOM 10502  C CA . PRO A 1 1433 ? 123.697 134.845 149.393 1.00 0.00 ? 1433 PRO A CA 6  
ATOM 10503  C CA . TRP A 1 1434 ? 121.326 135.291 152.381 1.00 0.00 ? 1434 TRP A CA 6  
ATOM 10504  C CA . LEU A 1 1435 ? 123.642 137.759 154.109 1.00 0.00 ? 1435 LEU A CA 6  
ATOM 10505  C CA . PHE A 1 1436 ? 123.778 139.956 150.940 1.00 0.00 ? 1436 PHE A CA 6  
ATOM 10506  C CA . ASN A 1 1437 ? 119.953 139.519 150.582 1.00 0.00 ? 1437 ASN A CA 6  
ATOM 10507  C CA . ILE A 1 1438 ? 119.540 140.962 154.119 1.00 0.00 ? 1438 ILE A CA 6  
ATOM 10508  C CA . LYS A 1 1439 ? 121.956 143.868 153.314 1.00 0.00 ? 1439 LYS A CA 6  
ATOM 10509  C CA . ALA A 1 1440 ? 120.161 144.951 150.095 1.00 0.00 ? 1440 ALA A CA 6  
ATOM 10510  C CA . ARG A 1 1441 ? 116.501 144.529 151.180 1.00 0.00 ? 1441 ARG A CA 6  
ATOM 10511  C CA . ALA A 1 1442 ? 117.002 145.860 154.640 1.00 0.00 ? 1442 ALA A CA 6  
ATOM 10512  C CA . SER A 1 1443 ? 119.288 148.864 155.121 1.00 0.00 ? 1443 SER A CA 6  
ATOM 10513  C CA . SER A 1 1444 ? 120.935 149.476 158.490 1.00 0.00 ? 1444 SER A CA 6  
ATOM 10514  C CA . SER A 1 1445 ? 118.421 147.007 160.015 1.00 0.00 ? 1445 SER A CA 6  
ATOM 10515  C CA . PRO A 1 1446 ? 120.008 144.521 162.541 1.00 0.00 ? 1446 PRO A CA 6  
ATOM 10516  C CA . VAL A 1 1447 ? 120.607 140.970 161.770 1.00 0.00 ? 1447 VAL A CA 6  
ATOM 10517  C CA . ILE A 1 1448 ? 120.898 138.089 164.223 1.00 0.00 ? 1448 ILE A CA 6  
ATOM 10518  C CA . LEU A 1 1449 ? 122.641 134.954 162.956 1.00 0.00 ? 1449 LEU A CA 6  
ATOM 10519  C CA . VAL A 1 1450 ? 121.238 131.706 164.369 1.00 0.00 ? 1450 VAL A CA 6  
ATOM 10520  C CA . GLY A 1 1451 ? 123.186 128.477 163.771 1.00 0.00 ? 1451 GLY A CA 6  
ATOM 10521  C CA . THR A 1 1452 ? 120.602 125.684 164.112 1.00 0.00 ? 1452 THR A CA 6  
ATOM 10522  C CA . HIS A 1 1453 ? 120.608 121.885 164.634 1.00 0.00 ? 1453 HIS A CA 6  
ATOM 10523  C CA . LEU A 1 1454 ? 123.808 121.981 166.681 1.00 0.00 ? 1454 LEU A CA 6  
ATOM 10524  C CA . ASP A 1 1455 ? 122.931 118.675 168.451 1.00 0.00 ? 1455 ASP A CA 6  
ATOM 10525  C CA . VAL A 1 1456 ? 123.434 116.723 165.168 1.00 0.00 ? 1456 VAL A CA 6  
ATOM 10526  C CA . SER A 1 1457 ? 126.846 118.372 164.692 1.00 0.00 ? 1457 SER A CA 6  
ATOM 10527  C CA . ASP A 1 1458 ? 128.380 117.637 168.144 1.00 0.00 ? 1458 ASP A CA 6  
ATOM 10528  C CA . GLU A 1 1459 ? 129.009 121.390 168.662 1.00 0.00 ? 1459 GLU A CA 6  
ATOM 10529  C CA . LYS A 1 1460 ? 131.496 121.426 165.724 1.00 0.00 ? 1460 LYS A CA 6  
ATOM 10530  C CA . GLN A 1 1461 ? 129.803 123.689 163.154 1.00 0.00 ? 1461 GLN A CA 6  
ATOM 10531  C CA . ARG A 1 1462 ? 129.727 126.636 165.547 1.00 0.00 ? 1462 ARG A CA 6  
ATOM 10532  C CA . LYS A 1 1463 ? 133.506 126.869 165.765 1.00 0.00 ? 1463 LYS A CA 6  
ATOM 10533  C CA . ALA A 1 1464 ? 135.645 129.648 164.185 1.00 0.00 ? 1464 ALA A CA 6  
ATOM 10534  C CA . CYS A 1 1465 ? 137.011 126.963 161.837 1.00 0.00 ? 1465 CYS A CA 6  
ATOM 10535  C CA . MET A 1 1466 ? 133.623 126.632 160.039 1.00 0.00 ? 1466 MET A CA 6  
ATOM 10536  C CA . SER A 1 1467 ? 131.643 129.723 161.121 1.00 0.00 ? 1467 SER A CA 6  
ATOM 10537  C CA . LYS A 1 1468 ? 133.680 132.817 160.264 1.00 0.00 ? 1468 LYS A CA 6  
ATOM 10538  C CA . ILE A 1 1469 ? 132.057 135.135 162.895 1.00 0.00 ? 1469 ILE A CA 6  
ATOM 10539  C CA . THR A 1 1470 ? 134.765 137.798 163.412 1.00 0.00 ? 1470 THR A CA 6  
ATOM 10540  C CA . LYS A 1 1471 ? 136.735 136.943 160.319 1.00 0.00 ? 1471 LYS A CA 6  
ATOM 10541  C CA . GLU A 1 1472 ? 133.925 137.304 157.650 1.00 0.00 ? 1472 GLU A CA 6  
ATOM 10542  C CA . LEU A 1 1473 ? 130.487 137.798 159.280 1.00 0.00 ? 1473 LEU A CA 6  
ATOM 10543  C CA . LEU A 1 1474 ? 130.973 140.856 161.584 1.00 0.00 ? 1474 LEU A CA 6  
ATOM 10544  C CA . ASN A 1 1475 ? 132.119 144.540 161.391 1.00 0.00 ? 1475 ASN A CA 6  
ATOM 10545  C CA . LYS A 1 1476 ? 135.782 143.626 160.621 1.00 0.00 ? 1476 LYS A CA 6  
ATOM 10546  C CA . ARG A 1 1477 ? 134.800 142.333 157.155 1.00 0.00 ? 1477 ARG A CA 6  
ATOM 10547  C CA . GLY A 1 1478 ? 131.916 144.529 156.091 1.00 0.00 ? 1478 GLY A CA 6  
ATOM 10548  C CA . PHE A 1 1479 ? 128.937 143.108 158.023 1.00 0.00 ? 1479 PHE A CA 6  
ATOM 10549  C CA . PRO A 1 1480 ? 128.261 145.933 160.532 1.00 0.00 ? 1480 PRO A CA 6  
ATOM 10550  C CA . ALA A 1 1481 ? 124.640 145.458 161.638 1.00 0.00 ? 1481 ALA A CA 6  
ATOM 10551  C CA . ILE A 1 1482 ? 125.061 141.956 163.146 1.00 0.00 ? 1482 ILE A CA 6  
ATOM 10552  C CA . ARG A 1 1483 ? 126.979 142.074 166.503 1.00 0.00 ? 1483 ARG A CA 6  
ATOM 10553  C CA . ASP A 1 1484 ? 125.185 138.855 167.625 1.00 0.00 ? 1484 ASP A CA 6  
ATOM 10554  C CA . TYR A 1 1485 ? 125.530 135.125 166.877 1.00 0.00 ? 1485 TYR A CA 6  
ATOM 10555  C CA . HIS A 1 1486 ? 123.667 132.110 168.323 1.00 0.00 ? 1486 HIS A CA 6  
ATOM 10556  C CA . PHE A 1 1487 ? 124.288 128.414 168.338 1.00 0.00 ? 1487 PHE A CA 6  
ATOM 10557  C CA . VAL A 1 1488 ? 121.150 126.494 169.226 1.00 0.00 ? 1488 VAL A CA 6  
ATOM 10558  C CA . ASN A 1 1489 ? 120.301 122.820 169.815 1.00 0.00 ? 1489 ASN A CA 6  
ATOM 10559  C CA . ALA A 1 1490 ? 116.545 122.681 170.333 1.00 0.00 ? 1490 ALA A CA 6  
ATOM 10560  C CA . THR A 1 1491 ? 115.982 119.091 171.411 1.00 0.00 ? 1491 THR A CA 6  
ATOM 10561  C CA . GLU A 1 1492 ? 118.934 119.043 173.820 1.00 0.00 ? 1492 GLU A CA 6  
ATOM 10562  C CA . GLU A 1 1493 ? 118.310 122.222 175.839 1.00 0.00 ? 1493 GLU A CA 6  
ATOM 10563  C CA . SER A 1 1494 ? 116.580 125.631 175.470 1.00 0.00 ? 1494 SER A CA 6  
ATOM 10564  C CA . ASP A 1 1495 ? 119.277 127.689 177.211 1.00 0.00 ? 1495 ASP A CA 6  
ATOM 10565  C CA . ALA A 1 1496 ? 120.828 129.137 174.018 1.00 0.00 ? 1496 ALA A CA 6  
ATOM 10566  C CA . LEU A 1 1497 ? 117.349 130.123 172.729 1.00 0.00 ? 1497 LEU A CA 6  
ATOM 10567  C CA . ALA A 1 1498 ? 116.804 132.311 175.798 1.00 0.00 ? 1498 ALA A CA 6  
ATOM 10568  C CA . LYS A 1 1499 ? 119.988 134.110 174.614 1.00 0.00 ? 1499 LYS A CA 6  
ATOM 10569  C CA . LEU A 1 1500 ? 118.205 134.828 171.271 1.00 0.00 ? 1500 LEU A CA 6  
ATOM 10570  C CA . ARG A 1 1501 ? 115.702 136.840 173.331 1.00 0.00 ? 1501 ARG A CA 6  
ATOM 10571  C CA . LYS A 1 1502 ? 118.593 139.078 174.551 1.00 0.00 ? 1502 LYS A CA 6  
ATOM 10572  C CA . THR A 1 1503 ? 119.444 139.893 170.925 1.00 0.00 ? 1503 THR A CA 6  
ATOM 10573  C CA . ILE A 1 1504 ? 115.728 140.556 170.204 1.00 0.00 ? 1504 ILE A CA 6  
ATOM 10574  C CA . ILE A 1 1505 ? 116.063 142.916 173.225 1.00 0.00 ? 1505 ILE A CA 6  
ATOM 10575  C CA . ASN A 1 1506 ? 119.266 144.531 171.746 1.00 0.00 ? 1506 ASN A CA 6  
ATOM 10576  C CA . GLU A 1 1507 ? 117.354 145.266 168.551 1.00 0.00 ? 1507 GLU A CA 6  
ATOM 10577  C CA . SER A 1 1508 ? 113.891 147.024 168.379 1.00 0.00 ? 1508 SER A CA 6  
ATOM 10578  C CA . LEU A 1 1509 ? 115.811 149.803 170.222 1.00 0.00 ? 1509 LEU A CA 6  
ATOM 10579  C CA . ASN A 1 1510 ? 116.921 151.752 167.130 1.00 0.00 ? 1510 ASN A CA 6  
ATOM 10580  C CA . PHE A 1 1511 ? 113.713 150.906 165.116 1.00 0.00 ? 1511 PHE A CA 6  
ATOM 10581  C CA . LYS A 1 1512 ? 110.819 152.051 167.194 1.00 0.00 ? 1512 LYS A CA 6  
ATOM 10582  C CA . ILE A 1 1513 ? 112.020 153.794 170.421 1.00 0.00 ? 1513 ILE A CA 6  
ATOM 10583  C CA . ARG A 1 1514 ? 113.607 156.847 168.738 1.00 0.00 ? 1514 ARG A CA 6  
ATOM 10584  C CA . PRO A 1 1524 ? 121.127 154.675 191.394 1.00 0.00 ? 1524 PRO A CA 6  
ATOM 10585  C CA . ASP A 1 1525 ? 117.281 154.755 191.244 1.00 0.00 ? 1525 ASP A CA 6  
ATOM 10586  C CA . CYS A 1 1526 ? 117.290 158.400 190.007 1.00 0.00 ? 1526 CYS A CA 6  
ATOM 10587  C CA . TYR A 1 1527 ? 119.225 157.436 186.803 1.00 0.00 ? 1527 TYR A CA 6  
ATOM 10588  C CA . VAL A 1 1528 ? 116.688 154.604 186.044 1.00 0.00 ? 1528 VAL A CA 6  
ATOM 10589  C CA . GLU A 1 1529 ? 113.711 156.917 186.846 1.00 0.00 ? 1529 GLU A CA 6  
ATOM 10590  C CA . LEU A 1 1530 ? 115.047 159.657 184.597 1.00 0.00 ? 1530 LEU A CA 6  
ATOM 10591  C CA . GLU A 1 1531 ? 115.864 157.161 181.782 1.00 0.00 ? 1531 GLU A CA 6  
ATOM 10592  C CA . LYS A 1 1532 ? 112.236 155.897 181.775 1.00 0.00 ? 1532 LYS A CA 6  
ATOM 10593  C CA . ILE A 1 1533 ? 110.755 159.434 181.744 1.00 0.00 ? 1533 ILE A CA 6  
ATOM 10594  C CA . ILE A 1 1534 ? 113.224 160.514 179.024 1.00 0.00 ? 1534 ILE A CA 6  
ATOM 10595  C CA . LEU A 1 1535 ? 112.310 157.451 176.876 1.00 0.00 ? 1535 LEU A CA 6  
ATOM 10596  C CA . SER A 1 1536 ? 108.540 158.043 177.292 1.00 0.00 ? 1536 SER A CA 6  
ATOM 10597  C CA . GLU A 1 1537 ? 108.883 161.794 176.468 1.00 0.00 ? 1537 GLU A CA 6  
ATOM 10598  C CA . ARG A 1 1538 ? 111.251 161.085 173.548 1.00 0.00 ? 1538 ARG A CA 6  
ATOM 10599  C CA . LYS A 1 1539 ? 109.330 158.295 171.765 1.00 0.00 ? 1539 LYS A CA 6  
ATOM 10600  C CA . ASN A 1 1540 ? 106.148 160.421 171.896 1.00 0.00 ? 1540 ASN A CA 6  
ATOM 10601  C CA . VAL A 1 1541 ? 107.870 163.075 169.738 1.00 0.00 ? 1541 VAL A CA 6  
ATOM 10602  C CA . PRO A 1 1542 ? 108.476 161.052 166.464 1.00 0.00 ? 1542 PRO A CA 6  
ATOM 10603  C CA . ILE A 1 1543 ? 106.994 163.760 164.300 1.00 0.00 ? 1543 ILE A CA 6  
ATOM 10604  C CA . GLU A 1 1544 ? 109.218 166.521 165.525 1.00 0.00 ? 1544 GLU A CA 6  
ATOM 10605  C CA . PHE A 1 1545 ? 112.983 166.953 166.245 1.00 0.00 ? 1545 PHE A CA 6  
ATOM 10606  C CA . PRO A 1 1546 ? 113.171 168.796 169.658 1.00 0.00 ? 1546 PRO A CA 6  
ATOM 10607  C CA . VAL A 1 1547 ? 112.062 165.615 171.212 1.00 0.00 ? 1547 VAL A CA 6  
ATOM 10608  C CA . ILE A 1 1548 ? 113.448 167.062 174.394 1.00 0.00 ? 1548 ILE A CA 6  
ATOM 10609  C CA . ASP A 1 1549 ? 114.697 170.669 174.647 1.00 0.00 ? 1549 ASP A CA 6  
ATOM 10610  C CA . ARG A 1 1550 ? 117.186 171.828 177.339 1.00 0.00 ? 1550 ARG A CA 6  
ATOM 10611  C CA . LYS A 1 1551 ? 114.502 173.208 179.694 1.00 0.00 ? 1551 LYS A CA 6  
ATOM 10612  C CA . ARG A 1 1552 ? 112.378 170.081 179.421 1.00 0.00 ? 1552 ARG A CA 6  
ATOM 10613  C CA . LEU A 1 1553 ? 115.161 167.613 180.463 1.00 0.00 ? 1553 LEU A CA 6  
ATOM 10614  C CA . LEU A 1 1554 ? 116.174 170.008 183.281 1.00 0.00 ? 1554 LEU A CA 6  
ATOM 10615  C CA . GLN A 1 1555 ? 112.561 169.772 184.503 1.00 0.00 ? 1555 GLN A CA 6  
ATOM 10616  C CA . LEU A 1 1556 ? 112.571 165.916 184.354 1.00 0.00 ? 1556 LEU A CA 6  
ATOM 10617  C CA . VAL A 1 1557 ? 115.989 165.744 186.131 1.00 0.00 ? 1557 VAL A CA 6  
ATOM 10618  C CA . ARG A 1 1558 ? 114.612 167.951 188.978 1.00 0.00 ? 1558 ARG A CA 6  
ATOM 10619  C CA . GLU A 1 1559 ? 111.511 165.771 189.478 1.00 0.00 ? 1559 GLU A CA 6  
ATOM 10620  C CA . ASN A 1 1560 ? 113.820 162.780 190.190 1.00 0.00 ? 1560 ASN A CA 6  
ATOM 10621  C CA . GLN A 1 1561 ? 116.044 164.982 192.450 1.00 0.00 ? 1561 GLN A CA 6  
ATOM 10622  C CA . LEU A 1 1562 ? 119.071 165.300 190.074 1.00 0.00 ? 1562 LEU A CA 6  
ATOM 10623  C CA . GLN A 1 1563 ? 119.032 169.117 189.518 1.00 0.00 ? 1563 GLN A CA 6  
ATOM 10624  C CA . LEU A 1 1564 ? 121.380 169.253 192.536 1.00 0.00 ? 1564 LEU A CA 6  
ATOM 10625  C CA . ASP A 1 1565 ? 124.445 169.116 190.269 1.00 0.00 ? 1565 ASP A CA 6  
ATOM 10626  C CA . GLU A 1 1566 ? 124.685 170.204 186.587 1.00 0.00 ? 1566 GLU A CA 6  
ATOM 10627  C CA . ASN A 1 1567 ? 127.849 168.116 186.443 1.00 0.00 ? 1567 ASN A CA 6  
ATOM 10628  C CA . GLU A 1 1568 ? 126.032 164.744 187.152 1.00 0.00 ? 1568 GLU A CA 6  
ATOM 10629  C CA . LEU A 1 1569 ? 123.340 165.495 184.591 1.00 0.00 ? 1569 LEU A CA 6  
ATOM 10630  C CA . PRO A 1 1570 ? 125.975 165.615 181.712 1.00 0.00 ? 1570 PRO A CA 6  
ATOM 10631  C CA . HIS A 1 1571 ? 127.349 162.335 183.081 1.00 0.00 ? 1571 HIS A CA 6  
ATOM 10632  C CA . ALA A 1 1572 ? 123.883 160.666 183.214 1.00 0.00 ? 1572 ALA A CA 6  
ATOM 10633  C CA . VAL A 1 1573 ? 122.986 161.834 179.679 1.00 0.00 ? 1573 VAL A CA 6  
ATOM 10634  C CA . HIS A 1 1574 ? 126.568 160.974 178.513 1.00 0.00 ? 1574 HIS A CA 6  
ATOM 10635  C CA . PHE A 1 1575 ? 125.886 157.426 179.854 1.00 0.00 ? 1575 PHE A CA 6  
ATOM 10636  C CA . LEU A 1 1576 ? 122.468 157.227 178.206 1.00 0.00 ? 1576 LEU A CA 6  
ATOM 10637  C CA . ASN A 1 1577 ? 124.011 158.449 174.926 1.00 0.00 ? 1577 ASN A CA 6  
ATOM 10638  C CA . GLU A 1 1578 ? 126.946 155.932 175.162 1.00 0.00 ? 1578 GLU A CA 6  
ATOM 10639  C CA . SER A 1 1579 ? 124.343 153.179 175.681 1.00 0.00 ? 1579 SER A CA 6  
ATOM 10640  C CA . GLY A 1 1580 ? 122.048 154.328 172.781 1.00 0.00 ? 1580 GLY A CA 6  
ATOM 10641  C CA . VAL A 1 1581 ? 118.975 154.647 175.012 1.00 0.00 ? 1581 VAL A CA 6  
ATOM 10642  C CA . LEU A 1 1582 ? 118.811 158.270 173.971 1.00 0.00 ? 1582 LEU A CA 6  
ATOM 10643  C CA . LEU A 1 1583 ? 121.078 160.379 171.812 1.00 0.00 ? 1583 LEU A CA 6  
ATOM 10644  C CA . HIS A 1 1584 ? 122.824 163.493 173.172 1.00 0.00 ? 1584 HIS A CA 6  
ATOM 10645  C CA . PHE A 1 1585 ? 125.391 165.276 171.075 1.00 0.00 ? 1585 PHE A CA 6  
ATOM 10646  C CA . GLN A 1 1586 ? 127.773 167.262 173.299 1.00 0.00 ? 1586 GLN A CA 6  
ATOM 10647  C CA . ASP A 1 1587 ? 129.734 168.708 170.300 1.00 0.00 ? 1587 ASP A CA 6  
ATOM 10648  C CA . PRO A 1 1588 ? 126.696 170.637 168.738 1.00 0.00 ? 1588 PRO A CA 6  
ATOM 10649  C CA . ALA A 1 1589 ? 125.289 171.374 172.261 1.00 0.00 ? 1589 ALA A CA 6  
ATOM 10650  C CA . LEU A 1 1590 ? 127.064 174.770 172.505 1.00 0.00 ? 1590 LEU A CA 6  
ATOM 10651  C CA . GLN A 1 1591 ? 124.498 176.469 170.223 1.00 0.00 ? 1591 GLN A CA 6  
ATOM 10652  C CA . LEU A 1 1592 ? 121.582 174.039 170.464 1.00 0.00 ? 1592 LEU A CA 6  
ATOM 10653  C CA . SER A 1 1593 ? 119.221 174.120 173.495 1.00 0.00 ? 1593 SER A CA 6  
ATOM 10654  C CA . ASP A 1 1594 ? 116.153 173.559 171.270 1.00 0.00 ? 1594 ASP A CA 6  
ATOM 10655  C CA . LEU A 1 1595 ? 117.292 170.069 170.259 1.00 0.00 ? 1595 LEU A CA 6  
ATOM 10656  C CA . TYR A 1 1596 ? 119.270 168.721 173.175 1.00 0.00 ? 1596 TYR A CA 6  
ATOM 10657  C CA . PHE A 1 1597 ? 118.465 165.013 173.543 1.00 0.00 ? 1597 PHE A CA 6  
ATOM 10658  C CA . VAL A 1 1598 ? 117.156 162.809 170.704 1.00 0.00 ? 1598 VAL A CA 6  
ATOM 10659  C CA . GLU A 1 1599 ? 115.092 159.618 169.954 1.00 0.00 ? 1599 GLU A CA 6  
ATOM 10660  C CA . PRO A 1 1600 ? 117.473 157.054 168.282 1.00 0.00 ? 1600 PRO A CA 6  
ATOM 10661  C CA . LYS A 1 1601 ? 114.747 155.721 165.946 1.00 0.00 ? 1601 LYS A CA 6  
ATOM 10662  C CA . TRP A 1 1602 ? 113.918 159.201 164.703 1.00 0.00 ? 1602 TRP A CA 6  
ATOM 10663  C CA . LEU A 1 1603 ? 117.636 159.929 163.996 1.00 0.00 ? 1603 LEU A CA 6  
ATOM 10664  C CA . CYS A 1 1604 ? 118.272 156.542 162.306 1.00 0.00 ? 1604 CYS A CA 6  
ATOM 10665  C CA . LYS A 1 1605 ? 115.216 156.800 160.004 1.00 0.00 ? 1605 LYS A CA 6  
ATOM 10666  C CA . ILE A 1 1606 ? 116.355 160.317 158.995 1.00 0.00 ? 1606 ILE A CA 6  
ATOM 10667  C CA . MET A 1 1607 ? 119.726 159.316 157.778 1.00 0.00 ? 1607 MET A CA 6  
ATOM 10668  C CA . ALA A 1 1608 ? 118.671 156.104 156.101 1.00 0.00 ? 1608 ALA A CA 6  
ATOM 10669  C CA . GLN A 1 1609 ? 116.199 158.217 154.037 1.00 0.00 ? 1609 GLN A CA 6  
ATOM 10670  C CA . ILE A 1 1610 ? 119.079 160.553 152.996 1.00 0.00 ? 1610 ILE A CA 6  
ATOM 10671  C CA . LEU A 1 1611 ? 121.344 157.546 152.235 1.00 0.00 ? 1611 LEU A CA 6  
ATOM 10672  C CA . THR A 1 1612 ? 118.720 155.708 150.094 1.00 0.00 ? 1612 THR A CA 6  
ATOM 10673  C CA . VAL A 1 1613 ? 117.266 158.736 148.291 1.00 0.00 ? 1613 VAL A CA 6  
ATOM 10674  C CA . LYS A 1 1614 ? 117.282 158.685 144.450 1.00 0.00 ? 1614 LYS A CA 6  
ATOM 10675  C CA . VAL A 1 1615 ? 118.442 162.336 144.380 1.00 0.00 ? 1615 VAL A CA 6  
ATOM 10676  C CA . GLU A 1 1616 ? 122.190 161.889 144.980 1.00 0.00 ? 1616 GLU A CA 6  
ATOM 10677  C CA . GLY A 1 1617 ? 123.101 164.592 142.447 1.00 0.00 ? 1617 GLY A CA 6  
ATOM 10678  C CA . CYS A 1 1618 ? 122.354 166.385 139.189 1.00 0.00 ? 1618 CYS A CA 6  
ATOM 10679  C CA . PRO A 1 1619 ? 120.340 164.333 136.553 1.00 0.00 ? 1619 PRO A CA 6  
ATOM 10680  C CA . LYS A 1 1620 ? 123.245 162.864 134.493 1.00 0.00 ? 1620 LYS A CA 6  
ATOM 10681  C CA . HIS A 1 1621 ? 125.806 162.630 137.332 1.00 0.00 ? 1621 HIS A CA 6  
ATOM 10682  C CA . PRO A 1 1622 ? 124.398 161.354 140.694 1.00 0.00 ? 1622 PRO A CA 6  
ATOM 10683  C CA . LYS A 1 1623 ? 127.596 160.298 142.506 1.00 0.00 ? 1623 LYS A CA 6  
ATOM 10684  C CA . GLY A 1 1624 ? 126.888 160.701 146.266 1.00 0.00 ? 1624 GLY A CA 6  
ATOM 10685  C CA . ILE A 1 1625 ? 126.030 164.425 146.019 1.00 0.00 ? 1625 ILE A CA 6  
ATOM 10686  C CA . ILE A 1 1626 ? 123.478 165.854 148.491 1.00 0.00 ? 1626 ILE A CA 6  
ATOM 10687  C CA . SER A 1 1627 ? 121.948 169.099 147.180 1.00 0.00 ? 1627 SER A CA 6  
ATOM 10688  C CA . ARG A 1 1628 ? 120.810 170.905 150.384 1.00 0.00 ? 1628 ARG A CA 6  
ATOM 10689  C CA . ARG A 1 1629 ? 117.622 172.339 148.769 1.00 0.00 ? 1629 ARG A CA 6  
ATOM 10690  C CA . ASP A 1 1630 ? 116.083 169.012 148.117 1.00 0.00 ? 1630 ASP A CA 6  
ATOM 10691  C CA . VAL A 1 1631 ? 116.081 167.779 151.783 1.00 0.00 ? 1631 VAL A CA 6  
ATOM 10692  C CA . GLU A 1 1632 ? 112.381 168.731 152.229 1.00 0.00 ? 1632 GLU A CA 6  
ATOM 10693  C CA . LYS A 1 1633 ? 111.384 166.295 149.471 1.00 0.00 ? 1633 LYS A CA 6  
ATOM 10694  C CA . PHE A 1 1634 ? 113.698 163.444 150.638 1.00 0.00 ? 1634 PHE A CA 6  
ATOM 10695  C CA . LEU A 1 1635 ? 112.680 163.463 154.232 1.00 0.00 ? 1635 LEU A CA 6  
ATOM 10696  C CA . SER A 1 1636 ? 108.956 164.472 154.181 1.00 0.00 ? 1636 SER A CA 6  
ATOM 10697  C CA . LYS A 1 1637 ? 106.076 163.319 154.585 1.00 0.00 ? 1637 LYS A CA 6  
ATOM 10698  C CA . LYS A 1 1638 ? 107.291 159.739 155.465 1.00 0.00 ? 1638 LYS A CA 6  
ATOM 10699  C CA . ARG A 1 1639 ? 108.778 161.421 158.458 1.00 0.00 ? 1639 ARG A CA 6  
ATOM 10700  C CA . LYS A 1 1640 ? 108.190 165.010 159.536 1.00 0.00 ? 1640 LYS A CA 6  
ATOM 10701  C CA . PHE A 1 1641 ? 111.265 167.219 159.194 1.00 0.00 ? 1641 PHE A CA 6  
ATOM 10702  C CA . PRO A 1 1642 ? 110.892 170.994 159.326 1.00 0.00 ? 1642 PRO A CA 6  
ATOM 10703  C CA . LYS A 1 1643 ? 113.722 173.293 158.105 1.00 0.00 ? 1643 LYS A CA 6  
ATOM 10704  C CA . ASN A 1 1644 ? 115.645 173.717 161.420 1.00 0.00 ? 1644 ASN A CA 6  
ATOM 10705  C CA . TYR A 1 1645 ? 115.419 169.940 161.974 1.00 0.00 ? 1645 TYR A CA 6  
ATOM 10706  C CA . MET A 1 1646 ? 116.766 169.571 158.416 1.00 0.00 ? 1646 MET A CA 6  
ATOM 10707  C CA . SER A 1 1647 ? 119.880 171.694 159.137 1.00 0.00 ? 1647 SER A CA 6  
ATOM 10708  C CA . GLN A 1 1648 ? 120.648 169.690 162.331 1.00 0.00 ? 1648 GLN A CA 6  
ATOM 10709  C CA . TYR A 1 1649 ? 120.359 166.150 160.822 1.00 0.00 ? 1649 TYR A CA 6  
ATOM 10710  C CA . PHE A 1 1650 ? 123.109 167.175 158.389 1.00 0.00 ? 1650 PHE A CA 6  
ATOM 10711  C CA . LYS A 1 1651 ? 125.280 167.964 161.442 1.00 0.00 ? 1651 LYS A CA 6  
ATOM 10712  C CA . LEU A 1 1652 ? 124.432 164.459 162.744 1.00 0.00 ? 1652 LEU A CA 6  
ATOM 10713  C CA . LEU A 1 1653 ? 125.580 162.976 159.359 1.00 0.00 ? 1653 LEU A CA 6  
ATOM 10714  C CA . GLU A 1 1654 ? 128.855 164.951 159.673 1.00 0.00 ? 1654 GLU A CA 6  
ATOM 10715  C CA . LYS A 1 1655 ? 129.268 163.688 163.244 1.00 0.00 ? 1655 LYS A CA 6  
ATOM 10716  C CA . PHE A 1 1656 ? 128.441 160.058 162.234 1.00 0.00 ? 1656 PHE A CA 6  
ATOM 10717  C CA . GLN A 1 1657 ? 131.076 160.524 159.447 1.00 0.00 ? 1657 GLN A CA 6  
ATOM 10718  C CA . ILE A 1 1658 ? 128.616 159.754 156.648 1.00 0.00 ? 1658 ILE A CA 6  
ATOM 10719  C CA . ALA A 1 1659 ? 129.088 163.041 154.788 1.00 0.00 ? 1659 ALA A CA 6  
ATOM 10720  C CA . LEU A 1 1660 ? 131.222 166.206 154.561 1.00 0.00 ? 1660 LEU A CA 6  
ATOM 10721  C CA . PRO A 1 1661 ? 130.554 169.777 153.264 1.00 0.00 ? 1661 PRO A CA 6  
ATOM 10722  C CA . ILE A 1 1662 ? 132.441 171.163 150.217 1.00 0.00 ? 1662 ILE A CA 6  
ATOM 10723  C CA . GLY A 1 1663 ? 130.890 174.643 150.625 1.00 0.00 ? 1663 GLY A CA 6  
ATOM 10724  C CA . GLU A 1 1664 ? 128.386 175.213 147.779 1.00 0.00 ? 1664 GLU A CA 6  
ATOM 10725  C CA . GLU A 1 1665 ? 125.300 173.792 149.642 1.00 0.00 ? 1665 GLU A CA 6  
ATOM 10726  C CA . TYR A 1 1666 ? 126.387 170.442 148.171 1.00 0.00 ? 1666 TYR A CA 6  
ATOM 10727  C CA . LEU A 1 1667 ? 127.637 167.619 150.410 1.00 0.00 ? 1667 LEU A CA 6  
ATOM 10728  C CA . LEU A 1 1668 ? 129.546 164.441 149.552 1.00 0.00 ? 1668 LEU A CA 6  
ATOM 10729  C CA . VAL A 1 1669 ? 128.343 161.032 150.823 1.00 0.00 ? 1669 VAL A CA 6  
ATOM 10730  C CA . ILE A 1 1690 ? 148.118 150.175 141.519 1.00 0.00 ? 1690 ILE A CA 6  
ATOM 10731  C CA . ILE A 1 1691 ? 149.231 149.587 145.178 1.00 0.00 ? 1691 ILE A CA 6  
ATOM 10732  C CA . ILE A 1 1692 ? 151.036 146.247 145.401 1.00 0.00 ? 1692 ILE A CA 6  
ATOM 10733  C CA . ARG A 1 1693 ? 152.112 144.703 148.722 1.00 0.00 ? 1693 ARG A CA 6  
ATOM 10734  C CA . LEU A 1 1694 ? 153.758 141.251 148.956 1.00 0.00 ? 1694 LEU A CA 6  
ATOM 10735  C CA . TYR A 1 1695 ? 154.127 138.965 152.038 1.00 0.00 ? 1695 TYR A CA 6  
ATOM 10736  C CA . GLU A 1 1696 ? 156.899 136.263 151.996 1.00 0.00 ? 1696 GLU A CA 6  
ATOM 10737  C CA . MET A 1 1697 ? 156.313 133.203 154.234 1.00 0.00 ? 1697 MET A CA 6  
ATOM 10738  C CA . PRO A 1 1698 ? 159.040 130.389 154.725 1.00 0.00 ? 1698 PRO A CA 6  
ATOM 10739  C CA . TYR A 1 1699 ? 156.050 128.153 154.934 1.00 0.00 ? 1699 TYR A CA 6  
ATOM 10740  C CA . PHE A 1 1700 ? 152.737 129.330 153.390 1.00 0.00 ? 1700 PHE A CA 6  
ATOM 10741  C CA . PRO A 1 1701 ? 149.830 127.356 155.048 1.00 0.00 ? 1701 PRO A CA 6  
ATOM 10742  C CA . MET A 1 1702 ? 147.377 126.114 152.408 1.00 0.00 ? 1702 MET A CA 6  
ATOM 10743  C CA . GLY A 1 1703 ? 144.567 127.165 154.756 1.00 0.00 ? 1703 GLY A CA 6  
ATOM 10744  C CA . PHE A 1 1704 ? 145.427 130.917 154.545 1.00 0.00 ? 1704 PHE A CA 6  
ATOM 10745  C CA . TRP A 1 1705 ? 143.536 131.707 151.340 1.00 0.00 ? 1705 TRP A CA 6  
ATOM 10746  C CA . SER A 1 1706 ? 140.633 129.464 152.193 1.00 0.00 ? 1706 SER A CA 6  
ATOM 10747  C CA . ARG A 1 1707 ? 140.253 131.168 155.582 1.00 0.00 ? 1707 ARG A CA 6  
ATOM 10748  C CA . LEU A 1 1708 ? 140.757 134.701 154.227 1.00 0.00 ? 1708 LEU A CA 6  
ATOM 10749  C CA . ILE A 1 1709 ? 138.073 133.954 151.582 1.00 0.00 ? 1709 ILE A CA 6  
ATOM 10750  C CA . ASN A 1 1710 ? 135.747 133.074 154.517 1.00 0.00 ? 1710 ASN A CA 6  
ATOM 10751  C CA . ARG A 1 1711 ? 136.612 136.253 156.521 1.00 0.00 ? 1711 ARG A CA 6  
ATOM 10752  C CA . LEU A 1 1712 ? 136.020 138.322 153.359 1.00 0.00 ? 1712 LEU A CA 6  
ATOM 10753  C CA . LEU A 1 1713 ? 133.039 136.411 151.789 1.00 0.00 ? 1713 LEU A CA 6  
ATOM 10754  C CA . GLU A 1 1714 ? 130.815 139.495 151.647 1.00 0.00 ? 1714 GLU A CA 6  
ATOM 10755  C CA . ILE A 1 1715 ? 133.196 141.513 149.408 1.00 0.00 ? 1715 ILE A CA 6  
ATOM 10756  C CA . SER A 1 1716 ? 133.948 138.846 146.749 1.00 0.00 ? 1716 SER A CA 6  
ATOM 10757  C CA . PRO A 1 1717 ? 130.887 139.480 144.491 1.00 0.00 ? 1717 PRO A CA 6  
ATOM 10758  C CA . TYR A 1 1718 ? 130.948 143.145 145.523 1.00 0.00 ? 1718 TYR A CA 6  
ATOM 10759  C CA . MET A 1 1719 ? 129.877 145.238 148.484 1.00 0.00 ? 1719 MET A CA 6  
ATOM 10760  C CA . LEU A 1 1720 ? 129.155 148.488 146.523 1.00 0.00 ? 1720 LEU A CA 6  
ATOM 10761  C CA . SER A 1 1721 ? 126.252 148.851 144.133 1.00 0.00 ? 1721 SER A CA 6  
ATOM 10762  C CA . GLY A 1 1722 ? 128.759 151.015 142.130 1.00 0.00 ? 1722 GLY A CA 6  
ATOM 10763  C CA . ARG A 1 1723 ? 130.518 148.321 140.172 1.00 0.00 ? 1723 ARG A CA 6  
ATOM 10764  C CA . GLU A 1 1724 ? 132.681 149.302 137.181 1.00 0.00 ? 1724 GLU A CA 6  
ATOM 10765  C CA . ARG A 1 1725 ? 134.452 146.062 136.263 1.00 0.00 ? 1725 ARG A CA 6  
ATOM 10766  C CA . ALA A 1 1726 ? 132.432 142.900 135.514 1.00 0.00 ? 1726 ALA A CA 6  
ATOM 10767  C CA . LEU A 1 1727 ? 135.442 140.555 135.660 1.00 0.00 ? 1727 LEU A CA 6  
ATOM 10768  C CA . ARG A 1 1728 ? 137.174 141.102 139.017 1.00 0.00 ? 1728 ARG A CA 6  
ATOM 10769  C CA . PRO A 1 1729 ? 134.275 140.679 141.563 1.00 0.00 ? 1729 PRO A CA 6  
ATOM 10770  C CA . ASN A 1 1730 ? 131.301 138.267 140.678 1.00 0.00 ? 1730 ASN A CA 6  
ATOM 10771  C CA . ARG A 1 1731 ? 132.229 134.866 142.149 1.00 0.00 ? 1731 ARG A CA 6  
ATOM 10772  C CA . MET A 1 1732 ? 135.767 135.530 141.128 1.00 0.00 ? 1732 MET A CA 6  
ATOM 10773  C CA . TYR A 1 1733 ? 137.469 133.432 143.608 1.00 0.00 ? 1733 TYR A CA 6  
ATOM 10774  C CA . TRP A 1 1734 ? 139.711 130.517 142.951 1.00 0.00 ? 1734 TRP A CA 6  
ATOM 10775  C CA . ARG A 1 1735 ? 141.999 128.121 144.834 1.00 0.00 ? 1735 ARG A CA 6  
ATOM 10776  C CA . GLN A 1 1736 ? 144.902 130.638 144.868 1.00 0.00 ? 1736 GLN A CA 6  
ATOM 10777  C CA . GLY A 1 1737 ? 143.034 133.969 145.205 1.00 0.00 ? 1737 GLY A CA 6  
ATOM 10778  C CA . ILE A 1 1738 ? 140.071 136.323 145.184 1.00 0.00 ? 1738 ILE A CA 6  
ATOM 10779  C CA . TYR A 1 1739 ? 138.916 139.734 143.946 1.00 0.00 ? 1739 TYR A CA 6  
ATOM 10780  C CA . LEU A 1 1740 ? 137.473 141.999 146.584 1.00 0.00 ? 1740 LEU A CA 6  
ATOM 10781  C CA . ASN A 1 1741 ? 135.330 145.144 146.186 1.00 0.00 ? 1741 ASN A CA 6  
ATOM 10782  C CA . TRP A 1 1742 ? 134.083 147.353 149.059 1.00 0.00 ? 1742 TRP A CA 6  
ATOM 10783  C CA . SER A 1 1743 ? 131.845 150.382 149.560 1.00 0.00 ? 1743 SER A CA 6  
ATOM 10784  C CA . PRO A 1 1744 ? 132.747 153.277 149.204 1.00 0.00 ? 1744 PRO A CA 6  
ATOM 10785  C CA . GLU A 1 1745 ? 134.717 154.335 147.133 1.00 0.00 ? 1745 GLU A CA 6  
ATOM 10786  C CA . ALA A 1 1746 ? 134.563 151.177 144.898 1.00 0.00 ? 1746 ALA A CA 6  
ATOM 10787  C CA . TYR A 1 1747 ? 138.094 150.063 145.395 1.00 0.00 ? 1747 TYR A CA 6  
ATOM 10788  C CA . CYS A 1 1748 ? 138.979 146.691 143.774 1.00 0.00 ? 1748 CYS A CA 6  
ATOM 10789  C CA . LEU A 1 1749 ? 141.581 144.419 145.434 1.00 0.00 ? 1749 LEU A CA 6  
ATOM 10790  C CA . VAL A 1 1750 ? 143.117 141.223 144.074 1.00 0.00 ? 1750 VAL A CA 6  
ATOM 10791  C CA . GLY A 1 1751 ? 144.645 138.870 146.564 1.00 0.00 ? 1751 GLY A CA 6  
ATOM 10792  C CA . SER A 1 1752 ? 146.733 136.073 145.047 1.00 0.00 ? 1752 SER A CA 6  
ATOM 10793  C CA . GLU A 1 1753 ? 149.152 134.001 147.160 1.00 0.00 ? 1753 GLU A CA 6  
ATOM 10794  C CA . VAL A 1 1754 ? 150.850 136.570 149.287 1.00 0.00 ? 1754 VAL A CA 6  
ATOM 10795  C CA . LEU A 1 1755 ? 150.347 139.321 146.688 1.00 0.00 ? 1755 LEU A CA 6  
ATOM 10796  C CA . ASP A 1 1756 ? 147.787 142.085 147.274 1.00 0.00 ? 1756 ASP A CA 6  
ATOM 10797  C CA . ASN A 1 1757 ? 147.241 144.485 144.311 1.00 0.00 ? 1757 ASN A CA 6  
ATOM 10798  C CA . HIS A 1 1758 ? 144.825 147.419 144.628 1.00 0.00 ? 1758 HIS A CA 6  
ATOM 10799  C CA . PRO A 1 1759 ? 143.256 150.126 142.214 1.00 0.00 ? 1759 PRO A CA 6  
ATOM 10800  C CA . GLU A 1 1760 ? 141.346 153.284 143.593 1.00 0.00 ? 1760 GLU A CA 6  
ATOM 10801  C CA . SER A 1 1761 ? 142.201 156.459 145.593 1.00 0.00 ? 1761 SER A CA 6  
ATOM 10802  C CA . PHE A 1 1762 ? 141.193 154.793 148.961 1.00 0.00 ? 1762 PHE A CA 6  
ATOM 10803  C CA . LEU A 1 1763 ? 143.983 152.257 148.538 1.00 0.00 ? 1763 LEU A CA 6  
ATOM 10804  C CA . LYS A 1 1764 ? 145.801 152.777 151.710 1.00 0.00 ? 1764 LYS A CA 6  
ATOM 10805  C CA . ILE A 1 1765 ? 142.842 152.132 154.095 1.00 0.00 ? 1765 ILE A CA 6  
ATOM 10806  C CA . THR A 1 1766 ? 141.772 149.001 152.197 1.00 0.00 ? 1766 THR A CA 6  
ATOM 10807  C CA . VAL A 1 1767 ? 145.148 147.334 152.406 1.00 0.00 ? 1767 VAL A CA 6  
ATOM 10808  C CA . PRO A 1 1768 ? 145.250 147.334 156.362 1.00 0.00 ? 1768 PRO A CA 6  
ATOM 10809  C CA . SER A 1 1769 ? 141.859 145.771 156.622 1.00 0.00 ? 1769 SER A CA 6  
ATOM 10810  C CA . CYS A 1 1770 ? 143.032 142.998 154.234 1.00 0.00 ? 1770 CYS A CA 6  
ATOM 10811  C CA . ARG A 1 1771 ? 146.533 143.023 155.871 1.00 0.00 ? 1771 ARG A CA 6  
ATOM 10812  C CA . LYS A 1 1772 ? 144.958 142.803 159.341 1.00 0.00 ? 1772 LYS A CA 6  
ATOM 10813  C CA . GLY A 1 1773 ? 142.725 139.849 158.329 1.00 0.00 ? 1773 GLY A CA 6  
ATOM 10814  C CA . CYS A 1 1774 ? 145.782 138.059 156.935 1.00 0.00 ? 1774 CYS A CA 6  
ATOM 10815  C CA . ILE A 1 1775 ? 147.819 138.802 160.111 1.00 0.00 ? 1775 ILE A CA 6  
ATOM 10816  C CA . LEU A 1 1776 ? 144.893 137.487 162.247 1.00 0.00 ? 1776 LEU A CA 6  
ATOM 10817  C CA . LEU A 1 1777 ? 144.982 134.160 160.367 1.00 0.00 ? 1777 LEU A CA 6  
ATOM 10818  C CA . GLY A 1 1778 ? 148.785 134.021 160.632 1.00 0.00 ? 1778 GLY A CA 6  
ATOM 10819  C CA . GLN A 1 1779 ? 148.553 134.232 164.446 1.00 0.00 ? 1779 GLN A CA 6  
ATOM 10820  C CA . VAL A 1 1780 ? 146.765 130.807 164.540 1.00 0.00 ? 1780 VAL A CA 6  
ATOM 10821  C CA . VAL A 1 1781 ? 150.069 129.238 163.379 1.00 0.00 ? 1781 VAL A CA 6  
ATOM 10822  C CA . ASP A 1 1782 ? 152.981 129.170 165.885 1.00 0.00 ? 1782 ASP A CA 6  
ATOM 10823  C CA . HIS A 1 1783 ? 156.472 130.248 164.616 1.00 0.00 ? 1783 HIS A CA 6  
ATOM 10824  C CA . ILE A 1 1784 ? 155.254 131.591 161.205 1.00 0.00 ? 1784 ILE A CA 6  
ATOM 10825  C CA . ASP A 1 1785 ? 157.734 134.105 159.695 1.00 0.00 ? 1785 ASP A CA 6  
ATOM 10826  C CA . SER A 1 1786 ? 156.330 136.745 157.302 1.00 0.00 ? 1786 SER A CA 6  
ATOM 10827  C CA . LEU A 1 1787 ? 158.523 139.287 155.494 1.00 0.00 ? 1787 LEU A CA 6  
ATOM 10828  C CA . MET A 1 1788 ? 156.681 142.153 153.825 1.00 0.00 ? 1788 MET A CA 6  
ATOM 10829  C CA . GLU A 1 1789 ? 157.807 143.634 150.502 1.00 0.00 ? 1789 GLU A CA 6  
ATOM 10830  C CA . GLU A 1 1790 ? 156.977 146.486 148.181 1.00 0.00 ? 1790 GLU A CA 6  
ATOM 10831  C CA . TRP A 1 1791 ? 157.730 146.563 144.469 1.00 0.00 ? 1791 TRP A CA 6  
ATOM 10832  C CA . PHE A 1 1792 ? 159.982 149.355 143.214 1.00 0.00 ? 1792 PHE A CA 6  
ATOM 10833  C CA . PRO A 1 1793 ? 158.182 152.135 141.109 1.00 0.00 ? 1793 PRO A CA 6  
ATOM 10834  C CA . GLY A 1 1794 ? 158.705 151.334 137.422 1.00 0.00 ? 1794 GLY A CA 6  
ATOM 10835  C CA . LEU A 1 1795 ? 160.199 147.910 138.230 1.00 0.00 ? 1795 LEU A CA 6  
ATOM 10836  C CA . LEU A 1 1796 ? 157.436 145.452 139.244 1.00 0.00 ? 1796 LEU A CA 6  
ATOM 10837  C CA . GLU A 1 1797 ? 159.780 142.465 139.872 1.00 0.00 ? 1797 GLU A CA 6  
ATOM 10838  C CA . ILE A 1 1798 ? 162.346 144.386 142.008 1.00 0.00 ? 1798 ILE A CA 6  
ATOM 10839  C CA . ASP A 1 1799 ? 161.269 144.295 145.654 1.00 0.00 ? 1799 ASP A CA 6  
ATOM 10840  C CA . ILE A 1 1800 ? 162.343 146.252 148.737 1.00 0.00 ? 1800 ILE A CA 6  
ATOM 10841  C CA . CYS A 1 1801 ? 161.621 145.019 152.262 1.00 0.00 ? 1801 CYS A CA 6  
ATOM 10842  C CA . GLY A 1 1802 ? 159.169 147.275 154.217 1.00 0.00 ? 1802 GLY A CA 6  
ATOM 10843  C CA . GLU A 1 1803 ? 161.330 146.769 157.319 1.00 0.00 ? 1803 GLU A CA 6  
ATOM 10844  C CA . GLY A 1 1804 ? 164.232 148.197 155.241 1.00 0.00 ? 1804 GLY A CA 6  
ATOM 10845  C CA . GLU A 1 1805 ? 162.356 151.429 154.415 1.00 0.00 ? 1805 GLU A CA 6  
ATOM 10846  C CA . THR A 1 1806 ? 161.127 151.927 158.032 1.00 0.00 ? 1806 THR A CA 6  
ATOM 10847  C CA . LEU A 1 1807 ? 164.736 151.425 159.218 1.00 0.00 ? 1807 LEU A CA 6  
ATOM 10848  C CA . LEU A 1 1808 ? 165.956 153.974 156.643 1.00 0.00 ? 1808 LEU A CA 6  
ATOM 10849  C CA . LYS A 1 1809 ? 163.373 156.493 158.032 1.00 0.00 ? 1809 LYS A CA 6  
ATOM 10850  C CA . LYS A 1 1810 ? 164.502 155.857 161.643 1.00 0.00 ? 1810 LYS A CA 6  
ATOM 10851  C CA . TRP A 1 1811 ? 168.086 156.460 160.445 1.00 0.00 ? 1811 TRP A CA 6  
ATOM 10852  C CA . ALA A 1 1812 ? 166.909 159.808 158.982 1.00 0.00 ? 1812 ALA A CA 6  
ATOM 10853  C CA . LEU A 1 1813 ? 167.589 158.799 155.355 1.00 0.00 ? 1813 LEU A CA 6  
ATOM 10854  C CA . TYR A 1 1814 ? 165.195 159.512 152.491 1.00 0.00 ? 1814 TYR A CA 6  
ATOM 10855  C CA . SER A 1 1815 ? 167.166 157.762 149.727 1.00 0.00 ? 1815 SER A CA 6  
ATOM 10856  C CA . PHE A 1 1816 ? 166.861 154.101 148.973 1.00 0.00 ? 1816 PHE A CA 6  
ATOM 10857  C CA . ASN A 1 1817 ? 169.596 153.371 146.409 1.00 0.00 ? 1817 ASN A CA 6  
ATOM 10858  C CA . ASP A 1 1818 ? 169.202 150.484 143.997 1.00 0.00 ? 1818 ASP A CA 6  
ATOM 10859  C CA . GLY A 1 1819 ? 172.771 149.524 142.998 1.00 0.00 ? 1819 GLY A CA 6  
ATOM 10860  C CA . GLU A 1 1820 ? 171.887 146.885 140.370 1.00 0.00 ? 1820 GLU A CA 6  
ATOM 10861  C CA . GLU A 1 1821 ? 169.342 149.186 138.658 1.00 0.00 ? 1821 GLU A CA 6  
ATOM 10862  C CA . HIS A 1 1822 ? 171.479 152.330 139.260 1.00 0.00 ? 1822 HIS A CA 6  
ATOM 10863  C CA . GLN A 1 1823 ? 168.385 154.364 140.278 1.00 0.00 ? 1823 GLN A CA 6  
ATOM 10864  C CA . LYS A 1 1824 ? 167.528 156.057 143.606 1.00 0.00 ? 1824 LYS A CA 6  
ATOM 10865  C CA . ILE A 1 1825 ? 164.053 156.268 145.114 1.00 0.00 ? 1825 ILE A CA 6  
ATOM 10866  C CA . LEU A 1 1826 ? 162.322 158.354 147.717 1.00 0.00 ? 1826 LEU A CA 6  
ATOM 10867  C CA . LEU A 1 1827 ? 161.780 156.258 150.827 1.00 0.00 ? 1827 LEU A CA 6  
ATOM 10868  C CA . ASP A 1 1828 ? 158.976 158.444 152.158 1.00 0.00 ? 1828 ASP A CA 6  
ATOM 10869  C CA . ASP A 1 1829 ? 157.118 158.631 148.809 1.00 0.00 ? 1829 ASP A CA 6  
ATOM 10870  C CA . LEU A 1 1830 ? 156.884 154.819 148.422 1.00 0.00 ? 1830 LEU A CA 6  
ATOM 10871  C CA . MET A 1 1831 ? 156.236 154.330 152.180 1.00 0.00 ? 1831 MET A CA 6  
ATOM 10872  C CA . LYS A 1 1832 ? 153.378 156.908 152.421 1.00 0.00 ? 1832 LYS A CA 6  
ATOM 10873  C CA . LYS A 1 1833 ? 151.535 155.436 149.386 1.00 0.00 ? 1833 LYS A CA 6  
ATOM 10874  C CA . ALA A 1 1834 ? 150.150 152.802 151.750 1.00 0.00 ? 1834 ALA A CA 6  
ATOM 10875  C CA . GLU A 1 1835 ? 148.553 153.060 155.258 1.00 0.00 ? 1835 GLU A CA 6  
ATOM 10876  C CA . GLU A 1 1836 ? 151.934 153.208 157.011 1.00 0.00 ? 1836 GLU A CA 6  
ATOM 10877  C CA . GLY A 1 1837 ? 152.111 157.029 157.006 1.00 0.00 ? 1837 GLY A CA 6  
ATOM 10878  C CA . PHE A 1 1883 ? 172.770 142.243 183.498 1.00 0.00 ? 1883 PHE A CA 6  
ATOM 10879  C CA . LEU A 1 1884 ? 168.920 141.992 183.398 1.00 0.00 ? 1884 LEU A CA 6  
ATOM 10880  C CA . LEU A 1 1885 ? 166.700 145.073 184.154 1.00 0.00 ? 1885 LEU A CA 6  
ATOM 10881  C CA . GLY A 1 1886 ? 163.493 143.924 182.409 1.00 0.00 ? 1886 GLY A CA 6  
ATOM 10882  C CA . ASP A 1 1887 ? 160.123 145.542 183.059 1.00 0.00 ? 1887 ASP A CA 6  
ATOM 10883  C CA . GLY A 1 1888 ? 159.171 144.848 179.365 1.00 0.00 ? 1888 GLY A CA 6  
ATOM 10884  C CA . SER A 1 1889 ? 155.836 144.728 177.482 1.00 0.00 ? 1889 SER A CA 6  
ATOM 10885  C CA . PHE A 1 1890 ? 156.669 141.664 175.360 1.00 0.00 ? 1890 PHE A CA 6  
ATOM 10886  C CA . GLY A 1 1891 ? 159.905 140.383 176.909 1.00 0.00 ? 1891 GLY A CA 6  
ATOM 10887  C CA . SER A 1 1892 ? 163.014 140.973 178.995 1.00 0.00 ? 1892 SER A CA 6  
ATOM 10888  C CA . VAL A 1 1893 ? 165.238 144.094 178.911 1.00 0.00 ? 1893 VAL A CA 6  
ATOM 10889  C CA . TYR A 1 1894 ? 169.019 143.660 179.379 1.00 0.00 ? 1894 TYR A CA 6  
ATOM 10890  C CA . ARG A 1 1895 ? 171.920 146.052 179.892 1.00 0.00 ? 1895 ARG A CA 6  
ATOM 10891  C CA . ALA A 1 1896 ? 175.028 145.289 177.840 1.00 0.00 ? 1896 ALA A CA 6  
ATOM 10892  C CA . ALA A 1 1897 ? 177.616 146.904 175.545 1.00 0.00 ? 1897 ALA A CA 6  
ATOM 10893  C CA . TYR A 1 1898 ? 178.555 146.863 171.819 1.00 0.00 ? 1898 TYR A CA 6  
ATOM 10894  C CA . GLU A 1 1899 ? 181.988 145.131 171.601 1.00 0.00 ? 1899 GLU A CA 6  
ATOM 10895  C CA . GLY A 1 1900 ? 183.375 147.546 168.935 1.00 0.00 ? 1900 GLY A CA 6  
ATOM 10896  C CA . GLU A 1 1901 ? 182.578 150.907 170.639 1.00 0.00 ? 1901 GLU A CA 6  
ATOM 10897  C CA . GLU A 1 1902 ? 182.097 150.084 174.361 1.00 0.00 ? 1902 GLU A CA 6  
ATOM 10898  C CA . VAL A 1 1903 ? 178.758 152.030 173.887 1.00 0.00 ? 1903 VAL A CA 6  
ATOM 10899  C CA . ALA A 1 1904 ? 176.329 151.058 176.641 1.00 0.00 ? 1904 ALA A CA 6  
ATOM 10900  C CA . VAL A 1 1905 ? 173.270 149.423 175.249 1.00 0.00 ? 1905 VAL A CA 6  
ATOM 10901  C CA . LYS A 1 1906 ? 169.743 148.320 176.195 1.00 0.00 ? 1906 LYS A CA 6  
ATOM 10902  C CA . ILE A 1 1907 ? 168.473 145.041 174.647 1.00 0.00 ? 1907 ILE A CA 6  
ATOM 10903  C CA . PHE A 1 1908 ? 164.762 144.227 174.452 1.00 0.00 ? 1908 PHE A CA 6  
ATOM 10904  C CA . ASN A 1 1909 ? 163.965 140.590 173.518 1.00 0.00 ? 1909 ASN A CA 6  
ATOM 10905  C CA . LYS A 1 1910 ? 161.349 137.810 173.009 1.00 0.00 ? 1910 LYS A CA 6  
ATOM 10906  C CA . HIS A 1 1911 ? 159.327 140.053 170.869 1.00 0.00 ? 1911 HIS A CA 6  
ATOM 10907  C CA . THR A 1 1912 ? 159.956 138.363 167.483 1.00 0.00 ? 1912 THR A CA 6  
ATOM 10908  C CA . SER A 1 1913 ? 156.490 137.304 166.407 1.00 0.00 ? 1913 SER A CA 6  
ATOM 10909  C CA . LEU A 1 1914 ? 154.583 140.305 167.734 1.00 0.00 ? 1914 LEU A CA 6  
ATOM 10910  C CA . ARG A 1 1915 ? 152.824 142.977 165.695 1.00 0.00 ? 1915 ARG A CA 6  
ATOM 10911  C CA . LEU A 1 1916 ? 153.813 145.621 168.323 1.00 0.00 ? 1916 LEU A CA 6  
ATOM 10912  C CA . LEU A 1 1917 ? 157.608 144.823 168.011 1.00 0.00 ? 1917 LEU A CA 6  
ATOM 10913  C CA . ARG A 1 1918 ? 157.353 144.956 164.280 1.00 0.00 ? 1918 ARG A CA 6  
ATOM 10914  C CA . GLN A 1 1919 ? 155.756 148.384 164.415 1.00 0.00 ? 1919 GLN A CA 6  
ATOM 10915  C CA . GLU A 1 1920 ? 158.370 149.571 166.950 1.00 0.00 ? 1920 GLU A CA 6  
ATOM 10916  C CA . LEU A 1 1921 ? 161.246 148.382 164.681 1.00 0.00 ? 1921 LEU A CA 6  
ATOM 10917  C CA . VAL A 1 1922 ? 159.617 149.935 161.552 1.00 0.00 ? 1922 VAL A CA 6  
ATOM 10918  C CA . VAL A 1 1923 ? 158.961 153.324 163.280 1.00 0.00 ? 1923 VAL A CA 6  
ATOM 10919  C CA . LEU A 1 1924 ? 162.437 153.526 164.904 1.00 0.00 ? 1924 LEU A CA 6  
ATOM 10920  C CA . CYS A 1 1925 ? 164.338 152.590 161.676 1.00 0.00 ? 1925 CYS A CA 6  
ATOM 10921  C CA . HIS A 1 1926 ? 163.764 156.056 160.113 1.00 0.00 ? 1926 HIS A CA 6  
ATOM 10922  C CA . LEU A 1 1927 ? 164.194 158.151 163.317 1.00 0.00 ? 1927 LEU A CA 6  
ATOM 10923  C CA . HIS A 1 1928 ? 167.600 159.743 164.005 1.00 0.00 ? 1928 HIS A CA 6  
ATOM 10924  C CA . HIS A 1 1929 ? 167.405 162.728 166.400 1.00 0.00 ? 1929 HIS A CA 6  
ATOM 10925  C CA . PRO A 1 1930 ? 169.256 163.499 169.694 1.00 0.00 ? 1930 PRO A CA 6  
ATOM 10926  C CA . SER A 1 1931 ? 166.074 163.725 171.802 1.00 0.00 ? 1931 SER A CA 6  
ATOM 10927  C CA . LEU A 1 1932 ? 164.689 160.378 170.570 1.00 0.00 ? 1932 LEU A CA 6  
ATOM 10928  C CA . ILE A 1 1933 ? 165.964 157.001 171.854 1.00 0.00 ? 1933 ILE A CA 6  
ATOM 10929  C CA . SER A 1 1934 ? 168.154 155.660 169.035 1.00 0.00 ? 1934 SER A CA 6  
ATOM 10930  C CA . LEU A 1 1935 ? 167.829 152.161 167.624 1.00 0.00 ? 1935 LEU A CA 6  
ATOM 10931  C CA . LEU A 1 1936 ? 171.320 150.750 167.004 1.00 0.00 ? 1936 LEU A CA 6  
ATOM 10932  C CA . ALA A 1 1937 ? 170.548 147.358 165.473 1.00 0.00 ? 1937 ALA A CA 6  
ATOM 10933  C CA . ALA A 1 1938 ? 168.394 144.224 165.363 1.00 0.00 ? 1938 ALA A CA 6  
ATOM 10934  C CA . GLY A 1 1939 ? 169.323 140.721 166.630 1.00 0.00 ? 1939 GLY A CA 6  
ATOM 10935  C CA . ILE A 1 1940 ? 167.780 137.296 165.874 1.00 0.00 ? 1940 ILE A CA 6  
ATOM 10936  C CA . ARG A 1 1941 ? 167.250 134.054 167.870 1.00 0.00 ? 1941 ARG A CA 6  
ATOM 10937  C CA . PRO A 1 1942 ? 165.440 135.521 169.773 1.00 0.00 ? 1942 PRO A CA 6  
ATOM 10938  C CA . ARG A 1 1943 ? 164.579 138.782 167.984 1.00 0.00 ? 1943 ARG A CA 6  
ATOM 10939  C CA . MET A 1 1944 ? 166.155 141.760 169.787 1.00 0.00 ? 1944 MET A CA 6  
ATOM 10940  C CA . LEU A 1 1945 ? 166.006 145.520 169.459 1.00 0.00 ? 1945 LEU A CA 6  
ATOM 10941  C CA . VAL A 1 1946 ? 169.317 146.982 170.561 1.00 0.00 ? 1946 VAL A CA 6  
ATOM 10942  C CA . MET A 1 1947 ? 168.725 150.570 171.774 1.00 0.00 ? 1947 MET A CA 6  
ATOM 10943  C CA . GLU A 1 1948 ? 171.000 153.266 173.283 1.00 0.00 ? 1948 GLU A CA 6  
ATOM 10944  C CA . LEU A 1 1949 ? 171.150 153.009 177.098 1.00 0.00 ? 1949 LEU A CA 6  
ATOM 10945  C CA . ALA A 1 1950 ? 169.719 156.093 178.821 1.00 0.00 ? 1950 ALA A CA 6  
ATOM 10946  C CA . SER A 1 1951 ? 171.329 156.227 182.249 1.00 0.00 ? 1951 SER A CA 6  
ATOM 10947  C CA . LYS A 1 1952 ? 169.254 158.344 184.679 1.00 0.00 ? 1952 LYS A CA 6  
ATOM 10948  C CA . GLY A 1 1953 ? 165.915 156.492 184.505 1.00 0.00 ? 1953 GLY A CA 6  
ATOM 10949  C CA . SER A 1 1954 ? 162.572 158.003 183.486 1.00 0.00 ? 1954 SER A CA 6  
ATOM 10950  C CA . LEU A 1 1955 ? 160.825 161.337 184.134 1.00 0.00 ? 1955 LEU A CA 6  
ATOM 10951  C CA . ASP A 1 1956 ? 157.887 159.750 186.040 1.00 0.00 ? 1956 ASP A CA 6  
ATOM 10952  C CA . ARG A 1 1957 ? 160.093 158.087 188.711 1.00 0.00 ? 1957 ARG A CA 6  
ATOM 10953  C CA . LEU A 1 1958 ? 162.288 161.179 189.105 1.00 0.00 ? 1958 LEU A CA 6  
ATOM 10954  C CA . LEU A 1 1959 ? 159.265 163.479 189.649 1.00 0.00 ? 1959 LEU A CA 6  
ATOM 10955  C CA . GLN A 1 1960 ? 158.144 161.159 192.515 1.00 0.00 ? 1960 GLN A CA 6  
ATOM 10956  C CA . GLN A 1 1961 ? 161.200 162.429 194.512 1.00 0.00 ? 1961 GLN A CA 6  
ATOM 10957  C CA . ASP A 1 1962 ? 159.410 165.439 196.174 1.00 0.00 ? 1962 ASP A CA 6  
ATOM 10958  C CA . LYS A 1 1963 ? 162.327 166.032 198.628 1.00 0.00 ? 1963 LYS A CA 6  
ATOM 10959  C CA . ALA A 1 1964 ? 164.703 166.784 195.721 1.00 0.00 ? 1964 ALA A CA 6  
ATOM 10960  C CA . SER A 1 1965 ? 162.762 169.075 193.372 1.00 0.00 ? 1965 SER A CA 6  
ATOM 10961  C CA . LEU A 1 1966 ? 164.125 169.647 189.856 1.00 0.00 ? 1966 LEU A CA 6  
ATOM 10962  C CA . THR A 1 1967 ? 165.578 173.155 189.571 1.00 0.00 ? 1967 THR A CA 6  
ATOM 10963  C CA . ARG A 1 1968 ? 163.799 175.544 187.193 1.00 0.00 ? 1968 ARG A CA 6  
ATOM 10964  C CA . THR A 1 1969 ? 166.657 175.833 184.619 1.00 0.00 ? 1969 THR A CA 6  
ATOM 10965  C CA . LEU A 1 1970 ? 166.678 172.055 184.301 1.00 0.00 ? 1970 LEU A CA 6  
ATOM 10966  C CA . GLN A 1 1971 ? 162.830 171.881 184.035 1.00 0.00 ? 1971 GLN A CA 6  
ATOM 10967  C CA . HIS A 1 1972 ? 163.127 174.262 181.037 1.00 0.00 ? 1972 HIS A CA 6  
ATOM 10968  C CA . ARG A 1 1973 ? 165.833 172.024 179.481 1.00 0.00 ? 1973 ARG A CA 6  
ATOM 10969  C CA . ILE A 1 1974 ? 163.514 168.961 179.890 1.00 0.00 ? 1974 ILE A CA 6  
ATOM 10970  C CA . ALA A 1 1975 ? 160.544 170.842 178.335 1.00 0.00 ? 1975 ALA A CA 6  
ATOM 10971  C CA . LEU A 1 1976 ? 162.580 171.968 175.276 1.00 0.00 ? 1976 LEU A CA 6  
ATOM 10972  C CA . HIS A 1 1977 ? 164.225 168.536 174.693 1.00 0.00 ? 1977 HIS A CA 6  
ATOM 10973  C CA . VAL A 1 1978 ? 160.873 166.741 174.617 1.00 0.00 ? 1978 VAL A CA 6  
ATOM 10974  C CA . ALA A 1 1979 ? 159.514 169.546 172.372 1.00 0.00 ? 1979 ALA A CA 6  
ATOM 10975  C CA . ASP A 1 1980 ? 162.412 169.146 169.863 1.00 0.00 ? 1980 ASP A CA 6  
ATOM 10976  C CA . GLY A 1 1981 ? 161.895 165.345 169.717 1.00 0.00 ? 1981 GLY A CA 6  
ATOM 10977  C CA . LEU A 1 1982 ? 158.169 165.859 169.037 1.00 0.00 ? 1982 LEU A CA 6  
ATOM 10978  C CA . ARG A 1 1983 ? 159.090 168.652 166.542 1.00 0.00 ? 1983 ARG A CA 6  
ATOM 10979  C CA . TYR A 1 1984 ? 161.409 166.239 164.660 1.00 0.00 ? 1984 TYR A CA 6  
ATOM 10980  C CA . LEU A 1 1985 ? 158.464 163.843 164.810 1.00 0.00 ? 1985 LEU A CA 6  
ATOM 10981  C CA . HIS A 1 1986 ? 156.168 166.483 163.297 1.00 0.00 ? 1986 HIS A CA 6  
ATOM 10982  C CA . SER A 1 1987 ? 158.571 166.626 160.282 1.00 0.00 ? 1987 SER A CA 6  
ATOM 10983  C CA . ALA A 1 1988 ? 158.314 162.852 159.701 1.00 0.00 ? 1988 ALA A CA 6  
ATOM 10984  C CA . MET A 1 1989 ? 154.454 162.773 160.170 1.00 0.00 ? 1989 MET A CA 6  
ATOM 10985  C CA . ILE A 1 1990 ? 154.525 160.115 162.935 1.00 0.00 ? 1990 ILE A CA 6  
ATOM 10986  C CA . ILE A 1 1991 ? 152.000 159.883 165.845 1.00 0.00 ? 1991 ILE A CA 6  
ATOM 10987  C CA . TYR A 1 1992 ? 153.432 158.420 169.093 1.00 0.00 ? 1992 TYR A CA 6  
ATOM 10988  C CA . ARG A 1 1993 ? 150.149 157.915 171.062 1.00 0.00 ? 1993 ARG A CA 6  
ATOM 10989  C CA . ASP A 1 1994 ? 151.765 156.895 174.394 1.00 0.00 ? 1994 ASP A CA 6  
ATOM 10990  C CA . LEU A 1 1995 ? 153.378 160.202 175.428 1.00 0.00 ? 1995 LEU A CA 6  
ATOM 10991  C CA . LYS A 1 1996 ? 153.438 160.164 179.248 1.00 0.00 ? 1996 LYS A CA 6  
ATOM 10992  C CA . PRO A 1 1997 ? 156.337 160.734 181.715 1.00 0.00 ? 1997 PRO A CA 6  
ATOM 10993  C CA . HIS A 1 1998 ? 157.215 157.011 182.060 1.00 0.00 ? 1998 HIS A CA 6  
ATOM 10994  C CA . ASN A 1 1999 ? 158.159 157.081 178.350 1.00 0.00 ? 1999 ASN A CA 6  
ATOM 10995  C CA . VAL A 1 2000 ? 160.450 160.117 178.751 1.00 0.00 ? 2000 VAL A CA 6  
ATOM 10996  C CA . LEU A 1 2001 ? 163.955 158.787 179.462 1.00 0.00 ? 2001 LEU A CA 6  
ATOM 10997  C CA . LEU A 1 2002 ? 166.523 160.924 181.183 1.00 0.00 ? 2002 LEU A CA 6  
ATOM 10998  C CA . PHE A 1 2003 ? 170.043 161.080 179.794 1.00 0.00 ? 2003 PHE A CA 6  
ATOM 10999  C CA . THR A 1 2004 ? 171.412 163.756 182.123 1.00 0.00 ? 2004 THR A CA 6  
ATOM 11000  C CA . LEU A 1 2005 ? 170.025 166.226 184.766 1.00 0.00 ? 2005 LEU A CA 6  
ATOM 11001  C CA . TYR A 1 2006 ? 172.950 168.718 184.606 1.00 0.00 ? 2006 TYR A CA 6  
ATOM 11002  C CA . PRO A 1 2007 ? 171.516 171.886 182.928 1.00 0.00 ? 2007 PRO A CA 6  
ATOM 11003  C CA . ASN A 1 2008 ? 174.557 172.330 180.599 1.00 0.00 ? 2008 ASN A CA 6  
ATOM 11004  C CA . ALA A 1 2009 ? 174.399 168.738 179.244 1.00 0.00 ? 2009 ALA A CA 6  
ATOM 11005  C CA . ALA A 1 2010 ? 174.144 168.175 175.478 1.00 0.00 ? 2010 ALA A CA 6  
ATOM 11006  C CA . ILE A 1 2011 ? 171.011 166.038 175.995 1.00 0.00 ? 2011 ILE A CA 6  
ATOM 11007  C CA . ILE A 1 2012 ? 168.757 165.844 179.104 1.00 0.00 ? 2012 ILE A CA 6  
ATOM 11008  C CA . ALA A 1 2013 ? 165.668 164.013 177.915 1.00 0.00 ? 2013 ALA A CA 6  
ATOM 11009  C CA . LYS A 1 2014 ? 164.775 161.592 175.161 1.00 0.00 ? 2014 LYS A CA 6  
ATOM 11010  C CA . ILE A 1 2015 ? 161.374 160.302 173.995 1.00 0.00 ? 2015 ILE A CA 6  
ATOM 11011  C CA . ALA A 1 2016 ? 161.064 156.478 174.137 1.00 0.00 ? 2016 ALA A CA 6  
ATOM 11012  C CA . ASP A 1 2017 ? 158.659 153.531 173.748 1.00 0.00 ? 2017 ASP A CA 6  
ATOM 11013  C CA . TYR A 1 2018 ? 157.143 153.875 170.294 1.00 0.00 ? 2018 TYR A CA 6  
ATOM 11014  C CA . GLY A 1 2019 ? 155.367 150.497 170.331 1.00 0.00 ? 2019 GLY A CA 6  
ATOM 11015  C CA . THR A 1 2020 ? 151.950 151.980 169.651 1.00 0.00 ? 2020 THR A CA 6  
ATOM 11016  C CA . ALA A 1 2021 ? 153.038 154.627 167.067 1.00 0.00 ? 2021 ALA A CA 6  
ATOM 11017  C CA . GLN A 1 2022 ? 151.453 155.379 163.637 1.00 0.00 ? 2022 GLN A CA 6  
ATOM 11018  C CA . TYR A 1 2023 ? 152.879 156.861 160.451 1.00 0.00 ? 2023 TYR A CA 6  
ATOM 11019  C CA . CYS A 1 2024 ? 150.174 156.951 157.800 1.00 0.00 ? 2024 CYS A CA 6  
ATOM 11020  C CA . CYS A 1 2025 ? 149.084 159.096 154.824 1.00 0.00 ? 2025 CYS A CA 6  
ATOM 11021  C CA . ARG A 1 2026 ? 145.486 158.290 155.809 1.00 0.00 ? 2026 ARG A CA 6  
ATOM 11022  C CA . MET A 1 2027 ? 143.491 159.223 158.899 1.00 0.00 ? 2027 MET A CA 6  
ATOM 11023  C CA . GLY A 1 2028 ? 144.624 157.569 162.183 1.00 0.00 ? 2028 GLY A CA 6  
ATOM 11024  C CA . ILE A 1 2029 ? 142.210 155.960 164.692 1.00 0.00 ? 2029 ILE A CA 6  
ATOM 11025  C CA . LYS A 1 2030 ? 142.435 154.148 168.122 1.00 0.00 ? 2030 LYS A CA 6  
ATOM 11026  C CA . THR A 1 2031 ? 140.429 152.962 171.273 1.00 0.00 ? 2031 THR A CA 6  
ATOM 11027  C CA . SER A 1 2032 ? 143.022 151.037 173.185 1.00 0.00 ? 2032 SER A CA 6  
ATOM 11028  C CA . GLU A 1 2033 ? 145.358 153.712 174.567 1.00 0.00 ? 2033 GLU A CA 6  
ATOM 11029  C CA . GLY A 1 2034 ? 142.977 153.680 177.543 1.00 0.00 ? 2034 GLY A CA 6  
ATOM 11030  C CA . THR A 1 2035 ? 145.138 155.856 179.913 1.00 0.00 ? 2035 THR A CA 6  
ATOM 11031  C CA . PRO A 1 2036 ? 143.043 159.007 179.409 1.00 0.00 ? 2036 PRO A CA 6  
ATOM 11032  C CA . GLY A 1 2037 ? 144.723 161.340 181.965 1.00 0.00 ? 2037 GLY A CA 6  
ATOM 11033  C CA . PHE A 1 2038 ? 147.456 161.844 179.337 1.00 0.00 ? 2038 PHE A CA 6  
ATOM 11034  C CA . ARG A 1 2039 ? 145.412 161.297 176.130 1.00 0.00 ? 2039 ARG A CA 6  
ATOM 11035  C CA . ALA A 1 2040 ? 143.513 163.686 173.860 1.00 0.00 ? 2040 ALA A CA 6  
ATOM 11036  C CA . PRO A 1 2041 ? 139.635 163.848 174.098 1.00 0.00 ? 2041 PRO A CA 6  
ATOM 11037  C CA . GLU A 1 2042 ? 139.176 161.669 170.956 1.00 0.00 ? 2042 GLU A CA 6  
ATOM 11038  C CA . VAL A 1 2043 ? 139.503 158.742 173.488 1.00 0.00 ? 2043 VAL A CA 6  
ATOM 11039  C CA . ALA A 1 2044 ? 135.716 158.571 173.406 1.00 0.00 ? 2044 ALA A CA 6  
ATOM 11040  C CA . ARG A 1 2045 ? 135.604 155.456 171.061 1.00 0.00 ? 2045 ARG A CA 6  
ATOM 11041  C CA . GLY A 1 2046 ? 137.101 153.718 167.873 1.00 0.00 ? 2046 GLY A CA 6  
ATOM 11042  C CA . ASN A 1 2047 ? 134.775 155.433 165.496 1.00 0.00 ? 2047 ASN A CA 6  
ATOM 11043  C CA . VAL A 1 2048 ? 136.655 158.802 165.479 1.00 0.00 ? 2048 VAL A CA 6  
ATOM 11044  C CA . ILE A 1 2049 ? 139.758 159.861 163.564 1.00 0.00 ? 2049 ILE A CA 6  
ATOM 11045  C CA . TYR A 1 2050 ? 142.656 161.996 164.711 1.00 0.00 ? 2050 TYR A CA 6  
ATOM 11046  C CA . ASN A 1 2051 ? 146.202 163.207 163.866 1.00 0.00 ? 2051 ASN A CA 6  
ATOM 11047  C CA . GLN A 1 2052 ? 149.596 164.218 165.444 1.00 0.00 ? 2052 GLN A CA 6  
ATOM 11048  C CA . GLN A 1 2053 ? 147.590 166.866 167.301 1.00 0.00 ? 2053 GLN A CA 6  
ATOM 11049  C CA . ALA A 1 2054 ? 146.756 164.041 169.761 1.00 0.00 ? 2054 ALA A CA 6  
ATOM 11050  C CA . ASP A 1 2055 ? 150.483 163.915 170.759 1.00 0.00 ? 2055 ASP A CA 6  
ATOM 11051  C CA . VAL A 1 2056 ? 150.453 167.757 171.070 1.00 0.00 ? 2056 VAL A CA 6  
ATOM 11052  C CA . TYR A 1 2057 ? 147.767 167.281 173.773 1.00 0.00 ? 2057 TYR A CA 6  
ATOM 11053  C CA . SER A 1 2058 ? 149.887 164.549 175.486 1.00 0.00 ? 2058 SER A CA 6  
ATOM 11054  C CA . PHE A 1 2059 ? 152.829 167.032 175.425 1.00 0.00 ? 2059 PHE A CA 6  
ATOM 11055  C CA . GLY A 1 2060 ? 150.748 169.686 177.326 1.00 0.00 ? 2060 GLY A CA 6  
ATOM 11056  C CA . LEU A 1 2061 ? 150.257 167.114 180.090 1.00 0.00 ? 2061 LEU A CA 6  
ATOM 11057  C CA . LEU A 1 2062 ? 154.057 166.437 180.060 1.00 0.00 ? 2062 LEU A CA 6  
ATOM 11058  C CA . LEU A 1 2063 ? 154.653 170.194 180.532 1.00 0.00 ? 2063 LEU A CA 6  
ATOM 11059  C CA . TYR A 1 2064 ? 152.110 170.265 183.417 1.00 0.00 ? 2064 TYR A CA 6  
ATOM 11060  C CA . ASP A 1 2065 ? 153.771 167.257 185.175 1.00 0.00 ? 2065 ASP A CA 6  
ATOM 11061  C CA . ILE A 1 2066 ? 157.299 168.855 184.802 1.00 0.00 ? 2066 ILE A CA 6  
ATOM 11062  C CA . LEU A 1 2067 ? 156.033 172.287 185.999 1.00 0.00 ? 2067 LEU A CA 6  
ATOM 11063  C CA . THR A 1 2068 ? 154.170 170.936 189.027 1.00 0.00 ? 2068 THR A CA 6  
ATOM 11064  C CA . THR A 1 2069 ? 155.887 167.606 189.944 1.00 0.00 ? 2069 THR A CA 6  
ATOM 11065  C CA . GLY A 1 2070 ? 152.298 166.205 190.107 1.00 0.00 ? 2070 GLY A CA 6  
ATOM 11066  C CA . GLY A 1 2071 ? 150.311 163.734 187.960 1.00 0.00 ? 2071 GLY A CA 6  
ATOM 11067  C CA . ARG A 1 2072 ? 146.906 162.008 187.808 1.00 0.00 ? 2072 ARG A CA 6  
ATOM 11068  C CA . ILE A 1 2073 ? 145.539 158.877 186.015 1.00 0.00 ? 2073 ILE A CA 6  
ATOM 11069  C CA . VAL A 1 2074 ? 141.760 158.590 185.791 1.00 0.00 ? 2074 VAL A CA 6  
ATOM 11070  C CA . GLU A 1 2075 ? 139.471 155.854 184.335 1.00 0.00 ? 2075 GLU A CA 6  
ATOM 11071  C CA . GLY A 1 2076 ? 135.642 155.545 184.009 1.00 0.00 ? 2076 GLY A CA 6  
ATOM 11072  C CA . LEU A 1 2077 ? 132.686 157.302 182.341 1.00 0.00 ? 2077 LEU A CA 6  
ATOM 11073  C CA . LYS A 1 2078 ? 132.118 160.599 184.192 1.00 0.00 ? 2078 LYS A CA 6  
ATOM 11074  C CA . PHE A 1 2079 ? 135.845 161.531 183.914 1.00 0.00 ? 2079 PHE A CA 6  
ATOM 11075  C CA . PRO A 1 2080 ? 136.018 161.047 180.036 1.00 0.00 ? 2080 PRO A CA 6  
ATOM 11076  C CA . ASN A 1 2081 ? 132.699 162.970 179.638 1.00 0.00 ? 2081 ASN A CA 6  
ATOM 11077  C CA . GLU A 1 2082 ? 134.166 165.775 181.772 1.00 0.00 ? 2082 GLU A CA 6  
ATOM 11078  C CA . PHE A 1 2083 ? 137.423 165.838 179.763 1.00 0.00 ? 2083 PHE A CA 6  
ATOM 11079  C CA . ASP A 1 2084 ? 135.674 165.556 176.329 1.00 0.00 ? 2084 ASP A CA 6  
ATOM 11080  C CA . GLU A 1 2085 ? 132.484 167.702 176.780 1.00 0.00 ? 2085 GLU A CA 6  
ATOM 11081  C CA . LEU A 1 2086 ? 133.152 169.996 179.814 1.00 0.00 ? 2086 LEU A CA 6  
ATOM 11082  C CA . GLU A 1 2087 ? 136.761 171.090 178.977 1.00 0.00 ? 2087 GLU A CA 6  
ATOM 11083  C CA . ILE A 1 2088 ? 138.254 169.607 182.226 1.00 0.00 ? 2088 ILE A CA 6  
ATOM 11084  C CA . GLN A 1 2089 ? 142.039 169.817 182.252 1.00 0.00 ? 2089 GLN A CA 6  
ATOM 11085  C CA . GLY A 1 2090 ? 144.716 170.009 184.955 1.00 0.00 ? 2090 GLY A CA 6  
ATOM 11086  C CA . LYS A 1 2091 ? 144.938 173.808 184.592 1.00 0.00 ? 2091 LYS A CA 6  
ATOM 11087  C CA . LEU A 1 2092 ? 141.144 174.440 184.635 1.00 0.00 ? 2092 LEU A CA 6  
ATOM 11088  C CA . PRO A 1 2093 ? 140.327 172.426 187.857 1.00 0.00 ? 2093 PRO A CA 6  
ATOM 11089  C CA . ASP A 1 2094 ? 143.193 174.061 189.792 1.00 0.00 ? 2094 ASP A CA 6  
ATOM 11090  C CA . PRO A 1 2095 ? 143.528 177.845 188.829 1.00 0.00 ? 2095 PRO A CA 6  
ATOM 11091  C CA . VAL A 1 2096 ? 145.053 178.580 192.278 1.00 0.00 ? 2096 VAL A CA 6  
ATOM 11092  C CA . LYS A 1 2097 ? 147.726 175.829 192.016 1.00 0.00 ? 2097 LYS A CA 6  
ATOM 11093  C CA . GLU A 1 2098 ? 149.106 177.232 188.779 1.00 0.00 ? 2098 GLU A CA 6  
ATOM 11094  C CA . TYR A 1 2099 ? 147.873 180.927 188.410 1.00 0.00 ? 2099 TYR A CA 6  
ATOM 11095  C CA . GLY A 1 2100 ? 148.324 181.762 192.173 1.00 0.00 ? 2100 GLY A CA 6  
ATOM 11096  C CA . CYS A 1 2101 ? 152.005 180.712 192.038 1.00 0.00 ? 2101 CYS A CA 6  
ATOM 11097  C CA . ALA A 1 2102 ? 152.441 182.863 188.887 1.00 0.00 ? 2102 ALA A CA 6  
ATOM 11098  C CA . PRO A 1 2103 ? 153.943 180.314 186.340 1.00 0.00 ? 2103 PRO A CA 6  
ATOM 11099  C CA . TRP A 1 2104 ? 155.416 182.303 183.388 1.00 0.00 ? 2104 TRP A CA 6  
ATOM 11100  C CA . PRO A 1 2105 ? 152.462 183.574 181.232 1.00 0.00 ? 2105 PRO A CA 6  
ATOM 11101  C CA . MET A 1 2106 ? 154.092 182.273 178.013 1.00 0.00 ? 2106 MET A CA 6  
ATOM 11102  C CA . VAL A 1 2107 ? 154.357 178.726 179.547 1.00 0.00 ? 2107 VAL A CA 6  
ATOM 11103  C CA . GLU A 1 2108 ? 150.719 179.011 180.666 1.00 0.00 ? 2108 GLU A CA 6  
ATOM 11104  C CA . LYS A 1 2109 ? 149.584 180.072 177.151 1.00 0.00 ? 2109 LYS A CA 6  
ATOM 11105  C CA . LEU A 1 2110 ? 151.483 177.173 175.555 1.00 0.00 ? 2110 LEU A CA 6  
ATOM 11106  C CA . ILE A 1 2111 ? 149.980 174.511 177.920 1.00 0.00 ? 2111 ILE A CA 6  
ATOM 11107  C CA . LYS A 1 2112 ? 146.454 175.938 177.343 1.00 0.00 ? 2112 LYS A CA 6  
ATOM 11108  C CA . GLN A 1 2113 ? 146.826 176.004 173.537 1.00 0.00 ? 2113 GLN A CA 6  
ATOM 11109  C CA . CYS A 1 2114 ? 148.396 172.488 173.480 1.00 0.00 ? 2114 CYS A CA 6  
ATOM 11110  C CA . LEU A 1 2115 ? 145.488 171.050 175.548 1.00 0.00 ? 2115 LEU A CA 6  
ATOM 11111  C CA . LYS A 1 2116 ? 142.714 172.630 173.433 1.00 0.00 ? 2116 LYS A CA 6  
ATOM 11112  C CA . GLU A 1 2117 ? 139.616 170.450 172.923 1.00 0.00 ? 2117 GLU A CA 6  
ATOM 11113  C CA . ASN A 1 2118 ? 139.635 171.424 169.248 1.00 0.00 ? 2118 ASN A CA 6  
ATOM 11114  C CA . PRO A 1 2119 ? 142.757 169.695 167.697 1.00 0.00 ? 2119 PRO A CA 6  
ATOM 11115  C CA . GLN A 1 2120 ? 143.205 172.512 165.124 1.00 0.00 ? 2120 GLN A CA 6  
ATOM 11116  C CA . GLU A 1 2121 ? 143.865 175.161 167.822 1.00 0.00 ? 2121 GLU A CA 6  
ATOM 11117  C CA . ARG A 1 2122 ? 146.794 173.191 169.261 1.00 0.00 ? 2122 ARG A CA 6  
ATOM 11118  C CA . PRO A 1 2123 ? 150.014 174.840 167.920 1.00 0.00 ? 2123 PRO A CA 6  
ATOM 11119  C CA . THR A 1 2124 ? 152.659 173.700 165.427 1.00 0.00 ? 2124 THR A CA 6  
ATOM 11120  C CA . SER A 1 2125 ? 155.839 172.595 167.258 1.00 0.00 ? 2125 SER A CA 6  
ATOM 11121  C CA . ALA A 1 2126 ? 157.873 175.448 165.739 1.00 0.00 ? 2126 ALA A CA 6  
ATOM 11122  C CA . GLN A 1 2127 ? 155.674 177.894 167.751 1.00 0.00 ? 2127 GLN A CA 6  
ATOM 11123  C CA . VAL A 1 2128 ? 156.010 175.616 170.819 1.00 0.00 ? 2128 VAL A CA 6  
ATOM 11124  C CA . PHE A 1 2129 ? 159.843 175.540 170.560 1.00 0.00 ? 2129 PHE A CA 6  
ATOM 11125  C CA . ASP A 1 2130 ? 160.097 179.358 170.037 1.00 0.00 ? 2130 ASP A CA 6  
ATOM 11126  C CA . ILE A 1 2131 ? 157.860 180.021 173.102 1.00 0.00 ? 2131 ILE A CA 6  
ATOM 11127  C CA . LEU A 1 2132 ? 159.745 177.521 175.378 1.00 0.00 ? 2132 LEU A CA 6  
ATOM 11128  C CA . ASN A 1 2133 ? 163.092 179.070 174.321 1.00 0.00 ? 2133 ASN A CA 6  
ATOM 11129  C CA . SER A 1 2134 ? 161.895 182.514 175.615 1.00 0.00 ? 2134 SER A CA 6  
ATOM 11130  C CA . ALA A 1 2135 ? 161.310 181.310 179.244 1.00 0.00 ? 2135 ALA A CA 6  
ATOM 11131  C CA . ARG A 1 2142 ? 149.035 192.376 181.189 1.00 0.00 ? 2142 ARG A CA 6  
ATOM 11132  C CA . ARG A 1 2143 ? 146.733 195.226 180.199 1.00 0.00 ? 2143 ARG A CA 6  
ATOM 11133  C CA . ILE A 1 2144 ? 145.957 198.093 182.586 1.00 0.00 ? 2144 ILE A CA 6  
ATOM 11134  C CA . LEU A 1 2145 ? 142.922 200.154 181.594 1.00 0.00 ? 2145 LEU A CA 6  
ATOM 11135  C CA . LEU A 1 2146 ? 143.107 203.856 182.365 1.00 0.00 ? 2146 LEU A CA 6  
ATOM 11136  C CA . PRO A 1 2147 ? 139.972 205.708 183.514 1.00 0.00 ? 2147 PRO A CA 6  
ATOM 11137  C CA . LYS A 1 2148 ? 137.499 206.312 180.717 1.00 0.00 ? 2148 LYS A CA 6  
ATOM 11138  C CA . ASN A 1 2149 ? 138.292 209.227 178.333 1.00 0.00 ? 2149 ASN A CA 6  
ATOM 11139  C CA . VAL A 1 2150 ? 141.784 209.766 179.799 1.00 0.00 ? 2150 VAL A CA 6  
ATOM 11140  C CA . ILE A 1 2151 ? 144.084 210.681 176.901 1.00 0.00 ? 2151 ILE A CA 6  
ATOM 11141  C CA . VAL A 1 2152 ? 147.837 210.330 177.441 1.00 0.00 ? 2152 VAL A CA 6  
ATOM 11142  C CA . GLU A 1 2153 ? 150.168 212.795 175.727 1.00 0.00 ? 2153 GLU A CA 6  
ATOM 11143  C CA . CYS A 1 2154 ? 153.406 211.654 177.366 1.00 0.00 ? 2154 CYS A CA 6  
ATOM 11144  C CA . MET A 1 2155 ? 154.661 209.042 179.783 1.00 0.00 ? 2155 MET A CA 6  
ATOM 11145  C CA . VAL A 1 2156 ? 157.707 208.299 181.969 1.00 0.00 ? 2156 VAL A CA 6  
ATOM 11146  C CA . ALA A 1 2157 ? 158.358 205.214 184.092 1.00 0.00 ? 2157 ALA A CA 6  
ATOM 11147  C CA . THR A 1 2158 ? 159.814 204.729 187.567 1.00 0.00 ? 2158 THR A CA 6  
ATOM 11148  C CA . ASN A 1 2164 ? 155.425 198.955 193.300 1.00 0.00 ? 2164 ASN A CA 6  
ATOM 11149  C CA . ALA A 1 2165 ? 156.496 200.258 189.911 1.00 0.00 ? 2165 ALA A CA 6  
ATOM 11150  C CA . SER A 1 2166 ? 154.571 203.257 188.644 1.00 0.00 ? 2166 SER A CA 6  
ATOM 11151  C CA . ILE A 1 2167 ? 154.314 205.755 185.807 1.00 0.00 ? 2167 ILE A CA 6  
ATOM 11152  C CA . TRP A 1 2168 ? 153.827 209.510 185.393 1.00 0.00 ? 2168 TRP A CA 6  
ATOM 11153  C CA . LEU A 1 2169 ? 151.398 210.579 182.662 1.00 0.00 ? 2169 LEU A CA 6  
ATOM 11154  C CA . GLY A 1 2170 ? 150.758 213.891 180.938 1.00 0.00 ? 2170 GLY A CA 6  
ATOM 11155  C CA . CYS A 1 2171 ? 147.115 214.290 179.986 1.00 0.00 ? 2171 CYS A CA 6  
ATOM 11156  C CA . GLY A 1 2172 ? 145.728 215.375 176.621 1.00 0.00 ? 2172 GLY A CA 6  
ATOM 11157  C CA . HIS A 1 2173 ? 142.012 215.412 177.405 1.00 0.00 ? 2173 HIS A CA 6  
ATOM 11158  C CA . THR A 1 2174 ? 142.370 218.862 179.005 1.00 0.00 ? 2174 THR A CA 6  
ATOM 11159  C CA . ASP A 1 2175 ? 143.593 222.300 177.964 1.00 0.00 ? 2175 ASP A CA 6  
ATOM 11160  C CA . ARG A 1 2176 ? 145.434 222.841 181.275 1.00 0.00 ? 2176 ARG A CA 6  
ATOM 11161  C CA . GLY A 1 2177 ? 148.368 221.067 182.894 1.00 0.00 ? 2177 GLY A CA 6  
ATOM 11162  C CA . GLN A 1 2178 ? 147.230 217.851 184.585 1.00 0.00 ? 2178 GLN A CA 6  
ATOM 11163  C CA . LEU A 1 2179 ? 149.821 215.408 185.948 1.00 0.00 ? 2179 LEU A CA 6  
ATOM 11164  C CA . SER A 1 2180 ? 148.667 211.824 186.531 1.00 0.00 ? 2180 SER A CA 6  
ATOM 11165  C CA . PHE A 1 2181 ? 150.179 208.898 188.426 1.00 0.00 ? 2181 PHE A CA 6  
ATOM 11166  C CA . LEU A 1 2182 ? 149.610 205.177 187.840 1.00 0.00 ? 2182 LEU A CA 6  
ATOM 11167  C CA . ASP A 1 2183 ? 150.682 202.397 190.216 1.00 0.00 ? 2183 ASP A CA 6  
ATOM 11168  C CA . LEU A 1 2184 ? 151.528 199.539 187.843 1.00 0.00 ? 2184 LEU A CA 6  
ATOM 11169  C CA . ASN A 1 2185 ? 150.933 197.017 190.662 1.00 0.00 ? 2185 ASN A CA 6  
ATOM 11170  C CA . THR A 1 2186 ? 147.573 198.205 192.035 1.00 0.00 ? 2186 THR A CA 6  
ATOM 11171  C CA . GLU A 1 2187 ? 146.400 199.870 188.780 1.00 0.00 ? 2187 GLU A CA 6  
ATOM 11172  C CA . GLY A 1 2188 ? 145.446 202.878 190.909 1.00 0.00 ? 2188 GLY A CA 6  
ATOM 11173  C CA . TYR A 1 2189 ? 145.211 206.221 189.128 1.00 0.00 ? 2189 TYR A CA 6  
ATOM 11174  C CA . THR A 1 2190 ? 145.480 209.719 190.605 1.00 0.00 ? 2190 THR A CA 6  
ATOM 11175  C CA . SER A 1 2191 ? 145.835 213.092 188.901 1.00 0.00 ? 2191 SER A CA 6  
ATOM 11176  C CA . GLU A 1 2192 ? 146.425 216.726 189.830 1.00 0.00 ? 2192 GLU A CA 6  
ATOM 11177  C CA . GLU A 1 2193 ? 146.016 219.941 187.832 1.00 0.00 ? 2193 GLU A CA 6  
ATOM 11178  C CA . VAL A 1 2194 ? 149.509 221.397 188.108 1.00 0.00 ? 2194 VAL A CA 6  
ATOM 11179  C CA . ALA A 1 2195 ? 149.984 223.962 185.302 1.00 0.00 ? 2195 ALA A CA 6  
ATOM 11180  C CA . ASP A 1 2196 ? 148.119 226.413 183.067 1.00 0.00 ? 2196 ASP A CA 6  
ATOM 11181  C CA . SER A 1 2197 ? 148.678 224.671 179.707 1.00 0.00 ? 2197 SER A CA 6  
ATOM 11182  C CA . ARG A 1 2198 ? 148.676 221.077 178.494 1.00 0.00 ? 2198 ARG A CA 6  
ATOM 11183  C CA . ILE A 1 2199 ? 151.622 218.981 179.659 1.00 0.00 ? 2199 ILE A CA 6  
ATOM 11184  C CA . LEU A 1 2200 ? 153.392 217.964 176.449 1.00 0.00 ? 2200 LEU A CA 6  
ATOM 11185  C CA . CYS A 1 2201 ? 156.363 215.963 177.742 1.00 0.00 ? 2201 CYS A CA 6  
ATOM 11186  C CA . LEU A 1 2202 ? 157.815 214.491 180.928 1.00 0.00 ? 2202 LEU A CA 6  
ATOM 11187  C CA . ALA A 1 2203 ? 161.335 213.783 182.161 1.00 0.00 ? 2203 ALA A CA 6  
ATOM 11188  C CA . LEU A 1 2204 ? 162.519 212.297 185.455 1.00 0.00 ? 2204 LEU A CA 6  
ATOM 11189  C CA . VAL A 1 2205 ? 165.685 213.898 186.853 1.00 0.00 ? 2205 VAL A CA 6  
ATOM 11190  C CA . HIS A 1 2206 ? 167.270 211.755 189.571 1.00 0.00 ? 2206 HIS A CA 6  
ATOM 11191  C CA . LEU A 1 2207 ? 169.971 213.150 191.855 1.00 0.00 ? 2207 LEU A CA 6  
ATOM 11192  C CA . PRO A 1 2208 ? 171.856 210.223 193.464 1.00 0.00 ? 2208 PRO A CA 6  
ATOM 11193  C CA . VAL A 1 2209 ? 173.703 212.468 195.838 1.00 0.00 ? 2209 VAL A CA 6  
ATOM 11194  C CA . GLU A 1 2210 ? 171.118 214.554 197.736 1.00 0.00 ? 2210 GLU A CA 6  
ATOM 11195  C CA . LYS A 1 2211 ? 168.808 211.534 197.215 1.00 0.00 ? 2211 LYS A CA 6  
ATOM 11196  C CA . GLU A 1 2212 ? 166.111 213.399 195.328 1.00 0.00 ? 2212 GLU A CA 6  
ATOM 11197  C CA . SER A 1 2213 ? 163.945 212.762 192.268 1.00 0.00 ? 2213 SER A CA 6  
ATOM 11198  C CA . TRP A 1 2214 ? 162.188 215.570 190.393 1.00 0.00 ? 2214 TRP A CA 6  
ATOM 11199  C CA . ILE A 1 2215 ? 159.509 215.157 187.726 1.00 0.00 ? 2215 ILE A CA 6  
ATOM 11200  C CA . VAL A 1 2216 ? 159.794 217.796 184.989 1.00 0.00 ? 2216 VAL A CA 6  
ATOM 11201  C CA . SER A 1 2217 ? 156.743 218.729 182.910 1.00 0.00 ? 2217 SER A CA 6  
ATOM 11202  C CA . GLY A 1 2218 ? 157.092 220.603 179.626 1.00 0.00 ? 2218 GLY A CA 6  
ATOM 11203  C CA . THR A 1 2219 ? 153.948 222.434 178.569 1.00 0.00 ? 2219 THR A CA 6  
ATOM 11204  C CA . GLN A 1 2220 ? 152.215 224.026 175.581 1.00 0.00 ? 2220 GLN A CA 6  
ATOM 11205  C CA . SER A 1 2221 ? 153.092 227.526 176.846 1.00 0.00 ? 2221 SER A CA 6  
ATOM 11206  C CA . GLY A 1 2222 ? 156.830 226.904 177.299 1.00 0.00 ? 2222 GLY A CA 6  
ATOM 11207  C CA . THR A 1 2223 ? 156.759 226.447 181.077 1.00 0.00 ? 2223 THR A CA 6  
ATOM 11208  C CA . LEU A 1 2224 ? 159.078 223.890 182.694 1.00 0.00 ? 2224 LEU A CA 6  
ATOM 11209  C CA . LEU A 1 2225 ? 157.383 222.809 185.930 1.00 0.00 ? 2225 LEU A CA 6  
ATOM 11210  C CA . VAL A 1 2226 ? 159.595 220.861 188.354 1.00 0.00 ? 2226 VAL A CA 6  
ATOM 11211  C CA . ILE A 1 2227 ? 157.852 218.902 191.121 1.00 0.00 ? 2227 ILE A CA 6  
ATOM 11212  C CA . ASN A 1 2228 ? 159.363 216.769 193.884 1.00 0.00 ? 2228 ASN A CA 6  
ATOM 11213  C CA . THR A 1 2229 ? 158.470 213.080 193.830 1.00 0.00 ? 2229 THR A CA 6  
ATOM 11214  C CA . GLU A 1 2230 ? 158.274 212.637 197.608 1.00 0.00 ? 2230 GLU A CA 6  
ATOM 11215  C CA . ASP A 1 2231 ? 156.780 216.009 198.648 1.00 0.00 ? 2231 ASP A CA 6  
ATOM 11216  C CA . GLY A 1 2232 ? 154.437 217.544 196.072 1.00 0.00 ? 2232 GLY A CA 6  
ATOM 11217  C CA . LYS A 1 2233 ? 154.539 220.811 198.028 1.00 0.00 ? 2233 LYS A CA 6  
ATOM 11218  C CA . LYS A 1 2234 ? 158.098 221.214 196.669 1.00 0.00 ? 2234 LYS A CA 6  
ATOM 11219  C CA . ARG A 1 2235 ? 157.637 222.621 193.171 1.00 0.00 ? 2235 ARG A CA 6  
ATOM 11220  C CA . HIS A 1 2236 ? 158.988 225.503 191.111 1.00 0.00 ? 2236 HIS A CA 6  
ATOM 11221  C CA . THR A 1 2237 ? 159.540 226.688 187.542 1.00 0.00 ? 2237 THR A CA 6  
ATOM 11222  C CA . LEU A 1 2238 ? 162.667 226.944 185.392 1.00 0.00 ? 2238 LEU A CA 6  
ATOM 11223  C CA . GLU A 1 2239 ? 163.220 229.605 182.724 1.00 0.00 ? 2239 GLU A CA 6  
ATOM 11224  C CA . LYS A 1 2240 ? 160.224 229.971 180.426 1.00 0.00 ? 2240 LYS A CA 6  
ATOM 11225  C CA . MET A 1 2241 ? 160.747 228.757 176.868 1.00 0.00 ? 2241 MET A CA 6  
ATOM 11226  C CA . THR A 1 2242 ? 159.942 230.987 173.904 1.00 0.00 ? 2242 THR A CA 6  
ATOM 11227  C CA . ASP A 1 2243 ? 157.655 228.279 172.469 1.00 0.00 ? 2243 ASP A CA 6  
ATOM 11228  C CA . SER A 1 2244 ? 155.990 225.081 173.649 1.00 0.00 ? 2244 SER A CA 6  
ATOM 11229  C CA . VAL A 1 2245 ? 158.193 222.344 175.095 1.00 0.00 ? 2245 VAL A CA 6  
ATOM 11230  C CA . THR A 1 2246 ? 158.050 219.408 172.678 1.00 0.00 ? 2246 THR A CA 6  
ATOM 11231  C CA . CYS A 1 2247 ? 160.919 217.246 173.968 1.00 0.00 ? 2247 CYS A CA 6  
ATOM 11232  C CA . LEU A 1 2248 ? 162.468 216.274 177.312 1.00 0.00 ? 2248 LEU A CA 6  
ATOM 11233  C CA . TYR A 1 2249 ? 165.434 213.908 177.541 1.00 0.00 ? 2249 TYR A CA 6  
ATOM 11234  C CA . CYS A 1 2250 ? 167.843 213.087 180.374 1.00 0.00 ? 2250 CYS A CA 6  
ATOM 11235  C CA . ASN A 1 2251 ? 171.427 212.629 179.191 1.00 0.00 ? 2251 ASN A CA 6  
ATOM 11236  C CA . SER A 1 2252 ? 174.872 211.893 180.611 1.00 0.00 ? 2252 SER A CA 6  
ATOM 11237  C CA . PHE A 1 2253 ? 178.416 212.776 179.549 1.00 0.00 ? 2253 PHE A CA 6  
ATOM 11238  C CA . GLN A 1 2259 ? 180.056 211.896 184.095 1.00 0.00 ? 2254 GLN A CA 6  
ATOM 11239  C CA . LYS A 1 2260 ? 177.708 214.897 184.092 1.00 0.00 ? 2260 LYS A CA 6  
ATOM 11240  C CA . ASN A 1 2261 ? 173.937 214.568 183.719 1.00 0.00 ? 2261 ASN A CA 6  
ATOM 11241  C CA . PHE A 1 2262 ? 171.804 217.020 181.757 1.00 0.00 ? 2262 PHE A CA 6  
ATOM 11242  C CA . LEU A 1 2263 ? 168.190 217.846 180.922 1.00 0.00 ? 2263 LEU A CA 6  
ATOM 11243  C CA . LEU A 1 2264 ? 167.742 218.454 177.190 1.00 0.00 ? 2264 LEU A CA 6  
ATOM 11244  C CA . VAL A 1 2265 ? 16