data_6XR8
# 
_entry.id   6XR8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6XR8         
WWPDB D_1000250604 
EMDB  EMD-22292    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Distinct conformational states of SARS-CoV-2 spike protein' 
_pdbx_database_related.db_id          EMD-22292 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XR8 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           N 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, J.'      1 0000-0002-1289-0624 
'Cai, Y.F.'      2 0000-0002-3628-3802 
'Xiao, T.S.'     3 0000-0003-1287-1228 
'Peng, H.Q.'     4 ?                   
'Sterling, S.M.' 5 ?                   
'Walsh Jr, R.M.' 6 0000-0002-8939-8988 
'Rawson, S.'     7 ?                   
'Volloch, S.R.'  8 ?                   
'Chen, B.'       9 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            369 
_citation.language                  ? 
_citation.page_first                1586 
_citation.page_last                 1592 
_citation.title                     'Distinct conformational states of SARS-CoV-2 spike protein.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.abd4251 
_citation.pdbx_database_id_PubMed   32694201 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cai, Y.'          1 ? 
primary 'Zhang, J.'        2 ? 
primary 'Xiao, T.'         3 ? 
primary 'Peng, H.'         4 ? 
primary 'Sterling, S.M.'   5 ? 
primary 'Walsh Jr., R.M.'  6 ? 
primary 'Rawson, S.'       7 ? 
primary 'Rits-Volloch, S.' 8 ? 
primary 'Chen, B.'         9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6XR8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6XR8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Spike glycoprotein' 144916.062 3  ? ? ? ? 
2 branched    man 
'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542    
21 ? ? ? ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401    9  ? ? ? ? 
4 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542    3 
? ? ? ? 
5 branched    man 
;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682    3  ? ? ? ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208    21 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S glycoprotein,E2,Peplomer protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFD
NPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV
QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS
NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF
NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAG
TITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRV
DFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYTLESGGGS
AWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFD
NPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV
QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS
NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF
NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAG
TITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRV
DFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYTLESGGGS
AWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    PHE n 
1 3    VAL n 
1 4    PHE n 
1 5    LEU n 
1 6    VAL n 
1 7    LEU n 
1 8    LEU n 
1 9    PRO n 
1 10   LEU n 
1 11   VAL n 
1 12   SER n 
1 13   SER n 
1 14   GLN n 
1 15   CYS n 
1 16   VAL n 
1 17   ASN n 
1 18   LEU n 
1 19   THR n 
1 20   THR n 
1 21   ARG n 
1 22   THR n 
1 23   GLN n 
1 24   LEU n 
1 25   PRO n 
1 26   PRO n 
1 27   ALA n 
1 28   TYR n 
1 29   THR n 
1 30   ASN n 
1 31   SER n 
1 32   PHE n 
1 33   THR n 
1 34   ARG n 
1 35   GLY n 
1 36   VAL n 
1 37   TYR n 
1 38   TYR n 
1 39   PRO n 
1 40   ASP n 
1 41   LYS n 
1 42   VAL n 
1 43   PHE n 
1 44   ARG n 
1 45   SER n 
1 46   SER n 
1 47   VAL n 
1 48   LEU n 
1 49   HIS n 
1 50   SER n 
1 51   THR n 
1 52   GLN n 
1 53   ASP n 
1 54   LEU n 
1 55   PHE n 
1 56   LEU n 
1 57   PRO n 
1 58   PHE n 
1 59   PHE n 
1 60   SER n 
1 61   ASN n 
1 62   VAL n 
1 63   THR n 
1 64   TRP n 
1 65   PHE n 
1 66   HIS n 
1 67   ALA n 
1 68   ILE n 
1 69   HIS n 
1 70   VAL n 
1 71   SER n 
1 72   GLY n 
1 73   THR n 
1 74   ASN n 
1 75   GLY n 
1 76   THR n 
1 77   LYS n 
1 78   ARG n 
1 79   PHE n 
1 80   ASP n 
1 81   ASN n 
1 82   PRO n 
1 83   VAL n 
1 84   LEU n 
1 85   PRO n 
1 86   PHE n 
1 87   ASN n 
1 88   ASP n 
1 89   GLY n 
1 90   VAL n 
1 91   TYR n 
1 92   PHE n 
1 93   ALA n 
1 94   SER n 
1 95   THR n 
1 96   GLU n 
1 97   LYS n 
1 98   SER n 
1 99   ASN n 
1 100  ILE n 
1 101  ILE n 
1 102  ARG n 
1 103  GLY n 
1 104  TRP n 
1 105  ILE n 
1 106  PHE n 
1 107  GLY n 
1 108  THR n 
1 109  THR n 
1 110  LEU n 
1 111  ASP n 
1 112  SER n 
1 113  LYS n 
1 114  THR n 
1 115  GLN n 
1 116  SER n 
1 117  LEU n 
1 118  LEU n 
1 119  ILE n 
1 120  VAL n 
1 121  ASN n 
1 122  ASN n 
1 123  ALA n 
1 124  THR n 
1 125  ASN n 
1 126  VAL n 
1 127  VAL n 
1 128  ILE n 
1 129  LYS n 
1 130  VAL n 
1 131  CYS n 
1 132  GLU n 
1 133  PHE n 
1 134  GLN n 
1 135  PHE n 
1 136  CYS n 
1 137  ASN n 
1 138  ASP n 
1 139  PRO n 
1 140  PHE n 
1 141  LEU n 
1 142  GLY n 
1 143  VAL n 
1 144  TYR n 
1 145  TYR n 
1 146  HIS n 
1 147  LYS n 
1 148  ASN n 
1 149  ASN n 
1 150  LYS n 
1 151  SER n 
1 152  TRP n 
1 153  MET n 
1 154  GLU n 
1 155  SER n 
1 156  GLU n 
1 157  PHE n 
1 158  ARG n 
1 159  VAL n 
1 160  TYR n 
1 161  SER n 
1 162  SER n 
1 163  ALA n 
1 164  ASN n 
1 165  ASN n 
1 166  CYS n 
1 167  THR n 
1 168  PHE n 
1 169  GLU n 
1 170  TYR n 
1 171  VAL n 
1 172  SER n 
1 173  GLN n 
1 174  PRO n 
1 175  PHE n 
1 176  LEU n 
1 177  MET n 
1 178  ASP n 
1 179  LEU n 
1 180  GLU n 
1 181  GLY n 
1 182  LYS n 
1 183  GLN n 
1 184  GLY n 
1 185  ASN n 
1 186  PHE n 
1 187  LYS n 
1 188  ASN n 
1 189  LEU n 
1 190  ARG n 
1 191  GLU n 
1 192  PHE n 
1 193  VAL n 
1 194  PHE n 
1 195  LYS n 
1 196  ASN n 
1 197  ILE n 
1 198  ASP n 
1 199  GLY n 
1 200  TYR n 
1 201  PHE n 
1 202  LYS n 
1 203  ILE n 
1 204  TYR n 
1 205  SER n 
1 206  LYS n 
1 207  HIS n 
1 208  THR n 
1 209  PRO n 
1 210  ILE n 
1 211  ASN n 
1 212  LEU n 
1 213  VAL n 
1 214  ARG n 
1 215  ASP n 
1 216  LEU n 
1 217  PRO n 
1 218  GLN n 
1 219  GLY n 
1 220  PHE n 
1 221  SER n 
1 222  ALA n 
1 223  LEU n 
1 224  GLU n 
1 225  PRO n 
1 226  LEU n 
1 227  VAL n 
1 228  ASP n 
1 229  LEU n 
1 230  PRO n 
1 231  ILE n 
1 232  GLY n 
1 233  ILE n 
1 234  ASN n 
1 235  ILE n 
1 236  THR n 
1 237  ARG n 
1 238  PHE n 
1 239  GLN n 
1 240  THR n 
1 241  LEU n 
1 242  LEU n 
1 243  ALA n 
1 244  LEU n 
1 245  HIS n 
1 246  ARG n 
1 247  SER n 
1 248  TYR n 
1 249  LEU n 
1 250  THR n 
1 251  PRO n 
1 252  GLY n 
1 253  ASP n 
1 254  SER n 
1 255  SER n 
1 256  SER n 
1 257  GLY n 
1 258  TRP n 
1 259  THR n 
1 260  ALA n 
1 261  GLY n 
1 262  ALA n 
1 263  ALA n 
1 264  ALA n 
1 265  TYR n 
1 266  TYR n 
1 267  VAL n 
1 268  GLY n 
1 269  TYR n 
1 270  LEU n 
1 271  GLN n 
1 272  PRO n 
1 273  ARG n 
1 274  THR n 
1 275  PHE n 
1 276  LEU n 
1 277  LEU n 
1 278  LYS n 
1 279  TYR n 
1 280  ASN n 
1 281  GLU n 
1 282  ASN n 
1 283  GLY n 
1 284  THR n 
1 285  ILE n 
1 286  THR n 
1 287  ASP n 
1 288  ALA n 
1 289  VAL n 
1 290  ASP n 
1 291  CYS n 
1 292  ALA n 
1 293  LEU n 
1 294  ASP n 
1 295  PRO n 
1 296  LEU n 
1 297  SER n 
1 298  GLU n 
1 299  THR n 
1 300  LYS n 
1 301  CYS n 
1 302  THR n 
1 303  LEU n 
1 304  LYS n 
1 305  SER n 
1 306  PHE n 
1 307  THR n 
1 308  VAL n 
1 309  GLU n 
1 310  LYS n 
1 311  GLY n 
1 312  ILE n 
1 313  TYR n 
1 314  GLN n 
1 315  THR n 
1 316  SER n 
1 317  ASN n 
1 318  PHE n 
1 319  ARG n 
1 320  VAL n 
1 321  GLN n 
1 322  PRO n 
1 323  THR n 
1 324  GLU n 
1 325  SER n 
1 326  ILE n 
1 327  VAL n 
1 328  ARG n 
1 329  PHE n 
1 330  PRO n 
1 331  ASN n 
1 332  ILE n 
1 333  THR n 
1 334  ASN n 
1 335  LEU n 
1 336  CYS n 
1 337  PRO n 
1 338  PHE n 
1 339  GLY n 
1 340  GLU n 
1 341  VAL n 
1 342  PHE n 
1 343  ASN n 
1 344  ALA n 
1 345  THR n 
1 346  ARG n 
1 347  PHE n 
1 348  ALA n 
1 349  SER n 
1 350  VAL n 
1 351  TYR n 
1 352  ALA n 
1 353  TRP n 
1 354  ASN n 
1 355  ARG n 
1 356  LYS n 
1 357  ARG n 
1 358  ILE n 
1 359  SER n 
1 360  ASN n 
1 361  CYS n 
1 362  VAL n 
1 363  ALA n 
1 364  ASP n 
1 365  TYR n 
1 366  SER n 
1 367  VAL n 
1 368  LEU n 
1 369  TYR n 
1 370  ASN n 
1 371  SER n 
1 372  ALA n 
1 373  SER n 
1 374  PHE n 
1 375  SER n 
1 376  THR n 
1 377  PHE n 
1 378  LYS n 
1 379  CYS n 
1 380  TYR n 
1 381  GLY n 
1 382  VAL n 
1 383  SER n 
1 384  PRO n 
1 385  THR n 
1 386  LYS n 
1 387  LEU n 
1 388  ASN n 
1 389  ASP n 
1 390  LEU n 
1 391  CYS n 
1 392  PHE n 
1 393  THR n 
1 394  ASN n 
1 395  VAL n 
1 396  TYR n 
1 397  ALA n 
1 398  ASP n 
1 399  SER n 
1 400  PHE n 
1 401  VAL n 
1 402  ILE n 
1 403  ARG n 
1 404  GLY n 
1 405  ASP n 
1 406  GLU n 
1 407  VAL n 
1 408  ARG n 
1 409  GLN n 
1 410  ILE n 
1 411  ALA n 
1 412  PRO n 
1 413  GLY n 
1 414  GLN n 
1 415  THR n 
1 416  GLY n 
1 417  LYS n 
1 418  ILE n 
1 419  ALA n 
1 420  ASP n 
1 421  TYR n 
1 422  ASN n 
1 423  TYR n 
1 424  LYS n 
1 425  LEU n 
1 426  PRO n 
1 427  ASP n 
1 428  ASP n 
1 429  PHE n 
1 430  THR n 
1 431  GLY n 
1 432  CYS n 
1 433  VAL n 
1 434  ILE n 
1 435  ALA n 
1 436  TRP n 
1 437  ASN n 
1 438  SER n 
1 439  ASN n 
1 440  ASN n 
1 441  LEU n 
1 442  ASP n 
1 443  SER n 
1 444  LYS n 
1 445  VAL n 
1 446  GLY n 
1 447  GLY n 
1 448  ASN n 
1 449  TYR n 
1 450  ASN n 
1 451  TYR n 
1 452  LEU n 
1 453  TYR n 
1 454  ARG n 
1 455  LEU n 
1 456  PHE n 
1 457  ARG n 
1 458  LYS n 
1 459  SER n 
1 460  ASN n 
1 461  LEU n 
1 462  LYS n 
1 463  PRO n 
1 464  PHE n 
1 465  GLU n 
1 466  ARG n 
1 467  ASP n 
1 468  ILE n 
1 469  SER n 
1 470  THR n 
1 471  GLU n 
1 472  ILE n 
1 473  TYR n 
1 474  GLN n 
1 475  ALA n 
1 476  GLY n 
1 477  SER n 
1 478  THR n 
1 479  PRO n 
1 480  CYS n 
1 481  ASN n 
1 482  GLY n 
1 483  VAL n 
1 484  GLU n 
1 485  GLY n 
1 486  PHE n 
1 487  ASN n 
1 488  CYS n 
1 489  TYR n 
1 490  PHE n 
1 491  PRO n 
1 492  LEU n 
1 493  GLN n 
1 494  SER n 
1 495  TYR n 
1 496  GLY n 
1 497  PHE n 
1 498  GLN n 
1 499  PRO n 
1 500  THR n 
1 501  ASN n 
1 502  GLY n 
1 503  VAL n 
1 504  GLY n 
1 505  TYR n 
1 506  GLN n 
1 507  PRO n 
1 508  TYR n 
1 509  ARG n 
1 510  VAL n 
1 511  VAL n 
1 512  VAL n 
1 513  LEU n 
1 514  SER n 
1 515  PHE n 
1 516  GLU n 
1 517  LEU n 
1 518  LEU n 
1 519  HIS n 
1 520  ALA n 
1 521  PRO n 
1 522  ALA n 
1 523  THR n 
1 524  VAL n 
1 525  CYS n 
1 526  GLY n 
1 527  PRO n 
1 528  LYS n 
1 529  LYS n 
1 530  SER n 
1 531  THR n 
1 532  ASN n 
1 533  LEU n 
1 534  VAL n 
1 535  LYS n 
1 536  ASN n 
1 537  LYS n 
1 538  CYS n 
1 539  VAL n 
1 540  ASN n 
1 541  PHE n 
1 542  ASN n 
1 543  PHE n 
1 544  ASN n 
1 545  GLY n 
1 546  LEU n 
1 547  THR n 
1 548  GLY n 
1 549  THR n 
1 550  GLY n 
1 551  VAL n 
1 552  LEU n 
1 553  THR n 
1 554  GLU n 
1 555  SER n 
1 556  ASN n 
1 557  LYS n 
1 558  LYS n 
1 559  PHE n 
1 560  LEU n 
1 561  PRO n 
1 562  PHE n 
1 563  GLN n 
1 564  GLN n 
1 565  PHE n 
1 566  GLY n 
1 567  ARG n 
1 568  ASP n 
1 569  ILE n 
1 570  ALA n 
1 571  ASP n 
1 572  THR n 
1 573  THR n 
1 574  ASP n 
1 575  ALA n 
1 576  VAL n 
1 577  ARG n 
1 578  ASP n 
1 579  PRO n 
1 580  GLN n 
1 581  THR n 
1 582  LEU n 
1 583  GLU n 
1 584  ILE n 
1 585  LEU n 
1 586  ASP n 
1 587  ILE n 
1 588  THR n 
1 589  PRO n 
1 590  CYS n 
1 591  SER n 
1 592  PHE n 
1 593  GLY n 
1 594  GLY n 
1 595  VAL n 
1 596  SER n 
1 597  VAL n 
1 598  ILE n 
1 599  THR n 
1 600  PRO n 
1 601  GLY n 
1 602  THR n 
1 603  ASN n 
1 604  THR n 
1 605  SER n 
1 606  ASN n 
1 607  GLN n 
1 608  VAL n 
1 609  ALA n 
1 610  VAL n 
1 611  LEU n 
1 612  TYR n 
1 613  GLN n 
1 614  ASP n 
1 615  VAL n 
1 616  ASN n 
1 617  CYS n 
1 618  THR n 
1 619  GLU n 
1 620  VAL n 
1 621  PRO n 
1 622  VAL n 
1 623  ALA n 
1 624  ILE n 
1 625  HIS n 
1 626  ALA n 
1 627  ASP n 
1 628  GLN n 
1 629  LEU n 
1 630  THR n 
1 631  PRO n 
1 632  THR n 
1 633  TRP n 
1 634  ARG n 
1 635  VAL n 
1 636  TYR n 
1 637  SER n 
1 638  THR n 
1 639  GLY n 
1 640  SER n 
1 641  ASN n 
1 642  VAL n 
1 643  PHE n 
1 644  GLN n 
1 645  THR n 
1 646  ARG n 
1 647  ALA n 
1 648  GLY n 
1 649  CYS n 
1 650  LEU n 
1 651  ILE n 
1 652  GLY n 
1 653  ALA n 
1 654  GLU n 
1 655  HIS n 
1 656  VAL n 
1 657  ASN n 
1 658  ASN n 
1 659  SER n 
1 660  TYR n 
1 661  GLU n 
1 662  CYS n 
1 663  ASP n 
1 664  ILE n 
1 665  PRO n 
1 666  ILE n 
1 667  GLY n 
1 668  ALA n 
1 669  GLY n 
1 670  ILE n 
1 671  CYS n 
1 672  ALA n 
1 673  SER n 
1 674  TYR n 
1 675  GLN n 
1 676  THR n 
1 677  GLN n 
1 678  THR n 
1 679  ASN n 
1 680  SER n 
1 681  PRO n 
1 682  ARG n 
1 683  ARG n 
1 684  ALA n 
1 685  ARG n 
1 686  SER n 
1 687  VAL n 
1 688  ALA n 
1 689  SER n 
1 690  GLN n 
1 691  SER n 
1 692  ILE n 
1 693  ILE n 
1 694  ALA n 
1 695  TYR n 
1 696  THR n 
1 697  MET n 
1 698  SER n 
1 699  LEU n 
1 700  GLY n 
1 701  ALA n 
1 702  GLU n 
1 703  ASN n 
1 704  SER n 
1 705  VAL n 
1 706  ALA n 
1 707  TYR n 
1 708  SER n 
1 709  ASN n 
1 710  ASN n 
1 711  SER n 
1 712  ILE n 
1 713  ALA n 
1 714  ILE n 
1 715  PRO n 
1 716  THR n 
1 717  ASN n 
1 718  PHE n 
1 719  THR n 
1 720  ILE n 
1 721  SER n 
1 722  VAL n 
1 723  THR n 
1 724  THR n 
1 725  GLU n 
1 726  ILE n 
1 727  LEU n 
1 728  PRO n 
1 729  VAL n 
1 730  SER n 
1 731  MET n 
1 732  THR n 
1 733  LYS n 
1 734  THR n 
1 735  SER n 
1 736  VAL n 
1 737  ASP n 
1 738  CYS n 
1 739  THR n 
1 740  MET n 
1 741  TYR n 
1 742  ILE n 
1 743  CYS n 
1 744  GLY n 
1 745  ASP n 
1 746  SER n 
1 747  THR n 
1 748  GLU n 
1 749  CYS n 
1 750  SER n 
1 751  ASN n 
1 752  LEU n 
1 753  LEU n 
1 754  LEU n 
1 755  GLN n 
1 756  TYR n 
1 757  GLY n 
1 758  SER n 
1 759  PHE n 
1 760  CYS n 
1 761  THR n 
1 762  GLN n 
1 763  LEU n 
1 764  ASN n 
1 765  ARG n 
1 766  ALA n 
1 767  LEU n 
1 768  THR n 
1 769  GLY n 
1 770  ILE n 
1 771  ALA n 
1 772  VAL n 
1 773  GLU n 
1 774  GLN n 
1 775  ASP n 
1 776  LYS n 
1 777  ASN n 
1 778  THR n 
1 779  GLN n 
1 780  GLU n 
1 781  VAL n 
1 782  PHE n 
1 783  ALA n 
1 784  GLN n 
1 785  VAL n 
1 786  LYS n 
1 787  GLN n 
1 788  ILE n 
1 789  TYR n 
1 790  LYS n 
1 791  THR n 
1 792  PRO n 
1 793  PRO n 
1 794  ILE n 
1 795  LYS n 
1 796  ASP n 
1 797  PHE n 
1 798  GLY n 
1 799  GLY n 
1 800  PHE n 
1 801  ASN n 
1 802  PHE n 
1 803  SER n 
1 804  GLN n 
1 805  ILE n 
1 806  LEU n 
1 807  PRO n 
1 808  ASP n 
1 809  PRO n 
1 810  SER n 
1 811  LYS n 
1 812  PRO n 
1 813  SER n 
1 814  LYS n 
1 815  ARG n 
1 816  SER n 
1 817  PHE n 
1 818  ILE n 
1 819  GLU n 
1 820  ASP n 
1 821  LEU n 
1 822  LEU n 
1 823  PHE n 
1 824  ASN n 
1 825  LYS n 
1 826  VAL n 
1 827  THR n 
1 828  LEU n 
1 829  ALA n 
1 830  ASP n 
1 831  ALA n 
1 832  GLY n 
1 833  PHE n 
1 834  ILE n 
1 835  LYS n 
1 836  GLN n 
1 837  TYR n 
1 838  GLY n 
1 839  ASP n 
1 840  CYS n 
1 841  LEU n 
1 842  GLY n 
1 843  ASP n 
1 844  ILE n 
1 845  ALA n 
1 846  ALA n 
1 847  ARG n 
1 848  ASP n 
1 849  LEU n 
1 850  ILE n 
1 851  CYS n 
1 852  ALA n 
1 853  GLN n 
1 854  LYS n 
1 855  PHE n 
1 856  ASN n 
1 857  GLY n 
1 858  LEU n 
1 859  THR n 
1 860  VAL n 
1 861  LEU n 
1 862  PRO n 
1 863  PRO n 
1 864  LEU n 
1 865  LEU n 
1 866  THR n 
1 867  ASP n 
1 868  GLU n 
1 869  MET n 
1 870  ILE n 
1 871  ALA n 
1 872  GLN n 
1 873  TYR n 
1 874  THR n 
1 875  SER n 
1 876  ALA n 
1 877  LEU n 
1 878  LEU n 
1 879  ALA n 
1 880  GLY n 
1 881  THR n 
1 882  ILE n 
1 883  THR n 
1 884  SER n 
1 885  GLY n 
1 886  TRP n 
1 887  THR n 
1 888  PHE n 
1 889  GLY n 
1 890  ALA n 
1 891  GLY n 
1 892  ALA n 
1 893  ALA n 
1 894  LEU n 
1 895  GLN n 
1 896  ILE n 
1 897  PRO n 
1 898  PHE n 
1 899  ALA n 
1 900  MET n 
1 901  GLN n 
1 902  MET n 
1 903  ALA n 
1 904  TYR n 
1 905  ARG n 
1 906  PHE n 
1 907  ASN n 
1 908  GLY n 
1 909  ILE n 
1 910  GLY n 
1 911  VAL n 
1 912  THR n 
1 913  GLN n 
1 914  ASN n 
1 915  VAL n 
1 916  LEU n 
1 917  TYR n 
1 918  GLU n 
1 919  ASN n 
1 920  GLN n 
1 921  LYS n 
1 922  LEU n 
1 923  ILE n 
1 924  ALA n 
1 925  ASN n 
1 926  GLN n 
1 927  PHE n 
1 928  ASN n 
1 929  SER n 
1 930  ALA n 
1 931  ILE n 
1 932  GLY n 
1 933  LYS n 
1 934  ILE n 
1 935  GLN n 
1 936  ASP n 
1 937  SER n 
1 938  LEU n 
1 939  SER n 
1 940  SER n 
1 941  THR n 
1 942  ALA n 
1 943  SER n 
1 944  ALA n 
1 945  LEU n 
1 946  GLY n 
1 947  LYS n 
1 948  LEU n 
1 949  GLN n 
1 950  ASP n 
1 951  VAL n 
1 952  VAL n 
1 953  ASN n 
1 954  GLN n 
1 955  ASN n 
1 956  ALA n 
1 957  GLN n 
1 958  ALA n 
1 959  LEU n 
1 960  ASN n 
1 961  THR n 
1 962  LEU n 
1 963  VAL n 
1 964  LYS n 
1 965  GLN n 
1 966  LEU n 
1 967  SER n 
1 968  SER n 
1 969  ASN n 
1 970  PHE n 
1 971  GLY n 
1 972  ALA n 
1 973  ILE n 
1 974  SER n 
1 975  SER n 
1 976  VAL n 
1 977  LEU n 
1 978  ASN n 
1 979  ASP n 
1 980  ILE n 
1 981  LEU n 
1 982  SER n 
1 983  ARG n 
1 984  LEU n 
1 985  ASP n 
1 986  LYS n 
1 987  VAL n 
1 988  GLU n 
1 989  ALA n 
1 990  GLU n 
1 991  VAL n 
1 992  GLN n 
1 993  ILE n 
1 994  ASP n 
1 995  ARG n 
1 996  LEU n 
1 997  ILE n 
1 998  THR n 
1 999  GLY n 
1 1000 ARG n 
1 1001 LEU n 
1 1002 GLN n 
1 1003 SER n 
1 1004 LEU n 
1 1005 GLN n 
1 1006 THR n 
1 1007 TYR n 
1 1008 VAL n 
1 1009 THR n 
1 1010 GLN n 
1 1011 GLN n 
1 1012 LEU n 
1 1013 ILE n 
1 1014 ARG n 
1 1015 ALA n 
1 1016 ALA n 
1 1017 GLU n 
1 1018 ILE n 
1 1019 ARG n 
1 1020 ALA n 
1 1021 SER n 
1 1022 ALA n 
1 1023 ASN n 
1 1024 LEU n 
1 1025 ALA n 
1 1026 ALA n 
1 1027 THR n 
1 1028 LYS n 
1 1029 MET n 
1 1030 SER n 
1 1031 GLU n 
1 1032 CYS n 
1 1033 VAL n 
1 1034 LEU n 
1 1035 GLY n 
1 1036 GLN n 
1 1037 SER n 
1 1038 LYS n 
1 1039 ARG n 
1 1040 VAL n 
1 1041 ASP n 
1 1042 PHE n 
1 1043 CYS n 
1 1044 GLY n 
1 1045 LYS n 
1 1046 GLY n 
1 1047 TYR n 
1 1048 HIS n 
1 1049 LEU n 
1 1050 MET n 
1 1051 SER n 
1 1052 PHE n 
1 1053 PRO n 
1 1054 GLN n 
1 1055 SER n 
1 1056 ALA n 
1 1057 PRO n 
1 1058 HIS n 
1 1059 GLY n 
1 1060 VAL n 
1 1061 VAL n 
1 1062 PHE n 
1 1063 LEU n 
1 1064 HIS n 
1 1065 VAL n 
1 1066 THR n 
1 1067 TYR n 
1 1068 VAL n 
1 1069 PRO n 
1 1070 ALA n 
1 1071 GLN n 
1 1072 GLU n 
1 1073 LYS n 
1 1074 ASN n 
1 1075 PHE n 
1 1076 THR n 
1 1077 THR n 
1 1078 ALA n 
1 1079 PRO n 
1 1080 ALA n 
1 1081 ILE n 
1 1082 CYS n 
1 1083 HIS n 
1 1084 ASP n 
1 1085 GLY n 
1 1086 LYS n 
1 1087 ALA n 
1 1088 HIS n 
1 1089 PHE n 
1 1090 PRO n 
1 1091 ARG n 
1 1092 GLU n 
1 1093 GLY n 
1 1094 VAL n 
1 1095 PHE n 
1 1096 VAL n 
1 1097 SER n 
1 1098 ASN n 
1 1099 GLY n 
1 1100 THR n 
1 1101 HIS n 
1 1102 TRP n 
1 1103 PHE n 
1 1104 VAL n 
1 1105 THR n 
1 1106 GLN n 
1 1107 ARG n 
1 1108 ASN n 
1 1109 PHE n 
1 1110 TYR n 
1 1111 GLU n 
1 1112 PRO n 
1 1113 GLN n 
1 1114 ILE n 
1 1115 ILE n 
1 1116 THR n 
1 1117 THR n 
1 1118 ASP n 
1 1119 ASN n 
1 1120 THR n 
1 1121 PHE n 
1 1122 VAL n 
1 1123 SER n 
1 1124 GLY n 
1 1125 ASN n 
1 1126 CYS n 
1 1127 ASP n 
1 1128 VAL n 
1 1129 VAL n 
1 1130 ILE n 
1 1131 GLY n 
1 1132 ILE n 
1 1133 VAL n 
1 1134 ASN n 
1 1135 ASN n 
1 1136 THR n 
1 1137 VAL n 
1 1138 TYR n 
1 1139 ASP n 
1 1140 PRO n 
1 1141 LEU n 
1 1142 GLN n 
1 1143 PRO n 
1 1144 GLU n 
1 1145 LEU n 
1 1146 ASP n 
1 1147 SER n 
1 1148 PHE n 
1 1149 LYS n 
1 1150 GLU n 
1 1151 GLU n 
1 1152 LEU n 
1 1153 ASP n 
1 1154 LYS n 
1 1155 TYR n 
1 1156 PHE n 
1 1157 LYS n 
1 1158 ASN n 
1 1159 HIS n 
1 1160 THR n 
1 1161 SER n 
1 1162 PRO n 
1 1163 ASP n 
1 1164 VAL n 
1 1165 ASP n 
1 1166 LEU n 
1 1167 GLY n 
1 1168 ASP n 
1 1169 ILE n 
1 1170 SER n 
1 1171 GLY n 
1 1172 ILE n 
1 1173 ASN n 
1 1174 ALA n 
1 1175 SER n 
1 1176 VAL n 
1 1177 VAL n 
1 1178 ASN n 
1 1179 ILE n 
1 1180 GLN n 
1 1181 LYS n 
1 1182 GLU n 
1 1183 ILE n 
1 1184 ASP n 
1 1185 ARG n 
1 1186 LEU n 
1 1187 ASN n 
1 1188 GLU n 
1 1189 VAL n 
1 1190 ALA n 
1 1191 LYS n 
1 1192 ASN n 
1 1193 LEU n 
1 1194 ASN n 
1 1195 GLU n 
1 1196 SER n 
1 1197 LEU n 
1 1198 ILE n 
1 1199 ASP n 
1 1200 LEU n 
1 1201 GLN n 
1 1202 GLU n 
1 1203 LEU n 
1 1204 GLY n 
1 1205 LYS n 
1 1206 TYR n 
1 1207 GLU n 
1 1208 GLN n 
1 1209 TYR n 
1 1210 ILE n 
1 1211 LYS n 
1 1212 TRP n 
1 1213 PRO n 
1 1214 TRP n 
1 1215 TYR n 
1 1216 ILE n 
1 1217 TRP n 
1 1218 LEU n 
1 1219 GLY n 
1 1220 PHE n 
1 1221 ILE n 
1 1222 ALA n 
1 1223 GLY n 
1 1224 LEU n 
1 1225 ILE n 
1 1226 ALA n 
1 1227 ILE n 
1 1228 VAL n 
1 1229 MET n 
1 1230 VAL n 
1 1231 THR n 
1 1232 ILE n 
1 1233 MET n 
1 1234 LEU n 
1 1235 CYS n 
1 1236 CYS n 
1 1237 MET n 
1 1238 THR n 
1 1239 SER n 
1 1240 CYS n 
1 1241 CYS n 
1 1242 SER n 
1 1243 CYS n 
1 1244 LEU n 
1 1245 LYS n 
1 1246 GLY n 
1 1247 CYS n 
1 1248 CYS n 
1 1249 SER n 
1 1250 CYS n 
1 1251 GLY n 
1 1252 SER n 
1 1253 CYS n 
1 1254 CYS n 
1 1255 LYS n 
1 1256 PHE n 
1 1257 ASP n 
1 1258 GLU n 
1 1259 ASP n 
1 1260 ASP n 
1 1261 SER n 
1 1262 GLU n 
1 1263 PRO n 
1 1264 VAL n 
1 1265 LEU n 
1 1266 LYS n 
1 1267 GLY n 
1 1268 VAL n 
1 1269 LYS n 
1 1270 LEU n 
1 1271 HIS n 
1 1272 TYR n 
1 1273 THR n 
1 1274 LEU n 
1 1275 GLU n 
1 1276 SER n 
1 1277 GLY n 
1 1278 GLY n 
1 1279 GLY n 
1 1280 SER n 
1 1281 ALA n 
1 1282 TRP n 
1 1283 SER n 
1 1284 HIS n 
1 1285 PRO n 
1 1286 GLN n 
1 1287 PHE n 
1 1288 GLU n 
1 1289 LYS n 
1 1290 GLY n 
1 1291 GLY n 
1 1292 GLY n 
1 1293 SER n 
1 1294 GLY n 
1 1295 GLY n 
1 1296 GLY n 
1 1297 SER n 
1 1298 GLY n 
1 1299 GLY n 
1 1300 SER n 
1 1301 SER n 
1 1302 ALA n 
1 1303 TRP n 
1 1304 SER n 
1 1305 HIS n 
1 1306 PRO n 
1 1307 GLN n 
1 1308 PHE n 
1 1309 GLU n 
1 1310 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1310 
_entity_src_gen.gene_src_common_name               2019-nCoV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S, 2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Severe acute respiratory syndrome coronavirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2697049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPIKE_SARS2 
_struct_ref.pdbx_db_accession          P0DTC2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFD
NPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV
QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS
NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF
NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAG
TITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRV
DFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6XR8 A 1 ? 1273 ? P0DTC2 1 ? 1273 ? 1 1273 
2 1 6XR8 B 1 ? 1273 ? P0DTC2 1 ? 1273 ? 1 1273 
3 1 6XR8 C 1 ? 1273 ? P0DTC2 1 ? 1273 ? 1 1273 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6XR8 LEU A 1274 ? UNP P0DTC2 ? ? 'expression tag' 1274 1   
1 6XR8 GLU A 1275 ? UNP P0DTC2 ? ? 'expression tag' 1275 2   
1 6XR8 SER A 1276 ? UNP P0DTC2 ? ? 'expression tag' 1276 3   
1 6XR8 GLY A 1277 ? UNP P0DTC2 ? ? 'expression tag' 1277 4   
1 6XR8 GLY A 1278 ? UNP P0DTC2 ? ? 'expression tag' 1278 5   
1 6XR8 GLY A 1279 ? UNP P0DTC2 ? ? 'expression tag' 1279 6   
1 6XR8 SER A 1280 ? UNP P0DTC2 ? ? 'expression tag' 1280 7   
1 6XR8 ALA A 1281 ? UNP P0DTC2 ? ? 'expression tag' 1281 8   
1 6XR8 TRP A 1282 ? UNP P0DTC2 ? ? 'expression tag' 1282 9   
1 6XR8 SER A 1283 ? UNP P0DTC2 ? ? 'expression tag' 1283 10  
1 6XR8 HIS A 1284 ? UNP P0DTC2 ? ? 'expression tag' 1284 11  
1 6XR8 PRO A 1285 ? UNP P0DTC2 ? ? 'expression tag' 1285 12  
1 6XR8 GLN A 1286 ? UNP P0DTC2 ? ? 'expression tag' 1286 13  
1 6XR8 PHE A 1287 ? UNP P0DTC2 ? ? 'expression tag' 1287 14  
1 6XR8 GLU A 1288 ? UNP P0DTC2 ? ? 'expression tag' 1288 15  
1 6XR8 LYS A 1289 ? UNP P0DTC2 ? ? 'expression tag' 1289 16  
1 6XR8 GLY A 1290 ? UNP P0DTC2 ? ? 'expression tag' 1290 17  
1 6XR8 GLY A 1291 ? UNP P0DTC2 ? ? 'expression tag' 1291 18  
1 6XR8 GLY A 1292 ? UNP P0DTC2 ? ? 'expression tag' 1292 19  
1 6XR8 SER A 1293 ? UNP P0DTC2 ? ? 'expression tag' 1293 20  
1 6XR8 GLY A 1294 ? UNP P0DTC2 ? ? 'expression tag' 1294 21  
1 6XR8 GLY A 1295 ? UNP P0DTC2 ? ? 'expression tag' 1295 22  
1 6XR8 GLY A 1296 ? UNP P0DTC2 ? ? 'expression tag' 1296 23  
1 6XR8 SER A 1297 ? UNP P0DTC2 ? ? 'expression tag' 1297 24  
1 6XR8 GLY A 1298 ? UNP P0DTC2 ? ? 'expression tag' 1298 25  
1 6XR8 GLY A 1299 ? UNP P0DTC2 ? ? 'expression tag' 1299 26  
1 6XR8 SER A 1300 ? UNP P0DTC2 ? ? 'expression tag' 1300 27  
1 6XR8 SER A 1301 ? UNP P0DTC2 ? ? 'expression tag' 1301 28  
1 6XR8 ALA A 1302 ? UNP P0DTC2 ? ? 'expression tag' 1302 29  
1 6XR8 TRP A 1303 ? UNP P0DTC2 ? ? 'expression tag' 1303 30  
1 6XR8 SER A 1304 ? UNP P0DTC2 ? ? 'expression tag' 1304 31  
1 6XR8 HIS A 1305 ? UNP P0DTC2 ? ? 'expression tag' 1305 32  
1 6XR8 PRO A 1306 ? UNP P0DTC2 ? ? 'expression tag' 1306 33  
1 6XR8 GLN A 1307 ? UNP P0DTC2 ? ? 'expression tag' 1307 34  
1 6XR8 PHE A 1308 ? UNP P0DTC2 ? ? 'expression tag' 1308 35  
1 6XR8 GLU A 1309 ? UNP P0DTC2 ? ? 'expression tag' 1309 36  
1 6XR8 LYS A 1310 ? UNP P0DTC2 ? ? 'expression tag' 1310 37  
2 6XR8 LEU B 1274 ? UNP P0DTC2 ? ? 'expression tag' 1274 38  
2 6XR8 GLU B 1275 ? UNP P0DTC2 ? ? 'expression tag' 1275 39  
2 6XR8 SER B 1276 ? UNP P0DTC2 ? ? 'expression tag' 1276 40  
2 6XR8 GLY B 1277 ? UNP P0DTC2 ? ? 'expression tag' 1277 41  
2 6XR8 GLY B 1278 ? UNP P0DTC2 ? ? 'expression tag' 1278 42  
2 6XR8 GLY B 1279 ? UNP P0DTC2 ? ? 'expression tag' 1279 43  
2 6XR8 SER B 1280 ? UNP P0DTC2 ? ? 'expression tag' 1280 44  
2 6XR8 ALA B 1281 ? UNP P0DTC2 ? ? 'expression tag' 1281 45  
2 6XR8 TRP B 1282 ? UNP P0DTC2 ? ? 'expression tag' 1282 46  
2 6XR8 SER B 1283 ? UNP P0DTC2 ? ? 'expression tag' 1283 47  
2 6XR8 HIS B 1284 ? UNP P0DTC2 ? ? 'expression tag' 1284 48  
2 6XR8 PRO B 1285 ? UNP P0DTC2 ? ? 'expression tag' 1285 49  
2 6XR8 GLN B 1286 ? UNP P0DTC2 ? ? 'expression tag' 1286 50  
2 6XR8 PHE B 1287 ? UNP P0DTC2 ? ? 'expression tag' 1287 51  
2 6XR8 GLU B 1288 ? UNP P0DTC2 ? ? 'expression tag' 1288 52  
2 6XR8 LYS B 1289 ? UNP P0DTC2 ? ? 'expression tag' 1289 53  
2 6XR8 GLY B 1290 ? UNP P0DTC2 ? ? 'expression tag' 1290 54  
2 6XR8 GLY B 1291 ? UNP P0DTC2 ? ? 'expression tag' 1291 55  
2 6XR8 GLY B 1292 ? UNP P0DTC2 ? ? 'expression tag' 1292 56  
2 6XR8 SER B 1293 ? UNP P0DTC2 ? ? 'expression tag' 1293 57  
2 6XR8 GLY B 1294 ? UNP P0DTC2 ? ? 'expression tag' 1294 58  
2 6XR8 GLY B 1295 ? UNP P0DTC2 ? ? 'expression tag' 1295 59  
2 6XR8 GLY B 1296 ? UNP P0DTC2 ? ? 'expression tag' 1296 60  
2 6XR8 SER B 1297 ? UNP P0DTC2 ? ? 'expression tag' 1297 61  
2 6XR8 GLY B 1298 ? UNP P0DTC2 ? ? 'expression tag' 1298 62  
2 6XR8 GLY B 1299 ? UNP P0DTC2 ? ? 'expression tag' 1299 63  
2 6XR8 SER B 1300 ? UNP P0DTC2 ? ? 'expression tag' 1300 64  
2 6XR8 SER B 1301 ? UNP P0DTC2 ? ? 'expression tag' 1301 65  
2 6XR8 ALA B 1302 ? UNP P0DTC2 ? ? 'expression tag' 1302 66  
2 6XR8 TRP B 1303 ? UNP P0DTC2 ? ? 'expression tag' 1303 67  
2 6XR8 SER B 1304 ? UNP P0DTC2 ? ? 'expression tag' 1304 68  
2 6XR8 HIS B 1305 ? UNP P0DTC2 ? ? 'expression tag' 1305 69  
2 6XR8 PRO B 1306 ? UNP P0DTC2 ? ? 'expression tag' 1306 70  
2 6XR8 GLN B 1307 ? UNP P0DTC2 ? ? 'expression tag' 1307 71  
2 6XR8 PHE B 1308 ? UNP P0DTC2 ? ? 'expression tag' 1308 72  
2 6XR8 GLU B 1309 ? UNP P0DTC2 ? ? 'expression tag' 1309 73  
2 6XR8 LYS B 1310 ? UNP P0DTC2 ? ? 'expression tag' 1310 74  
3 6XR8 LEU C 1274 ? UNP P0DTC2 ? ? 'expression tag' 1274 75  
3 6XR8 GLU C 1275 ? UNP P0DTC2 ? ? 'expression tag' 1275 76  
3 6XR8 SER C 1276 ? UNP P0DTC2 ? ? 'expression tag' 1276 77  
3 6XR8 GLY C 1277 ? UNP P0DTC2 ? ? 'expression tag' 1277 78  
3 6XR8 GLY C 1278 ? UNP P0DTC2 ? ? 'expression tag' 1278 79  
3 6XR8 GLY C 1279 ? UNP P0DTC2 ? ? 'expression tag' 1279 80  
3 6XR8 SER C 1280 ? UNP P0DTC2 ? ? 'expression tag' 1280 81  
3 6XR8 ALA C 1281 ? UNP P0DTC2 ? ? 'expression tag' 1281 82  
3 6XR8 TRP C 1282 ? UNP P0DTC2 ? ? 'expression tag' 1282 83  
3 6XR8 SER C 1283 ? UNP P0DTC2 ? ? 'expression tag' 1283 84  
3 6XR8 HIS C 1284 ? UNP P0DTC2 ? ? 'expression tag' 1284 85  
3 6XR8 PRO C 1285 ? UNP P0DTC2 ? ? 'expression tag' 1285 86  
3 6XR8 GLN C 1286 ? UNP P0DTC2 ? ? 'expression tag' 1286 87  
3 6XR8 PHE C 1287 ? UNP P0DTC2 ? ? 'expression tag' 1287 88  
3 6XR8 GLU C 1288 ? UNP P0DTC2 ? ? 'expression tag' 1288 89  
3 6XR8 LYS C 1289 ? UNP P0DTC2 ? ? 'expression tag' 1289 90  
3 6XR8 GLY C 1290 ? UNP P0DTC2 ? ? 'expression tag' 1290 91  
3 6XR8 GLY C 1291 ? UNP P0DTC2 ? ? 'expression tag' 1291 92  
3 6XR8 GLY C 1292 ? UNP P0DTC2 ? ? 'expression tag' 1292 93  
3 6XR8 SER C 1293 ? UNP P0DTC2 ? ? 'expression tag' 1293 94  
3 6XR8 GLY C 1294 ? UNP P0DTC2 ? ? 'expression tag' 1294 95  
3 6XR8 GLY C 1295 ? UNP P0DTC2 ? ? 'expression tag' 1295 96  
3 6XR8 GLY C 1296 ? UNP P0DTC2 ? ? 'expression tag' 1296 97  
3 6XR8 SER C 1297 ? UNP P0DTC2 ? ? 'expression tag' 1297 98  
3 6XR8 GLY C 1298 ? UNP P0DTC2 ? ? 'expression tag' 1298 99  
3 6XR8 GLY C 1299 ? UNP P0DTC2 ? ? 'expression tag' 1299 100 
3 6XR8 SER C 1300 ? UNP P0DTC2 ? ? 'expression tag' 1300 101 
3 6XR8 SER C 1301 ? UNP P0DTC2 ? ? 'expression tag' 1301 102 
3 6XR8 ALA C 1302 ? UNP P0DTC2 ? ? 'expression tag' 1302 103 
3 6XR8 TRP C 1303 ? UNP P0DTC2 ? ? 'expression tag' 1303 104 
3 6XR8 SER C 1304 ? UNP P0DTC2 ? ? 'expression tag' 1304 105 
3 6XR8 HIS C 1305 ? UNP P0DTC2 ? ? 'expression tag' 1305 106 
3 6XR8 PRO C 1306 ? UNP P0DTC2 ? ? 'expression tag' 1306 107 
3 6XR8 GLN C 1307 ? UNP P0DTC2 ? ? 'expression tag' 1307 108 
3 6XR8 PHE C 1308 ? UNP P0DTC2 ? ? 'expression tag' 1308 109 
3 6XR8 GLU C 1309 ? UNP P0DTC2 ? ? 'expression tag' 1309 110 
3 6XR8 LYS C 1310 ? UNP P0DTC2 ? ? 'expression tag' 1310 111 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 
180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XR8 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6XR8 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.004  ? 28227 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.592  ? 38388 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 18.945 ? 10368 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.057  ? 4694  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.003  ? 4788  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6XR8 
_struct.title                        'Distinct conformational states of SARS-CoV-2 spike protein' 
_struct.pdbx_descriptor              'Spike glycoprotein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XR8 
_struct_keywords.text            'VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 5 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 5 ? 
BA N N 2 ? 
CA N N 3 ? 
DA N N 4 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 5 ? 
NA N N 6 ? 
OA N N 6 ? 
PA N N 6 ? 
QA N N 6 ? 
RA N N 6 ? 
SA N N 6 ? 
TA N N 6 ? 
UA N N 6 ? 
VA N N 6 ? 
WA N N 6 ? 
XA N N 6 ? 
YA N N 6 ? 
ZA N N 6 ? 
AB N N 6 ? 
BB N N 6 ? 
CB N N 6 ? 
DB N N 6 ? 
EB N N 6 ? 
FB N N 6 ? 
GB N N 6 ? 
HB N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 294  ? LYS A 304  ? ASP A 294  LYS A 304  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 337  ? ASN A 343  ? PRO A 337  ASN A 343  1 ? 7  
HELX_P HELX_P3  AA3 ASP A 364  ? TYR A 369  ? ASP A 364  TYR A 369  5 ? 6  
HELX_P HELX_P4  AA4 SER A 383  ? ASP A 389  ? SER A 383  ASP A 389  5 ? 7  
HELX_P HELX_P5  AA5 ASP A 405  ? ALA A 411  ? ASP A 405  ALA A 411  5 ? 7  
HELX_P HELX_P6  AA6 GLY A 416  ? ASN A 422  ? GLY A 416  ASN A 422  1 ? 7  
HELX_P HELX_P7  AA7 SER A 438  ? SER A 443  ? SER A 438  SER A 443  1 ? 6  
HELX_P HELX_P8  AA8 ASP A 737  ? GLY A 744  ? ASP A 737  GLY A 744  1 ? 8  
HELX_P HELX_P9  AA9 SER A 746  ? LEU A 754  ? SER A 746  LEU A 754  1 ? 9  
HELX_P HELX_P10 AB1 GLY A 757  ? ALA A 783  ? GLY A 757  ALA A 783  1 ? 27 
HELX_P HELX_P11 AB2 SER A 816  ? VAL A 826  ? SER A 816  VAL A 826  1 ? 11 
HELX_P HELX_P12 AB3 TYR A 837  ? LEU A 841  ? TYR A 837  LEU A 841  5 ? 5  
HELX_P HELX_P13 AB4 GLY A 842  ? ASP A 848  ? GLY A 842  ASP A 848  1 ? 7  
HELX_P HELX_P14 AB5 ASP A 848  ? ASN A 856  ? ASP A 848  ASN A 856  1 ? 9  
HELX_P HELX_P15 AB6 THR A 866  ? GLY A 885  ? THR A 866  GLY A 885  1 ? 20 
HELX_P HELX_P16 AB7 TRP A 886  ? GLY A 891  ? TRP A 886  GLY A 891  1 ? 6  
HELX_P HELX_P17 AB8 PRO A 897  ? ILE A 909  ? PRO A 897  ILE A 909  1 ? 13 
HELX_P HELX_P18 AB9 GLN A 913  ? GLU A 918  ? GLN A 913  GLU A 918  1 ? 6  
HELX_P HELX_P19 AC1 ASN A 919  ? THR A 941  ? ASN A 919  THR A 941  1 ? 23 
HELX_P HELX_P20 AC2 LEU A 945  ? GLN A 965  ? LEU A 945  GLN A 965  1 ? 21 
HELX_P HELX_P21 AC3 LEU A 966  ? SER A 968  ? LEU A 966  SER A 968  5 ? 3  
HELX_P HELX_P22 AC4 VAL A 976  ? SER A 982  ? VAL A 976  SER A 982  1 ? 7  
HELX_P HELX_P23 AC5 ASP A 985  ? CYS A 1032 ? ASP A 985  CYS A 1032 1 ? 48 
HELX_P HELX_P24 AC6 PRO A 1140 ? SER A 1161 ? PRO A 1140 SER A 1161 1 ? 22 
HELX_P HELX_P25 AC7 ASP B 294  ? LYS B 304  ? ASP B 294  LYS B 304  1 ? 11 
HELX_P HELX_P26 AC8 PRO B 337  ? PHE B 342  ? PRO B 337  PHE B 342  1 ? 6  
HELX_P HELX_P27 AC9 SER B 349  ? TRP B 353  ? SER B 349  TRP B 353  5 ? 5  
HELX_P HELX_P28 AD1 ASP B 364  ? TYR B 369  ? ASP B 364  TYR B 369  5 ? 6  
HELX_P HELX_P29 AD2 SER B 383  ? ASP B 389  ? SER B 383  ASP B 389  5 ? 7  
HELX_P HELX_P30 AD3 ASP B 405  ? ALA B 411  ? ASP B 405  ALA B 411  5 ? 7  
HELX_P HELX_P31 AD4 GLY B 416  ? ASN B 422  ? GLY B 416  ASN B 422  1 ? 7  
HELX_P HELX_P32 AD5 SER B 438  ? SER B 443  ? SER B 438  SER B 443  1 ? 6  
HELX_P HELX_P33 AD6 ASP B 737  ? CYS B 743  ? ASP B 737  CYS B 743  1 ? 7  
HELX_P HELX_P34 AD7 SER B 746  ? LEU B 754  ? SER B 746  LEU B 754  1 ? 9  
HELX_P HELX_P35 AD8 GLY B 757  ? ALA B 783  ? GLY B 757  ALA B 783  1 ? 27 
HELX_P HELX_P36 AD9 SER B 816  ? VAL B 826  ? SER B 816  VAL B 826  1 ? 11 
HELX_P HELX_P37 AE1 GLY B 842  ? ASP B 848  ? GLY B 842  ASP B 848  1 ? 7  
HELX_P HELX_P38 AE2 ASP B 848  ? ASN B 856  ? ASP B 848  ASN B 856  1 ? 9  
HELX_P HELX_P39 AE3 THR B 866  ? GLY B 885  ? THR B 866  GLY B 885  1 ? 20 
HELX_P HELX_P40 AE4 TRP B 886  ? GLY B 891  ? TRP B 886  GLY B 891  1 ? 6  
HELX_P HELX_P41 AE5 PRO B 897  ? ILE B 909  ? PRO B 897  ILE B 909  1 ? 13 
HELX_P HELX_P42 AE6 GLN B 913  ? GLU B 918  ? GLN B 913  GLU B 918  1 ? 6  
HELX_P HELX_P43 AE7 ASN B 919  ? THR B 941  ? ASN B 919  THR B 941  1 ? 23 
HELX_P HELX_P44 AE8 LEU B 945  ? GLN B 965  ? LEU B 945  GLN B 965  1 ? 21 
HELX_P HELX_P45 AE9 LEU B 966  ? SER B 968  ? LEU B 966  SER B 968  5 ? 3  
HELX_P HELX_P46 AF1 VAL B 976  ? SER B 982  ? VAL B 976  SER B 982  1 ? 7  
HELX_P HELX_P47 AF2 ASP B 985  ? VAL B 1033 ? ASP B 985  VAL B 1033 1 ? 49 
HELX_P HELX_P48 AF3 PRO B 1140 ? SER B 1161 ? PRO B 1140 SER B 1161 1 ? 22 
HELX_P HELX_P49 AF4 ASP C 294  ? LYS C 304  ? ASP C 294  LYS C 304  1 ? 11 
HELX_P HELX_P50 AF5 PRO C 337  ? PHE C 342  ? PRO C 337  PHE C 342  1 ? 6  
HELX_P HELX_P51 AF6 SER C 349  ? TRP C 353  ? SER C 349  TRP C 353  5 ? 5  
HELX_P HELX_P52 AF7 ASP C 364  ? TYR C 369  ? ASP C 364  TYR C 369  5 ? 6  
HELX_P HELX_P53 AF8 SER C 383  ? LEU C 390  ? SER C 383  LEU C 390  5 ? 8  
HELX_P HELX_P54 AF9 ASP C 405  ? ALA C 411  ? ASP C 405  ALA C 411  5 ? 7  
HELX_P HELX_P55 AG1 GLY C 416  ? ASN C 422  ? GLY C 416  ASN C 422  1 ? 7  
HELX_P HELX_P56 AG2 SER C 438  ? SER C 443  ? SER C 438  SER C 443  1 ? 6  
HELX_P HELX_P57 AG3 ASP C 737  ? CYS C 743  ? ASP C 737  CYS C 743  1 ? 7  
HELX_P HELX_P58 AG4 SER C 746  ? LEU C 754  ? SER C 746  LEU C 754  1 ? 9  
HELX_P HELX_P59 AG5 GLN C 755  ? GLY C 757  ? GLN C 755  GLY C 757  5 ? 3  
HELX_P HELX_P60 AG6 SER C 758  ? ALA C 783  ? SER C 758  ALA C 783  1 ? 26 
HELX_P HELX_P61 AG7 ASN C 801  ? ILE C 805  ? ASN C 801  ILE C 805  5 ? 5  
HELX_P HELX_P62 AG8 SER C 816  ? VAL C 826  ? SER C 816  VAL C 826  1 ? 11 
HELX_P HELX_P63 AG9 TYR C 837  ? LEU C 841  ? TYR C 837  LEU C 841  5 ? 5  
HELX_P HELX_P64 AH1 GLY C 842  ? ASP C 848  ? GLY C 842  ASP C 848  1 ? 7  
HELX_P HELX_P65 AH2 ASP C 848  ? ASN C 856  ? ASP C 848  ASN C 856  1 ? 9  
HELX_P HELX_P66 AH3 THR C 866  ? GLY C 885  ? THR C 866  GLY C 885  1 ? 20 
HELX_P HELX_P67 AH4 TRP C 886  ? GLY C 891  ? TRP C 886  GLY C 891  1 ? 6  
HELX_P HELX_P68 AH5 PRO C 897  ? ILE C 909  ? PRO C 897  ILE C 909  1 ? 13 
HELX_P HELX_P69 AH6 GLN C 913  ? GLU C 918  ? GLN C 913  GLU C 918  1 ? 6  
HELX_P HELX_P70 AH7 ASN C 919  ? THR C 941  ? ASN C 919  THR C 941  1 ? 23 
HELX_P HELX_P71 AH8 ALA C 942  ? ALA C 944  ? ALA C 942  ALA C 944  5 ? 3  
HELX_P HELX_P72 AH9 LEU C 945  ? GLN C 965  ? LEU C 945  GLN C 965  1 ? 21 
HELX_P HELX_P73 AI1 LEU C 966  ? SER C 968  ? LEU C 966  SER C 968  5 ? 3  
HELX_P HELX_P74 AI2 VAL C 976  ? SER C 982  ? VAL C 976  SER C 982  1 ? 7  
HELX_P HELX_P75 AI3 ASP C 985  ? VAL C 1033 ? ASP C 985  VAL C 1033 1 ? 49 
HELX_P HELX_P76 AI4 PRO C 1140 ? SER C 1161 ? PRO C 1140 SER C 1161 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?    ? A  CYS 15   SG  ? ? ? 1_555 A  CYS 136  SG ? ? A  CYS 15   A  CYS 136  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf2   disulf ?    ? A  CYS 131  SG  ? ? ? 1_555 A  CYS 166  SG ? ? A  CYS 131  A  CYS 166  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf3   disulf ?    ? A  CYS 291  SG  ? ? ? 1_555 A  CYS 301  SG ? ? A  CYS 291  A  CYS 301  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf4   disulf ?    ? A  CYS 336  SG  ? ? ? 1_555 A  CYS 361  SG ? ? A  CYS 336  A  CYS 361  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf5   disulf ?    ? A  CYS 379  SG  ? ? ? 1_555 A  CYS 432  SG ? ? A  CYS 379  A  CYS 432  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf6   disulf ?    ? A  CYS 391  SG  ? ? ? 1_555 A  CYS 525  SG ? ? A  CYS 391  A  CYS 525  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf7   disulf ?    ? A  CYS 480  SG  ? ? ? 1_555 A  CYS 488  SG ? ? A  CYS 480  A  CYS 488  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf8   disulf ?    ? A  CYS 538  SG  ? ? ? 1_555 A  CYS 590  SG ? ? A  CYS 538  A  CYS 590  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf9   disulf ?    ? A  CYS 617  SG  ? ? ? 1_555 A  CYS 649  SG ? ? A  CYS 617  A  CYS 649  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf10  disulf ?    ? A  CYS 662  SG  ? ? ? 1_555 A  CYS 671  SG ? ? A  CYS 662  A  CYS 671  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf11  disulf ?    ? A  CYS 738  SG  ? ? ? 1_555 A  CYS 760  SG ? ? A  CYS 738  A  CYS 760  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf12  disulf ?    ? A  CYS 743  SG  ? ? ? 1_555 A  CYS 749  SG ? ? A  CYS 743  A  CYS 749  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf13  disulf ?    ? A  CYS 840  SG  ? ? ? 1_555 A  CYS 851  SG ? ? A  CYS 840  A  CYS 851  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf14  disulf ?    ? A  CYS 1032 SG  ? ? ? 1_555 A  CYS 1043 SG ? ? A  CYS 1032 A  CYS 1043 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf15  disulf ?    ? A  CYS 1082 SG  ? ? ? 1_555 A  CYS 1126 SG ? ? A  CYS 1082 A  CYS 1126 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf16  disulf ?    ? B  CYS 15   SG  ? ? ? 1_555 B  CYS 136  SG ? ? B  CYS 15   B  CYS 136  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf17  disulf ?    ? B  CYS 131  SG  ? ? ? 1_555 B  CYS 166  SG ? ? B  CYS 131  B  CYS 166  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf18  disulf ?    ? B  CYS 291  SG  ? ? ? 1_555 B  CYS 301  SG ? ? B  CYS 291  B  CYS 301  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf19  disulf ?    ? B  CYS 336  SG  ? ? ? 1_555 B  CYS 361  SG ? ? B  CYS 336  B  CYS 361  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf20  disulf ?    ? B  CYS 379  SG  ? ? ? 1_555 B  CYS 432  SG ? ? B  CYS 379  B  CYS 432  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf21  disulf ?    ? B  CYS 391  SG  ? ? ? 1_555 B  CYS 525  SG ? ? B  CYS 391  B  CYS 525  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf22  disulf ?    ? B  CYS 480  SG  ? ? ? 1_555 B  CYS 488  SG ? ? B  CYS 480  B  CYS 488  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf23  disulf ?    ? B  CYS 538  SG  ? ? ? 1_555 B  CYS 590  SG ? ? B  CYS 538  B  CYS 590  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf24  disulf ?    ? B  CYS 617  SG  ? ? ? 1_555 B  CYS 649  SG ? ? B  CYS 617  B  CYS 649  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf25  disulf ?    ? B  CYS 662  SG  ? ? ? 1_555 B  CYS 671  SG ? ? B  CYS 662  B  CYS 671  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf26  disulf ?    ? B  CYS 738  SG  ? ? ? 1_555 B  CYS 760  SG ? ? B  CYS 738  B  CYS 760  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf27  disulf ?    ? B  CYS 743  SG  ? ? ? 1_555 B  CYS 749  SG ? ? B  CYS 743  B  CYS 749  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf28  disulf ?    ? B  CYS 840  SG  ? ? ? 1_555 B  CYS 851  SG ? ? B  CYS 840  B  CYS 851  1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf29  disulf ?    ? B  CYS 1032 SG  ? ? ? 1_555 B  CYS 1043 SG ? ? B  CYS 1032 B  CYS 1043 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf30  disulf ?    ? B  CYS 1082 SG  ? ? ? 1_555 B  CYS 1126 SG ? ? B  CYS 1082 B  CYS 1126 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf31  disulf ?    ? C  CYS 15   SG  ? ? ? 1_555 C  CYS 136  SG ? ? C  CYS 15   C  CYS 136  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf32  disulf ?    ? C  CYS 131  SG  ? ? ? 1_555 C  CYS 166  SG ? ? C  CYS 131  C  CYS 166  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf33  disulf ?    ? C  CYS 291  SG  ? ? ? 1_555 C  CYS 301  SG ? ? C  CYS 291  C  CYS 301  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf34  disulf ?    ? C  CYS 336  SG  ? ? ? 1_555 C  CYS 361  SG ? ? C  CYS 336  C  CYS 361  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf35  disulf ?    ? C  CYS 379  SG  ? ? ? 1_555 C  CYS 432  SG ? ? C  CYS 379  C  CYS 432  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf36  disulf ?    ? C  CYS 391  SG  ? ? ? 1_555 C  CYS 525  SG ? ? C  CYS 391  C  CYS 525  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf37  disulf ?    ? C  CYS 480  SG  ? ? ? 1_555 C  CYS 488  SG ? ? C  CYS 480  C  CYS 488  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf38  disulf ?    ? C  CYS 538  SG  ? ? ? 1_555 C  CYS 590  SG ? ? C  CYS 538  C  CYS 590  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf39  disulf ?    ? C  CYS 617  SG  ? ? ? 1_555 C  CYS 649  SG ? ? C  CYS 617  C  CYS 649  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf40  disulf ?    ? C  CYS 662  SG  ? ? ? 1_555 C  CYS 671  SG ? ? C  CYS 662  C  CYS 671  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf41  disulf ?    ? C  CYS 738  SG  ? ? ? 1_555 C  CYS 760  SG ? ? C  CYS 738  C  CYS 760  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf42  disulf ?    ? C  CYS 743  SG  ? ? ? 1_555 C  CYS 749  SG ? ? C  CYS 743  C  CYS 749  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf43  disulf ?    ? C  CYS 840  SG  ? ? ? 1_555 C  CYS 851  SG ? ? C  CYS 840  C  CYS 851  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf44  disulf ?    ? C  CYS 1032 SG  ? ? ? 1_555 C  CYS 1043 SG ? ? C  CYS 1032 C  CYS 1043 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf45  disulf ?    ? C  CYS 1082 SG  ? ? ? 1_555 C  CYS 1126 SG ? ? C  CYS 1082 C  CYS 1126 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
covale1   covale one  ? A  ASN 17   ND2 ? ? ? 1_555 E  NAG .    C1 ? ? A  ASN 17   L  NAG 1    1_555 ? ? ? ? ? ? ? 1.492 ? 
N-Glycosylation 
covale2   covale one  ? A  ASN 149  ND2 ? ? ? 1_555 SA NAG .    C1 ? ? A  ASN 149  A  NAG 1406 1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale3   covale one  ? A  ASN 165  ND2 ? ? ? 1_555 I  NAG .    C1 ? ? A  ASN 165  W  NAG 1    1_555 ? ? ? ? ? ? ? 1.519 ? 
N-Glycosylation 
covale4   covale one  ? A  ASN 234  ND2 ? ? ? 1_555 J  NAG .    C1 ? ? A  ASN 234  Y  NAG 1    1_555 ? ? ? ? ? ? ? 1.471 ? 
N-Glycosylation 
covale5   covale one  ? A  ASN 603  ND2 ? ? ? 1_555 PA NAG .    C1 ? ? A  ASN 603  A  NAG 1403 1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale6   covale one  ? A  ASN 709  ND2 ? ? ? 1_555 RA NAG .    C1 ? ? A  ASN 709  A  NAG 1405 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale7   covale one  ? A  ASN 1098 ND2 ? ? ? 1_555 N  NAG .    C1 ? ? A  ASN 1098 k  NAG 1    1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale8   covale one  ? A  ASN 1134 ND2 ? ? ? 1_555 O  NAG .    C1 ? ? A  ASN 1134 n  NAG 1    1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale9   covale one  ? A  ASN 1158 ND2 ? ? ? 1_555 TA NAG .    C1 ? ? A  ASN 1158 A  NAG 1407 1_555 ? ? ? ? ? ? ? 1.535 ? 
N-Glycosylation 
covale10  covale one  ? B  ASN 17   ND2 ? ? ? 1_555 Q  NAG .    C1 ? ? B  ASN 17   0  NAG 1    1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale11  covale one  ? B  ASN 61   ND2 ? ? ? 1_555 UA NAG .    C1 ? ? B  ASN 61   B  NAG 1401 1_555 ? ? ? ? ? ? ? 1.456 ? 
N-Glycosylation 
covale12  covale one  ? B  ASN 122  ND2 ? ? ? 1_555 S  NAG .    C1 ? ? B  ASN 122  5  NAG 1    1_555 ? ? ? ? ? ? ? 1.365 ? 
N-Glycosylation 
covale13  covale one  ? B  ASN 149  ND2 ? ? ? 1_555 ZA NAG .    C1 ? ? B  ASN 149  B  NAG 1406 1_555 ? ? ? ? ? ? ? 1.528 ? 
N-Glycosylation 
covale14  covale one  ? B  ASN 234  ND2 ? ? ? 1_555 V  NAG .    C1 ? ? B  ASN 234  DA NAG 1    1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale15  covale one  ? B  ASN 331  ND2 ? ? ? 1_555 T  NAG .    C1 ? ? B  ASN 331  9  NAG 1    1_555 ? ? ? ? ? ? ? 1.288 ? 
N-Glycosylation 
covale16  covale one  ? B  ASN 343  ND2 ? ? ? 1_555 VA NAG .    C1 ? ? B  ASN 343  B  NAG 1402 1_555 ? ? ? ? ? ? ? 1.456 ? 
N-Glycosylation 
covale17  covale one  ? B  ASN 603  ND2 ? ? ? 1_555 WA NAG .    C1 ? ? B  ASN 603  B  NAG 1403 1_555 ? ? ? ? ? ? ? 1.523 ? 
N-Glycosylation 
covale18  covale one  ? B  ASN 616  ND2 ? ? ? 1_555 X  NAG .    C1 ? ? B  ASN 616  JA NAG 1    1_555 ? ? ? ? ? ? ? 1.497 ? 
N-Glycosylation 
covale19  covale one  ? B  ASN 657  ND2 ? ? ? 1_555 XA NAG .    C1 ? ? B  ASN 657  B  NAG 1404 1_555 ? ? ? ? ? ? ? 1.383 ? 
N-Glycosylation 
covale20  covale one  ? B  ASN 709  ND2 ? ? ? 1_555 YA NAG .    C1 ? ? B  ASN 709  B  NAG 1405 1_555 ? ? ? ? ? ? ? 1.496 ? 
N-Glycosylation 
covale21  covale one  ? B  ASN 717  ND2 ? ? ? 1_555 P  NAG .    C1 ? ? B  ASN 717  x  NAG 1    1_555 ? ? ? ? ? ? ? 1.582 ? 
N-Glycosylation 
covale22  covale one  ? B  ASN 801  ND2 ? ? ? 1_555 Y  NAG .    C1 ? ? B  ASN 801  MA NAG 1    1_555 ? ? ? ? ? ? ? 1.577 ? 
N-Glycosylation 
covale23  covale one  ? B  ASN 1074 ND2 ? ? ? 1_555 R  NAG .    C1 ? ? B  ASN 1074 2  NAG 1    1_555 ? ? ? ? ? ? ? 1.496 ? 
N-Glycosylation 
covale24  covale one  ? B  ASN 1098 ND2 ? ? ? 1_555 Z  NAG .    C1 ? ? B  ASN 1098 PA NAG 1    1_555 ? ? ? ? ? ? ? 1.505 ? 
N-Glycosylation 
covale25  covale one  ? B  ASN 1158 ND2 ? ? ? 1_555 AB NAG .    C1 ? ? B  ASN 1158 B  NAG 1407 1_555 ? ? ? ? ? ? ? 1.544 ? 
N-Glycosylation 
covale26  covale one  ? C  ASN 17   ND2 ? ? ? 1_555 CA NAG .    C1 ? ? C  ASN 17   fA NAG 1    1_555 ? ? ? ? ? ? ? 1.499 ? 
N-Glycosylation 
covale27  covale one  ? C  ASN 61   ND2 ? ? ? 1_555 BB NAG .    C1 ? ? C  ASN 61   C  NAG 1401 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale28  covale one  ? C  ASN 122  ND2 ? ? ? 1_555 EA NAG .    C1 ? ? C  ASN 122  kA NAG 1    1_555 ? ? ? ? ? ? ? 1.409 ? 
N-Glycosylation 
covale29  covale one  ? C  ASN 149  ND2 ? ? ? 1_555 GB NAG .    C1 ? ? C  ASN 149  C  NAG 1406 1_555 ? ? ? ? ? ? ? 1.432 ? 
N-Glycosylation 
covale30  covale one  ? C  ASN 165  ND2 ? ? ? 1_555 GA NAG .    C1 ? ? C  ASN 165  qA NAG 1    1_555 ? ? ? ? ? ? ? 1.430 ? 
N-Glycosylation 
covale31  covale one  ? C  ASN 234  ND2 ? ? ? 1_555 HA NAG .    C1 ? ? C  ASN 234  sA NAG 1    1_555 ? ? ? ? ? ? ? 1.411 ? 
N-Glycosylation 
covale32  covale one  ? C  ASN 282  ND2 ? ? ? 1_555 IA NAG .    C1 ? ? C  ASN 282  vA NAG 1    1_555 ? ? ? ? ? ? ? 1.482 ? 
N-Glycosylation 
covale33  covale one  ? C  ASN 331  ND2 ? ? ? 1_555 FA NAG .    C1 ? ? C  ASN 331  oA NAG 1    1_555 ? ? ? ? ? ? ? 1.260 ? 
N-Glycosylation 
covale34  covale one  ? C  ASN 343  ND2 ? ? ? 1_555 CB NAG .    C1 ? ? C  ASN 343  C  NAG 1402 1_555 ? ? ? ? ? ? ? 1.475 ? 
N-Glycosylation 
covale35  covale one  ? C  ASN 603  ND2 ? ? ? 1_555 DB NAG .    C1 ? ? C  ASN 603  C  NAG 1403 1_555 ? ? ? ? ? ? ? 1.514 ? 
N-Glycosylation 
covale36  covale one  ? C  ASN 616  ND2 ? ? ? 1_555 JA NAG .    C1 ? ? C  ASN 616  yA NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale37  covale one  ? C  ASN 657  ND2 ? ? ? 1_555 EB NAG .    C1 ? ? C  ASN 657  C  NAG 1404 1_555 ? ? ? ? ? ? ? 1.397 ? 
N-Glycosylation 
covale38  covale one  ? C  ASN 709  ND2 ? ? ? 1_555 FB NAG .    C1 ? ? C  ASN 709  C  NAG 1405 1_555 ? ? ? ? ? ? ? 1.466 ? 
N-Glycosylation 
covale39  covale one  ? C  ASN 717  ND2 ? ? ? 1_555 BA NAG .    C1 ? ? C  ASN 717  cA NAG 1    1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale40  covale one  ? C  ASN 801  ND2 ? ? ? 1_555 KA NAG .    C1 ? ? C  ASN 801  1A NAG 1    1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale41  covale one  ? C  ASN 1074 ND2 ? ? ? 1_555 DA NAG .    C1 ? ? C  ASN 1074 hA NAG 1    1_555 ? ? ? ? ? ? ? 1.487 ? 
N-Glycosylation 
covale42  covale one  ? C  ASN 1098 ND2 ? ? ? 1_555 LA NAG .    C1 ? ? C  ASN 1098 4A NAG 1    1_555 ? ? ? ? ? ? ? 1.428 ? 
N-Glycosylation 
covale43  covale one  ? C  ASN 1134 ND2 ? ? ? 1_555 MA NAG .    C1 ? ? C  ASN 1134 7A NAG 1    1_555 ? ? ? ? ? ? ? 1.477 ? 
N-Glycosylation 
covale44  covale one  ? C  ASN 1158 ND2 ? ? ? 1_555 HB NAG .    C1 ? ? C  ASN 1158 C  NAG 1407 1_555 ? ? ? ? ? ? ? 1.419 ? 
N-Glycosylation 
covale45  covale both ? D  NAG .    O4  ? ? ? 1_555 D  NAG .    C1 ? ? I  NAG 1    I  NAG 2    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale46  covale both ? D  NAG .    O4  ? ? ? 1_555 D  MAN .    C1 ? ? I  NAG 2    I  MAN 3    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale47  covale both ? E  NAG .    O4  ? ? ? 1_555 E  NAG .    C1 ? ? L  NAG 1    L  NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale48  covale both ? F  NAG .    O4  ? ? ? 1_555 F  NAG .    C1 ? ? N  NAG 1    N  NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale49  covale both ? F  NAG .    O6  ? ? ? 1_555 F  FUC .    C1 ? ? N  NAG 1    N  FUC 3    1_555 ? ? ? ? ? ? ? 1.455 ? ? 
covale50  covale both ? G  NAG .    O4  ? ? ? 1_555 G  NAG .    C1 ? ? Q  NAG 1    Q  NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale51  covale both ? G  NAG .    O4  ? ? ? 1_555 G  MAN .    C1 ? ? Q  NAG 2    Q  MAN 3    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale52  covale both ? H  NAG .    O4  ? ? ? 1_555 H  NAG .    C1 ? ? U  NAG 1    U  NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale53  covale both ? I  NAG .    O4  ? ? ? 1_555 I  NAG .    C1 ? ? W  NAG 1    W  NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale54  covale both ? J  NAG .    O4  ? ? ? 1_555 J  NAG .    C1 ? ? Y  NAG 1    Y  NAG 2    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale55  covale both ? J  NAG .    O4  ? ? ? 1_555 J  MAN .    C1 ? ? Y  NAG 2    Y  MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale56  covale both ? K  NAG .    O4  ? ? ? 1_555 K  NAG .    C1 ? ? b  NAG 1    b  NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale57  covale both ? K  NAG .    O4  ? ? ? 1_555 K  MAN .    C1 ? ? b  NAG 2    b  MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale58  covale both ? L  NAG .    O4  ? ? ? 1_555 L  NAG .    C1 ? ? e  NAG 1    e  NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale59  covale both ? L  NAG .    O4  ? ? ? 1_555 L  MAN .    C1 ? ? e  NAG 2    e  MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale60  covale both ? M  NAG .    O4  ? ? ? 1_555 M  NAG .    C1 ? ? h  NAG 1    h  NAG 2    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale61  covale both ? M  NAG .    O4  ? ? ? 1_555 M  MAN .    C1 ? ? h  NAG 2    h  MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale62  covale both ? N  NAG .    O4  ? ? ? 1_555 N  NAG .    C1 ? ? k  NAG 1    k  NAG 2    1_555 ? ? ? ? ? ? ? 1.454 ? ? 
covale63  covale both ? N  NAG .    O4  ? ? ? 1_555 N  MAN .    C1 ? ? k  NAG 2    k  MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale64  covale both ? O  NAG .    O4  ? ? ? 1_555 O  NAG .    C1 ? ? n  NAG 1    n  NAG 2    1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale65  covale both ? O  NAG .    O4  ? ? ? 1_555 O  MAN .    C1 ? ? n  NAG 2    n  MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale66  covale both ? O  MAN .    O3  ? ? ? 1_555 O  MAN .    C1 ? ? n  MAN 3    n  MAN 4    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale67  covale both ? P  NAG .    O4  ? ? ? 1_555 P  NAG .    C1 ? ? x  NAG 1    x  NAG 2    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale68  covale both ? P  NAG .    O4  ? ? ? 1_555 P  MAN .    C1 ? ? x  NAG 2    x  MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale69  covale both ? Q  NAG .    O4  ? ? ? 1_555 Q  NAG .    C1 ? ? 0  NAG 1    0  NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale70  covale both ? R  NAG .    O4  ? ? ? 1_555 R  NAG .    C1 ? ? 2  NAG 1    2  NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale71  covale both ? R  NAG .    O6  ? ? ? 1_555 R  FUC .    C1 ? ? 2  NAG 1    2  FUC 3    1_555 ? ? ? ? ? ? ? 1.457 ? ? 
covale72  covale both ? S  NAG .    O4  ? ? ? 1_555 S  NAG .    C1 ? ? 5  NAG 1    5  NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale73  covale both ? S  NAG .    O4  ? ? ? 1_555 S  MAN .    C1 ? ? 5  NAG 2    5  MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale74  covale both ? T  NAG .    O4  ? ? ? 1_555 T  NAG .    C1 ? ? 9  NAG 1    9  NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale75  covale both ? U  NAG .    O4  ? ? ? 1_555 U  NAG .    C1 ? ? BA NAG 1    BA NAG 2    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale76  covale both ? V  NAG .    O4  ? ? ? 1_555 V  NAG .    C1 ? ? DA NAG 1    DA NAG 2    1_555 ? ? ? ? ? ? ? 1.455 ? ? 
covale77  covale both ? V  NAG .    O4  ? ? ? 1_555 V  MAN .    C1 ? ? DA NAG 2    DA MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale78  covale both ? W  NAG .    O4  ? ? ? 1_555 W  NAG .    C1 ? ? GA NAG 1    GA NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale79  covale both ? W  NAG .    O4  ? ? ? 1_555 W  MAN .    C1 ? ? GA NAG 2    GA MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale80  covale both ? X  NAG .    O4  ? ? ? 1_555 X  NAG .    C1 ? ? JA NAG 1    JA NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale81  covale both ? X  NAG .    O4  ? ? ? 1_555 X  MAN .    C1 ? ? JA NAG 2    JA MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale82  covale both ? Y  NAG .    O4  ? ? ? 1_555 Y  NAG .    C1 ? ? MA NAG 1    MA NAG 2    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale83  covale both ? Y  NAG .    O4  ? ? ? 1_555 Y  MAN .    C1 ? ? MA NAG 2    MA MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale84  covale both ? Z  NAG .    O4  ? ? ? 1_555 Z  NAG .    C1 ? ? PA NAG 1    PA NAG 2    1_555 ? ? ? ? ? ? ? 1.453 ? ? 
covale85  covale both ? Z  NAG .    O4  ? ? ? 1_555 Z  MAN .    C1 ? ? PA NAG 2    PA MAN 3    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale86  covale both ? AA NAG .    O4  ? ? ? 1_555 AA NAG .    C1 ? ? SA NAG 1    SA NAG 2    1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale87  covale both ? AA NAG .    O4  ? ? ? 1_555 AA MAN .    C1 ? ? SA NAG 2    SA MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale88  covale both ? AA MAN .    O3  ? ? ? 1_555 AA MAN .    C1 ? ? SA MAN 3    SA MAN 4    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale89  covale both ? BA NAG .    O4  ? ? ? 1_555 BA NAG .    C1 ? ? cA NAG 1    cA NAG 2    1_555 ? ? ? ? ? ? ? 1.453 ? ? 
covale90  covale both ? BA NAG .    O4  ? ? ? 1_555 BA MAN .    C1 ? ? cA NAG 2    cA MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale91  covale both ? CA NAG .    O4  ? ? ? 1_555 CA NAG .    C1 ? ? fA NAG 1    fA NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale92  covale both ? DA NAG .    O4  ? ? ? 1_555 DA NAG .    C1 ? ? hA NAG 1    hA NAG 2    1_555 ? ? ? ? ? ? ? 1.436 ? ? 
covale93  covale both ? DA NAG .    O6  ? ? ? 1_555 DA FUC .    C1 ? ? hA NAG 1    hA FUC 3    1_555 ? ? ? ? ? ? ? 1.458 ? ? 
covale94  covale both ? EA NAG .    O4  ? ? ? 1_555 EA NAG .    C1 ? ? kA NAG 1    kA NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale95  covale both ? EA NAG .    O4  ? ? ? 1_555 EA MAN .    C1 ? ? kA NAG 2    kA MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale96  covale both ? FA NAG .    O4  ? ? ? 1_555 FA NAG .    C1 ? ? oA NAG 1    oA NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale97  covale both ? GA NAG .    O4  ? ? ? 1_555 GA NAG .    C1 ? ? qA NAG 1    qA NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale98  covale both ? HA NAG .    O4  ? ? ? 1_555 HA NAG .    C1 ? ? sA NAG 1    sA NAG 2    1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale99  covale both ? HA NAG .    O4  ? ? ? 1_555 HA MAN .    C1 ? ? sA NAG 2    sA MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale100 covale both ? IA NAG .    O4  ? ? ? 1_555 IA NAG .    C1 ? ? vA NAG 1    vA NAG 2    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale101 covale both ? IA NAG .    O4  ? ? ? 1_555 IA MAN .    C1 ? ? vA NAG 2    vA MAN 3    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale102 covale both ? JA NAG .    O4  ? ? ? 1_555 JA NAG .    C1 ? ? yA NAG 1    yA NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale103 covale both ? JA NAG .    O4  ? ? ? 1_555 JA MAN .    C1 ? ? yA NAG 2    yA MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale104 covale both ? KA NAG .    O4  ? ? ? 1_555 KA NAG .    C1 ? ? 1A NAG 1    1A NAG 2    1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale105 covale both ? KA NAG .    O4  ? ? ? 1_555 KA MAN .    C1 ? ? 1A NAG 2    1A MAN 3    1_555 ? ? ? ? ? ? ? 1.449 ? ? 
covale106 covale both ? LA NAG .    O4  ? ? ? 1_555 LA NAG .    C1 ? ? 4A NAG 1    4A NAG 2    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale107 covale both ? LA NAG .    O4  ? ? ? 1_555 LA MAN .    C1 ? ? 4A NAG 2    4A MAN 3    1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale108 covale both ? MA NAG .    O4  ? ? ? 1_555 MA NAG .    C1 ? ? 7A NAG 1    7A NAG 2    1_555 ? ? ? ? ? ? ? 1.451 ? ? 
covale109 covale both ? MA NAG .    O4  ? ? ? 1_555 MA MAN .    C1 ? ? 7A NAG 2    7A MAN 3    1_555 ? ? ? ? ? ? ? 1.447 ? ? 
covale110 covale both ? MA MAN .    O3  ? ? ? 1_555 MA MAN .    C1 ? ? 7A MAN 3    7A MAN 4    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 7 ? 
AA3 ? 3 ? 
AA4 ? 4 ? 
AA5 ? 6 ? 
AA6 ? 5 ? 
AA7 ? 3 ? 
AA8 ? 6 ? 
AA9 ? 5 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 3 ? 
AC5 ? 7 ? 
AC6 ? 3 ? 
AC7 ? 6 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 6 ? 
AD2 ? 5 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 4 ? 
AE3 ? 3 ? 
AE4 ? 3 ? 
AE5 ? 7 ? 
AE6 ? 3 ? 
AE7 ? 6 ? 
AE8 ? 4 ? 
AE9 ? 5 ? 
AF1 ? 6 ? 
AF2 ? 5 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 4 ? 
AF7 ? 2 ? 
AF8 ? 3 ? 
AF9 ? 2 ? 
AG1 ? 4 ? 
AG2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AC1 1 2 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC5 5 6 ? anti-parallel 
AC5 6 7 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC7 5 6 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD3 1 2 ? parallel      
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? parallel      
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE5 5 6 ? anti-parallel 
AE5 6 7 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE7 4 5 ? anti-parallel 
AE7 5 6 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? parallel      
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AE9 4 5 ? anti-parallel 
AF1 1 2 ? parallel      
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? anti-parallel 
AF1 5 6 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF3 1 2 ? parallel      
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? parallel      
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? parallel      
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 27   ? SER A 31   ? ALA A 27   SER A 31   
AA1 2 SER A 60   ? ILE A 68   ? SER A 60   ILE A 68   
AA1 3 ARG A 78   ? PHE A 79   ? ARG A 78   PHE A 79   
AA2 1 ALA A 27   ? SER A 31   ? ALA A 27   SER A 31   
AA2 2 SER A 60   ? ILE A 68   ? SER A 60   ILE A 68   
AA2 3 ALA A 263  ? TYR A 269  ? ALA A 263  TYR A 269  
AA2 4 VAL A 90   ? GLU A 96   ? VAL A 90   GLU A 96   
AA2 5 PHE A 186  ? ILE A 197  ? PHE A 186  ILE A 197  
AA2 6 TYR A 200  ? LEU A 212  ? TYR A 200  LEU A 212  
AA2 7 GLU A 224  ? LEU A 229  ? GLU A 224  LEU A 229  
AA3 1 VAL A 47   ? PHE A 55   ? VAL A 47   PHE A 55   
AA3 2 GLN A 271  ? TYR A 279  ? GLN A 271  TYR A 279  
AA3 3 ILE A 285  ? ASP A 290  ? ILE A 285  ASP A 290  
AA4 1 LEU A 84   ? PRO A 85   ? LEU A 84   PRO A 85   
AA4 2 ARG A 237  ? LEU A 244  ? ARG A 237  LEU A 244  
AA4 3 PHE A 135  ? TYR A 144  ? PHE A 135  TYR A 144  
AA4 4 MET A 153  ? TYR A 160  ? MET A 153  TYR A 160  
AA5 1 LEU A 84   ? PRO A 85   ? LEU A 84   PRO A 85   
AA5 2 ARG A 237  ? LEU A 244  ? ARG A 237  LEU A 244  
AA5 3 ILE A 101  ? GLY A 107  ? ILE A 101  GLY A 107  
AA5 4 SER A 116  ? ASN A 121  ? SER A 116  ASN A 121  
AA5 5 VAL A 126  ? CYS A 131  ? VAL A 126  CYS A 131  
AA5 6 CYS A 166  ? VAL A 171  ? CYS A 166  VAL A 171  
AA6 1 GLY A 311  ? THR A 315  ? GLY A 311  THR A 315  
AA6 2 VAL A 595  ? THR A 599  ? VAL A 595  THR A 599  
AA6 3 ALA A 609  ? TYR A 612  ? ALA A 609  TYR A 612  
AA6 4 GLY A 648  ? ILE A 651  ? GLY A 648  ILE A 651  
AA6 5 VAL A 642  ? THR A 645  ? VAL A 642  THR A 645  
AA7 1 GLU A 324  ? ARG A 328  ? GLU A 324  ARG A 328  
AA7 2 CYS A 538  ? PHE A 543  ? CYS A 538  PHE A 543  
AA7 3 LEU A 546  ? THR A 547  ? LEU A 546  THR A 547  
AA8 1 GLU A 324  ? ARG A 328  ? GLU A 324  ARG A 328  
AA8 2 CYS A 538  ? PHE A 543  ? CYS A 538  PHE A 543  
AA8 3 GLY A 550  ? GLU A 554  ? GLY A 550  GLU A 554  
AA8 4 ILE A 584  ? THR A 588  ? ILE A 584  THR A 588  
AA8 5 THR A 573  ? ARG A 577  ? THR A 573  ARG A 577  
AA8 6 PHE A 565  ? ARG A 567  ? PHE A 565  ARG A 567  
AA9 1 ASN A 354  ? ILE A 358  ? ASN A 354  ILE A 358  
AA9 2 VAL A 395  ? ARG A 403  ? VAL A 395  ARG A 403  
AA9 3 PRO A 507  ? PHE A 515  ? PRO A 507  PHE A 515  
AA9 4 GLY A 431  ? ASN A 437  ? GLY A 431  ASN A 437  
AA9 5 THR A 376  ? CYS A 379  ? THR A 376  CYS A 379  
AB1 1 CYS A 361  ? VAL A 362  ? CYS A 361  VAL A 362  
AB1 2 VAL A 524  ? CYS A 525  ? VAL A 524  CYS A 525  
AB1 3 CYS A 391  ? PHE A 392  ? CYS A 391  PHE A 392  
AB2 1 LEU A 452  ? ARG A 454  ? LEU A 452  ARG A 454  
AB2 2 LEU A 492  ? SER A 494  ? LEU A 492  SER A 494  
AB3 1 TYR A 473  ? GLN A 474  ? TYR A 473  GLN A 474  
AB3 2 CYS A 488  ? TYR A 489  ? CYS A 488  TYR A 489  
AB4 1 GLU A 654  ? HIS A 655  ? GLU A 654  HIS A 655  
AB4 2 SER A 691  ? THR A 696  ? SER A 691  THR A 696  
AB4 3 ILE A 670  ? GLN A 675  ? ILE A 670  GLN A 675  
AB4 4 ILE A 664  ? GLY A 667  ? ILE A 664  GLY A 667  
AB5 1 ALA A 701  ? SER A 704  ? ALA A 701  SER A 704  
AB5 2 GLN B 787  ? LYS B 790  ? GLN B 787  LYS B 790  
AB6 1 SER A 711  ? PRO A 715  ? SER A 711  PRO A 715  
AB6 2 GLU A 1072 ? THR A 1076 ? GLU A 1072 THR A 1076 
AB7 1 PHE A 718  ? PRO A 728  ? PHE A 718  PRO A 728  
AB7 2 GLY A 1059 ? PRO A 1069 ? GLY A 1059 PRO A 1069 
AB7 3 TYR A 1047 ? ALA A 1056 ? TYR A 1047 ALA A 1056 
AB8 1 LYS A 733  ? VAL A 736  ? LYS A 733  VAL A 736  
AB8 2 LEU A 858  ? LEU A 861  ? LEU A 858  LEU A 861  
AB9 1 GLN A 787  ? LYS A 790  ? GLN A 787  LYS A 790  
AB9 2 ALA C 701  ? SER C 704  ? ALA C 701  SER C 704  
AC1 1 ILE A 1081 ? CYS A 1082 ? ILE A 1081 CYS A 1082 
AC1 2 VAL A 1133 ? ASN A 1134 ? VAL A 1133 ASN A 1134 
AC2 1 HIS A 1088 ? PRO A 1090 ? HIS A 1088 PRO A 1090 
AC2 2 THR A 1120 ? VAL A 1122 ? THR A 1120 VAL A 1122 
AC3 1 VAL A 1094 ? SER A 1097 ? VAL A 1094 SER A 1097 
AC3 2 TRP A 1102 ? THR A 1105 ? TRP A 1102 THR A 1105 
AC3 3 GLN A 1113 ? ILE A 1114 ? GLN A 1113 ILE A 1114 
AC4 1 ALA B 27   ? SER B 31   ? ALA B 27   SER B 31   
AC4 2 SER B 60   ? ILE B 68   ? SER B 60   ILE B 68   
AC4 3 ARG B 78   ? PHE B 79   ? ARG B 78   PHE B 79   
AC5 1 ALA B 27   ? SER B 31   ? ALA B 27   SER B 31   
AC5 2 SER B 60   ? ILE B 68   ? SER B 60   ILE B 68   
AC5 3 ALA B 263  ? TYR B 269  ? ALA B 263  TYR B 269  
AC5 4 VAL B 90   ? GLU B 96   ? VAL B 90   GLU B 96   
AC5 5 ASN B 188  ? ILE B 197  ? ASN B 188  ILE B 197  
AC5 6 TYR B 200  ? PRO B 209  ? TYR B 200  PRO B 209  
AC5 7 GLU B 224  ? LEU B 229  ? GLU B 224  LEU B 229  
AC6 1 VAL B 47   ? PHE B 55   ? VAL B 47   PHE B 55   
AC6 2 GLN B 271  ? TYR B 279  ? GLN B 271  TYR B 279  
AC6 3 ILE B 285  ? ASP B 290  ? ILE B 285  ASP B 290  
AC7 1 LEU B 84   ? PRO B 85   ? LEU B 84   PRO B 85   
AC7 2 ARG B 237  ? LEU B 244  ? ARG B 237  LEU B 244  
AC7 3 ILE B 101  ? GLY B 107  ? ILE B 101  GLY B 107  
AC7 4 SER B 116  ? ASN B 121  ? SER B 116  ASN B 121  
AC7 5 VAL B 126  ? TYR B 144  ? VAL B 126  TYR B 144  
AC7 6 MET B 153  ? VAL B 171  ? MET B 153  VAL B 171  
AC8 1 LEU B 84   ? PRO B 85   ? LEU B 84   PRO B 85   
AC8 2 ARG B 237  ? LEU B 244  ? ARG B 237  LEU B 244  
AC8 3 VAL B 126  ? TYR B 144  ? VAL B 126  TYR B 144  
AC8 4 MET B 153  ? VAL B 171  ? MET B 153  VAL B 171  
AC9 1 GLY B 311  ? THR B 315  ? GLY B 311  THR B 315  
AC9 2 VAL B 595  ? THR B 599  ? VAL B 595  THR B 599  
AC9 3 ALA B 609  ? TYR B 612  ? ALA B 609  TYR B 612  
AC9 4 GLY B 648  ? ILE B 651  ? GLY B 648  ILE B 651  
AC9 5 VAL B 642  ? THR B 645  ? VAL B 642  THR B 645  
AD1 1 GLU B 324  ? ARG B 328  ? GLU B 324  ARG B 328  
AD1 2 CYS B 538  ? PHE B 543  ? CYS B 538  PHE B 543  
AD1 3 LEU B 546  ? GLU B 554  ? LEU B 546  GLU B 554  
AD1 4 ILE B 584  ? THR B 588  ? ILE B 584  THR B 588  
AD1 5 THR B 573  ? ARG B 577  ? THR B 573  ARG B 577  
AD1 6 PHE B 565  ? ARG B 567  ? PHE B 565  ARG B 567  
AD2 1 ASN B 354  ? ILE B 358  ? ASN B 354  ILE B 358  
AD2 2 VAL B 395  ? ARG B 403  ? VAL B 395  ARG B 403  
AD2 3 PRO B 507  ? PHE B 515  ? PRO B 507  PHE B 515  
AD2 4 GLY B 431  ? ASN B 437  ? GLY B 431  ASN B 437  
AD2 5 THR B 376  ? CYS B 379  ? THR B 376  CYS B 379  
AD3 1 CYS B 361  ? VAL B 362  ? CYS B 361  VAL B 362  
AD3 2 VAL B 524  ? CYS B 525  ? VAL B 524  CYS B 525  
AD3 3 CYS B 391  ? PHE B 392  ? CYS B 391  PHE B 392  
AD4 1 LEU B 452  ? ARG B 454  ? LEU B 452  ARG B 454  
AD4 2 LEU B 492  ? SER B 494  ? LEU B 492  SER B 494  
AD5 1 TYR B 473  ? GLN B 474  ? TYR B 473  GLN B 474  
AD5 2 CYS B 488  ? TYR B 489  ? CYS B 488  TYR B 489  
AD6 1 GLU B 654  ? HIS B 655  ? GLU B 654  HIS B 655  
AD6 2 SER B 691  ? THR B 696  ? SER B 691  THR B 696  
AD6 3 ILE B 670  ? GLN B 675  ? ILE B 670  GLN B 675  
AD6 4 ILE B 664  ? GLY B 667  ? ILE B 664  GLY B 667  
AD7 1 ALA B 701  ? SER B 704  ? ALA B 701  SER B 704  
AD7 2 GLN C 787  ? LYS C 790  ? GLN C 787  LYS C 790  
AD8 1 SER B 711  ? PRO B 715  ? SER B 711  PRO B 715  
AD8 2 GLU B 1072 ? THR B 1076 ? GLU B 1072 THR B 1076 
AD9 1 PHE B 718  ? PRO B 728  ? PHE B 718  PRO B 728  
AD9 2 GLY B 1059 ? PRO B 1069 ? GLY B 1059 PRO B 1069 
AD9 3 TYR B 1047 ? ALA B 1056 ? TYR B 1047 ALA B 1056 
AE1 1 LYS B 733  ? VAL B 736  ? LYS B 733  VAL B 736  
AE1 2 LEU B 858  ? LEU B 861  ? LEU B 858  LEU B 861  
AE2 1 THR B 1120 ? ASN B 1125 ? THR B 1120 ASN B 1125 
AE2 2 LYS B 1086 ? PRO B 1090 ? LYS B 1086 PRO B 1090 
AE2 3 ILE B 1081 ? CYS B 1082 ? ILE B 1081 CYS B 1082 
AE2 4 VAL B 1133 ? ASN B 1134 ? VAL B 1133 ASN B 1134 
AE3 1 VAL B 1094 ? SER B 1097 ? VAL B 1094 SER B 1097 
AE3 2 TRP B 1102 ? THR B 1105 ? TRP B 1102 THR B 1105 
AE3 3 GLN B 1113 ? ILE B 1114 ? GLN B 1113 ILE B 1114 
AE4 1 ALA C 27   ? SER C 31   ? ALA C 27   SER C 31   
AE4 2 SER C 60   ? ILE C 68   ? SER C 60   ILE C 68   
AE4 3 ARG C 78   ? PHE C 79   ? ARG C 78   PHE C 79   
AE5 1 ALA C 27   ? SER C 31   ? ALA C 27   SER C 31   
AE5 2 SER C 60   ? ILE C 68   ? SER C 60   ILE C 68   
AE5 3 ALA C 263  ? TYR C 269  ? ALA C 263  TYR C 269  
AE5 4 VAL C 90   ? GLU C 96   ? VAL C 90   GLU C 96   
AE5 5 PHE C 186  ? ILE C 197  ? PHE C 186  ILE C 197  
AE5 6 TYR C 200  ? LEU C 212  ? TYR C 200  LEU C 212  
AE5 7 GLU C 224  ? LEU C 229  ? GLU C 224  LEU C 229  
AE6 1 VAL C 47   ? PHE C 55   ? VAL C 47   PHE C 55   
AE6 2 GLN C 271  ? TYR C 279  ? GLN C 271  TYR C 279  
AE6 3 ILE C 285  ? ASP C 290  ? ILE C 285  ASP C 290  
AE7 1 LEU C 84   ? PRO C 85   ? LEU C 84   PRO C 85   
AE7 2 ARG C 237  ? LEU C 244  ? ARG C 237  LEU C 244  
AE7 3 ILE C 101  ? GLY C 107  ? ILE C 101  GLY C 107  
AE7 4 SER C 116  ? ASN C 122  ? SER C 116  ASN C 122  
AE7 5 ASN C 125  ? TYR C 144  ? ASN C 125  TYR C 144  
AE7 6 MET C 153  ? VAL C 171  ? MET C 153  VAL C 171  
AE8 1 LEU C 84   ? PRO C 85   ? LEU C 84   PRO C 85   
AE8 2 ARG C 237  ? LEU C 244  ? ARG C 237  LEU C 244  
AE8 3 ASN C 125  ? TYR C 144  ? ASN C 125  TYR C 144  
AE8 4 MET C 153  ? VAL C 171  ? MET C 153  VAL C 171  
AE9 1 GLY C 311  ? THR C 315  ? GLY C 311  THR C 315  
AE9 2 VAL C 595  ? THR C 599  ? VAL C 595  THR C 599  
AE9 3 ALA C 609  ? TYR C 612  ? ALA C 609  TYR C 612  
AE9 4 GLY C 648  ? ILE C 651  ? GLY C 648  ILE C 651  
AE9 5 VAL C 642  ? THR C 645  ? VAL C 642  THR C 645  
AF1 1 GLU C 324  ? SER C 325  ? GLU C 324  SER C 325  
AF1 2 CYS C 538  ? PHE C 543  ? CYS C 538  PHE C 543  
AF1 3 LEU C 546  ? GLU C 554  ? LEU C 546  GLU C 554  
AF1 4 ILE C 584  ? THR C 588  ? ILE C 584  THR C 588  
AF1 5 THR C 573  ? ARG C 577  ? THR C 573  ARG C 577  
AF1 6 PHE C 565  ? ARG C 567  ? PHE C 565  ARG C 567  
AF2 1 ASN C 354  ? ILE C 358  ? ASN C 354  ILE C 358  
AF2 2 VAL C 395  ? ARG C 403  ? VAL C 395  ARG C 403  
AF2 3 PRO C 507  ? SER C 514  ? PRO C 507  SER C 514  
AF2 4 GLY C 431  ? ASN C 437  ? GLY C 431  ASN C 437  
AF2 5 THR C 376  ? CYS C 379  ? THR C 376  CYS C 379  
AF3 1 CYS C 361  ? VAL C 362  ? CYS C 361  VAL C 362  
AF3 2 VAL C 524  ? CYS C 525  ? VAL C 524  CYS C 525  
AF4 1 LEU C 452  ? ARG C 454  ? LEU C 452  ARG C 454  
AF4 2 LEU C 492  ? SER C 494  ? LEU C 492  SER C 494  
AF5 1 TYR C 473  ? GLN C 474  ? TYR C 473  GLN C 474  
AF5 2 CYS C 488  ? TYR C 489  ? CYS C 488  TYR C 489  
AF6 1 GLU C 654  ? HIS C 655  ? GLU C 654  HIS C 655  
AF6 2 SER C 691  ? THR C 696  ? SER C 691  THR C 696  
AF6 3 ILE C 670  ? GLN C 675  ? ILE C 670  GLN C 675  
AF6 4 ILE C 664  ? GLY C 667  ? ILE C 664  GLY C 667  
AF7 1 SER C 711  ? PRO C 715  ? SER C 711  PRO C 715  
AF7 2 GLU C 1072 ? THR C 1076 ? GLU C 1072 THR C 1076 
AF8 1 PHE C 718  ? PRO C 728  ? PHE C 718  PRO C 728  
AF8 2 GLY C 1059 ? PRO C 1069 ? GLY C 1059 PRO C 1069 
AF8 3 TYR C 1047 ? ALA C 1056 ? TYR C 1047 ALA C 1056 
AF9 1 LYS C 733  ? VAL C 736  ? LYS C 733  VAL C 736  
AF9 2 LEU C 858  ? LEU C 861  ? LEU C 858  LEU C 861  
AG1 1 THR C 1120 ? VAL C 1122 ? THR C 1120 VAL C 1122 
AG1 2 ALA C 1087 ? PRO C 1090 ? ALA C 1087 PRO C 1090 
AG1 3 ILE C 1081 ? CYS C 1082 ? ILE C 1081 CYS C 1082 
AG1 4 VAL C 1133 ? ASN C 1134 ? VAL C 1133 ASN C 1134 
AG2 1 VAL C 1094 ? SER C 1097 ? VAL C 1094 SER C 1097 
AG2 2 TRP C 1102 ? THR C 1105 ? TRP C 1102 THR C 1105 
AG2 3 GLN C 1113 ? ILE C 1114 ? GLN C 1113 ILE C 1114 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 31   ? N SER A 31   O SER A 60   ? O SER A 60   
AA1 2 3 N ILE A 68   ? N ILE A 68   O ARG A 78   ? O ARG A 78   
AA2 1 2 N SER A 31   ? N SER A 31   O SER A 60   ? O SER A 60   
AA2 2 3 N THR A 63   ? N THR A 63   O VAL A 267  ? O VAL A 267  
AA2 3 4 O TYR A 266  ? O TYR A 266  N ALA A 93   ? N ALA A 93   
AA2 4 5 N PHE A 92   ? N PHE A 92   O PHE A 192  ? O PHE A 192  
AA2 5 6 N LYS A 195  ? N LYS A 195  O LYS A 202  ? O LYS A 202  
AA2 6 7 N PHE A 201  ? N PHE A 201  O LEU A 229  ? O LEU A 229  
AA3 1 2 N THR A 51   ? N THR A 51   O PHE A 275  ? O PHE A 275  
AA3 2 3 N LYS A 278  ? N LYS A 278  O ASP A 287  ? O ASP A 287  
AA4 1 2 N LEU A 84   ? N LEU A 84   O PHE A 238  ? O PHE A 238  
AA4 2 3 O LEU A 244  ? O LEU A 244  N VAL A 143  ? N VAL A 143  
AA4 3 4 N CYS A 136  ? N CYS A 136  O VAL A 159  ? O VAL A 159  
AA5 1 2 N LEU A 84   ? N LEU A 84   O PHE A 238  ? O PHE A 238  
AA5 2 3 O ARG A 237  ? O ARG A 237  N GLY A 107  ? N GLY A 107  
AA5 3 4 N ARG A 102  ? N ARG A 102  O ASN A 121  ? O ASN A 121  
AA5 4 5 N LEU A 118  ? N LEU A 118  O LYS A 129  ? O LYS A 129  
AA5 5 6 N ILE A 128  ? N ILE A 128  O TYR A 170  ? O TYR A 170  
AA6 1 2 N THR A 315  ? N THR A 315  O VAL A 595  ? O VAL A 595  
AA6 2 3 N SER A 596  ? N SER A 596  O LEU A 611  ? O LEU A 611  
AA6 3 4 N VAL A 610  ? N VAL A 610  O ILE A 651  ? O ILE A 651  
AA6 4 5 O LEU A 650  ? O LEU A 650  N PHE A 643  ? N PHE A 643  
AA7 1 2 N ARG A 328  ? N ARG A 328  O ASN A 542  ? O ASN A 542  
AA7 2 3 N PHE A 543  ? N PHE A 543  O LEU A 546  ? O LEU A 546  
AA8 1 2 N ARG A 328  ? N ARG A 328  O ASN A 542  ? O ASN A 542  
AA8 2 3 N VAL A 539  ? N VAL A 539  O GLY A 550  ? O GLY A 550  
AA8 3 4 N VAL A 551  ? N VAL A 551  O THR A 588  ? O THR A 588  
AA8 4 5 O LEU A 585  ? O LEU A 585  N VAL A 576  ? N VAL A 576  
AA8 5 6 O ALA A 575  ? O ALA A 575  N GLY A 566  ? N GLY A 566  
AA9 1 2 N ILE A 358  ? N ILE A 358  O VAL A 395  ? O VAL A 395  
AA9 2 3 N ILE A 402  ? N ILE A 402  O TYR A 508  ? O TYR A 508  
AA9 3 4 O VAL A 511  ? O VAL A 511  N ILE A 434  ? N ILE A 434  
AA9 4 5 O VAL A 433  ? O VAL A 433  N LYS A 378  ? N LYS A 378  
AB1 1 2 N CYS A 361  ? N CYS A 361  O CYS A 525  ? O CYS A 525  
AB1 2 3 O VAL A 524  ? O VAL A 524  N PHE A 392  ? N PHE A 392  
AB2 1 2 N TYR A 453  ? N TYR A 453  O GLN A 493  ? O GLN A 493  
AB3 1 2 N TYR A 473  ? N TYR A 473  O TYR A 489  ? O TYR A 489  
AB4 1 2 N GLU A 654  ? N GLU A 654  O ALA A 694  ? O ALA A 694  
AB4 2 3 O ILE A 693  ? O ILE A 693  N SER A 673  ? N SER A 673  
AB4 3 4 O ALA A 672  ? O ALA A 672  N ILE A 664  ? N ILE A 664  
AB5 1 2 N ALA A 701  ? N ALA A 701  O ILE B 788  ? O ILE B 788  
AB6 1 2 N ILE A 712  ? N ILE A 712  O PHE A 1075 ? O PHE A 1075 
AB7 1 2 N THR A 723  ? N THR A 723  O HIS A 1064 ? O HIS A 1064 
AB7 2 3 O VAL A 1065 ? O VAL A 1065 N MET A 1050 ? N MET A 1050 
AB8 1 2 N SER A 735  ? N SER A 735  O THR A 859  ? O THR A 859  
AB9 1 2 N ILE A 788  ? N ILE A 788  O ASN C 703  ? O ASN C 703  
AC1 1 2 N CYS A 1082 ? N CYS A 1082 O VAL A 1133 ? O VAL A 1133 
AC2 1 2 N PHE A 1089 ? N PHE A 1089 O PHE A 1121 ? O PHE A 1121 
AC3 1 2 N VAL A 1094 ? N VAL A 1094 O THR A 1105 ? O THR A 1105 
AC3 2 3 N VAL A 1104 ? N VAL A 1104 O GLN A 1113 ? O GLN A 1113 
AC4 1 2 N THR B 29   ? N THR B 29   O VAL B 62   ? O VAL B 62   
AC4 2 3 N ILE B 68   ? N ILE B 68   O ARG B 78   ? O ARG B 78   
AC5 1 2 N THR B 29   ? N THR B 29   O VAL B 62   ? O VAL B 62   
AC5 2 3 N ALA B 67   ? N ALA B 67   O ALA B 263  ? O ALA B 263  
AC5 3 4 O TYR B 266  ? O TYR B 266  N ALA B 93   ? N ALA B 93   
AC5 4 5 N PHE B 92   ? N PHE B 92   O PHE B 192  ? O PHE B 192  
AC5 5 6 N LYS B 195  ? N LYS B 195  O LYS B 202  ? O LYS B 202  
AC5 6 7 N PHE B 201  ? N PHE B 201  O LEU B 229  ? O LEU B 229  
AC6 1 2 N THR B 51   ? N THR B 51   O PHE B 275  ? O PHE B 275  
AC6 2 3 N LYS B 278  ? N LYS B 278  O ASP B 287  ? O ASP B 287  
AC7 1 2 N LEU B 84   ? N LEU B 84   O PHE B 238  ? O PHE B 238  
AC7 2 3 O LEU B 241  ? O LEU B 241  N ARG B 102  ? N ARG B 102  
AC7 3 4 N PHE B 106  ? N PHE B 106  O LEU B 117  ? O LEU B 117  
AC7 4 5 N LEU B 118  ? N LEU B 118  O LYS B 129  ? O LYS B 129  
AC7 5 6 N TYR B 144  ? N TYR B 144  O MET B 153  ? O MET B 153  
AC8 1 2 N LEU B 84   ? N LEU B 84   O PHE B 238  ? O PHE B 238  
AC8 2 3 O LEU B 244  ? O LEU B 244  N LEU B 141  ? N LEU B 141  
AC8 3 4 N TYR B 144  ? N TYR B 144  O MET B 153  ? O MET B 153  
AC9 1 2 N TYR B 313  ? N TYR B 313  O VAL B 597  ? O VAL B 597  
AC9 2 3 N SER B 596  ? N SER B 596  O LEU B 611  ? O LEU B 611  
AC9 3 4 N VAL B 610  ? N VAL B 610  O ILE B 651  ? O ILE B 651  
AC9 4 5 O LEU B 650  ? O LEU B 650  N PHE B 643  ? N PHE B 643  
AD1 1 2 N ARG B 328  ? N ARG B 328  O ASN B 542  ? O ASN B 542  
AD1 2 3 N PHE B 541  ? N PHE B 541  O GLY B 548  ? O GLY B 548  
AD1 3 4 N VAL B 551  ? N VAL B 551  O THR B 588  ? O THR B 588  
AD1 4 5 O ILE B 587  ? O ILE B 587  N ASP B 574  ? N ASP B 574  
AD1 5 6 O ALA B 575  ? O ALA B 575  N GLY B 566  ? N GLY B 566  
AD2 1 2 N ILE B 358  ? N ILE B 358  O VAL B 395  ? O VAL B 395  
AD2 2 3 N ILE B 402  ? N ILE B 402  O TYR B 508  ? O TYR B 508  
AD2 3 4 O VAL B 511  ? O VAL B 511  N ILE B 434  ? N ILE B 434  
AD2 4 5 O VAL B 433  ? O VAL B 433  N LYS B 378  ? N LYS B 378  
AD3 1 2 N CYS B 361  ? N CYS B 361  O CYS B 525  ? O CYS B 525  
AD3 2 3 O VAL B 524  ? O VAL B 524  N PHE B 392  ? N PHE B 392  
AD4 1 2 N TYR B 453  ? N TYR B 453  O GLN B 493  ? O GLN B 493  
AD5 1 2 N TYR B 473  ? N TYR B 473  O TYR B 489  ? O TYR B 489  
AD6 1 2 N GLU B 654  ? N GLU B 654  O ALA B 694  ? O ALA B 694  
AD6 2 3 O ILE B 693  ? O ILE B 693  N SER B 673  ? N SER B 673  
AD6 3 4 O ILE B 670  ? O ILE B 670  N ILE B 666  ? N ILE B 666  
AD7 1 2 N ALA B 701  ? N ALA B 701  O ILE C 788  ? O ILE C 788  
AD8 1 2 N ILE B 712  ? N ILE B 712  O PHE B 1075 ? O PHE B 1075 
AD9 1 2 N THR B 719  ? N THR B 719  O VAL B 1068 ? O VAL B 1068 
AD9 2 3 O VAL B 1061 ? O VAL B 1061 N GLN B 1054 ? N GLN B 1054 
AE1 1 2 N SER B 735  ? N SER B 735  O THR B 859  ? O THR B 859  
AE2 1 2 O PHE B 1121 ? O PHE B 1121 N PHE B 1089 ? N PHE B 1089 
AE2 2 3 O HIS B 1088 ? O HIS B 1088 N ILE B 1081 ? N ILE B 1081 
AE2 3 4 N CYS B 1082 ? N CYS B 1082 O VAL B 1133 ? O VAL B 1133 
AE3 1 2 N VAL B 1094 ? N VAL B 1094 O THR B 1105 ? O THR B 1105 
AE3 2 3 N VAL B 1104 ? N VAL B 1104 O GLN B 1113 ? O GLN B 1113 
AE4 1 2 N THR C 29   ? N THR C 29   O VAL C 62   ? O VAL C 62   
AE4 2 3 N ILE C 68   ? N ILE C 68   O ARG C 78   ? O ARG C 78   
AE5 1 2 N THR C 29   ? N THR C 29   O VAL C 62   ? O VAL C 62   
AE5 2 3 N ALA C 67   ? N ALA C 67   O ALA C 263  ? O ALA C 263  
AE5 3 4 O TYR C 266  ? O TYR C 266  N ALA C 93   ? N ALA C 93   
AE5 4 5 N PHE C 92   ? N PHE C 92   O PHE C 192  ? O PHE C 192  
AE5 5 6 N LYS C 195  ? N LYS C 195  O LYS C 202  ? O LYS C 202  
AE5 6 7 N PHE C 201  ? N PHE C 201  O LEU C 229  ? O LEU C 229  
AE6 1 2 N THR C 51   ? N THR C 51   O PHE C 275  ? O PHE C 275  
AE6 2 3 N LYS C 278  ? N LYS C 278  O ASP C 287  ? O ASP C 287  
AE7 1 2 N LEU C 84   ? N LEU C 84   O PHE C 238  ? O PHE C 238  
AE7 2 3 O ARG C 237  ? O ARG C 237  N GLY C 107  ? N GLY C 107  
AE7 3 4 N ARG C 102  ? N ARG C 102  O ASN C 121  ? O ASN C 121  
AE7 4 5 N LEU C 118  ? N LEU C 118  O LYS C 129  ? O LYS C 129  
AE7 5 6 N TYR C 144  ? N TYR C 144  O MET C 153  ? O MET C 153  
AE8 1 2 N LEU C 84   ? N LEU C 84   O PHE C 238  ? O PHE C 238  
AE8 2 3 O LEU C 242  ? O LEU C 242  N LEU C 141  ? N LEU C 141  
AE8 3 4 N TYR C 144  ? N TYR C 144  O MET C 153  ? O MET C 153  
AE9 1 2 N TYR C 313  ? N TYR C 313  O VAL C 597  ? O VAL C 597  
AE9 2 3 N SER C 596  ? N SER C 596  O LEU C 611  ? O LEU C 611  
AE9 3 4 N TYR C 612  ? N TYR C 612  O CYS C 649  ? O CYS C 649  
AE9 4 5 O GLY C 648  ? O GLY C 648  N THR C 645  ? N THR C 645  
AF1 1 2 N GLU C 324  ? N GLU C 324  O ASN C 540  ? O ASN C 540  
AF1 2 3 N PHE C 543  ? N PHE C 543  O LEU C 546  ? O LEU C 546  
AF1 3 4 N VAL C 551  ? N VAL C 551  O THR C 588  ? O THR C 588  
AF1 4 5 O ILE C 587  ? O ILE C 587  N ASP C 574  ? N ASP C 574  
AF1 5 6 O ALA C 575  ? O ALA C 575  N GLY C 566  ? N GLY C 566  
AF2 1 2 N ILE C 358  ? N ILE C 358  O VAL C 395  ? O VAL C 395  
AF2 2 3 N ILE C 402  ? N ILE C 402  O TYR C 508  ? O TYR C 508  
AF2 3 4 O VAL C 511  ? O VAL C 511  N ILE C 434  ? N ILE C 434  
AF2 4 5 O VAL C 433  ? O VAL C 433  N LYS C 378  ? N LYS C 378  
AF3 1 2 N CYS C 361  ? N CYS C 361  O CYS C 525  ? O CYS C 525  
AF4 1 2 N TYR C 453  ? N TYR C 453  O GLN C 493  ? O GLN C 493  
AF5 1 2 N TYR C 473  ? N TYR C 473  O TYR C 489  ? O TYR C 489  
AF6 1 2 N GLU C 654  ? N GLU C 654  O ALA C 694  ? O ALA C 694  
AF6 2 3 O ILE C 693  ? O ILE C 693  N SER C 673  ? N SER C 673  
AF6 3 4 O ALA C 672  ? O ALA C 672  N ILE C 664  ? N ILE C 664  
AF7 1 2 N ILE C 712  ? N ILE C 712  O PHE C 1075 ? O PHE C 1075 
AF8 1 2 N THR C 719  ? N THR C 719  O VAL C 1068 ? O VAL C 1068 
AF8 2 3 O VAL C 1065 ? O VAL C 1065 N MET C 1050 ? N MET C 1050 
AF9 1 2 N SER C 735  ? N SER C 735  O THR C 859  ? O THR C 859  
AG1 1 2 O PHE C 1121 ? O PHE C 1121 N PHE C 1089 ? N PHE C 1089 
AG1 2 3 O HIS C 1088 ? O HIS C 1088 N ILE C 1081 ? N ILE C 1081 
AG1 3 4 N CYS C 1082 ? N CYS C 1082 O VAL C 1133 ? O VAL C 1133 
AG2 1 2 N VAL C 1096 ? N VAL C 1096 O PHE C 1103 ? O PHE C 1103 
AG2 2 3 N VAL C 1104 ? N VAL C 1104 O GLN C 1113 ? O GLN C 1113 
# 
_atom_sites.entry_id                    6XR8 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 14   ? 186.427 251.988 146.571 1.00 86.23  ? 14   GLN A  N   1 
ATOM   2     C CA  . GLN A  1 14   ? 187.611 252.638 146.027 1.00 89.17  ? 14   GLN A  CA  1 
ATOM   3     C C   . GLN A  1 14   ? 188.836 252.285 146.862 1.00 93.34  ? 14   GLN A  C   1 
ATOM   4     O O   . GLN A  1 14   ? 188.843 251.289 147.585 1.00 90.60  ? 14   GLN A  O   1 
ATOM   5     C CB  . GLN A  1 14   ? 187.420 254.155 145.982 1.00 88.52  ? 14   GLN A  CB  1 
ATOM   6     C CG  . GLN A  1 14   ? 186.064 254.601 145.459 1.00 89.34  ? 14   GLN A  CG  1 
ATOM   7     C CD  . GLN A  1 14   ? 185.909 256.111 145.450 1.00 92.73  ? 14   GLN A  CD  1 
ATOM   8     O OE1 . GLN A  1 14   ? 186.876 256.846 145.648 1.00 92.41  ? 14   GLN A  OE1 1 
ATOM   9     N NE2 . GLN A  1 14   ? 184.686 256.583 145.222 1.00 95.26  ? 14   GLN A  NE2 1 
ATOM   10    N N   . CYS A  1 15   ? 189.875 253.110 146.761 1.00 94.16  ? 15   CYS A  N   1 
ATOM   11    C CA  . CYS A  1 15   ? 191.112 252.858 147.485 1.00 94.09  ? 15   CYS A  CA  1 
ATOM   12    C C   . CYS A  1 15   ? 191.807 254.187 147.756 1.00 90.63  ? 15   CYS A  C   1 
ATOM   13    O O   . CYS A  1 15   ? 192.482 254.730 146.872 1.00 91.37  ? 15   CYS A  O   1 
ATOM   14    C CB  . CYS A  1 15   ? 191.997 251.920 146.666 1.00 97.01  ? 15   CYS A  CB  1 
ATOM   15    S SG  . CYS A  1 15   ? 193.174 250.864 147.554 1.00 110.39 ? 15   CYS A  SG  1 
ATOM   16    N N   . VAL A  1 16   ? 191.661 254.715 148.968 1.00 92.33  ? 16   VAL A  N   1 
ATOM   17    C CA  . VAL A  1 16   ? 192.140 256.049 149.311 1.00 88.20  ? 16   VAL A  CA  1 
ATOM   18    C C   . VAL A  1 16   ? 192.804 256.002 150.682 1.00 85.67  ? 16   VAL A  C   1 
ATOM   19    O O   . VAL A  1 16   ? 192.325 255.313 151.591 1.00 82.82  ? 16   VAL A  O   1 
ATOM   20    C CB  . VAL A  1 16   ? 190.999 257.081 149.313 1.00 84.50  ? 16   VAL A  CB  1 
ATOM   21    C CG1 . VAL A  1 16   ? 191.559 258.483 149.495 1.00 87.41  ? 16   VAL A  CG1 1 
ATOM   22    C CG2 . VAL A  1 16   ? 190.174 256.977 148.039 1.00 86.74  ? 16   VAL A  CG2 1 
ATOM   23    N N   . ASN A  1 17   ? 193.907 256.733 150.832 1.00 84.08  ? 17   ASN A  N   1 
ATOM   24    C CA  . ASN A  1 17   ? 194.567 256.875 152.120 1.00 83.76  ? 17   ASN A  CA  1 
ATOM   25    C C   . ASN A  1 17   ? 194.001 258.100 152.832 1.00 88.17  ? 17   ASN A  C   1 
ATOM   26    O O   . ASN A  1 17   ? 194.072 259.214 152.305 1.00 88.76  ? 17   ASN A  O   1 
ATOM   27    C CB  . ASN A  1 17   ? 196.080 257.020 151.955 1.00 83.40  ? 17   ASN A  CB  1 
ATOM   28    C CG  . ASN A  1 17   ? 196.733 255.783 151.374 1.00 85.97  ? 17   ASN A  CG  1 
ATOM   29    O OD1 . ASN A  1 17   ? 196.097 254.741 151.215 1.00 84.07  ? 17   ASN A  OD1 1 
ATOM   30    N ND2 . ASN A  1 17   ? 198.018 255.895 151.057 1.00 90.65  ? 17   ASN A  ND2 1 
ATOM   31    N N   . LEU A  1 18   ? 193.447 257.896 154.024 1.00 82.84  ? 18   LEU A  N   1 
ATOM   32    C CA  . LEU A  1 18   ? 192.933 258.981 154.858 1.00 76.34  ? 18   LEU A  CA  1 
ATOM   33    C C   . LEU A  1 18   ? 193.910 259.224 156.007 1.00 79.85  ? 18   LEU A  C   1 
ATOM   34    O O   . LEU A  1 18   ? 193.791 258.667 157.095 1.00 82.45  ? 18   LEU A  O   1 
ATOM   35    C CB  . LEU A  1 18   ? 191.531 258.644 155.358 1.00 73.06  ? 18   LEU A  CB  1 
ATOM   36    C CG  . LEU A  1 18   ? 190.392 259.013 154.406 1.00 74.01  ? 18   LEU A  CG  1 
ATOM   37    C CD1 . LEU A  1 18   ? 190.514 258.241 153.105 1.00 79.89  ? 18   LEU A  CD1 1 
ATOM   38    C CD2 . LEU A  1 18   ? 189.041 258.777 155.057 1.00 71.95  ? 18   LEU A  CD2 1 
ATOM   39    N N   . THR A  1 19   ? 194.904 260.067 155.742 1.00 80.86  ? 19   THR A  N   1 
ATOM   40    C CA  . THR A  1 19   ? 196.056 260.198 156.628 1.00 84.47  ? 19   THR A  CA  1 
ATOM   41    C C   . THR A  1 19   ? 195.853 261.171 157.787 1.00 84.35  ? 19   THR A  C   1 
ATOM   42    O O   . THR A  1 19   ? 196.696 261.212 158.691 1.00 84.80  ? 19   THR A  O   1 
ATOM   43    C CB  . THR A  1 19   ? 197.275 260.636 155.818 1.00 81.02  ? 19   THR A  CB  1 
ATOM   44    O OG1 . THR A  1 19   ? 197.011 261.907 155.211 1.00 81.77  ? 19   THR A  OG1 1 
ATOM   45    C CG2 . THR A  1 19   ? 197.561 259.620 154.721 1.00 84.40  ? 19   THR A  CG2 1 
ATOM   46    N N   . THR A  1 20   ? 194.784 261.959 157.787 1.00 83.23  ? 20   THR A  N   1 
ATOM   47    C CA  . THR A  1 20   ? 194.589 262.984 158.813 1.00 85.04  ? 20   THR A  CA  1 
ATOM   48    C C   . THR A  1 20   ? 194.241 262.331 160.148 1.00 84.69  ? 20   THR A  C   1 
ATOM   49    O O   . THR A  1 20   ? 193.101 261.915 160.367 1.00 83.23  ? 20   THR A  O   1 
ATOM   50    C CB  . THR A  1 20   ? 193.492 263.952 158.383 1.00 84.06  ? 20   THR A  CB  1 
ATOM   51    O OG1 . THR A  1 20   ? 192.344 263.211 157.941 1.00 79.46  ? 20   THR A  OG1 1 
ATOM   52    C CG2 . THR A  1 20   ? 193.977 264.848 157.256 1.00 84.35  ? 20   THR A  CG2 1 
ATOM   53    N N   . ARG A  1 21   ? 195.218 262.245 161.054 1.00 86.07  ? 21   ARG A  N   1 
ATOM   54    C CA  . ARG A  1 21   ? 194.989 261.656 162.367 1.00 83.83  ? 21   ARG A  CA  1 
ATOM   55    C C   . ARG A  1 21   ? 196.097 262.075 163.327 1.00 81.41  ? 21   ARG A  C   1 
ATOM   56    O O   . ARG A  1 21   ? 197.233 262.311 162.908 1.00 81.23  ? 21   ARG A  O   1 
ATOM   57    C CB  . ARG A  1 21   ? 194.914 260.127 162.285 1.00 78.63  ? 21   ARG A  CB  1 
ATOM   58    C CG  . ARG A  1 21   ? 195.780 259.514 161.197 1.00 77.43  ? 21   ARG A  CG  1 
ATOM   59    C CD  . ARG A  1 21   ? 195.848 258.005 161.341 1.00 73.91  ? 21   ARG A  CD  1 
ATOM   60    N NE  . ARG A  1 21   ? 196.271 257.351 160.105 1.00 74.88  ? 21   ARG A  NE  1 
ATOM   61    C CZ  . ARG A  1 21   ? 195.443 256.880 159.176 1.00 81.81  ? 21   ARG A  CZ  1 
ATOM   62    N NH1 . ARG A  1 21   ? 194.127 256.980 159.319 1.00 84.96  ? 21   ARG A  NH1 1 
ATOM   63    N NH2 . ARG A  1 21   ? 195.937 256.304 158.091 1.00 80.83  ? 21   ARG A  NH2 1 
ATOM   64    N N   . THR A  1 22   ? 195.749 262.174 164.609 1.00 77.65  ? 22   THR A  N   1 
ATOM   65    C CA  . THR A  1 22   ? 196.714 262.490 165.654 1.00 83.85  ? 22   THR A  CA  1 
ATOM   66    C C   . THR A  1 22   ? 197.460 261.233 166.087 1.00 87.76  ? 22   THR A  C   1 
ATOM   67    O O   . THR A  1 22   ? 196.907 260.130 166.071 1.00 89.33  ? 22   THR A  O   1 
ATOM   68    C CB  . THR A  1 22   ? 196.013 263.113 166.860 1.00 80.98  ? 22   THR A  CB  1 
ATOM   69    O OG1 . THR A  1 22   ? 195.061 264.087 166.416 1.00 79.24  ? 22   THR A  OG1 1 
ATOM   70    C CG2 . THR A  1 22   ? 197.024 263.787 167.781 1.00 81.59  ? 22   THR A  CG2 1 
ATOM   71    N N   . GLN A  1 23   ? 198.725 261.404 166.463 1.00 83.39  ? 23   GLN A  N   1 
ATOM   72    C CA  . GLN A  1 23   ? 199.560 260.294 166.903 1.00 81.43  ? 23   GLN A  CA  1 
ATOM   73    C C   . GLN A  1 23   ? 199.458 260.115 168.414 1.00 86.39  ? 23   GLN A  C   1 
ATOM   74    O O   . GLN A  1 23   ? 199.683 261.062 169.174 1.00 83.92  ? 23   GLN A  O   1 
ATOM   75    C CB  . GLN A  1 23   ? 201.018 260.530 166.507 1.00 80.20  ? 23   GLN A  CB  1 
ATOM   76    C CG  . GLN A  1 23   ? 201.247 260.655 165.009 1.00 79.62  ? 23   GLN A  CG  1 
ATOM   77    C CD  . GLN A  1 23   ? 200.944 259.371 164.267 1.00 80.41  ? 23   GLN A  CD  1 
ATOM   78    O OE1 . GLN A  1 23   ? 200.553 258.369 164.868 1.00 85.83  ? 23   GLN A  OE1 1 
ATOM   79    N NE2 . GLN A  1 23   ? 201.127 259.389 162.951 1.00 76.73  ? 23   GLN A  NE2 1 
ATOM   80    N N   . LEU A  1 24   ? 199.127 258.900 168.842 1.00 93.30  ? 24   LEU A  N   1 
ATOM   81    C CA  . LEU A  1 24   ? 199.072 258.530 170.248 1.00 89.40  ? 24   LEU A  CA  1 
ATOM   82    C C   . LEU A  1 24   ? 199.897 257.273 170.477 1.00 88.18  ? 24   LEU A  C   1 
ATOM   83    O O   . LEU A  1 24   ? 200.112 256.490 169.547 1.00 89.53  ? 24   LEU A  O   1 
ATOM   84    C CB  . LEU A  1 24   ? 197.629 258.279 170.715 1.00 83.21  ? 24   LEU A  CB  1 
ATOM   85    C CG  . LEU A  1 24   ? 196.701 259.483 170.913 1.00 87.20  ? 24   LEU A  CG  1 
ATOM   86    C CD1 . LEU A  1 24   ? 197.222 260.383 172.020 1.00 79.35  ? 24   LEU A  CD1 1 
ATOM   87    C CD2 . LEU A  1 24   ? 196.521 260.266 169.624 1.00 83.96  ? 24   LEU A  CD2 1 
ATOM   88    N N   . PRO A  1 25   ? 200.378 257.057 171.698 1.00 88.38  ? 25   PRO A  N   1 
ATOM   89    C CA  . PRO A  1 25   ? 201.172 255.859 171.981 1.00 82.29  ? 25   PRO A  CA  1 
ATOM   90    C C   . PRO A  1 25   ? 200.285 254.640 172.159 1.00 83.56  ? 25   PRO A  C   1 
ATOM   91    O O   . PRO A  1 25   ? 199.058 254.764 172.292 1.00 81.50  ? 25   PRO A  O   1 
ATOM   92    C CB  . PRO A  1 25   ? 201.894 256.220 173.286 1.00 83.98  ? 25   PRO A  CB  1 
ATOM   93    C CG  . PRO A  1 25   ? 200.960 257.155 173.969 1.00 85.52  ? 25   PRO A  CG  1 
ATOM   94    C CD  . PRO A  1 25   ? 200.258 257.929 172.880 1.00 84.24  ? 25   PRO A  CD  1 
ATOM   95    N N   . PRO A  1 26   ? 200.867 253.441 172.172 1.00 88.57  ? 26   PRO A  N   1 
ATOM   96    C CA  . PRO A  1 26   ? 200.059 252.226 172.366 1.00 84.34  ? 26   PRO A  CA  1 
ATOM   97    C C   . PRO A  1 26   ? 199.464 252.162 173.765 1.00 85.80  ? 26   PRO A  C   1 
ATOM   98    O O   . PRO A  1 26   ? 200.172 252.287 174.768 1.00 87.07  ? 26   PRO A  O   1 
ATOM   99    C CB  . PRO A  1 26   ? 201.065 251.094 172.125 1.00 78.96  ? 26   PRO A  CB  1 
ATOM   100   C CG  . PRO A  1 26   ? 202.395 251.699 172.409 1.00 78.20  ? 26   PRO A  CG  1 
ATOM   101   C CD  . PRO A  1 26   ? 202.292 253.128 171.967 1.00 85.80  ? 26   PRO A  CD  1 
ATOM   102   N N   . ALA A  1 27   ? 198.150 251.974 173.826 1.00 81.76  ? 27   ALA A  N   1 
ATOM   103   C CA  . ALA A  1 27   ? 197.444 251.786 175.083 1.00 80.10  ? 27   ALA A  CA  1 
ATOM   104   C C   . ALA A  1 27   ? 197.294 250.301 175.404 1.00 79.85  ? 27   ALA A  C   1 
ATOM   105   O O   . ALA A  1 27   ? 197.415 249.435 174.536 1.00 78.19  ? 27   ALA A  O   1 
ATOM   106   C CB  . ALA A  1 27   ? 196.067 252.446 175.032 1.00 74.03  ? 27   ALA A  CB  1 
ATOM   107   N N   . TYR A  1 28   ? 197.034 250.018 176.679 1.00 77.49  ? 28   TYR A  N   1 
ATOM   108   C CA  . TYR A  1 28   ? 196.742 248.667 177.133 1.00 73.79  ? 28   TYR A  CA  1 
ATOM   109   C C   . TYR A  1 28   ? 195.690 248.721 178.233 1.00 73.93  ? 28   TYR A  C   1 
ATOM   110   O O   . TYR A  1 28   ? 195.500 249.749 178.889 1.00 79.67  ? 28   TYR A  O   1 
ATOM   111   C CB  . TYR A  1 28   ? 198.003 247.961 177.647 1.00 75.53  ? 28   TYR A  CB  1 
ATOM   112   C CG  . TYR A  1 28   ? 198.629 248.615 178.858 1.00 82.76  ? 28   TYR A  CG  1 
ATOM   113   C CD1 . TYR A  1 28   ? 198.239 248.260 180.141 1.00 82.04  ? 28   TYR A  CD1 1 
ATOM   114   C CD2 . TYR A  1 28   ? 199.602 249.594 178.720 1.00 87.08  ? 28   TYR A  CD2 1 
ATOM   115   C CE1 . TYR A  1 28   ? 198.805 248.855 181.247 1.00 86.42  ? 28   TYR A  CE1 1 
ATOM   116   C CE2 . TYR A  1 28   ? 200.172 250.195 179.823 1.00 90.99  ? 28   TYR A  CE2 1 
ATOM   117   C CZ  . TYR A  1 28   ? 199.771 249.822 181.084 1.00 88.54  ? 28   TYR A  CZ  1 
ATOM   118   O OH  . TYR A  1 28   ? 200.339 250.422 182.186 1.00 88.61  ? 28   TYR A  OH  1 
ATOM   119   N N   . THR A  1 29   ? 195.000 247.599 178.424 1.00 71.19  ? 29   THR A  N   1 
ATOM   120   C CA  . THR A  1 29   ? 194.084 247.441 179.545 1.00 70.63  ? 29   THR A  CA  1 
ATOM   121   C C   . THR A  1 29   ? 194.079 245.976 179.964 1.00 66.26  ? 29   THR A  C   1 
ATOM   122   O O   . THR A  1 29   ? 194.776 245.140 179.385 1.00 63.14  ? 29   THR A  O   1 
ATOM   123   C CB  . THR A  1 29   ? 192.668 247.929 179.205 1.00 68.25  ? 29   THR A  CB  1 
ATOM   124   O OG1 . THR A  1 29   ? 191.825 247.784 180.354 1.00 60.93  ? 29   THR A  OG1 1 
ATOM   125   C CG2 . THR A  1 29   ? 192.075 247.140 178.055 1.00 60.42  ? 29   THR A  CG2 1 
ATOM   126   N N   . ASN A  1 30   ? 193.299 245.676 180.998 1.00 68.04  ? 30   ASN A  N   1 
ATOM   127   C CA  . ASN A  1 30   ? 193.342 244.381 181.666 1.00 61.43  ? 30   ASN A  CA  1 
ATOM   128   C C   . ASN A  1 30   ? 192.159 243.517 181.247 1.00 64.58  ? 30   ASN A  C   1 
ATOM   129   O O   . ASN A  1 30   ? 191.005 243.953 181.323 1.00 59.61  ? 30   ASN A  O   1 
ATOM   130   C CB  . ASN A  1 30   ? 193.341 244.566 183.184 1.00 60.16  ? 30   ASN A  CB  1 
ATOM   131   C CG  . ASN A  1 30   ? 193.664 243.289 183.929 1.00 63.02  ? 30   ASN A  CG  1 
ATOM   132   O OD1 . ASN A  1 30   ? 192.807 242.425 184.100 1.00 65.70  ? 30   ASN A  OD1 1 
ATOM   133   N ND2 . ASN A  1 30   ? 194.901 243.170 184.391 1.00 61.73  ? 30   ASN A  ND2 1 
ATOM   134   N N   . SER A  1 31   ? 192.453 242.291 180.807 1.00 63.97  ? 31   SER A  N   1 
ATOM   135   C CA  . SER A  1 31   ? 191.431 241.279 180.526 1.00 60.40  ? 31   SER A  CA  1 
ATOM   136   C C   . SER A  1 31   ? 191.141 240.493 181.806 1.00 59.73  ? 31   SER A  C   1 
ATOM   137   O O   . SER A  1 31   ? 191.657 239.400 182.044 1.00 57.55  ? 31   SER A  O   1 
ATOM   138   C CB  . SER A  1 31   ? 191.885 240.362 179.400 1.00 51.87  ? 31   SER A  CB  1 
ATOM   139   O OG  . SER A  1 31   ? 193.143 239.776 179.694 1.00 61.58  ? 31   SER A  OG  1 
ATOM   140   N N   . PHE A  1 32   ? 190.301 241.091 182.653 1.00 58.16  ? 32   PHE A  N   1 
ATOM   141   C CA  . PHE A  1 32   ? 190.061 240.536 183.981 1.00 59.37  ? 32   PHE A  CA  1 
ATOM   142   C C   . PHE A  1 32   ? 189.637 239.073 183.911 1.00 63.87  ? 32   PHE A  C   1 
ATOM   143   O O   . PHE A  1 32   ? 190.392 238.171 184.290 1.00 73.25  ? 32   PHE A  O   1 
ATOM   144   C CB  . PHE A  1 32   ? 188.990 241.357 184.703 1.00 65.51  ? 32   PHE A  CB  1 
ATOM   145   C CG  . PHE A  1 32   ? 189.233 242.836 184.672 1.00 68.31  ? 32   PHE A  CG  1 
ATOM   146   C CD1 . PHE A  1 32   ? 190.282 243.396 185.376 1.00 67.09  ? 32   PHE A  CD1 1 
ATOM   147   C CD2 . PHE A  1 32   ? 188.404 243.666 183.942 1.00 72.77  ? 32   PHE A  CD2 1 
ATOM   148   C CE1 . PHE A  1 32   ? 190.501 244.756 185.346 1.00 70.56  ? 32   PHE A  CE1 1 
ATOM   149   C CE2 . PHE A  1 32   ? 188.620 245.024 183.909 1.00 69.39  ? 32   PHE A  CE2 1 
ATOM   150   C CZ  . PHE A  1 32   ? 189.669 245.570 184.611 1.00 69.60  ? 32   PHE A  CZ  1 
ATOM   151   N N   . THR A  1 33   ? 188.424 238.824 183.421 1.00 60.05  ? 33   THR A  N   1 
ATOM   152   C CA  . THR A  1 33   ? 187.858 237.481 183.386 1.00 63.02  ? 33   THR A  CA  1 
ATOM   153   C C   . THR A  1 33   ? 187.098 237.243 182.087 1.00 60.99  ? 33   THR A  C   1 
ATOM   154   O O   . THR A  1 33   ? 185.977 236.726 182.108 1.00 67.21  ? 33   THR A  O   1 
ATOM   155   C CB  . THR A  1 33   ? 186.937 237.254 184.587 1.00 66.18  ? 33   THR A  CB  1 
ATOM   156   O OG1 . THR A  1 33   ? 186.177 238.442 184.842 1.00 66.65  ? 33   THR A  OG1 1 
ATOM   157   C CG2 . THR A  1 33   ? 187.740 236.883 185.823 1.00 60.71  ? 33   THR A  CG2 1 
ATOM   158   N N   . ARG A  1 34   ? 187.684 237.618 180.953 1.00 56.01  ? 34   ARG A  N   1 
ATOM   159   C CA  . ARG A  1 34   ? 186.998 237.566 179.671 1.00 58.01  ? 34   ARG A  CA  1 
ATOM   160   C C   . ARG A  1 34   ? 187.731 236.607 178.743 1.00 57.96  ? 34   ARG A  C   1 
ATOM   161   O O   . ARG A  1 34   ? 188.793 236.072 179.072 1.00 64.11  ? 34   ARG A  O   1 
ATOM   162   C CB  . ARG A  1 34   ? 186.911 238.957 179.026 1.00 49.89  ? 34   ARG A  CB  1 
ATOM   163   C CG  . ARG A  1 34   ? 186.040 239.960 179.772 1.00 58.94  ? 34   ARG A  CG  1 
ATOM   164   C CD  . ARG A  1 34   ? 184.561 239.751 179.482 1.00 64.36  ? 34   ARG A  CD  1 
ATOM   165   N NE  . ARG A  1 34   ? 183.749 240.892 179.897 1.00 67.28  ? 34   ARG A  NE  1 
ATOM   166   C CZ  . ARG A  1 34   ? 182.445 241.011 179.664 1.00 65.04  ? 34   ARG A  CZ  1 
ATOM   167   N NH1 . ARG A  1 34   ? 181.794 242.087 180.081 1.00 60.34  ? 34   ARG A  NH1 1 
ATOM   168   N NH2 . ARG A  1 34   ? 181.789 240.060 179.015 1.00 67.70  ? 34   ARG A  NH2 1 
ATOM   169   N N   . GLY A  1 35   ? 187.145 236.395 177.569 1.00 47.33  ? 35   GLY A  N   1 
ATOM   170   C CA  . GLY A  1 35   ? 187.733 235.506 176.586 1.00 50.74  ? 35   GLY A  CA  1 
ATOM   171   C C   . GLY A  1 35   ? 187.587 234.033 176.895 1.00 54.67  ? 35   GLY A  C   1 
ATOM   172   O O   . GLY A  1 35   ? 188.433 233.234 176.481 1.00 51.82  ? 35   GLY A  O   1 
ATOM   173   N N   . VAL A  1 36   ? 186.539 233.650 177.614 1.00 62.62  ? 36   VAL A  N   1 
ATOM   174   C CA  . VAL A  1 36   ? 186.200 232.249 177.834 1.00 53.87  ? 36   VAL A  CA  1 
ATOM   175   C C   . VAL A  1 36   ? 185.023 231.897 176.938 1.00 52.31  ? 36   VAL A  C   1 
ATOM   176   O O   . VAL A  1 36   ? 184.093 232.695 176.770 1.00 54.20  ? 36   VAL A  O   1 
ATOM   177   C CB  . VAL A  1 36   ? 185.881 231.972 179.315 1.00 53.04  ? 36   VAL A  CB  1 
ATOM   178   C CG1 . VAL A  1 36   ? 185.184 230.632 179.470 1.00 47.77  ? 36   VAL A  CG1 1 
ATOM   179   C CG2 . VAL A  1 36   ? 187.157 232.000 180.138 1.00 57.01  ? 36   VAL A  CG2 1 
ATOM   180   N N   . TYR A  1 37   ? 185.068 230.704 176.353 1.00 52.78  ? 37   TYR A  N   1 
ATOM   181   C CA  . TYR A  1 37   ? 184.037 230.246 175.436 1.00 41.88  ? 37   TYR A  CA  1 
ATOM   182   C C   . TYR A  1 37   ? 183.712 228.796 175.748 1.00 49.16  ? 37   TYR A  C   1 
ATOM   183   O O   . TYR A  1 37   ? 184.468 228.101 176.430 1.00 65.42  ? 37   TYR A  O   1 
ATOM   184   C CB  . TYR A  1 37   ? 184.481 230.387 173.977 1.00 37.94  ? 37   TYR A  CB  1 
ATOM   185   C CG  . TYR A  1 37   ? 185.839 229.790 173.704 1.00 40.98  ? 37   TYR A  CG  1 
ATOM   186   C CD1 . TYR A  1 37   ? 185.968 228.501 173.213 1.00 47.36  ? 37   TYR A  CD1 1 
ATOM   187   C CD2 . TYR A  1 37   ? 186.994 230.513 173.944 1.00 41.71  ? 37   TYR A  CD2 1 
ATOM   188   C CE1 . TYR A  1 37   ? 187.206 227.955 172.967 1.00 45.00  ? 37   TYR A  CE1 1 
ATOM   189   C CE2 . TYR A  1 37   ? 188.234 229.974 173.701 1.00 43.44  ? 37   TYR A  CE2 1 
ATOM   190   C CZ  . TYR A  1 37   ? 188.335 228.696 173.214 1.00 49.91  ? 37   TYR A  CZ  1 
ATOM   191   O OH  . TYR A  1 37   ? 189.575 228.158 172.971 1.00 57.84  ? 37   TYR A  OH  1 
ATOM   192   N N   . TYR A  1 38   ? 182.575 228.346 175.245 1.00 41.14  ? 38   TYR A  N   1 
ATOM   193   C CA  . TYR A  1 38   ? 182.181 226.959 175.443 1.00 45.77  ? 38   TYR A  CA  1 
ATOM   194   C C   . TYR A  1 38   ? 183.147 226.055 174.689 1.00 46.83  ? 38   TYR A  C   1 
ATOM   195   O O   . TYR A  1 38   ? 183.232 226.149 173.458 1.00 48.75  ? 38   TYR A  O   1 
ATOM   196   C CB  . TYR A  1 38   ? 180.754 226.749 174.961 1.00 50.27  ? 38   TYR A  CB  1 
ATOM   197   C CG  . TYR A  1 38   ? 179.733 227.390 175.864 1.00 45.56  ? 38   TYR A  CG  1 
ATOM   198   C CD1 . TYR A  1 38   ? 179.492 228.752 175.809 1.00 45.79  ? 38   TYR A  CD1 1 
ATOM   199   C CD2 . TYR A  1 38   ? 179.016 226.637 176.778 1.00 52.12  ? 38   TYR A  CD2 1 
ATOM   200   C CE1 . TYR A  1 38   ? 178.566 229.343 176.634 1.00 49.26  ? 38   TYR A  CE1 1 
ATOM   201   C CE2 . TYR A  1 38   ? 178.086 227.221 177.606 1.00 49.70  ? 38   TYR A  CE2 1 
ATOM   202   C CZ  . TYR A  1 38   ? 177.865 228.574 177.528 1.00 44.77  ? 38   TYR A  CZ  1 
ATOM   203   O OH  . TYR A  1 38   ? 176.940 229.168 178.351 1.00 54.22  ? 38   TYR A  OH  1 
ATOM   204   N N   . PRO A  1 39   ? 183.880 225.165 175.365 1.00 48.36  ? 39   PRO A  N   1 
ATOM   205   C CA  . PRO A  1 39   ? 184.937 224.416 174.675 1.00 50.74  ? 39   PRO A  CA  1 
ATOM   206   C C   . PRO A  1 39   ? 184.423 223.321 173.763 1.00 60.55  ? 39   PRO A  C   1 
ATOM   207   O O   . PRO A  1 39   ? 185.181 222.851 172.905 1.00 59.00  ? 39   PRO A  O   1 
ATOM   208   C CB  . PRO A  1 39   ? 185.749 223.824 175.832 1.00 48.80  ? 39   PRO A  CB  1 
ATOM   209   C CG  . PRO A  1 39   ? 184.756 223.643 176.918 1.00 58.63  ? 39   PRO A  CG  1 
ATOM   210   C CD  . PRO A  1 39   ? 183.738 224.745 176.772 1.00 56.78  ? 39   PRO A  CD  1 
ATOM   211   N N   . ASP A  1 40   ? 183.173 222.898 173.918 1.00 63.70  ? 40   ASP A  N   1 
ATOM   212   C CA  . ASP A  1 40   ? 182.584 221.915 173.024 1.00 59.03  ? 40   ASP A  CA  1 
ATOM   213   C C   . ASP A  1 40   ? 181.072 222.043 173.112 1.00 58.37  ? 40   ASP A  C   1 
ATOM   214   O O   . ASP A  1 40   ? 180.533 222.675 174.023 1.00 62.40  ? 40   ASP A  O   1 
ATOM   215   C CB  . ASP A  1 40   ? 183.047 220.498 173.371 1.00 74.06  ? 40   ASP A  CB  1 
ATOM   216   C CG  . ASP A  1 40   ? 182.709 220.111 174.790 1.00 66.51  ? 40   ASP A  CG  1 
ATOM   217   O OD1 . ASP A  1 40   ? 182.071 220.927 175.488 1.00 68.38  ? 40   ASP A  OD1 1 
ATOM   218   O OD2 . ASP A  1 40   ? 183.081 218.997 175.212 1.00 57.83  ? 40   ASP A  OD2 1 
ATOM   219   N N   . LYS A  1 41   ? 180.393 221.425 172.153 1.00 59.38  ? 41   LYS A  N   1 
ATOM   220   C CA  . LYS A  1 41   ? 178.948 221.538 172.022 1.00 58.93  ? 41   LYS A  CA  1 
ATOM   221   C C   . LYS A  1 41   ? 178.188 220.550 172.902 1.00 68.77  ? 41   LYS A  C   1 
ATOM   222   O O   . LYS A  1 41   ? 177.013 220.277 172.637 1.00 62.50  ? 41   LYS A  O   1 
ATOM   223   C CB  . LYS A  1 41   ? 178.555 221.362 170.555 1.00 53.20  ? 41   LYS A  CB  1 
ATOM   224   C CG  . LYS A  1 41   ? 179.251 222.359 169.652 1.00 64.81  ? 41   LYS A  CG  1 
ATOM   225   C CD  . LYS A  1 41   ? 178.595 222.467 168.295 1.00 54.05  ? 41   LYS A  CD  1 
ATOM   226   C CE  . LYS A  1 41   ? 179.273 223.544 167.468 1.00 55.09  ? 41   LYS A  CE  1 
ATOM   227   N NZ  . LYS A  1 41   ? 178.560 223.808 166.193 1.00 53.12  ? 41   LYS A  NZ  1 
ATOM   228   N N   . VAL A  1 42   ? 178.829 220.009 173.931 1.00 69.75  ? 42   VAL A  N   1 
ATOM   229   C CA  . VAL A  1 42   ? 178.183 219.112 174.882 1.00 58.44  ? 42   VAL A  CA  1 
ATOM   230   C C   . VAL A  1 42   ? 177.591 219.933 176.018 1.00 56.55  ? 42   VAL A  C   1 
ATOM   231   O O   . VAL A  1 42   ? 178.176 220.928 176.458 1.00 59.63  ? 42   VAL A  O   1 
ATOM   232   C CB  . VAL A  1 42   ? 179.178 218.065 175.413 1.00 52.34  ? 42   VAL A  CB  1 
ATOM   233   C CG1 . VAL A  1 42   ? 178.578 217.314 176.590 1.00 44.05  ? 42   VAL A  CG1 1 
ATOM   234   C CG2 . VAL A  1 42   ? 179.569 217.102 174.303 1.00 56.79  ? 42   VAL A  CG2 1 
ATOM   235   N N   . PHE A  1 43   ? 176.417 219.520 176.484 1.00 44.49  ? 43   PHE A  N   1 
ATOM   236   C CA  . PHE A  1 43   ? 175.763 220.177 177.606 1.00 36.89  ? 43   PHE A  CA  1 
ATOM   237   C C   . PHE A  1 43   ? 176.293 219.631 178.927 1.00 45.21  ? 43   PHE A  C   1 
ATOM   238   O O   . PHE A  1 43   ? 176.551 218.433 179.059 1.00 55.01  ? 43   PHE A  O   1 
ATOM   239   C CB  . PHE A  1 43   ? 174.251 219.973 177.522 1.00 42.58  ? 43   PHE A  CB  1 
ATOM   240   C CG  . PHE A  1 43   ? 173.488 220.595 178.652 1.00 44.23  ? 43   PHE A  CG  1 
ATOM   241   C CD1 . PHE A  1 43   ? 173.270 219.900 179.823 1.00 43.80  ? 43   PHE A  CD1 1 
ATOM   242   C CD2 . PHE A  1 43   ? 172.981 221.873 178.538 1.00 44.58  ? 43   PHE A  CD2 1 
ATOM   243   C CE1 . PHE A  1 43   ? 172.571 220.472 180.858 1.00 41.91  ? 43   PHE A  CE1 1 
ATOM   244   C CE2 . PHE A  1 43   ? 172.279 222.446 179.570 1.00 39.72  ? 43   PHE A  CE2 1 
ATOM   245   C CZ  . PHE A  1 43   ? 172.074 221.745 180.731 1.00 40.15  ? 43   PHE A  CZ  1 
ATOM   246   N N   . ARG A  1 44   ? 176.462 220.522 179.904 1.00 44.00  ? 44   ARG A  N   1 
ATOM   247   C CA  . ARG A  1 44   ? 176.877 220.137 181.246 1.00 43.30  ? 44   ARG A  CA  1 
ATOM   248   C C   . ARG A  1 44   ? 176.251 221.089 182.253 1.00 35.94  ? 44   ARG A  C   1 
ATOM   249   O O   . ARG A  1 44   ? 176.210 222.299 182.024 1.00 40.52  ? 44   ARG A  O   1 
ATOM   250   C CB  . ARG A  1 44   ? 178.399 220.160 181.400 1.00 43.77  ? 44   ARG A  CB  1 
ATOM   251   C CG  . ARG A  1 44   ? 179.129 219.146 180.553 1.00 35.15  ? 44   ARG A  CG  1 
ATOM   252   C CD  . ARG A  1 44   ? 180.621 219.246 180.770 1.00 32.60  ? 44   ARG A  CD  1 
ATOM   253   N NE  . ARG A  1 44   ? 181.360 218.354 179.886 1.00 32.86  ? 44   ARG A  NE  1 
ATOM   254   C CZ  . ARG A  1 44   ? 181.731 218.663 178.648 1.00 43.39  ? 44   ARG A  CZ  1 
ATOM   255   N NH1 . ARG A  1 44   ? 181.434 219.848 178.131 1.00 49.89  ? 44   ARG A  NH1 1 
ATOM   256   N NH2 . ARG A  1 44   ? 182.402 217.782 177.922 1.00 46.71  ? 44   ARG A  NH2 1 
ATOM   257   N N   . SER A  1 45   ? 175.787 220.541 183.374 1.00 31.98  ? 45   SER A  N   1 
ATOM   258   C CA  . SER A  1 45   ? 175.150 221.333 184.415 1.00 39.80  ? 45   SER A  CA  1 
ATOM   259   C C   . SER A  1 45   ? 175.604 220.850 185.783 1.00 43.97  ? 45   SER A  C   1 
ATOM   260   O O   . SER A  1 45   ? 175.858 219.661 185.986 1.00 45.41  ? 45   SER A  O   1 
ATOM   261   C CB  . SER A  1 45   ? 173.623 221.249 184.327 1.00 50.76  ? 45   SER A  CB  1 
ATOM   262   O OG  . SER A  1 45   ? 173.183 219.912 184.467 1.00 48.97  ? 45   SER A  OG  1 
ATOM   263   N N   . SER A  1 46   ? 175.698 221.790 186.724 1.00 43.14  ? 46   SER A  N   1 
ATOM   264   C CA  . SER A  1 46   ? 176.006 221.476 188.118 1.00 39.90  ? 46   SER A  CA  1 
ATOM   265   C C   . SER A  1 46   ? 177.322 220.715 188.242 1.00 45.29  ? 46   SER A  C   1 
ATOM   266   O O   . SER A  1 46   ? 177.437 219.761 189.013 1.00 56.34  ? 46   SER A  O   1 
ATOM   267   C CB  . SER A  1 46   ? 174.868 220.683 188.762 1.00 55.34  ? 46   SER A  CB  1 
ATOM   268   O OG  . SER A  1 46   ? 173.622 221.328 188.572 1.00 58.75  ? 46   SER A  OG  1 
ATOM   269   N N   . VAL A  1 47   ? 178.327 221.136 187.475 1.00 44.39  ? 47   VAL A  N   1 
ATOM   270   C CA  . VAL A  1 47   ? 179.621 220.467 187.468 1.00 42.68  ? 47   VAL A  CA  1 
ATOM   271   C C   . VAL A  1 47   ? 180.709 221.504 187.238 1.00 41.39  ? 47   VAL A  C   1 
ATOM   272   O O   . VAL A  1 47   ? 180.478 222.544 186.616 1.00 38.04  ? 47   VAL A  O   1 
ATOM   273   C CB  . VAL A  1 47   ? 179.678 219.360 186.391 1.00 36.18  ? 47   VAL A  CB  1 
ATOM   274   C CG1 . VAL A  1 47   ? 179.561 219.966 185.003 1.00 34.38  ? 47   VAL A  CG1 1 
ATOM   275   C CG2 . VAL A  1 47   ? 180.958 218.560 186.517 1.00 47.40  ? 47   VAL A  CG2 1 
ATOM   276   N N   . LEU A  1 48   ? 181.903 221.212 187.747 1.00 48.20  ? 48   LEU A  N   1 
ATOM   277   C CA  . LEU A  1 48   ? 183.102 221.994 187.476 1.00 48.75  ? 48   LEU A  CA  1 
ATOM   278   C C   . LEU A  1 48   ? 183.975 221.186 186.526 1.00 44.95  ? 48   LEU A  C   1 
ATOM   279   O O   . LEU A  1 48   ? 184.393 220.072 186.861 1.00 46.17  ? 48   LEU A  O   1 
ATOM   280   C CB  . LEU A  1 48   ? 183.857 222.324 188.765 1.00 45.98  ? 48   LEU A  CB  1 
ATOM   281   C CG  . LEU A  1 48   ? 183.264 223.421 189.652 1.00 38.43  ? 48   LEU A  CG  1 
ATOM   282   C CD1 . LEU A  1 48   ? 181.807 223.142 189.987 1.00 40.81  ? 48   LEU A  CD1 1 
ATOM   283   C CD2 . LEU A  1 48   ? 184.077 223.559 190.922 1.00 51.95  ? 48   LEU A  CD2 1 
ATOM   284   N N   . HIS A  1 49   ? 184.247 221.744 185.349 1.00 43.34  ? 49   HIS A  N   1 
ATOM   285   C CA  . HIS A  1 49   ? 184.851 221.005 184.247 1.00 43.05  ? 49   HIS A  CA  1 
ATOM   286   C C   . HIS A  1 49   ? 186.213 221.593 183.916 1.00 38.74  ? 49   HIS A  C   1 
ATOM   287   O O   . HIS A  1 49   ? 186.325 222.790 183.631 1.00 41.38  ? 49   HIS A  O   1 
ATOM   288   C CB  . HIS A  1 49   ? 183.945 221.038 183.015 1.00 43.04  ? 49   HIS A  CB  1 
ATOM   289   C CG  . HIS A  1 49   ? 184.336 220.060 181.954 1.00 44.91  ? 49   HIS A  CG  1 
ATOM   290   N ND1 . HIS A  1 49   ? 184.694 220.445 180.681 1.00 43.83  ? 49   HIS A  ND1 1 
ATOM   291   C CD2 . HIS A  1 49   ? 184.433 218.710 181.981 1.00 47.01  ? 49   HIS A  CD2 1 
ATOM   292   C CE1 . HIS A  1 49   ? 184.991 219.373 179.967 1.00 43.05  ? 49   HIS A  CE1 1 
ATOM   293   N NE2 . HIS A  1 49   ? 184.841 218.308 180.733 1.00 44.15  ? 49   HIS A  NE2 1 
ATOM   294   N N   . SER A  1 50   ? 187.243 220.752 183.958 1.00 41.47  ? 50   SER A  N   1 
ATOM   295   C CA  . SER A  1 50   ? 188.580 221.154 183.546 1.00 44.31  ? 50   SER A  CA  1 
ATOM   296   C C   . SER A  1 50   ? 188.764 220.899 182.057 1.00 48.02  ? 50   SER A  C   1 
ATOM   297   O O   . SER A  1 50   ? 188.406 219.830 181.554 1.00 48.20  ? 50   SER A  O   1 
ATOM   298   C CB  . SER A  1 50   ? 189.633 220.387 184.342 1.00 44.21  ? 50   SER A  CB  1 
ATOM   299   O OG  . SER A  1 50   ? 190.934 220.663 183.856 1.00 34.87  ? 50   SER A  OG  1 
ATOM   300   N N   . THR A  1 51   ? 189.323 221.881 181.352 1.00 53.92  ? 51   THR A  N   1 
ATOM   301   C CA  . THR A  1 51   ? 189.615 221.741 179.933 1.00 48.64  ? 51   THR A  CA  1 
ATOM   302   C C   . THR A  1 51   ? 190.866 222.533 179.588 1.00 51.60  ? 51   THR A  C   1 
ATOM   303   O O   . THR A  1 51   ? 191.140 223.580 180.179 1.00 49.85  ? 51   THR A  O   1 
ATOM   304   C CB  . THR A  1 51   ? 188.448 222.218 179.062 1.00 48.81  ? 51   THR A  CB  1 
ATOM   305   O OG1 . THR A  1 51   ? 188.779 222.040 177.679 1.00 69.17  ? 51   THR A  OG1 1 
ATOM   306   C CG2 . THR A  1 51   ? 188.148 223.684 179.323 1.00 45.91  ? 51   THR A  CG2 1 
ATOM   307   N N   . GLN A  1 52   ? 191.624 222.021 178.622 1.00 49.66  ? 52   GLN A  N   1 
ATOM   308   C CA  . GLN A  1 52   ? 192.816 222.681 178.106 1.00 52.78  ? 52   GLN A  CA  1 
ATOM   309   C C   . GLN A  1 52   ? 192.554 223.081 176.661 1.00 51.90  ? 52   GLN A  C   1 
ATOM   310   O O   . GLN A  1 52   ? 192.225 222.229 175.829 1.00 55.60  ? 52   GLN A  O   1 
ATOM   311   C CB  . GLN A  1 52   ? 194.039 221.769 178.200 1.00 51.63  ? 52   GLN A  CB  1 
ATOM   312   C CG  . GLN A  1 52   ? 195.335 222.413 177.730 1.00 57.01  ? 52   GLN A  CG  1 
ATOM   313   C CD  . GLN A  1 52   ? 196.515 221.476 177.830 1.00 67.28  ? 52   GLN A  CD  1 
ATOM   314   O OE1 . GLN A  1 52   ? 196.458 220.458 178.520 1.00 62.53  ? 52   GLN A  OE1 1 
ATOM   315   N NE2 . GLN A  1 52   ? 197.599 221.810 177.138 1.00 74.00  ? 52   GLN A  NE2 1 
ATOM   316   N N   . ASP A  1 53   ? 192.695 224.369 176.369 1.00 54.51  ? 53   ASP A  N   1 
ATOM   317   C CA  . ASP A  1 53   ? 192.439 224.888 175.034 1.00 57.21  ? 53   ASP A  CA  1 
ATOM   318   C C   . ASP A  1 53   ? 193.142 226.233 174.903 1.00 54.73  ? 53   ASP A  C   1 
ATOM   319   O O   . ASP A  1 53   ? 193.794 226.711 175.834 1.00 59.12  ? 53   ASP A  O   1 
ATOM   320   C CB  . ASP A  1 53   ? 190.937 225.016 174.768 1.00 56.56  ? 53   ASP A  CB  1 
ATOM   321   C CG  . ASP A  1 53   ? 190.590 224.865 173.303 1.00 68.59  ? 53   ASP A  CG  1 
ATOM   322   O OD1 . ASP A  1 53   ? 191.429 225.228 172.452 1.00 69.66  ? 53   ASP A  OD1 1 
ATOM   323   O OD2 . ASP A  1 53   ? 189.478 224.383 173.001 1.00 59.65  ? 53   ASP A  OD2 1 
ATOM   324   N N   . LEU A  1 54   ? 193.009 226.839 173.727 1.00 53.61  ? 54   LEU A  N   1 
ATOM   325   C CA  . LEU A  1 54   ? 193.559 228.166 173.461 1.00 51.21  ? 54   LEU A  CA  1 
ATOM   326   C C   . LEU A  1 54   ? 192.599 229.197 174.037 1.00 48.10  ? 54   LEU A  C   1 
ATOM   327   O O   . LEU A  1 54   ? 191.619 229.591 173.405 1.00 48.71  ? 54   LEU A  O   1 
ATOM   328   C CB  . LEU A  1 54   ? 193.771 228.369 171.968 1.00 48.85  ? 54   LEU A  CB  1 
ATOM   329   C CG  . LEU A  1 54   ? 194.701 227.353 171.310 1.00 51.45  ? 54   LEU A  CG  1 
ATOM   330   C CD1 . LEU A  1 54   ? 194.400 227.242 169.829 1.00 46.07  ? 54   LEU A  CD1 1 
ATOM   331   C CD2 . LEU A  1 54   ? 196.153 227.732 171.537 1.00 49.59  ? 54   LEU A  CD2 1 
ATOM   332   N N   . PHE A  1 55   ? 192.879 229.627 175.260 1.00 45.10  ? 55   PHE A  N   1 
ATOM   333   C CA  . PHE A  1 55   ? 192.072 230.613 175.958 1.00 44.19  ? 55   PHE A  CA  1 
ATOM   334   C C   . PHE A  1 55   ? 192.828 231.926 176.080 1.00 48.64  ? 55   PHE A  C   1 
ATOM   335   O O   . PHE A  1 55   ? 194.057 231.977 175.981 1.00 49.31  ? 55   PHE A  O   1 
ATOM   336   C CB  . PHE A  1 55   ? 191.685 230.124 177.357 1.00 54.32  ? 55   PHE A  CB  1 
ATOM   337   C CG  . PHE A  1 55   ? 190.626 229.064 177.360 1.00 54.20  ? 55   PHE A  CG  1 
ATOM   338   C CD1 . PHE A  1 55   ? 189.290 229.401 177.250 1.00 51.96  ? 55   PHE A  CD1 1 
ATOM   339   C CD2 . PHE A  1 55   ? 190.966 227.731 177.482 1.00 49.41  ? 55   PHE A  CD2 1 
ATOM   340   C CE1 . PHE A  1 55   ? 188.317 228.429 177.256 1.00 51.43  ? 55   PHE A  CE1 1 
ATOM   341   C CE2 . PHE A  1 55   ? 189.996 226.758 177.491 1.00 49.37  ? 55   PHE A  CE2 1 
ATOM   342   C CZ  . PHE A  1 55   ? 188.670 227.107 177.375 1.00 50.58  ? 55   PHE A  CZ  1 
ATOM   343   N N   . LEU A  1 56   ? 192.074 232.991 176.292 1.00 51.36  ? 56   LEU A  N   1 
ATOM   344   C CA  . LEU A  1 56   ? 192.669 234.273 176.625 1.00 58.52  ? 56   LEU A  CA  1 
ATOM   345   C C   . LEU A  1 56   ? 193.095 234.252 178.087 1.00 61.65  ? 56   LEU A  C   1 
ATOM   346   O O   . LEU A  1 56   ? 192.227 234.150 178.964 1.00 65.16  ? 56   LEU A  O   1 
ATOM   347   C CB  . LEU A  1 56   ? 191.675 235.404 176.379 1.00 58.70  ? 56   LEU A  CB  1 
ATOM   348   C CG  . LEU A  1 56   ? 192.181 236.806 176.723 1.00 52.34  ? 56   LEU A  CG  1 
ATOM   349   C CD1 . LEU A  1 56   ? 193.312 237.210 175.794 1.00 51.03  ? 56   LEU A  CD1 1 
ATOM   350   C CD2 . LEU A  1 56   ? 191.046 237.806 176.664 1.00 44.81  ? 56   LEU A  CD2 1 
ATOM   351   N N   . PRO A  1 57   ? 194.386 234.350 178.403 1.00 55.77  ? 57   PRO A  N   1 
ATOM   352   C CA  . PRO A  1 57   ? 194.794 234.297 179.810 1.00 52.13  ? 57   PRO A  CA  1 
ATOM   353   C C   . PRO A  1 57   ? 194.133 235.396 180.628 1.00 59.19  ? 57   PRO A  C   1 
ATOM   354   O O   . PRO A  1 57   ? 193.941 236.519 180.159 1.00 59.39  ? 57   PRO A  O   1 
ATOM   355   C CB  . PRO A  1 57   ? 196.314 234.476 179.747 1.00 55.13  ? 57   PRO A  CB  1 
ATOM   356   C CG  . PRO A  1 57   ? 196.690 234.018 178.386 1.00 55.20  ? 57   PRO A  CG  1 
ATOM   357   C CD  . PRO A  1 57   ? 195.548 234.406 177.500 1.00 53.22  ? 57   PRO A  CD  1 
ATOM   358   N N   . PHE A  1 58   ? 193.770 235.052 181.860 1.00 58.38  ? 58   PHE A  N   1 
ATOM   359   C CA  . PHE A  1 58   ? 193.157 236.021 182.754 1.00 55.84  ? 58   PHE A  CA  1 
ATOM   360   C C   . PHE A  1 58   ? 194.135 237.140 183.086 1.00 61.83  ? 58   PHE A  C   1 
ATOM   361   O O   . PHE A  1 58   ? 195.340 236.921 183.241 1.00 62.17  ? 58   PHE A  O   1 
ATOM   362   C CB  . PHE A  1 58   ? 192.697 235.343 184.047 1.00 53.19  ? 58   PHE A  CB  1 
ATOM   363   C CG  . PHE A  1 58   ? 191.363 234.645 183.949 1.00 56.65  ? 58   PHE A  CG  1 
ATOM   364   C CD1 . PHE A  1 58   ? 190.574 234.738 182.814 1.00 61.75  ? 58   PHE A  CD1 1 
ATOM   365   C CD2 . PHE A  1 58   ? 190.893 233.902 185.017 1.00 59.72  ? 58   PHE A  CD2 1 
ATOM   366   C CE1 . PHE A  1 58   ? 189.358 234.104 182.747 1.00 62.42  ? 58   PHE A  CE1 1 
ATOM   367   C CE2 . PHE A  1 58   ? 189.675 233.266 184.950 1.00 57.29  ? 58   PHE A  CE2 1 
ATOM   368   C CZ  . PHE A  1 58   ? 188.908 233.367 183.813 1.00 57.45  ? 58   PHE A  CZ  1 
ATOM   369   N N   . PHE A  1 59   ? 193.599 238.353 183.195 1.00 61.43  ? 59   PHE A  N   1 
ATOM   370   C CA  . PHE A  1 59   ? 194.357 239.515 183.650 1.00 60.76  ? 59   PHE A  CA  1 
ATOM   371   C C   . PHE A  1 59   ? 195.579 239.793 182.778 1.00 64.58  ? 59   PHE A  C   1 
ATOM   372   O O   . PHE A  1 59   ? 196.570 240.358 183.250 1.00 71.97  ? 59   PHE A  O   1 
ATOM   373   C CB  . PHE A  1 59   ? 194.766 239.346 185.115 1.00 54.65  ? 59   PHE A  CB  1 
ATOM   374   C CG  . PHE A  1 59   ? 193.599 239.311 186.058 1.00 59.95  ? 59   PHE A  CG  1 
ATOM   375   C CD1 . PHE A  1 59   ? 192.987 240.485 186.461 1.00 66.42  ? 59   PHE A  CD1 1 
ATOM   376   C CD2 . PHE A  1 59   ? 193.102 238.109 186.530 1.00 57.36  ? 59   PHE A  CD2 1 
ATOM   377   C CE1 . PHE A  1 59   ? 191.908 240.461 187.319 1.00 62.04  ? 59   PHE A  CE1 1 
ATOM   378   C CE2 . PHE A  1 59   ? 192.022 238.080 187.389 1.00 51.91  ? 59   PHE A  CE2 1 
ATOM   379   C CZ  . PHE A  1 59   ? 191.425 239.258 187.783 1.00 54.72  ? 59   PHE A  CZ  1 
ATOM   380   N N   . SER A  1 60   ? 195.460 239.466 181.496 1.00 57.97  ? 60   SER A  N   1 
ATOM   381   C CA  . SER A  1 60   ? 196.515 239.737 180.533 1.00 54.01  ? 60   SER A  CA  1 
ATOM   382   C C   . SER A  1 60   ? 196.277 241.129 179.943 1.00 63.14  ? 60   SER A  C   1 
ATOM   383   O O   . SER A  1 60   ? 195.262 241.769 180.227 1.00 60.28  ? 60   SER A  O   1 
ATOM   384   C CB  . SER A  1 60   ? 196.519 238.683 179.425 1.00 61.26  ? 60   SER A  CB  1 
ATOM   385   O OG  . SER A  1 60   ? 195.288 238.677 178.723 1.00 58.36  ? 60   SER A  OG  1 
ATOM   386   N N   . ASN A  1 61   ? 197.210 241.596 179.123 1.00 66.59  ? 61   ASN A  N   1 
ATOM   387   C CA  . ASN A  1 61   ? 197.103 242.913 178.501 1.00 63.55  ? 61   ASN A  CA  1 
ATOM   388   C C   . ASN A  1 61   ? 196.386 242.771 177.166 1.00 61.07  ? 61   ASN A  C   1 
ATOM   389   O O   . ASN A  1 61   ? 196.948 242.252 176.198 1.00 62.36  ? 61   ASN A  O   1 
ATOM   390   C CB  . ASN A  1 61   ? 198.476 243.547 178.296 1.00 69.57  ? 61   ASN A  CB  1 
ATOM   391   C CG  . ASN A  1 61   ? 199.207 243.827 179.596 1.00 80.73  ? 61   ASN A  CG  1 
ATOM   392   O OD1 . ASN A  1 61   ? 198.658 243.665 180.685 1.00 81.92  ? 61   ASN A  OD1 1 
ATOM   393   N ND2 . ASN A  1 61   ? 200.460 244.265 179.482 1.00 83.94  ? 61   ASN A  ND2 1 
ATOM   394   N N   . VAL A  1 62   ? 195.188 243.307 177.107 1.00 59.53  ? 62   VAL A  N   1 
ATOM   395   C CA  . VAL A  1 62   ? 194.506 243.319 175.857 1.00 60.25  ? 62   VAL A  CA  1 
ATOM   396   C C   . VAL A  1 62   ? 194.901 244.680 175.307 1.00 66.83  ? 62   VAL A  C   1 
ATOM   397   O O   . VAL A  1 62   ? 194.590 245.705 175.914 1.00 68.79  ? 62   VAL A  O   1 
ATOM   398   C CB  . VAL A  1 62   ? 192.981 243.258 176.036 1.00 53.42  ? 62   VAL A  CB  1 
ATOM   399   C CG1 . VAL A  1 62   ? 192.485 241.829 175.874 1.00 63.36  ? 62   VAL A  CG1 1 
ATOM   400   C CG2 . VAL A  1 62   ? 192.584 243.816 177.395 1.00 59.39  ? 62   VAL A  CG2 1 
ATOM   401   N N   . THR A  1 63   ? 195.585 244.708 174.156 1.00 69.60  ? 63   THR A  N   1 
ATOM   402   C CA  . THR A  1 63   ? 195.937 245.946 173.477 1.00 61.10  ? 63   THR A  CA  1 
ATOM   403   C C   . THR A  1 63   ? 194.668 246.682 173.072 1.00 61.01  ? 63   THR A  C   1 
ATOM   404   O O   . THR A  1 63   ? 193.651 246.068 172.741 1.00 63.97  ? 63   THR A  O   1 
ATOM   405   C CB  . THR A  1 63   ? 196.807 245.665 172.253 1.00 63.59  ? 63   THR A  CB  1 
ATOM   406   O OG1 . THR A  1 63   ? 197.957 244.903 172.642 1.00 68.40  ? 63   THR A  OG1 1 
ATOM   407   C CG2 . THR A  1 63   ? 197.276 246.968 171.622 1.00 63.42  ? 63   THR A  CG2 1 
ATOM   408   N N   . TRP A  1 64   ? 194.737 248.006 173.100 1.00 57.67  ? 64   TRP A  N   1 
ATOM   409   C CA  . TRP A  1 64   ? 193.561 248.858 173.132 1.00 54.64  ? 64   TRP A  CA  1 
ATOM   410   C C   . TRP A  1 64   ? 193.650 249.904 172.031 1.00 61.32  ? 64   TRP A  C   1 
ATOM   411   O O   . TRP A  1 64   ? 194.683 250.560 171.867 1.00 62.56  ? 64   TRP A  O   1 
ATOM   412   C CB  . TRP A  1 64   ? 193.460 249.507 174.512 1.00 62.22  ? 64   TRP A  CB  1 
ATOM   413   C CG  . TRP A  1 64   ? 192.287 250.382 174.755 1.00 63.15  ? 64   TRP A  CG  1 
ATOM   414   C CD1 . TRP A  1 64   ? 191.172 250.521 173.981 1.00 60.29  ? 64   TRP A  CD1 1 
ATOM   415   C CD2 . TRP A  1 64   ? 192.110 251.251 175.874 1.00 65.23  ? 64   TRP A  CD2 1 
ATOM   416   N NE1 . TRP A  1 64   ? 190.313 251.428 174.552 1.00 59.92  ? 64   TRP A  NE1 1 
ATOM   417   C CE2 . TRP A  1 64   ? 190.867 251.890 175.717 1.00 63.47  ? 64   TRP A  CE2 1 
ATOM   418   C CE3 . TRP A  1 64   ? 192.886 251.550 176.998 1.00 70.44  ? 64   TRP A  CE3 1 
ATOM   419   C CZ2 . TRP A  1 64   ? 190.382 252.813 176.638 1.00 64.61  ? 64   TRP A  CZ2 1 
ATOM   420   C CZ3 . TRP A  1 64   ? 192.403 252.464 177.911 1.00 78.83  ? 64   TRP A  CZ3 1 
ATOM   421   C CH2 . TRP A  1 64   ? 191.163 253.087 177.726 1.00 70.46  ? 64   TRP A  CH2 1 
ATOM   422   N N   . PHE A  1 65   ? 192.560 250.057 171.280 1.00 60.98  ? 65   PHE A  N   1 
ATOM   423   C CA  . PHE A  1 65   ? 192.523 250.943 170.125 1.00 53.46  ? 65   PHE A  CA  1 
ATOM   424   C C   . PHE A  1 65   ? 191.254 251.779 170.158 1.00 59.85  ? 65   PHE A  C   1 
ATOM   425   O O   . PHE A  1 65   ? 190.218 251.330 170.656 1.00 62.57  ? 65   PHE A  O   1 
ATOM   426   C CB  . PHE A  1 65   ? 192.594 250.153 168.816 1.00 53.30  ? 65   PHE A  CB  1 
ATOM   427   C CG  . PHE A  1 65   ? 193.738 249.184 168.757 1.00 55.84  ? 65   PHE A  CG  1 
ATOM   428   C CD1 . PHE A  1 65   ? 195.006 249.607 168.403 1.00 56.93  ? 65   PHE A  CD1 1 
ATOM   429   C CD2 . PHE A  1 65   ? 193.546 247.851 169.059 1.00 58.26  ? 65   PHE A  CD2 1 
ATOM   430   C CE1 . PHE A  1 65   ? 196.056 248.717 168.352 1.00 54.53  ? 65   PHE A  CE1 1 
ATOM   431   C CE2 . PHE A  1 65   ? 194.594 246.958 169.007 1.00 53.03  ? 65   PHE A  CE2 1 
ATOM   432   C CZ  . PHE A  1 65   ? 195.849 247.392 168.653 1.00 52.61  ? 65   PHE A  CZ  1 
ATOM   433   N N   . HIS A  1 66   ? 191.346 252.994 169.622 1.00 64.06  ? 66   HIS A  N   1 
ATOM   434   C CA  . HIS A  1 66   ? 190.277 253.979 169.696 1.00 63.50  ? 66   HIS A  CA  1 
ATOM   435   C C   . HIS A  1 66   ? 189.903 254.486 168.311 1.00 63.93  ? 66   HIS A  C   1 
ATOM   436   O O   . HIS A  1 66   ? 190.752 254.580 167.419 1.00 63.96  ? 66   HIS A  O   1 
ATOM   437   C CB  . HIS A  1 66   ? 190.689 255.181 170.549 1.00 64.20  ? 66   HIS A  CB  1 
ATOM   438   C CG  . HIS A  1 66   ? 191.258 254.817 171.882 1.00 65.64  ? 66   HIS A  CG  1 
ATOM   439   N ND1 . HIS A  1 66   ? 192.597 254.553 172.074 1.00 66.05  ? 66   HIS A  ND1 1 
ATOM   440   C CD2 . HIS A  1 66   ? 190.672 254.685 173.095 1.00 64.76  ? 66   HIS A  CD2 1 
ATOM   441   C CE1 . HIS A  1 66   ? 192.810 254.269 173.346 1.00 60.64  ? 66   HIS A  CE1 1 
ATOM   442   N NE2 . HIS A  1 66   ? 191.658 254.342 173.987 1.00 63.60  ? 66   HIS A  NE2 1 
ATOM   443   N N   . ALA A  1 67   ? 188.624 254.803 168.142 1.00 63.28  ? 67   ALA A  N   1 
ATOM   444   C CA  . ALA A  1 67   ? 188.152 255.700 167.096 1.00 69.87  ? 67   ALA A  CA  1 
ATOM   445   C C   . ALA A  1 67   ? 187.535 256.912 167.776 1.00 79.85  ? 67   ALA A  C   1 
ATOM   446   O O   . ALA A  1 67   ? 186.650 256.763 168.624 1.00 77.31  ? 67   ALA A  O   1 
ATOM   447   C CB  . ALA A  1 67   ? 187.133 255.015 166.185 1.00 66.74  ? 67   ALA A  CB  1 
ATOM   448   N N   . ILE A  1 68   ? 188.008 258.104 167.420 1.00 81.59  ? 68   ILE A  N   1 
ATOM   449   C CA  . ILE A  1 68   ? 187.623 259.329 168.112 1.00 74.35  ? 68   ILE A  CA  1 
ATOM   450   C C   . ILE A  1 68   ? 187.372 260.416 167.080 1.00 82.43  ? 68   ILE A  C   1 
ATOM   451   O O   . ILE A  1 68   ? 188.175 260.605 166.160 1.00 80.86  ? 68   ILE A  O   1 
ATOM   452   C CB  . ILE A  1 68   ? 188.700 259.783 169.118 1.00 67.48  ? 68   ILE A  CB  1 
ATOM   453   C CG1 . ILE A  1 68   ? 189.028 258.648 170.090 1.00 71.00  ? 68   ILE A  CG1 1 
ATOM   454   C CG2 . ILE A  1 68   ? 188.224 261.007 169.885 1.00 62.65  ? 68   ILE A  CG2 1 
ATOM   455   C CD1 . ILE A  1 68   ? 190.100 258.987 171.102 1.00 70.38  ? 68   ILE A  CD1 1 
ATOM   456   N N   . HIS A  1 69   ? 186.263 261.134 167.237 1.00 82.05  ? 69   HIS A  N   1 
ATOM   457   C CA  . HIS A  1 69   ? 185.925 262.253 166.361 1.00 78.17  ? 69   HIS A  CA  1 
ATOM   458   C C   . HIS A  1 69   ? 186.112 261.893 164.893 1.00 85.79  ? 69   HIS A  C   1 
ATOM   459   O O   . HIS A  1 69   ? 186.783 262.612 164.155 1.00 85.70  ? 69   HIS A  O   1 
ATOM   460   C CB  . HIS A  1 69   ? 186.778 263.477 166.702 1.00 75.92  ? 69   HIS A  CB  1 
ATOM   461   C CG  . HIS A  1 69   ? 186.517 264.036 168.066 1.00 72.43  ? 69   HIS A  CG  1 
ATOM   462   N ND1 . HIS A  1 69   ? 187.519 264.553 168.858 1.00 69.34  ? 69   HIS A  ND1 1 
ATOM   463   C CD2 . HIS A  1 69   ? 185.372 264.162 168.778 1.00 70.00  ? 69   HIS A  CD2 1 
ATOM   464   C CE1 . HIS A  1 69   ? 187.004 264.972 169.999 1.00 68.20  ? 69   HIS A  CE1 1 
ATOM   465   N NE2 . HIS A  1 69   ? 185.703 264.746 169.976 1.00 65.63  ? 69   HIS A  NE2 1 
ATOM   466   N N   . LYS A  1 77   ? 190.058 262.642 164.603 1.00 72.45  ? 77   LYS A  N   1 
ATOM   467   C CA  . LYS A  1 77   ? 191.118 262.906 165.567 1.00 72.75  ? 77   LYS A  CA  1 
ATOM   468   C C   . LYS A  1 77   ? 191.957 261.656 165.795 1.00 78.75  ? 77   LYS A  C   1 
ATOM   469   O O   . LYS A  1 77   ? 193.190 261.725 165.820 1.00 79.43  ? 77   LYS A  O   1 
ATOM   470   C CB  . LYS A  1 77   ? 190.530 263.398 166.892 1.00 68.47  ? 77   LYS A  CB  1 
ATOM   471   C CG  . LYS A  1 77   ? 191.590 263.714 167.935 1.00 67.37  ? 77   LYS A  CG  1 
ATOM   472   C CD  . LYS A  1 77   ? 190.987 264.092 169.273 1.00 66.40  ? 77   LYS A  CD  1 
ATOM   473   C CE  . LYS A  1 77   ? 192.074 264.436 170.274 1.00 62.50  ? 77   LYS A  CE  1 
ATOM   474   N NZ  . LYS A  1 77   ? 192.762 265.706 169.914 1.00 60.27  ? 77   LYS A  NZ  1 
ATOM   475   N N   . ARG A  1 78   ? 191.298 260.511 165.963 1.00 76.77  ? 78   ARG A  N   1 
ATOM   476   C CA  . ARG A  1 78   ? 191.976 259.229 166.042 1.00 74.67  ? 78   ARG A  CA  1 
ATOM   477   C C   . ARG A  1 78   ? 191.141 258.183 165.317 1.00 76.12  ? 78   ARG A  C   1 
ATOM   478   O O   . ARG A  1 78   ? 189.925 258.094 165.505 1.00 75.66  ? 78   ARG A  O   1 
ATOM   479   C CB  . ARG A  1 78   ? 192.216 258.813 167.501 1.00 67.75  ? 78   ARG A  CB  1 
ATOM   480   C CG  . ARG A  1 78   ? 193.077 257.575 167.671 1.00 77.53  ? 78   ARG A  CG  1 
ATOM   481   C CD  . ARG A  1 78   ? 194.496 257.806 167.177 1.00 80.00  ? 78   ARG A  CD  1 
ATOM   482   N NE  . ARG A  1 78   ? 195.370 256.675 167.473 1.00 86.64  ? 78   ARG A  NE  1 
ATOM   483   C CZ  . ARG A  1 78   ? 196.658 256.618 167.151 1.00 87.29  ? 78   ARG A  CZ  1 
ATOM   484   N NH1 . ARG A  1 78   ? 197.236 257.630 166.518 1.00 85.52  ? 78   ARG A  NH1 1 
ATOM   485   N NH2 . ARG A  1 78   ? 197.373 255.546 167.462 1.00 86.04  ? 78   ARG A  NH2 1 
ATOM   486   N N   . PHE A  1 79   ? 191.817 257.391 164.486 1.00 73.53  ? 79   PHE A  N   1 
ATOM   487   C CA  . PHE A  1 79   ? 191.183 256.315 163.735 1.00 68.50  ? 79   PHE A  CA  1 
ATOM   488   C C   . PHE A  1 79   ? 192.190 255.184 163.589 1.00 75.65  ? 79   PHE A  C   1 
ATOM   489   O O   . PHE A  1 79   ? 192.978 255.158 162.639 1.00 70.65  ? 79   PHE A  O   1 
ATOM   490   C CB  . PHE A  1 79   ? 190.719 256.827 162.370 1.00 73.86  ? 79   PHE A  CB  1 
ATOM   491   C CG  . PHE A  1 79   ? 189.923 255.836 161.574 1.00 69.74  ? 79   PHE A  CG  1 
ATOM   492   C CD1 . PHE A  1 79   ? 188.582 255.629 161.840 1.00 68.17  ? 79   PHE A  CD1 1 
ATOM   493   C CD2 . PHE A  1 79   ? 190.506 255.141 160.531 1.00 65.21  ? 79   PHE A  CD2 1 
ATOM   494   C CE1 . PHE A  1 79   ? 187.847 254.733 161.096 1.00 70.07  ? 79   PHE A  CE1 1 
ATOM   495   C CE2 . PHE A  1 79   ? 189.775 254.243 159.785 1.00 67.70  ? 79   PHE A  CE2 1 
ATOM   496   C CZ  . PHE A  1 79   ? 188.445 254.041 160.065 1.00 70.99  ? 79   PHE A  CZ  1 
ATOM   497   N N   . ASP A  1 80   ? 192.163 254.245 164.529 1.00 80.70  ? 80   ASP A  N   1 
ATOM   498   C CA  . ASP A  1 80   ? 193.233 253.265 164.684 1.00 69.55  ? 80   ASP A  CA  1 
ATOM   499   C C   . ASP A  1 80   ? 192.812 251.957 164.023 1.00 64.75  ? 80   ASP A  C   1 
ATOM   500   O O   . ASP A  1 80   ? 191.937 251.247 164.524 1.00 60.45  ? 80   ASP A  O   1 
ATOM   501   C CB  . ASP A  1 80   ? 193.555 253.075 166.163 1.00 64.19  ? 80   ASP A  CB  1 
ATOM   502   C CG  . ASP A  1 80   ? 195.007 252.725 166.403 1.00 67.80  ? 80   ASP A  CG  1 
ATOM   503   O OD1 . ASP A  1 80   ? 195.751 252.558 165.415 1.00 66.58  ? 80   ASP A  OD1 1 
ATOM   504   O OD2 . ASP A  1 80   ? 195.409 252.628 167.581 1.00 68.83  ? 80   ASP A  OD2 1 
ATOM   505   N N   . ASN A  1 81   ? 193.421 251.643 162.880 1.00 66.56  ? 81   ASN A  N   1 
ATOM   506   C CA  . ASN A  1 81   ? 193.136 250.399 162.177 1.00 61.54  ? 81   ASN A  CA  1 
ATOM   507   C C   . ASN A  1 81   ? 194.427 249.689 161.782 1.00 60.36  ? 81   ASN A  C   1 
ATOM   508   O O   . ASN A  1 81   ? 194.633 249.397 160.598 1.00 63.99  ? 81   ASN A  O   1 
ATOM   509   C CB  . ASN A  1 81   ? 192.289 250.670 160.935 1.00 62.55  ? 81   ASN A  CB  1 
ATOM   510   C CG  . ASN A  1 81   ? 192.911 251.706 160.023 1.00 65.94  ? 81   ASN A  CG  1 
ATOM   511   O OD1 . ASN A  1 81   ? 193.955 252.279 160.336 1.00 77.41  ? 81   ASN A  OD1 1 
ATOM   512   N ND2 . ASN A  1 81   ? 192.280 251.940 158.879 1.00 60.63  ? 81   ASN A  ND2 1 
ATOM   513   N N   . PRO A  1 82   ? 195.311 249.391 162.730 1.00 54.88  ? 82   PRO A  N   1 
ATOM   514   C CA  . PRO A  1 82   ? 196.586 248.765 162.373 1.00 58.77  ? 82   PRO A  CA  1 
ATOM   515   C C   . PRO A  1 82   ? 196.419 247.321 161.931 1.00 59.94  ? 82   PRO A  C   1 
ATOM   516   O O   . PRO A  1 82   ? 195.476 246.629 162.320 1.00 61.65  ? 82   PRO A  O   1 
ATOM   517   C CB  . PRO A  1 82   ? 197.393 248.851 163.670 1.00 52.92  ? 82   PRO A  CB  1 
ATOM   518   C CG  . PRO A  1 82   ? 196.358 248.792 164.734 1.00 50.66  ? 82   PRO A  CG  1 
ATOM   519   C CD  . PRO A  1 82   ? 195.153 249.516 164.189 1.00 49.93  ? 82   PRO A  CD  1 
ATOM   520   N N   . VAL A  1 83   ? 197.359 246.871 161.106 1.00 59.28  ? 83   VAL A  N   1 
ATOM   521   C CA  . VAL A  1 83   ? 197.485 245.453 160.788 1.00 56.32  ? 83   VAL A  CA  1 
ATOM   522   C C   . VAL A  1 83   ? 198.192 244.778 161.955 1.00 62.07  ? 83   VAL A  C   1 
ATOM   523   O O   . VAL A  1 83   ? 199.316 245.147 162.310 1.00 57.55  ? 83   VAL A  O   1 
ATOM   524   C CB  . VAL A  1 83   ? 198.251 245.243 159.476 1.00 50.72  ? 83   VAL A  CB  1 
ATOM   525   C CG1 . VAL A  1 83   ? 198.541 243.769 159.255 1.00 50.02  ? 83   VAL A  CG1 1 
ATOM   526   C CG2 . VAL A  1 83   ? 197.458 245.809 158.311 1.00 51.70  ? 83   VAL A  CG2 1 
ATOM   527   N N   . LEU A  1 84   ? 197.540 243.779 162.549 1.00 59.48  ? 84   LEU A  N   1 
ATOM   528   C CA  . LEU A  1 84   ? 198.014 243.189 163.788 1.00 49.43  ? 84   LEU A  CA  1 
ATOM   529   C C   . LEU A  1 84   ? 198.388 241.727 163.587 1.00 50.84  ? 84   LEU A  C   1 
ATOM   530   O O   . LEU A  1 84   ? 197.845 241.058 162.705 1.00 54.87  ? 84   LEU A  O   1 
ATOM   531   C CB  . LEU A  1 84   ? 196.946 243.282 164.882 1.00 49.09  ? 84   LEU A  CB  1 
ATOM   532   C CG  . LEU A  1 84   ? 196.582 244.696 165.319 1.00 47.71  ? 84   LEU A  CG  1 
ATOM   533   C CD1 . LEU A  1 84   ? 195.254 244.699 166.047 1.00 40.75  ? 84   LEU A  CD1 1 
ATOM   534   C CD2 . LEU A  1 84   ? 197.681 245.262 166.197 1.00 50.85  ? 84   LEU A  CD2 1 
ATOM   535   N N   . PRO A  1 85   ? 199.314 241.203 164.390 1.00 52.17  ? 85   PRO A  N   1 
ATOM   536   C CA  . PRO A  1 85   ? 199.605 239.769 164.336 1.00 53.58  ? 85   PRO A  CA  1 
ATOM   537   C C   . PRO A  1 85   ? 198.368 238.946 164.666 1.00 55.16  ? 85   PRO A  C   1 
ATOM   538   O O   . PRO A  1 85   ? 197.454 239.405 165.353 1.00 54.35  ? 85   PRO A  O   1 
ATOM   539   C CB  . PRO A  1 85   ? 200.701 239.588 165.392 1.00 49.44  ? 85   PRO A  CB  1 
ATOM   540   C CG  . PRO A  1 85   ? 201.319 240.926 165.529 1.00 57.81  ? 85   PRO A  CG  1 
ATOM   541   C CD  . PRO A  1 85   ? 200.215 241.908 165.316 1.00 55.65  ? 85   PRO A  CD  1 
ATOM   542   N N   . PHE A  1 86   ? 198.342 237.720 164.147 1.00 57.18  ? 86   PHE A  N   1 
ATOM   543   C CA  . PHE A  1 86   ? 197.287 236.754 164.452 1.00 55.47  ? 86   PHE A  CA  1 
ATOM   544   C C   . PHE A  1 86   ? 197.990 235.423 164.694 1.00 59.78  ? 86   PHE A  C   1 
ATOM   545   O O   . PHE A  1 86   ? 198.275 234.685 163.746 1.00 68.80  ? 86   PHE A  O   1 
ATOM   546   C CB  . PHE A  1 86   ? 196.271 236.658 163.320 1.00 52.96  ? 86   PHE A  CB  1 
ATOM   547   C CG  . PHE A  1 86   ? 195.079 235.796 163.638 1.00 45.89  ? 86   PHE A  CG  1 
ATOM   548   C CD1 . PHE A  1 86   ? 195.185 234.418 163.657 1.00 41.49  ? 86   PHE A  CD1 1 
ATOM   549   C CD2 . PHE A  1 86   ? 193.847 236.367 163.896 1.00 48.37  ? 86   PHE A  CD2 1 
ATOM   550   C CE1 . PHE A  1 86   ? 194.091 233.630 163.940 1.00 40.42  ? 86   PHE A  CE1 1 
ATOM   551   C CE2 . PHE A  1 86   ? 192.751 235.582 164.177 1.00 46.05  ? 86   PHE A  CE2 1 
ATOM   552   C CZ  . PHE A  1 86   ? 192.873 234.213 164.198 1.00 42.76  ? 86   PHE A  CZ  1 
ATOM   553   N N   . ASN A  1 87   ? 198.268 235.124 165.960 1.00 52.94  ? 87   ASN A  N   1 
ATOM   554   C CA  . ASN A  1 87   ? 199.020 233.932 166.324 1.00 60.53  ? 87   ASN A  CA  1 
ATOM   555   C C   . ASN A  1 87   ? 198.269 233.181 167.409 1.00 62.65  ? 87   ASN A  C   1 
ATOM   556   O O   . ASN A  1 87   ? 197.839 233.780 168.398 1.00 62.91  ? 87   ASN A  O   1 
ATOM   557   C CB  . ASN A  1 87   ? 200.429 234.294 166.806 1.00 68.80  ? 87   ASN A  CB  1 
ATOM   558   C CG  . ASN A  1 87   ? 200.423 235.416 167.815 1.00 61.73  ? 87   ASN A  CG  1 
ATOM   559   O OD1 . ASN A  1 87   ? 199.581 236.312 167.758 1.00 58.92  ? 87   ASN A  OD1 1 
ATOM   560   N ND2 . ASN A  1 87   ? 201.363 235.375 168.751 1.00 61.65  ? 87   ASN A  ND2 1 
ATOM   561   N N   . ASP A  1 88   ? 198.122 231.873 167.220 1.00 62.98  ? 88   ASP A  N   1 
ATOM   562   C CA  . ASP A  1 88   ? 197.404 231.017 168.158 1.00 65.63  ? 88   ASP A  CA  1 
ATOM   563   C C   . ASP A  1 88   ? 196.062 231.632 168.543 1.00 63.04  ? 88   ASP A  C   1 
ATOM   564   O O   . ASP A  1 88   ? 195.680 231.678 169.712 1.00 66.51  ? 88   ASP A  O   1 
ATOM   565   C CB  . ASP A  1 88   ? 198.254 230.745 169.399 1.00 62.86  ? 88   ASP A  CB  1 
ATOM   566   C CG  . ASP A  1 88   ? 199.441 229.849 169.107 1.00 68.56  ? 88   ASP A  CG  1 
ATOM   567   O OD1 . ASP A  1 88   ? 199.572 229.393 167.952 1.00 80.25  ? 88   ASP A  OD1 1 
ATOM   568   O OD2 . ASP A  1 88   ? 200.243 229.602 170.034 1.00 61.93  ? 88   ASP A  OD2 1 
ATOM   569   N N   . GLY A  1 89   ? 195.338 232.113 167.536 1.00 54.75  ? 89   GLY A  N   1 
ATOM   570   C CA  . GLY A  1 89   ? 194.020 232.676 167.758 1.00 44.31  ? 89   GLY A  CA  1 
ATOM   571   C C   . GLY A  1 89   ? 194.032 234.053 168.390 1.00 37.88  ? 89   GLY A  C   1 
ATOM   572   O O   . GLY A  1 89   ? 195.057 234.500 168.912 1.00 45.96  ? 89   GLY A  O   1 
ATOM   573   N N   . VAL A  1 90   ? 192.889 234.736 168.338 1.00 42.05  ? 90   VAL A  N   1 
ATOM   574   C CA  . VAL A  1 90   ? 192.746 236.104 168.819 1.00 48.29  ? 90   VAL A  CA  1 
ATOM   575   C C   . VAL A  1 90   ? 191.427 236.245 169.563 1.00 46.79  ? 90   VAL A  C   1 
ATOM   576   O O   . VAL A  1 90   ? 190.408 235.680 169.152 1.00 46.32  ? 90   VAL A  O   1 
ATOM   577   C CB  . VAL A  1 90   ? 192.809 237.118 167.656 1.00 42.83  ? 90   VAL A  CB  1 
ATOM   578   C CG1 . VAL A  1 90   ? 192.117 238.424 168.034 1.00 42.81  ? 90   VAL A  CG1 1 
ATOM   579   C CG2 . VAL A  1 90   ? 194.244 237.369 167.260 1.00 44.17  ? 90   VAL A  CG2 1 
ATOM   580   N N   . TYR A  1 91   ? 191.446 237.007 170.653 1.00 49.18  ? 91   TYR A  N   1 
ATOM   581   C CA  . TYR A  1 91   ? 190.233 237.488 171.300 1.00 48.52  ? 91   TYR A  CA  1 
ATOM   582   C C   . TYR A  1 91   ? 190.017 238.944 170.919 1.00 47.14  ? 91   TYR A  C   1 
ATOM   583   O O   . TYR A  1 91   ? 190.895 239.783 171.142 1.00 50.70  ? 91   TYR A  O   1 
ATOM   584   C CB  . TYR A  1 91   ? 190.316 237.359 172.820 1.00 49.51  ? 91   TYR A  CB  1 
ATOM   585   C CG  . TYR A  1 91   ? 189.259 238.170 173.540 1.00 52.97  ? 91   TYR A  CG  1 
ATOM   586   C CD1 . TYR A  1 91   ? 187.985 237.666 173.740 1.00 50.41  ? 91   TYR A  CD1 1 
ATOM   587   C CD2 . TYR A  1 91   ? 189.536 239.444 174.012 1.00 57.23  ? 91   TYR A  CD2 1 
ATOM   588   C CE1 . TYR A  1 91   ? 187.020 238.403 174.392 1.00 46.39  ? 91   TYR A  CE1 1 
ATOM   589   C CE2 . TYR A  1 91   ? 188.577 240.185 174.664 1.00 49.88  ? 91   TYR A  CE2 1 
ATOM   590   C CZ  . TYR A  1 91   ? 187.321 239.660 174.852 1.00 47.01  ? 91   TYR A  CZ  1 
ATOM   591   O OH  . TYR A  1 91   ? 186.359 240.394 175.502 1.00 49.63  ? 91   TYR A  OH  1 
ATOM   592   N N   . PHE A  1 92   ? 188.849 239.242 170.362 1.00 49.04  ? 92   PHE A  N   1 
ATOM   593   C CA  . PHE A  1 92   ? 188.508 240.585 169.914 1.00 49.47  ? 92   PHE A  CA  1 
ATOM   594   C C   . PHE A  1 92   ? 187.204 241.026 170.561 1.00 52.78  ? 92   PHE A  C   1 
ATOM   595   O O   . PHE A  1 92   ? 186.221 240.279 170.572 1.00 57.93  ? 92   PHE A  O   1 
ATOM   596   C CB  . PHE A  1 92   ? 188.391 240.634 168.386 1.00 52.13  ? 92   PHE A  CB  1 
ATOM   597   C CG  . PHE A  1 92   ? 188.068 241.997 167.841 1.00 50.09  ? 92   PHE A  CG  1 
ATOM   598   C CD1 . PHE A  1 92   ? 186.765 242.458 167.819 1.00 49.02  ? 92   PHE A  CD1 1 
ATOM   599   C CD2 . PHE A  1 92   ? 189.067 242.811 167.341 1.00 48.80  ? 92   PHE A  CD2 1 
ATOM   600   C CE1 . PHE A  1 92   ? 186.466 243.704 167.321 1.00 49.21  ? 92   PHE A  CE1 1 
ATOM   601   C CE2 . PHE A  1 92   ? 188.770 244.058 166.839 1.00 43.80  ? 92   PHE A  CE2 1 
ATOM   602   C CZ  . PHE A  1 92   ? 187.469 244.506 166.831 1.00 49.58  ? 92   PHE A  CZ  1 
ATOM   603   N N   . ALA A  1 93   ? 187.198 242.247 171.089 1.00 51.38  ? 93   ALA A  N   1 
ATOM   604   C CA  . ALA A  1 93   ? 186.015 242.820 171.713 1.00 53.69  ? 93   ALA A  CA  1 
ATOM   605   C C   . ALA A  1 93   ? 185.928 244.294 171.350 1.00 59.08  ? 93   ALA A  C   1 
ATOM   606   O O   . ALA A  1 93   ? 186.946 244.950 171.118 1.00 63.54  ? 93   ALA A  O   1 
ATOM   607   C CB  . ALA A  1 93   ? 186.040 242.658 173.235 1.00 51.19  ? 93   ALA A  CB  1 
ATOM   608   N N   . SER A  1 94   ? 184.702 244.812 171.308 1.00 54.29  ? 94   SER A  N   1 
ATOM   609   C CA  . SER A  1 94   ? 184.458 246.184 170.870 1.00 57.28  ? 94   SER A  CA  1 
ATOM   610   C C   . SER A  1 94   ? 183.299 246.776 171.659 1.00 67.04  ? 94   SER A  C   1 
ATOM   611   O O   . SER A  1 94   ? 182.143 246.400 171.441 1.00 69.93  ? 94   SER A  O   1 
ATOM   612   C CB  . SER A  1 94   ? 184.163 246.234 169.373 1.00 65.92  ? 94   SER A  CB  1 
ATOM   613   O OG  . SER A  1 94   ? 183.109 245.349 169.034 1.00 71.06  ? 94   SER A  OG  1 
ATOM   614   N N   . THR A  1 95   ? 183.605 247.702 172.564 1.00 68.55  ? 95   THR A  N   1 
ATOM   615   C CA  . THR A  1 95   ? 182.578 248.552 173.156 1.00 69.49  ? 95   THR A  CA  1 
ATOM   616   C C   . THR A  1 95   ? 182.118 249.548 172.098 1.00 70.24  ? 95   THR A  C   1 
ATOM   617   O O   . THR A  1 95   ? 182.854 250.476 171.748 1.00 65.00  ? 95   THR A  O   1 
ATOM   618   C CB  . THR A  1 95   ? 183.121 249.267 174.388 1.00 67.45  ? 95   THR A  CB  1 
ATOM   619   O OG1 . THR A  1 95   ? 184.337 249.946 174.055 1.00 71.92  ? 95   THR A  OG1 1 
ATOM   620   C CG2 . THR A  1 95   ? 183.390 248.271 175.503 1.00 62.10  ? 95   THR A  CG2 1 
ATOM   621   N N   . GLU A  1 96   ? 180.907 249.356 171.584 1.00 68.73  ? 96   GLU A  N   1 
ATOM   622   C CA  . GLU A  1 96   ? 180.490 249.957 170.327 1.00 70.34  ? 96   GLU A  CA  1 
ATOM   623   C C   . GLU A  1 96   ? 179.203 250.747 170.493 1.00 78.38  ? 96   GLU A  C   1 
ATOM   624   O O   . GLU A  1 96   ? 178.276 250.312 171.183 1.00 77.50  ? 96   GLU A  O   1 
ATOM   625   C CB  . GLU A  1 96   ? 180.287 248.876 169.264 1.00 73.49  ? 96   GLU A  CB  1 
ATOM   626   C CG  . GLU A  1 96   ? 180.206 249.389 167.840 1.00 73.36  ? 96   GLU A  CG  1 
ATOM   627   C CD  . GLU A  1 96   ? 180.214 248.261 166.826 1.00 74.77  ? 96   GLU A  CD  1 
ATOM   628   O OE1 . GLU A  1 96   ? 180.386 247.095 167.239 1.00 79.36  ? 96   GLU A  OE1 1 
ATOM   629   O OE2 . GLU A  1 96   ? 180.049 248.536 165.619 1.00 65.86  ? 96   GLU A  OE2 1 
ATOM   630   N N   . LYS A  1 97   ? 179.161 251.913 169.855 1.00 77.69  ? 97   LYS A  N   1 
ATOM   631   C CA  . LYS A  1 97   ? 177.933 252.666 169.667 1.00 73.83  ? 97   LYS A  CA  1 
ATOM   632   C C   . LYS A  1 97   ? 177.881 253.147 168.224 1.00 80.39  ? 97   LYS A  C   1 
ATOM   633   O O   . LYS A  1 97   ? 178.911 253.406 167.597 1.00 82.46  ? 97   LYS A  O   1 
ATOM   634   C CB  . LYS A  1 97   ? 177.841 253.857 170.631 1.00 76.48  ? 97   LYS A  CB  1 
ATOM   635   C CG  . LYS A  1 97   ? 178.753 255.017 170.275 1.00 73.91  ? 97   LYS A  CG  1 
ATOM   636   C CD  . LYS A  1 97   ? 178.858 256.009 171.420 1.00 72.71  ? 97   LYS A  CD  1 
ATOM   637   C CE  . LYS A  1 97   ? 179.613 257.254 170.999 1.00 77.11  ? 97   LYS A  CE  1 
ATOM   638   N NZ  . LYS A  1 97   ? 179.956 258.117 172.161 1.00 83.07  ? 97   LYS A  NZ  1 
ATOM   639   N N   . SER A  1 98   ? 176.662 253.276 167.705 1.00 81.83  ? 98   SER A  N   1 
ATOM   640   C CA  . SER A  1 98   ? 176.442 253.731 166.331 1.00 78.07  ? 98   SER A  CA  1 
ATOM   641   C C   . SER A  1 98   ? 177.198 252.879 165.312 1.00 72.97  ? 98   SER A  C   1 
ATOM   642   O O   . SER A  1 98   ? 177.600 253.369 164.255 1.00 73.96  ? 98   SER A  O   1 
ATOM   643   C CB  . SER A  1 98   ? 176.827 255.204 166.182 1.00 79.49  ? 98   SER A  CB  1 
ATOM   644   O OG  . SER A  1 98   ? 178.206 255.399 166.445 1.00 77.34  ? 98   SER A  OG  1 
ATOM   645   N N   . ASN A  1 99   ? 177.396 251.597 165.624 1.00 67.44  ? 99   ASN A  N   1 
ATOM   646   C CA  . ASN A  1 99   ? 177.821 250.584 164.655 1.00 67.46  ? 99   ASN A  CA  1 
ATOM   647   C C   . ASN A  1 99   ? 179.035 251.043 163.839 1.00 66.42  ? 99   ASN A  C   1 
ATOM   648   O O   . ASN A  1 99   ? 178.970 251.244 162.628 1.00 68.37  ? 99   ASN A  O   1 
ATOM   649   C CB  . ASN A  1 99   ? 176.655 250.222 163.732 1.00 69.36  ? 99   ASN A  CB  1 
ATOM   650   C CG  . ASN A  1 99   ? 175.519 249.546 164.469 1.00 74.92  ? 99   ASN A  CG  1 
ATOM   651   O OD1 . ASN A  1 99   ? 175.467 249.559 165.698 1.00 74.79  ? 99   ASN A  OD1 1 
ATOM   652   N ND2 . ASN A  1 99   ? 174.598 248.952 163.720 1.00 76.47  ? 99   ASN A  ND2 1 
ATOM   653   N N   . ILE A  1 100  ? 180.156 251.196 164.539 1.00 67.27  ? 100  ILE A  N   1 
ATOM   654   C CA  . ILE A  1 100  ? 181.399 251.642 163.923 1.00 68.76  ? 100  ILE A  CA  1 
ATOM   655   C C   . ILE A  1 100  ? 182.278 250.469 163.502 1.00 71.62  ? 100  ILE A  C   1 
ATOM   656   O O   . ILE A  1 100  ? 182.896 250.510 162.439 1.00 71.09  ? 100  ILE A  O   1 
ATOM   657   C CB  . ILE A  1 100  ? 182.158 252.588 164.879 1.00 71.70  ? 100  ILE A  CB  1 
ATOM   658   C CG1 . ILE A  1 100  ? 181.330 253.846 165.165 1.00 78.07  ? 100  ILE A  CG1 1 
ATOM   659   C CG2 . ILE A  1 100  ? 183.509 252.961 164.295 1.00 62.88  ? 100  ILE A  CG2 1 
ATOM   660   C CD1 . ILE A  1 100  ? 181.047 254.706 163.945 1.00 70.70  ? 100  ILE A  CD1 1 
ATOM   661   N N   . ILE A  1 101  ? 182.358 249.422 164.318 1.00 73.04  ? 101  ILE A  N   1 
ATOM   662   C CA  . ILE A  1 101  ? 183.151 248.242 163.981 1.00 71.13  ? 101  ILE A  CA  1 
ATOM   663   C C   . ILE A  1 101  ? 182.287 247.306 163.145 1.00 65.86  ? 101  ILE A  C   1 
ATOM   664   O O   . ILE A  1 101  ? 181.216 246.877 163.587 1.00 62.74  ? 101  ILE A  O   1 
ATOM   665   C CB  . ILE A  1 101  ? 183.663 247.535 165.243 1.00 72.53  ? 101  ILE A  CB  1 
ATOM   666   C CG1 . ILE A  1 101  ? 184.396 248.521 166.159 1.00 64.39  ? 101  ILE A  CG1 1 
ATOM   667   C CG2 . ILE A  1 101  ? 184.577 246.379 164.867 1.00 60.67  ? 101  ILE A  CG2 1 
ATOM   668   C CD1 . ILE A  1 101  ? 185.660 249.103 165.559 1.00 57.04  ? 101  ILE A  CD1 1 
ATOM   669   N N   . ARG A  1 102  ? 182.747 246.988 161.931 1.00 59.83  ? 102  ARG A  N   1 
ATOM   670   C CA  . ARG A  1 102  ? 181.907 246.306 160.956 1.00 60.57  ? 102  ARG A  CA  1 
ATOM   671   C C   . ARG A  1 102  ? 182.512 245.045 160.348 1.00 60.20  ? 102  ARG A  C   1 
ATOM   672   O O   . ARG A  1 102  ? 181.820 244.365 159.581 1.00 65.23  ? 102  ARG A  O   1 
ATOM   673   C CB  . ARG A  1 102  ? 181.539 247.279 159.830 1.00 59.11  ? 102  ARG A  CB  1 
ATOM   674   C CG  . ARG A  1 102  ? 180.833 248.526 160.328 1.00 63.78  ? 102  ARG A  CG  1 
ATOM   675   C CD  . ARG A  1 102  ? 180.051 249.215 159.229 1.00 63.74  ? 102  ARG A  CD  1 
ATOM   676   N NE  . ARG A  1 102  ? 178.817 248.499 158.915 1.00 71.91  ? 102  ARG A  NE  1 
ATOM   677   C CZ  . ARG A  1 102  ? 177.659 248.680 159.544 1.00 78.74  ? 102  ARG A  CZ  1 
ATOM   678   N NH1 . ARG A  1 102  ? 177.556 249.557 160.533 1.00 82.36  ? 102  ARG A  NH1 1 
ATOM   679   N NH2 . ARG A  1 102  ? 176.595 247.978 159.183 1.00 74.69  ? 102  ARG A  NH2 1 
ATOM   680   N N   . GLY A  1 103  ? 183.758 244.703 160.650 1.00 56.35  ? 103  GLY A  N   1 
ATOM   681   C CA  . GLY A  1 103  ? 184.330 243.503 160.075 1.00 50.97  ? 103  GLY A  CA  1 
ATOM   682   C C   . GLY A  1 103  ? 185.826 243.430 160.306 1.00 46.06  ? 103  GLY A  C   1 
ATOM   683   O O   . GLY A  1 103  ? 186.404 244.238 161.036 1.00 53.27  ? 103  GLY A  O   1 
ATOM   684   N N   . TRP A  1 104  ? 186.436 242.438 159.659 1.00 43.64  ? 104  TRP A  N   1 
ATOM   685   C CA  . TRP A  1 104  ? 187.854 242.155 159.826 1.00 51.50  ? 104  TRP A  CA  1 
ATOM   686   C C   . TRP A  1 104  ? 188.428 241.635 158.519 1.00 50.31  ? 104  TRP A  C   1 
ATOM   687   O O   . TRP A  1 104  ? 187.705 241.159 157.641 1.00 57.08  ? 104  TRP A  O   1 
ATOM   688   C CB  . TRP A  1 104  ? 188.104 241.121 160.927 1.00 52.12  ? 104  TRP A  CB  1 
ATOM   689   C CG  . TRP A  1 104  ? 187.488 241.471 162.225 1.00 46.99  ? 104  TRP A  CG  1 
ATOM   690   C CD1 . TRP A  1 104  ? 188.049 242.200 163.227 1.00 46.25  ? 104  TRP A  CD1 1 
ATOM   691   C CD2 . TRP A  1 104  ? 186.183 241.102 162.676 1.00 47.95  ? 104  TRP A  CD2 1 
ATOM   692   N NE1 . TRP A  1 104  ? 187.173 242.311 164.274 1.00 51.22  ? 104  TRP A  NE1 1 
ATOM   693   C CE2 . TRP A  1 104  ? 186.020 241.645 163.961 1.00 49.03  ? 104  TRP A  CE2 1 
ATOM   694   C CE3 . TRP A  1 104  ? 185.137 240.363 162.118 1.00 45.51  ? 104  TRP A  CE3 1 
ATOM   695   C CZ2 . TRP A  1 104  ? 184.856 241.479 164.696 1.00 52.65  ? 104  TRP A  CZ2 1 
ATOM   696   C CZ3 . TRP A  1 104  ? 183.983 240.199 162.850 1.00 43.03  ? 104  TRP A  CZ3 1 
ATOM   697   C CH2 . TRP A  1 104  ? 183.850 240.755 164.126 1.00 48.41  ? 104  TRP A  CH2 1 
ATOM   698   N N   . ILE A  1 105  ? 189.748 241.736 158.406 1.00 45.11  ? 105  ILE A  N   1 
ATOM   699   C CA  . ILE A  1 105  ? 190.507 241.156 157.307 1.00 49.75  ? 105  ILE A  CA  1 
ATOM   700   C C   . ILE A  1 105  ? 191.554 240.231 157.906 1.00 50.49  ? 105  ILE A  C   1 
ATOM   701   O O   . ILE A  1 105  ? 192.226 240.599 158.875 1.00 53.83  ? 105  ILE A  O   1 
ATOM   702   C CB  . ILE A  1 105  ? 191.165 242.241 156.437 1.00 50.44  ? 105  ILE A  CB  1 
ATOM   703   C CG1 . ILE A  1 105  ? 190.091 243.120 155.794 1.00 54.70  ? 105  ILE A  CG1 1 
ATOM   704   C CG2 . ILE A  1 105  ? 192.049 241.610 155.378 1.00 63.57  ? 105  ILE A  CG2 1 
ATOM   705   C CD1 . ILE A  1 105  ? 189.100 242.357 154.930 1.00 62.91  ? 105  ILE A  CD1 1 
ATOM   706   N N   . PHE A  1 106  ? 191.685 239.033 157.340 1.00 49.31  ? 106  PHE A  N   1 
ATOM   707   C CA  . PHE A  1 106  ? 192.661 238.056 157.797 1.00 49.77  ? 106  PHE A  CA  1 
ATOM   708   C C   . PHE A  1 106  ? 193.485 237.577 156.615 1.00 49.43  ? 106  PHE A  C   1 
ATOM   709   O O   . PHE A  1 106  ? 192.967 237.429 155.505 1.00 59.96  ? 106  PHE A  O   1 
ATOM   710   C CB  . PHE A  1 106  ? 191.993 236.849 158.467 1.00 51.36  ? 106  PHE A  CB  1 
ATOM   711   C CG  . PHE A  1 106  ? 190.971 237.216 159.501 1.00 46.28  ? 106  PHE A  CG  1 
ATOM   712   C CD1 . PHE A  1 106  ? 189.648 237.401 159.148 1.00 49.17  ? 106  PHE A  CD1 1 
ATOM   713   C CD2 . PHE A  1 106  ? 191.331 237.367 160.825 1.00 43.24  ? 106  PHE A  CD2 1 
ATOM   714   C CE1 . PHE A  1 106  ? 188.707 237.733 160.095 1.00 42.36  ? 106  PHE A  CE1 1 
ATOM   715   C CE2 . PHE A  1 106  ? 190.393 237.701 161.773 1.00 47.83  ? 106  PHE A  CE2 1 
ATOM   716   C CZ  . PHE A  1 106  ? 189.081 237.884 161.407 1.00 47.52  ? 106  PHE A  CZ  1 
ATOM   717   N N   . GLY A  1 107  ? 194.765 237.339 156.859 1.00 43.33  ? 107  GLY A  N   1 
ATOM   718   C CA  . GLY A  1 107  ? 195.633 236.831 155.818 1.00 51.99  ? 107  GLY A  CA  1 
ATOM   719   C C   . GLY A  1 107  ? 197.062 236.797 156.299 1.00 53.47  ? 107  GLY A  C   1 
ATOM   720   O O   . GLY A  1 107  ? 197.327 236.875 157.499 1.00 59.54  ? 107  GLY A  O   1 
ATOM   721   N N   . THR A  1 108  ? 197.988 236.672 155.349 1.00 52.12  ? 108  THR A  N   1 
ATOM   722   C CA  . THR A  1 108  ? 199.405 236.706 155.672 1.00 56.03  ? 108  THR A  CA  1 
ATOM   723   C C   . THR A  1 108  ? 200.212 237.624 154.762 1.00 73.45  ? 108  THR A  C   1 
ATOM   724   O O   . THR A  1 108  ? 201.387 237.872 155.051 1.00 74.43  ? 108  THR A  O   1 
ATOM   725   C CB  . THR A  1 108  ? 199.998 235.287 155.621 1.00 56.01  ? 108  THR A  CB  1 
ATOM   726   O OG1 . THR A  1 108  ? 201.347 235.309 156.102 1.00 66.41  ? 108  THR A  OG1 1 
ATOM   727   C CG2 . THR A  1 108  ? 199.972 234.735 154.206 1.00 53.69  ? 108  THR A  CG2 1 
ATOM   728   N N   . THR A  1 109  ? 199.625 238.132 153.676 1.00 72.11  ? 109  THR A  N   1 
ATOM   729   C CA  . THR A  1 109  ? 200.275 239.146 152.852 1.00 70.88  ? 109  THR A  CA  1 
ATOM   730   C C   . THR A  1 109  ? 199.358 240.344 152.653 1.00 66.69  ? 109  THR A  C   1 
ATOM   731   O O   . THR A  1 109  ? 199.819 241.489 152.629 1.00 65.05  ? 109  THR A  O   1 
ATOM   732   C CB  . THR A  1 109  ? 200.668 238.576 151.488 1.00 76.94  ? 109  THR A  CB  1 
ATOM   733   O OG1 . THR A  1 109  ? 199.497 238.097 150.814 1.00 72.55  ? 109  THR A  OG1 1 
ATOM   734   C CG2 . THR A  1 109  ? 201.666 237.444 151.640 1.00 68.22  ? 109  THR A  CG2 1 
ATOM   735   N N   . LEU A  1 110  ? 198.059 240.087 152.507 1.00 67.55  ? 110  LEU A  N   1 
ATOM   736   C CA  . LEU A  1 110  ? 197.069 241.136 152.266 1.00 63.80  ? 110  LEU A  CA  1 
ATOM   737   C C   . LEU A  1 110  ? 197.392 241.941 151.010 1.00 68.78  ? 110  LEU A  C   1 
ATOM   738   O O   . LEU A  1 110  ? 197.080 243.131 150.930 1.00 74.03  ? 110  LEU A  O   1 
ATOM   739   C CB  . LEU A  1 110  ? 196.947 242.072 153.471 1.00 63.53  ? 110  LEU A  CB  1 
ATOM   740   C CG  . LEU A  1 110  ? 196.631 241.435 154.828 1.00 57.58  ? 110  LEU A  CG  1 
ATOM   741   C CD1 . LEU A  1 110  ? 196.331 242.512 155.855 1.00 49.95  ? 110  LEU A  CD1 1 
ATOM   742   C CD2 . LEU A  1 110  ? 195.475 240.451 154.734 1.00 63.91  ? 110  LEU A  CD2 1 
ATOM   743   N N   . ASP A  1 111  ? 198.024 241.307 150.019 1.00 69.42  ? 111  ASP A  N   1 
ATOM   744   C CA  . ASP A  1 111  ? 198.415 241.990 148.791 1.00 66.68  ? 111  ASP A  CA  1 
ATOM   745   C C   . ASP A  1 111  ? 198.140 241.159 147.542 1.00 71.21  ? 111  ASP A  C   1 
ATOM   746   O O   . ASP A  1 111  ? 198.686 241.467 146.477 1.00 76.94  ? 111  ASP A  O   1 
ATOM   747   C CB  . ASP A  1 111  ? 199.900 242.372 148.840 1.00 67.83  ? 111  ASP A  CB  1 
ATOM   748   C CG  . ASP A  1 111  ? 200.811 241.163 148.870 1.00 69.92  ? 111  ASP A  CG  1 
ATOM   749   O OD1 . ASP A  1 111  ? 200.292 240.028 148.897 1.00 72.62  ? 111  ASP A  OD1 1 
ATOM   750   O OD2 . ASP A  1 111  ? 202.046 241.347 148.865 1.00 75.83  ? 111  ASP A  OD2 1 
ATOM   751   N N   . SER A  1 112  ? 197.322 240.115 147.646 1.00 67.81  ? 112  SER A  N   1 
ATOM   752   C CA  . SER A  1 112  ? 196.901 239.266 146.534 1.00 64.67  ? 112  SER A  CA  1 
ATOM   753   C C   . SER A  1 112  ? 197.993 238.319 146.057 1.00 66.96  ? 112  SER A  C   1 
ATOM   754   O O   . SER A  1 112  ? 197.770 237.563 145.104 1.00 66.05  ? 112  SER A  O   1 
ATOM   755   C CB  . SER A  1 112  ? 196.406 240.097 145.345 1.00 60.17  ? 112  SER A  CB  1 
ATOM   756   O OG  . SER A  1 112  ? 197.473 240.789 144.723 1.00 61.04  ? 112  SER A  OG  1 
ATOM   757   N N   . LYS A  1 113  ? 199.170 238.334 146.685 1.00 68.42  ? 113  LYS A  N   1 
ATOM   758   C CA  . LYS A  1 113  ? 200.102 237.228 146.497 1.00 67.74  ? 113  LYS A  CA  1 
ATOM   759   C C   . LYS A  1 113  ? 199.533 235.939 147.069 1.00 71.83  ? 113  LYS A  C   1 
ATOM   760   O O   . LYS A  1 113  ? 199.878 234.847 146.605 1.00 73.51  ? 113  LYS A  O   1 
ATOM   761   C CB  . LYS A  1 113  ? 201.442 237.540 147.160 1.00 65.01  ? 113  LYS A  CB  1 
ATOM   762   C CG  . LYS A  1 113  ? 202.391 238.387 146.332 1.00 64.91  ? 113  LYS A  CG  1 
ATOM   763   C CD  . LYS A  1 113  ? 203.617 238.801 147.146 1.00 67.18  ? 113  LYS A  CD  1 
ATOM   764   C CE  . LYS A  1 113  ? 204.431 237.602 147.630 1.00 68.49  ? 113  LYS A  CE  1 
ATOM   765   N NZ  . LYS A  1 113  ? 205.618 238.016 148.435 1.00 74.34  ? 113  LYS A  NZ  1 
ATOM   766   N N   . THR A  1 114  ? 198.672 236.050 148.078 1.00 69.31  ? 114  THR A  N   1 
ATOM   767   C CA  . THR A  1 114  ? 198.070 234.906 148.741 1.00 59.74  ? 114  THR A  CA  1 
ATOM   768   C C   . THR A  1 114  ? 196.613 235.233 149.037 1.00 57.98  ? 114  THR A  C   1 
ATOM   769   O O   . THR A  1 114  ? 196.173 236.378 148.906 1.00 56.41  ? 114  THR A  O   1 
ATOM   770   C CB  . THR A  1 114  ? 198.813 234.550 150.034 1.00 60.44  ? 114  THR A  CB  1 
ATOM   771   O OG1 . THR A  1 114  ? 198.638 235.600 150.991 1.00 63.66  ? 114  THR A  OG1 1 
ATOM   772   C CG2 . THR A  1 114  ? 200.299 234.367 149.766 1.00 67.92  ? 114  THR A  CG2 1 
ATOM   773   N N   . GLN A  1 115  ? 195.861 234.215 149.440 1.00 63.07  ? 115  GLN A  N   1 
ATOM   774   C CA  . GLN A  1 115  ? 194.451 234.410 149.730 1.00 54.82  ? 115  GLN A  CA  1 
ATOM   775   C C   . GLN A  1 115  ? 194.260 235.110 151.074 1.00 54.57  ? 115  GLN A  C   1 
ATOM   776   O O   . GLN A  1 115  ? 195.162 235.171 151.913 1.00 60.15  ? 115  GLN A  O   1 
ATOM   777   C CB  . GLN A  1 115  ? 193.711 233.074 149.728 1.00 48.77  ? 115  GLN A  CB  1 
ATOM   778   C CG  . GLN A  1 115  ? 193.537 232.484 148.350 1.00 60.98  ? 115  GLN A  CG  1 
ATOM   779   C CD  . GLN A  1 115  ? 192.548 231.345 148.335 1.00 69.06  ? 115  GLN A  CD  1 
ATOM   780   O OE1 . GLN A  1 115  ? 191.520 231.409 147.662 1.00 64.76  ? 115  GLN A  OE1 1 
ATOM   781   N NE2 . GLN A  1 115  ? 192.857 230.283 149.069 1.00 65.12  ? 115  GLN A  NE2 1 
ATOM   782   N N   . SER A  1 116  ? 193.059 235.648 151.265 1.00 56.34  ? 116  SER A  N   1 
ATOM   783   C CA  . SER A  1 116  ? 192.709 236.340 152.494 1.00 53.87  ? 116  SER A  CA  1 
ATOM   784   C C   . SER A  1 116  ? 191.217 236.186 152.741 1.00 52.31  ? 116  SER A  C   1 
ATOM   785   O O   . SER A  1 116  ? 190.435 236.001 151.805 1.00 58.52  ? 116  SER A  O   1 
ATOM   786   C CB  . SER A  1 116  ? 193.086 237.824 152.427 1.00 55.57  ? 116  SER A  CB  1 
ATOM   787   O OG  . SER A  1 116  ? 194.477 237.984 152.216 1.00 61.28  ? 116  SER A  OG  1 
ATOM   788   N N   . LEU A  1 117  ? 190.832 236.265 154.010 1.00 49.81  ? 117  LEU A  N   1 
ATOM   789   C CA  . LEU A  1 117  ? 189.440 236.140 154.424 1.00 50.89  ? 117  LEU A  CA  1 
ATOM   790   C C   . LEU A  1 117  ? 188.877 237.515 154.756 1.00 48.74  ? 117  LEU A  C   1 
ATOM   791   O O   . LEU A  1 117  ? 189.476 238.263 155.535 1.00 49.42  ? 117  LEU A  O   1 
ATOM   792   C CB  . LEU A  1 117  ? 189.317 235.211 155.633 1.00 43.31  ? 117  LEU A  CB  1 
ATOM   793   C CG  . LEU A  1 117  ? 187.988 235.243 156.394 1.00 31.88  ? 117  LEU A  CG  1 
ATOM   794   C CD1 . LEU A  1 117  ? 186.836 234.844 155.496 1.00 39.49  ? 117  LEU A  CD1 1 
ATOM   795   C CD2 . LEU A  1 117  ? 188.053 234.344 157.604 1.00 41.12  ? 117  LEU A  CD2 1 
ATOM   796   N N   . LEU A  1 118  ? 187.736 237.845 154.157 1.00 49.06  ? 118  LEU A  N   1 
ATOM   797   C CA  . LEU A  1 118  ? 187.029 239.085 154.445 1.00 45.81  ? 118  LEU A  CA  1 
ATOM   798   C C   . LEU A  1 118  ? 185.707 238.776 155.131 1.00 43.75  ? 118  LEU A  C   1 
ATOM   799   O O   . LEU A  1 118  ? 184.876 238.045 154.584 1.00 43.77  ? 118  LEU A  O   1 
ATOM   800   C CB  . LEU A  1 118  ? 186.785 239.882 153.161 1.00 55.29  ? 118  LEU A  CB  1 
ATOM   801   C CG  . LEU A  1 118  ? 185.970 241.177 153.263 1.00 51.63  ? 118  LEU A  CG  1 
ATOM   802   C CD1 . LEU A  1 118  ? 186.419 242.158 152.196 1.00 56.00  ? 118  LEU A  CD1 1 
ATOM   803   C CD2 . LEU A  1 118  ? 184.475 240.916 153.125 1.00 46.20  ? 118  LEU A  CD2 1 
ATOM   804   N N   . ILE A  1 119  ? 185.512 239.341 156.320 1.00 47.81  ? 119  ILE A  N   1 
ATOM   805   C CA  . ILE A  1 119  ? 184.224 239.332 157.004 1.00 51.66  ? 119  ILE A  CA  1 
ATOM   806   C C   . ILE A  1 119  ? 183.792 240.781 157.161 1.00 54.95  ? 119  ILE A  C   1 
ATOM   807   O O   . ILE A  1 119  ? 184.497 241.575 157.796 1.00 55.36  ? 119  ILE A  O   1 
ATOM   808   C CB  . ILE A  1 119  ? 184.298 238.633 158.370 1.00 44.15  ? 119  ILE A  CB  1 
ATOM   809   C CG1 . ILE A  1 119  ? 184.884 237.228 158.222 1.00 45.01  ? 119  ILE A  CG1 1 
ATOM   810   C CG2 . ILE A  1 119  ? 182.913 238.568 159.007 1.00 39.45  ? 119  ILE A  CG2 1 
ATOM   811   C CD1 . ILE A  1 119  ? 185.068 236.502 159.531 1.00 41.50  ? 119  ILE A  CD1 1 
ATOM   812   N N   . VAL A  1 120  ? 182.645 241.127 156.582 1.00 53.01  ? 120  VAL A  N   1 
ATOM   813   C CA  . VAL A  1 120  ? 182.126 242.489 156.610 1.00 61.31  ? 120  VAL A  CA  1 
ATOM   814   C C   . VAL A  1 120  ? 180.629 242.445 156.865 1.00 70.54  ? 120  VAL A  C   1 
ATOM   815   O O   . VAL A  1 120  ? 179.896 241.730 156.172 1.00 68.03  ? 120  VAL A  O   1 
ATOM   816   C CB  . VAL A  1 120  ? 182.418 243.239 155.295 1.00 65.18  ? 120  VAL A  CB  1 
ATOM   817   C CG1 . VAL A  1 120  ? 181.462 244.414 155.128 1.00 66.04  ? 120  VAL A  CG1 1 
ATOM   818   C CG2 . VAL A  1 120  ? 183.858 243.716 155.264 1.00 58.72  ? 120  VAL A  CG2 1 
ATOM   819   N N   . ASN A  1 121  ? 180.178 243.206 157.856 1.00 71.68  ? 121  ASN A  N   1 
ATOM   820   C CA  . ASN A  1 121  ? 178.766 243.531 158.002 1.00 73.27  ? 121  ASN A  CA  1 
ATOM   821   C C   . ASN A  1 121  ? 178.536 244.917 157.419 1.00 69.65  ? 121  ASN A  C   1 
ATOM   822   O O   . ASN A  1 121  ? 179.004 245.912 157.980 1.00 70.45  ? 121  ASN A  O   1 
ATOM   823   C CB  . ASN A  1 121  ? 178.339 243.501 159.467 1.00 73.03  ? 121  ASN A  CB  1 
ATOM   824   C CG  . ASN A  1 121  ? 177.010 244.195 159.696 1.00 74.18  ? 121  ASN A  CG  1 
ATOM   825   O OD1 . ASN A  1 121  ? 176.075 244.045 158.910 1.00 71.18  ? 121  ASN A  OD1 1 
ATOM   826   N ND2 . ASN A  1 121  ? 176.928 244.977 160.765 1.00 73.03  ? 121  ASN A  ND2 1 
ATOM   827   N N   . ASN A  1 122  ? 177.818 244.988 156.305 1.00 75.73  ? 122  ASN A  N   1 
ATOM   828   C CA  . ASN A  1 122  ? 177.462 246.267 155.714 1.00 76.43  ? 122  ASN A  CA  1 
ATOM   829   C C   . ASN A  1 122  ? 175.959 246.483 155.857 1.00 79.82  ? 122  ASN A  C   1 
ATOM   830   O O   . ASN A  1 122  ? 175.227 245.631 156.371 1.00 82.50  ? 122  ASN A  O   1 
ATOM   831   C CB  . ASN A  1 122  ? 177.946 246.353 154.260 1.00 80.13  ? 122  ASN A  CB  1 
ATOM   832   C CG  . ASN A  1 122  ? 177.201 245.433 153.315 1.00 82.57  ? 122  ASN A  CG  1 
ATOM   833   O OD1 . ASN A  1 122  ? 176.138 244.901 153.631 1.00 80.29  ? 122  ASN A  OD1 1 
ATOM   834   N ND2 . ASN A  1 122  ? 177.772 245.248 152.126 1.00 80.99  ? 122  ASN A  ND2 1 
ATOM   835   N N   . ALA A  1 123  ? 175.500 247.647 155.400 1.00 81.42  ? 123  ALA A  N   1 
ATOM   836   C CA  . ALA A  1 123  ? 174.163 248.103 155.765 1.00 82.56  ? 123  ALA A  CA  1 
ATOM   837   C C   . ALA A  1 123  ? 173.094 247.083 155.395 1.00 83.52  ? 123  ALA A  C   1 
ATOM   838   O O   . ALA A  1 123  ? 172.067 246.980 156.075 1.00 84.41  ? 123  ALA A  O   1 
ATOM   839   C CB  . ALA A  1 123  ? 173.872 249.448 155.102 1.00 81.98  ? 123  ALA A  CB  1 
ATOM   840   N N   . THR A  1 124  ? 173.312 246.318 154.326 1.00 80.07  ? 124  THR A  N   1 
ATOM   841   C CA  . THR A  1 124  ? 172.272 245.440 153.806 1.00 78.26  ? 124  THR A  CA  1 
ATOM   842   C C   . THR A  1 124  ? 172.431 243.983 154.217 1.00 82.77  ? 124  THR A  C   1 
ATOM   843   O O   . THR A  1 124  ? 171.420 243.292 154.381 1.00 87.22  ? 124  THR A  O   1 
ATOM   844   C CB  . THR A  1 124  ? 172.231 245.522 152.276 1.00 80.00  ? 124  THR A  CB  1 
ATOM   845   O OG1 . THR A  1 124  ? 173.538 245.273 151.746 1.00 84.72  ? 124  THR A  OG1 1 
ATOM   846   C CG2 . THR A  1 124  ? 171.749 246.895 151.826 1.00 80.21  ? 124  THR A  CG2 1 
ATOM   847   N N   . ASN A  1 125  ? 173.656 243.488 154.386 1.00 84.76  ? 125  ASN A  N   1 
ATOM   848   C CA  . ASN A  1 125  ? 173.844 242.094 154.764 1.00 79.10  ? 125  ASN A  CA  1 
ATOM   849   C C   . ASN A  1 125  ? 175.291 241.857 155.175 1.00 71.90  ? 125  ASN A  C   1 
ATOM   850   O O   . ASN A  1 125  ? 176.185 242.650 154.868 1.00 69.81  ? 125  ASN A  O   1 
ATOM   851   C CB  . ASN A  1 125  ? 173.458 241.150 153.620 1.00 77.80  ? 125  ASN A  CB  1 
ATOM   852   C CG  . ASN A  1 125  ? 173.998 241.606 152.286 1.00 78.83  ? 125  ASN A  CG  1 
ATOM   853   O OD1 . ASN A  1 125  ? 175.202 241.560 152.042 1.00 79.67  ? 125  ASN A  OD1 1 
ATOM   854   N ND2 . ASN A  1 125  ? 173.108 242.046 151.408 1.00 79.00  ? 125  ASN A  ND2 1 
ATOM   855   N N   . VAL A  1 126  ? 175.501 240.750 155.877 1.00 75.41  ? 126  VAL A  N   1 
ATOM   856   C CA  . VAL A  1 126  ? 176.842 240.293 156.220 1.00 75.34  ? 126  VAL A  CA  1 
ATOM   857   C C   . VAL A  1 126  ? 177.386 239.458 155.070 1.00 70.30  ? 126  VAL A  C   1 
ATOM   858   O O   . VAL A  1 126  ? 176.684 238.601 154.520 1.00 70.81  ? 126  VAL A  O   1 
ATOM   859   C CB  . VAL A  1 126  ? 176.820 239.490 157.533 1.00 69.63  ? 126  VAL A  CB  1 
ATOM   860   C CG1 . VAL A  1 126  ? 178.209 238.975 157.868 1.00 59.88  ? 126  VAL A  CG1 1 
ATOM   861   C CG2 . VAL A  1 126  ? 176.278 240.345 158.670 1.00 68.29  ? 126  VAL A  CG2 1 
ATOM   862   N N   . VAL A  1 127  ? 178.636 239.711 154.695 1.00 61.44  ? 127  VAL A  N   1 
ATOM   863   C CA  . VAL A  1 127  ? 179.293 238.998 153.608 1.00 58.60  ? 127  VAL A  CA  1 
ATOM   864   C C   . VAL A  1 127  ? 180.588 238.390 154.126 1.00 56.79  ? 127  VAL A  C   1 
ATOM   865   O O   . VAL A  1 127  ? 181.394 239.070 154.770 1.00 55.90  ? 127  VAL A  O   1 
ATOM   866   C CB  . VAL A  1 127  ? 179.566 239.924 152.404 1.00 64.89  ? 127  VAL A  CB  1 
ATOM   867   C CG1 . VAL A  1 127  ? 180.240 241.207 152.857 1.00 67.91  ? 127  VAL A  CG1 1 
ATOM   868   C CG2 . VAL A  1 127  ? 180.418 239.211 151.366 1.00 60.38  ? 127  VAL A  CG2 1 
ATOM   869   N N   . ILE A  1 128  ? 180.786 237.107 153.833 1.00 54.32  ? 128  ILE A  N   1 
ATOM   870   C CA  . ILE A  1 128  ? 182.013 236.391 154.159 1.00 53.97  ? 128  ILE A  CA  1 
ATOM   871   C C   . ILE A  1 128  ? 182.572 235.845 152.856 1.00 50.37  ? 128  ILE A  C   1 
ATOM   872   O O   . ILE A  1 128  ? 181.873 235.123 152.134 1.00 57.06  ? 128  ILE A  O   1 
ATOM   873   C CB  . ILE A  1 128  ? 181.773 235.253 155.166 1.00 58.56  ? 128  ILE A  CB  1 
ATOM   874   C CG1 . ILE A  1 128  ? 181.251 235.817 156.490 1.00 56.13  ? 128  ILE A  CG1 1 
ATOM   875   C CG2 . ILE A  1 128  ? 183.054 234.459 155.383 1.00 49.67  ? 128  ILE A  CG2 1 
ATOM   876   C CD1 . ILE A  1 128  ? 180.682 234.772 157.421 1.00 44.71  ? 128  ILE A  CD1 1 
ATOM   877   N N   . LYS A  1 129  ? 183.819 236.191 152.549 1.00 50.68  ? 129  LYS A  N   1 
ATOM   878   C CA  . LYS A  1 129  ? 184.403 235.826 151.269 1.00 51.25  ? 129  LYS A  CA  1 
ATOM   879   C C   . LYS A  1 129  ? 185.902 235.624 151.422 1.00 51.78  ? 129  LYS A  C   1 
ATOM   880   O O   . LYS A  1 129  ? 186.562 236.356 152.163 1.00 51.08  ? 129  LYS A  O   1 
ATOM   881   C CB  . LYS A  1 129  ? 184.126 236.902 150.218 1.00 50.27  ? 129  LYS A  CB  1 
ATOM   882   C CG  . LYS A  1 129  ? 184.203 236.399 148.797 1.00 60.93  ? 129  LYS A  CG  1 
ATOM   883   C CD  . LYS A  1 129  ? 183.981 237.520 147.802 1.00 64.88  ? 129  LYS A  CD  1 
ATOM   884   C CE  . LYS A  1 129  ? 182.626 238.171 148.011 1.00 66.73  ? 129  LYS A  CE  1 
ATOM   885   N NZ  . LYS A  1 129  ? 182.099 238.792 146.767 1.00 75.42  ? 129  LYS A  NZ  1 
ATOM   886   N N   . VAL A  1 130  ? 186.430 234.640 150.700 1.00 50.17  ? 130  VAL A  N   1 
ATOM   887   C CA  . VAL A  1 130  ? 187.856 234.341 150.671 1.00 51.39  ? 130  VAL A  CA  1 
ATOM   888   C C   . VAL A  1 130  ? 188.328 234.505 149.235 1.00 60.45  ? 130  VAL A  C   1 
ATOM   889   O O   . VAL A  1 130  ? 187.905 233.751 148.351 1.00 70.10  ? 130  VAL A  O   1 
ATOM   890   C CB  . VAL A  1 130  ? 188.153 232.924 151.186 1.00 44.04  ? 130  VAL A  CB  1 
ATOM   891   C CG1 . VAL A  1 130  ? 189.637 232.622 151.098 1.00 43.42  ? 130  VAL A  CG1 1 
ATOM   892   C CG2 . VAL A  1 130  ? 187.660 232.765 152.609 1.00 44.38  ? 130  VAL A  CG2 1 
ATOM   893   N N   . CYS A  1 131  ? 189.198 235.485 149.003 1.00 55.29  ? 131  CYS A  N   1 
ATOM   894   C CA  . CYS A  1 131  ? 189.735 235.748 147.678 1.00 53.06  ? 131  CYS A  CA  1 
ATOM   895   C C   . CYS A  1 131  ? 191.175 236.221 147.802 1.00 51.53  ? 131  CYS A  C   1 
ATOM   896   O O   . CYS A  1 131  ? 191.657 236.526 148.895 1.00 60.68  ? 131  CYS A  O   1 
ATOM   897   C CB  . CYS A  1 131  ? 188.917 236.808 146.928 1.00 62.19  ? 131  CYS A  CB  1 
ATOM   898   S SG  . CYS A  1 131  ? 187.127 236.629 146.990 1.00 67.04  ? 131  CYS A  SG  1 
ATOM   899   N N   . GLU A  1 132  ? 191.868 236.264 146.665 1.00 56.43  ? 132  GLU A  N   1 
ATOM   900   C CA  . GLU A  1 132  ? 193.180 236.896 146.599 1.00 58.91  ? 132  GLU A  CA  1 
ATOM   901   C C   . GLU A  1 132  ? 193.029 238.412 146.542 1.00 64.91  ? 132  GLU A  C   1 
ATOM   902   O O   . GLU A  1 132  ? 193.319 239.037 145.516 1.00 68.37  ? 132  GLU A  O   1 
ATOM   903   C CB  . GLU A  1 132  ? 193.960 236.386 145.386 1.00 63.18  ? 132  GLU A  CB  1 
ATOM   904   C CG  . GLU A  1 132  ? 194.475 234.961 145.542 1.00 67.64  ? 132  GLU A  CG  1 
ATOM   905   C CD  . GLU A  1 132  ? 195.305 234.500 144.363 1.00 67.83  ? 132  GLU A  CD  1 
ATOM   906   O OE1 . GLU A  1 132  ? 195.094 235.017 143.247 1.00 76.00  ? 132  GLU A  OE1 1 
ATOM   907   O OE2 . GLU A  1 132  ? 196.174 233.622 144.556 1.00 66.52  ? 132  GLU A  OE2 1 
ATOM   908   N N   . PHE A  1 133  ? 192.582 239.010 147.642 1.00 66.99  ? 133  PHE A  N   1 
ATOM   909   C CA  . PHE A  1 133  ? 192.262 240.431 147.659 1.00 65.42  ? 133  PHE A  CA  1 
ATOM   910   C C   . PHE A  1 133  ? 193.511 241.290 147.516 1.00 66.19  ? 133  PHE A  C   1 
ATOM   911   O O   . PHE A  1 133  ? 194.601 240.914 147.956 1.00 60.86  ? 133  PHE A  O   1 
ATOM   912   C CB  . PHE A  1 133  ? 191.556 240.799 148.960 1.00 64.37  ? 133  PHE A  CB  1 
ATOM   913   C CG  . PHE A  1 133  ? 190.152 240.289 149.058 1.00 58.91  ? 133  PHE A  CG  1 
ATOM   914   C CD1 . PHE A  1 133  ? 189.133 240.877 148.335 1.00 60.91  ? 133  PHE A  CD1 1 
ATOM   915   C CD2 . PHE A  1 133  ? 189.850 239.231 149.889 1.00 59.83  ? 133  PHE A  CD2 1 
ATOM   916   C CE1 . PHE A  1 133  ? 187.841 240.410 148.435 1.00 58.98  ? 133  PHE A  CE1 1 
ATOM   917   C CE2 . PHE A  1 133  ? 188.562 238.763 149.990 1.00 59.87  ? 133  PHE A  CE2 1 
ATOM   918   C CZ  . PHE A  1 133  ? 187.556 239.352 149.261 1.00 52.77  ? 133  PHE A  CZ  1 
ATOM   919   N N   . GLN A  1 134  ? 193.340 242.456 146.896 1.00 67.27  ? 134  GLN A  N   1 
ATOM   920   C CA  . GLN A  1 134  ? 194.351 243.512 146.889 1.00 70.43  ? 134  GLN A  CA  1 
ATOM   921   C C   . GLN A  1 134  ? 193.841 244.612 147.814 1.00 75.91  ? 134  GLN A  C   1 
ATOM   922   O O   . GLN A  1 134  ? 193.113 245.513 147.397 1.00 83.92  ? 134  GLN A  O   1 
ATOM   923   C CB  . GLN A  1 134  ? 194.601 244.028 145.478 1.00 62.85  ? 134  GLN A  CB  1 
ATOM   924   C CG  . GLN A  1 134  ? 195.631 245.136 145.400 1.00 63.57  ? 134  GLN A  CG  1 
ATOM   925   C CD  . GLN A  1 134  ? 196.999 244.683 145.861 1.00 64.20  ? 134  GLN A  CD  1 
ATOM   926   O OE1 . GLN A  1 134  ? 197.401 244.939 146.995 1.00 65.49  ? 134  GLN A  OE1 1 
ATOM   927   N NE2 . GLN A  1 134  ? 197.724 244.003 144.983 1.00 65.93  ? 134  GLN A  NE2 1 
ATOM   928   N N   . PHE A  1 135  ? 194.228 244.533 149.083 1.00 69.67  ? 135  PHE A  N   1 
ATOM   929   C CA  . PHE A  1 135  ? 193.702 245.448 150.081 1.00 74.74  ? 135  PHE A  CA  1 
ATOM   930   C C   . PHE A  1 135  ? 194.406 246.799 150.017 1.00 82.25  ? 135  PHE A  C   1 
ATOM   931   O O   . PHE A  1 135  ? 195.539 246.924 149.546 1.00 81.12  ? 135  PHE A  O   1 
ATOM   932   C CB  . PHE A  1 135  ? 193.841 244.855 151.481 1.00 70.22  ? 135  PHE A  CB  1 
ATOM   933   C CG  . PHE A  1 135  ? 192.949 243.677 151.725 1.00 72.00  ? 135  PHE A  CG  1 
ATOM   934   C CD1 . PHE A  1 135  ? 191.577 243.836 151.796 1.00 72.40  ? 135  PHE A  CD1 1 
ATOM   935   C CD2 . PHE A  1 135  ? 193.479 242.413 151.884 1.00 67.46  ? 135  PHE A  CD2 1 
ATOM   936   C CE1 . PHE A  1 135  ? 190.754 242.757 152.017 1.00 64.38  ? 135  PHE A  CE1 1 
ATOM   937   C CE2 . PHE A  1 135  ? 192.660 241.332 152.110 1.00 59.69  ? 135  PHE A  CE2 1 
ATOM   938   C CZ  . PHE A  1 135  ? 191.295 241.503 152.175 1.00 59.38  ? 135  PHE A  CZ  1 
ATOM   939   N N   . CYS A  1 136  ? 193.706 247.817 150.503 1.00 80.79  ? 136  CYS A  N   1 
ATOM   940   C CA  . CYS A  1 136  ? 194.232 249.169 150.550 1.00 84.43  ? 136  CYS A  CA  1 
ATOM   941   C C   . CYS A  1 136  ? 195.061 249.362 151.815 1.00 81.88  ? 136  CYS A  C   1 
ATOM   942   O O   . CYS A  1 136  ? 194.950 248.605 152.782 1.00 79.84  ? 136  CYS A  O   1 
ATOM   943   C CB  . CYS A  1 136  ? 193.083 250.176 150.486 1.00 83.00  ? 136  CYS A  CB  1 
ATOM   944   S SG  . CYS A  1 136  ? 192.086 249.943 148.998 1.00 111.57 ? 136  CYS A  SG  1 
ATOM   945   N N   . ASN A  1 137  ? 195.918 250.383 151.795 1.00 80.47  ? 137  ASN A  N   1 
ATOM   946   C CA  . ASN A  1 137  ? 196.719 250.662 152.980 1.00 82.51  ? 137  ASN A  CA  1 
ATOM   947   C C   . ASN A  1 137  ? 195.829 251.028 154.159 1.00 83.04  ? 137  ASN A  C   1 
ATOM   948   O O   . ASN A  1 137  ? 196.104 250.631 155.298 1.00 84.43  ? 137  ASN A  O   1 
ATOM   949   C CB  . ASN A  1 137  ? 197.723 251.777 152.694 1.00 84.54  ? 137  ASN A  CB  1 
ATOM   950   C CG  . ASN A  1 137  ? 198.690 252.002 153.847 1.00 81.77  ? 137  ASN A  CG  1 
ATOM   951   O OD1 . ASN A  1 137  ? 198.885 253.132 154.294 1.00 78.19  ? 137  ASN A  OD1 1 
ATOM   952   N ND2 . ASN A  1 137  ? 199.291 250.923 154.341 1.00 84.46  ? 137  ASN A  ND2 1 
ATOM   953   N N   . ASP A  1 138  ? 194.760 251.779 153.910 1.00 76.31  ? 138  ASP A  N   1 
ATOM   954   C CA  . ASP A  1 138  ? 193.781 252.120 154.942 1.00 74.34  ? 138  ASP A  CA  1 
ATOM   955   C C   . ASP A  1 138  ? 192.389 251.699 154.495 1.00 72.24  ? 138  ASP A  C   1 
ATOM   956   O O   . ASP A  1 138  ? 191.683 252.483 153.834 1.00 68.72  ? 138  ASP A  O   1 
ATOM   957   C CB  . ASP A  1 138  ? 193.825 253.617 155.241 1.00 74.31  ? 138  ASP A  CB  1 
ATOM   958   C CG  . ASP A  1 138  ? 195.148 254.044 155.844 1.00 83.04  ? 138  ASP A  CG  1 
ATOM   959   O OD1 . ASP A  1 138  ? 195.869 253.170 156.369 1.00 82.99  ? 138  ASP A  OD1 1 
ATOM   960   O OD2 . ASP A  1 138  ? 195.471 255.249 155.792 1.00 87.67  ? 138  ASP A  OD2 1 
ATOM   961   N N   . PRO A  1 139  ? 191.941 250.488 154.830 1.00 76.91  ? 139  PRO A  N   1 
ATOM   962   C CA  . PRO A  1 139  ? 190.587 250.066 154.457 1.00 70.79  ? 139  PRO A  CA  1 
ATOM   963   C C   . PRO A  1 139  ? 189.548 250.584 155.437 1.00 70.83  ? 139  PRO A  C   1 
ATOM   964   O O   . PRO A  1 139  ? 189.778 250.668 156.644 1.00 70.80  ? 139  PRO A  O   1 
ATOM   965   C CB  . PRO A  1 139  ? 190.684 248.537 154.514 1.00 64.21  ? 139  PRO A  CB  1 
ATOM   966   C CG  . PRO A  1 139  ? 191.666 248.288 155.601 1.00 64.22  ? 139  PRO A  CG  1 
ATOM   967   C CD  . PRO A  1 139  ? 192.667 249.422 155.542 1.00 71.28  ? 139  PRO A  CD  1 
ATOM   968   N N   . PHE A  1 140  ? 188.386 250.946 154.902 1.00 68.48  ? 140  PHE A  N   1 
ATOM   969   C CA  . PHE A  1 140  ? 187.314 251.462 155.738 1.00 66.09  ? 140  PHE A  CA  1 
ATOM   970   C C   . PHE A  1 140  ? 186.015 251.457 154.948 1.00 66.71  ? 140  PHE A  C   1 
ATOM   971   O O   . PHE A  1 140  ? 186.001 251.300 153.725 1.00 71.56  ? 140  PHE A  O   1 
ATOM   972   C CB  . PHE A  1 140  ? 187.639 252.872 156.237 1.00 67.83  ? 140  PHE A  CB  1 
ATOM   973   C CG  . PHE A  1 140  ? 187.793 253.879 155.135 1.00 69.87  ? 140  PHE A  CG  1 
ATOM   974   C CD1 . PHE A  1 140  ? 188.992 254.010 154.461 1.00 68.85  ? 140  PHE A  CD1 1 
ATOM   975   C CD2 . PHE A  1 140  ? 186.734 254.690 154.768 1.00 74.19  ? 140  PHE A  CD2 1 
ATOM   976   C CE1 . PHE A  1 140  ? 189.132 254.929 153.446 1.00 72.95  ? 140  PHE A  CE1 1 
ATOM   977   C CE2 . PHE A  1 140  ? 186.870 255.610 153.754 1.00 67.00  ? 140  PHE A  CE2 1 
ATOM   978   C CZ  . PHE A  1 140  ? 188.071 255.731 153.093 1.00 69.07  ? 140  PHE A  CZ  1 
ATOM   979   N N   . LEU A  1 141  ? 184.918 251.627 155.675 1.00 63.35  ? 141  LEU A  N   1 
ATOM   980   C CA  . LEU A  1 141  ? 183.610 251.913 155.114 1.00 65.40  ? 141  LEU A  CA  1 
ATOM   981   C C   . LEU A  1 141  ? 183.202 253.306 155.570 1.00 73.20  ? 141  LEU A  C   1 
ATOM   982   O O   . LEU A  1 141  ? 183.889 253.940 156.376 1.00 79.19  ? 141  LEU A  O   1 
ATOM   983   C CB  . LEU A  1 141  ? 182.575 250.861 155.539 1.00 67.77  ? 141  LEU A  CB  1 
ATOM   984   C CG  . LEU A  1 141  ? 182.899 249.417 155.133 1.00 67.55  ? 141  LEU A  CG  1 
ATOM   985   C CD1 . LEU A  1 141  ? 183.875 248.752 156.102 1.00 61.75  ? 141  LEU A  CD1 1 
ATOM   986   C CD2 . LEU A  1 141  ? 181.630 248.589 155.012 1.00 69.08  ? 141  LEU A  CD2 1 
ATOM   987   N N   . GLY A  1 142  ? 182.083 253.796 155.049 1.00 73.58  ? 142  GLY A  N   1 
ATOM   988   C CA  . GLY A  1 142  ? 181.716 255.181 155.277 1.00 74.73  ? 142  GLY A  CA  1 
ATOM   989   C C   . GLY A  1 142  ? 180.222 255.386 155.240 1.00 78.83  ? 142  GLY A  C   1 
ATOM   990   O O   . GLY A  1 142  ? 179.490 254.640 154.584 1.00 81.28  ? 142  GLY A  O   1 
ATOM   991   N N   . VAL A  1 143  ? 179.770 256.413 155.956 1.00 77.66  ? 143  VAL A  N   1 
ATOM   992   C CA  . VAL A  1 143  ? 178.359 256.766 156.051 1.00 76.04  ? 143  VAL A  CA  1 
ATOM   993   C C   . VAL A  1 143  ? 178.218 258.269 155.862 1.00 82.05  ? 143  VAL A  C   1 
ATOM   994   O O   . VAL A  1 143  ? 179.081 259.041 156.293 1.00 87.50  ? 143  VAL A  O   1 
ATOM   995   C CB  . VAL A  1 143  ? 177.757 256.333 157.405 1.00 76.35  ? 143  VAL A  CB  1 
ATOM   996   C CG1 . VAL A  1 143  ? 176.276 256.658 157.457 1.00 76.33  ? 143  VAL A  CG1 1 
ATOM   997   C CG2 . VAL A  1 143  ? 177.987 254.853 157.638 1.00 77.17  ? 143  VAL A  CG2 1 
ATOM   998   N N   . TYR A  1 144  ? 177.132 258.683 155.209 1.00 93.61  ? 144  TYR A  N   1 
ATOM   999   C CA  . TYR A  1 144  ? 176.806 260.099 155.047 1.00 88.06  ? 144  TYR A  CA  1 
ATOM   1000  C C   . TYR A  1 144  ? 175.947 260.542 156.226 1.00 88.40  ? 144  TYR A  C   1 
ATOM   1001  O O   . TYR A  1 144  ? 174.840 260.032 156.424 1.00 87.25  ? 144  TYR A  O   1 
ATOM   1002  C CB  . TYR A  1 144  ? 176.082 260.346 153.727 1.00 87.96  ? 144  TYR A  CB  1 
ATOM   1003  C CG  . TYR A  1 144  ? 176.961 260.878 152.613 1.00 91.18  ? 144  TYR A  CG  1 
ATOM   1004  C CD1 . TYR A  1 144  ? 177.918 261.857 152.855 1.00 84.77  ? 144  TYR A  CD1 1 
ATOM   1005  C CD2 . TYR A  1 144  ? 176.827 260.406 151.316 1.00 86.72  ? 144  TYR A  CD2 1 
ATOM   1006  C CE1 . TYR A  1 144  ? 178.715 262.342 151.843 1.00 81.08  ? 144  TYR A  CE1 1 
ATOM   1007  C CE2 . TYR A  1 144  ? 177.621 260.886 150.297 1.00 87.31  ? 144  TYR A  CE2 1 
ATOM   1008  C CZ  . TYR A  1 144  ? 178.564 261.854 150.566 1.00 82.85  ? 144  TYR A  CZ  1 
ATOM   1009  O OH  . TYR A  1 144  ? 179.359 262.336 149.552 1.00 85.80  ? 144  TYR A  OH  1 
ATOM   1010  N N   . TYR A  1 145  ? 176.455 261.497 157.000 1.00 88.13  ? 145  TYR A  N   1 
ATOM   1011  C CA  . TYR A  1 145  ? 175.831 261.890 158.260 1.00 96.06  ? 145  TYR A  CA  1 
ATOM   1012  C C   . TYR A  1 145  ? 174.840 263.028 158.027 1.00 102.65 ? 145  TYR A  C   1 
ATOM   1013  O O   . TYR A  1 145  ? 175.237 264.155 157.713 1.00 97.43  ? 145  TYR A  O   1 
ATOM   1014  C CB  . TYR A  1 145  ? 176.900 262.278 159.283 1.00 91.84  ? 145  TYR A  CB  1 
ATOM   1015  C CG  . TYR A  1 145  ? 177.891 263.344 158.840 1.00 96.75  ? 145  TYR A  CG  1 
ATOM   1016  C CD1 . TYR A  1 145  ? 178.929 263.043 157.964 1.00 97.12  ? 145  TYR A  CD1 1 
ATOM   1017  C CD2 . TYR A  1 145  ? 177.812 264.642 159.329 1.00 94.65  ? 145  TYR A  CD2 1 
ATOM   1018  C CE1 . TYR A  1 145  ? 179.836 264.007 157.567 1.00 88.69  ? 145  TYR A  CE1 1 
ATOM   1019  C CE2 . TYR A  1 145  ? 178.720 265.611 158.939 1.00 92.71  ? 145  TYR A  CE2 1 
ATOM   1020  C CZ  . TYR A  1 145  ? 179.729 265.287 158.061 1.00 90.95  ? 145  TYR A  CZ  1 
ATOM   1021  O OH  . TYR A  1 145  ? 180.635 266.245 157.670 1.00 90.28  ? 145  TYR A  OH  1 
ATOM   1022  N N   . HIS A  1 146  ? 173.546 262.731 158.192 1.00 101.78 ? 146  HIS A  N   1 
ATOM   1023  C CA  . HIS A  1 146  ? 172.509 263.758 158.310 1.00 98.69  ? 146  HIS A  CA  1 
ATOM   1024  C C   . HIS A  1 146  ? 172.509 264.699 157.105 1.00 104.73 ? 146  HIS A  C   1 
ATOM   1025  O O   . HIS A  1 146  ? 172.452 265.923 157.244 1.00 105.12 ? 146  HIS A  O   1 
ATOM   1026  C CB  . HIS A  1 146  ? 172.696 264.535 159.618 1.00 94.48  ? 146  HIS A  CB  1 
ATOM   1027  C CG  . HIS A  1 146  ? 171.421 265.021 160.239 1.00 101.95 ? 146  HIS A  CG  1 
ATOM   1028  N ND1 . HIS A  1 146  ? 170.706 266.091 159.744 1.00 104.89 ? 146  HIS A  ND1 1 
ATOM   1029  C CD2 . HIS A  1 146  ? 170.751 264.599 161.338 1.00 100.80 ? 146  HIS A  CD2 1 
ATOM   1030  C CE1 . HIS A  1 146  ? 169.643 266.296 160.501 1.00 106.09 ? 146  HIS A  CE1 1 
ATOM   1031  N NE2 . HIS A  1 146  ? 169.647 265.404 161.475 1.00 103.51 ? 146  HIS A  NE2 1 
ATOM   1032  N N   . LYS A  1 147  ? 172.570 264.120 155.902 1.00 99.22  ? 147  LYS A  N   1 
ATOM   1033  C CA  . LYS A  1 147  ? 172.711 264.900 154.669 1.00 107.67 ? 147  LYS A  CA  1 
ATOM   1034  C C   . LYS A  1 147  ? 171.332 265.216 154.094 1.00 108.61 ? 147  LYS A  C   1 
ATOM   1035  O O   . LYS A  1 147  ? 170.941 264.776 153.010 1.00 108.52 ? 147  LYS A  O   1 
ATOM   1036  C CB  . LYS A  1 147  ? 173.590 264.155 153.676 1.00 97.61  ? 147  LYS A  CB  1 
ATOM   1037  C CG  . LYS A  1 147  ? 174.995 263.884 154.208 1.00 92.85  ? 147  LYS A  CG  1 
ATOM   1038  C CD  . LYS A  1 147  ? 175.656 265.152 154.758 1.00 89.62  ? 147  LYS A  CD  1 
ATOM   1039  C CE  . LYS A  1 147  ? 175.666 266.286 153.735 1.00 94.60  ? 147  LYS A  CE  1 
ATOM   1040  N NZ  . LYS A  1 147  ? 176.260 267.539 154.286 1.00 80.65  ? 147  LYS A  NZ  1 
ATOM   1041  N N   . ASN A  1 148  ? 170.710 266.146 154.826 1.00 111.41 ? 148  ASN A  N   1 
ATOM   1042  C CA  . ASN A  1 148  ? 169.402 266.733 154.559 1.00 108.14 ? 148  ASN A  CA  1 
ATOM   1043  C C   . ASN A  1 148  ? 168.297 265.715 154.437 1.00 106.64 ? 148  ASN A  C   1 
ATOM   1044  O O   . ASN A  1 148  ? 167.264 265.987 153.826 1.00 103.92 ? 148  ASN A  O   1 
ATOM   1045  C CB  . ASN A  1 148  ? 169.450 267.613 153.306 1.00 104.35 ? 148  ASN A  CB  1 
ATOM   1046  C CG  . ASN A  1 148  ? 170.348 268.823 153.476 1.00 103.44 ? 148  ASN A  CG  1 
ATOM   1047  O OD1 . ASN A  1 148  ? 170.587 269.280 154.594 1.00 100.86 ? 148  ASN A  OD1 1 
ATOM   1048  N ND2 . ASN A  1 148  ? 170.850 269.349 152.365 1.00 104.25 ? 148  ASN A  ND2 1 
ATOM   1049  N N   . ASN A  1 149  ? 168.488 264.564 155.068 1.00 107.15 ? 149  ASN A  N   1 
ATOM   1050  C CA  . ASN A  1 149  ? 167.501 263.503 154.935 1.00 106.22 ? 149  ASN A  CA  1 
ATOM   1051  C C   . ASN A  1 149  ? 166.974 263.003 156.271 1.00 106.50 ? 149  ASN A  C   1 
ATOM   1052  O O   . ASN A  1 149  ? 166.040 262.192 156.281 1.00 104.24 ? 149  ASN A  O   1 
ATOM   1053  C CB  . ASN A  1 149  ? 168.078 262.318 154.144 1.00 105.14 ? 149  ASN A  CB  1 
ATOM   1054  C CG  . ASN A  1 149  ? 167.801 262.416 152.651 1.00 107.76 ? 149  ASN A  CG  1 
ATOM   1055  O OD1 . ASN A  1 149  ? 167.525 263.493 152.121 1.00 106.86 ? 149  ASN A  OD1 1 
ATOM   1056  N ND2 . ASN A  1 149  ? 167.874 261.278 151.965 1.00 109.97 ? 149  ASN A  ND2 1 
ATOM   1057  N N   . LYS A  1 150  ? 167.594 263.479 157.357 1.00 104.49 ? 150  LYS A  N   1 
ATOM   1058  C CA  . LYS A  1 150  ? 167.336 263.112 158.769 1.00 104.02 ? 150  LYS A  CA  1 
ATOM   1059  C C   . LYS A  1 150  ? 167.905 261.730 159.137 1.00 104.34 ? 150  LYS A  C   1 
ATOM   1060  O O   . LYS A  1 150  ? 168.368 261.535 160.261 1.00 99.88  ? 150  LYS A  O   1 
ATOM   1061  C CB  . LYS A  1 150  ? 165.888 263.334 159.260 1.00 101.28 ? 150  LYS A  CB  1 
ATOM   1062  C CG  . LYS A  1 150  ? 165.788 263.992 160.627 1.00 98.55  ? 150  LYS A  CG  1 
ATOM   1063  C CD  . LYS A  1 150  ? 164.341 264.249 161.011 1.00 94.12  ? 150  LYS A  CD  1 
ATOM   1064  C CE  . LYS A  1 150  ? 164.227 264.722 162.452 1.00 98.14  ? 150  LYS A  CE  1 
ATOM   1065  N NZ  . LYS A  1 150  ? 163.802 263.625 163.365 1.00 104.51 ? 150  LYS A  NZ  1 
ATOM   1066  N N   . SER A  1 151  ? 167.874 260.777 158.205 1.00 104.53 ? 151  SER A  N   1 
ATOM   1067  C CA  . SER A  1 151  ? 168.469 259.473 158.466 1.00 100.22 ? 151  SER A  CA  1 
ATOM   1068  C C   . SER A  1 151  ? 169.914 259.410 157.975 1.00 99.37  ? 151  SER A  C   1 
ATOM   1069  O O   . SER A  1 151  ? 170.373 260.242 157.187 1.00 94.31  ? 151  SER A  O   1 
ATOM   1070  C CB  . SER A  1 151  ? 167.662 258.370 157.784 1.00 95.06  ? 151  SER A  CB  1 
ATOM   1071  O OG  . SER A  1 151  ? 167.600 258.588 156.385 1.00 93.87  ? 151  SER A  OG  1 
ATOM   1072  N N   . TRP A  1 152  ? 170.633 258.401 158.462 1.00 94.54  ? 152  TRP A  N   1 
ATOM   1073  C CA  . TRP A  1 152  ? 171.997 258.118 158.033 1.00 90.59  ? 152  TRP A  CA  1 
ATOM   1074  C C   . TRP A  1 152  ? 171.983 256.919 157.096 1.00 91.75  ? 152  TRP A  C   1 
ATOM   1075  O O   . TRP A  1 152  ? 171.264 255.944 157.341 1.00 91.74  ? 152  TRP A  O   1 
ATOM   1076  C CB  . TRP A  1 152  ? 172.916 257.833 159.221 1.00 86.20  ? 152  TRP A  CB  1 
ATOM   1077  C CG  . TRP A  1 152  ? 173.054 258.969 160.182 1.00 84.29  ? 152  TRP A  CG  1 
ATOM   1078  C CD1 . TRP A  1 152  ? 172.058 259.784 160.639 1.00 84.39  ? 152  TRP A  CD1 1 
ATOM   1079  C CD2 . TRP A  1 152  ? 174.259 259.424 160.809 1.00 84.53  ? 152  TRP A  CD2 1 
ATOM   1080  N NE1 . TRP A  1 152  ? 172.566 260.710 161.511 1.00 88.18  ? 152  TRP A  NE1 1 
ATOM   1081  C CE2 . TRP A  1 152  ? 173.916 260.513 161.631 1.00 89.01  ? 152  TRP A  CE2 1 
ATOM   1082  C CE3 . TRP A  1 152  ? 175.596 259.018 160.752 1.00 78.89  ? 152  TRP A  CE3 1 
ATOM   1083  C CZ2 . TRP A  1 152  ? 174.855 261.199 162.390 1.00 82.65  ? 152  TRP A  CZ2 1 
ATOM   1084  C CZ3 . TRP A  1 152  ? 176.527 259.703 161.512 1.00 75.40  ? 152  TRP A  CZ3 1 
ATOM   1085  C CH2 . TRP A  1 152  ? 176.152 260.781 162.318 1.00 72.71  ? 152  TRP A  CH2 1 
ATOM   1086  N N   . MET A  1 153  ? 172.762 256.998 156.020 1.00 84.68  ? 153  MET A  N   1 
ATOM   1087  C CA  . MET A  1 153  ? 172.852 255.916 155.051 1.00 82.52  ? 153  MET A  CA  1 
ATOM   1088  C C   . MET A  1 153  ? 174.295 255.719 154.609 1.00 83.01  ? 153  MET A  C   1 
ATOM   1089  O O   . MET A  1 153  ? 175.053 256.683 154.467 1.00 80.66  ? 153  MET A  O   1 
ATOM   1090  C CB  . MET A  1 153  ? 171.966 256.187 153.836 1.00 79.32  ? 153  MET A  CB  1 
ATOM   1091  C CG  . MET A  1 153  ? 172.021 255.086 152.799 1.00 81.12  ? 153  MET A  CG  1 
ATOM   1092  S SD  . MET A  1 153  ? 170.672 255.184 151.612 1.00 97.44  ? 153  MET A  SD  1 
ATOM   1093  C CE  . MET A  1 153  ? 170.892 253.638 150.739 1.00 81.15  ? 153  MET A  CE  1 
ATOM   1094  N N   . GLU A  1 154  ? 174.661 254.459 154.391 1.00 80.95  ? 154  GLU A  N   1 
ATOM   1095  C CA  . GLU A  1 154  ? 176.026 254.107 154.019 1.00 81.14  ? 154  GLU A  CA  1 
ATOM   1096  C C   . GLU A  1 154  ? 176.280 254.412 152.548 1.00 80.16  ? 154  GLU A  C   1 
ATOM   1097  O O   . GLU A  1 154  ? 175.439 254.138 151.688 1.00 78.66  ? 154  GLU A  O   1 
ATOM   1098  C CB  . GLU A  1 154  ? 176.262 252.623 154.300 1.00 82.73  ? 154  GLU A  CB  1 
ATOM   1099  C CG  . GLU A  1 154  ? 177.700 252.160 154.191 1.00 77.19  ? 154  GLU A  CG  1 
ATOM   1100  C CD  . GLU A  1 154  ? 177.863 250.718 154.625 1.00 81.63  ? 154  GLU A  CD  1 
ATOM   1101  O OE1 . GLU A  1 154  ? 177.018 249.884 154.237 1.00 86.11  ? 154  GLU A  OE1 1 
ATOM   1102  O OE2 . GLU A  1 154  ? 178.823 250.422 155.367 1.00 79.43  ? 154  GLU A  OE2 1 
ATOM   1103  N N   . SER A  1 155  ? 177.452 254.989 152.255 1.00 84.55  ? 155  SER A  N   1 
ATOM   1104  C CA  . SER A  1 155  ? 177.801 255.306 150.872 1.00 85.93  ? 155  SER A  CA  1 
ATOM   1105  C C   . SER A  1 155  ? 179.188 254.848 150.437 1.00 83.06  ? 155  SER A  C   1 
ATOM   1106  O O   . SER A  1 155  ? 179.369 254.585 149.244 1.00 85.88  ? 155  SER A  O   1 
ATOM   1107  C CB  . SER A  1 155  ? 177.694 256.818 150.629 1.00 89.40  ? 155  SER A  CB  1 
ATOM   1108  O OG  . SER A  1 155  ? 177.917 257.126 149.264 1.00 88.73  ? 155  SER A  OG  1 
ATOM   1109  N N   . GLU A  1 156  ? 180.166 254.731 151.330 1.00 81.40  ? 156  GLU A  N   1 
ATOM   1110  C CA  . GLU A  1 156  ? 181.547 254.473 150.939 1.00 84.17  ? 156  GLU A  CA  1 
ATOM   1111  C C   . GLU A  1 156  ? 181.951 253.051 151.302 1.00 83.98  ? 156  GLU A  C   1 
ATOM   1112  O O   . GLU A  1 156  ? 181.665 252.581 152.408 1.00 80.52  ? 156  GLU A  O   1 
ATOM   1113  C CB  . GLU A  1 156  ? 182.498 255.469 151.603 1.00 83.82  ? 156  GLU A  CB  1 
ATOM   1114  C CG  . GLU A  1 156  ? 182.177 256.925 151.299 1.00 88.58  ? 156  GLU A  CG  1 
ATOM   1115  C CD  . GLU A  1 156  ? 183.193 257.883 151.891 1.00 97.16  ? 156  GLU A  CD  1 
ATOM   1116  O OE1 . GLU A  1 156  ? 184.402 257.576 151.842 1.00 97.81  ? 156  GLU A  OE1 1 
ATOM   1117  O OE2 . GLU A  1 156  ? 182.781 258.944 152.408 1.00 98.63  ? 156  GLU A  OE2 1 
ATOM   1118  N N   . PHE A  1 157  ? 182.611 252.372 150.363 1.00 82.95  ? 157  PHE A  N   1 
ATOM   1119  C CA  . PHE A  1 157  ? 183.163 251.036 150.584 1.00 74.73  ? 157  PHE A  CA  1 
ATOM   1120  C C   . PHE A  1 157  ? 184.533 250.998 149.913 1.00 73.06  ? 157  PHE A  C   1 
ATOM   1121  O O   . PHE A  1 157  ? 184.628 250.773 148.702 1.00 81.08  ? 157  PHE A  O   1 
ATOM   1122  C CB  . PHE A  1 157  ? 182.242 249.957 150.028 1.00 71.42  ? 157  PHE A  CB  1 
ATOM   1123  C CG  . PHE A  1 157  ? 182.739 248.561 150.258 1.00 72.04  ? 157  PHE A  CG  1 
ATOM   1124  C CD1 . PHE A  1 157  ? 182.420 247.884 151.420 1.00 72.29  ? 157  PHE A  CD1 1 
ATOM   1125  C CD2 . PHE A  1 157  ? 183.524 247.923 149.313 1.00 69.70  ? 157  PHE A  CD2 1 
ATOM   1126  C CE1 . PHE A  1 157  ? 182.874 246.602 151.638 1.00 63.24  ? 157  PHE A  CE1 1 
ATOM   1127  C CE2 . PHE A  1 157  ? 183.980 246.639 149.527 1.00 66.48  ? 157  PHE A  CE2 1 
ATOM   1128  C CZ  . PHE A  1 157  ? 183.654 245.978 150.691 1.00 61.92  ? 157  PHE A  CZ  1 
ATOM   1129  N N   . ARG A  1 158  ? 185.588 251.224 150.694 1.00 70.03  ? 158  ARG A  N   1 
ATOM   1130  C CA  . ARG A  1 158  ? 186.956 251.320 150.178 1.00 76.39  ? 158  ARG A  CA  1 
ATOM   1131  C C   . ARG A  1 158  ? 187.850 250.412 151.016 1.00 73.57  ? 158  ARG A  C   1 
ATOM   1132  O O   . ARG A  1 158  ? 188.490 250.869 151.966 1.00 72.01  ? 158  ARG A  O   1 
ATOM   1133  C CB  . ARG A  1 158  ? 187.438 252.765 150.209 1.00 79.05  ? 158  ARG A  CB  1 
ATOM   1134  C CG  . ARG A  1 158  ? 186.511 253.728 149.491 1.00 81.49  ? 158  ARG A  CG  1 
ATOM   1135  C CD  . ARG A  1 158  ? 187.018 255.147 149.585 1.00 83.09  ? 158  ARG A  CD  1 
ATOM   1136  N NE  . ARG A  1 158  ? 186.130 256.098 148.926 1.00 80.15  ? 158  ARG A  NE  1 
ATOM   1137  C CZ  . ARG A  1 158  ? 186.328 257.411 148.914 1.00 85.85  ? 158  ARG A  CZ  1 
ATOM   1138  N NH1 . ARG A  1 158  ? 185.473 258.212 148.293 1.00 90.09  ? 158  ARG A  NH1 1 
ATOM   1139  N NH2 . ARG A  1 158  ? 187.385 257.926 149.525 1.00 87.87  ? 158  ARG A  NH2 1 
ATOM   1140  N N   . VAL A  1 159  ? 187.896 249.128 150.662 1.00 75.28  ? 159  VAL A  N   1 
ATOM   1141  C CA  . VAL A  1 159  ? 188.718 248.164 151.385 1.00 77.68  ? 159  VAL A  CA  1 
ATOM   1142  C C   . VAL A  1 159  ? 189.716 247.515 150.436 1.00 83.61  ? 159  VAL A  C   1 
ATOM   1143  O O   . VAL A  1 159  ? 190.917 247.465 150.723 1.00 78.37  ? 159  VAL A  O   1 
ATOM   1144  C CB  . VAL A  1 159  ? 187.845 247.095 152.064 1.00 65.21  ? 159  VAL A  CB  1 
ATOM   1145  C CG1 . VAL A  1 159  ? 188.716 245.985 152.629 1.00 67.00  ? 159  VAL A  CG1 1 
ATOM   1146  C CG2 . VAL A  1 159  ? 186.997 247.722 153.158 1.00 67.09  ? 159  VAL A  CG2 1 
ATOM   1147  N N   . TYR A  1 160  ? 189.232 247.030 149.295 1.00 81.38  ? 160  TYR A  N   1 
ATOM   1148  C CA  . TYR A  1 160  ? 190.067 246.319 148.341 1.00 73.12  ? 160  TYR A  CA  1 
ATOM   1149  C C   . TYR A  1 160  ? 189.754 246.806 146.935 1.00 83.36  ? 160  TYR A  C   1 
ATOM   1150  O O   . TYR A  1 160  ? 188.675 247.339 146.666 1.00 92.49  ? 160  TYR A  O   1 
ATOM   1151  C CB  . TYR A  1 160  ? 189.863 244.799 148.423 1.00 66.40  ? 160  TYR A  CB  1 
ATOM   1152  C CG  . TYR A  1 160  ? 188.456 244.344 148.094 1.00 69.36  ? 160  TYR A  CG  1 
ATOM   1153  C CD1 . TYR A  1 160  ? 188.053 244.162 146.778 1.00 67.46  ? 160  TYR A  CD1 1 
ATOM   1154  C CD2 . TYR A  1 160  ? 187.535 244.090 149.098 1.00 73.99  ? 160  TYR A  CD2 1 
ATOM   1155  C CE1 . TYR A  1 160  ? 186.773 243.748 146.475 1.00 63.78  ? 160  TYR A  CE1 1 
ATOM   1156  C CE2 . TYR A  1 160  ? 186.254 243.674 148.802 1.00 70.47  ? 160  TYR A  CE2 1 
ATOM   1157  C CZ  . TYR A  1 160  ? 185.879 243.505 147.491 1.00 68.47  ? 160  TYR A  CZ  1 
ATOM   1158  O OH  . TYR A  1 160  ? 184.601 243.091 147.197 1.00 75.87  ? 160  TYR A  OH  1 
ATOM   1159  N N   . SER A  1 161  ? 190.717 246.613 146.035 1.00 75.89  ? 161  SER A  N   1 
ATOM   1160  C CA  . SER A  1 161  ? 190.547 247.013 144.644 1.00 73.39  ? 161  SER A  CA  1 
ATOM   1161  C C   . SER A  1 161  ? 189.938 245.909 143.785 1.00 78.74  ? 161  SER A  C   1 
ATOM   1162  O O   . SER A  1 161  ? 189.027 246.179 142.998 1.00 76.49  ? 161  SER A  O   1 
ATOM   1163  C CB  . SER A  1 161  ? 191.892 247.435 144.051 1.00 71.06  ? 161  SER A  CB  1 
ATOM   1164  O OG  . SER A  1 161  ? 192.796 246.347 144.023 1.00 76.33  ? 161  SER A  OG  1 
ATOM   1165  N N   . SER A  1 162  ? 190.424 244.675 143.909 1.00 80.26  ? 162  SER A  N   1 
ATOM   1166  C CA  . SER A  1 162  ? 189.899 243.573 143.114 1.00 79.79  ? 162  SER A  CA  1 
ATOM   1167  C C   . SER A  1 162  ? 190.088 242.265 143.870 1.00 75.13  ? 162  SER A  C   1 
ATOM   1168  O O   . SER A  1 162  ? 190.992 242.124 144.698 1.00 68.44  ? 162  SER A  O   1 
ATOM   1169  C CB  . SER A  1 162  ? 190.565 243.507 141.734 1.00 81.16  ? 162  SER A  CB  1 
ATOM   1170  O OG  . SER A  1 162  ? 190.156 244.592 140.922 1.00 83.79  ? 162  SER A  OG  1 
ATOM   1171  N N   . ALA A  1 163  ? 189.205 241.300 143.563 1.00 73.46  ? 163  ALA A  N   1 
ATOM   1172  C CA  . ALA A  1 163  ? 188.998 240.098 144.375 1.00 68.75  ? 163  ALA A  CA  1 
ATOM   1173  C C   . ALA A  1 163  ? 188.885 238.857 143.474 1.00 68.28  ? 163  ALA A  C   1 
ATOM   1174  O O   . ALA A  1 163  ? 187.934 238.087 143.556 1.00 76.73  ? 163  ALA A  O   1 
ATOM   1175  C CB  . ALA A  1 163  ? 187.756 240.256 145.252 1.00 64.80  ? 163  ALA A  CB  1 
ATOM   1176  N N   . ASN A  1 164  ? 189.865 238.662 142.596 1.00 66.30  ? 164  ASN A  N   1 
ATOM   1177  C CA  . ASN A  1 164  ? 189.699 237.712 141.494 1.00 73.18  ? 164  ASN A  CA  1 
ATOM   1178  C C   . ASN A  1 164  ? 189.524 236.261 141.936 1.00 77.13  ? 164  ASN A  C   1 
ATOM   1179  O O   . ASN A  1 164  ? 188.446 235.695 141.737 1.00 76.04  ? 164  ASN A  O   1 
ATOM   1180  C CB  . ASN A  1 164  ? 190.905 237.808 140.563 1.00 70.69  ? 164  ASN A  CB  1 
ATOM   1181  C CG  . ASN A  1 164  ? 192.214 237.796 141.310 1.00 65.86  ? 164  ASN A  CG  1 
ATOM   1182  O OD1 . ASN A  1 164  ? 192.650 236.755 141.797 1.00 68.32  ? 164  ASN A  OD1 1 
ATOM   1183  N ND2 . ASN A  1 164  ? 192.840 238.955 141.421 1.00 70.14  ? 164  ASN A  ND2 1 
ATOM   1184  N N   . ASN A  1 165  ? 190.558 235.660 142.538 1.00 70.50  ? 165  ASN A  N   1 
ATOM   1185  C CA  . ASN A  1 165  ? 190.531 234.223 142.812 1.00 66.16  ? 165  ASN A  CA  1 
ATOM   1186  C C   . ASN A  1 165  ? 189.856 234.000 144.165 1.00 67.30  ? 165  ASN A  C   1 
ATOM   1187  O O   . ASN A  1 165  ? 190.478 234.061 145.231 1.00 71.73  ? 165  ASN A  O   1 
ATOM   1188  C CB  . ASN A  1 165  ? 191.937 233.620 142.744 1.00 71.32  ? 165  ASN A  CB  1 
ATOM   1189  C CG  . ASN A  1 165  ? 192.330 233.162 141.344 1.00 75.91  ? 165  ASN A  CG  1 
ATOM   1190  O OD1 . ASN A  1 165  ? 191.495 233.022 140.443 1.00 79.42  ? 165  ASN A  OD1 1 
ATOM   1191  N ND2 . ASN A  1 165  ? 193.633 232.917 141.177 1.00 76.80  ? 165  ASN A  ND2 1 
ATOM   1192  N N   . CYS A  1 166  ? 188.544 233.770 144.101 1.00 63.38  ? 166  CYS A  N   1 
ATOM   1193  C CA  . CYS A  1 166  ? 187.718 233.478 145.264 1.00 63.51  ? 166  CYS A  CA  1 
ATOM   1194  C C   . CYS A  1 166  ? 187.412 231.985 145.344 1.00 62.97  ? 166  CYS A  C   1 
ATOM   1195  O O   . CYS A  1 166  ? 187.014 231.376 144.341 1.00 67.88  ? 166  CYS A  O   1 
ATOM   1196  C CB  . CYS A  1 166  ? 186.410 234.267 145.201 1.00 72.54  ? 166  CYS A  CB  1 
ATOM   1197  S SG  . CYS A  1 166  ? 186.632 236.047 145.110 1.00 88.60  ? 166  CYS A  SG  1 
ATOM   1198  N N   . THR A  1 167  ? 187.612 231.410 146.523 1.00 63.34  ? 167  THR A  N   1 
ATOM   1199  C CA  . THR A  1 167  ? 187.350 230.004 146.764 1.00 58.46  ? 167  THR A  CA  1 
ATOM   1200  C C   . THR A  1 167  ? 186.334 229.749 147.865 1.00 56.62  ? 167  THR A  C   1 
ATOM   1201  O O   . THR A  1 167  ? 186.019 228.584 148.133 1.00 71.58  ? 167  THR A  O   1 
ATOM   1202  C CB  . THR A  1 167  ? 188.660 229.280 147.117 1.00 61.83  ? 167  THR A  CB  1 
ATOM   1203  O OG1 . THR A  1 167  ? 189.283 229.951 148.217 1.00 67.22  ? 167  THR A  OG1 1 
ATOM   1204  C CG2 . THR A  1 167  ? 189.608 229.335 145.930 1.00 66.05  ? 167  THR A  CG2 1 
ATOM   1205  N N   . PHE A  1 168  ? 185.838 230.791 148.523 1.00 54.71  ? 168  PHE A  N   1 
ATOM   1206  C CA  . PHE A  1 168  ? 184.719 230.670 149.446 1.00 54.46  ? 168  PHE A  CA  1 
ATOM   1207  C C   . PHE A  1 168  ? 183.936 231.973 149.394 1.00 54.45  ? 168  PHE A  C   1 
ATOM   1208  O O   . PHE A  1 168  ? 184.528 233.047 149.267 1.00 58.84  ? 168  PHE A  O   1 
ATOM   1209  C CB  . PHE A  1 168  ? 185.178 230.372 150.878 1.00 54.36  ? 168  PHE A  CB  1 
ATOM   1210  C CG  . PHE A  1 168  ? 184.051 230.196 151.846 1.00 50.93  ? 168  PHE A  CG  1 
ATOM   1211  C CD1 . PHE A  1 168  ? 183.474 228.955 152.037 1.00 52.74  ? 168  PHE A  CD1 1 
ATOM   1212  C CD2 . PHE A  1 168  ? 183.570 231.267 152.575 1.00 50.44  ? 168  PHE A  CD2 1 
ATOM   1213  C CE1 . PHE A  1 168  ? 182.432 228.789 152.929 1.00 56.18  ? 168  PHE A  CE1 1 
ATOM   1214  C CE2 . PHE A  1 168  ? 182.528 231.105 153.467 1.00 50.28  ? 168  PHE A  CE2 1 
ATOM   1215  C CZ  . PHE A  1 168  ? 181.959 229.867 153.642 1.00 57.22  ? 168  PHE A  CZ  1 
ATOM   1216  N N   . GLU A  1 169  ? 182.614 231.874 149.513 1.00 52.74  ? 169  GLU A  N   1 
ATOM   1217  C CA  . GLU A  1 169  ? 181.757 233.042 149.334 1.00 53.05  ? 169  GLU A  CA  1 
ATOM   1218  C C   . GLU A  1 169  ? 180.420 232.779 150.003 1.00 56.86  ? 169  GLU A  C   1 
ATOM   1219  O O   . GLU A  1 169  ? 179.736 231.812 149.657 1.00 67.84  ? 169  GLU A  O   1 
ATOM   1220  C CB  . GLU A  1 169  ? 181.571 233.346 147.849 1.00 56.86  ? 169  GLU A  CB  1 
ATOM   1221  C CG  . GLU A  1 169  ? 180.846 234.647 147.563 1.00 56.48  ? 169  GLU A  CG  1 
ATOM   1222  C CD  . GLU A  1 169  ? 180.976 235.070 146.117 1.00 67.71  ? 169  GLU A  CD  1 
ATOM   1223  O OE1 . GLU A  1 169  ? 181.151 234.188 145.251 1.00 78.84  ? 169  GLU A  OE1 1 
ATOM   1224  O OE2 . GLU A  1 169  ? 180.903 236.285 145.847 1.00 64.89  ? 169  GLU A  OE2 1 
ATOM   1225  N N   . TYR A  1 170  ? 180.053 233.630 150.956 1.00 56.48  ? 170  TYR A  N   1 
ATOM   1226  C CA  . TYR A  1 170  ? 178.766 233.547 151.629 1.00 55.67  ? 170  TYR A  CA  1 
ATOM   1227  C C   . TYR A  1 170  ? 178.209 234.948 151.823 1.00 61.64  ? 170  TYR A  C   1 
ATOM   1228  O O   . TYR A  1 170  ? 178.947 235.876 152.165 1.00 63.43  ? 170  TYR A  O   1 
ATOM   1229  C CB  . TYR A  1 170  ? 178.887 232.846 152.987 1.00 56.50  ? 170  TYR A  CB  1 
ATOM   1230  C CG  . TYR A  1 170  ? 177.675 233.024 153.876 1.00 55.78  ? 170  TYR A  CG  1 
ATOM   1231  C CD1 . TYR A  1 170  ? 177.585 234.096 154.754 1.00 62.00  ? 170  TYR A  CD1 1 
ATOM   1232  C CD2 . TYR A  1 170  ? 176.625 232.121 153.841 1.00 53.11  ? 170  TYR A  CD2 1 
ATOM   1233  C CE1 . TYR A  1 170  ? 176.482 234.263 155.563 1.00 62.80  ? 170  TYR A  CE1 1 
ATOM   1234  C CE2 . TYR A  1 170  ? 175.519 232.280 154.649 1.00 54.47  ? 170  TYR A  CE2 1 
ATOM   1235  C CZ  . TYR A  1 170  ? 175.453 233.353 155.508 1.00 57.26  ? 170  TYR A  CZ  1 
ATOM   1236  O OH  . TYR A  1 170  ? 174.352 233.515 156.316 1.00 51.01  ? 170  TYR A  OH  1 
ATOM   1237  N N   . VAL A  1 171  ? 176.904 235.095 151.607 1.00 66.90  ? 171  VAL A  N   1 
ATOM   1238  C CA  . VAL A  1 171  ? 176.199 236.351 151.837 1.00 58.18  ? 171  VAL A  CA  1 
ATOM   1239  C C   . VAL A  1 171  ? 174.888 236.045 152.544 1.00 66.12  ? 171  VAL A  C   1 
ATOM   1240  O O   . VAL A  1 171  ? 174.114 235.198 152.087 1.00 67.74  ? 171  VAL A  O   1 
ATOM   1241  C CB  . VAL A  1 171  ? 175.953 237.113 150.523 1.00 60.40  ? 171  VAL A  CB  1 
ATOM   1242  C CG1 . VAL A  1 171  ? 175.057 238.319 150.762 1.00 67.44  ? 171  VAL A  CG1 1 
ATOM   1243  C CG2 . VAL A  1 171  ? 177.281 237.542 149.927 1.00 64.94  ? 171  VAL A  CG2 1 
ATOM   1244  N N   . SER A  1 172  ? 174.643 236.735 153.654 1.00 70.25  ? 172  SER A  N   1 
ATOM   1245  C CA  . SER A  1 172  ? 173.453 236.492 154.453 1.00 73.80  ? 172  SER A  CA  1 
ATOM   1246  C C   . SER A  1 172  ? 172.226 237.124 153.803 1.00 83.15  ? 172  SER A  C   1 
ATOM   1247  O O   . SER A  1 172  ? 172.322 237.953 152.895 1.00 83.65  ? 172  SER A  O   1 
ATOM   1248  C CB  . SER A  1 172  ? 173.636 237.046 155.864 1.00 66.25  ? 172  SER A  CB  1 
ATOM   1249  O OG  . SER A  1 172  ? 173.977 238.419 155.830 1.00 64.63  ? 172  SER A  OG  1 
ATOM   1250  N N   . GLN A  1 173  ? 171.057 236.713 154.281 1.00 82.74  ? 173  GLN A  N   1 
ATOM   1251  C CA  . GLN A  1 173  ? 169.819 237.290 153.786 1.00 71.70  ? 173  GLN A  CA  1 
ATOM   1252  C C   . GLN A  1 173  ? 169.747 238.765 154.176 1.00 76.41  ? 173  GLN A  C   1 
ATOM   1253  O O   . GLN A  1 173  ? 170.244 239.152 155.238 1.00 82.39  ? 173  GLN A  O   1 
ATOM   1254  C CB  . GLN A  1 173  ? 168.616 236.527 154.335 1.00 76.59  ? 173  GLN A  CB  1 
ATOM   1255  C CG  . GLN A  1 173  ? 168.526 235.101 153.807 1.00 78.43  ? 173  GLN A  CG  1 
ATOM   1256  C CD  . GLN A  1 173  ? 167.241 234.403 154.197 1.00 80.54  ? 173  GLN A  CD  1 
ATOM   1257  O OE1 . GLN A  1 173  ? 166.344 235.008 154.785 1.00 75.20  ? 173  GLN A  OE1 1 
ATOM   1258  N NE2 . GLN A  1 173  ? 167.142 233.117 153.866 1.00 84.97  ? 173  GLN A  NE2 1 
ATOM   1259  N N   . PRO A  1 174  ? 169.143 239.609 153.345 1.00 84.75  ? 174  PRO A  N   1 
ATOM   1260  C CA  . PRO A  1 174  ? 169.275 241.056 153.533 1.00 83.57  ? 174  PRO A  CA  1 
ATOM   1261  C C   . PRO A  1 174  ? 168.509 241.584 154.734 1.00 83.61  ? 174  PRO A  C   1 
ATOM   1262  O O   . PRO A  1 174  ? 167.524 241.000 155.193 1.00 83.30  ? 174  PRO A  O   1 
ATOM   1263  C CB  . PRO A  1 174  ? 168.704 241.628 152.230 1.00 77.21  ? 174  PRO A  CB  1 
ATOM   1264  C CG  . PRO A  1 174  ? 167.715 240.614 151.787 1.00 85.21  ? 174  PRO A  CG  1 
ATOM   1265  C CD  . PRO A  1 174  ? 168.261 239.277 152.211 1.00 85.98  ? 174  PRO A  CD  1 
ATOM   1266  N N   . PHE A  1 175  ? 168.991 242.717 155.240 1.00 74.44  ? 175  PHE A  N   1 
ATOM   1267  C CA  . PHE A  1 175  ? 168.357 243.445 156.329 1.00 76.04  ? 175  PHE A  CA  1 
ATOM   1268  C C   . PHE A  1 175  ? 168.688 244.923 156.167 1.00 81.62  ? 175  PHE A  C   1 
ATOM   1269  O O   . PHE A  1 175  ? 169.370 245.326 155.221 1.00 82.14  ? 175  PHE A  O   1 
ATOM   1270  C CB  . PHE A  1 175  ? 168.815 242.921 157.697 1.00 77.70  ? 175  PHE A  CB  1 
ATOM   1271  C CG  . PHE A  1 175  ? 170.315 242.856 157.856 1.00 82.72  ? 175  PHE A  CG  1 
ATOM   1272  C CD1 . PHE A  1 175  ? 171.087 244.006 157.821 1.00 83.54  ? 175  PHE A  CD1 1 
ATOM   1273  C CD2 . PHE A  1 175  ? 170.949 241.642 158.049 1.00 78.36  ? 175  PHE A  CD2 1 
ATOM   1274  C CE1 . PHE A  1 175  ? 172.457 243.946 157.968 1.00 76.59  ? 175  PHE A  CE1 1 
ATOM   1275  C CE2 . PHE A  1 175  ? 172.322 241.578 158.197 1.00 78.85  ? 175  PHE A  CE2 1 
ATOM   1276  C CZ  . PHE A  1 175  ? 173.075 242.732 158.157 1.00 75.47  ? 175  PHE A  CZ  1 
ATOM   1277  N N   . LEU A  1 176  ? 168.189 245.740 157.091 1.00 84.36  ? 176  LEU A  N   1 
ATOM   1278  C CA  . LEU A  1 176  ? 168.644 247.117 157.250 1.00 88.06  ? 176  LEU A  CA  1 
ATOM   1279  C C   . LEU A  1 176  ? 168.991 247.344 158.713 1.00 84.10  ? 176  LEU A  C   1 
ATOM   1280  O O   . LEU A  1 176  ? 168.111 247.287 159.579 1.00 83.68  ? 176  LEU A  O   1 
ATOM   1281  C CB  . LEU A  1 176  ? 167.587 248.122 156.785 1.00 85.23  ? 176  LEU A  CB  1 
ATOM   1282  C CG  . LEU A  1 176  ? 167.948 249.591 157.038 1.00 82.56  ? 176  LEU A  CG  1 
ATOM   1283  C CD1 . LEU A  1 176  ? 169.303 249.933 156.426 1.00 80.02  ? 176  LEU A  CD1 1 
ATOM   1284  C CD2 . LEU A  1 176  ? 166.870 250.510 156.494 1.00 85.06  ? 176  LEU A  CD2 1 
ATOM   1285  N N   . MET A  1 177  ? 170.266 247.607 158.983 1.00 81.34  ? 177  MET A  N   1 
ATOM   1286  C CA  . MET A  1 177  ? 170.749 247.895 160.326 1.00 86.98  ? 177  MET A  CA  1 
ATOM   1287  C C   . MET A  1 177  ? 171.150 249.360 160.405 1.00 85.73  ? 177  MET A  C   1 
ATOM   1288  O O   . MET A  1 177  ? 171.942 249.838 159.585 1.00 86.72  ? 177  MET A  O   1 
ATOM   1289  C CB  . MET A  1 177  ? 171.928 246.990 160.690 1.00 87.01  ? 177  MET A  CB  1 
ATOM   1290  C CG  . MET A  1 177  ? 171.537 245.529 160.870 1.00 86.93  ? 177  MET A  CG  1 
ATOM   1291  S SD  . MET A  1 177  ? 170.599 245.213 162.378 1.00 102.89 ? 177  MET A  SD  1 
ATOM   1292  C CE  . MET A  1 177  ? 170.193 243.478 162.170 1.00 87.69  ? 177  MET A  CE  1 
ATOM   1293  N N   . ASP A  1 178  ? 170.609 250.061 161.397 1.00 88.20  ? 178  ASP A  N   1 
ATOM   1294  C CA  . ASP A  1 178  ? 170.756 251.508 161.473 1.00 90.13  ? 178  ASP A  CA  1 
ATOM   1295  C C   . ASP A  1 178  ? 172.186 251.902 161.818 1.00 90.17  ? 178  ASP A  C   1 
ATOM   1296  O O   . ASP A  1 178  ? 172.883 251.201 162.556 1.00 94.99  ? 178  ASP A  O   1 
ATOM   1297  C CB  . ASP A  1 178  ? 169.793 252.075 162.511 1.00 84.07  ? 178  ASP A  CB  1 
ATOM   1298  C CG  . ASP A  1 178  ? 168.343 251.926 162.101 1.00 89.68  ? 178  ASP A  CG  1 
ATOM   1299  O OD1 . ASP A  1 178  ? 168.056 252.046 160.891 1.00 96.41  ? 178  ASP A  OD1 1 
ATOM   1300  O OD2 . ASP A  1 178  ? 167.494 251.683 162.983 1.00 82.53  ? 178  ASP A  OD2 1 
ATOM   1301  N N   . LEU A  1 179  ? 172.617 253.043 161.276 1.00 90.07  ? 179  LEU A  N   1 
ATOM   1302  C CA  . LEU A  1 179  ? 173.975 253.547 161.441 1.00 85.22  ? 179  LEU A  CA  1 
ATOM   1303  C C   . LEU A  1 179  ? 173.988 254.948 162.043 1.00 83.06  ? 179  LEU A  C   1 
ATOM   1304  O O   . LEU A  1 179  ? 174.840 255.769 161.697 1.00 82.22  ? 179  LEU A  O   1 
ATOM   1305  C CB  . LEU A  1 179  ? 174.713 253.546 160.103 1.00 85.23  ? 179  LEU A  CB  1 
ATOM   1306  C CG  . LEU A  1 179  ? 174.641 252.253 159.288 1.00 86.67  ? 179  LEU A  CG  1 
ATOM   1307  C CD1 . LEU A  1 179  ? 173.455 252.278 158.333 1.00 78.23  ? 179  LEU A  CD1 1 
ATOM   1308  C CD2 . LEU A  1 179  ? 175.941 252.031 158.532 1.00 82.90  ? 179  LEU A  CD2 1 
ATOM   1309  N N   . GLU A  1 180  ? 173.049 255.239 162.941 1.00 88.86  ? 180  GLU A  N   1 
ATOM   1310  C CA  . GLU A  1 180  ? 172.913 256.566 163.522 1.00 85.82  ? 180  GLU A  CA  1 
ATOM   1311  C C   . GLU A  1 180  ? 172.896 256.475 165.042 1.00 87.42  ? 180  GLU A  C   1 
ATOM   1312  O O   . GLU A  1 180  ? 172.382 255.513 165.619 1.00 90.31  ? 180  GLU A  O   1 
ATOM   1313  C CB  . GLU A  1 180  ? 171.639 257.267 163.016 1.00 85.22  ? 180  GLU A  CB  1 
ATOM   1314  C CG  . GLU A  1 180  ? 170.375 256.418 163.053 1.00 86.97  ? 180  GLU A  CG  1 
ATOM   1315  C CD  . GLU A  1 180  ? 169.846 256.216 164.456 1.00 91.78  ? 180  GLU A  CD  1 
ATOM   1316  O OE1 . GLU A  1 180  ? 169.595 255.053 164.836 1.00 95.84  ? 180  GLU A  OE1 1 
ATOM   1317  O OE2 . GLU A  1 180  ? 169.692 257.223 165.181 1.00 91.88  ? 180  GLU A  OE2 1 
ATOM   1318  N N   . GLY A  1 181  ? 173.470 257.490 165.684 1.00 89.53  ? 181  GLY A  N   1 
ATOM   1319  C CA  . GLY A  1 181  ? 173.482 257.570 167.132 1.00 91.71  ? 181  GLY A  CA  1 
ATOM   1320  C C   . GLY A  1 181  ? 174.555 258.498 167.660 1.00 88.95  ? 181  GLY A  C   1 
ATOM   1321  O O   . GLY A  1 181  ? 175.646 258.582 167.089 1.00 82.40  ? 181  GLY A  O   1 
ATOM   1322  N N   . LYS A  1 182  ? 174.255 259.205 168.762 1.00 96.55  ? 182  LYS A  N   1 
ATOM   1323  C CA  . LYS A  1 182  ? 175.221 260.149 169.316 1.00 97.77  ? 182  LYS A  CA  1 
ATOM   1324  C C   . LYS A  1 182  ? 175.299 260.087 170.842 1.00 97.48  ? 182  LYS A  C   1 
ATOM   1325  O O   . LYS A  1 182  ? 175.865 260.998 171.456 1.00 97.64  ? 182  LYS A  O   1 
ATOM   1326  C CB  . LYS A  1 182  ? 174.859 261.585 168.862 1.00 88.20  ? 182  LYS A  CB  1 
ATOM   1327  C CG  . LYS A  1 182  ? 175.919 262.654 169.136 1.00 85.78  ? 182  LYS A  CG  1 
ATOM   1328  C CD  . LYS A  1 182  ? 177.274 262.271 168.559 1.00 86.80  ? 182  LYS A  CD  1 
ATOM   1329  C CE  . LYS A  1 182  ? 178.285 263.390 168.714 1.00 83.64  ? 182  LYS A  CE  1 
ATOM   1330  N NZ  . LYS A  1 182  ? 178.067 264.472 167.718 1.00 81.81  ? 182  LYS A  NZ  1 
ATOM   1331  N N   . GLN A  1 183  ? 174.775 259.039 171.469 1.00 95.24  ? 183  GLN A  N   1 
ATOM   1332  C CA  . GLN A  1 183  ? 174.781 258.963 172.921 1.00 92.17  ? 183  GLN A  CA  1 
ATOM   1333  C C   . GLN A  1 183  ? 176.206 258.818 173.446 1.00 88.08  ? 183  GLN A  C   1 
ATOM   1334  O O   . GLN A  1 183  ? 177.094 258.295 172.768 1.00 90.61  ? 183  GLN A  O   1 
ATOM   1335  C CB  . GLN A  1 183  ? 173.913 257.799 173.395 1.00 93.53  ? 183  GLN A  CB  1 
ATOM   1336  C CG  . GLN A  1 183  ? 172.446 257.946 173.014 1.00 94.67  ? 183  GLN A  CG  1 
ATOM   1337  C CD  . GLN A  1 183  ? 171.587 256.833 173.573 1.00 100.83 ? 183  GLN A  CD  1 
ATOM   1338  O OE1 . GLN A  1 183  ? 172.097 255.873 174.153 1.00 98.89  ? 183  GLN A  OE1 1 
ATOM   1339  N NE2 . GLN A  1 183  ? 170.272 256.954 173.406 1.00 98.88  ? 183  GLN A  NE2 1 
ATOM   1340  N N   . GLY A  1 184  ? 176.421 259.307 174.664 1.00 89.75  ? 184  GLY A  N   1 
ATOM   1341  C CA  . GLY A  1 184  ? 177.758 259.382 175.218 1.00 83.86  ? 184  GLY A  CA  1 
ATOM   1342  C C   . GLY A  1 184  ? 178.397 258.042 175.518 1.00 81.80  ? 184  GLY A  C   1 
ATOM   1343  O O   . GLY A  1 184  ? 179.362 257.650 174.854 1.00 81.61  ? 184  GLY A  O   1 
ATOM   1344  N N   . ASN A  1 185  ? 177.877 257.329 176.513 1.00 86.06  ? 185  ASN A  N   1 
ATOM   1345  C CA  . ASN A  1 185  ? 178.487 256.072 176.919 1.00 82.31  ? 185  ASN A  CA  1 
ATOM   1346  C C   . ASN A  1 185  ? 178.124 254.950 175.954 1.00 82.04  ? 185  ASN A  C   1 
ATOM   1347  O O   . ASN A  1 185  ? 177.054 254.943 175.339 1.00 77.03  ? 185  ASN A  O   1 
ATOM   1348  C CB  . ASN A  1 185  ? 178.060 255.697 178.339 1.00 77.23  ? 185  ASN A  CB  1 
ATOM   1349  C CG  . ASN A  1 185  ? 176.560 255.731 178.528 1.00 80.90  ? 185  ASN A  CG  1 
ATOM   1350  O OD1 . ASN A  1 185  ? 175.848 254.820 178.109 1.00 79.16  ? 185  ASN A  OD1 1 
ATOM   1351  N ND2 . ASN A  1 185  ? 176.071 256.782 179.172 1.00 83.74  ? 185  ASN A  ND2 1 
ATOM   1352  N N   . PHE A  1 186  ? 179.031 253.984 175.838 1.00 83.34  ? 186  PHE A  N   1 
ATOM   1353  C CA  . PHE A  1 186  ? 178.807 252.846 174.960 1.00 75.53  ? 186  PHE A  CA  1 
ATOM   1354  C C   . PHE A  1 186  ? 177.689 251.967 175.501 1.00 76.74  ? 186  PHE A  C   1 
ATOM   1355  O O   . PHE A  1 186  ? 177.605 251.711 176.705 1.00 80.91  ? 186  PHE A  O   1 
ATOM   1356  C CB  . PHE A  1 186  ? 180.085 252.024 174.823 1.00 71.06  ? 186  PHE A  CB  1 
ATOM   1357  C CG  . PHE A  1 186  ? 181.256 252.805 174.307 1.00 76.33  ? 186  PHE A  CG  1 
ATOM   1358  C CD1 . PHE A  1 186  ? 181.181 253.482 173.104 1.00 68.61  ? 186  PHE A  CD1 1 
ATOM   1359  C CD2 . PHE A  1 186  ? 182.438 252.851 175.021 1.00 78.27  ? 186  PHE A  CD2 1 
ATOM   1360  C CE1 . PHE A  1 186  ? 182.261 254.195 172.630 1.00 69.39  ? 186  PHE A  CE1 1 
ATOM   1361  C CE2 . PHE A  1 186  ? 183.520 253.560 174.549 1.00 73.99  ? 186  PHE A  CE2 1 
ATOM   1362  C CZ  . PHE A  1 186  ? 183.431 254.234 173.355 1.00 67.51  ? 186  PHE A  CZ  1 
ATOM   1363  N N   . LYS A  1 187  ? 176.829 251.497 174.598 1.00 75.31  ? 187  LYS A  N   1 
ATOM   1364  C CA  . LYS A  1 187  ? 175.683 250.685 174.971 1.00 74.21  ? 187  LYS A  CA  1 
ATOM   1365  C C   . LYS A  1 187  ? 175.802 249.226 174.556 1.00 73.60  ? 187  LYS A  C   1 
ATOM   1366  O O   . LYS A  1 187  ? 174.919 248.432 174.901 1.00 72.19  ? 187  LYS A  O   1 
ATOM   1367  C CB  . LYS A  1 187  ? 174.400 251.276 174.368 1.00 79.99  ? 187  LYS A  CB  1 
ATOM   1368  C CG  . LYS A  1 187  ? 174.029 252.646 174.922 1.00 77.72  ? 187  LYS A  CG  1 
ATOM   1369  C CD  . LYS A  1 187  ? 173.697 252.579 176.405 1.00 76.68  ? 187  LYS A  CD  1 
ATOM   1370  C CE  . LYS A  1 187  ? 173.288 253.936 176.949 1.00 83.56  ? 187  LYS A  CE  1 
ATOM   1371  N NZ  . LYS A  1 187  ? 171.952 254.367 176.453 1.00 92.63  ? 187  LYS A  NZ  1 
ATOM   1372  N N   . ASN A  1 188  ? 176.850 248.848 173.826 1.00 72.74  ? 188  ASN A  N   1 
ATOM   1373  C CA  . ASN A  1 188  ? 177.010 247.480 173.355 1.00 72.28  ? 188  ASN A  CA  1 
ATOM   1374  C C   . ASN A  1 188  ? 178.439 247.005 173.560 1.00 71.15  ? 188  ASN A  C   1 
ATOM   1375  O O   . ASN A  1 188  ? 179.394 247.737 173.283 1.00 69.22  ? 188  ASN A  O   1 
ATOM   1376  C CB  . ASN A  1 188  ? 176.653 247.357 171.873 1.00 74.31  ? 188  ASN A  CB  1 
ATOM   1377  C CG  . ASN A  1 188  ? 175.280 247.904 171.559 1.00 83.14  ? 188  ASN A  CG  1 
ATOM   1378  O OD1 . ASN A  1 188  ? 174.266 247.261 171.827 1.00 78.42  ? 188  ASN A  OD1 1 
ATOM   1379  N ND2 . ASN A  1 188  ? 175.239 249.098 170.982 1.00 82.69  ? 188  ASN A  ND2 1 
ATOM   1380  N N   . LEU A  1 189  ? 178.575 245.776 174.047 1.00 67.99  ? 189  LEU A  N   1 
ATOM   1381  C CA  . LEU A  1 189  ? 179.838 245.052 174.039 1.00 65.85  ? 189  LEU A  CA  1 
ATOM   1382  C C   . LEU A  1 189  ? 179.685 243.820 173.158 1.00 68.00  ? 189  LEU A  C   1 
ATOM   1383  O O   . LEU A  1 189  ? 178.820 242.975 173.413 1.00 72.58  ? 189  LEU A  O   1 
ATOM   1384  C CB  . LEU A  1 189  ? 180.257 244.644 175.454 1.00 61.51  ? 189  LEU A  CB  1 
ATOM   1385  C CG  . LEU A  1 189  ? 181.564 243.854 175.574 1.00 50.84  ? 189  LEU A  CG  1 
ATOM   1386  C CD1 . LEU A  1 189  ? 182.753 244.685 175.132 1.00 57.65  ? 189  LEU A  CD1 1 
ATOM   1387  C CD2 . LEU A  1 189  ? 181.759 243.367 176.996 1.00 55.91  ? 189  LEU A  CD2 1 
ATOM   1388  N N   . ARG A  1 190  ? 180.517 243.723 172.127 1.00 62.33  ? 190  ARG A  N   1 
ATOM   1389  C CA  . ARG A  1 190  ? 180.562 242.560 171.252 1.00 55.55  ? 190  ARG A  CA  1 
ATOM   1390  C C   . ARG A  1 190  ? 181.917 241.897 171.423 1.00 58.05  ? 190  ARG A  C   1 
ATOM   1391  O O   . ARG A  1 190  ? 182.949 242.570 171.362 1.00 63.02  ? 190  ARG A  O   1 
ATOM   1392  C CB  . ARG A  1 190  ? 180.343 242.946 169.785 1.00 61.49  ? 190  ARG A  CB  1 
ATOM   1393  C CG  . ARG A  1 190  ? 179.081 243.749 169.527 1.00 69.72  ? 190  ARG A  CG  1 
ATOM   1394  C CD  . ARG A  1 190  ? 177.828 242.896 169.610 1.00 71.16  ? 190  ARG A  CD  1 
ATOM   1395  N NE  . ARG A  1 190  ? 177.662 242.044 168.432 1.00 64.92  ? 190  ARG A  NE  1 
ATOM   1396  C CZ  . ARG A  1 190  ? 177.986 240.755 168.367 1.00 66.16  ? 190  ARG A  CZ  1 
ATOM   1397  N NH1 . ARG A  1 190  ? 178.500 240.124 169.415 1.00 64.30  ? 190  ARG A  NH1 1 
ATOM   1398  N NH2 . ARG A  1 190  ? 177.790 240.085 167.240 1.00 65.74  ? 190  ARG A  NH2 1 
ATOM   1399  N N   . GLU A  1 191  ? 181.910 240.588 171.640 1.00 51.90  ? 191  GLU A  N   1 
ATOM   1400  C CA  . GLU A  1 191  ? 183.124 239.836 171.911 1.00 45.00  ? 191  GLU A  CA  1 
ATOM   1401  C C   . GLU A  1 191  ? 183.264 238.726 170.885 1.00 49.76  ? 191  GLU A  C   1 
ATOM   1402  O O   . GLU A  1 191  ? 182.274 238.093 170.510 1.00 57.91  ? 191  GLU A  O   1 
ATOM   1403  C CB  . GLU A  1 191  ? 183.096 239.253 173.323 1.00 52.74  ? 191  GLU A  CB  1 
ATOM   1404  C CG  . GLU A  1 191  ? 182.769 240.279 174.391 1.00 57.61  ? 191  GLU A  CG  1 
ATOM   1405  C CD  . GLU A  1 191  ? 183.011 239.761 175.785 1.00 64.65  ? 191  GLU A  CD  1 
ATOM   1406  O OE1 . GLU A  1 191  ? 182.025 239.506 176.506 1.00 60.60  ? 191  GLU A  OE1 1 
ATOM   1407  O OE2 . GLU A  1 191  ? 184.191 239.602 176.157 1.00 63.16  ? 191  GLU A  OE2 1 
ATOM   1408  N N   . PHE A  1 192  ? 184.490 238.504 170.420 1.00 48.81  ? 192  PHE A  N   1 
ATOM   1409  C CA  . PHE A  1 192  ? 184.757 237.465 169.438 1.00 46.83  ? 192  PHE A  CA  1 
ATOM   1410  C C   . PHE A  1 192  ? 186.062 236.759 169.767 1.00 39.07  ? 192  PHE A  C   1 
ATOM   1411  O O   . PHE A  1 192  ? 187.022 237.387 170.218 1.00 47.57  ? 192  PHE A  O   1 
ATOM   1412  C CB  . PHE A  1 192  ? 184.831 238.036 168.019 1.00 55.11  ? 192  PHE A  CB  1 
ATOM   1413  C CG  . PHE A  1 192  ? 183.567 238.701 167.568 1.00 52.76  ? 192  PHE A  CG  1 
ATOM   1414  C CD1 . PHE A  1 192  ? 183.345 240.038 167.829 1.00 53.97  ? 192  PHE A  CD1 1 
ATOM   1415  C CD2 . PHE A  1 192  ? 182.602 237.991 166.883 1.00 47.20  ? 192  PHE A  CD2 1 
ATOM   1416  C CE1 . PHE A  1 192  ? 182.188 240.651 167.418 1.00 57.20  ? 192  PHE A  CE1 1 
ATOM   1417  C CE2 . PHE A  1 192  ? 181.444 238.600 166.471 1.00 52.32  ? 192  PHE A  CE2 1 
ATOM   1418  C CZ  . PHE A  1 192  ? 181.237 239.932 166.738 1.00 58.71  ? 192  PHE A  CZ  1 
ATOM   1419  N N   . VAL A  1 193  ? 186.082 235.450 169.541 1.00 34.64  ? 193  VAL A  N   1 
ATOM   1420  C CA  . VAL A  1 193  ? 187.296 234.647 169.593 1.00 37.68  ? 193  VAL A  CA  1 
ATOM   1421  C C   . VAL A  1 193  ? 187.507 234.043 168.214 1.00 44.10  ? 193  VAL A  C   1 
ATOM   1422  O O   . VAL A  1 193  ? 186.585 233.447 167.645 1.00 48.68  ? 193  VAL A  O   1 
ATOM   1423  C CB  . VAL A  1 193  ? 187.207 233.551 170.670 1.00 37.08  ? 193  VAL A  CB  1 
ATOM   1424  C CG1 . VAL A  1 193  ? 188.184 232.428 170.372 1.00 41.86  ? 193  VAL A  CG1 1 
ATOM   1425  C CG2 . VAL A  1 193  ? 187.484 234.134 172.040 1.00 39.33  ? 193  VAL A  CG2 1 
ATOM   1426  N N   . PHE A  1 194  ? 188.709 234.206 167.673 1.00 45.18  ? 194  PHE A  N   1 
ATOM   1427  C CA  . PHE A  1 194  ? 189.060 233.672 166.365 1.00 38.44  ? 194  PHE A  CA  1 
ATOM   1428  C C   . PHE A  1 194  ? 190.152 232.629 166.520 1.00 41.85  ? 194  PHE A  C   1 
ATOM   1429  O O   . PHE A  1 194  ? 191.198 232.902 167.116 1.00 45.00  ? 194  PHE A  O   1 
ATOM   1430  C CB  . PHE A  1 194  ? 189.529 234.780 165.422 1.00 40.91  ? 194  PHE A  CB  1 
ATOM   1431  C CG  . PHE A  1 194  ? 188.569 235.923 165.309 1.00 43.68  ? 194  PHE A  CG  1 
ATOM   1432  C CD1 . PHE A  1 194  ? 187.284 235.719 164.846 1.00 48.50  ? 194  PHE A  CD1 1 
ATOM   1433  C CD2 . PHE A  1 194  ? 188.951 237.201 165.661 1.00 47.31  ? 194  PHE A  CD2 1 
ATOM   1434  C CE1 . PHE A  1 194  ? 186.399 236.765 164.742 1.00 45.26  ? 194  PHE A  CE1 1 
ATOM   1435  C CE2 . PHE A  1 194  ? 188.070 238.251 165.558 1.00 43.05  ? 194  PHE A  CE2 1 
ATOM   1436  C CZ  . PHE A  1 194  ? 186.793 238.032 165.098 1.00 47.06  ? 194  PHE A  CZ  1 
ATOM   1437  N N   . LYS A  1 195  ? 189.905 231.438 165.987 1.00 36.31  ? 195  LYS A  N   1 
ATOM   1438  C CA  . LYS A  1 195  ? 190.895 230.375 165.952 1.00 40.38  ? 195  LYS A  CA  1 
ATOM   1439  C C   . LYS A  1 195  ? 190.938 229.787 164.553 1.00 36.16  ? 195  LYS A  C   1 
ATOM   1440  O O   . LYS A  1 195  ? 189.896 229.549 163.938 1.00 43.68  ? 195  LYS A  O   1 
ATOM   1441  C CB  . LYS A  1 195  ? 190.574 229.286 166.977 1.00 48.37  ? 195  LYS A  CB  1 
ATOM   1442  C CG  . LYS A  1 195  ? 190.449 229.811 168.394 1.00 43.30  ? 195  LYS A  CG  1 
ATOM   1443  C CD  . LYS A  1 195  ? 190.536 228.697 169.412 1.00 45.11  ? 195  LYS A  CD  1 
ATOM   1444  C CE  . LYS A  1 195  ? 189.394 227.715 169.259 1.00 44.64  ? 195  LYS A  CE  1 
ATOM   1445  N NZ  . LYS A  1 195  ? 189.387 226.716 170.359 1.00 53.69  ? 195  LYS A  NZ  1 
ATOM   1446  N N   . ASN A  1 196  ? 192.149 229.565 164.052 1.00 47.14  ? 196  ASN A  N   1 
ATOM   1447  C CA  . ASN A  1 196  ? 192.380 228.983 162.731 1.00 52.71  ? 196  ASN A  CA  1 
ATOM   1448  C C   . ASN A  1 196  ? 193.131 227.674 162.939 1.00 56.34  ? 196  ASN A  C   1 
ATOM   1449  O O   . ASN A  1 196  ? 194.363 227.644 162.955 1.00 62.64  ? 196  ASN A  O   1 
ATOM   1450  C CB  . ASN A  1 196  ? 193.152 229.951 161.847 1.00 51.20  ? 196  ASN A  CB  1 
ATOM   1451  C CG  . ASN A  1 196  ? 193.251 229.479 160.416 1.00 48.22  ? 196  ASN A  CG  1 
ATOM   1452  O OD1 . ASN A  1 196  ? 192.378 228.765 159.924 1.00 47.22  ? 196  ASN A  OD1 1 
ATOM   1453  N ND2 . ASN A  1 196  ? 194.318 229.876 159.738 1.00 58.14  ? 196  ASN A  ND2 1 
ATOM   1454  N N   . ILE A  1 197  ? 192.381 226.589 163.104 1.00 58.02  ? 197  ILE A  N   1 
ATOM   1455  C CA  . ILE A  1 197  ? 192.934 225.294 163.487 1.00 55.49  ? 197  ILE A  CA  1 
ATOM   1456  C C   . ILE A  1 197  ? 192.692 224.307 162.354 1.00 56.78  ? 197  ILE A  C   1 
ATOM   1457  O O   . ILE A  1 197  ? 191.541 224.027 161.998 1.00 64.38  ? 197  ILE A  O   1 
ATOM   1458  C CB  . ILE A  1 197  ? 192.314 224.785 164.797 1.00 59.54  ? 197  ILE A  CB  1 
ATOM   1459  C CG1 . ILE A  1 197  ? 192.380 225.864 165.883 1.00 54.41  ? 197  ILE A  CG1 1 
ATOM   1460  C CG2 . ILE A  1 197  ? 193.018 223.520 165.263 1.00 61.23  ? 197  ILE A  CG2 1 
ATOM   1461  C CD1 . ILE A  1 197  ? 193.778 226.354 166.196 1.00 52.24  ? 197  ILE A  CD1 1 
ATOM   1462  N N   . ASP A  1 198  ? 193.779 223.782 161.792 1.00 56.82  ? 198  ASP A  N   1 
ATOM   1463  C CA  . ASP A  1 198  ? 193.726 222.710 160.797 1.00 60.57  ? 198  ASP A  CA  1 
ATOM   1464  C C   . ASP A  1 198  ? 192.699 223.009 159.706 1.00 54.77  ? 198  ASP A  C   1 
ATOM   1465  O O   . ASP A  1 198  ? 191.834 222.192 159.385 1.00 48.92  ? 198  ASP A  O   1 
ATOM   1466  C CB  . ASP A  1 198  ? 193.442 221.364 161.466 1.00 57.30  ? 198  ASP A  CB  1 
ATOM   1467  C CG  . ASP A  1 198  ? 194.597 220.885 162.321 1.00 57.94  ? 198  ASP A  CG  1 
ATOM   1468  O OD1 . ASP A  1 198  ? 195.733 221.356 162.102 1.00 49.12  ? 198  ASP A  OD1 1 
ATOM   1469  O OD2 . ASP A  1 198  ? 194.374 220.036 163.209 1.00 54.90  ? 198  ASP A  OD2 1 
ATOM   1470  N N   . GLY A  1 199  ? 192.803 224.205 159.130 1.00 51.43  ? 199  GLY A  N   1 
ATOM   1471  C CA  . GLY A  1 199  ? 192.001 224.583 157.988 1.00 50.88  ? 199  GLY A  CA  1 
ATOM   1472  C C   . GLY A  1 199  ? 190.611 225.087 158.301 1.00 48.89  ? 199  GLY A  C   1 
ATOM   1473  O O   . GLY A  1 199  ? 189.941 225.596 157.394 1.00 42.37  ? 199  GLY A  O   1 
ATOM   1474  N N   . TYR A  1 200  ? 190.144 224.959 159.538 1.00 55.31  ? 200  TYR A  N   1 
ATOM   1475  C CA  . TYR A  1 200  ? 188.836 225.460 159.938 1.00 50.44  ? 200  TYR A  CA  1 
ATOM   1476  C C   . TYR A  1 200  ? 189.015 226.743 160.738 1.00 45.73  ? 200  TYR A  C   1 
ATOM   1477  O O   . TYR A  1 200  ? 189.722 226.753 161.751 1.00 48.67  ? 200  TYR A  O   1 
ATOM   1478  C CB  . TYR A  1 200  ? 188.075 224.419 160.759 1.00 51.05  ? 200  TYR A  CB  1 
ATOM   1479  C CG  . TYR A  1 200  ? 187.657 223.206 159.962 1.00 53.13  ? 200  TYR A  CG  1 
ATOM   1480  C CD1 . TYR A  1 200  ? 186.485 223.209 159.222 1.00 52.18  ? 200  TYR A  CD1 1 
ATOM   1481  C CD2 . TYR A  1 200  ? 188.435 222.058 159.951 1.00 60.33  ? 200  TYR A  CD2 1 
ATOM   1482  C CE1 . TYR A  1 200  ? 186.102 222.105 158.492 1.00 60.90  ? 200  TYR A  CE1 1 
ATOM   1483  C CE2 . TYR A  1 200  ? 188.059 220.951 159.225 1.00 66.48  ? 200  TYR A  CE2 1 
ATOM   1484  C CZ  . TYR A  1 200  ? 186.892 220.978 158.496 1.00 61.80  ? 200  TYR A  CZ  1 
ATOM   1485  O OH  . TYR A  1 200  ? 186.516 219.871 157.770 1.00 46.08  ? 200  TYR A  OH  1 
ATOM   1486  N N   . PHE A  1 201  ? 188.376 227.817 160.283 1.00 38.81  ? 201  PHE A  N   1 
ATOM   1487  C CA  . PHE A  1 201  ? 188.399 229.097 160.983 1.00 40.40  ? 201  PHE A  CA  1 
ATOM   1488  C C   . PHE A  1 201  ? 187.154 229.184 161.860 1.00 40.55  ? 201  PHE A  C   1 
ATOM   1489  O O   . PHE A  1 201  ? 186.031 229.248 161.352 1.00 44.71  ? 201  PHE A  O   1 
ATOM   1490  C CB  . PHE A  1 201  ? 188.462 230.251 159.988 1.00 43.62  ? 201  PHE A  CB  1 
ATOM   1491  C CG  . PHE A  1 201  ? 188.630 231.595 160.630 1.00 50.23  ? 201  PHE A  CG  1 
ATOM   1492  C CD1 . PHE A  1 201  ? 187.529 232.364 160.958 1.00 45.24  ? 201  PHE A  CD1 1 
ATOM   1493  C CD2 . PHE A  1 201  ? 189.890 232.089 160.911 1.00 51.38  ? 201  PHE A  CD2 1 
ATOM   1494  C CE1 . PHE A  1 201  ? 187.683 233.595 161.552 1.00 37.11  ? 201  PHE A  CE1 1 
ATOM   1495  C CE2 . PHE A  1 201  ? 190.048 233.319 161.504 1.00 46.45  ? 201  PHE A  CE2 1 
ATOM   1496  C CZ  . PHE A  1 201  ? 188.942 234.074 161.824 1.00 44.41  ? 201  PHE A  CZ  1 
ATOM   1497  N N   . LYS A  1 202  ? 187.355 229.198 163.174 1.00 42.68  ? 202  LYS A  N   1 
ATOM   1498  C CA  . LYS A  1 202  ? 186.272 229.113 164.145 1.00 34.11  ? 202  LYS A  CA  1 
ATOM   1499  C C   . LYS A  1 202  ? 186.029 230.474 164.780 1.00 36.01  ? 202  LYS A  C   1 
ATOM   1500  O O   . LYS A  1 202  ? 186.981 231.178 165.130 1.00 42.26  ? 202  LYS A  O   1 
ATOM   1501  C CB  . LYS A  1 202  ? 186.597 228.084 165.227 1.00 41.00  ? 202  LYS A  CB  1 
ATOM   1502  C CG  . LYS A  1 202  ? 186.797 226.682 164.701 1.00 46.89  ? 202  LYS A  CG  1 
ATOM   1503  C CD  . LYS A  1 202  ? 187.278 225.748 165.790 1.00 49.15  ? 202  LYS A  CD  1 
ATOM   1504  C CE  . LYS A  1 202  ? 187.230 224.303 165.333 1.00 60.87  ? 202  LYS A  CE  1 
ATOM   1505  N NZ  . LYS A  1 202  ? 185.831 223.810 165.182 1.00 68.54  ? 202  LYS A  NZ  1 
ATOM   1506  N N   . ILE A  1 203  ? 184.757 230.839 164.923 1.00 35.69  ? 203  ILE A  N   1 
ATOM   1507  C CA  . ILE A  1 203  ? 184.349 232.099 165.531 1.00 35.57  ? 203  ILE A  CA  1 
ATOM   1508  C C   . ILE A  1 203  ? 183.390 231.799 166.674 1.00 43.26  ? 203  ILE A  C   1 
ATOM   1509  O O   . ILE A  1 203  ? 182.413 231.062 166.495 1.00 46.91  ? 203  ILE A  O   1 
ATOM   1510  C CB  . ILE A  1 203  ? 183.687 233.038 164.506 1.00 40.28  ? 203  ILE A  CB  1 
ATOM   1511  C CG1 . ILE A  1 203  ? 184.546 233.134 163.244 1.00 41.70  ? 203  ILE A  CG1 1 
ATOM   1512  C CG2 . ILE A  1 203  ? 183.467 234.420 165.113 1.00 40.73  ? 203  ILE A  CG2 1 
ATOM   1513  C CD1 . ILE A  1 203  ? 184.038 234.133 162.231 1.00 39.75  ? 203  ILE A  CD1 1 
ATOM   1514  N N   . TYR A  1 204  ? 183.671 232.368 167.842 1.00 42.86  ? 204  TYR A  N   1 
ATOM   1515  C CA  . TYR A  1 204  ? 182.753 232.375 168.971 1.00 32.95  ? 204  TYR A  CA  1 
ATOM   1516  C C   . TYR A  1 204  ? 182.427 233.824 169.289 1.00 36.08  ? 204  TYR A  C   1 
ATOM   1517  O O   . TYR A  1 204  ? 183.289 234.696 169.159 1.00 45.48  ? 204  TYR A  O   1 
ATOM   1518  C CB  . TYR A  1 204  ? 183.361 231.692 170.203 1.00 37.21  ? 204  TYR A  CB  1 
ATOM   1519  C CG  . TYR A  1 204  ? 183.998 230.351 169.925 1.00 39.02  ? 204  TYR A  CG  1 
ATOM   1520  C CD1 . TYR A  1 204  ? 185.180 230.259 169.208 1.00 38.07  ? 204  TYR A  CD1 1 
ATOM   1521  C CD2 . TYR A  1 204  ? 183.430 229.180 170.396 1.00 36.20  ? 204  TYR A  CD2 1 
ATOM   1522  C CE1 . TYR A  1 204  ? 185.766 229.045 168.956 1.00 37.02  ? 204  TYR A  CE1 1 
ATOM   1523  C CE2 . TYR A  1 204  ? 184.014 227.960 170.149 1.00 42.46  ? 204  TYR A  CE2 1 
ATOM   1524  C CZ  . TYR A  1 204  ? 185.182 227.898 169.429 1.00 45.68  ? 204  TYR A  CZ  1 
ATOM   1525  O OH  . TYR A  1 204  ? 185.772 226.682 169.177 1.00 61.06  ? 204  TYR A  OH  1 
ATOM   1526  N N   . SER A  1 205  ? 181.190 234.091 169.698 1.00 42.51  ? 205  SER A  N   1 
ATOM   1527  C CA  . SER A  1 205  ? 180.781 235.470 169.906 1.00 46.51  ? 205  SER A  CA  1 
ATOM   1528  C C   . SER A  1 205  ? 179.743 235.550 171.012 1.00 49.63  ? 205  SER A  C   1 
ATOM   1529  O O   . SER A  1 205  ? 179.046 234.580 171.317 1.00 51.37  ? 205  SER A  O   1 
ATOM   1530  C CB  . SER A  1 205  ? 180.218 236.085 168.621 1.00 54.08  ? 205  SER A  CB  1 
ATOM   1531  O OG  . SER A  1 205  ? 178.938 235.554 168.329 1.00 69.95  ? 205  SER A  OG  1 
ATOM   1532  N N   . LYS A  1 206  ? 179.652 236.736 171.608 1.00 58.19  ? 206  LYS A  N   1 
ATOM   1533  C CA  . LYS A  1 206  ? 178.668 237.026 172.637 1.00 60.47  ? 206  LYS A  CA  1 
ATOM   1534  C C   . LYS A  1 206  ? 178.332 238.507 172.570 1.00 67.52  ? 206  LYS A  C   1 
ATOM   1535  O O   . LYS A  1 206  ? 179.164 239.326 172.172 1.00 63.85  ? 206  LYS A  O   1 
ATOM   1536  C CB  . LYS A  1 206  ? 179.187 236.660 174.032 1.00 54.62  ? 206  LYS A  CB  1 
ATOM   1537  C CG  . LYS A  1 206  ? 178.153 236.769 175.136 1.00 57.97  ? 206  LYS A  CG  1 
ATOM   1538  C CD  . LYS A  1 206  ? 176.998 235.813 174.897 1.00 69.36  ? 206  LYS A  CD  1 
ATOM   1539  C CE  . LYS A  1 206  ? 176.238 235.519 176.175 1.00 75.55  ? 206  LYS A  CE  1 
ATOM   1540  N NZ  . LYS A  1 206  ? 176.803 234.339 176.885 1.00 53.59  ? 206  LYS A  NZ  1 
ATOM   1541  N N   . HIS A  1 207  ? 177.106 238.843 172.961 1.00 69.86  ? 207  HIS A  N   1 
ATOM   1542  C CA  . HIS A  1 207  ? 176.642 240.224 172.980 1.00 69.88  ? 207  HIS A  CA  1 
ATOM   1543  C C   . HIS A  1 207  ? 175.985 240.513 174.321 1.00 70.48  ? 207  HIS A  C   1 
ATOM   1544  O O   . HIS A  1 207  ? 175.117 239.754 174.764 1.00 70.48  ? 207  HIS A  O   1 
ATOM   1545  C CB  . HIS A  1 207  ? 175.655 240.495 171.841 1.00 72.03  ? 207  HIS A  CB  1 
ATOM   1546  C CG  . HIS A  1 207  ? 175.020 241.847 171.908 1.00 73.85  ? 207  HIS A  CG  1 
ATOM   1547  N ND1 . HIS A  1 207  ? 175.752 243.014 171.890 1.00 69.45  ? 207  HIS A  ND1 1 
ATOM   1548  C CD2 . HIS A  1 207  ? 173.721 242.220 172.002 1.00 81.17  ? 207  HIS A  CD2 1 
ATOM   1549  C CE1 . HIS A  1 207  ? 174.932 244.047 171.967 1.00 77.45  ? 207  HIS A  CE1 1 
ATOM   1550  N NE2 . HIS A  1 207  ? 173.695 243.593 172.035 1.00 84.57  ? 207  HIS A  NE2 1 
ATOM   1551  N N   . THR A  1 208  ? 176.392 241.611 174.959 1.00 77.17  ? 208  THR A  N   1 
ATOM   1552  C CA  . THR A  1 208  ? 175.815 242.032 176.228 1.00 82.23  ? 208  THR A  CA  1 
ATOM   1553  C C   . THR A  1 208  ? 175.629 243.544 176.240 1.00 78.81  ? 208  THR A  C   1 
ATOM   1554  O O   . THR A  1 208  ? 176.482 244.275 175.714 1.00 74.08  ? 208  THR A  O   1 
ATOM   1555  C CB  . THR A  1 208  ? 176.697 241.616 177.414 1.00 72.30  ? 208  THR A  CB  1 
ATOM   1556  O OG1 . THR A  1 208  ? 176.079 242.028 178.639 1.00 77.31  ? 208  THR A  OG1 1 
ATOM   1557  C CG2 . THR A  1 208  ? 178.078 242.246 177.307 1.00 65.89  ? 208  THR A  CG2 1 
ATOM   1558  N N   . PRO A  1 209  ? 174.535 244.044 176.819 1.00 72.94  ? 209  PRO A  N   1 
ATOM   1559  C CA  . PRO A  1 209  ? 174.389 245.497 176.968 1.00 74.12  ? 209  PRO A  CA  1 
ATOM   1560  C C   . PRO A  1 209  ? 175.261 246.033 178.092 1.00 75.59  ? 209  PRO A  C   1 
ATOM   1561  O O   . PRO A  1 209  ? 175.487 245.362 179.102 1.00 82.13  ? 209  PRO A  O   1 
ATOM   1562  C CB  . PRO A  1 209  ? 172.901 245.673 177.279 1.00 75.44  ? 209  PRO A  CB  1 
ATOM   1563  C CG  . PRO A  1 209  ? 172.507 244.400 177.931 1.00 76.30  ? 209  PRO A  CG  1 
ATOM   1564  C CD  . PRO A  1 209  ? 173.338 243.324 177.289 1.00 72.29  ? 209  PRO A  CD  1 
ATOM   1565  N N   . ILE A  1 210  ? 175.755 247.259 177.910 1.00 68.36  ? 210  ILE A  N   1 
ATOM   1566  C CA  . ILE A  1 210  ? 176.596 247.922 178.897 1.00 73.66  ? 210  ILE A  CA  1 
ATOM   1567  C C   . ILE A  1 210  ? 176.245 249.405 178.938 1.00 82.55  ? 210  ILE A  C   1 
ATOM   1568  O O   . ILE A  1 210  ? 175.525 249.923 178.084 1.00 80.81  ? 210  ILE A  O   1 
ATOM   1569  C CB  . ILE A  1 210  ? 178.096 247.731 178.603 1.00 72.46  ? 210  ILE A  CB  1 
ATOM   1570  C CG1 . ILE A  1 210  ? 178.416 248.129 177.163 1.00 75.48  ? 210  ILE A  CG1 1 
ATOM   1571  C CG2 . ILE A  1 210  ? 178.485 246.286 178.841 1.00 73.71  ? 210  ILE A  CG2 1 
ATOM   1572  C CD1 . ILE A  1 210  ? 179.887 248.383 176.914 1.00 67.83  ? 210  ILE A  CD1 1 
ATOM   1573  N N   . ASN A  1 211  ? 176.748 250.080 179.967 1.00 79.42  ? 211  ASN A  N   1 
ATOM   1574  C CA  . ASN A  1 211  ? 176.547 251.513 180.150 1.00 73.09  ? 211  ASN A  CA  1 
ATOM   1575  C C   . ASN A  1 211  ? 177.864 252.160 180.582 1.00 76.01  ? 211  ASN A  C   1 
ATOM   1576  O O   . ASN A  1 211  ? 177.916 252.974 181.501 1.00 80.89  ? 211  ASN A  O   1 
ATOM   1577  C CB  . ASN A  1 211  ? 175.435 251.766 181.166 1.00 78.35  ? 211  ASN A  CB  1 
ATOM   1578  C CG  . ASN A  1 211  ? 174.831 253.145 181.036 1.00 85.35  ? 211  ASN A  CG  1 
ATOM   1579  O OD1 . ASN A  1 211  ? 173.862 253.343 180.306 1.00 81.14  ? 211  ASN A  OD1 1 
ATOM   1580  N ND2 . ASN A  1 211  ? 175.400 254.111 181.748 1.00 88.88  ? 211  ASN A  ND2 1 
ATOM   1581  N N   . LEU A  1 212  ? 178.964 251.814 179.916 1.00 75.73  ? 212  LEU A  N   1 
ATOM   1582  C CA  . LEU A  1 212  ? 180.294 252.232 180.343 1.00 72.73  ? 212  LEU A  CA  1 
ATOM   1583  C C   . LEU A  1 212  ? 180.885 253.232 179.361 1.00 74.18  ? 212  LEU A  C   1 
ATOM   1584  O O   . LEU A  1 212  ? 180.487 253.295 178.195 1.00 72.71  ? 212  LEU A  O   1 
ATOM   1585  C CB  . LEU A  1 212  ? 181.249 251.042 180.478 1.00 77.87  ? 212  LEU A  CB  1 
ATOM   1586  C CG  . LEU A  1 212  ? 181.169 250.295 181.810 1.00 75.65  ? 212  LEU A  CG  1 
ATOM   1587  C CD1 . LEU A  1 212  ? 179.994 249.332 181.816 1.00 72.61  ? 212  LEU A  CD1 1 
ATOM   1588  C CD2 . LEU A  1 212  ? 182.477 249.575 182.102 1.00 70.25  ? 212  LEU A  CD2 1 
ATOM   1589  N N   . VAL A  1 213  ? 181.841 254.018 179.855 1.00 78.99  ? 213  VAL A  N   1 
ATOM   1590  C CA  . VAL A  1 213  ? 182.391 255.133 179.094 1.00 76.48  ? 213  VAL A  CA  1 
ATOM   1591  C C   . VAL A  1 213  ? 183.635 254.729 178.311 1.00 75.03  ? 213  VAL A  C   1 
ATOM   1592  O O   . VAL A  1 213  ? 183.642 254.801 177.077 1.00 80.70  ? 213  VAL A  O   1 
ATOM   1593  C CB  . VAL A  1 213  ? 182.690 256.337 180.013 1.00 74.44  ? 213  VAL A  CB  1 
ATOM   1594  C CG1 . VAL A  1 213  ? 183.372 255.907 181.316 1.00 73.21  ? 213  VAL A  CG1 1 
ATOM   1595  C CG2 . VAL A  1 213  ? 183.542 257.366 179.284 1.00 74.65  ? 213  VAL A  CG2 1 
ATOM   1596  N N   . ARG A  1 214  ? 184.699 254.306 179.003 1.00 73.26  ? 214  ARG A  N   1 
ATOM   1597  C CA  . ARG A  1 214  ? 186.027 254.285 178.393 1.00 74.30  ? 214  ARG A  CA  1 
ATOM   1598  C C   . ARG A  1 214  ? 186.879 253.076 178.770 1.00 75.43  ? 214  ARG A  C   1 
ATOM   1599  O O   . ARG A  1 214  ? 188.108 253.167 178.709 1.00 85.08  ? 214  ARG A  O   1 
ATOM   1600  C CB  . ARG A  1 214  ? 186.782 255.570 178.736 1.00 74.01  ? 214  ARG A  CB  1 
ATOM   1601  C CG  . ARG A  1 214  ? 187.098 255.762 180.212 1.00 71.82  ? 214  ARG A  CG  1 
ATOM   1602  C CD  . ARG A  1 214  ? 188.061 256.922 180.392 1.00 78.76  ? 214  ARG A  CD  1 
ATOM   1603  N NE  . ARG A  1 214  ? 188.213 257.331 181.785 1.00 86.84  ? 214  ARG A  NE  1 
ATOM   1604  C CZ  . ARG A  1 214  ? 188.951 258.365 182.177 1.00 83.88  ? 214  ARG A  CZ  1 
ATOM   1605  N NH1 . ARG A  1 214  ? 189.603 259.096 181.281 1.00 84.45  ? 214  ARG A  NH1 1 
ATOM   1606  N NH2 . ARG A  1 214  ? 189.039 258.673 183.464 1.00 82.05  ? 214  ARG A  NH2 1 
ATOM   1607  N N   . ASP A  1 215  ? 186.286 251.955 179.174 1.00 77.93  ? 215  ASP A  N   1 
ATOM   1608  C CA  . ASP A  1 215  ? 187.110 250.781 179.429 1.00 75.53  ? 215  ASP A  CA  1 
ATOM   1609  C C   . ASP A  1 215  ? 186.302 249.503 179.257 1.00 79.87  ? 215  ASP A  C   1 
ATOM   1610  O O   . ASP A  1 215  ? 185.074 249.498 179.376 1.00 84.33  ? 215  ASP A  O   1 
ATOM   1611  C CB  . ASP A  1 215  ? 187.730 250.814 180.828 1.00 71.06  ? 215  ASP A  CB  1 
ATOM   1612  C CG  . ASP A  1 215  ? 188.974 249.949 180.930 1.00 73.58  ? 215  ASP A  CG  1 
ATOM   1613  O OD1 . ASP A  1 215  ? 189.273 249.219 179.961 1.00 67.84  ? 215  ASP A  OD1 1 
ATOM   1614  O OD2 . ASP A  1 215  ? 189.657 250.003 181.974 1.00 81.25  ? 215  ASP A  OD2 1 
ATOM   1615  N N   . LEU A  1 216  ? 187.024 248.419 178.964 1.00 73.51  ? 216  LEU A  N   1 
ATOM   1616  C CA  . LEU A  1 216  ? 186.489 247.067 178.872 1.00 65.10  ? 216  LEU A  CA  1 
ATOM   1617  C C   . LEU A  1 216  ? 185.788 246.705 180.177 1.00 71.93  ? 216  LEU A  C   1 
ATOM   1618  O O   . LEU A  1 216  ? 186.446 246.618 181.221 1.00 76.79  ? 216  LEU A  O   1 
ATOM   1619  C CB  . LEU A  1 216  ? 187.624 246.085 178.571 1.00 67.72  ? 216  LEU A  CB  1 
ATOM   1620  C CG  . LEU A  1 216  ? 187.299 244.628 178.237 1.00 72.97  ? 216  LEU A  CG  1 
ATOM   1621  C CD1 . LEU A  1 216  ? 186.371 244.527 177.041 1.00 59.41  ? 216  LEU A  CD1 1 
ATOM   1622  C CD2 . LEU A  1 216  ? 188.590 243.868 177.974 1.00 54.94  ? 216  LEU A  CD2 1 
ATOM   1623  N N   . PRO A  1 217  ? 184.473 246.479 180.172 1.00 65.79  ? 217  PRO A  N   1 
ATOM   1624  C CA  . PRO A  1 217  ? 183.766 246.275 181.443 1.00 63.66  ? 217  PRO A  CA  1 
ATOM   1625  C C   . PRO A  1 217  ? 184.302 245.067 182.195 1.00 66.42  ? 217  PRO A  C   1 
ATOM   1626  O O   . PRO A  1 217  ? 184.599 244.027 181.605 1.00 64.61  ? 217  PRO A  O   1 
ATOM   1627  C CB  . PRO A  1 217  ? 182.309 246.068 181.011 1.00 63.92  ? 217  PRO A  CB  1 
ATOM   1628  C CG  . PRO A  1 217  ? 182.227 246.614 179.632 1.00 64.46  ? 217  PRO A  CG  1 
ATOM   1629  C CD  . PRO A  1 217  ? 183.560 246.360 179.024 1.00 65.57  ? 217  PRO A  CD  1 
ATOM   1630  N N   . GLN A  1 218  ? 184.430 245.217 183.511 1.00 74.61  ? 218  GLN A  N   1 
ATOM   1631  C CA  . GLN A  1 218  ? 184.759 244.083 184.361 1.00 74.21  ? 218  GLN A  CA  1 
ATOM   1632  C C   . GLN A  1 218  ? 183.549 243.163 184.466 1.00 78.77  ? 218  GLN A  C   1 
ATOM   1633  O O   . GLN A  1 218  ? 182.414 243.629 184.609 1.00 77.26  ? 218  GLN A  O   1 
ATOM   1634  C CB  . GLN A  1 218  ? 185.187 244.557 185.748 1.00 70.09  ? 218  GLN A  CB  1 
ATOM   1635  C CG  . GLN A  1 218  ? 185.847 243.468 186.578 1.00 70.00  ? 218  GLN A  CG  1 
ATOM   1636  C CD  . GLN A  1 218  ? 185.395 243.464 188.023 1.00 85.31  ? 218  GLN A  CD  1 
ATOM   1637  O OE1 . GLN A  1 218  ? 184.717 244.385 188.482 1.00 90.64  ? 218  GLN A  OE1 1 
ATOM   1638  N NE2 . GLN A  1 218  ? 185.763 242.416 188.753 1.00 84.28  ? 218  GLN A  NE2 1 
ATOM   1639  N N   . GLY A  1 219  ? 183.785 241.867 184.392 1.00 81.64  ? 219  GLY A  N   1 
ATOM   1640  C CA  . GLY A  1 219  ? 182.708 240.902 184.470 1.00 70.32  ? 219  GLY A  CA  1 
ATOM   1641  C C   . GLY A  1 219  ? 183.109 239.603 183.801 1.00 73.51  ? 219  GLY A  C   1 
ATOM   1642  O O   . GLY A  1 219  ? 184.251 239.412 183.393 1.00 72.41  ? 219  GLY A  O   1 
ATOM   1643  N N   . PHE A  1 220  ? 182.132 238.703 183.704 1.00 73.56  ? 220  PHE A  N   1 
ATOM   1644  C CA  . PHE A  1 220  ? 182.351 237.397 183.102 1.00 64.73  ? 220  PHE A  CA  1 
ATOM   1645  C C   . PHE A  1 220  ? 181.138 236.984 182.283 1.00 67.39  ? 220  PHE A  C   1 
ATOM   1646  O O   . PHE A  1 220  ? 179.997 237.124 182.731 1.00 76.09  ? 220  PHE A  O   1 
ATOM   1647  C CB  . PHE A  1 220  ? 182.638 236.327 184.166 1.00 56.79  ? 220  PHE A  CB  1 
ATOM   1648  C CG  . PHE A  1 220  ? 182.825 234.950 183.600 1.00 57.34  ? 220  PHE A  CG  1 
ATOM   1649  C CD1 . PHE A  1 220  ? 181.759 234.076 183.502 1.00 54.92  ? 220  PHE A  CD1 1 
ATOM   1650  C CD2 . PHE A  1 220  ? 184.066 234.534 183.156 1.00 59.17  ? 220  PHE A  CD2 1 
ATOM   1651  C CE1 . PHE A  1 220  ? 181.928 232.816 182.976 1.00 53.26  ? 220  PHE A  CE1 1 
ATOM   1652  C CE2 . PHE A  1 220  ? 184.239 233.275 182.629 1.00 49.56  ? 220  PHE A  CE2 1 
ATOM   1653  C CZ  . PHE A  1 220  ? 183.170 232.416 182.539 1.00 50.14  ? 220  PHE A  CZ  1 
ATOM   1654  N N   . SER A  1 221  ? 181.399 236.471 181.081 1.00 64.64  ? 221  SER A  N   1 
ATOM   1655  C CA  . SER A  1 221  ? 180.357 235.901 180.234 1.00 57.30  ? 221  SER A  CA  1 
ATOM   1656  C C   . SER A  1 221  ? 181.029 235.107 179.123 1.00 58.80  ? 221  SER A  C   1 
ATOM   1657  O O   . SER A  1 221  ? 181.922 235.626 178.448 1.00 52.04  ? 221  SER A  O   1 
ATOM   1658  C CB  . SER A  1 221  ? 179.455 236.993 179.650 1.00 57.12  ? 221  SER A  CB  1 
ATOM   1659  O OG  . SER A  1 221  ? 178.393 236.426 178.904 1.00 67.03  ? 221  SER A  OG  1 
ATOM   1660  N N   . ALA A  1 222  ? 180.604 233.857 178.940 1.00 64.16  ? 222  ALA A  N   1 
ATOM   1661  C CA  . ALA A  1 222  ? 181.241 232.955 177.988 1.00 47.71  ? 222  ALA A  CA  1 
ATOM   1662  C C   . ALA A  1 222  ? 180.631 233.100 176.600 1.00 49.62  ? 222  ALA A  C   1 
ATOM   1663  O O   . ALA A  1 222  ? 179.434 233.362 176.455 1.00 51.95  ? 222  ALA A  O   1 
ATOM   1664  C CB  . ALA A  1 222  ? 181.123 231.504 178.452 1.00 43.42  ? 222  ALA A  CB  1 
ATOM   1665  N N   . LEU A  1 223  ? 181.470 232.928 175.580 1.00 49.79  ? 223  LEU A  N   1 
ATOM   1666  C CA  . LEU A  1 223  ? 181.053 233.086 174.192 1.00 51.53  ? 223  LEU A  CA  1 
ATOM   1667  C C   . LEU A  1 223  ? 180.583 231.750 173.630 1.00 47.47  ? 223  LEU A  C   1 
ATOM   1668  O O   . LEU A  1 223  ? 181.297 230.747 173.728 1.00 52.70  ? 223  LEU A  O   1 
ATOM   1669  C CB  . LEU A  1 223  ? 182.205 233.627 173.350 1.00 54.82  ? 223  LEU A  CB  1 
ATOM   1670  C CG  . LEU A  1 223  ? 183.120 234.663 173.999 1.00 45.17  ? 223  LEU A  CG  1 
ATOM   1671  C CD1 . LEU A  1 223  ? 184.280 234.973 173.077 1.00 40.35  ? 223  LEU A  CD1 1 
ATOM   1672  C CD2 . LEU A  1 223  ? 182.347 235.919 174.335 1.00 55.16  ? 223  LEU A  CD2 1 
ATOM   1673  N N   . GLU A  1 224  ? 179.388 231.734 173.046 1.00 46.81  ? 224  GLU A  N   1 
ATOM   1674  C CA  . GLU A  1 224  ? 178.940 230.556 172.325 1.00 44.20  ? 224  GLU A  CA  1 
ATOM   1675  C C   . GLU A  1 224  ? 179.556 230.525 170.926 1.00 48.15  ? 224  GLU A  C   1 
ATOM   1676  O O   . GLU A  1 224  ? 179.780 231.574 170.317 1.00 58.32  ? 224  GLU A  O   1 
ATOM   1677  C CB  . GLU A  1 224  ? 177.419 230.537 172.206 1.00 43.31  ? 224  GLU A  CB  1 
ATOM   1678  C CG  . GLU A  1 224  ? 176.683 230.582 173.531 1.00 41.24  ? 224  GLU A  CG  1 
ATOM   1679  C CD  . GLU A  1 224  ? 176.447 231.995 174.019 1.00 56.21  ? 224  GLU A  CD  1 
ATOM   1680  O OE1 . GLU A  1 224  ? 176.410 232.920 173.181 1.00 67.30  ? 224  GLU A  OE1 1 
ATOM   1681  O OE2 . GLU A  1 224  ? 176.296 232.182 175.244 1.00 67.09  ? 224  GLU A  OE2 1 
ATOM   1682  N N   . PRO A  1 225  ? 179.836 229.338 170.390 1.00 48.19  ? 225  PRO A  N   1 
ATOM   1683  C CA  . PRO A  1 225  ? 180.216 229.253 168.975 1.00 52.09  ? 225  PRO A  CA  1 
ATOM   1684  C C   . PRO A  1 225  ? 179.051 229.649 168.086 1.00 55.07  ? 225  PRO A  C   1 
ATOM   1685  O O   . PRO A  1 225  ? 177.888 229.422 168.426 1.00 52.80  ? 225  PRO A  O   1 
ATOM   1686  C CB  . PRO A  1 225  ? 180.590 227.780 168.795 1.00 54.52  ? 225  PRO A  CB  1 
ATOM   1687  C CG  . PRO A  1 225  ? 179.820 227.073 169.843 1.00 53.51  ? 225  PRO A  CG  1 
ATOM   1688  C CD  . PRO A  1 225  ? 179.756 228.007 171.013 1.00 52.44  ? 225  PRO A  CD  1 
ATOM   1689  N N   . LEU A  1 226  ? 179.365 230.255 166.940 1.00 59.58  ? 226  LEU A  N   1 
ATOM   1690  C CA  . LEU A  1 226  ? 178.308 230.655 166.018 1.00 65.82  ? 226  LEU A  CA  1 
ATOM   1691  C C   . LEU A  1 226  ? 178.532 230.117 164.611 1.00 59.66  ? 226  LEU A  C   1 
ATOM   1692  O O   . LEU A  1 226  ? 177.581 229.665 163.964 1.00 57.92  ? 226  LEU A  O   1 
ATOM   1693  C CB  . LEU A  1 226  ? 178.186 232.181 165.976 1.00 64.56  ? 226  LEU A  CB  1 
ATOM   1694  C CG  . LEU A  1 226  ? 177.062 232.735 165.091 1.00 70.45  ? 226  LEU A  CG  1 
ATOM   1695  C CD1 . LEU A  1 226  ? 175.737 232.018 165.341 1.00 63.02  ? 226  LEU A  CD1 1 
ATOM   1696  C CD2 . LEU A  1 226  ? 176.895 234.227 165.317 1.00 59.05  ? 226  LEU A  CD2 1 
ATOM   1697  N N   . VAL A  1 227  ? 179.774 230.142 164.130 1.00 52.94  ? 227  VAL A  N   1 
ATOM   1698  C CA  . VAL A  1 227  ? 180.069 229.743 162.760 1.00 53.83  ? 227  VAL A  CA  1 
ATOM   1699  C C   . VAL A  1 227  ? 181.478 229.171 162.703 1.00 48.95  ? 227  VAL A  C   1 
ATOM   1700  O O   . VAL A  1 227  ? 182.355 229.550 163.481 1.00 50.15  ? 227  VAL A  O   1 
ATOM   1701  C CB  . VAL A  1 227  ? 179.909 230.927 161.777 1.00 50.81  ? 227  VAL A  CB  1 
ATOM   1702  C CG1 . VAL A  1 227  ? 180.991 231.973 162.009 1.00 50.87  ? 227  VAL A  CG1 1 
ATOM   1703  C CG2 . VAL A  1 227  ? 179.926 230.431 160.342 1.00 59.73  ? 227  VAL A  CG2 1 
ATOM   1704  N N   . ASP A  1 228  ? 181.685 228.249 161.765 1.00 54.21  ? 228  ASP A  N   1 
ATOM   1705  C CA  . ASP A  1 228  ? 182.979 227.610 161.545 1.00 52.49  ? 228  ASP A  CA  1 
ATOM   1706  C C   . ASP A  1 228  ? 183.210 227.562 160.042 1.00 55.87  ? 228  ASP A  C   1 
ATOM   1707  O O   . ASP A  1 228  ? 182.493 226.856 159.326 1.00 58.13  ? 228  ASP A  O   1 
ATOM   1708  C CB  . ASP A  1 228  ? 183.015 226.209 162.154 1.00 59.04  ? 228  ASP A  CB  1 
ATOM   1709  C CG  . ASP A  1 228  ? 184.354 225.520 161.970 1.00 49.87  ? 228  ASP A  CG  1 
ATOM   1710  O OD1 . ASP A  1 228  ? 185.002 225.715 160.921 1.00 37.77  ? 228  ASP A  OD1 1 
ATOM   1711  O OD2 . ASP A  1 228  ? 184.757 224.771 162.883 1.00 51.37  ? 228  ASP A  OD2 1 
ATOM   1712  N N   . LEU A  1 229  ? 184.209 228.303 159.565 1.00 53.12  ? 229  LEU A  N   1 
ATOM   1713  C CA  . LEU A  1 229  ? 184.405 228.490 158.137 1.00 49.65  ? 229  LEU A  CA  1 
ATOM   1714  C C   . LEU A  1 229  ? 185.529 227.593 157.648 1.00 53.32  ? 229  LEU A  C   1 
ATOM   1715  O O   . LEU A  1 229  ? 186.625 227.624 158.226 1.00 57.93  ? 229  LEU A  O   1 
ATOM   1716  C CB  . LEU A  1 229  ? 184.723 229.948 157.831 1.00 51.83  ? 229  LEU A  CB  1 
ATOM   1717  C CG  . LEU A  1 229  ? 183.701 230.943 158.381 1.00 47.04  ? 229  LEU A  CG  1 
ATOM   1718  C CD1 . LEU A  1 229  ? 184.216 232.359 158.250 1.00 55.44  ? 229  LEU A  CD1 1 
ATOM   1719  C CD2 . LEU A  1 229  ? 182.374 230.787 157.666 1.00 42.26  ? 229  LEU A  CD2 1 
ATOM   1720  N N   . PRO A  1 230  ? 185.311 226.773 156.619 1.00 56.39  ? 230  PRO A  N   1 
ATOM   1721  C CA  . PRO A  1 230  ? 186.379 225.892 156.133 1.00 53.64  ? 230  PRO A  CA  1 
ATOM   1722  C C   . PRO A  1 230  ? 187.303 226.575 155.135 1.00 55.50  ? 230  PRO A  C   1 
ATOM   1723  O O   . PRO A  1 230  ? 187.546 226.041 154.048 1.00 57.89  ? 230  PRO A  O   1 
ATOM   1724  C CB  . PRO A  1 230  ? 185.593 224.755 155.481 1.00 42.89  ? 230  PRO A  CB  1 
ATOM   1725  C CG  . PRO A  1 230  ? 184.409 225.458 154.905 1.00 46.67  ? 230  PRO A  CG  1 
ATOM   1726  C CD  . PRO A  1 230  ? 184.064 226.574 155.862 1.00 50.66  ? 230  PRO A  CD  1 
ATOM   1727  N N   . ILE A  1 231  ? 187.818 227.755 155.480 1.00 50.52  ? 231  ILE A  N   1 
ATOM   1728  C CA  . ILE A  1 231  ? 188.549 228.552 154.499 1.00 48.38  ? 231  ILE A  CA  1 
ATOM   1729  C C   . ILE A  1 231  ? 189.861 227.886 154.102 1.00 53.06  ? 231  ILE A  C   1 
ATOM   1730  O O   . ILE A  1 231  ? 190.208 227.847 152.916 1.00 54.69  ? 231  ILE A  O   1 
ATOM   1731  C CB  . ILE A  1 231  ? 188.776 229.973 155.048 1.00 44.21  ? 231  ILE A  CB  1 
ATOM   1732  C CG1 . ILE A  1 231  ? 189.741 229.940 156.232 1.00 36.76  ? 231  ILE A  CG1 1 
ATOM   1733  C CG2 . ILE A  1 231  ? 187.453 230.585 155.468 1.00 44.36  ? 231  ILE A  CG2 1 
ATOM   1734  C CD1 . ILE A  1 231  ? 189.889 231.257 156.931 1.00 52.77  ? 231  ILE A  CD1 1 
ATOM   1735  N N   . GLY A  1 232  ? 190.605 227.348 155.066 1.00 53.88  ? 232  GLY A  N   1 
ATOM   1736  C CA  . GLY A  1 232  ? 191.844 226.661 154.751 1.00 51.53  ? 232  GLY A  CA  1 
ATOM   1737  C C   . GLY A  1 232  ? 192.979 227.535 154.266 1.00 48.91  ? 232  GLY A  C   1 
ATOM   1738  O O   . GLY A  1 232  ? 193.810 227.067 153.484 1.00 49.43  ? 232  GLY A  O   1 
ATOM   1739  N N   . ILE A  1 233  ? 193.043 228.789 154.696 1.00 55.68  ? 233  ILE A  N   1 
ATOM   1740  C CA  . ILE A  1 233  ? 194.106 229.692 154.296 1.00 57.39  ? 233  ILE A  CA  1 
ATOM   1741  C C   . ILE A  1 233  ? 195.086 229.861 155.450 1.00 58.13  ? 233  ILE A  C   1 
ATOM   1742  O O   . ILE A  1 233  ? 194.800 229.520 156.595 1.00 62.49  ? 233  ILE A  O   1 
ATOM   1743  C CB  . ILE A  1 233  ? 193.559 231.062 153.839 1.00 43.44  ? 233  ILE A  CB  1 
ATOM   1744  C CG1 . ILE A  1 233  ? 192.848 231.769 154.996 1.00 37.37  ? 233  ILE A  CG1 1 
ATOM   1745  C CG2 . ILE A  1 233  ? 192.614 230.879 152.681 1.00 45.72  ? 233  ILE A  CG2 1 
ATOM   1746  C CD1 . ILE A  1 233  ? 192.494 233.204 154.707 1.00 44.01  ? 233  ILE A  CD1 1 
ATOM   1747  N N   . ASN A  1 234  ? 196.257 230.407 155.147 1.00 59.64  ? 234  ASN A  N   1 
ATOM   1748  C CA  . ASN A  1 234  ? 197.256 230.718 156.156 1.00 54.11  ? 234  ASN A  CA  1 
ATOM   1749  C C   . ASN A  1 234  ? 197.030 232.140 156.649 1.00 52.69  ? 234  ASN A  C   1 
ATOM   1750  O O   . ASN A  1 234  ? 197.095 233.090 155.863 1.00 60.34  ? 234  ASN A  O   1 
ATOM   1751  C CB  . ASN A  1 234  ? 198.657 230.557 155.574 1.00 61.69  ? 234  ASN A  CB  1 
ATOM   1752  C CG  . ASN A  1 234  ? 199.751 230.860 156.575 1.00 63.07  ? 234  ASN A  CG  1 
ATOM   1753  O OD1 . ASN A  1 234  ? 199.488 231.198 157.730 1.00 64.98  ? 234  ASN A  OD1 1 
ATOM   1754  N ND2 . ASN A  1 234  ? 200.996 230.733 156.132 1.00 65.67  ? 234  ASN A  ND2 1 
ATOM   1755  N N   . ILE A  1 235  ? 196.777 232.282 157.946 1.00 48.86  ? 235  ILE A  N   1 
ATOM   1756  C CA  . ILE A  1 235  ? 196.475 233.567 158.565 1.00 45.85  ? 235  ILE A  CA  1 
ATOM   1757  C C   . ILE A  1 235  ? 197.588 233.870 159.556 1.00 47.15  ? 235  ILE A  C   1 
ATOM   1758  O O   . ILE A  1 235  ? 197.800 233.115 160.513 1.00 50.83  ? 235  ILE A  O   1 
ATOM   1759  C CB  . ILE A  1 235  ? 195.107 233.563 159.261 1.00 39.05  ? 235  ILE A  CB  1 
ATOM   1760  C CG1 . ILE A  1 235  ? 193.993 233.372 158.230 1.00 45.04  ? 235  ILE A  CG1 1 
ATOM   1761  C CG2 . ILE A  1 235  ? 194.899 234.858 160.042 1.00 42.16  ? 235  ILE A  CG2 1 
ATOM   1762  C CD1 . ILE A  1 235  ? 192.608 233.234 158.825 1.00 39.27  ? 235  ILE A  CD1 1 
ATOM   1763  N N   . THR A  1 236  ? 198.310 234.967 159.320 1.00 51.88  ? 236  THR A  N   1 
ATOM   1764  C CA  . THR A  1 236  ? 199.326 235.448 160.244 1.00 53.82  ? 236  THR A  CA  1 
ATOM   1765  C C   . THR A  1 236  ? 199.070 236.860 160.743 1.00 53.13  ? 236  THR A  C   1 
ATOM   1766  O O   . THR A  1 236  ? 199.614 237.232 161.787 1.00 58.46  ? 236  THR A  O   1 
ATOM   1767  C CB  . THR A  1 236  ? 200.715 235.405 159.587 1.00 56.57  ? 236  THR A  CB  1 
ATOM   1768  O OG1 . THR A  1 236  ? 200.965 234.090 159.077 1.00 56.61  ? 236  THR A  OG1 1 
ATOM   1769  C CG2 . THR A  1 236  ? 201.795 235.757 160.591 1.00 64.79  ? 236  THR A  CG2 1 
ATOM   1770  N N   . ARG A  1 237  ? 198.260 237.647 160.040 1.00 48.57  ? 237  ARG A  N   1 
ATOM   1771  C CA  . ARG A  1 237  ? 197.954 239.009 160.442 1.00 45.62  ? 237  ARG A  CA  1 
ATOM   1772  C C   . ARG A  1 237  ? 196.494 239.292 160.128 1.00 42.88  ? 237  ARG A  C   1 
ATOM   1773  O O   . ARG A  1 237  ? 195.880 238.628 159.291 1.00 48.92  ? 237  ARG A  O   1 
ATOM   1774  C CB  . ARG A  1 237  ? 198.856 240.023 159.732 1.00 48.06  ? 237  ARG A  CB  1 
ATOM   1775  C CG  . ARG A  1 237  ? 200.334 239.721 159.864 1.00 57.67  ? 237  ARG A  CG  1 
ATOM   1776  C CD  . ARG A  1 237  ? 201.168 240.941 159.528 1.00 72.72  ? 237  ARG A  CD  1 
ATOM   1777  N NE  . ARG A  1 237  ? 201.006 241.346 158.134 1.00 64.18  ? 237  ARG A  NE  1 
ATOM   1778  C CZ  . ARG A  1 237  ? 201.675 240.812 157.117 1.00 65.08  ? 237  ARG A  CZ  1 
ATOM   1779  N NH1 . ARG A  1 237  ? 202.556 239.844 157.331 1.00 66.08  ? 237  ARG A  NH1 1 
ATOM   1780  N NH2 . ARG A  1 237  ? 201.463 241.245 155.880 1.00 63.43  ? 237  ARG A  NH2 1 
ATOM   1781  N N   . PHE A  1 238  ? 195.939 240.286 160.813 1.00 42.03  ? 238  PHE A  N   1 
ATOM   1782  C CA  . PHE A  1 238  ? 194.540 240.629 160.625 1.00 43.68  ? 238  PHE A  CA  1 
ATOM   1783  C C   . PHE A  1 238  ? 194.355 242.119 160.873 1.00 46.17  ? 238  PHE A  C   1 
ATOM   1784  O O   . PHE A  1 238  ? 195.239 242.800 161.397 1.00 51.28  ? 238  PHE A  O   1 
ATOM   1785  C CB  . PHE A  1 238  ? 193.635 239.798 161.539 1.00 52.04  ? 238  PHE A  CB  1 
ATOM   1786  C CG  . PHE A  1 238  ? 193.452 240.381 162.909 1.00 48.02  ? 238  PHE A  CG  1 
ATOM   1787  C CD1 . PHE A  1 238  ? 194.404 240.192 163.893 1.00 43.23  ? 238  PHE A  CD1 1 
ATOM   1788  C CD2 . PHE A  1 238  ? 192.318 241.107 163.215 1.00 43.06  ? 238  PHE A  CD2 1 
ATOM   1789  C CE1 . PHE A  1 238  ? 194.230 240.726 165.148 1.00 46.52  ? 238  PHE A  CE1 1 
ATOM   1790  C CE2 . PHE A  1 238  ? 192.140 241.642 164.467 1.00 38.11  ? 238  PHE A  CE2 1 
ATOM   1791  C CZ  . PHE A  1 238  ? 193.094 241.452 165.435 1.00 45.57  ? 238  PHE A  CZ  1 
ATOM   1792  N N   . GLN A  1 239  ? 193.191 242.623 160.474 1.00 45.58  ? 239  GLN A  N   1 
ATOM   1793  C CA  . GLN A  1 239  ? 192.916 244.051 160.543 1.00 48.63  ? 239  GLN A  CA  1 
ATOM   1794  C C   . GLN A  1 239  ? 191.413 244.270 160.568 1.00 48.74  ? 239  GLN A  C   1 
ATOM   1795  O O   . GLN A  1 239  ? 190.693 243.708 159.740 1.00 52.49  ? 239  GLN A  O   1 
ATOM   1796  C CB  . GLN A  1 239  ? 193.547 244.769 159.348 1.00 53.91  ? 239  GLN A  CB  1 
ATOM   1797  C CG  . GLN A  1 239  ? 193.354 246.266 159.331 1.00 58.09  ? 239  GLN A  CG  1 
ATOM   1798  C CD  . GLN A  1 239  ? 194.067 246.913 158.167 1.00 60.10  ? 239  GLN A  CD  1 
ATOM   1799  O OE1 . GLN A  1 239  ? 194.257 246.293 157.121 1.00 66.44  ? 239  GLN A  OE1 1 
ATOM   1800  N NE2 . GLN A  1 239  ? 194.478 248.162 158.341 1.00 71.42  ? 239  GLN A  NE2 1 
ATOM   1801  N N   . THR A  1 240  ? 190.946 245.082 161.512 1.00 45.86  ? 240  THR A  N   1 
ATOM   1802  C CA  . THR A  1 240  ? 189.523 245.362 161.620 1.00 50.19  ? 240  THR A  CA  1 
ATOM   1803  C C   . THR A  1 240  ? 189.124 246.493 160.679 1.00 58.11  ? 240  THR A  C   1 
ATOM   1804  O O   . THR A  1 240  ? 189.920 247.382 160.365 1.00 63.50  ? 240  THR A  O   1 
ATOM   1805  C CB  . THR A  1 240  ? 189.144 245.723 163.056 1.00 51.89  ? 240  THR A  CB  1 
ATOM   1806  O OG1 . THR A  1 240  ? 187.718 245.812 163.168 1.00 43.76  ? 240  THR A  OG1 1 
ATOM   1807  C CG2 . THR A  1 240  ? 189.755 247.048 163.459 1.00 52.22  ? 240  THR A  CG2 1 
ATOM   1808  N N   . LEU A  1 241  ? 187.871 246.453 160.234 1.00 60.38  ? 241  LEU A  N   1 
ATOM   1809  C CA  . LEU A  1 241  ? 187.318 247.449 159.323 1.00 55.06  ? 241  LEU A  CA  1 
ATOM   1810  C C   . LEU A  1 241  ? 186.328 248.315 160.088 1.00 58.51  ? 241  LEU A  C   1 
ATOM   1811  O O   . LEU A  1 241  ? 185.371 247.798 160.674 1.00 61.32  ? 241  LEU A  O   1 
ATOM   1812  C CB  . LEU A  1 241  ? 186.638 246.778 158.131 1.00 49.33  ? 241  LEU A  CB  1 
ATOM   1813  C CG  . LEU A  1 241  ? 187.528 245.813 157.349 1.00 51.95  ? 241  LEU A  CG  1 
ATOM   1814  C CD1 . LEU A  1 241  ? 186.712 245.037 156.337 1.00 60.45  ? 241  LEU A  CD1 1 
ATOM   1815  C CD2 . LEU A  1 241  ? 188.648 246.573 156.670 1.00 53.64  ? 241  LEU A  CD2 1 
ATOM   1816  N N   . LEU A  1 242  ? 186.558 249.625 160.078 1.00 58.64  ? 242  LEU A  N   1 
ATOM   1817  C CA  . LEU A  1 242  ? 185.724 250.579 160.791 1.00 62.25  ? 242  LEU A  CA  1 
ATOM   1818  C C   . LEU A  1 242  ? 184.963 251.459 159.809 1.00 66.38  ? 242  LEU A  C   1 
ATOM   1819  O O   . LEU A  1 242  ? 185.453 251.777 158.722 1.00 65.67  ? 242  LEU A  O   1 
ATOM   1820  C CB  . LEU A  1 242  ? 186.567 251.464 161.714 1.00 59.37  ? 242  LEU A  CB  1 
ATOM   1821  C CG  . LEU A  1 242  ? 187.525 250.760 162.675 1.00 54.23  ? 242  LEU A  CG  1 
ATOM   1822  C CD1 . LEU A  1 242  ? 188.903 250.623 162.054 1.00 53.26  ? 242  LEU A  CD1 1 
ATOM   1823  C CD2 . LEU A  1 242  ? 187.603 251.511 163.993 1.00 67.80  ? 242  LEU A  CD2 1 
ATOM   1824  N N   . ALA A  1 243  ? 183.754 251.846 160.204 1.00 68.32  ? 243  ALA A  N   1 
ATOM   1825  C CA  . ALA A  1 243  ? 182.991 252.833 159.457 1.00 67.37  ? 243  ALA A  CA  1 
ATOM   1826  C C   . ALA A  1 243  ? 183.574 254.222 159.683 1.00 65.85  ? 243  ALA A  C   1 
ATOM   1827  O O   . ALA A  1 243  ? 184.183 254.504 160.719 1.00 63.09  ? 243  ALA A  O   1 
ATOM   1828  C CB  . ALA A  1 243  ? 181.520 252.804 159.869 1.00 64.79  ? 243  ALA A  CB  1 
ATOM   1829  N N   . LEU A  1 244  ? 183.391 255.089 158.694 1.00 71.34  ? 244  LEU A  N   1 
ATOM   1830  C CA  . LEU A  1 244  ? 184.012 256.407 158.720 1.00 73.71  ? 244  LEU A  CA  1 
ATOM   1831  C C   . LEU A  1 244  ? 183.073 257.475 158.175 1.00 69.43  ? 244  LEU A  C   1 
ATOM   1832  O O   . LEU A  1 244  ? 181.955 257.181 157.759 1.00 69.39  ? 244  LEU A  O   1 
ATOM   1833  C CB  . LEU A  1 244  ? 185.313 256.380 157.915 1.00 68.47  ? 244  LEU A  CB  1 
ATOM   1834  C CG  . LEU A  1 244  ? 186.113 257.678 157.808 1.00 65.70  ? 244  LEU A  CG  1 
ATOM   1835  C CD1 . LEU A  1 244  ? 187.601 257.373 157.782 1.00 66.74  ? 244  LEU A  CD1 1 
ATOM   1836  C CD2 . LEU A  1 244  ? 185.716 258.459 156.569 1.00 74.74  ? 244  LEU A  CD2 1 
ATOM   1837  N N   . SER A  1 254  ? 187.435 266.227 150.950 1.00 80.38  ? 254  SER A  N   1 
ATOM   1838  C CA  . SER A  1 254  ? 187.085 265.288 149.892 1.00 83.71  ? 254  SER A  CA  1 
ATOM   1839  C C   . SER A  1 254  ? 187.521 263.870 150.247 1.00 92.09  ? 254  SER A  C   1 
ATOM   1840  O O   . SER A  1 254  ? 186.765 263.113 150.857 1.00 83.99  ? 254  SER A  O   1 
ATOM   1841  C CB  . SER A  1 254  ? 187.718 265.712 148.565 1.00 82.62  ? 254  SER A  CB  1 
ATOM   1842  O OG  . SER A  1 254  ? 187.186 266.947 148.118 1.00 88.03  ? 254  SER A  OG  1 
ATOM   1843  N N   . SER A  1 255  ? 188.742 263.517 149.862 1.00 91.62  ? 255  SER A  N   1 
ATOM   1844  C CA  . SER A  1 255  ? 189.278 262.189 150.137 1.00 84.42  ? 255  SER A  CA  1 
ATOM   1845  C C   . SER A  1 255  ? 189.863 262.106 151.543 1.00 85.99  ? 255  SER A  C   1 
ATOM   1846  O O   . SER A  1 255  ? 189.727 261.089 152.223 1.00 91.05  ? 255  SER A  O   1 
ATOM   1847  C CB  . SER A  1 255  ? 190.347 261.818 149.106 1.00 83.56  ? 255  SER A  CB  1 
ATOM   1848  O OG  . SER A  1 255  ? 191.462 262.686 149.192 1.00 83.84  ? 255  SER A  OG  1 
ATOM   1849  N N   . SER A  1 256  ? 190.512 263.182 151.975 1.00 83.51  ? 256  SER A  N   1 
ATOM   1850  C CA  . SER A  1 256  ? 191.117 263.232 153.300 1.00 84.06  ? 256  SER A  CA  1 
ATOM   1851  C C   . SER A  1 256  ? 190.421 264.257 154.190 1.00 87.18  ? 256  SER A  C   1 
ATOM   1852  O O   . SER A  1 256  ? 189.830 265.219 153.699 1.00 86.70  ? 256  SER A  O   1 
ATOM   1853  C CB  . SER A  1 256  ? 192.609 263.557 153.198 1.00 83.46  ? 256  SER A  CB  1 
ATOM   1854  O OG  . SER A  1 256  ? 193.313 262.520 152.537 1.00 81.50  ? 256  SER A  OG  1 
ATOM   1855  N N   . GLY A  1 257  ? 190.494 264.044 155.500 1.00 82.97  ? 257  GLY A  N   1 
ATOM   1856  C CA  . GLY A  1 257  ? 189.874 264.945 156.454 1.00 81.75  ? 257  GLY A  CA  1 
ATOM   1857  C C   . GLY A  1 257  ? 188.446 264.551 156.776 1.00 74.31  ? 257  GLY A  C   1 
ATOM   1858  O O   . GLY A  1 257  ? 187.526 264.833 156.008 1.00 58.85  ? 257  GLY A  O   1 
ATOM   1859  N N   . TRP A  1 258  ? 188.251 263.922 157.931 1.00 89.92  ? 258  TRP A  N   1 
ATOM   1860  C CA  . TRP A  1 258  ? 186.932 263.435 158.324 1.00 86.58  ? 258  TRP A  CA  1 
ATOM   1861  C C   . TRP A  1 258  ? 186.685 263.508 159.825 1.00 84.91  ? 258  TRP A  C   1 
ATOM   1862  O O   . TRP A  1 258  ? 187.338 264.262 160.547 1.00 76.76  ? 258  TRP A  O   1 
ATOM   1863  C CB  . TRP A  1 258  ? 186.827 261.973 157.907 1.00 69.70  ? 258  TRP A  CB  1 
ATOM   1864  C CG  . TRP A  1 258  ? 188.141 261.291 158.075 1.00 74.51  ? 258  TRP A  CG  1 
ATOM   1865  C CD1 . TRP A  1 258  ? 189.099 261.121 157.123 1.00 79.13  ? 258  TRP A  CD1 1 
ATOM   1866  C CD2 . TRP A  1 258  ? 188.674 260.736 159.285 1.00 76.32  ? 258  TRP A  CD2 1 
ATOM   1867  N NE1 . TRP A  1 258  ? 190.186 260.478 157.658 1.00 81.91  ? 258  TRP A  NE1 1 
ATOM   1868  C CE2 . TRP A  1 258  ? 189.949 260.226 158.983 1.00 77.34  ? 258  TRP A  CE2 1 
ATOM   1869  C CE3 . TRP A  1 258  ? 188.190 260.610 160.590 1.00 78.29  ? 258  TRP A  CE3 1 
ATOM   1870  C CZ2 . TRP A  1 258  ? 190.749 259.600 159.935 1.00 70.62  ? 258  TRP A  CZ2 1 
ATOM   1871  C CZ3 . TRP A  1 258  ? 188.984 259.988 161.534 1.00 81.32  ? 258  TRP A  CZ3 1 
ATOM   1872  C CH2 . TRP A  1 258  ? 190.250 259.491 161.202 1.00 73.39  ? 258  TRP A  CH2 1 
ATOM   1873  N N   . THR A  1 259  ? 185.726 262.704 160.277 1.00 81.26  ? 259  THR A  N   1 
ATOM   1874  C CA  . THR A  1 259  ? 185.357 262.614 161.685 1.00 88.88  ? 259  THR A  CA  1 
ATOM   1875  C C   . THR A  1 259  ? 185.159 261.145 162.048 1.00 89.83  ? 259  THR A  C   1 
ATOM   1876  O O   . THR A  1 259  ? 184.417 260.430 161.376 1.00 89.93  ? 259  THR A  O   1 
ATOM   1877  C CB  . THR A  1 259  ? 184.058 263.384 161.986 1.00 89.71  ? 259  THR A  CB  1 
ATOM   1878  O OG1 . THR A  1 259  ? 184.096 264.666 161.348 1.00 82.54  ? 259  THR A  OG1 1 
ATOM   1879  C CG2 . THR A  1 259  ? 183.889 263.574 163.486 1.00 83.02  ? 259  THR A  CG2 1 
ATOM   1880  N N   . ALA A  1 260  ? 185.824 260.697 163.109 1.00 83.00  ? 260  ALA A  N   1 
ATOM   1881  C CA  . ALA A  1 260  ? 185.726 259.305 163.540 1.00 78.46  ? 260  ALA A  CA  1 
ATOM   1882  C C   . ALA A  1 260  ? 184.624 259.077 164.570 1.00 83.13  ? 260  ALA A  C   1 
ATOM   1883  O O   . ALA A  1 260  ? 184.298 259.966 165.355 1.00 86.49  ? 260  ALA A  O   1 
ATOM   1884  C CB  . ALA A  1 260  ? 187.064 258.828 164.087 1.00 74.76  ? 260  ALA A  CB  1 
ATOM   1885  N N   . GLY A  1 261  ? 184.053 257.877 164.558 1.00 84.10  ? 261  GLY A  N   1 
ATOM   1886  C CA  . GLY A  1 261  ? 182.992 257.528 165.485 1.00 84.73  ? 261  GLY A  CA  1 
ATOM   1887  C C   . GLY A  1 261  ? 183.520 257.195 166.866 1.00 79.89  ? 261  GLY A  C   1 
ATOM   1888  O O   . GLY A  1 261  ? 184.629 256.680 167.009 1.00 76.66  ? 261  GLY A  O   1 
ATOM   1889  N N   . ALA A  1 262  ? 182.721 257.489 167.886 1.00 85.88  ? 262  ALA A  N   1 
ATOM   1890  C CA  . ALA A  1 262  ? 183.108 257.220 169.266 1.00 82.10  ? 262  ALA A  CA  1 
ATOM   1891  C C   . ALA A  1 262  ? 182.987 255.736 169.598 1.00 76.98  ? 262  ALA A  C   1 
ATOM   1892  O O   . ALA A  1 262  ? 182.016 255.307 170.220 1.00 86.75  ? 262  ALA A  O   1 
ATOM   1893  C CB  . ALA A  1 262  ? 182.267 258.050 170.223 1.00 78.31  ? 262  ALA A  CB  1 
ATOM   1894  N N   . ALA A  1 263  ? 183.980 254.958 169.178 1.00 75.05  ? 263  ALA A  N   1 
ATOM   1895  C CA  . ALA A  1 263  ? 183.988 253.523 169.431 1.00 79.50  ? 263  ALA A  CA  1 
ATOM   1896  C C   . ALA A  1 263  ? 185.397 253.030 169.741 1.00 65.71  ? 263  ALA A  C   1 
ATOM   1897  O O   . ALA A  1 263  ? 186.379 253.573 169.236 1.00 68.35  ? 263  ALA A  O   1 
ATOM   1898  C CB  . ALA A  1 263  ? 183.409 252.771 168.243 1.00 71.21  ? 263  ALA A  CB  1 
ATOM   1899  N N   . ALA A  1 264  ? 185.488 251.999 170.575 1.00 62.93  ? 264  ALA A  N   1 
ATOM   1900  C CA  . ALA A  1 264  ? 186.777 251.433 170.953 1.00 54.75  ? 264  ALA A  CA  1 
ATOM   1901  C C   . ALA A  1 264  ? 186.741 249.909 170.924 1.00 61.98  ? 264  ALA A  C   1 
ATOM   1902  O O   . ALA A  1 264  ? 185.721 249.296 171.239 1.00 65.91  ? 264  ALA A  O   1 
ATOM   1903  C CB  . ALA A  1 264  ? 187.191 251.930 172.329 1.00 67.66  ? 264  ALA A  CB  1 
ATOM   1904  N N   . TYR A  1 265  ? 187.861 249.303 170.544 1.00 62.55  ? 265  TYR A  N   1 
ATOM   1905  C CA  . TYR A  1 265  ? 187.960 247.855 170.475 1.00 59.81  ? 265  TYR A  CA  1 
ATOM   1906  C C   . TYR A  1 265  ? 189.283 247.409 171.081 1.00 60.72  ? 265  TYR A  C   1 
ATOM   1907  O O   . TYR A  1 265  ? 190.263 248.157 171.096 1.00 60.91  ? 265  TYR A  O   1 
ATOM   1908  C CB  . TYR A  1 265  ? 187.818 247.348 169.033 1.00 54.73  ? 265  TYR A  CB  1 
ATOM   1909  C CG  . TYR A  1 265  ? 188.967 247.697 168.117 1.00 59.26  ? 265  TYR A  CG  1 
ATOM   1910  C CD1 . TYR A  1 265  ? 188.987 248.896 167.421 1.00 61.17  ? 265  TYR A  CD1 1 
ATOM   1911  C CD2 . TYR A  1 265  ? 190.024 246.820 167.936 1.00 57.69  ? 265  TYR A  CD2 1 
ATOM   1912  C CE1 . TYR A  1 265  ? 190.031 249.213 166.580 1.00 58.27  ? 265  TYR A  CE1 1 
ATOM   1913  C CE2 . TYR A  1 265  ? 191.069 247.129 167.096 1.00 54.23  ? 265  TYR A  CE2 1 
ATOM   1914  C CZ  . TYR A  1 265  ? 191.070 248.327 166.422 1.00 55.09  ? 265  TYR A  CZ  1 
ATOM   1915  O OH  . TYR A  1 265  ? 192.113 248.639 165.582 1.00 57.02  ? 265  TYR A  OH  1 
ATOM   1916  N N   . TYR A  1 266  ? 189.296 246.175 171.581 1.00 59.83  ? 266  TYR A  N   1 
ATOM   1917  C CA  . TYR A  1 266  ? 190.418 245.629 172.331 1.00 55.36  ? 266  TYR A  CA  1 
ATOM   1918  C C   . TYR A  1 266  ? 190.784 244.274 171.751 1.00 49.37  ? 266  TYR A  C   1 
ATOM   1919  O O   . TYR A  1 266  ? 189.913 243.538 171.280 1.00 52.86  ? 266  TYR A  O   1 
ATOM   1920  C CB  . TYR A  1 266  ? 190.077 245.486 173.819 1.00 54.62  ? 266  TYR A  CB  1 
ATOM   1921  C CG  . TYR A  1 266  ? 189.159 246.567 174.343 1.00 62.07  ? 266  TYR A  CG  1 
ATOM   1922  C CD1 . TYR A  1 266  ? 187.800 246.547 174.059 1.00 62.85  ? 266  TYR A  CD1 1 
ATOM   1923  C CD2 . TYR A  1 266  ? 189.646 247.600 175.126 1.00 59.90  ? 266  TYR A  CD2 1 
ATOM   1924  C CE1 . TYR A  1 266  ? 186.959 247.526 174.529 1.00 59.73  ? 266  TYR A  CE1 1 
ATOM   1925  C CE2 . TYR A  1 266  ? 188.809 248.583 175.603 1.00 61.65  ? 266  TYR A  CE2 1 
ATOM   1926  C CZ  . TYR A  1 266  ? 187.467 248.541 175.301 1.00 60.27  ? 266  TYR A  CZ  1 
ATOM   1927  O OH  . TYR A  1 266  ? 186.622 249.517 175.771 1.00 65.27  ? 266  TYR A  OH  1 
ATOM   1928  N N   . VAL A  1 267  ? 192.073 243.950 171.780 1.00 48.13  ? 267  VAL A  N   1 
ATOM   1929  C CA  . VAL A  1 267  ? 192.590 242.736 171.161 1.00 51.61  ? 267  VAL A  CA  1 
ATOM   1930  C C   . VAL A  1 267  ? 193.517 242.036 172.141 1.00 54.81  ? 267  VAL A  C   1 
ATOM   1931  O O   . VAL A  1 267  ? 194.489 242.633 172.618 1.00 52.52  ? 267  VAL A  O   1 
ATOM   1932  C CB  . VAL A  1 267  ? 193.329 243.038 169.849 1.00 49.14  ? 267  VAL A  CB  1 
ATOM   1933  C CG1 . VAL A  1 267  ? 193.959 241.772 169.288 1.00 44.67  ? 267  VAL A  CG1 1 
ATOM   1934  C CG2 . VAL A  1 267  ? 192.374 243.651 168.853 1.00 50.38  ? 267  VAL A  CG2 1 
ATOM   1935  N N   . GLY A  1 268  ? 193.222 240.769 172.430 1.00 55.02  ? 268  GLY A  N   1 
ATOM   1936  C CA  . GLY A  1 268  ? 194.131 239.891 173.129 1.00 49.40  ? 268  GLY A  CA  1 
ATOM   1937  C C   . GLY A  1 268  ? 194.543 238.743 172.225 1.00 51.90  ? 268  GLY A  C   1 
ATOM   1938  O O   . GLY A  1 268  ? 194.145 238.662 171.061 1.00 60.32  ? 268  GLY A  O   1 
ATOM   1939  N N   . TYR A  1 269  ? 195.363 237.858 172.781 1.00 52.51  ? 269  TYR A  N   1 
ATOM   1940  C CA  . TYR A  1 269  ? 195.814 236.675 172.065 1.00 52.75  ? 269  TYR A  CA  1 
ATOM   1941  C C   . TYR A  1 269  ? 195.632 235.444 172.938 1.00 53.91  ? 269  TYR A  C   1 
ATOM   1942  O O   . TYR A  1 269  ? 195.865 235.489 174.149 1.00 58.10  ? 269  TYR A  O   1 
ATOM   1943  C CB  . TYR A  1 269  ? 197.277 236.816 171.633 1.00 53.31  ? 269  TYR A  CB  1 
ATOM   1944  C CG  . TYR A  1 269  ? 197.493 237.941 170.646 1.00 54.04  ? 269  TYR A  CG  1 
ATOM   1945  C CD1 . TYR A  1 269  ? 197.158 237.789 169.309 1.00 57.69  ? 269  TYR A  CD1 1 
ATOM   1946  C CD2 . TYR A  1 269  ? 198.024 239.155 171.052 1.00 56.28  ? 269  TYR A  CD2 1 
ATOM   1947  C CE1 . TYR A  1 269  ? 197.347 238.812 168.407 1.00 60.88  ? 269  TYR A  CE1 1 
ATOM   1948  C CE2 . TYR A  1 269  ? 198.218 240.185 170.155 1.00 56.24  ? 269  TYR A  CE2 1 
ATOM   1949  C CZ  . TYR A  1 269  ? 197.878 240.007 168.835 1.00 63.68  ? 269  TYR A  CZ  1 
ATOM   1950  O OH  . TYR A  1 269  ? 198.067 241.031 167.937 1.00 71.82  ? 269  TYR A  OH  1 
ATOM   1951  N N   . LEU A  1 270  ? 195.214 234.346 172.312 1.00 55.73  ? 270  LEU A  N   1 
ATOM   1952  C CA  . LEU A  1 270  ? 194.921 233.106 173.016 1.00 47.66  ? 270  LEU A  CA  1 
ATOM   1953  C C   . LEU A  1 270  ? 196.188 232.274 173.150 1.00 48.30  ? 270  LEU A  C   1 
ATOM   1954  O O   . LEU A  1 270  ? 196.996 232.205 172.219 1.00 49.42  ? 270  LEU A  O   1 
ATOM   1955  C CB  . LEU A  1 270  ? 193.851 232.301 172.278 1.00 46.92  ? 270  LEU A  CB  1 
ATOM   1956  C CG  . LEU A  1 270  ? 192.625 233.051 171.764 1.00 40.83  ? 270  LEU A  CG  1 
ATOM   1957  C CD1 . LEU A  1 270  ? 191.787 232.139 170.889 1.00 49.46  ? 270  LEU A  CD1 1 
ATOM   1958  C CD2 . LEU A  1 270  ? 191.804 233.582 172.916 1.00 37.17  ? 270  LEU A  CD2 1 
ATOM   1959  N N   . GLN A  1 271  ? 196.359 231.654 174.311 1.00 48.57  ? 271  GLN A  N   1 
ATOM   1960  C CA  . GLN A  1 271  ? 197.471 230.761 174.570 1.00 47.94  ? 271  GLN A  CA  1 
ATOM   1961  C C   . GLN A  1 271  ? 196.949 229.426 175.083 1.00 48.94  ? 271  GLN A  C   1 
ATOM   1962  O O   . GLN A  1 271  ? 195.856 229.365 175.654 1.00 50.69  ? 271  GLN A  O   1 
ATOM   1963  C CB  . GLN A  1 271  ? 198.435 231.364 175.598 1.00 48.78  ? 271  GLN A  CB  1 
ATOM   1964  C CG  . GLN A  1 271  ? 198.979 232.719 175.194 1.00 49.06  ? 271  GLN A  CG  1 
ATOM   1965  C CD  . GLN A  1 271  ? 199.754 233.382 176.304 1.00 71.53  ? 271  GLN A  CD  1 
ATOM   1966  O OE1 . GLN A  1 271  ? 199.818 232.872 177.423 1.00 72.64  ? 271  GLN A  OE1 1 
ATOM   1967  N NE2 . GLN A  1 271  ? 200.352 234.531 176.006 1.00 71.43  ? 271  GLN A  NE2 1 
ATOM   1968  N N   . PRO A  1 272  ? 197.698 228.339 174.897 1.00 49.60  ? 272  PRO A  N   1 
ATOM   1969  C CA  . PRO A  1 272  ? 197.218 227.039 175.382 1.00 52.44  ? 272  PRO A  CA  1 
ATOM   1970  C C   . PRO A  1 272  ? 197.269 226.956 176.898 1.00 56.61  ? 272  PRO A  C   1 
ATOM   1971  O O   . PRO A  1 272  ? 198.349 226.856 177.488 1.00 58.72  ? 272  PRO A  O   1 
ATOM   1972  C CB  . PRO A  1 272  ? 198.180 226.045 174.723 1.00 52.20  ? 272  PRO A  CB  1 
ATOM   1973  C CG  . PRO A  1 272  ? 199.430 226.824 174.510 1.00 59.03  ? 272  PRO A  CG  1 
ATOM   1974  C CD  . PRO A  1 272  ? 199.002 228.233 174.221 1.00 57.50  ? 272  PRO A  CD  1 
ATOM   1975  N N   . ARG A  1 273  ? 196.100 226.994 177.535 1.00 51.98  ? 273  ARG A  N   1 
ATOM   1976  C CA  . ARG A  1 273  ? 196.003 227.113 178.980 1.00 50.31  ? 273  ARG A  CA  1 
ATOM   1977  C C   . ARG A  1 273  ? 194.864 226.247 179.496 1.00 52.69  ? 273  ARG A  C   1 
ATOM   1978  O O   . ARG A  1 273  ? 193.836 226.102 178.831 1.00 56.44  ? 273  ARG A  O   1 
ATOM   1979  C CB  . ARG A  1 273  ? 195.772 228.572 179.394 1.00 48.10  ? 273  ARG A  CB  1 
ATOM   1980  C CG  . ARG A  1 273  ? 196.927 229.513 179.079 1.00 52.20  ? 273  ARG A  CG  1 
ATOM   1981  C CD  . ARG A  1 273  ? 198.098 229.296 180.021 1.00 56.90  ? 273  ARG A  CD  1 
ATOM   1982  N NE  . ARG A  1 273  ? 199.014 230.431 180.022 1.00 48.67  ? 273  ARG A  NE  1 
ATOM   1983  C CZ  . ARG A  1 273  ? 198.791 231.568 180.675 1.00 52.39  ? 273  ARG A  CZ  1 
ATOM   1984  N NH1 . ARG A  1 273  ? 197.678 231.727 181.379 1.00 52.28  ? 273  ARG A  NH1 1 
ATOM   1985  N NH2 . ARG A  1 273  ? 199.680 232.550 180.621 1.00 68.29  ? 273  ARG A  NH2 1 
ATOM   1986  N N   . THR A  1 274  ? 195.055 225.672 180.682 1.00 52.55  ? 274  THR A  N   1 
ATOM   1987  C CA  . THR A  1 274  ? 193.983 224.934 181.338 1.00 49.88  ? 274  THR A  CA  1 
ATOM   1988  C C   . THR A  1 274  ? 193.030 225.902 182.029 1.00 44.40  ? 274  THR A  C   1 
ATOM   1989  O O   . THR A  1 274  ? 193.463 226.815 182.737 1.00 52.29  ? 274  THR A  O   1 
ATOM   1990  C CB  . THR A  1 274  ? 194.553 223.947 182.355 1.00 55.97  ? 274  THR A  CB  1 
ATOM   1991  O OG1 . THR A  1 274  ? 195.533 223.115 181.725 1.00 51.93  ? 274  THR A  OG1 1 
ATOM   1992  C CG2 . THR A  1 274  ? 193.446 223.072 182.924 1.00 56.69  ? 274  THR A  CG2 1 
ATOM   1993  N N   . PHE A  1 275  ? 191.732 225.707 181.816 1.00 45.54  ? 275  PHE A  N   1 
ATOM   1994  C CA  . PHE A  1 275  ? 190.699 226.524 182.439 1.00 47.63  ? 275  PHE A  CA  1 
ATOM   1995  C C   . PHE A  1 275  ? 189.690 225.625 183.137 1.00 50.07  ? 275  PHE A  C   1 
ATOM   1996  O O   . PHE A  1 275  ? 189.087 224.753 182.503 1.00 51.45  ? 275  PHE A  O   1 
ATOM   1997  C CB  . PHE A  1 275  ? 189.999 227.399 181.399 1.00 48.56  ? 275  PHE A  CB  1 
ATOM   1998  C CG  . PHE A  1 275  ? 190.603 228.763 181.252 1.00 44.90  ? 275  PHE A  CG  1 
ATOM   1999  C CD1 . PHE A  1 275  ? 191.877 228.919 180.738 1.00 49.46  ? 275  PHE A  CD1 1 
ATOM   2000  C CD2 . PHE A  1 275  ? 189.894 229.889 181.616 1.00 43.06  ? 275  PHE A  CD2 1 
ATOM   2001  C CE1 . PHE A  1 275  ? 192.432 230.171 180.600 1.00 43.81  ? 275  PHE A  CE1 1 
ATOM   2002  C CE2 . PHE A  1 275  ? 190.445 231.140 181.479 1.00 47.36  ? 275  PHE A  CE2 1 
ATOM   2003  C CZ  . PHE A  1 275  ? 191.714 231.282 180.970 1.00 47.63  ? 275  PHE A  CZ  1 
ATOM   2004  N N   . LEU A  1 276  ? 189.506 225.842 184.435 1.00 46.32  ? 276  LEU A  N   1 
ATOM   2005  C CA  . LEU A  1 276  ? 188.413 225.215 185.161 1.00 39.00  ? 276  LEU A  CA  1 
ATOM   2006  C C   . LEU A  1 276  ? 187.152 226.045 184.979 1.00 37.95  ? 276  LEU A  C   1 
ATOM   2007  O O   . LEU A  1 276  ? 187.171 227.267 185.147 1.00 45.72  ? 276  LEU A  O   1 
ATOM   2008  C CB  . LEU A  1 276  ? 188.756 225.093 186.644 1.00 45.44  ? 276  LEU A  CB  1 
ATOM   2009  C CG  . LEU A  1 276  ? 187.759 224.320 187.508 1.00 43.06  ? 276  LEU A  CG  1 
ATOM   2010  C CD1 . LEU A  1 276  ? 188.003 222.828 187.381 1.00 54.40  ? 276  LEU A  CD1 1 
ATOM   2011  C CD2 . LEU A  1 276  ? 187.845 224.765 188.955 1.00 34.18  ? 276  LEU A  CD2 1 
ATOM   2012  N N   . LEU A  1 277  ? 186.051 225.379 184.641 1.00 38.33  ? 277  LEU A  N   1 
ATOM   2013  C CA  . LEU A  1 277  ? 184.815 226.061 184.280 1.00 42.68  ? 277  LEU A  CA  1 
ATOM   2014  C C   . LEU A  1 277  ? 183.682 225.567 185.161 1.00 40.43  ? 277  LEU A  C   1 
ATOM   2015  O O   . LEU A  1 277  ? 183.482 224.358 185.305 1.00 43.00  ? 277  LEU A  O   1 
ATOM   2016  C CB  . LEU A  1 277  ? 184.467 225.832 182.807 1.00 41.02  ? 277  LEU A  CB  1 
ATOM   2017  C CG  . LEU A  1 277  ? 185.570 226.155 181.799 1.00 37.80  ? 277  LEU A  CG  1 
ATOM   2018  C CD1 . LEU A  1 277  ? 185.299 225.456 180.484 1.00 37.16  ? 277  LEU A  CD1 1 
ATOM   2019  C CD2 . LEU A  1 277  ? 185.689 227.651 181.594 1.00 40.46  ? 277  LEU A  CD2 1 
ATOM   2020  N N   . LYS A  1 278  ? 182.948 226.504 185.749 1.00 42.80  ? 278  LYS A  N   1 
ATOM   2021  C CA  . LYS A  1 278  ? 181.773 226.185 186.547 1.00 36.86  ? 278  LYS A  CA  1 
ATOM   2022  C C   . LYS A  1 278  ? 180.532 226.254 185.665 1.00 38.91  ? 278  LYS A  C   1 
ATOM   2023  O O   . LYS A  1 278  ? 180.292 227.270 185.005 1.00 52.67  ? 278  LYS A  O   1 
ATOM   2024  C CB  . LYS A  1 278  ? 181.648 227.147 187.727 1.00 28.56  ? 278  LYS A  CB  1 
ATOM   2025  C CG  . LYS A  1 278  ? 180.458 226.867 188.626 1.00 38.21  ? 278  LYS A  CG  1 
ATOM   2026  C CD  . LYS A  1 278  ? 180.605 227.558 189.967 1.00 34.78  ? 278  LYS A  CD  1 
ATOM   2027  C CE  . LYS A  1 278  ? 180.146 229.001 189.900 1.00 54.79  ? 278  LYS A  CE  1 
ATOM   2028  N NZ  . LYS A  1 278  ? 178.679 229.119 190.135 1.00 53.76  ? 278  LYS A  NZ  1 
ATOM   2029  N N   . TYR A  1 279  ? 179.754 225.177 185.650 1.00 43.79  ? 279  TYR A  N   1 
ATOM   2030  C CA  . TYR A  1 279  ? 178.453 225.147 184.996 1.00 33.90  ? 279  TYR A  CA  1 
ATOM   2031  C C   . TYR A  1 279  ? 177.373 225.222 186.062 1.00 37.68  ? 279  TYR A  C   1 
ATOM   2032  O O   . TYR A  1 279  ? 177.395 224.450 187.025 1.00 44.04  ? 279  TYR A  O   1 
ATOM   2033  C CB  . TYR A  1 279  ? 178.276 223.876 184.163 1.00 36.61  ? 279  TYR A  CB  1 
ATOM   2034  C CG  . TYR A  1 279  ? 179.203 223.767 182.978 1.00 42.18  ? 279  TYR A  CG  1 
ATOM   2035  C CD1 . TYR A  1 279  ? 180.483 223.255 183.119 1.00 39.87  ? 279  TYR A  CD1 1 
ATOM   2036  C CD2 . TYR A  1 279  ? 178.792 224.160 181.715 1.00 42.88  ? 279  TYR A  CD2 1 
ATOM   2037  C CE1 . TYR A  1 279  ? 181.327 223.146 182.040 1.00 36.47  ? 279  TYR A  CE1 1 
ATOM   2038  C CE2 . TYR A  1 279  ? 179.631 224.052 180.630 1.00 43.91  ? 279  TYR A  CE2 1 
ATOM   2039  C CZ  . TYR A  1 279  ? 180.897 223.546 180.798 1.00 41.85  ? 279  TYR A  CZ  1 
ATOM   2040  O OH  . TYR A  1 279  ? 181.742 223.437 179.720 1.00 53.69  ? 279  TYR A  OH  1 
ATOM   2041  N N   . ASN A  1 280  ? 176.435 226.147 185.892 1.00 42.40  ? 280  ASN A  N   1 
ATOM   2042  C CA  . ASN A  1 280  ? 175.362 226.304 186.859 1.00 46.51  ? 280  ASN A  CA  1 
ATOM   2043  C C   . ASN A  1 280  ? 174.269 225.267 186.603 1.00 51.49  ? 280  ASN A  C   1 
ATOM   2044  O O   . ASN A  1 280  ? 174.397 224.382 185.754 1.00 51.65  ? 280  ASN A  O   1 
ATOM   2045  C CB  . ASN A  1 280  ? 174.809 227.725 186.809 1.00 44.21  ? 280  ASN A  CB  1 
ATOM   2046  C CG  . ASN A  1 280  ? 174.197 228.061 185.471 1.00 50.49  ? 280  ASN A  CG  1 
ATOM   2047  O OD1 . ASN A  1 280  ? 174.364 227.327 184.499 1.00 49.46  ? 280  ASN A  OD1 1 
ATOM   2048  N ND2 . ASN A  1 280  ? 173.490 229.183 185.409 1.00 63.68  ? 280  ASN A  ND2 1 
ATOM   2049  N N   . GLU A  1 281  ? 173.184 225.374 187.364 1.00 55.84  ? 281  GLU A  N   1 
ATOM   2050  C CA  . GLU A  1 281  ? 172.066 224.435 187.265 1.00 59.63  ? 281  GLU A  CA  1 
ATOM   2051  C C   . GLU A  1 281  ? 171.368 224.406 185.904 1.00 59.56  ? 281  GLU A  C   1 
ATOM   2052  O O   . GLU A  1 281  ? 170.668 223.446 185.583 1.00 61.60  ? 281  GLU A  O   1 
ATOM   2053  C CB  . GLU A  1 281  ? 171.039 224.718 188.365 1.00 71.76  ? 281  GLU A  CB  1 
ATOM   2054  C CG  . GLU A  1 281  ? 171.556 224.476 189.774 1.00 77.20  ? 281  GLU A  CG  1 
ATOM   2055  C CD  . GLU A  1 281  ? 170.529 224.815 190.836 1.00 70.42  ? 281  GLU A  CD  1 
ATOM   2056  O OE1 . GLU A  1 281  ? 169.490 225.414 190.489 1.00 60.21  ? 281  GLU A  OE1 1 
ATOM   2057  O OE2 . GLU A  1 281  ? 170.760 224.481 192.018 1.00 79.65  ? 281  GLU A  OE2 1 
ATOM   2058  N N   . ASN A  1 282  ? 171.557 225.453 185.110 1.00 59.62  ? 282  ASN A  N   1 
ATOM   2059  C CA  . ASN A  1 282  ? 170.929 225.537 183.799 1.00 58.37  ? 282  ASN A  CA  1 
ATOM   2060  C C   . ASN A  1 282  ? 171.891 225.240 182.658 1.00 55.27  ? 282  ASN A  C   1 
ATOM   2061  O O   . ASN A  1 282  ? 171.470 225.245 181.497 1.00 63.21  ? 282  ASN A  O   1 
ATOM   2062  C CB  . ASN A  1 282  ? 170.325 226.929 183.594 1.00 62.79  ? 282  ASN A  CB  1 
ATOM   2063  C CG  . ASN A  1 282  ? 169.223 227.246 184.584 1.00 77.72  ? 282  ASN A  CG  1 
ATOM   2064  O OD1 . ASN A  1 282  ? 168.873 226.430 185.439 1.00 79.57  ? 282  ASN A  OD1 1 
ATOM   2065  N ND2 . ASN A  1 282  ? 168.678 228.455 184.473 1.00 86.78  ? 282  ASN A  ND2 1 
ATOM   2066  N N   . GLY A  1 283  ? 173.167 225.016 182.953 1.00 48.86  ? 283  GLY A  N   1 
ATOM   2067  C CA  . GLY A  1 283  ? 174.117 224.555 181.966 1.00 44.12  ? 283  GLY A  CA  1 
ATOM   2068  C C   . GLY A  1 283  ? 174.982 225.624 181.344 1.00 46.86  ? 283  GLY A  C   1 
ATOM   2069  O O   . GLY A  1 283  ? 175.787 225.302 180.463 1.00 45.59  ? 283  GLY A  O   1 
ATOM   2070  N N   . THR A  1 284  ? 174.843 226.877 181.760 1.00 49.06  ? 284  THR A  N   1 
ATOM   2071  C CA  . THR A  1 284  ? 175.663 227.956 181.234 1.00 50.05  ? 284  THR A  CA  1 
ATOM   2072  C C   . THR A  1 284  ? 176.916 228.129 182.080 1.00 49.01  ? 284  THR A  C   1 
ATOM   2073  O O   . THR A  1 284  ? 176.848 228.159 183.312 1.00 54.10  ? 284  THR A  O   1 
ATOM   2074  C CB  . THR A  1 284  ? 174.876 229.266 181.205 1.00 43.76  ? 284  THR A  CB  1 
ATOM   2075  O OG1 . THR A  1 284  ? 174.286 229.499 182.490 1.00 43.30  ? 284  THR A  OG1 1 
ATOM   2076  C CG2 . THR A  1 284  ? 173.784 229.214 180.154 1.00 45.07  ? 284  THR A  CG2 1 
ATOM   2077  N N   . ILE A  1 285  ? 178.062 228.245 181.410 1.00 44.97  ? 285  ILE A  N   1 
ATOM   2078  C CA  . ILE A  1 285  ? 179.310 228.493 182.121 1.00 41.52  ? 285  ILE A  CA  1 
ATOM   2079  C C   . ILE A  1 285  ? 179.173 229.803 182.881 1.00 48.74  ? 285  ILE A  C   1 
ATOM   2080  O O   . ILE A  1 285  ? 179.072 230.879 182.280 1.00 56.54  ? 285  ILE A  O   1 
ATOM   2081  C CB  . ILE A  1 285  ? 180.493 228.516 181.146 1.00 40.32  ? 285  ILE A  CB  1 
ATOM   2082  C CG1 . ILE A  1 285  ? 180.651 227.145 180.484 1.00 39.54  ? 285  ILE A  CG1 1 
ATOM   2083  C CG2 . ILE A  1 285  ? 181.777 228.914 181.866 1.00 40.56  ? 285  ILE A  CG2 1 
ATOM   2084  C CD1 . ILE A  1 285  ? 181.729 227.074 179.428 1.00 40.91  ? 285  ILE A  CD1 1 
ATOM   2085  N N   . THR A  1 286  ? 179.179 229.718 184.213 1.00 48.10  ? 286  THR A  N   1 
ATOM   2086  C CA  . THR A  1 286  ? 178.930 230.868 185.067 1.00 49.16  ? 286  THR A  CA  1 
ATOM   2087  C C   . THR A  1 286  ? 180.177 231.415 185.742 1.00 50.29  ? 286  THR A  C   1 
ATOM   2088  O O   . THR A  1 286  ? 180.167 232.576 186.160 1.00 51.93  ? 286  THR A  O   1 
ATOM   2089  C CB  . THR A  1 286  ? 177.907 230.513 186.161 1.00 48.08  ? 286  THR A  CB  1 
ATOM   2090  O OG1 . THR A  1 286  ? 176.728 229.960 185.563 1.00 52.84  ? 286  THR A  OG1 1 
ATOM   2091  C CG2 . THR A  1 286  ? 177.522 231.748 186.960 1.00 53.83  ? 286  THR A  CG2 1 
ATOM   2092  N N   . ASP A  1 287  ? 181.242 230.626 185.860 1.00 40.56  ? 287  ASP A  N   1 
ATOM   2093  C CA  . ASP A  1 287  ? 182.496 231.108 186.420 1.00 39.92  ? 287  ASP A  CA  1 
ATOM   2094  C C   . ASP A  1 287  ? 183.626 230.259 185.862 1.00 37.50  ? 287  ASP A  C   1 
ATOM   2095  O O   . ASP A  1 287  ? 183.402 229.165 185.341 1.00 42.25  ? 287  ASP A  O   1 
ATOM   2096  C CB  . ASP A  1 287  ? 182.484 231.061 187.950 1.00 44.29  ? 287  ASP A  CB  1 
ATOM   2097  C CG  . ASP A  1 287  ? 183.615 231.859 188.563 1.00 52.08  ? 287  ASP A  CG  1 
ATOM   2098  O OD1 . ASP A  1 287  ? 184.442 232.397 187.798 1.00 45.69  ? 287  ASP A  OD1 1 
ATOM   2099  O OD2 . ASP A  1 287  ? 183.677 231.950 189.807 1.00 57.72  ? 287  ASP A  OD2 1 
ATOM   2100  N N   . ALA A  1 288  ? 184.846 230.780 185.972 1.00 38.97  ? 288  ALA A  N   1 
ATOM   2101  C CA  . ALA A  1 288  ? 186.010 230.085 185.446 1.00 36.49  ? 288  ALA A  CA  1 
ATOM   2102  C C   . ALA A  1 288  ? 187.247 230.477 186.239 1.00 44.91  ? 288  ALA A  C   1 
ATOM   2103  O O   . ALA A  1 288  ? 187.305 231.557 186.832 1.00 54.82  ? 288  ALA A  O   1 
ATOM   2104  C CB  . ALA A  1 288  ? 186.221 230.395 183.962 1.00 43.78  ? 288  ALA A  CB  1 
ATOM   2105  N N   . VAL A  1 289  ? 188.237 229.585 186.240 1.00 44.80  ? 289  VAL A  N   1 
ATOM   2106  C CA  . VAL A  1 289  ? 189.514 229.809 186.909 1.00 49.57  ? 289  VAL A  CA  1 
ATOM   2107  C C   . VAL A  1 289  ? 190.637 229.470 185.939 1.00 47.44  ? 289  VAL A  C   1 
ATOM   2108  O O   . VAL A  1 289  ? 190.653 228.379 185.360 1.00 51.00  ? 289  VAL A  O   1 
ATOM   2109  C CB  . VAL A  1 289  ? 189.638 228.972 188.196 1.00 38.60  ? 289  VAL A  CB  1 
ATOM   2110  C CG1 . VAL A  1 289  ? 191.089 228.628 188.484 1.00 44.25  ? 289  VAL A  CG1 1 
ATOM   2111  C CG2 . VAL A  1 289  ? 189.042 229.724 189.365 1.00 41.17  ? 289  VAL A  CG2 1 
ATOM   2112  N N   . ASP A  1 290  ? 191.580 230.398 185.772 1.00 48.27  ? 290  ASP A  N   1 
ATOM   2113  C CA  . ASP A  1 290  ? 192.753 230.172 184.934 1.00 47.48  ? 290  ASP A  CA  1 
ATOM   2114  C C   . ASP A  1 290  ? 193.820 229.467 185.760 1.00 46.63  ? 290  ASP A  C   1 
ATOM   2115  O O   . ASP A  1 290  ? 194.364 230.039 186.709 1.00 53.92  ? 290  ASP A  O   1 
ATOM   2116  C CB  . ASP A  1 290  ? 193.280 231.488 184.372 1.00 50.04  ? 290  ASP A  CB  1 
ATOM   2117  C CG  . ASP A  1 290  ? 194.459 231.291 183.439 1.00 46.54  ? 290  ASP A  CG  1 
ATOM   2118  O OD1 . ASP A  1 290  ? 194.825 230.126 183.177 1.00 48.84  ? 290  ASP A  OD1 1 
ATOM   2119  O OD2 . ASP A  1 290  ? 195.020 232.300 182.966 1.00 50.32  ? 290  ASP A  OD2 1 
ATOM   2120  N N   . CYS A  1 291  ? 194.134 228.227 185.386 1.00 38.87  ? 291  CYS A  N   1 
ATOM   2121  C CA  . CYS A  1 291  ? 195.026 227.384 186.173 1.00 45.25  ? 291  CYS A  CA  1 
ATOM   2122  C C   . CYS A  1 291  ? 196.437 227.943 186.307 1.00 56.19  ? 291  CYS A  C   1 
ATOM   2123  O O   . CYS A  1 291  ? 197.175 227.491 187.189 1.00 61.06  ? 291  CYS A  O   1 
ATOM   2124  C CB  . CYS A  1 291  ? 195.086 225.991 185.544 1.00 55.20  ? 291  CYS A  CB  1 
ATOM   2125  S SG  . CYS A  1 291  ? 193.502 225.122 185.542 1.00 92.91  ? 291  CYS A  SG  1 
ATOM   2126  N N   . ALA A  1 292  ? 196.837 228.897 185.466 1.00 53.83  ? 292  ALA A  N   1 
ATOM   2127  C CA  . ALA A  1 292  ? 198.189 229.445 185.504 1.00 43.66  ? 292  ALA A  CA  1 
ATOM   2128  C C   . ALA A  1 292  ? 198.213 230.937 185.808 1.00 49.44  ? 292  ALA A  C   1 
ATOM   2129  O O   . ALA A  1 292  ? 199.274 231.561 185.709 1.00 51.00  ? 292  ALA A  O   1 
ATOM   2130  C CB  . ALA A  1 292  ? 198.908 229.173 184.180 1.00 35.76  ? 292  ALA A  CB  1 
ATOM   2131  N N   . LEU A  1 293  ? 197.077 231.525 186.182 1.00 47.73  ? 293  LEU A  N   1 
ATOM   2132  C CA  . LEU A  1 293  ? 197.058 232.944 186.514 1.00 51.09  ? 293  LEU A  CA  1 
ATOM   2133  C C   . LEU A  1 293  ? 198.018 233.247 187.657 1.00 66.33  ? 293  LEU A  C   1 
ATOM   2134  O O   . LEU A  1 293  ? 198.760 234.236 187.616 1.00 78.91  ? 293  LEU A  O   1 
ATOM   2135  C CB  . LEU A  1 293  ? 195.635 233.374 186.869 1.00 47.67  ? 293  LEU A  CB  1 
ATOM   2136  C CG  . LEU A  1 293  ? 195.455 234.747 187.521 1.00 46.00  ? 293  LEU A  CG  1 
ATOM   2137  C CD1 . LEU A  1 293  ? 196.019 235.848 186.641 1.00 49.24  ? 293  LEU A  CD1 1 
ATOM   2138  C CD2 . LEU A  1 293  ? 193.985 234.997 187.819 1.00 54.51  ? 293  LEU A  CD2 1 
ATOM   2139  N N   . ASP A  1 294  ? 198.010 232.412 188.689 1.00 59.55  ? 294  ASP A  N   1 
ATOM   2140  C CA  . ASP A  1 294  ? 198.888 232.587 189.838 1.00 53.59  ? 294  ASP A  CA  1 
ATOM   2141  C C   . ASP A  1 294  ? 198.868 231.297 190.644 1.00 61.02  ? 294  ASP A  C   1 
ATOM   2142  O O   . ASP A  1 294  ? 198.039 230.411 190.393 1.00 63.22  ? 294  ASP A  O   1 
ATOM   2143  C CB  . ASP A  1 294  ? 198.452 233.789 190.695 1.00 54.67  ? 294  ASP A  CB  1 
ATOM   2144  C CG  . ASP A  1 294  ? 196.974 233.772 191.008 1.00 56.91  ? 294  ASP A  CG  1 
ATOM   2145  O OD1 . ASP A  1 294  ? 196.313 232.762 190.695 1.00 60.30  ? 294  ASP A  OD1 1 
ATOM   2146  O OD2 . ASP A  1 294  ? 196.470 234.772 191.559 1.00 63.59  ? 294  ASP A  OD2 1 
ATOM   2147  N N   . PRO A  1 295  ? 199.771 231.151 191.618 1.00 62.50  ? 295  PRO A  N   1 
ATOM   2148  C CA  . PRO A  1 295  ? 199.791 229.905 192.405 1.00 61.53  ? 295  PRO A  CA  1 
ATOM   2149  C C   . PRO A  1 295  ? 198.483 229.604 193.115 1.00 57.42  ? 295  PRO A  C   1 
ATOM   2150  O O   . PRO A  1 295  ? 198.119 228.429 193.233 1.00 54.76  ? 295  PRO A  O   1 
ATOM   2151  C CB  . PRO A  1 295  ? 200.932 230.146 193.402 1.00 63.54  ? 295  PRO A  CB  1 
ATOM   2152  C CG  . PRO A  1 295  ? 201.823 231.111 192.718 1.00 58.61  ? 295  PRO A  CG  1 
ATOM   2153  C CD  . PRO A  1 295  ? 200.917 232.017 191.938 1.00 57.74  ? 295  PRO A  CD  1 
ATOM   2154  N N   . LEU A  1 296  ? 197.759 230.618 193.591 1.00 55.56  ? 296  LEU A  N   1 
ATOM   2155  C CA  . LEU A  1 296  ? 196.464 230.356 194.211 1.00 50.29  ? 296  LEU A  CA  1 
ATOM   2156  C C   . LEU A  1 296  ? 195.528 229.670 193.227 1.00 50.77  ? 296  LEU A  C   1 
ATOM   2157  O O   . LEU A  1 296  ? 194.897 228.657 193.551 1.00 59.58  ? 296  LEU A  O   1 
ATOM   2158  C CB  . LEU A  1 296  ? 195.845 231.659 194.715 1.00 53.06  ? 296  LEU A  CB  1 
ATOM   2159  C CG  . LEU A  1 296  ? 194.391 231.561 195.193 1.00 45.27  ? 296  LEU A  CG  1 
ATOM   2160  C CD1 . LEU A  1 296  ? 194.268 230.580 196.344 1.00 47.03  ? 296  LEU A  CD1 1 
ATOM   2161  C CD2 . LEU A  1 296  ? 193.858 232.926 195.593 1.00 40.82  ? 296  LEU A  CD2 1 
ATOM   2162  N N   . SER A  1 297  ? 195.430 230.209 192.012 1.00 45.60  ? 297  SER A  N   1 
ATOM   2163  C CA  . SER A  1 297  ? 194.560 229.611 191.009 1.00 38.84  ? 297  SER A  CA  1 
ATOM   2164  C C   . SER A  1 297  ? 195.010 228.203 190.655 1.00 38.34  ? 297  SER A  C   1 
ATOM   2165  O O   . SER A  1 297  ? 194.179 227.354 190.316 1.00 47.41  ? 297  SER A  O   1 
ATOM   2166  C CB  . SER A  1 297  ? 194.522 230.492 189.763 1.00 52.78  ? 297  SER A  CB  1 
ATOM   2167  O OG  . SER A  1 297  ? 194.095 231.803 190.087 1.00 51.46  ? 297  SER A  OG  1 
ATOM   2168  N N   . GLU A  1 298  ? 196.312 227.932 190.734 1.00 44.35  ? 298  GLU A  N   1 
ATOM   2169  C CA  . GLU A  1 298  ? 196.793 226.580 190.479 1.00 50.33  ? 298  GLU A  CA  1 
ATOM   2170  C C   . GLU A  1 298  ? 196.175 225.589 191.453 1.00 47.61  ? 298  GLU A  C   1 
ATOM   2171  O O   . GLU A  1 298  ? 195.777 224.488 191.060 1.00 56.22  ? 298  GLU A  O   1 
ATOM   2172  C CB  . GLU A  1 298  ? 198.317 226.545 190.572 1.00 60.01  ? 298  GLU A  CB  1 
ATOM   2173  C CG  . GLU A  1 298  ? 198.934 225.183 190.314 1.00 60.74  ? 298  GLU A  CG  1 
ATOM   2174  C CD  . GLU A  1 298  ? 200.435 225.259 190.112 1.00 62.89  ? 298  GLU A  CD  1 
ATOM   2175  O OE1 . GLU A  1 298  ? 200.965 226.385 189.997 1.00 60.62  ? 298  GLU A  OE1 1 
ATOM   2176  O OE2 . GLU A  1 298  ? 201.087 224.195 190.069 1.00 75.11  ? 298  GLU A  OE2 1 
ATOM   2177  N N   . THR A  1 299  ? 196.085 225.962 192.731 1.00 54.92  ? 299  THR A  N   1 
ATOM   2178  C CA  . THR A  1 299  ? 195.467 225.082 193.716 1.00 46.52  ? 299  THR A  CA  1 
ATOM   2179  C C   . THR A  1 299  ? 193.984 224.897 193.428 1.00 44.67  ? 299  THR A  C   1 
ATOM   2180  O O   . THR A  1 299  ? 193.471 223.774 193.457 1.00 57.72  ? 299  THR A  O   1 
ATOM   2181  C CB  . THR A  1 299  ? 195.674 225.644 195.118 1.00 45.66  ? 299  THR A  CB  1 
ATOM   2182  O OG1 . THR A  1 299  ? 195.075 226.943 195.205 1.00 46.00  ? 299  THR A  OG1 1 
ATOM   2183  C CG2 . THR A  1 299  ? 197.156 225.747 195.430 1.00 43.61  ? 299  THR A  CG2 1 
ATOM   2184  N N   . LYS A  1 300  ? 193.271 225.996 193.159 1.00 44.21  ? 300  LYS A  N   1 
ATOM   2185  C CA  . LYS A  1 300  ? 191.876 225.880 192.751 1.00 36.95  ? 300  LYS A  CA  1 
ATOM   2186  C C   . LYS A  1 300  ? 191.742 224.932 191.570 1.00 41.60  ? 300  LYS A  C   1 
ATOM   2187  O O   . LYS A  1 300  ? 190.822 224.110 191.520 1.00 45.94  ? 300  LYS A  O   1 
ATOM   2188  C CB  . LYS A  1 300  ? 191.311 227.252 192.386 1.00 40.68  ? 300  LYS A  CB  1 
ATOM   2189  C CG  . LYS A  1 300  ? 191.276 228.259 193.517 1.00 40.58  ? 300  LYS A  CG  1 
ATOM   2190  C CD  . LYS A  1 300  ? 190.559 229.518 193.072 1.00 35.70  ? 300  LYS A  CD  1 
ATOM   2191  C CE  . LYS A  1 300  ? 190.465 230.537 194.185 1.00 41.09  ? 300  LYS A  CE  1 
ATOM   2192  N NZ  . LYS A  1 300  ? 189.401 231.540 193.900 1.00 37.05  ? 300  LYS A  NZ  1 
ATOM   2193  N N   . CYS A  1 301  ? 192.654 225.039 190.606 1.00 50.56  ? 301  CYS A  N   1 
ATOM   2194  C CA  . CYS A  1 301  ? 192.646 224.138 189.462 1.00 52.68  ? 301  CYS A  CA  1 
ATOM   2195  C C   . CYS A  1 301  ? 192.849 222.694 189.906 1.00 47.09  ? 301  CYS A  C   1 
ATOM   2196  O O   . CYS A  1 301  ? 192.096 221.796 189.513 1.00 47.91  ? 301  CYS A  O   1 
ATOM   2197  C CB  . CYS A  1 301  ? 193.733 224.562 188.475 1.00 60.80  ? 301  CYS A  CB  1 
ATOM   2198  S SG  . CYS A  1 301  ? 193.770 223.660 186.919 1.00 119.25 ? 301  CYS A  SG  1 
ATOM   2199  N N   . THR A  1 302  ? 193.883 222.450 190.714 1.00 50.15  ? 302  THR A  N   1 
ATOM   2200  C CA  . THR A  1 302  ? 194.187 221.088 191.145 1.00 47.37  ? 302  THR A  CA  1 
ATOM   2201  C C   . THR A  1 302  ? 193.063 220.512 191.996 1.00 45.13  ? 302  THR A  C   1 
ATOM   2202  O O   . THR A  1 302  ? 192.717 219.332 191.865 1.00 34.90  ? 302  THR A  O   1 
ATOM   2203  C CB  . THR A  1 302  ? 195.504 221.062 191.919 1.00 41.58  ? 302  THR A  CB  1 
ATOM   2204  O OG1 . THR A  1 302  ? 196.545 221.641 191.122 1.00 52.76  ? 302  THR A  OG1 1 
ATOM   2205  C CG2 . THR A  1 302  ? 195.887 219.632 192.270 1.00 44.26  ? 302  THR A  CG2 1 
ATOM   2206  N N   . LEU A  1 303  ? 192.499 221.320 192.893 1.00 47.73  ? 303  LEU A  N   1 
ATOM   2207  C CA  . LEU A  1 303  ? 191.420 220.867 193.761 1.00 44.49  ? 303  LEU A  CA  1 
ATOM   2208  C C   . LEU A  1 303  ? 190.081 220.788 193.043 1.00 40.97  ? 303  LEU A  C   1 
ATOM   2209  O O   . LEU A  1 303  ? 189.133 220.224 193.598 1.00 42.91  ? 303  LEU A  O   1 
ATOM   2210  C CB  . LEU A  1 303  ? 191.292 221.801 194.968 1.00 31.16  ? 303  LEU A  CB  1 
ATOM   2211  C CG  . LEU A  1 303  ? 192.525 221.900 195.866 1.00 24.47  ? 303  LEU A  CG  1 
ATOM   2212  C CD1 . LEU A  1 303  ? 192.541 223.218 196.622 1.00 43.10  ? 303  LEU A  CD1 1 
ATOM   2213  C CD2 . LEU A  1 303  ? 192.567 220.733 196.833 1.00 39.94  ? 303  LEU A  CD2 1 
ATOM   2214  N N   . LYS A  1 304  ? 189.981 221.331 191.832 1.00 43.79  ? 304  LYS A  N   1 
ATOM   2215  C CA  . LYS A  1 304  ? 188.717 221.400 191.108 1.00 37.81  ? 304  LYS A  CA  1 
ATOM   2216  C C   . LYS A  1 304  ? 187.635 222.016 191.987 1.00 41.26  ? 304  LYS A  C   1 
ATOM   2217  O O   . LYS A  1 304  ? 186.518 221.509 192.099 1.00 42.26  ? 304  LYS A  O   1 
ATOM   2218  C CB  . LYS A  1 304  ? 188.296 220.022 190.602 1.00 38.90  ? 304  LYS A  CB  1 
ATOM   2219  C CG  . LYS A  1 304  ? 189.110 219.527 189.419 1.00 39.77  ? 304  LYS A  CG  1 
ATOM   2220  C CD  . LYS A  1 304  ? 190.239 218.617 189.862 1.00 42.88  ? 304  LYS A  CD  1 
ATOM   2221  C CE  . LYS A  1 304  ? 191.268 218.421 188.760 1.00 48.31  ? 304  LYS A  CE  1 
ATOM   2222  N NZ  . LYS A  1 304  ? 192.395 217.554 189.204 1.00 39.81  ? 304  LYS A  NZ  1 
ATOM   2223  N N   . SER A  1 305  ? 187.987 223.129 192.625 1.00 38.63  ? 305  SER A  N   1 
ATOM   2224  C CA  . SER A  1 305  ? 187.061 223.861 193.472 1.00 31.72  ? 305  SER A  CA  1 
ATOM   2225  C C   . SER A  1 305  ? 187.418 225.337 193.415 1.00 40.53  ? 305  SER A  C   1 
ATOM   2226  O O   . SER A  1 305  ? 188.597 225.696 193.372 1.00 47.33  ? 305  SER A  O   1 
ATOM   2227  C CB  . SER A  1 305  ? 187.107 223.359 194.918 1.00 35.42  ? 305  SER A  CB  1 
ATOM   2228  O OG  . SER A  1 305  ? 186.171 224.048 195.727 1.00 36.86  ? 305  SER A  OG  1 
ATOM   2229  N N   . PHE A  1 306  ? 186.392 226.185 193.403 1.00 43.33  ? 306  PHE A  N   1 
ATOM   2230  C CA  . PHE A  1 306  ? 186.607 227.624 193.393 1.00 43.02  ? 306  PHE A  CA  1 
ATOM   2231  C C   . PHE A  1 306  ? 186.905 228.185 194.776 1.00 45.42  ? 306  PHE A  C   1 
ATOM   2232  O O   . PHE A  1 306  ? 187.372 229.324 194.878 1.00 65.08  ? 306  PHE A  O   1 
ATOM   2233  C CB  . PHE A  1 306  ? 185.386 228.326 192.796 1.00 58.22  ? 306  PHE A  CB  1 
ATOM   2234  C CG  . PHE A  1 306  ? 185.345 228.280 191.300 1.00 48.69  ? 306  PHE A  CG  1 
ATOM   2235  C CD1 . PHE A  1 306  ? 185.045 227.103 190.644 1.00 41.55  ? 306  PHE A  CD1 1 
ATOM   2236  C CD2 . PHE A  1 306  ? 185.618 229.406 190.550 1.00 48.19  ? 306  PHE A  CD2 1 
ATOM   2237  C CE1 . PHE A  1 306  ? 185.015 227.051 189.272 1.00 48.75  ? 306  PHE A  CE1 1 
ATOM   2238  C CE2 . PHE A  1 306  ? 185.586 229.358 189.177 1.00 49.74  ? 306  PHE A  CE2 1 
ATOM   2239  C CZ  . PHE A  1 306  ? 185.285 228.179 188.537 1.00 47.13  ? 306  PHE A  CZ  1 
ATOM   2240  N N   . THR A  1 307  ? 186.647 227.421 195.832 1.00 43.25  ? 307  THR A  N   1 
ATOM   2241  C CA  . THR A  1 307  ? 186.930 227.831 197.201 1.00 48.31  ? 307  THR A  CA  1 
ATOM   2242  C C   . THR A  1 307  ? 187.916 226.849 197.818 1.00 49.67  ? 307  THR A  C   1 
ATOM   2243  O O   . THR A  1 307  ? 187.723 225.633 197.732 1.00 55.40  ? 307  THR A  O   1 
ATOM   2244  C CB  . THR A  1 307  ? 185.645 227.897 198.034 1.00 48.53  ? 307  THR A  CB  1 
ATOM   2245  O OG1 . THR A  1 307  ? 185.965 228.202 199.396 1.00 45.74  ? 307  THR A  OG1 1 
ATOM   2246  C CG2 . THR A  1 307  ? 184.892 226.574 197.972 1.00 53.01  ? 307  THR A  CG2 1 
ATOM   2247  N N   . VAL A  1 308  ? 188.975 227.378 198.426 1.00 53.51  ? 308  VAL A  N   1 
ATOM   2248  C CA  . VAL A  1 308  ? 190.035 226.576 199.025 1.00 54.99  ? 308  VAL A  CA  1 
ATOM   2249  C C   . VAL A  1 308  ? 190.039 226.822 200.526 1.00 61.53  ? 308  VAL A  C   1 
ATOM   2250  O O   . VAL A  1 308  ? 190.070 227.975 200.973 1.00 64.42  ? 308  VAL A  O   1 
ATOM   2251  C CB  . VAL A  1 308  ? 191.406 226.908 198.415 1.00 47.35  ? 308  VAL A  CB  1 
ATOM   2252  C CG1 . VAL A  1 308  ? 192.471 225.977 198.964 1.00 40.72  ? 308  VAL A  CG1 1 
ATOM   2253  C CG2 . VAL A  1 308  ? 191.348 226.821 196.904 1.00 43.97  ? 308  VAL A  CG2 1 
ATOM   2254  N N   . GLU A  1 309  ? 190.011 225.742 201.300 1.00 63.51  ? 309  GLU A  N   1 
ATOM   2255  C CA  . GLU A  1 309  ? 190.052 225.852 202.748 1.00 52.62  ? 309  GLU A  CA  1 
ATOM   2256  C C   . GLU A  1 309  ? 191.448 226.241 203.227 1.00 47.33  ? 309  GLU A  C   1 
ATOM   2257  O O   . GLU A  1 309  ? 192.443 226.133 202.507 1.00 49.35  ? 309  GLU A  O   1 
ATOM   2258  C CB  . GLU A  1 309  ? 189.628 224.537 203.400 1.00 45.70  ? 309  GLU A  CB  1 
ATOM   2259  C CG  . GLU A  1 309  ? 188.132 224.281 203.355 1.00 48.96  ? 309  GLU A  CG  1 
ATOM   2260  C CD  . GLU A  1 309  ? 187.717 223.100 204.208 1.00 47.67  ? 309  GLU A  CD  1 
ATOM   2261  O OE1 . GLU A  1 309  ? 186.637 222.528 203.949 1.00 58.70  ? 309  GLU A  OE1 1 
ATOM   2262  O OE2 . GLU A  1 309  ? 188.472 222.740 205.136 1.00 37.43  ? 309  GLU A  OE2 1 
ATOM   2263  N N   . LYS A  1 310  ? 191.505 226.701 204.473 1.00 50.04  ? 310  LYS A  N   1 
ATOM   2264  C CA  . LYS A  1 310  ? 192.767 227.074 205.096 1.00 50.42  ? 310  LYS A  CA  1 
ATOM   2265  C C   . LYS A  1 310  ? 193.735 225.900 205.107 1.00 47.89  ? 310  LYS A  C   1 
ATOM   2266  O O   . LYS A  1 310  ? 193.353 224.762 205.390 1.00 69.16  ? 310  LYS A  O   1 
ATOM   2267  C CB  . LYS A  1 310  ? 192.502 227.551 206.523 1.00 53.00  ? 310  LYS A  CB  1 
ATOM   2268  C CG  . LYS A  1 310  ? 193.721 227.963 207.312 1.00 39.41  ? 310  LYS A  CG  1 
ATOM   2269  C CD  . LYS A  1 310  ? 193.273 228.504 208.652 1.00 37.15  ? 310  LYS A  CD  1 
ATOM   2270  C CE  . LYS A  1 310  ? 194.419 228.996 209.496 1.00 40.76  ? 310  LYS A  CE  1 
ATOM   2271  N NZ  . LYS A  1 310  ? 193.892 229.540 210.775 1.00 52.71  ? 310  LYS A  NZ  1 
ATOM   2272  N N   . GLY A  1 311  ? 194.991 226.180 204.796 1.00 36.14  ? 311  GLY A  N   1 
ATOM   2273  C CA  . GLY A  1 311  ? 196.016 225.160 204.847 1.00 37.16  ? 311  GLY A  CA  1 
ATOM   2274  C C   . GLY A  1 311  ? 197.172 225.509 203.931 1.00 29.65  ? 311  GLY A  C   1 
ATOM   2275  O O   . GLY A  1 311  ? 197.250 226.608 203.385 1.00 32.81  ? 311  GLY A  O   1 
ATOM   2276  N N   . ILE A  1 312  ? 198.071 224.539 203.783 1.00 19.97  ? 312  ILE A  N   1 
ATOM   2277  C CA  . ILE A  1 312  ? 199.208 224.635 202.876 1.00 18.28  ? 312  ILE A  CA  1 
ATOM   2278  C C   . ILE A  1 312  ? 199.077 223.526 201.845 1.00 22.50  ? 312  ILE A  C   1 
ATOM   2279  O O   . ILE A  1 312  ? 198.913 222.354 202.203 1.00 30.84  ? 312  ILE A  O   1 
ATOM   2280  C CB  . ILE A  1 312  ? 200.550 224.543 203.625 1.00 16.89  ? 312  ILE A  CB  1 
ATOM   2281  C CG1 . ILE A  1 312  ? 201.714 224.645 202.640 1.00 21.39  ? 312  ILE A  CG1 1 
ATOM   2282  C CG2 . ILE A  1 312  ? 200.639 223.255 204.418 1.00 29.24  ? 312  ILE A  CG2 1 
ATOM   2283  C CD1 . ILE A  1 312  ? 203.055 224.829 203.302 1.00 10.75  ? 312  ILE A  CD1 1 
ATOM   2284  N N   . TYR A  1 313  ? 199.142 223.898 200.570 1.00 28.38  ? 313  TYR A  N   1 
ATOM   2285  C CA  . TYR A  1 313  ? 198.878 222.991 199.461 1.00 25.30  ? 313  TYR A  CA  1 
ATOM   2286  C C   . TYR A  1 313  ? 200.114 222.871 198.585 1.00 26.89  ? 313  TYR A  C   1 
ATOM   2287  O O   . TYR A  1 313  ? 200.690 223.883 198.173 1.00 25.69  ? 313  TYR A  O   1 
ATOM   2288  C CB  . TYR A  1 313  ? 197.695 223.487 198.633 1.00 17.00  ? 313  TYR A  CB  1 
ATOM   2289  C CG  . TYR A  1 313  ? 196.416 223.568 199.421 1.00 19.78  ? 313  TYR A  CG  1 
ATOM   2290  C CD1 . TYR A  1 313  ? 195.517 222.519 199.424 1.00 30.69  ? 313  TYR A  CD1 1 
ATOM   2291  C CD2 . TYR A  1 313  ? 196.114 224.689 200.172 1.00 24.22  ? 313  TYR A  CD2 1 
ATOM   2292  C CE1 . TYR A  1 313  ? 194.352 222.585 200.145 1.00 28.24  ? 313  TYR A  CE1 1 
ATOM   2293  C CE2 . TYR A  1 313  ? 194.949 224.764 200.897 1.00 31.09  ? 313  TYR A  CE2 1 
ATOM   2294  C CZ  . TYR A  1 313  ? 194.072 223.709 200.880 1.00 39.72  ? 313  TYR A  CZ  1 
ATOM   2295  O OH  . TYR A  1 313  ? 192.907 223.778 201.603 1.00 53.40  ? 313  TYR A  OH  1 
ATOM   2296  N N   . GLN A  1 314  ? 200.517 221.636 198.306 1.00 30.85  ? 314  GLN A  N   1 
ATOM   2297  C CA  . GLN A  1 314  ? 201.631 221.393 197.403 1.00 26.78  ? 314  GLN A  CA  1 
ATOM   2298  C C   . GLN A  1 314  ? 201.205 221.648 195.963 1.00 27.84  ? 314  GLN A  C   1 
ATOM   2299  O O   . GLN A  1 314  ? 200.077 221.339 195.571 1.00 36.64  ? 314  GLN A  O   1 
ATOM   2300  C CB  . GLN A  1 314  ? 202.125 219.957 197.554 1.00 35.09  ? 314  GLN A  CB  1 
ATOM   2301  C CG  . GLN A  1 314  ? 203.587 219.766 197.208 1.00 35.88  ? 314  GLN A  CG  1 
ATOM   2302  C CD  . GLN A  1 314  ? 204.510 220.275 198.291 1.00 37.98  ? 314  GLN A  CD  1 
ATOM   2303  O OE1 . GLN A  1 314  ? 204.071 220.590 199.398 1.00 41.06  ? 314  GLN A  OE1 1 
ATOM   2304  N NE2 . GLN A  1 314  ? 205.799 220.364 197.980 1.00 33.81  ? 314  GLN A  NE2 1 
ATOM   2305  N N   . THR A  1 315  ? 202.112 222.219 195.172 1.00 28.33  ? 315  THR A  N   1 
ATOM   2306  C CA  . THR A  1 315  ? 201.821 222.511 193.773 1.00 35.12  ? 315  THR A  CA  1 
ATOM   2307  C C   . THR A  1 315  ? 202.916 221.972 192.859 1.00 41.89  ? 315  THR A  C   1 
ATOM   2308  O O   . THR A  1 315  ? 203.810 221.249 193.309 1.00 37.27  ? 315  THR A  O   1 
ATOM   2309  C CB  . THR A  1 315  ? 201.650 224.016 193.564 1.00 41.52  ? 315  THR A  CB  1 
ATOM   2310  O OG1 . THR A  1 315  ? 202.842 224.696 193.973 1.00 37.80  ? 315  THR A  OG1 1 
ATOM   2311  C CG2 . THR A  1 315  ? 200.470 224.536 194.368 1.00 40.26  ? 315  THR A  CG2 1 
ATOM   2312  N N   . SER A  1 316  ? 202.851 222.320 191.577 1.00 47.24  ? 316  SER A  N   1 
ATOM   2313  C CA  . SER A  1 316  ? 203.822 221.832 190.610 1.00 47.67  ? 316  SER A  CA  1 
ATOM   2314  C C   . SER A  1 316  ? 205.228 222.294 190.970 1.00 54.97  ? 316  SER A  C   1 
ATOM   2315  O O   . SER A  1 316  ? 205.429 223.382 191.515 1.00 58.75  ? 316  SER A  O   1 
ATOM   2316  C CB  . SER A  1 316  ? 203.466 222.329 189.210 1.00 42.43  ? 316  SER A  CB  1 
ATOM   2317  O OG  . SER A  1 316  ? 202.106 222.075 188.906 1.00 40.07  ? 316  SER A  OG  1 
ATOM   2318  N N   . ASN A  1 317  ? 206.209 221.453 190.656 1.00 55.87  ? 317  ASN A  N   1 
ATOM   2319  C CA  . ASN A  1 317  ? 207.599 221.856 190.801 1.00 45.57  ? 317  ASN A  CA  1 
ATOM   2320  C C   . ASN A  1 317  ? 207.874 223.086 189.945 1.00 48.56  ? 317  ASN A  C   1 
ATOM   2321  O O   . ASN A  1 317  ? 207.385 223.210 188.821 1.00 56.98  ? 317  ASN A  O   1 
ATOM   2322  C CB  . ASN A  1 317  ? 208.537 220.719 190.388 1.00 54.69  ? 317  ASN A  CB  1 
ATOM   2323  C CG  . ASN A  1 317  ? 208.772 219.717 191.496 1.00 52.06  ? 317  ASN A  CG  1 
ATOM   2324  O OD1 . ASN A  1 317  ? 207.980 219.608 192.430 1.00 62.59  ? 317  ASN A  OD1 1 
ATOM   2325  N ND2 . ASN A  1 317  ? 209.868 218.974 191.395 1.00 47.42  ? 317  ASN A  ND2 1 
ATOM   2326  N N   . PHE A  1 318  ? 208.667 224.003 190.489 1.00 52.70  ? 318  PHE A  N   1 
ATOM   2327  C CA  . PHE A  1 318  ? 209.048 225.190 189.736 1.00 50.27  ? 318  PHE A  CA  1 
ATOM   2328  C C   . PHE A  1 318  ? 209.826 224.782 188.492 1.00 59.71  ? 318  PHE A  C   1 
ATOM   2329  O O   . PHE A  1 318  ? 210.752 223.969 188.566 1.00 63.51  ? 318  PHE A  O   1 
ATOM   2330  C CB  . PHE A  1 318  ? 209.888 226.114 190.614 1.00 49.06  ? 318  PHE A  CB  1 
ATOM   2331  C CG  . PHE A  1 318  ? 210.354 227.355 189.919 1.00 50.79  ? 318  PHE A  CG  1 
ATOM   2332  C CD1 . PHE A  1 318  ? 209.536 228.464 189.835 1.00 50.19  ? 318  PHE A  CD1 1 
ATOM   2333  C CD2 . PHE A  1 318  ? 211.614 227.419 189.358 1.00 55.31  ? 318  PHE A  CD2 1 
ATOM   2334  C CE1 . PHE A  1 318  ? 209.962 229.605 189.201 1.00 46.21  ? 318  PHE A  CE1 1 
ATOM   2335  C CE2 . PHE A  1 318  ? 212.044 228.559 188.724 1.00 55.92  ? 318  PHE A  CE2 1 
ATOM   2336  C CZ  . PHE A  1 318  ? 211.217 229.654 188.645 1.00 57.50  ? 318  PHE A  CZ  1 
ATOM   2337  N N   . ARG A  1 319  ? 209.456 225.351 187.344 1.00 58.44  ? 319  ARG A  N   1 
ATOM   2338  C CA  . ARG A  1 319  ? 210.049 224.937 186.076 1.00 59.53  ? 319  ARG A  CA  1 
ATOM   2339  C C   . ARG A  1 319  ? 210.147 226.119 185.126 1.00 53.49  ? 319  ARG A  C   1 
ATOM   2340  O O   . ARG A  1 319  ? 209.134 226.738 184.791 1.00 54.92  ? 319  ARG A  O   1 
ATOM   2341  C CB  . ARG A  1 319  ? 209.243 223.800 185.444 1.00 66.05  ? 319  ARG A  CB  1 
ATOM   2342  C CG  . ARG A  1 319  ? 207.741 224.024 185.364 1.00 73.23  ? 319  ARG A  CG  1 
ATOM   2343  C CD  . ARG A  1 319  ? 207.058 222.733 184.940 1.00 70.79  ? 319  ARG A  CD  1 
ATOM   2344  N NE  . ARG A  1 319  ? 205.603 222.829 184.891 1.00 76.16  ? 319  ARG A  NE  1 
ATOM   2345  C CZ  . ARG A  1 319  ? 204.803 221.809 184.596 1.00 93.02  ? 319  ARG A  CZ  1 
ATOM   2346  N NH1 . ARG A  1 319  ? 203.488 221.978 184.570 1.00 96.58  ? 319  ARG A  NH1 1 
ATOM   2347  N NH2 . ARG A  1 319  ? 205.316 220.615 184.327 1.00 98.91  ? 319  ARG A  NH2 1 
ATOM   2348  N N   . VAL A  1 320  ? 211.376 226.431 184.709 1.00 45.34  ? 320  VAL A  N   1 
ATOM   2349  C CA  . VAL A  1 320  ? 211.603 227.471 183.717 1.00 49.62  ? 320  VAL A  CA  1 
ATOM   2350  C C   . VAL A  1 320  ? 211.250 226.952 182.330 1.00 53.58  ? 320  VAL A  C   1 
ATOM   2351  O O   . VAL A  1 320  ? 211.499 225.785 181.997 1.00 50.91  ? 320  VAL A  O   1 
ATOM   2352  C CB  . VAL A  1 320  ? 213.062 227.953 183.767 1.00 45.85  ? 320  VAL A  CB  1 
ATOM   2353  C CG1 . VAL A  1 320  ? 213.377 228.810 182.552 1.00 48.06  ? 320  VAL A  CG1 1 
ATOM   2354  C CG2 . VAL A  1 320  ? 213.312 228.730 185.042 1.00 43.31  ? 320  VAL A  CG2 1 
ATOM   2355  N N   . GLN A  1 321  ? 210.660 227.820 181.516 1.00 53.91  ? 321  GLN A  N   1 
ATOM   2356  C CA  . GLN A  1 321  ? 210.394 227.500 180.125 1.00 52.87  ? 321  GLN A  CA  1 
ATOM   2357  C C   . GLN A  1 321  ? 211.636 227.748 179.270 1.00 49.35  ? 321  GLN A  C   1 
ATOM   2358  O O   . GLN A  1 321  ? 212.469 228.594 179.605 1.00 53.16  ? 321  GLN A  O   1 
ATOM   2359  C CB  . GLN A  1 321  ? 209.238 228.341 179.603 1.00 53.23  ? 321  GLN A  CB  1 
ATOM   2360  C CG  . GLN A  1 321  ? 207.954 228.158 180.381 1.00 58.42  ? 321  GLN A  CG  1 
ATOM   2361  C CD  . GLN A  1 321  ? 207.491 226.721 180.395 1.00 53.29  ? 321  GLN A  CD  1 
ATOM   2362  O OE1 . GLN A  1 321  ? 207.685 225.985 179.428 1.00 48.04  ? 321  GLN A  OE1 1 
ATOM   2363  N NE2 . GLN A  1 321  ? 206.882 226.305 181.499 1.00 59.59  ? 321  GLN A  NE2 1 
ATOM   2364  N N   . PRO A  1 322  ? 211.780 227.029 178.157 1.00 46.63  ? 322  PRO A  N   1 
ATOM   2365  C CA  . PRO A  1 322  ? 212.955 227.234 177.301 1.00 50.24  ? 322  PRO A  CA  1 
ATOM   2366  C C   . PRO A  1 322  ? 212.978 228.632 176.701 1.00 57.36  ? 322  PRO A  C   1 
ATOM   2367  O O   . PRO A  1 322  ? 211.946 229.175 176.302 1.00 56.55  ? 322  PRO A  O   1 
ATOM   2368  C CB  . PRO A  1 322  ? 212.796 226.164 176.217 1.00 53.25  ? 322  PRO A  CB  1 
ATOM   2369  C CG  . PRO A  1 322  ? 211.336 225.889 176.174 1.00 59.41  ? 322  PRO A  CG  1 
ATOM   2370  C CD  . PRO A  1 322  ? 210.842 226.052 177.579 1.00 56.27  ? 322  PRO A  CD  1 
ATOM   2371  N N   . THR A  1 323  ? 214.177 229.214 176.643 1.00 61.81  ? 323  THR A  N   1 
ATOM   2372  C CA  . THR A  1 323  ? 214.326 230.546 176.066 1.00 56.45  ? 323  THR A  CA  1 
ATOM   2373  C C   . THR A  1 323  ? 214.331 230.504 174.542 1.00 58.52  ? 323  THR A  C   1 
ATOM   2374  O O   . THR A  1 323  ? 213.675 231.329 173.897 1.00 63.58  ? 323  THR A  O   1 
ATOM   2375  C CB  . THR A  1 323  ? 215.610 231.201 176.574 1.00 57.22  ? 323  THR A  CB  1 
ATOM   2376  O OG1 . THR A  1 323  ? 216.743 230.445 176.129 1.00 55.26  ? 323  THR A  OG1 1 
ATOM   2377  C CG2 . THR A  1 323  ? 215.612 231.270 178.094 1.00 59.44  ? 323  THR A  CG2 1 
ATOM   2378  N N   . GLU A  1 324  ? 215.057 229.556 173.951 1.00 60.53  ? 324  GLU A  N   1 
ATOM   2379  C CA  . GLU A  1 324  ? 215.149 229.456 172.503 1.00 56.35  ? 324  GLU A  CA  1 
ATOM   2380  C C   . GLU A  1 324  ? 215.464 228.018 172.117 1.00 56.18  ? 324  GLU A  C   1 
ATOM   2381  O O   . GLU A  1 324  ? 215.906 227.212 172.939 1.00 61.50  ? 324  GLU A  O   1 
ATOM   2382  C CB  . GLU A  1 324  ? 216.217 230.403 171.944 1.00 60.61  ? 324  GLU A  CB  1 
ATOM   2383  C CG  . GLU A  1 324  ? 217.638 230.091 172.402 1.00 64.30  ? 324  GLU A  CG  1 
ATOM   2384  C CD  . GLU A  1 324  ? 218.682 230.864 171.622 1.00 75.18  ? 324  GLU A  CD  1 
ATOM   2385  O OE1 . GLU A  1 324  ? 219.576 230.223 171.031 1.00 72.16  ? 324  GLU A  OE1 1 
ATOM   2386  O OE2 . GLU A  1 324  ? 218.605 232.110 171.592 1.00 86.33  ? 324  GLU A  OE2 1 
ATOM   2387  N N   . SER A  1 325  ? 215.228 227.704 170.846 1.00 54.10  ? 325  SER A  N   1 
ATOM   2388  C CA  . SER A  1 325  ? 215.618 226.416 170.295 1.00 52.41  ? 325  SER A  CA  1 
ATOM   2389  C C   . SER A  1 325  ? 217.078 226.445 169.859 1.00 49.51  ? 325  SER A  C   1 
ATOM   2390  O O   . SER A  1 325  ? 217.613 227.489 169.475 1.00 51.10  ? 325  SER A  O   1 
ATOM   2391  C CB  . SER A  1 325  ? 214.730 226.050 169.106 1.00 53.53  ? 325  SER A  CB  1 
ATOM   2392  O OG  . SER A  1 325  ? 213.366 225.996 169.484 1.00 47.61  ? 325  SER A  OG  1 
ATOM   2393  N N   . ILE A  1 326  ? 217.726 225.285 169.935 1.00 45.49  ? 326  ILE A  N   1 
ATOM   2394  C CA  . ILE A  1 326  ? 219.088 225.105 169.450 1.00 44.23  ? 326  ILE A  CA  1 
ATOM   2395  C C   . ILE A  1 326  ? 219.151 223.792 168.679 1.00 49.03  ? 326  ILE A  C   1 
ATOM   2396  O O   . ILE A  1 326  ? 218.631 222.768 169.136 1.00 52.11  ? 326  ILE A  O   1 
ATOM   2397  C CB  . ILE A  1 326  ? 220.114 225.126 170.606 1.00 33.76  ? 326  ILE A  CB  1 
ATOM   2398  C CG1 . ILE A  1 326  ? 221.528 224.901 170.082 1.00 37.84  ? 326  ILE A  CG1 1 
ATOM   2399  C CG2 . ILE A  1 326  ? 219.800 224.065 171.633 1.00 42.47  ? 326  ILE A  CG2 1 
ATOM   2400  C CD1 . ILE A  1 326  ? 222.601 225.167 171.107 1.00 43.47  ? 326  ILE A  CD1 1 
ATOM   2401  N N   . VAL A  1 327  ? 219.782 223.825 167.506 1.00 51.00  ? 327  VAL A  N   1 
ATOM   2402  C CA  . VAL A  1 327  ? 219.893 222.667 166.625 1.00 41.01  ? 327  VAL A  CA  1 
ATOM   2403  C C   . VAL A  1 327  ? 221.359 222.470 166.270 1.00 40.88  ? 327  VAL A  C   1 
ATOM   2404  O O   . VAL A  1 327  ? 222.040 223.424 165.876 1.00 45.94  ? 327  VAL A  O   1 
ATOM   2405  C CB  . VAL A  1 327  ? 219.047 222.836 165.349 1.00 38.92  ? 327  VAL A  CB  1 
ATOM   2406  C CG1 . VAL A  1 327  ? 219.213 221.636 164.433 1.00 39.93  ? 327  VAL A  CG1 1 
ATOM   2407  C CG2 . VAL A  1 327  ? 217.586 223.033 165.704 1.00 42.62  ? 327  VAL A  CG2 1 
ATOM   2408  N N   . ARG A  1 328  ? 221.844 221.237 166.409 1.00 47.54  ? 328  ARG A  N   1 
ATOM   2409  C CA  . ARG A  1 328  ? 223.246 220.906 166.170 1.00 55.74  ? 328  ARG A  CA  1 
ATOM   2410  C C   . ARG A  1 328  ? 223.314 219.625 165.353 1.00 55.96  ? 328  ARG A  C   1 
ATOM   2411  O O   . ARG A  1 328  ? 223.057 218.535 165.875 1.00 55.61  ? 328  ARG A  O   1 
ATOM   2412  C CB  . ARG A  1 328  ? 224.006 220.746 167.483 1.00 54.84  ? 328  ARG A  CB  1 
ATOM   2413  C CG  . ARG A  1 328  ? 223.943 221.963 168.378 1.00 48.64  ? 328  ARG A  CG  1 
ATOM   2414  C CD  . ARG A  1 328  ? 224.689 223.128 167.776 1.00 48.50  ? 328  ARG A  CD  1 
ATOM   2415  N NE  . ARG A  1 328  ? 226.118 222.860 167.685 1.00 53.80  ? 328  ARG A  NE  1 
ATOM   2416  C CZ  . ARG A  1 328  ? 227.006 223.711 167.184 1.00 58.40  ? 328  ARG A  CZ  1 
ATOM   2417  N NH1 . ARG A  1 328  ? 226.615 224.891 166.722 1.00 51.61  ? 328  ARG A  NH1 1 
ATOM   2418  N NH2 . ARG A  1 328  ? 228.287 223.382 167.145 1.00 56.51  ? 328  ARG A  NH2 1 
ATOM   2419  N N   . PHE A  1 329  ? 223.664 219.757 164.077 1.00 53.28  ? 329  PHE A  N   1 
ATOM   2420  C CA  . PHE A  1 329  ? 223.859 218.627 163.196 1.00 49.54  ? 329  PHE A  CA  1 
ATOM   2421  C C   . PHE A  1 329  ? 225.313 218.572 162.750 1.00 56.34  ? 329  PHE A  C   1 
ATOM   2422  O O   . PHE A  1 329  ? 225.950 219.618 162.603 1.00 67.33  ? 329  PHE A  O   1 
ATOM   2423  C CB  . PHE A  1 329  ? 222.951 218.729 161.963 1.00 54.84  ? 329  PHE A  CB  1 
ATOM   2424  C CG  . PHE A  1 329  ? 221.549 218.238 162.190 1.00 55.01  ? 329  PHE A  CG  1 
ATOM   2425  C CD1 . PHE A  1 329  ? 220.907 218.458 163.394 1.00 50.36  ? 329  PHE A  CD1 1 
ATOM   2426  C CD2 . PHE A  1 329  ? 220.869 217.570 161.190 1.00 58.13  ? 329  PHE A  CD2 1 
ATOM   2427  C CE1 . PHE A  1 329  ? 219.621 218.013 163.594 1.00 48.21  ? 329  PHE A  CE1 1 
ATOM   2428  C CE2 . PHE A  1 329  ? 219.582 217.125 161.388 1.00 53.86  ? 329  PHE A  CE2 1 
ATOM   2429  C CZ  . PHE A  1 329  ? 218.958 217.347 162.590 1.00 49.48  ? 329  PHE A  CZ  1 
ATOM   2430  N N   . PRO A  1 330  ? 225.872 217.384 162.548 1.00 58.45  ? 330  PRO A  N   1 
ATOM   2431  C CA  . PRO A  1 330  ? 227.202 217.294 161.936 1.00 59.63  ? 330  PRO A  CA  1 
ATOM   2432  C C   . PRO A  1 330  ? 227.213 218.049 160.620 1.00 61.01  ? 330  PRO A  C   1 
ATOM   2433  O O   . PRO A  1 330  ? 226.287 217.934 159.808 1.00 72.40  ? 330  PRO A  O   1 
ATOM   2434  C CB  . PRO A  1 330  ? 227.391 215.790 161.725 1.00 59.55  ? 330  PRO A  CB  1 
ATOM   2435  C CG  . PRO A  1 330  ? 226.500 215.147 162.721 1.00 61.49  ? 330  PRO A  CG  1 
ATOM   2436  C CD  . PRO A  1 330  ? 225.330 216.063 162.898 1.00 64.17  ? 330  PRO A  CD  1 
ATOM   2437  N N   . ASN A  1 331  ? 228.246 218.862 160.415 1.00 63.09  ? 331  ASN A  N   1 
ATOM   2438  C CA  . ASN A  1 331  ? 228.296 219.682 159.216 1.00 64.19  ? 331  ASN A  CA  1 
ATOM   2439  C C   . ASN A  1 331  ? 228.875 218.841 158.077 1.00 65.80  ? 331  ASN A  C   1 
ATOM   2440  O O   . ASN A  1 331  ? 230.072 218.560 158.024 1.00 63.78  ? 331  ASN A  O   1 
ATOM   2441  C CB  . ASN A  1 331  ? 229.041 220.992 159.472 1.00 64.52  ? 331  ASN A  CB  1 
ATOM   2442  C CG  . ASN A  1 331  ? 230.545 220.840 159.618 1.00 62.39  ? 331  ASN A  CG  1 
ATOM   2443  O OD1 . ASN A  1 331  ? 231.288 221.055 158.659 1.00 74.03  ? 331  ASN A  OD1 1 
ATOM   2444  N ND2 . ASN A  1 331  ? 231.010 220.484 160.804 1.00 61.22  ? 331  ASN A  ND2 1 
ATOM   2445  N N   . ILE A  1 332  ? 228.012 218.464 157.143 1.00 64.21  ? 332  ILE A  N   1 
ATOM   2446  C CA  . ILE A  1 332  ? 228.397 217.829 155.889 1.00 60.18  ? 332  ILE A  CA  1 
ATOM   2447  C C   . ILE A  1 332  ? 227.713 218.607 154.788 1.00 64.06  ? 332  ILE A  C   1 
ATOM   2448  O O   . ILE A  1 332  ? 226.515 218.879 154.893 1.00 65.95  ? 332  ILE A  O   1 
ATOM   2449  C CB  . ILE A  1 332  ? 228.000 216.340 155.835 1.00 56.64  ? 332  ILE A  CB  1 
ATOM   2450  C CG1 . ILE A  1 332  ? 228.844 215.520 156.807 1.00 58.27  ? 332  ILE A  CG1 1 
ATOM   2451  C CG2 . ILE A  1 332  ? 228.131 215.818 154.430 1.00 60.34  ? 332  ILE A  CG2 1 
ATOM   2452  C CD1 . ILE A  1 332  ? 228.126 215.145 158.080 1.00 69.68  ? 332  ILE A  CD1 1 
ATOM   2453  N N   . THR A  1 333  ? 228.478 218.995 153.764 1.00 61.41  ? 333  THR A  N   1 
ATOM   2454  C CA  . THR A  1 333  ? 227.976 219.878 152.718 1.00 59.81  ? 333  THR A  CA  1 
ATOM   2455  C C   . THR A  1 333  ? 227.475 219.147 151.474 1.00 59.92  ? 333  THR A  C   1 
ATOM   2456  O O   . THR A  1 333  ? 226.579 219.653 150.785 1.00 58.67  ? 333  THR A  O   1 
ATOM   2457  C CB  . THR A  1 333  ? 229.074 220.868 152.307 1.00 66.91  ? 333  THR A  CB  1 
ATOM   2458  O OG1 . THR A  1 333  ? 230.188 220.146 151.763 1.00 61.92  ? 333  THR A  OG1 1 
ATOM   2459  C CG2 . THR A  1 333  ? 229.560 221.656 153.517 1.00 58.25  ? 333  THR A  CG2 1 
ATOM   2460  N N   . ASN A  1 334  ? 228.054 218.000 151.144 1.00 65.80  ? 334  ASN A  N   1 
ATOM   2461  C CA  . ASN A  1 334  ? 227.674 217.277 149.938 1.00 61.34  ? 334  ASN A  CA  1 
ATOM   2462  C C   . ASN A  1 334  ? 226.412 216.455 150.173 1.00 58.42  ? 334  ASN A  C   1 
ATOM   2463  O O   . ASN A  1 334  ? 226.219 215.885 151.248 1.00 58.39  ? 334  ASN A  O   1 
ATOM   2464  C CB  . ASN A  1 334  ? 228.815 216.368 149.482 1.00 53.29  ? 334  ASN A  CB  1 
ATOM   2465  C CG  . ASN A  1 334  ? 229.371 215.529 150.610 1.00 56.96  ? 334  ASN A  CG  1 
ATOM   2466  O OD1 . ASN A  1 334  ? 230.203 215.988 151.389 1.00 59.99  ? 334  ASN A  OD1 1 
ATOM   2467  N ND2 . ASN A  1 334  ? 228.920 214.286 150.698 1.00 62.37  ? 334  ASN A  ND2 1 
ATOM   2468  N N   . LEU A  1 335  ? 225.556 216.396 149.155 1.00 62.73  ? 335  LEU A  N   1 
ATOM   2469  C CA  . LEU A  1 335  ? 224.282 215.706 149.261 1.00 53.04  ? 335  LEU A  CA  1 
ATOM   2470  C C   . LEU A  1 335  ? 224.454 214.218 148.978 1.00 53.69  ? 335  LEU A  C   1 
ATOM   2471  O O   . LEU A  1 335  ? 225.428 213.782 148.360 1.00 51.10  ? 335  LEU A  O   1 
ATOM   2472  C CB  . LEU A  1 335  ? 223.265 216.322 148.298 1.00 51.10  ? 335  LEU A  CB  1 
ATOM   2473  C CG  . LEU A  1 335  ? 221.783 216.005 148.507 1.00 56.87  ? 335  LEU A  CG  1 
ATOM   2474  C CD1 . LEU A  1 335  ? 221.275 216.547 149.827 1.00 63.80  ? 335  LEU A  CD1 1 
ATOM   2475  C CD2 . LEU A  1 335  ? 220.960 216.578 147.371 1.00 48.54  ? 335  LEU A  CD2 1 
ATOM   2476  N N   . CYS A  1 336  ? 223.476 213.439 149.436 1.00 61.38  ? 336  CYS A  N   1 
ATOM   2477  C CA  . CYS A  1 336  ? 223.570 211.993 149.350 1.00 56.15  ? 336  CYS A  CA  1 
ATOM   2478  C C   . CYS A  1 336  ? 223.451 211.521 147.904 1.00 51.99  ? 336  CYS A  C   1 
ATOM   2479  O O   . CYS A  1 336  ? 222.843 212.192 147.065 1.00 47.31  ? 336  CYS A  O   1 
ATOM   2480  C CB  . CYS A  1 336  ? 222.493 211.338 150.207 1.00 53.54  ? 336  CYS A  CB  1 
ATOM   2481  S SG  . CYS A  1 336  ? 222.741 211.598 151.977 1.00 70.93  ? 336  CYS A  SG  1 
ATOM   2482  N N   . PRO A  1 337  ? 224.022 210.359 147.591 1.00 52.91  ? 337  PRO A  N   1 
ATOM   2483  C CA  . PRO A  1 337  ? 223.990 209.873 146.208 1.00 49.19  ? 337  PRO A  CA  1 
ATOM   2484  C C   . PRO A  1 337  ? 222.610 209.392 145.791 1.00 51.74  ? 337  PRO A  C   1 
ATOM   2485  O O   . PRO A  1 337  ? 222.422 208.219 145.455 1.00 59.42  ? 337  PRO A  O   1 
ATOM   2486  C CB  . PRO A  1 337  ? 225.013 208.730 146.225 1.00 49.71  ? 337  PRO A  CB  1 
ATOM   2487  C CG  . PRO A  1 337  ? 224.980 208.229 147.626 1.00 50.90  ? 337  PRO A  CG  1 
ATOM   2488  C CD  . PRO A  1 337  ? 224.742 209.433 148.485 1.00 60.03  ? 337  PRO A  CD  1 
ATOM   2489  N N   . PHE A  1 338  ? 221.632 210.301 145.805 1.00 48.85  ? 338  PHE A  N   1 
ATOM   2490  C CA  . PHE A  1 338  ? 220.282 209.930 145.399 1.00 46.48  ? 338  PHE A  CA  1 
ATOM   2491  C C   . PHE A  1 338  ? 220.247 209.513 143.936 1.00 49.02  ? 338  PHE A  C   1 
ATOM   2492  O O   . PHE A  1 338  ? 219.544 208.565 143.571 1.00 54.02  ? 338  PHE A  O   1 
ATOM   2493  C CB  . PHE A  1 338  ? 219.319 211.093 145.637 1.00 49.68  ? 338  PHE A  CB  1 
ATOM   2494  C CG  . PHE A  1 338  ? 219.013 211.348 147.085 1.00 47.30  ? 338  PHE A  CG  1 
ATOM   2495  C CD1 . PHE A  1 338  ? 218.249 210.457 147.817 1.00 45.70  ? 338  PHE A  CD1 1 
ATOM   2496  C CD2 . PHE A  1 338  ? 219.477 212.490 147.710 1.00 51.98  ? 338  PHE A  CD2 1 
ATOM   2497  C CE1 . PHE A  1 338  ? 217.965 210.697 149.145 1.00 53.42  ? 338  PHE A  CE1 1 
ATOM   2498  C CE2 . PHE A  1 338  ? 219.195 212.733 149.037 1.00 56.79  ? 338  PHE A  CE2 1 
ATOM   2499  C CZ  . PHE A  1 338  ? 218.438 211.835 149.755 1.00 55.93  ? 338  PHE A  CZ  1 
ATOM   2500  N N   . GLY A  1 339  ? 220.997 210.212 143.084 1.00 54.53  ? 339  GLY A  N   1 
ATOM   2501  C CA  . GLY A  1 339  ? 221.017 209.861 141.674 1.00 58.29  ? 339  GLY A  CA  1 
ATOM   2502  C C   . GLY A  1 339  ? 221.653 208.509 141.416 1.00 56.60  ? 339  GLY A  C   1 
ATOM   2503  O O   . GLY A  1 339  ? 221.212 207.763 140.540 1.00 59.86  ? 339  GLY A  O   1 
ATOM   2504  N N   . GLU A  1 340  ? 222.700 208.175 142.168 1.00 59.11  ? 340  GLU A  N   1 
ATOM   2505  C CA  . GLU A  1 340  ? 223.364 206.896 141.961 1.00 61.55  ? 340  GLU A  CA  1 
ATOM   2506  C C   . GLU A  1 340  ? 222.567 205.744 142.556 1.00 60.52  ? 340  GLU A  C   1 
ATOM   2507  O O   . GLU A  1 340  ? 222.730 204.598 142.126 1.00 61.05  ? 340  GLU A  O   1 
ATOM   2508  C CB  . GLU A  1 340  ? 224.772 206.940 142.554 1.00 57.21  ? 340  GLU A  CB  1 
ATOM   2509  C CG  . GLU A  1 340  ? 225.533 208.211 142.205 1.00 59.47  ? 340  GLU A  CG  1 
ATOM   2510  C CD  . GLU A  1 340  ? 227.012 208.109 142.507 1.00 71.29  ? 340  GLU A  CD  1 
ATOM   2511  O OE1 . GLU A  1 340  ? 227.402 207.208 143.279 1.00 69.97  ? 340  GLU A  OE1 1 
ATOM   2512  O OE2 . GLU A  1 340  ? 227.787 208.927 141.966 1.00 75.14  ? 340  GLU A  OE2 1 
ATOM   2513  N N   . VAL A  1 341  ? 221.709 206.022 143.535 1.00 54.54  ? 341  VAL A  N   1 
ATOM   2514  C CA  . VAL A  1 341  ? 220.870 204.977 144.116 1.00 50.66  ? 341  VAL A  CA  1 
ATOM   2515  C C   . VAL A  1 341  ? 219.636 204.733 143.254 1.00 55.96  ? 341  VAL A  C   1 
ATOM   2516  O O   . VAL A  1 341  ? 219.373 203.605 142.822 1.00 47.56  ? 341  VAL A  O   1 
ATOM   2517  C CB  . VAL A  1 341  ? 220.478 205.344 145.559 1.00 54.30  ? 341  VAL A  CB  1 
ATOM   2518  C CG1 . VAL A  1 341  ? 219.417 204.387 146.085 1.00 53.93  ? 341  VAL A  CG1 1 
ATOM   2519  C CG2 . VAL A  1 341  ? 221.698 205.324 146.458 1.00 53.00  ? 341  VAL A  CG2 1 
ATOM   2520  N N   . PHE A  1 342  ? 218.862 205.787 142.994 1.00 57.14  ? 342  PHE A  N   1 
ATOM   2521  C CA  . PHE A  1 342  ? 217.534 205.665 142.408 1.00 50.13  ? 342  PHE A  CA  1 
ATOM   2522  C C   . PHE A  1 342  ? 217.526 205.864 140.896 1.00 53.27  ? 342  PHE A  C   1 
ATOM   2523  O O   . PHE A  1 342  ? 216.447 205.966 140.301 1.00 67.02  ? 342  PHE A  O   1 
ATOM   2524  C CB  . PHE A  1 342  ? 216.585 206.676 143.057 1.00 45.58  ? 342  PHE A  CB  1 
ATOM   2525  C CG  . PHE A  1 342  ? 216.397 206.481 144.534 1.00 49.12  ? 342  PHE A  CG  1 
ATOM   2526  C CD1 . PHE A  1 342  ? 215.556 205.495 145.013 1.00 47.24  ? 342  PHE A  CD1 1 
ATOM   2527  C CD2 . PHE A  1 342  ? 217.044 207.299 145.442 1.00 51.99  ? 342  PHE A  CD2 1 
ATOM   2528  C CE1 . PHE A  1 342  ? 215.375 205.321 146.368 1.00 32.47  ? 342  PHE A  CE1 1 
ATOM   2529  C CE2 . PHE A  1 342  ? 216.864 207.127 146.799 1.00 46.74  ? 342  PHE A  CE2 1 
ATOM   2530  C CZ  . PHE A  1 342  ? 216.029 206.138 147.261 1.00 28.35  ? 342  PHE A  CZ  1 
ATOM   2531  N N   . ASN A  1 343  ? 218.695 205.924 140.260 1.00 52.33  ? 343  ASN A  N   1 
ATOM   2532  C CA  . ASN A  1 343  ? 218.755 206.205 138.831 1.00 58.14  ? 343  ASN A  CA  1 
ATOM   2533  C C   . ASN A  1 343  ? 219.765 205.322 138.107 1.00 55.33  ? 343  ASN A  C   1 
ATOM   2534  O O   . ASN A  1 343  ? 219.933 205.446 136.890 1.00 59.77  ? 343  ASN A  O   1 
ATOM   2535  C CB  . ASN A  1 343  ? 219.095 207.680 138.608 1.00 65.27  ? 343  ASN A  CB  1 
ATOM   2536  C CG  . ASN A  1 343  ? 217.965 208.457 137.965 1.00 70.81  ? 343  ASN A  CG  1 
ATOM   2537  O OD1 . ASN A  1 343  ? 216.813 208.020 137.945 1.00 63.25  ? 343  ASN A  OD1 1 
ATOM   2538  N ND2 . ASN A  1 343  ? 218.298 209.628 137.436 1.00 74.49  ? 343  ASN A  ND2 1 
ATOM   2539  N N   . ALA A  1 344  ? 220.444 204.438 138.835 1.00 56.04  ? 344  ALA A  N   1 
ATOM   2540  C CA  . ALA A  1 344  ? 221.475 203.600 138.234 1.00 56.59  ? 344  ALA A  CA  1 
ATOM   2541  C C   . ALA A  1 344  ? 220.933 202.874 137.013 1.00 63.84  ? 344  ALA A  C   1 
ATOM   2542  O O   . ALA A  1 344  ? 219.851 202.284 137.055 1.00 58.98  ? 344  ALA A  O   1 
ATOM   2543  C CB  . ALA A  1 344  ? 221.998 202.596 139.260 1.00 59.17  ? 344  ALA A  CB  1 
ATOM   2544  N N   . THR A  1 345  ? 221.686 202.941 135.917 1.00 72.49  ? 345  THR A  N   1 
ATOM   2545  C CA  . THR A  1 345  ? 221.265 202.368 134.646 1.00 65.57  ? 345  THR A  CA  1 
ATOM   2546  C C   . THR A  1 345  ? 220.876 200.901 134.775 1.00 58.83  ? 345  THR A  C   1 
ATOM   2547  O O   . THR A  1 345  ? 219.935 200.446 134.115 1.00 59.99  ? 345  THR A  O   1 
ATOM   2548  C CB  . THR A  1 345  ? 222.378 202.525 133.607 1.00 77.83  ? 345  THR A  CB  1 
ATOM   2549  O OG1 . THR A  1 345  ? 222.619 203.917 133.370 1.00 74.62  ? 345  THR A  OG1 1 
ATOM   2550  C CG2 . THR A  1 345  ? 221.994 201.849 132.300 1.00 72.34  ? 345  THR A  CG2 1 
ATOM   2551  N N   . ARG A  1 346  ? 221.590 200.150 135.612 1.00 60.17  ? 346  ARG A  N   1 
ATOM   2552  C CA  . ARG A  1 346  ? 221.377 198.709 135.739 1.00 64.62  ? 346  ARG A  CA  1 
ATOM   2553  C C   . ARG A  1 346  ? 221.362 198.346 137.217 1.00 60.62  ? 346  ARG A  C   1 
ATOM   2554  O O   . ARG A  1 346  ? 222.364 198.537 137.914 1.00 59.17  ? 346  ARG A  O   1 
ATOM   2555  C CB  . ARG A  1 346  ? 222.462 197.924 135.001 1.00 62.99  ? 346  ARG A  CB  1 
ATOM   2556  C CG  . ARG A  1 346  ? 222.252 196.420 135.025 1.00 59.45  ? 346  ARG A  CG  1 
ATOM   2557  C CD  . ARG A  1 346  ? 223.270 195.699 134.164 1.00 70.09  ? 346  ARG A  CD  1 
ATOM   2558  N NE  . ARG A  1 346  ? 223.105 194.250 134.230 1.00 68.81  ? 346  ARG A  NE  1 
ATOM   2559  C CZ  . ARG A  1 346  ? 223.874 193.378 133.585 1.00 73.41  ? 346  ARG A  CZ  1 
ATOM   2560  N NH1 . ARG A  1 346  ? 224.869 193.804 132.818 1.00 80.92  ? 346  ARG A  NH1 1 
ATOM   2561  N NH2 . ARG A  1 346  ? 223.648 192.077 133.707 1.00 81.20  ? 346  ARG A  NH2 1 
ATOM   2562  N N   . PHE A  1 347  ? 220.230 197.836 137.695 1.00 53.03  ? 347  PHE A  N   1 
ATOM   2563  C CA  . PHE A  1 347  ? 220.142 197.322 139.052 1.00 46.76  ? 347  PHE A  CA  1 
ATOM   2564  C C   . PHE A  1 347  ? 220.622 195.875 139.115 1.00 49.13  ? 347  PHE A  C   1 
ATOM   2565  O O   . PHE A  1 347  ? 220.769 195.191 138.099 1.00 57.98  ? 347  PHE A  O   1 
ATOM   2566  C CB  . PHE A  1 347  ? 218.709 197.412 139.578 1.00 37.02  ? 347  PHE A  CB  1 
ATOM   2567  C CG  . PHE A  1 347  ? 218.412 198.682 140.323 1.00 40.40  ? 347  PHE A  CG  1 
ATOM   2568  C CD1 . PHE A  1 347  ? 219.087 199.855 140.036 1.00 46.42  ? 347  PHE A  CD1 1 
ATOM   2569  C CD2 . PHE A  1 347  ? 217.460 198.696 141.324 1.00 40.37  ? 347  PHE A  CD2 1 
ATOM   2570  C CE1 . PHE A  1 347  ? 218.810 201.014 140.727 1.00 40.30  ? 347  PHE A  CE1 1 
ATOM   2571  C CE2 . PHE A  1 347  ? 217.182 199.851 142.017 1.00 39.34  ? 347  PHE A  CE2 1 
ATOM   2572  C CZ  . PHE A  1 347  ? 217.857 201.011 141.719 1.00 36.80  ? 347  PHE A  CZ  1 
ATOM   2573  N N   . ALA A  1 348  ? 220.874 195.417 140.336 1.00 39.29  ? 348  ALA A  N   1 
ATOM   2574  C CA  . ALA A  1 348  ? 221.328 194.055 140.566 1.00 39.40  ? 348  ALA A  CA  1 
ATOM   2575  C C   . ALA A  1 348  ? 220.155 193.084 140.591 1.00 42.04  ? 348  ALA A  C   1 
ATOM   2576  O O   . ALA A  1 348  ? 219.016 193.458 140.883 1.00 46.50  ? 348  ALA A  O   1 
ATOM   2577  C CB  . ALA A  1 348  ? 222.094 193.963 141.883 1.00 42.72  ? 348  ALA A  CB  1 
ATOM   2578  N N   . SER A  1 349  ? 220.443 191.824 140.275 1.00 46.30  ? 349  SER A  N   1 
ATOM   2579  C CA  . SER A  1 349  ? 219.451 190.774 140.444 1.00 42.05  ? 349  SER A  CA  1 
ATOM   2580  C C   . SER A  1 349  ? 219.156 190.575 141.925 1.00 41.00  ? 349  SER A  C   1 
ATOM   2581  O O   . SER A  1 349  ? 220.003 190.818 142.788 1.00 46.56  ? 349  SER A  O   1 
ATOM   2582  C CB  . SER A  1 349  ? 219.944 189.467 139.823 1.00 43.44  ? 349  SER A  CB  1 
ATOM   2583  O OG  . SER A  1 349  ? 220.169 189.614 138.432 1.00 50.44  ? 349  SER A  OG  1 
ATOM   2584  N N   . VAL A  1 350  ? 217.939 190.119 142.220 1.00 42.31  ? 350  VAL A  N   1 
ATOM   2585  C CA  . VAL A  1 350  ? 217.525 190.030 143.616 1.00 36.98  ? 350  VAL A  CA  1 
ATOM   2586  C C   . VAL A  1 350  ? 218.338 188.986 144.372 1.00 41.62  ? 350  VAL A  C   1 
ATOM   2587  O O   . VAL A  1 350  ? 218.633 189.170 145.556 1.00 39.88  ? 350  VAL A  O   1 
ATOM   2588  C CB  . VAL A  1 350  ? 216.015 189.746 143.716 1.00 37.11  ? 350  VAL A  CB  1 
ATOM   2589  C CG1 . VAL A  1 350  ? 215.634 188.511 142.917 1.00 43.99  ? 350  VAL A  CG1 1 
ATOM   2590  C CG2 . VAL A  1 350  ? 215.602 189.592 145.170 1.00 33.17  ? 350  VAL A  CG2 1 
ATOM   2591  N N   . TYR A  1 351  ? 218.711 187.883 143.722 1.00 47.68  ? 351  TYR A  N   1 
ATOM   2592  C CA  . TYR A  1 351  ? 219.529 186.884 144.401 1.00 45.06  ? 351  TYR A  CA  1 
ATOM   2593  C C   . TYR A  1 351  ? 220.925 187.425 144.687 1.00 45.99  ? 351  TYR A  C   1 
ATOM   2594  O O   . TYR A  1 351  ? 221.539 187.072 145.700 1.00 42.60  ? 351  TYR A  O   1 
ATOM   2595  C CB  . TYR A  1 351  ? 219.591 185.603 143.569 1.00 38.79  ? 351  TYR A  CB  1 
ATOM   2596  C CG  . TYR A  1 351  ? 220.746 185.526 142.599 1.00 45.14  ? 351  TYR A  CG  1 
ATOM   2597  C CD1 . TYR A  1 351  ? 220.642 186.052 141.321 1.00 43.42  ? 351  TYR A  CD1 1 
ATOM   2598  C CD2 . TYR A  1 351  ? 221.935 184.909 142.959 1.00 49.83  ? 351  TYR A  CD2 1 
ATOM   2599  C CE1 . TYR A  1 351  ? 221.696 185.976 140.433 1.00 49.59  ? 351  TYR A  CE1 1 
ATOM   2600  C CE2 . TYR A  1 351  ? 222.992 184.829 142.078 1.00 58.03  ? 351  TYR A  CE2 1 
ATOM   2601  C CZ  . TYR A  1 351  ? 222.868 185.363 140.817 1.00 60.15  ? 351  TYR A  CZ  1 
ATOM   2602  O OH  . TYR A  1 351  ? 223.922 185.283 139.936 1.00 53.80  ? 351  TYR A  OH  1 
ATOM   2603  N N   . ALA A  1 352  ? 221.445 188.278 143.803 1.00 42.65  ? 352  ALA A  N   1 
ATOM   2604  C CA  . ALA A  1 352  ? 222.740 188.923 143.984 1.00 37.03  ? 352  ALA A  CA  1 
ATOM   2605  C C   . ALA A  1 352  ? 222.600 190.378 144.416 1.00 47.83  ? 352  ALA A  C   1 
ATOM   2606  O O   . ALA A  1 352  ? 223.383 191.230 143.986 1.00 54.98  ? 352  ALA A  O   1 
ATOM   2607  C CB  . ALA A  1 352  ? 223.558 188.833 142.697 1.00 41.37  ? 352  ALA A  CB  1 
ATOM   2608  N N   . TRP A  1 353  ? 221.620 190.673 145.269 1.00 47.09  ? 353  TRP A  N   1 
ATOM   2609  C CA  . TRP A  1 353  ? 221.266 192.054 145.573 1.00 37.29  ? 353  TRP A  CA  1 
ATOM   2610  C C   . TRP A  1 353  ? 222.473 192.844 146.065 1.00 42.06  ? 353  TRP A  C   1 
ATOM   2611  O O   . TRP A  1 353  ? 223.303 192.341 146.826 1.00 53.08  ? 353  TRP A  O   1 
ATOM   2612  C CB  . TRP A  1 353  ? 220.148 192.098 146.617 1.00 30.79  ? 353  TRP A  CB  1 
ATOM   2613  C CG  . TRP A  1 353  ? 220.422 191.320 147.863 1.00 30.35  ? 353  TRP A  CG  1 
ATOM   2614  C CD1 . TRP A  1 353  ? 220.166 189.997 148.078 1.00 38.62  ? 353  TRP A  CD1 1 
ATOM   2615  C CD2 . TRP A  1 353  ? 220.986 191.819 149.081 1.00 35.19  ? 353  TRP A  CD2 1 
ATOM   2616  N NE1 . TRP A  1 353  ? 220.540 189.643 149.346 1.00 41.02  ? 353  TRP A  NE1 1 
ATOM   2617  C CE2 . TRP A  1 353  ? 221.047 190.743 149.983 1.00 39.53  ? 353  TRP A  CE2 1 
ATOM   2618  C CE3 . TRP A  1 353  ? 221.444 193.071 149.495 1.00 39.05  ? 353  TRP A  CE3 1 
ATOM   2619  C CZ2 . TRP A  1 353  ? 221.551 190.879 151.270 1.00 44.33  ? 353  TRP A  CZ2 1 
ATOM   2620  C CZ3 . TRP A  1 353  ? 221.944 193.201 150.775 1.00 31.40  ? 353  TRP A  CZ3 1 
ATOM   2621  C CH2 . TRP A  1 353  ? 221.993 192.112 151.646 1.00 34.51  ? 353  TRP A  CH2 1 
ATOM   2622  N N   . ASN A  1 354  ? 222.566 194.088 145.605 1.00 37.33  ? 354  ASN A  N   1 
ATOM   2623  C CA  . ASN A  1 354  ? 223.680 194.964 145.934 1.00 35.34  ? 354  ASN A  CA  1 
ATOM   2624  C C   . ASN A  1 354  ? 223.466 195.640 147.281 1.00 45.36  ? 354  ASN A  C   1 
ATOM   2625  O O   . ASN A  1 354  ? 222.337 195.788 147.754 1.00 49.76  ? 354  ASN A  O   1 
ATOM   2626  C CB  . ASN A  1 354  ? 223.848 196.027 144.849 1.00 41.05  ? 354  ASN A  CB  1 
ATOM   2627  C CG  . ASN A  1 354  ? 225.032 196.931 145.096 1.00 50.88  ? 354  ASN A  CG  1 
ATOM   2628  O OD1 . ASN A  1 354  ? 224.921 197.936 145.795 1.00 58.55  ? 354  ASN A  OD1 1 
ATOM   2629  N ND2 . ASN A  1 354  ? 226.176 196.584 144.519 1.00 43.94  ? 354  ASN A  ND2 1 
ATOM   2630  N N   . ARG A  1 355  ? 224.572 196.042 147.904 1.00 51.42  ? 355  ARG A  N   1 
ATOM   2631  C CA  . ARG A  1 355  ? 224.548 196.834 149.129 1.00 40.57  ? 355  ARG A  CA  1 
ATOM   2632  C C   . ARG A  1 355  ? 225.593 197.933 149.027 1.00 45.22  ? 355  ARG A  C   1 
ATOM   2633  O O   . ARG A  1 355  ? 226.775 197.650 148.809 1.00 52.35  ? 355  ARG A  O   1 
ATOM   2634  C CB  . ARG A  1 355  ? 224.806 195.968 150.362 1.00 35.78  ? 355  ARG A  CB  1 
ATOM   2635  C CG  . ARG A  1 355  ? 225.211 196.777 151.577 1.00 53.04  ? 355  ARG A  CG  1 
ATOM   2636  C CD  . ARG A  1 355  ? 224.982 196.020 152.865 1.00 46.79  ? 355  ARG A  CD  1 
ATOM   2637  N NE  . ARG A  1 355  ? 223.583 196.052 153.277 1.00 40.61  ? 355  ARG A  NE  1 
ATOM   2638  C CZ  . ARG A  1 355  ? 223.112 195.481 154.381 1.00 44.57  ? 355  ARG A  CZ  1 
ATOM   2639  N NH1 . ARG A  1 355  ? 221.823 195.569 154.672 1.00 58.38  ? 355  ARG A  NH1 1 
ATOM   2640  N NH2 . ARG A  1 355  ? 223.924 194.820 155.194 1.00 35.77  ? 355  ARG A  NH2 1 
ATOM   2641  N N   . LYS A  1 356  ? 225.157 199.179 149.185 1.00 42.95  ? 356  LYS A  N   1 
ATOM   2642  C CA  . LYS A  1 356  ? 226.018 200.347 149.089 1.00 46.43  ? 356  LYS A  CA  1 
ATOM   2643  C C   . LYS A  1 356  ? 226.016 201.107 150.408 1.00 45.03  ? 356  LYS A  C   1 
ATOM   2644  O O   . LYS A  1 356  ? 224.968 201.267 151.038 1.00 49.13  ? 356  LYS A  O   1 
ATOM   2645  C CB  . LYS A  1 356  ? 225.552 201.262 147.953 1.00 49.99  ? 356  LYS A  CB  1 
ATOM   2646  C CG  . LYS A  1 356  ? 226.275 202.589 147.863 1.00 51.35  ? 356  LYS A  CG  1 
ATOM   2647  C CD  . LYS A  1 356  ? 225.910 203.306 146.575 1.00 43.43  ? 356  LYS A  CD  1 
ATOM   2648  C CE  . LYS A  1 356  ? 226.445 204.722 146.549 1.00 44.67  ? 356  LYS A  CE  1 
ATOM   2649  N NZ  . LYS A  1 356  ? 227.930 204.760 146.653 1.00 60.55  ? 356  LYS A  NZ  1 
ATOM   2650  N N   . ARG A  1 357  ? 227.190 201.579 150.822 1.00 47.52  ? 357  ARG A  N   1 
ATOM   2651  C CA  . ARG A  1 357  ? 227.324 202.353 152.051 1.00 46.95  ? 357  ARG A  CA  1 
ATOM   2652  C C   . ARG A  1 357  ? 227.125 203.831 151.742 1.00 54.18  ? 357  ARG A  C   1 
ATOM   2653  O O   . ARG A  1 357  ? 227.804 204.386 150.872 1.00 53.65  ? 357  ARG A  O   1 
ATOM   2654  C CB  . ARG A  1 357  ? 228.690 202.129 152.700 1.00 51.64  ? 357  ARG A  CB  1 
ATOM   2655  C CG  . ARG A  1 357  ? 228.904 202.915 153.996 1.00 52.79  ? 357  ARG A  CG  1 
ATOM   2656  C CD  . ARG A  1 357  ? 227.974 202.444 155.105 1.00 55.88  ? 357  ARG A  CD  1 
ATOM   2657  N NE  . ARG A  1 357  ? 228.041 203.290 156.296 1.00 53.11  ? 357  ARG A  NE  1 
ATOM   2658  C CZ  . ARG A  1 357  ? 228.766 203.024 157.380 1.00 65.62  ? 357  ARG A  CZ  1 
ATOM   2659  N NH1 . ARG A  1 357  ? 229.506 201.925 157.457 1.00 66.46  ? 357  ARG A  NH1 1 
ATOM   2660  N NH2 . ARG A  1 357  ? 228.749 203.867 158.402 1.00 68.31  ? 357  ARG A  NH2 1 
ATOM   2661  N N   . ILE A  1 358  ? 226.201 204.462 152.459 1.00 51.61  ? 358  ILE A  N   1 
ATOM   2662  C CA  . ILE A  1 358  ? 225.922 205.888 152.335 1.00 49.13  ? 358  ILE A  CA  1 
ATOM   2663  C C   . ILE A  1 358  ? 226.457 206.569 153.587 1.00 57.39  ? 358  ILE A  C   1 
ATOM   2664  O O   . ILE A  1 358  ? 226.019 206.263 154.703 1.00 65.40  ? 358  ILE A  O   1 
ATOM   2665  C CB  . ILE A  1 358  ? 224.422 206.155 152.151 1.00 41.08  ? 358  ILE A  CB  1 
ATOM   2666  C CG1 . ILE A  1 358  ? 223.945 205.564 150.821 1.00 48.19  ? 358  ILE A  CG1 1 
ATOM   2667  C CG2 . ILE A  1 358  ? 224.136 207.645 152.217 1.00 47.74  ? 358  ILE A  CG2 1 
ATOM   2668  C CD1 . ILE A  1 358  ? 222.448 205.595 150.632 1.00 58.19  ? 358  ILE A  CD1 1 
ATOM   2669  N N   . SER A  1 359  ? 227.394 207.496 153.403 1.00 56.09  ? 359  SER A  N   1 
ATOM   2670  C CA  . SER A  1 359  ? 228.081 208.118 154.526 1.00 52.10  ? 359  SER A  CA  1 
ATOM   2671  C C   . SER A  1 359  ? 228.514 209.522 154.138 1.00 57.42  ? 359  SER A  C   1 
ATOM   2672  O O   . SER A  1 359  ? 228.761 209.796 152.962 1.00 70.80  ? 359  SER A  O   1 
ATOM   2673  C CB  . SER A  1 359  ? 229.301 207.296 154.955 1.00 55.45  ? 359  SER A  CB  1 
ATOM   2674  O OG  . SER A  1 359  ? 230.091 206.939 153.836 1.00 61.19  ? 359  SER A  OG  1 
ATOM   2675  N N   . ASN A  1 360  ? 228.602 210.400 155.134 1.00 46.79  ? 360  ASN A  N   1 
ATOM   2676  C CA  . ASN A  1 360  ? 229.024 211.784 154.946 1.00 51.96  ? 360  ASN A  CA  1 
ATOM   2677  C C   . ASN A  1 360  ? 228.240 212.444 153.811 1.00 55.32  ? 360  ASN A  C   1 
ATOM   2678  O O   . ASN A  1 360  ? 228.788 212.865 152.792 1.00 64.35  ? 360  ASN A  O   1 
ATOM   2679  C CB  . ASN A  1 360  ? 230.529 211.849 154.681 1.00 52.76  ? 360  ASN A  CB  1 
ATOM   2680  C CG  . ASN A  1 360  ? 231.351 211.546 155.914 1.00 62.66  ? 360  ASN A  CG  1 
ATOM   2681  O OD1 . ASN A  1 360  ? 232.072 210.549 155.967 1.00 71.80  ? 360  ASN A  OD1 1 
ATOM   2682  N ND2 . ASN A  1 360  ? 231.252 212.412 156.914 1.00 58.99  ? 360  ASN A  ND2 1 
ATOM   2683  N N   . CYS A  1 361  ? 226.928 212.525 154.022 1.00 47.16  ? 361  CYS A  N   1 
ATOM   2684  C CA  . CYS A  1 361  ? 226.054 213.195 153.072 1.00 48.84  ? 361  CYS A  CA  1 
ATOM   2685  C C   . CYS A  1 361  ? 224.796 213.672 153.781 1.00 53.31  ? 361  CYS A  C   1 
ATOM   2686  O O   . CYS A  1 361  ? 224.470 213.229 154.885 1.00 58.92  ? 361  CYS A  O   1 
ATOM   2687  C CB  . CYS A  1 361  ? 225.701 212.278 151.907 1.00 55.90  ? 361  CYS A  CB  1 
ATOM   2688  S SG  . CYS A  1 361  ? 224.616 210.895 152.324 1.00 57.96  ? 361  CYS A  SG  1 
ATOM   2689  N N   . VAL A  1 362  ? 224.089 214.588 153.125 1.00 56.62  ? 362  VAL A  N   1 
ATOM   2690  C CA  . VAL A  1 362  ? 222.875 215.196 153.660 1.00 55.63  ? 362  VAL A  CA  1 
ATOM   2691  C C   . VAL A  1 362  ? 221.669 214.524 153.017 1.00 53.25  ? 362  VAL A  C   1 
ATOM   2692  O O   . VAL A  1 362  ? 221.570 214.453 151.787 1.00 54.83  ? 362  VAL A  O   1 
ATOM   2693  C CB  . VAL A  1 362  ? 222.867 216.714 153.408 1.00 48.27  ? 362  VAL A  CB  1 
ATOM   2694  C CG1 . VAL A  1 362  ? 221.649 217.364 154.036 1.00 49.72  ? 362  VAL A  CG1 1 
ATOM   2695  C CG2 . VAL A  1 362  ? 224.145 217.342 153.946 1.00 52.34  ? 362  VAL A  CG2 1 
ATOM   2696  N N   . ALA A  1 363  ? 220.747 214.035 153.849 1.00 61.51  ? 363  ALA A  N   1 
ATOM   2697  C CA  . ALA A  1 363  ? 219.595 213.277 153.373 1.00 56.12  ? 363  ALA A  CA  1 
ATOM   2698  C C   . ALA A  1 363  ? 218.430 214.171 152.961 1.00 59.66  ? 363  ALA A  C   1 
ATOM   2699  O O   . ALA A  1 363  ? 217.322 214.032 153.491 1.00 63.35  ? 363  ALA A  O   1 
ATOM   2700  C CB  . ALA A  1 363  ? 219.133 212.299 154.455 1.00 50.43  ? 363  ALA A  CB  1 
ATOM   2701  N N   . ASP A  1 364  ? 218.661 215.085 152.018 1.00 56.03  ? 364  ASP A  N   1 
ATOM   2702  C CA  . ASP A  1 364  ? 217.609 215.962 151.497 1.00 49.06  ? 364  ASP A  CA  1 
ATOM   2703  C C   . ASP A  1 364  ? 216.816 215.217 150.422 1.00 52.63  ? 364  ASP A  C   1 
ATOM   2704  O O   . ASP A  1 364  ? 216.969 215.432 149.218 1.00 55.70  ? 364  ASP A  O   1 
ATOM   2705  C CB  . ASP A  1 364  ? 218.212 217.248 150.948 1.00 52.75  ? 364  ASP A  CB  1 
ATOM   2706  C CG  . ASP A  1 364  ? 217.168 218.311 150.670 1.00 65.14  ? 364  ASP A  CG  1 
ATOM   2707  O OD1 . ASP A  1 364  ? 216.056 218.221 151.229 1.00 62.77  ? 364  ASP A  OD1 1 
ATOM   2708  O OD2 . ASP A  1 364  ? 217.461 219.239 149.887 1.00 72.38  ? 364  ASP A  OD2 1 
ATOM   2709  N N   . TYR A  1 365  ? 215.945 214.319 150.884 1.00 56.20  ? 365  TYR A  N   1 
ATOM   2710  C CA  . TYR A  1 365  ? 215.189 213.473 149.967 1.00 50.61  ? 365  TYR A  CA  1 
ATOM   2711  C C   . TYR A  1 365  ? 214.186 214.252 149.125 1.00 47.86  ? 365  TYR A  C   1 
ATOM   2712  O O   . TYR A  1 365  ? 213.551 213.657 148.247 1.00 54.20  ? 365  TYR A  O   1 
ATOM   2713  C CB  . TYR A  1 365  ? 214.473 212.362 150.745 1.00 52.39  ? 365  TYR A  CB  1 
ATOM   2714  C CG  . TYR A  1 365  ? 213.334 212.822 151.628 1.00 50.48  ? 365  TYR A  CG  1 
ATOM   2715  C CD1 . TYR A  1 365  ? 213.570 213.284 152.913 1.00 49.02  ? 365  TYR A  CD1 1 
ATOM   2716  C CD2 . TYR A  1 365  ? 212.020 212.769 151.185 1.00 56.40  ? 365  TYR A  CD2 1 
ATOM   2717  C CE1 . TYR A  1 365  ? 212.533 213.694 153.725 1.00 59.97  ? 365  TYR A  CE1 1 
ATOM   2718  C CE2 . TYR A  1 365  ? 210.977 213.176 151.993 1.00 62.26  ? 365  TYR A  CE2 1 
ATOM   2719  C CZ  . TYR A  1 365  ? 211.240 213.637 153.261 1.00 66.97  ? 365  TYR A  CZ  1 
ATOM   2720  O OH  . TYR A  1 365  ? 210.206 214.044 154.073 1.00 64.30  ? 365  TYR A  OH  1 
ATOM   2721  N N   . SER A  1 366  ? 214.018 215.554 149.368 1.00 48.43  ? 366  SER A  N   1 
ATOM   2722  C CA  . SER A  1 366  ? 213.102 216.348 148.553 1.00 56.26  ? 366  SER A  CA  1 
ATOM   2723  C C   . SER A  1 366  ? 213.559 216.436 147.103 1.00 54.75  ? 366  SER A  C   1 
ATOM   2724  O O   . SER A  1 366  ? 212.730 216.603 146.202 1.00 54.24  ? 366  SER A  O   1 
ATOM   2725  C CB  . SER A  1 366  ? 212.964 217.754 149.140 1.00 56.73  ? 366  SER A  CB  1 
ATOM   2726  O OG  . SER A  1 366  ? 212.266 218.615 148.256 1.00 50.21  ? 366  SER A  OG  1 
ATOM   2727  N N   . VAL A  1 367  ? 214.865 216.322 146.854 1.00 59.50  ? 367  VAL A  N   1 
ATOM   2728  C CA  . VAL A  1 367  ? 215.409 216.587 145.526 1.00 53.32  ? 367  VAL A  CA  1 
ATOM   2729  C C   . VAL A  1 367  ? 214.829 215.667 144.462 1.00 52.34  ? 367  VAL A  C   1 
ATOM   2730  O O   . VAL A  1 367  ? 214.841 216.013 143.277 1.00 58.07  ? 367  VAL A  O   1 
ATOM   2731  C CB  . VAL A  1 367  ? 216.945 216.467 145.555 1.00 46.43  ? 367  VAL A  CB  1 
ATOM   2732  C CG1 . VAL A  1 367  ? 217.537 217.525 146.466 1.00 47.48  ? 367  VAL A  CG1 1 
ATOM   2733  C CG2 . VAL A  1 367  ? 217.362 215.069 145.996 1.00 56.45  ? 367  VAL A  CG2 1 
ATOM   2734  N N   . LEU A  1 368  ? 214.326 214.498 144.849 1.00 51.96  ? 368  LEU A  N   1 
ATOM   2735  C CA  . LEU A  1 368  ? 213.865 213.500 143.895 1.00 58.39  ? 368  LEU A  CA  1 
ATOM   2736  C C   . LEU A  1 368  ? 212.353 213.493 143.711 1.00 61.05  ? 368  LEU A  C   1 
ATOM   2737  O O   . LEU A  1 368  ? 211.834 212.609 143.023 1.00 65.08  ? 368  LEU A  O   1 
ATOM   2738  C CB  . LEU A  1 368  ? 214.352 212.107 144.314 1.00 55.24  ? 368  LEU A  CB  1 
ATOM   2739  C CG  . LEU A  1 368  ? 214.217 211.677 145.778 1.00 47.64  ? 368  LEU A  CG  1 
ATOM   2740  C CD1 . LEU A  1 368  ? 212.779 211.331 146.129 1.00 51.27  ? 368  LEU A  CD1 1 
ATOM   2741  C CD2 . LEU A  1 368  ? 215.135 210.503 146.062 1.00 47.45  ? 368  LEU A  CD2 1 
ATOM   2742  N N   . TYR A  1 369  ? 211.633 214.444 144.310 1.00 60.03  ? 369  TYR A  N   1 
ATOM   2743  C CA  . TYR A  1 369  ? 210.186 214.499 144.132 1.00 54.49  ? 369  TYR A  CA  1 
ATOM   2744  C C   . TYR A  1 369  ? 209.810 214.593 142.658 1.00 57.15  ? 369  TYR A  C   1 
ATOM   2745  O O   . TYR A  1 369  ? 208.918 213.880 142.186 1.00 61.40  ? 369  TYR A  O   1 
ATOM   2746  C CB  . TYR A  1 369  ? 209.606 215.689 144.905 1.00 52.81  ? 369  TYR A  CB  1 
ATOM   2747  C CG  . TYR A  1 369  ? 209.483 215.497 146.406 1.00 52.05  ? 369  TYR A  CG  1 
ATOM   2748  C CD1 . TYR A  1 369  ? 209.768 214.277 147.006 1.00 56.42  ? 369  TYR A  CD1 1 
ATOM   2749  C CD2 . TYR A  1 369  ? 209.066 216.540 147.220 1.00 53.70  ? 369  TYR A  CD2 1 
ATOM   2750  C CE1 . TYR A  1 369  ? 209.649 214.107 148.368 1.00 52.09  ? 369  TYR A  CE1 1 
ATOM   2751  C CE2 . TYR A  1 369  ? 208.945 216.377 148.584 1.00 54.51  ? 369  TYR A  CE2 1 
ATOM   2752  C CZ  . TYR A  1 369  ? 209.238 215.159 149.151 1.00 51.95  ? 369  TYR A  CZ  1 
ATOM   2753  O OH  . TYR A  1 369  ? 209.119 214.990 150.510 1.00 54.20  ? 369  TYR A  OH  1 
ATOM   2754  N N   . ASN A  1 370  ? 210.474 215.482 141.915 1.00 55.37  ? 370  ASN A  N   1 
ATOM   2755  C CA  . ASN A  1 370  ? 210.098 215.708 140.521 1.00 65.11  ? 370  ASN A  CA  1 
ATOM   2756  C C   . ASN A  1 370  ? 210.146 214.428 139.693 1.00 66.16  ? 370  ASN A  C   1 
ATOM   2757  O O   . ASN A  1 370  ? 209.350 214.256 138.763 1.00 58.82  ? 370  ASN A  O   1 
ATOM   2758  C CB  . ASN A  1 370  ? 210.996 216.775 139.887 1.00 65.12  ? 370  ASN A  CB  1 
ATOM   2759  C CG  . ASN A  1 370  ? 212.441 216.670 140.328 1.00 67.24  ? 370  ASN A  CG  1 
ATOM   2760  O OD1 . ASN A  1 370  ? 213.115 215.674 140.065 1.00 71.28  ? 370  ASN A  OD1 1 
ATOM   2761  N ND2 . ASN A  1 370  ? 212.931 217.713 140.992 1.00 66.83  ? 370  ASN A  ND2 1 
ATOM   2762  N N   . SER A  1 371  ? 211.067 213.514 140.011 1.00 68.96  ? 371  SER A  N   1 
ATOM   2763  C CA  . SER A  1 371  ? 211.376 212.403 139.118 1.00 60.41  ? 371  SER A  CA  1 
ATOM   2764  C C   . SER A  1 371  ? 211.305 211.018 139.749 1.00 60.60  ? 371  SER A  C   1 
ATOM   2765  O O   . SER A  1 371  ? 211.521 210.034 139.034 1.00 77.81  ? 371  SER A  O   1 
ATOM   2766  C CB  . SER A  1 371  ? 212.778 212.586 138.519 1.00 70.66  ? 371  SER A  CB  1 
ATOM   2767  O OG  . SER A  1 371  ? 213.736 212.823 139.536 1.00 65.90  ? 371  SER A  OG  1 
ATOM   2768  N N   . ALA A  1 372  ? 211.015 210.899 141.046 1.00 56.97  ? 372  ALA A  N   1 
ATOM   2769  C CA  . ALA A  1 372  ? 211.030 209.587 141.686 1.00 57.16  ? 372  ALA A  CA  1 
ATOM   2770  C C   . ALA A  1 372  ? 209.799 208.766 141.311 1.00 48.05  ? 372  ALA A  C   1 
ATOM   2771  O O   . ALA A  1 372  ? 209.905 207.746 140.620 1.00 44.81  ? 372  ALA A  O   1 
ATOM   2772  C CB  . ALA A  1 372  ? 211.121 209.750 143.203 1.00 60.01  ? 372  ALA A  CB  1 
ATOM   2773  N N   . SER A  1 373  ? 208.623 209.195 141.759 1.00 43.15  ? 373  SER A  N   1 
ATOM   2774  C CA  . SER A  1 373  ? 207.369 208.480 141.523 1.00 43.89  ? 373  SER A  CA  1 
ATOM   2775  C C   . SER A  1 373  ? 207.417 207.066 142.109 1.00 37.98  ? 373  SER A  C   1 
ATOM   2776  O O   . SER A  1 373  ? 207.283 206.063 141.408 1.00 45.25  ? 373  SER A  O   1 
ATOM   2777  C CB  . SER A  1 373  ? 207.041 208.439 140.029 1.00 55.25  ? 373  SER A  CB  1 
ATOM   2778  O OG  . SER A  1 373  ? 205.822 207.755 139.794 1.00 61.25  ? 373  SER A  OG  1 
ATOM   2779  N N   . PHE A  1 374  ? 207.607 207.005 143.424 1.00 36.61  ? 374  PHE A  N   1 
ATOM   2780  C CA  . PHE A  1 374  ? 207.635 205.726 144.121 1.00 30.48  ? 374  PHE A  CA  1 
ATOM   2781  C C   . PHE A  1 374  ? 206.226 205.174 144.298 1.00 39.80  ? 374  PHE A  C   1 
ATOM   2782  O O   . PHE A  1 374  ? 205.334 205.868 144.791 1.00 46.86  ? 374  PHE A  O   1 
ATOM   2783  C CB  . PHE A  1 374  ? 208.302 205.887 145.482 1.00 26.76  ? 374  PHE A  CB  1 
ATOM   2784  C CG  . PHE A  1 374  ? 209.711 206.391 145.411 1.00 25.26  ? 374  PHE A  CG  1 
ATOM   2785  C CD1 . PHE A  1 374  ? 210.589 205.907 144.461 1.00 27.71  ? 374  PHE A  CD1 1 
ATOM   2786  C CD2 . PHE A  1 374  ? 210.154 207.354 146.293 1.00 28.24  ? 374  PHE A  CD2 1 
ATOM   2787  C CE1 . PHE A  1 374  ? 211.882 206.371 144.397 1.00 26.63  ? 374  PHE A  CE1 1 
ATOM   2788  C CE2 . PHE A  1 374  ? 211.444 207.822 146.232 1.00 42.94  ? 374  PHE A  CE2 1 
ATOM   2789  C CZ  . PHE A  1 374  ? 212.310 207.329 145.284 1.00 37.89  ? 374  PHE A  CZ  1 
ATOM   2790  N N   . SER A  1 375  ? 206.031 203.914 143.903 1.00 39.27  ? 375  SER A  N   1 
ATOM   2791  C CA  . SER A  1 375  ? 204.760 203.240 144.147 1.00 36.34  ? 375  SER A  CA  1 
ATOM   2792  C C   . SER A  1 375  ? 204.638 202.773 145.589 1.00 34.15  ? 375  SER A  C   1 
ATOM   2793  O O   . SER A  1 375  ? 203.525 202.697 146.119 1.00 34.68  ? 375  SER A  O   1 
ATOM   2794  C CB  . SER A  1 375  ? 204.603 202.042 143.209 1.00 46.51  ? 375  SER A  CB  1 
ATOM   2795  O OG  . SER A  1 375  ? 205.506 201.004 143.552 1.00 44.51  ? 375  SER A  OG  1 
ATOM   2796  N N   . THR A  1 376  ? 205.758 202.448 146.229 1.00 38.63  ? 376  THR A  N   1 
ATOM   2797  C CA  . THR A  1 376  ? 205.784 202.029 147.621 1.00 33.01  ? 376  THR A  CA  1 
ATOM   2798  C C   . THR A  1 376  ? 206.893 202.782 148.335 1.00 30.60  ? 376  THR A  C   1 
ATOM   2799  O O   . THR A  1 376  ? 208.023 202.840 147.842 1.00 32.20  ? 376  THR A  O   1 
ATOM   2800  C CB  . THR A  1 376  ? 206.014 200.518 147.751 1.00 35.62  ? 376  THR A  CB  1 
ATOM   2801  O OG1 . THR A  1 376  ? 204.925 199.808 147.150 1.00 45.47  ? 376  THR A  OG1 1 
ATOM   2802  C CG2 . THR A  1 376  ? 206.127 200.113 149.210 1.00 17.76  ? 376  THR A  CG2 1 
ATOM   2803  N N   . PHE A  1 377  ? 206.567 203.362 149.486 1.00 39.02  ? 377  PHE A  N   1 
ATOM   2804  C CA  . PHE A  1 377  ? 207.556 203.979 150.365 1.00 33.10  ? 377  PHE A  CA  1 
ATOM   2805  C C   . PHE A  1 377  ? 207.053 203.800 151.787 1.00 41.60  ? 377  PHE A  C   1 
ATOM   2806  O O   . PHE A  1 377  ? 206.158 204.527 152.226 1.00 54.74  ? 377  PHE A  O   1 
ATOM   2807  C CB  . PHE A  1 377  ? 207.767 205.454 150.028 1.00 33.72  ? 377  PHE A  CB  1 
ATOM   2808  C CG  . PHE A  1 377  ? 208.580 206.202 151.045 1.00 29.77  ? 377  PHE A  CG  1 
ATOM   2809  C CD1 . PHE A  1 377  ? 209.687 205.625 151.637 1.00 27.49  ? 377  PHE A  CD1 1 
ATOM   2810  C CD2 . PHE A  1 377  ? 208.242 207.496 151.396 1.00 48.10  ? 377  PHE A  CD2 1 
ATOM   2811  C CE1 . PHE A  1 377  ? 210.432 206.319 152.567 1.00 39.27  ? 377  PHE A  CE1 1 
ATOM   2812  C CE2 . PHE A  1 377  ? 208.984 208.194 152.324 1.00 60.95  ? 377  PHE A  CE2 1 
ATOM   2813  C CZ  . PHE A  1 377  ? 210.081 207.606 152.909 1.00 60.52  ? 377  PHE A  CZ  1 
ATOM   2814  N N   . LYS A  1 378  ? 207.630 202.841 152.503 1.00 33.83  ? 378  LYS A  N   1 
ATOM   2815  C CA  . LYS A  1 378  ? 207.142 202.437 153.812 1.00 33.14  ? 378  LYS A  CA  1 
ATOM   2816  C C   . LYS A  1 378  ? 208.305 202.403 154.788 1.00 34.06  ? 378  LYS A  C   1 
ATOM   2817  O O   . LYS A  1 378  ? 209.324 201.759 154.522 1.00 40.19  ? 378  LYS A  O   1 
ATOM   2818  C CB  . LYS A  1 378  ? 206.461 201.067 153.732 1.00 39.09  ? 378  LYS A  CB  1 
ATOM   2819  C CG  . LYS A  1 378  ? 206.036 200.484 155.068 1.00 48.71  ? 378  LYS A  CG  1 
ATOM   2820  C CD  . LYS A  1 378  ? 205.019 201.360 155.779 1.00 40.79  ? 378  LYS A  CD  1 
ATOM   2821  C CE  . LYS A  1 378  ? 204.635 200.768 157.125 1.00 39.90  ? 378  LYS A  CE  1 
ATOM   2822  N NZ  . LYS A  1 378  ? 203.889 199.488 156.975 1.00 72.13  ? 378  LYS A  NZ  1 
ATOM   2823  N N   . CYS A  1 379  ? 208.148 203.094 155.911 1.00 31.84  ? 379  CYS A  N   1 
ATOM   2824  C CA  . CYS A  1 379  ? 209.151 203.131 156.961 1.00 34.71  ? 379  CYS A  CA  1 
ATOM   2825  C C   . CYS A  1 379  ? 208.724 202.247 158.124 1.00 40.99  ? 379  CYS A  C   1 
ATOM   2826  O O   . CYS A  1 379  ? 207.534 202.107 158.419 1.00 40.88  ? 379  CYS A  O   1 
ATOM   2827  C CB  . CYS A  1 379  ? 209.381 204.561 157.446 1.00 38.82  ? 379  CYS A  CB  1 
ATOM   2828  S SG  . CYS A  1 379  ? 210.142 205.641 156.211 1.00 44.08  ? 379  CYS A  SG  1 
ATOM   2829  N N   . TYR A  1 380  ? 209.714 201.655 158.790 1.00 42.80  ? 380  TYR A  N   1 
ATOM   2830  C CA  . TYR A  1 380  ? 209.462 200.682 159.838 1.00 40.15  ? 380  TYR A  CA  1 
ATOM   2831  C C   . TYR A  1 380  ? 210.046 201.057 161.189 1.00 44.99  ? 380  TYR A  C   1 
ATOM   2832  O O   . TYR A  1 380  ? 209.589 200.519 162.203 1.00 58.10  ? 380  TYR A  O   1 
ATOM   2833  C CB  . TYR A  1 380  ? 210.008 199.308 159.423 1.00 36.41  ? 380  TYR A  CB  1 
ATOM   2834  C CG  . TYR A  1 380  ? 209.360 198.781 158.166 1.00 39.98  ? 380  TYR A  CG  1 
ATOM   2835  C CD1 . TYR A  1 380  ? 209.884 199.074 156.919 1.00 38.45  ? 380  TYR A  CD1 1 
ATOM   2836  C CD2 . TYR A  1 380  ? 208.213 198.007 158.226 1.00 32.77  ? 380  TYR A  CD2 1 
ATOM   2837  C CE1 . TYR A  1 380  ? 209.292 198.605 155.772 1.00 35.49  ? 380  TYR A  CE1 1 
ATOM   2838  C CE2 . TYR A  1 380  ? 207.613 197.535 157.081 1.00 34.28  ? 380  TYR A  CE2 1 
ATOM   2839  C CZ  . TYR A  1 380  ? 208.157 197.837 155.857 1.00 41.05  ? 380  TYR A  CZ  1 
ATOM   2840  O OH  . TYR A  1 380  ? 207.566 197.366 154.708 1.00 57.36  ? 380  TYR A  OH  1 
ATOM   2841  N N   . GLY A  1 381  ? 211.024 201.953 161.241 1.00 36.22  ? 381  GLY A  N   1 
ATOM   2842  C CA  . GLY A  1 381  ? 211.578 202.374 162.510 1.00 45.02  ? 381  GLY A  CA  1 
ATOM   2843  C C   . GLY A  1 381  ? 211.324 203.834 162.812 1.00 53.27  ? 381  GLY A  C   1 
ATOM   2844  O O   . GLY A  1 381  ? 211.708 204.328 163.875 1.00 56.71  ? 381  GLY A  O   1 
ATOM   2845  N N   . VAL A  1 382  ? 210.671 204.536 161.885 1.00 51.01  ? 382  VAL A  N   1 
ATOM   2846  C CA  . VAL A  1 382  ? 210.431 205.967 162.013 1.00 42.86  ? 382  VAL A  CA  1 
ATOM   2847  C C   . VAL A  1 382  ? 209.140 206.309 161.290 1.00 39.72  ? 382  VAL A  C   1 
ATOM   2848  O O   . VAL A  1 382  ? 208.663 205.560 160.436 1.00 41.34  ? 382  VAL A  O   1 
ATOM   2849  C CB  . VAL A  1 382  ? 211.590 206.812 161.432 1.00 32.28  ? 382  VAL A  CB  1 
ATOM   2850  C CG1 . VAL A  1 382  ? 212.809 206.721 162.308 1.00 36.58  ? 382  VAL A  CG1 1 
ATOM   2851  C CG2 . VAL A  1 382  ? 211.917 206.351 160.021 1.00 42.75  ? 382  VAL A  CG2 1 
ATOM   2852  N N   . SER A  1 383  ? 208.569 207.446 161.647 1.00 50.07  ? 383  SER A  N   1 
ATOM   2853  C CA  . SER A  1 383  ? 207.510 208.014 160.834 1.00 45.07  ? 383  SER A  CA  1 
ATOM   2854  C C   . SER A  1 383  ? 208.126 208.739 159.640 1.00 46.81  ? 383  SER A  C   1 
ATOM   2855  O O   . SER A  1 383  ? 209.166 209.385 159.781 1.00 45.92  ? 383  SER A  O   1 
ATOM   2856  C CB  . SER A  1 383  ? 206.663 208.987 161.651 1.00 38.34  ? 383  SER A  CB  1 
ATOM   2857  O OG  . SER A  1 383  ? 206.059 208.338 162.755 1.00 45.93  ? 383  SER A  OG  1 
ATOM   2858  N N   . PRO A  1 384  ? 207.519 208.648 158.454 1.00 51.36  ? 384  PRO A  N   1 
ATOM   2859  C CA  . PRO A  1 384  ? 208.128 209.306 157.290 1.00 50.96  ? 384  PRO A  CA  1 
ATOM   2860  C C   . PRO A  1 384  ? 208.234 210.811 157.446 1.00 49.70  ? 384  PRO A  C   1 
ATOM   2861  O O   . PRO A  1 384  ? 209.144 211.421 156.873 1.00 43.05  ? 384  PRO A  O   1 
ATOM   2862  C CB  . PRO A  1 384  ? 207.195 208.915 156.138 1.00 62.92  ? 384  PRO A  CB  1 
ATOM   2863  C CG  . PRO A  1 384  ? 205.895 208.614 156.788 1.00 48.64  ? 384  PRO A  CG  1 
ATOM   2864  C CD  . PRO A  1 384  ? 206.229 208.022 158.121 1.00 50.99  ? 384  PRO A  CD  1 
ATOM   2865  N N   . THR A  1 385  ? 207.330 211.427 158.207 1.00 51.34  ? 385  THR A  N   1 
ATOM   2866  C CA  . THR A  1 385  ? 207.371 212.874 158.383 1.00 47.06  ? 385  THR A  CA  1 
ATOM   2867  C C   . THR A  1 385  ? 208.644 213.325 159.088 1.00 49.16  ? 385  THR A  C   1 
ATOM   2868  O O   . THR A  1 385  ? 209.111 214.447 158.864 1.00 51.43  ? 385  THR A  O   1 
ATOM   2869  C CB  . THR A  1 385  ? 206.144 213.334 159.170 1.00 36.20  ? 385  THR A  CB  1 
ATOM   2870  O OG1 . THR A  1 385  ? 206.172 212.760 160.481 1.00 35.00  ? 385  THR A  OG1 1 
ATOM   2871  C CG2 . THR A  1 385  ? 204.870 212.904 158.470 1.00 45.16  ? 385  THR A  CG2 1 
ATOM   2872  N N   . LYS A  1 386  ? 209.223 212.473 159.933 1.00 51.53  ? 386  LYS A  N   1 
ATOM   2873  C CA  . LYS A  1 386  ? 210.323 212.877 160.799 1.00 36.96  ? 386  LYS A  CA  1 
ATOM   2874  C C   . LYS A  1 386  ? 211.683 212.828 160.122 1.00 45.64  ? 386  LYS A  C   1 
ATOM   2875  O O   . LYS A  1 386  ? 212.659 213.308 160.707 1.00 56.18  ? 386  LYS A  O   1 
ATOM   2876  C CB  . LYS A  1 386  ? 210.361 211.987 162.041 1.00 30.32  ? 386  LYS A  CB  1 
ATOM   2877  C CG  . LYS A  1 386  ? 209.249 212.261 163.032 1.00 42.83  ? 386  LYS A  CG  1 
ATOM   2878  C CD  . LYS A  1 386  ? 209.469 213.585 163.736 1.00 43.99  ? 386  LYS A  CD  1 
ATOM   2879  C CE  . LYS A  1 386  ? 208.422 213.839 164.794 1.00 49.48  ? 386  LYS A  CE  1 
ATOM   2880  N NZ  . LYS A  1 386  ? 208.650 215.151 165.459 1.00 55.60  ? 386  LYS A  NZ  1 
ATOM   2881  N N   . LEU A  1 387  ? 211.777 212.270 158.915 1.00 55.71  ? 387  LEU A  N   1 
ATOM   2882  C CA  . LEU A  1 387  ? 213.085 212.006 158.325 1.00 50.73  ? 387  LEU A  CA  1 
ATOM   2883  C C   . LEU A  1 387  ? 213.920 213.273 158.183 1.00 52.22  ? 387  LEU A  C   1 
ATOM   2884  O O   . LEU A  1 387  ? 215.153 213.210 158.248 1.00 57.08  ? 387  LEU A  O   1 
ATOM   2885  C CB  . LEU A  1 387  ? 212.905 211.327 156.970 1.00 44.97  ? 387  LEU A  CB  1 
ATOM   2886  C CG  . LEU A  1 387  ? 212.407 209.884 157.064 1.00 38.56  ? 387  LEU A  CG  1 
ATOM   2887  C CD1 . LEU A  1 387  ? 211.802 209.431 155.749 1.00 50.59  ? 387  LEU A  CD1 1 
ATOM   2888  C CD2 . LEU A  1 387  ? 213.538 208.956 157.479 1.00 33.23  ? 387  LEU A  CD2 1 
ATOM   2889  N N   . ASN A  1 388  ? 213.281 214.429 157.996 1.00 51.09  ? 388  ASN A  N   1 
ATOM   2890  C CA  . ASN A  1 388  ? 214.045 215.661 157.827 1.00 57.12  ? 388  ASN A  CA  1 
ATOM   2891  C C   . ASN A  1 388  ? 214.641 216.145 159.142 1.00 61.80  ? 388  ASN A  C   1 
ATOM   2892  O O   . ASN A  1 388  ? 215.701 216.780 159.142 1.00 61.03  ? 388  ASN A  O   1 
ATOM   2893  C CB  . ASN A  1 388  ? 213.161 216.752 157.223 1.00 60.45  ? 388  ASN A  CB  1 
ATOM   2894  C CG  . ASN A  1 388  ? 213.046 216.640 155.718 1.00 72.14  ? 388  ASN A  CG  1 
ATOM   2895  O OD1 . ASN A  1 388  ? 213.858 215.982 155.068 1.00 72.93  ? 388  ASN A  OD1 1 
ATOM   2896  N ND2 . ASN A  1 388  ? 212.040 217.297 155.152 1.00 86.69  ? 388  ASN A  ND2 1 
ATOM   2897  N N   . ASP A  1 389  ? 213.985 215.855 160.262 1.00 63.30  ? 389  ASP A  N   1 
ATOM   2898  C CA  . ASP A  1 389  ? 214.433 216.296 161.575 1.00 60.74  ? 389  ASP A  CA  1 
ATOM   2899  C C   . ASP A  1 389  ? 215.393 215.313 162.230 1.00 62.78  ? 389  ASP A  C   1 
ATOM   2900  O O   . ASP A  1 389  ? 215.595 215.382 163.445 1.00 61.71  ? 389  ASP A  O   1 
ATOM   2901  C CB  . ASP A  1 389  ? 213.225 216.517 162.491 1.00 57.01  ? 389  ASP A  CB  1 
ATOM   2902  C CG  . ASP A  1 389  ? 212.199 217.457 161.889 1.00 61.39  ? 389  ASP A  CG  1 
ATOM   2903  O OD1 . ASP A  1 389  ? 212.585 218.557 161.444 1.00 65.83  ? 389  ASP A  OD1 1 
ATOM   2904  O OD2 . ASP A  1 389  ? 211.005 217.091 161.857 1.00 66.16  ? 389  ASP A  OD2 1 
ATOM   2905  N N   . LEU A  1 390  ? 215.995 214.411 161.458 1.00 59.19  ? 390  LEU A  N   1 
ATOM   2906  C CA  . LEU A  1 390  ? 216.634 213.230 162.014 1.00 55.09  ? 390  LEU A  CA  1 
ATOM   2907  C C   . LEU A  1 390  ? 217.979 212.990 161.341 1.00 54.14  ? 390  LEU A  C   1 
ATOM   2908  O O   . LEU A  1 390  ? 218.194 213.377 160.190 1.00 49.23  ? 390  LEU A  O   1 
ATOM   2909  C CB  . LEU A  1 390  ? 215.705 212.021 161.840 1.00 50.55  ? 390  LEU A  CB  1 
ATOM   2910  C CG  . LEU A  1 390  ? 215.827 210.794 162.739 1.00 42.92  ? 390  LEU A  CG  1 
ATOM   2911  C CD1 . LEU A  1 390  ? 215.916 211.168 164.206 1.00 42.98  ? 390  LEU A  CD1 1 
ATOM   2912  C CD2 . LEU A  1 390  ? 214.624 209.896 162.496 1.00 40.05  ? 390  LEU A  CD2 1 
ATOM   2913  N N   . CYS A  1 391  ? 218.881 212.344 162.078 1.00 61.13  ? 391  CYS A  N   1 
ATOM   2914  C CA  . CYS A  1 391  ? 220.197 211.958 161.588 1.00 51.99  ? 391  CYS A  CA  1 
ATOM   2915  C C   . CYS A  1 391  ? 220.327 210.446 161.685 1.00 54.26  ? 391  CYS A  C   1 
ATOM   2916  O O   . CYS A  1 391  ? 219.608 209.791 162.442 1.00 59.15  ? 391  CYS A  O   1 
ATOM   2917  C CB  . CYS A  1 391  ? 221.329 212.618 162.387 1.00 47.53  ? 391  CYS A  CB  1 
ATOM   2918  S SG  . CYS A  1 391  ? 221.646 214.359 162.029 1.00 57.47  ? 391  CYS A  SG  1 
ATOM   2919  N N   . PHE A  1 392  ? 221.259 209.892 160.912 1.00 49.66  ? 392  PHE A  N   1 
ATOM   2920  C CA  . PHE A  1 392  ? 221.418 208.450 160.793 1.00 49.20  ? 392  PHE A  CA  1 
ATOM   2921  C C   . PHE A  1 392  ? 222.880 208.071 160.974 1.00 49.68  ? 392  PHE A  C   1 
ATOM   2922  O O   . PHE A  1 392  ? 223.776 208.794 160.531 1.00 53.41  ? 392  PHE A  O   1 
ATOM   2923  C CB  . PHE A  1 392  ? 220.904 207.966 159.442 1.00 47.46  ? 392  PHE A  CB  1 
ATOM   2924  C CG  . PHE A  1 392  ? 219.565 208.536 159.073 1.00 49.74  ? 392  PHE A  CG  1 
ATOM   2925  C CD1 . PHE A  1 392  ? 219.469 209.786 158.489 1.00 47.93  ? 392  PHE A  CD1 1 
ATOM   2926  C CD2 . PHE A  1 392  ? 218.405 207.832 159.323 1.00 47.79  ? 392  PHE A  CD2 1 
ATOM   2927  C CE1 . PHE A  1 392  ? 218.240 210.316 158.157 1.00 47.81  ? 392  PHE A  CE1 1 
ATOM   2928  C CE2 . PHE A  1 392  ? 217.175 208.359 158.993 1.00 44.66  ? 392  PHE A  CE2 1 
ATOM   2929  C CZ  . PHE A  1 392  ? 217.093 209.601 158.409 1.00 46.02  ? 392  PHE A  CZ  1 
ATOM   2930  N N   . THR A  1 393  ? 223.113 206.925 161.614 1.00 55.47  ? 393  THR A  N   1 
ATOM   2931  C CA  . THR A  1 393  ? 224.445 206.535 162.063 1.00 53.68  ? 393  THR A  CA  1 
ATOM   2932  C C   . THR A  1 393  ? 225.199 205.705 161.032 1.00 66.23  ? 393  THR A  C   1 
ATOM   2933  O O   . THR A  1 393  ? 226.323 206.057 160.661 1.00 70.25  ? 393  THR A  O   1 
ATOM   2934  C CB  . THR A  1 393  ? 224.342 205.758 163.379 1.00 56.29  ? 393  THR A  CB  1 
ATOM   2935  O OG1 . THR A  1 393  ? 223.553 204.581 163.178 1.00 59.88  ? 393  THR A  OG1 1 
ATOM   2936  C CG2 . THR A  1 393  ? 223.695 206.617 164.452 1.00 56.47  ? 393  THR A  CG2 1 
ATOM   2937  N N   . ASN A  1 394  ? 224.621 204.600 160.574 1.00 64.60  ? 394  ASN A  N   1 
ATOM   2938  C CA  . ASN A  1 394  ? 225.152 203.872 159.432 1.00 56.92  ? 394  ASN A  CA  1 
ATOM   2939  C C   . ASN A  1 394  ? 224.000 203.556 158.492 1.00 53.30  ? 394  ASN A  C   1 
ATOM   2940  O O   . ASN A  1 394  ? 222.953 203.072 158.928 1.00 54.60  ? 394  ASN A  O   1 
ATOM   2941  C CB  . ASN A  1 394  ? 225.883 202.587 159.864 1.00 51.54  ? 394  ASN A  CB  1 
ATOM   2942  C CG  . ASN A  1 394  ? 224.964 201.574 160.511 1.00 49.57  ? 394  ASN A  CG  1 
ATOM   2943  O OD1 . ASN A  1 394  ? 224.117 200.978 159.848 1.00 42.57  ? 394  ASN A  OD1 1 
ATOM   2944  N ND2 . ASN A  1 394  ? 225.140 201.355 161.809 1.00 57.92  ? 394  ASN A  ND2 1 
ATOM   2945  N N   . VAL A  1 395  ? 224.196 203.826 157.204 1.00 47.14  ? 395  VAL A  N   1 
ATOM   2946  C CA  . VAL A  1 395  ? 223.119 203.778 156.222 1.00 46.86  ? 395  VAL A  CA  1 
ATOM   2947  C C   . VAL A  1 395  ? 223.560 202.904 155.059 1.00 44.36  ? 395  VAL A  C   1 
ATOM   2948  O O   . VAL A  1 395  ? 224.622 203.134 154.471 1.00 43.80  ? 395  VAL A  O   1 
ATOM   2949  C CB  . VAL A  1 395  ? 222.740 205.187 155.727 1.00 41.08  ? 395  VAL A  CB  1 
ATOM   2950  C CG1 . VAL A  1 395  ? 221.514 205.128 154.834 1.00 36.07  ? 395  VAL A  CG1 1 
ATOM   2951  C CG2 . VAL A  1 395  ? 222.496 206.118 156.899 1.00 42.21  ? 395  VAL A  CG2 1 
ATOM   2952  N N   . TYR A  1 396  ? 222.738 201.912 154.724 1.00 43.80  ? 396  TYR A  N   1 
ATOM   2953  C CA  . TYR A  1 396  ? 223.010 200.989 153.631 1.00 36.11  ? 396  TYR A  CA  1 
ATOM   2954  C C   . TYR A  1 396  ? 221.802 200.932 152.711 1.00 45.53  ? 396  TYR A  C   1 
ATOM   2955  O O   . TYR A  1 396  ? 220.683 200.683 153.168 1.00 54.44  ? 396  TYR A  O   1 
ATOM   2956  C CB  . TYR A  1 396  ? 223.319 199.586 154.154 1.00 37.16  ? 396  TYR A  CB  1 
ATOM   2957  C CG  . TYR A  1 396  ? 224.659 199.458 154.826 1.00 40.38  ? 396  TYR A  CG  1 
ATOM   2958  C CD1 . TYR A  1 396  ? 225.817 199.341 154.080 1.00 44.25  ? 396  TYR A  CD1 1 
ATOM   2959  C CD2 . TYR A  1 396  ? 224.767 199.440 156.206 1.00 41.56  ? 396  TYR A  CD2 1 
ATOM   2960  C CE1 . TYR A  1 396  ? 227.040 199.222 154.686 1.00 46.44  ? 396  TYR A  CE1 1 
ATOM   2961  C CE2 . TYR A  1 396  ? 225.989 199.319 156.821 1.00 43.37  ? 396  TYR A  CE2 1 
ATOM   2962  C CZ  . TYR A  1 396  ? 227.124 199.208 156.057 1.00 47.76  ? 396  TYR A  CZ  1 
ATOM   2963  O OH  . TYR A  1 396  ? 228.352 199.087 156.666 1.00 63.11  ? 396  TYR A  OH  1 
ATOM   2964  N N   . ALA A  1 397  ? 222.030 201.152 151.420 1.00 43.72  ? 397  ALA A  N   1 
ATOM   2965  C CA  . ALA A  1 397  ? 220.981 201.037 150.416 1.00 38.71  ? 397  ALA A  CA  1 
ATOM   2966  C C   . ALA A  1 397  ? 221.125 199.707 149.685 1.00 44.47  ? 397  ALA A  C   1 
ATOM   2967  O O   . ALA A  1 397  ? 222.143 199.462 149.030 1.00 46.74  ? 397  ALA A  O   1 
ATOM   2968  C CB  . ALA A  1 397  ? 221.049 202.202 149.432 1.00 46.65  ? 397  ALA A  CB  1 
ATOM   2969  N N   . ASP A  1 398  ? 220.109 198.855 149.795 1.00 43.72  ? 398  ASP A  N   1 
ATOM   2970  C CA  . ASP A  1 398  ? 220.078 197.570 149.108 1.00 37.05  ? 398  ASP A  CA  1 
ATOM   2971  C C   . ASP A  1 398  ? 219.213 197.701 147.861 1.00 40.85  ? 398  ASP A  C   1 
ATOM   2972  O O   . ASP A  1 398  ? 218.019 197.998 147.960 1.00 44.83  ? 398  ASP A  O   1 
ATOM   2973  C CB  . ASP A  1 398  ? 219.536 196.475 150.025 1.00 39.36  ? 398  ASP A  CB  1 
ATOM   2974  C CG  . ASP A  1 398  ? 220.241 196.438 151.362 1.00 48.95  ? 398  ASP A  CG  1 
ATOM   2975  O OD1 . ASP A  1 398  ? 221.423 196.836 151.420 1.00 51.58  ? 398  ASP A  OD1 1 
ATOM   2976  O OD2 . ASP A  1 398  ? 219.612 196.017 152.355 1.00 50.05  ? 398  ASP A  OD2 1 
ATOM   2977  N N   . SER A  1 399  ? 219.807 197.458 146.696 1.00 39.08  ? 399  SER A  N   1 
ATOM   2978  C CA  . SER A  1 399  ? 219.168 197.710 145.412 1.00 31.35  ? 399  SER A  CA  1 
ATOM   2979  C C   . SER A  1 399  ? 219.011 196.405 144.648 1.00 29.42  ? 399  SER A  C   1 
ATOM   2980  O O   . SER A  1 399  ? 219.976 195.651 144.499 1.00 38.06  ? 399  SER A  O   1 
ATOM   2981  C CB  . SER A  1 399  ? 219.991 198.698 144.586 1.00 38.73  ? 399  SER A  CB  1 
ATOM   2982  O OG  . SER A  1 399  ? 220.258 199.877 145.324 1.00 50.24  ? 399  SER A  OG  1 
ATOM   2983  N N   . PHE A  1 400  ? 217.799 196.142 144.168 1.00 32.11  ? 400  PHE A  N   1 
ATOM   2984  C CA  . PHE A  1 400  ? 217.547 194.965 143.349 1.00 39.52  ? 400  PHE A  CA  1 
ATOM   2985  C C   . PHE A  1 400  ? 216.222 195.140 142.621 1.00 33.29  ? 400  PHE A  C   1 
ATOM   2986  O O   . PHE A  1 400  ? 215.444 196.051 142.911 1.00 40.70  ? 400  PHE A  O   1 
ATOM   2987  C CB  . PHE A  1 400  ? 217.543 193.691 144.194 1.00 39.67  ? 400  PHE A  CB  1 
ATOM   2988  C CG  . PHE A  1 400  ? 216.583 193.728 145.343 1.00 28.89  ? 400  PHE A  CG  1 
ATOM   2989  C CD1 . PHE A  1 400  ? 215.284 193.286 145.191 1.00 24.28  ? 400  PHE A  CD1 1 
ATOM   2990  C CD2 . PHE A  1 400  ? 216.980 194.202 146.577 1.00 26.88  ? 400  PHE A  CD2 1 
ATOM   2991  C CE1 . PHE A  1 400  ? 214.404 193.320 146.242 1.00 24.45  ? 400  PHE A  CE1 1 
ATOM   2992  C CE2 . PHE A  1 400  ? 216.101 194.237 147.630 1.00 29.44  ? 400  PHE A  CE2 1 
ATOM   2993  C CZ  . PHE A  1 400  ? 214.812 193.796 147.463 1.00 30.70  ? 400  PHE A  CZ  1 
ATOM   2994  N N   . VAL A  1 401  ? 215.982 194.254 141.659 1.00 30.82  ? 401  VAL A  N   1 
ATOM   2995  C CA  . VAL A  1 401  ? 214.772 194.266 140.845 1.00 40.56  ? 401  VAL A  CA  1 
ATOM   2996  C C   . VAL A  1 401  ? 214.019 192.964 141.063 1.00 40.92  ? 401  VAL A  C   1 
ATOM   2997  O O   . VAL A  1 401  ? 214.620 191.884 141.096 1.00 40.54  ? 401  VAL A  O   1 
ATOM   2998  C CB  . VAL A  1 401  ? 215.101 194.462 139.354 1.00 39.22  ? 401  VAL A  CB  1 
ATOM   2999  C CG1 . VAL A  1 401  ? 213.893 194.137 138.494 1.00 41.78  ? 401  VAL A  CG1 1 
ATOM   3000  C CG2 . VAL A  1 401  ? 215.544 195.876 139.112 1.00 41.90  ? 401  VAL A  CG2 1 
ATOM   3001  N N   . ILE A  1 402  ? 212.697 193.067 141.204 1.00 39.46  ? 402  ILE A  N   1 
ATOM   3002  C CA  . ILE A  1 402  ? 211.839 191.908 141.406 1.00 33.00  ? 402  ILE A  CA  1 
ATOM   3003  C C   . ILE A  1 402  ? 210.532 192.107 140.654 1.00 40.02  ? 402  ILE A  C   1 
ATOM   3004  O O   . ILE A  1 402  ? 210.193 193.208 140.219 1.00 48.41  ? 402  ILE A  O   1 
ATOM   3005  C CB  . ILE A  1 402  ? 211.543 191.643 142.898 1.00 32.82  ? 402  ILE A  CB  1 
ATOM   3006  C CG1 . ILE A  1 402  ? 211.119 192.933 143.595 1.00 36.78  ? 402  ILE A  CG1 1 
ATOM   3007  C CG2 . ILE A  1 402  ? 212.754 191.048 143.582 1.00 38.60  ? 402  ILE A  CG2 1 
ATOM   3008  C CD1 . ILE A  1 402  ? 210.413 192.704 144.909 1.00 33.83  ? 402  ILE A  CD1 1 
ATOM   3009  N N   . ARG A  1 403  ? 209.802 191.008 140.509 1.00 37.46  ? 403  ARG A  N   1 
ATOM   3010  C CA  . ARG A  1 403  ? 208.459 191.052 139.954 1.00 37.02  ? 403  ARG A  CA  1 
ATOM   3011  C C   . ARG A  1 403  ? 207.563 191.933 140.813 1.00 36.43  ? 403  ARG A  C   1 
ATOM   3012  O O   . ARG A  1 403  ? 207.715 191.998 142.035 1.00 52.88  ? 403  ARG A  O   1 
ATOM   3013  C CB  . ARG A  1 403  ? 207.897 189.635 139.875 1.00 42.52  ? 403  ARG A  CB  1 
ATOM   3014  C CG  . ARG A  1 403  ? 206.496 189.528 139.333 1.00 48.24  ? 403  ARG A  CG  1 
ATOM   3015  C CD  . ARG A  1 403  ? 206.034 188.086 139.368 1.00 52.50  ? 403  ARG A  CD  1 
ATOM   3016  N NE  . ARG A  1 403  ? 206.946 187.214 138.634 1.00 61.21  ? 403  ARG A  NE  1 
ATOM   3017  C CZ  . ARG A  1 403  ? 206.785 185.902 138.501 1.00 67.30  ? 403  ARG A  CZ  1 
ATOM   3018  N NH1 . ARG A  1 403  ? 205.740 185.299 139.053 1.00 60.93  ? 403  ARG A  NH1 1 
ATOM   3019  N NH2 . ARG A  1 403  ? 207.670 185.192 137.813 1.00 64.14  ? 403  ARG A  NH2 1 
ATOM   3020  N N   . GLY A  1 404  ? 206.631 192.631 140.163 1.00 30.97  ? 404  GLY A  N   1 
ATOM   3021  C CA  . GLY A  1 404  ? 205.764 193.540 140.892 1.00 31.61  ? 404  GLY A  CA  1 
ATOM   3022  C C   . GLY A  1 404  ? 204.953 192.864 141.977 1.00 39.57  ? 404  GLY A  C   1 
ATOM   3023  O O   . GLY A  1 404  ? 204.763 193.429 143.057 1.00 41.14  ? 404  GLY A  O   1 
ATOM   3024  N N   . ASP A  1 405  ? 204.461 191.653 141.714 1.00 51.02  ? 405  ASP A  N   1 
ATOM   3025  C CA  . ASP A  1 405  ? 203.661 190.952 142.711 1.00 45.67  ? 405  ASP A  CA  1 
ATOM   3026  C C   . ASP A  1 405  ? 204.454 190.632 143.970 1.00 41.83  ? 405  ASP A  C   1 
ATOM   3027  O O   . ASP A  1 405  ? 203.854 190.416 145.027 1.00 47.66  ? 405  ASP A  O   1 
ATOM   3028  C CB  . ASP A  1 405  ? 203.091 189.660 142.122 1.00 41.05  ? 405  ASP A  CB  1 
ATOM   3029  C CG  . ASP A  1 405  ? 201.977 189.913 141.127 1.00 60.60  ? 405  ASP A  CG  1 
ATOM   3030  O OD1 . ASP A  1 405  ? 201.369 191.003 141.175 1.00 61.08  ? 405  ASP A  OD1 1 
ATOM   3031  O OD2 . ASP A  1 405  ? 201.704 189.018 140.301 1.00 73.68  ? 405  ASP A  OD2 1 
ATOM   3032  N N   . GLU A  1 406  ? 205.782 190.603 143.888 1.00 42.30  ? 406  GLU A  N   1 
ATOM   3033  C CA  . GLU A  1 406  ? 206.607 190.185 145.011 1.00 35.34  ? 406  GLU A  CA  1 
ATOM   3034  C C   . GLU A  1 406  ? 207.100 191.343 145.869 1.00 36.00  ? 406  GLU A  C   1 
ATOM   3035  O O   . GLU A  1 406  ? 207.820 191.100 146.843 1.00 45.88  ? 406  GLU A  O   1 
ATOM   3036  C CB  . GLU A  1 406  ? 207.804 189.376 144.502 1.00 39.80  ? 406  GLU A  CB  1 
ATOM   3037  C CG  . GLU A  1 406  ? 207.418 188.237 143.577 1.00 41.17  ? 406  GLU A  CG  1 
ATOM   3038  C CD  . GLU A  1 406  ? 208.605 187.400 143.168 1.00 48.84  ? 406  GLU A  CD  1 
ATOM   3039  O OE1 . GLU A  1 406  ? 208.633 186.199 143.508 1.00 58.16  ? 406  GLU A  OE1 1 
ATOM   3040  O OE2 . GLU A  1 406  ? 209.520 187.946 142.519 1.00 51.94  ? 406  GLU A  OE2 1 
ATOM   3041  N N   . VAL A  1 407  ? 206.740 192.587 145.544 1.00 34.71  ? 407  VAL A  N   1 
ATOM   3042  C CA  . VAL A  1 407  ? 207.186 193.714 146.360 1.00 34.37  ? 407  VAL A  CA  1 
ATOM   3043  C C   . VAL A  1 407  ? 206.657 193.595 147.782 1.00 42.56  ? 407  VAL A  C   1 
ATOM   3044  O O   . VAL A  1 407  ? 207.299 194.056 148.732 1.00 49.26  ? 407  VAL A  O   1 
ATOM   3045  C CB  . VAL A  1 407  ? 206.759 195.048 145.719 1.00 33.74  ? 407  VAL A  CB  1 
ATOM   3046  C CG1 . VAL A  1 407  ? 207.072 196.207 146.654 1.00 34.75  ? 407  VAL A  CG1 1 
ATOM   3047  C CG2 . VAL A  1 407  ? 207.455 195.240 144.388 1.00 46.82  ? 407  VAL A  CG2 1 
ATOM   3048  N N   . ARG A  1 408  ? 205.484 192.985 147.956 1.00 33.69  ? 408  ARG A  N   1 
ATOM   3049  C CA  . ARG A  1 408  ? 204.941 192.805 149.297 1.00 32.67  ? 408  ARG A  CA  1 
ATOM   3050  C C   . ARG A  1 408  ? 205.845 191.930 150.155 1.00 36.84  ? 408  ARG A  C   1 
ATOM   3051  O O   . ARG A  1 408  ? 205.880 192.090 151.379 1.00 42.53  ? 408  ARG A  O   1 
ATOM   3052  C CB  . ARG A  1 408  ? 203.543 192.197 149.214 1.00 34.31  ? 408  ARG A  CB  1 
ATOM   3053  C CG  . ARG A  1 408  ? 203.529 190.808 148.614 1.00 42.83  ? 408  ARG A  CG  1 
ATOM   3054  C CD  . ARG A  1 408  ? 202.128 190.252 148.490 1.00 39.84  ? 408  ARG A  CD  1 
ATOM   3055  N NE  . ARG A  1 408  ? 202.146 188.892 147.961 1.00 30.23  ? 408  ARG A  NE  1 
ATOM   3056  C CZ  . ARG A  1 408  ? 202.340 187.803 148.696 1.00 34.90  ? 408  ARG A  CZ  1 
ATOM   3057  N NH1 . ARG A  1 408  ? 202.534 187.899 150.005 1.00 40.19  ? 408  ARG A  NH1 1 
ATOM   3058  N NH2 . ARG A  1 408  ? 202.343 186.610 148.120 1.00 38.99  ? 408  ARG A  NH2 1 
ATOM   3059  N N   . GLN A  1 409  ? 206.576 191.000 149.538 1.00 38.13  ? 409  GLN A  N   1 
ATOM   3060  C CA  . GLN A  1 409  ? 207.460 190.113 150.283 1.00 33.35  ? 409  GLN A  CA  1 
ATOM   3061  C C   . GLN A  1 409  ? 208.652 190.836 150.892 1.00 33.89  ? 409  GLN A  C   1 
ATOM   3062  O O   . GLN A  1 409  ? 209.356 190.243 151.715 1.00 34.76  ? 409  GLN A  O   1 
ATOM   3063  C CB  . GLN A  1 409  ? 207.962 188.991 149.377 1.00 32.28  ? 409  GLN A  CB  1 
ATOM   3064  C CG  . GLN A  1 409  ? 206.863 188.163 148.755 1.00 28.67  ? 409  GLN A  CG  1 
ATOM   3065  C CD  . GLN A  1 409  ? 207.398 186.961 148.021 1.00 40.47  ? 409  GLN A  CD  1 
ATOM   3066  O OE1 . GLN A  1 409  ? 208.438 186.414 148.382 1.00 47.98  ? 409  GLN A  OE1 1 
ATOM   3067  N NE2 . GLN A  1 409  ? 206.695 186.541 146.977 1.00 44.59  ? 409  GLN A  NE2 1 
ATOM   3068  N N   . ILE A  1 410  ? 208.903 192.090 150.510 1.00 34.17  ? 410  ILE A  N   1 
ATOM   3069  C CA  . ILE A  1 410  ? 210.049 192.814 151.053 1.00 33.59  ? 410  ILE A  CA  1 
ATOM   3070  C C   . ILE A  1 410  ? 209.780 193.361 152.445 1.00 38.79  ? 410  ILE A  C   1 
ATOM   3071  O O   . ILE A  1 410  ? 210.706 193.859 153.094 1.00 43.86  ? 410  ILE A  O   1 
ATOM   3072  C CB  . ILE A  1 410  ? 210.457 193.951 150.098 1.00 26.79  ? 410  ILE A  CB  1 
ATOM   3073  C CG1 . ILE A  1 410  ? 210.667 193.410 148.680 1.00 27.76  ? 410  ILE A  CG1 1 
ATOM   3074  C CG2 . ILE A  1 410  ? 211.730 194.635 150.579 1.00 33.01  ? 410  ILE A  CG2 1 
ATOM   3075  C CD1 . ILE A  1 410  ? 211.665 192.269 148.585 1.00 35.91  ? 410  ILE A  CD1 1 
ATOM   3076  N N   . ALA A  1 411  ? 208.542 193.285 152.924 1.00 41.58  ? 411  ALA A  N   1 
ATOM   3077  C CA  . ALA A  1 411  ? 208.247 193.660 154.296 1.00 34.46  ? 411  ALA A  CA  1 
ATOM   3078  C C   . ALA A  1 411  ? 208.893 192.667 155.263 1.00 35.28  ? 411  ALA A  C   1 
ATOM   3079  O O   . ALA A  1 411  ? 209.038 191.484 154.943 1.00 38.68  ? 411  ALA A  O   1 
ATOM   3080  C CB  . ALA A  1 411  ? 206.740 193.703 154.526 1.00 46.22  ? 411  ALA A  CB  1 
ATOM   3081  N N   . PRO A  1 412  ? 209.290 193.116 156.454 1.00 38.45  ? 412  PRO A  N   1 
ATOM   3082  C CA  . PRO A  1 412  ? 209.862 192.183 157.434 1.00 42.33  ? 412  PRO A  CA  1 
ATOM   3083  C C   . PRO A  1 412  ? 208.806 191.219 157.953 1.00 49.73  ? 412  PRO A  C   1 
ATOM   3084  O O   . PRO A  1 412  ? 207.678 191.613 158.254 1.00 54.54  ? 412  PRO A  O   1 
ATOM   3085  C CB  . PRO A  1 412  ? 210.381 193.104 158.541 1.00 35.02  ? 412  PRO A  CB  1 
ATOM   3086  C CG  . PRO A  1 412  ? 209.549 194.320 158.434 1.00 34.24  ? 412  PRO A  CG  1 
ATOM   3087  C CD  . PRO A  1 412  ? 209.225 194.489 156.980 1.00 42.24  ? 412  PRO A  CD  1 
ATOM   3088  N N   . GLY A  1 413  ? 209.183 189.948 158.058 1.00 54.99  ? 413  GLY A  N   1 
ATOM   3089  C CA  . GLY A  1 413  ? 208.261 188.926 158.512 1.00 63.48  ? 413  GLY A  CA  1 
ATOM   3090  C C   . GLY A  1 413  ? 207.317 188.473 157.421 1.00 47.81  ? 413  GLY A  C   1 
ATOM   3091  O O   . GLY A  1 413  ? 206.097 188.606 157.549 1.00 39.00  ? 413  GLY A  O   1 
ATOM   3092  N N   . GLN A  1 414  ? 207.874 187.935 156.340 1.00 51.80  ? 414  GLN A  N   1 
ATOM   3093  C CA  . GLN A  1 414  ? 207.102 187.508 155.186 1.00 51.20  ? 414  GLN A  CA  1 
ATOM   3094  C C   . GLN A  1 414  ? 207.574 186.135 154.734 1.00 56.38  ? 414  GLN A  C   1 
ATOM   3095  O O   . GLN A  1 414  ? 208.635 185.653 155.140 1.00 64.32  ? 414  GLN A  O   1 
ATOM   3096  C CB  . GLN A  1 414  ? 207.230 188.501 154.025 1.00 43.68  ? 414  GLN A  CB  1 
ATOM   3097  C CG  . GLN A  1 414  ? 206.318 189.706 154.128 1.00 41.85  ? 414  GLN A  CG  1 
ATOM   3098  C CD  . GLN A  1 414  ? 204.901 189.397 153.711 1.00 41.23  ? 414  GLN A  CD  1 
ATOM   3099  O OE1 . GLN A  1 414  ? 204.382 188.315 153.986 1.00 49.18  ? 414  GLN A  OE1 1 
ATOM   3100  N NE2 . GLN A  1 414  ? 204.263 190.343 153.034 1.00 53.69  ? 414  GLN A  NE2 1 
ATOM   3101  N N   . THR A  1 415  ? 206.768 185.509 153.882 1.00 50.47  ? 415  THR A  N   1 
ATOM   3102  C CA  . THR A  1 415  ? 207.141 184.262 153.238 1.00 51.63  ? 415  THR A  CA  1 
ATOM   3103  C C   . THR A  1 415  ? 206.810 184.370 151.758 1.00 53.38  ? 415  THR A  C   1 
ATOM   3104  O O   . THR A  1 415  ? 206.164 185.319 151.308 1.00 50.22  ? 415  THR A  O   1 
ATOM   3105  C CB  . THR A  1 415  ? 206.442 183.052 153.870 1.00 50.90  ? 415  THR A  CB  1 
ATOM   3106  O OG1 . THR A  1 415  ? 207.090 181.851 153.435 1.00 54.38  ? 415  THR A  OG1 1 
ATOM   3107  C CG2 . THR A  1 415  ? 204.980 183.002 153.472 1.00 44.18  ? 415  THR A  CG2 1 
ATOM   3108  N N   . GLY A  1 416  ? 207.261 183.378 151.000 1.00 47.44  ? 416  GLY A  N   1 
ATOM   3109  C CA  . GLY A  1 416  ? 207.282 183.476 149.556 1.00 41.09  ? 416  GLY A  CA  1 
ATOM   3110  C C   . GLY A  1 416  ? 208.705 183.318 149.075 1.00 40.05  ? 416  GLY A  C   1 
ATOM   3111  O O   . GLY A  1 416  ? 209.638 183.438 149.873 1.00 46.66  ? 416  GLY A  O   1 
ATOM   3112  N N   . LYS A  1 417  ? 208.902 183.049 147.785 1.00 39.39  ? 417  LYS A  N   1 
ATOM   3113  C CA  . LYS A  1 417  ? 210.236 182.667 147.340 1.00 47.22  ? 417  LYS A  CA  1 
ATOM   3114  C C   . LYS A  1 417  ? 211.233 183.808 147.484 1.00 48.21  ? 417  LYS A  C   1 
ATOM   3115  O O   . LYS A  1 417  ? 212.427 183.559 147.670 1.00 47.12  ? 417  LYS A  O   1 
ATOM   3116  C CB  . LYS A  1 417  ? 210.199 182.150 145.901 1.00 51.64  ? 417  LYS A  CB  1 
ATOM   3117  C CG  . LYS A  1 417  ? 209.678 183.110 144.853 1.00 49.21  ? 417  LYS A  CG  1 
ATOM   3118  C CD  . LYS A  1 417  ? 209.769 182.462 143.477 1.00 45.03  ? 417  LYS A  CD  1 
ATOM   3119  C CE  . LYS A  1 417  ? 209.200 183.345 142.386 1.00 42.57  ? 417  LYS A  CE  1 
ATOM   3120  N NZ  . LYS A  1 417  ? 207.725 183.498 142.507 1.00 38.40  ? 417  LYS A  NZ  1 
ATOM   3121  N N   . ILE A  1 418  ? 210.784 185.061 147.413 1.00 51.33  ? 418  ILE A  N   1 
ATOM   3122  C CA  . ILE A  1 418  ? 211.723 186.166 147.578 1.00 43.94  ? 418  ILE A  CA  1 
ATOM   3123  C C   . ILE A  1 418  ? 212.132 186.304 149.038 1.00 45.45  ? 418  ILE A  C   1 
ATOM   3124  O O   . ILE A  1 418  ? 213.320 186.404 149.361 1.00 47.02  ? 418  ILE A  O   1 
ATOM   3125  C CB  . ILE A  1 418  ? 211.130 187.477 147.037 1.00 39.11  ? 418  ILE A  CB  1 
ATOM   3126  C CG1 . ILE A  1 418  ? 210.810 187.346 145.548 1.00 46.31  ? 418  ILE A  CG1 1 
ATOM   3127  C CG2 . ILE A  1 418  ? 212.097 188.628 147.279 1.00 37.50  ? 418  ILE A  CG2 1 
ATOM   3128  C CD1 . ILE A  1 418  ? 211.994 186.967 144.684 1.00 52.61  ? 418  ILE A  CD1 1 
ATOM   3129  N N   . ALA A  1 419  ? 211.154 186.310 149.944 1.00 46.04  ? 419  ALA A  N   1 
ATOM   3130  C CA  . ALA A  1 419  ? 211.468 186.408 151.365 1.00 41.93  ? 419  ALA A  CA  1 
ATOM   3131  C C   . ALA A  1 419  ? 212.211 185.172 151.849 1.00 46.74  ? 419  ALA A  C   1 
ATOM   3132  O O   . ALA A  1 419  ? 213.114 185.269 152.688 1.00 61.99  ? 419  ALA A  O   1 
ATOM   3133  C CB  . ALA A  1 419  ? 210.187 186.607 152.171 1.00 43.27  ? 419  ALA A  CB  1 
ATOM   3134  N N   . ASP A  1 420  ? 211.847 184.003 151.331 1.00 40.32  ? 420  ASP A  N   1 
ATOM   3135  C CA  . ASP A  1 420  ? 212.397 182.750 151.823 1.00 48.10  ? 420  ASP A  CA  1 
ATOM   3136  C C   . ASP A  1 420  ? 213.743 182.391 151.210 1.00 52.96  ? 420  ASP A  C   1 
ATOM   3137  O O   . ASP A  1 420  ? 214.506 181.646 151.834 1.00 58.27  ? 420  ASP A  O   1 
ATOM   3138  C CB  . ASP A  1 420  ? 211.416 181.603 151.557 1.00 51.64  ? 420  ASP A  CB  1 
ATOM   3139  C CG  . ASP A  1 420  ? 210.245 181.597 152.519 1.00 61.45  ? 420  ASP A  CG  1 
ATOM   3140  O OD1 . ASP A  1 420  ? 210.140 182.532 153.340 1.00 70.31  ? 420  ASP A  OD1 1 
ATOM   3141  O OD2 . ASP A  1 420  ? 209.430 180.651 152.460 1.00 55.65  ? 420  ASP A  OD2 1 
ATOM   3142  N N   . TYR A  1 421  ? 214.069 182.889 150.013 1.00 52.17  ? 421  TYR A  N   1 
ATOM   3143  C CA  . TYR A  1 421  ? 215.164 182.308 149.246 1.00 42.15  ? 421  TYR A  CA  1 
ATOM   3144  C C   . TYR A  1 421  ? 216.226 183.281 148.755 1.00 41.56  ? 421  TYR A  C   1 
ATOM   3145  O O   . TYR A  1 421  ? 217.329 182.828 148.429 1.00 44.35  ? 421  TYR A  O   1 
ATOM   3146  C CB  . TYR A  1 421  ? 214.608 181.540 148.034 1.00 43.83  ? 421  TYR A  CB  1 
ATOM   3147  C CG  . TYR A  1 421  ? 213.716 180.378 148.413 1.00 44.37  ? 421  TYR A  CG  1 
ATOM   3148  C CD1 . TYR A  1 421  ? 213.944 179.658 149.574 1.00 41.08  ? 421  TYR A  CD1 1 
ATOM   3149  C CD2 . TYR A  1 421  ? 212.647 180.002 147.613 1.00 50.78  ? 421  TYR A  CD2 1 
ATOM   3150  C CE1 . TYR A  1 421  ? 213.143 178.602 149.929 1.00 48.24  ? 421  TYR A  CE1 1 
ATOM   3151  C CE2 . TYR A  1 421  ? 211.836 178.944 147.962 1.00 53.85  ? 421  TYR A  CE2 1 
ATOM   3152  C CZ  . TYR A  1 421  ? 212.090 178.247 149.122 1.00 60.18  ? 421  TYR A  CZ  1 
ATOM   3153  O OH  . TYR A  1 421  ? 211.289 177.189 149.481 1.00 72.77  ? 421  TYR A  OH  1 
ATOM   3154  N N   . ASN A  1 422  ? 215.951 184.584 148.663 1.00 44.13  ? 422  ASN A  N   1 
ATOM   3155  C CA  . ASN A  1 422  ? 217.026 185.496 148.274 1.00 41.08  ? 422  ASN A  CA  1 
ATOM   3156  C C   . ASN A  1 422  ? 217.110 186.790 149.077 1.00 43.07  ? 422  ASN A  C   1 
ATOM   3157  O O   . ASN A  1 422  ? 218.191 187.386 149.107 1.00 45.43  ? 422  ASN A  O   1 
ATOM   3158  C CB  . ASN A  1 422  ? 216.909 185.845 146.792 1.00 44.94  ? 422  ASN A  CB  1 
ATOM   3159  C CG  . ASN A  1 422  ? 215.517 186.213 146.410 1.00 47.71  ? 422  ASN A  CG  1 
ATOM   3160  O OD1 . ASN A  1 422  ? 214.697 186.517 147.271 1.00 56.80  ? 422  ASN A  OD1 1 
ATOM   3161  N ND2 . ASN A  1 422  ? 215.228 186.192 145.119 1.00 39.53  ? 422  ASN A  ND2 1 
ATOM   3162  N N   . TYR A  1 423  ? 216.044 187.260 149.728 1.00 35.24  ? 423  TYR A  N   1 
ATOM   3163  C CA  . TYR A  1 423  ? 216.133 188.523 150.466 1.00 40.76  ? 423  TYR A  CA  1 
ATOM   3164  C C   . TYR A  1 423  ? 215.190 188.471 151.664 1.00 43.79  ? 423  TYR A  C   1 
ATOM   3165  O O   . TYR A  1 423  ? 213.969 188.499 151.499 1.00 48.73  ? 423  TYR A  O   1 
ATOM   3166  C CB  . TYR A  1 423  ? 215.820 189.714 149.575 1.00 41.96  ? 423  TYR A  CB  1 
ATOM   3167  C CG  . TYR A  1 423  ? 216.173 191.024 150.231 1.00 38.44  ? 423  TYR A  CG  1 
ATOM   3168  C CD1 . TYR A  1 423  ? 217.479 191.477 150.246 1.00 38.71  ? 423  TYR A  CD1 1 
ATOM   3169  C CD2 . TYR A  1 423  ? 215.206 191.797 150.853 1.00 39.25  ? 423  TYR A  CD2 1 
ATOM   3170  C CE1 . TYR A  1 423  ? 217.812 192.663 150.850 1.00 34.57  ? 423  TYR A  CE1 1 
ATOM   3171  C CE2 . TYR A  1 423  ? 215.534 192.987 151.460 1.00 42.71  ? 423  TYR A  CE2 1 
ATOM   3172  C CZ  . TYR A  1 423  ? 216.840 193.414 151.455 1.00 40.41  ? 423  TYR A  CZ  1 
ATOM   3173  O OH  . TYR A  1 423  ? 217.182 194.601 152.055 1.00 54.03  ? 423  TYR A  OH  1 
ATOM   3174  N N   . LYS A  1 424  ? 215.767 188.401 152.861 1.00 37.44  ? 424  LYS A  N   1 
ATOM   3175  C CA  . LYS A  1 424  ? 215.011 188.408 154.105 1.00 36.23  ? 424  LYS A  CA  1 
ATOM   3176  C C   . LYS A  1 424  ? 215.348 189.658 154.909 1.00 37.57  ? 424  LYS A  C   1 
ATOM   3177  O O   . LYS A  1 424  ? 216.520 190.026 155.028 1.00 35.02  ? 424  LYS A  O   1 
ATOM   3178  C CB  . LYS A  1 424  ? 215.319 187.155 154.922 1.00 39.66  ? 424  LYS A  CB  1 
ATOM   3179  C CG  . LYS A  1 424  ? 214.396 186.935 156.103 1.00 46.37  ? 424  LYS A  CG  1 
ATOM   3180  C CD  . LYS A  1 424  ? 213.154 186.175 155.687 1.00 55.12  ? 424  LYS A  CD  1 
ATOM   3181  C CE  . LYS A  1 424  ? 212.246 185.897 156.867 1.00 68.69  ? 424  LYS A  CE  1 
ATOM   3182  N NZ  . LYS A  1 424  ? 211.132 184.984 156.493 1.00 57.12  ? 424  LYS A  NZ  1 
ATOM   3183  N N   . LEU A  1 425  ? 214.318 190.314 155.450 1.00 42.65  ? 425  LEU A  N   1 
ATOM   3184  C CA  . LEU A  1 425  ? 214.534 191.429 156.365 1.00 38.89  ? 425  LEU A  CA  1 
ATOM   3185  C C   . LEU A  1 425  ? 214.350 190.981 157.811 1.00 38.38  ? 425  LEU A  C   1 
ATOM   3186  O O   . LEU A  1 425  ? 213.481 190.151 158.095 1.00 44.69  ? 425  LEU A  O   1 
ATOM   3187  C CB  . LEU A  1 425  ? 213.567 192.579 156.078 1.00 32.63  ? 425  LEU A  CB  1 
ATOM   3188  C CG  . LEU A  1 425  ? 213.814 193.443 154.842 1.00 27.26  ? 425  LEU A  CG  1 
ATOM   3189  C CD1 . LEU A  1 425  ? 212.854 194.611 154.842 1.00 30.50  ? 425  LEU A  CD1 1 
ATOM   3190  C CD2 . LEU A  1 425  ? 215.248 193.934 154.795 1.00 30.46  ? 425  LEU A  CD2 1 
ATOM   3191  N N   . PRO A  1 426  ? 215.129 191.505 158.754 1.00 36.75  ? 426  PRO A  N   1 
ATOM   3192  C CA  . PRO A  1 426  ? 214.960 191.103 160.153 1.00 41.70  ? 426  PRO A  CA  1 
ATOM   3193  C C   . PRO A  1 426  ? 213.676 191.658 160.747 1.00 45.71  ? 426  PRO A  C   1 
ATOM   3194  O O   . PRO A  1 426  ? 213.067 192.595 160.228 1.00 49.99  ? 426  PRO A  O   1 
ATOM   3195  C CB  . PRO A  1 426  ? 216.195 191.689 160.841 1.00 44.11  ? 426  PRO A  CB  1 
ATOM   3196  C CG  . PRO A  1 426  ? 216.569 192.848 160.007 1.00 34.17  ? 426  PRO A  CG  1 
ATOM   3197  C CD  . PRO A  1 426  ? 216.207 192.494 158.595 1.00 34.98  ? 426  PRO A  CD  1 
ATOM   3198  N N   . ASP A  1 427  ? 213.259 191.047 161.859 1.00 46.44  ? 427  ASP A  N   1 
ATOM   3199  C CA  . ASP A  1 427  ? 212.017 191.455 162.507 1.00 40.51  ? 427  ASP A  CA  1 
ATOM   3200  C C   . ASP A  1 427  ? 212.128 192.841 163.130 1.00 48.42  ? 427  ASP A  C   1 
ATOM   3201  O O   . ASP A  1 427  ? 211.134 193.573 163.185 1.00 54.61  ? 427  ASP A  O   1 
ATOM   3202  C CB  . ASP A  1 427  ? 211.623 190.429 163.568 1.00 48.33  ? 427  ASP A  CB  1 
ATOM   3203  C CG  . ASP A  1 427  ? 211.437 189.038 162.996 1.00 53.08  ? 427  ASP A  CG  1 
ATOM   3204  O OD1 . ASP A  1 427  ? 211.158 188.925 161.784 1.00 44.18  ? 427  ASP A  OD1 1 
ATOM   3205  O OD2 . ASP A  1 427  ? 211.569 188.056 163.758 1.00 72.99  ? 427  ASP A  OD2 1 
ATOM   3206  N N   . ASP A  1 428  ? 213.318 193.220 163.598 1.00 51.32  ? 428  ASP A  N   1 
ATOM   3207  C CA  . ASP A  1 428  ? 213.563 194.538 164.170 1.00 48.98  ? 428  ASP A  CA  1 
ATOM   3208  C C   . ASP A  1 428  ? 214.131 195.507 163.140 1.00 43.61  ? 428  ASP A  C   1 
ATOM   3209  O O   . ASP A  1 428  ? 214.902 196.408 163.486 1.00 47.44  ? 428  ASP A  O   1 
ATOM   3210  C CB  . ASP A  1 428  ? 214.506 194.428 165.368 1.00 54.52  ? 428  ASP A  CB  1 
ATOM   3211  C CG  . ASP A  1 428  ? 215.815 193.757 165.016 1.00 57.14  ? 428  ASP A  CG  1 
ATOM   3212  O OD1 . ASP A  1 428  ? 215.938 193.256 163.879 1.00 59.87  ? 428  ASP A  OD1 1 
ATOM   3213  O OD2 . ASP A  1 428  ? 216.721 193.731 165.874 1.00 59.64  ? 428  ASP A  OD2 1 
ATOM   3214  N N   . PHE A  1 429  ? 213.761 195.328 161.874 1.00 35.94  ? 429  PHE A  N   1 
ATOM   3215  C CA  . PHE A  1 429  ? 214.265 196.147 160.781 1.00 32.40  ? 429  PHE A  CA  1 
ATOM   3216  C C   . PHE A  1 429  ? 213.979 197.625 161.007 1.00 45.17  ? 429  PHE A  C   1 
ATOM   3217  O O   . PHE A  1 429  ? 212.817 198.037 161.074 1.00 49.37  ? 429  PHE A  O   1 
ATOM   3218  C CB  . PHE A  1 429  ? 213.645 195.678 159.464 1.00 38.35  ? 429  PHE A  CB  1 
ATOM   3219  C CG  . PHE A  1 429  ? 213.915 196.586 158.304 1.00 41.20  ? 429  PHE A  CG  1 
ATOM   3220  C CD1 . PHE A  1 429  ? 215.207 196.832 157.884 1.00 38.87  ? 429  PHE A  CD1 1 
ATOM   3221  C CD2 . PHE A  1 429  ? 212.872 197.180 157.623 1.00 33.78  ? 429  PHE A  CD2 1 
ATOM   3222  C CE1 . PHE A  1 429  ? 215.452 197.662 156.816 1.00 31.91  ? 429  PHE A  CE1 1 
ATOM   3223  C CE2 . PHE A  1 429  ? 213.113 198.007 156.556 1.00 35.18  ? 429  PHE A  CE2 1 
ATOM   3224  C CZ  . PHE A  1 429  ? 214.403 198.249 156.151 1.00 33.76  ? 429  PHE A  CZ  1 
ATOM   3225  N N   . THR A  1 430  ? 215.035 198.427 161.132 1.00 44.83  ? 430  THR A  N   1 
ATOM   3226  C CA  . THR A  1 430  ? 214.929 199.880 161.186 1.00 39.83  ? 430  THR A  CA  1 
ATOM   3227  C C   . THR A  1 430  ? 215.327 200.424 159.820 1.00 39.01  ? 430  THR A  C   1 
ATOM   3228  O O   . THR A  1 430  ? 216.507 200.405 159.458 1.00 46.71  ? 430  THR A  O   1 
ATOM   3229  C CB  . THR A  1 430  ? 215.823 200.456 162.281 1.00 50.18  ? 430  THR A  CB  1 
ATOM   3230  O OG1 . THR A  1 430  ? 215.488 199.863 163.542 1.00 65.77  ? 430  THR A  OG1 1 
ATOM   3231  C CG2 . THR A  1 430  ? 215.657 201.966 162.374 1.00 38.39  ? 430  THR A  CG2 1 
ATOM   3232  N N   . GLY A  1 431  ? 214.349 200.903 159.065 1.00 37.71  ? 431  GLY A  N   1 
ATOM   3233  C CA  . GLY A  1 431  ? 214.617 201.377 157.723 1.00 41.57  ? 431  GLY A  CA  1 
ATOM   3234  C C   . GLY A  1 431  ? 213.333 201.699 157.000 1.00 43.08  ? 431  GLY A  C   1 
ATOM   3235  O O   . GLY A  1 431  ? 212.229 201.460 157.496 1.00 45.04  ? 431  GLY A  O   1 
ATOM   3236  N N   . CYS A  1 432  ? 213.503 202.259 155.805 1.00 43.00  ? 432  CYS A  N   1 
ATOM   3237  C CA  . CYS A  1 432  ? 212.402 202.610 154.919 1.00 37.33  ? 432  CYS A  CA  1 
ATOM   3238  C C   . CYS A  1 432  ? 212.602 201.889 153.594 1.00 28.98  ? 432  CYS A  C   1 
ATOM   3239  O O   . CYS A  1 432  ? 213.670 201.996 152.985 1.00 28.54  ? 432  CYS A  O   1 
ATOM   3240  C CB  . CYS A  1 432  ? 212.334 204.122 154.703 1.00 40.66  ? 432  CYS A  CB  1 
ATOM   3241  S SG  . CYS A  1 432  ? 212.106 205.110 156.206 1.00 65.51  ? 432  CYS A  SG  1 
ATOM   3242  N N   . VAL A  1 433  ? 211.583 201.153 153.159 1.00 32.41  ? 433  VAL A  N   1 
ATOM   3243  C CA  . VAL A  1 433  ? 211.630 200.393 151.913 1.00 26.88  ? 433  VAL A  CA  1 
ATOM   3244  C C   . VAL A  1 433  ? 210.977 201.204 150.805 1.00 35.45  ? 433  VAL A  C   1 
ATOM   3245  O O   . VAL A  1 433  ? 209.919 201.809 151.002 1.00 44.07  ? 433  VAL A  O   1 
ATOM   3246  C CB  . VAL A  1 433  ? 210.941 199.028 152.081 1.00 29.14  ? 433  VAL A  CB  1 
ATOM   3247  C CG1 . VAL A  1 433  ? 210.794 198.343 150.736 1.00 28.58  ? 433  VAL A  CG1 1 
ATOM   3248  C CG2 . VAL A  1 433  ? 211.730 198.156 153.039 1.00 36.80  ? 433  VAL A  CG2 1 
ATOM   3249  N N   . ILE A  1 434  ? 211.601 201.204 149.629 1.00 34.95  ? 434  ILE A  N   1 
ATOM   3250  C CA  . ILE A  1 434  ? 211.170 202.026 148.503 1.00 29.33  ? 434  ILE A  CA  1 
ATOM   3251  C C   . ILE A  1 434  ? 211.156 201.170 147.246 1.00 31.16  ? 434  ILE A  C   1 
ATOM   3252  O O   . ILE A  1 434  ? 212.111 200.434 146.979 1.00 41.36  ? 434  ILE A  O   1 
ATOM   3253  C CB  . ILE A  1 434  ? 212.088 203.247 148.304 1.00 26.34  ? 434  ILE A  CB  1 
ATOM   3254  C CG1 . ILE A  1 434  ? 211.998 204.180 149.510 1.00 27.11  ? 434  ILE A  CG1 1 
ATOM   3255  C CG2 . ILE A  1 434  ? 211.712 203.986 147.037 1.00 39.79  ? 434  ILE A  CG2 1 
ATOM   3256  C CD1 . ILE A  1 434  ? 213.239 204.990 149.735 1.00 26.37  ? 434  ILE A  CD1 1 
ATOM   3257  N N   . ALA A  1 435  ? 210.075 201.265 146.475 1.00 29.09  ? 435  ALA A  N   1 
ATOM   3258  C CA  . ALA A  1 435  ? 209.944 200.536 145.224 1.00 32.02  ? 435  ALA A  CA  1 
ATOM   3259  C C   . ALA A  1 435  ? 209.139 201.363 144.235 1.00 39.31  ? 435  ALA A  C   1 
ATOM   3260  O O   . ALA A  1 435  ? 208.273 202.146 144.631 1.00 45.24  ? 435  ALA A  O   1 
ATOM   3261  C CB  . ALA A  1 435  ? 209.268 199.178 145.430 1.00 29.29  ? 435  ALA A  CB  1 
ATOM   3262  N N   . TRP A  1 436  ? 209.435 201.194 142.948 1.00 40.87  ? 436  TRP A  N   1 
ATOM   3263  C CA  . TRP A  1 436  ? 208.693 201.868 141.893 1.00 35.72  ? 436  TRP A  CA  1 
ATOM   3264  C C   . TRP A  1 436  ? 208.681 201.004 140.642 1.00 38.77  ? 436  TRP A  C   1 
ATOM   3265  O O   . TRP A  1 436  ? 209.655 200.308 140.348 1.00 39.11  ? 436  TRP A  O   1 
ATOM   3266  C CB  . TRP A  1 436  ? 209.292 203.239 141.573 1.00 38.54  ? 436  TRP A  CB  1 
ATOM   3267  C CG  . TRP A  1 436  ? 210.693 203.178 141.096 1.00 37.87  ? 436  TRP A  CG  1 
ATOM   3268  C CD1 . TRP A  1 436  ? 211.126 203.261 139.807 1.00 46.82  ? 436  TRP A  CD1 1 
ATOM   3269  C CD2 . TRP A  1 436  ? 211.862 203.021 141.903 1.00 37.38  ? 436  TRP A  CD2 1 
ATOM   3270  N NE1 . TRP A  1 436  ? 212.492 203.167 139.762 1.00 53.73  ? 436  TRP A  NE1 1 
ATOM   3271  C CE2 . TRP A  1 436  ? 212.968 203.017 141.036 1.00 44.66  ? 436  TRP A  CE2 1 
ATOM   3272  C CE3 . TRP A  1 436  ? 212.081 202.883 143.275 1.00 36.84  ? 436  TRP A  CE3 1 
ATOM   3273  C CZ2 . TRP A  1 436  ? 214.271 202.880 141.494 1.00 40.50  ? 436  TRP A  CZ2 1 
ATOM   3274  C CZ3 . TRP A  1 436  ? 213.374 202.746 143.726 1.00 32.82  ? 436  TRP A  CZ3 1 
ATOM   3275  C CH2 . TRP A  1 436  ? 214.453 202.747 142.839 1.00 32.37  ? 436  TRP A  CH2 1 
ATOM   3276  N N   . ASN A  1 437  ? 207.571 201.058 139.912 1.00 41.76  ? 437  ASN A  N   1 
ATOM   3277  C CA  . ASN A  1 437  ? 207.442 200.299 138.676 1.00 38.42  ? 437  ASN A  CA  1 
ATOM   3278  C C   . ASN A  1 437  ? 208.504 200.726 137.670 1.00 37.94  ? 437  ASN A  C   1 
ATOM   3279  O O   . ASN A  1 437  ? 208.717 201.919 137.444 1.00 47.72  ? 437  ASN A  O   1 
ATOM   3280  C CB  . ASN A  1 437  ? 206.049 200.502 138.088 1.00 40.92  ? 437  ASN A  CB  1 
ATOM   3281  C CG  . ASN A  1 437  ? 205.886 199.844 136.741 1.00 37.03  ? 437  ASN A  CG  1 
ATOM   3282  O OD1 . ASN A  1 437  ? 206.648 198.951 136.379 1.00 37.80  ? 437  ASN A  OD1 1 
ATOM   3283  N ND2 . ASN A  1 437  ? 204.885 200.279 135.987 1.00 38.03  ? 437  ASN A  ND2 1 
ATOM   3284  N N   . SER A  1 438  ? 209.168 199.740 137.057 1.00 42.26  ? 438  SER A  N   1 
ATOM   3285  C CA  . SER A  1 438  ? 210.245 200.010 136.109 1.00 40.64  ? 438  SER A  CA  1 
ATOM   3286  C C   . SER A  1 438  ? 210.046 199.289 134.781 1.00 47.50  ? 438  SER A  C   1 
ATOM   3287  O O   . SER A  1 438  ? 211.028 198.877 134.158 1.00 53.57  ? 438  SER A  O   1 
ATOM   3288  C CB  . SER A  1 438  ? 211.598 199.621 136.704 1.00 42.16  ? 438  SER A  CB  1 
ATOM   3289  O OG  . SER A  1 438  ? 211.867 200.360 137.878 1.00 56.51  ? 438  SER A  OG  1 
ATOM   3290  N N   . ASN A  1 439  ? 208.802 199.117 134.333 1.00 47.99  ? 439  ASN A  N   1 
ATOM   3291  C CA  . ASN A  1 439  ? 208.580 198.430 133.066 1.00 46.82  ? 439  ASN A  CA  1 
ATOM   3292  C C   . ASN A  1 439  ? 209.283 199.147 131.921 1.00 56.90  ? 439  ASN A  C   1 
ATOM   3293  O O   . ASN A  1 439  ? 209.875 198.506 131.047 1.00 66.41  ? 439  ASN A  O   1 
ATOM   3294  C CB  . ASN A  1 439  ? 207.085 198.320 132.773 1.00 46.11  ? 439  ASN A  CB  1 
ATOM   3295  C CG  . ASN A  1 439  ? 206.792 197.386 131.621 1.00 50.83  ? 439  ASN A  CG  1 
ATOM   3296  O OD1 . ASN A  1 439  ? 207.441 196.352 131.471 1.00 57.81  ? 439  ASN A  OD1 1 
ATOM   3297  N ND2 . ASN A  1 439  ? 205.823 197.748 130.790 1.00 61.66  ? 439  ASN A  ND2 1 
ATOM   3298  N N   . ASN A  1 440  ? 209.238 200.479 131.915 1.00 55.88  ? 440  ASN A  N   1 
ATOM   3299  C CA  . ASN A  1 440  ? 209.816 201.231 130.809 1.00 53.72  ? 440  ASN A  CA  1 
ATOM   3300  C C   . ASN A  1 440  ? 211.333 201.120 130.759 1.00 51.11  ? 440  ASN A  C   1 
ATOM   3301  O O   . ASN A  1 440  ? 211.914 201.252 129.677 1.00 51.65  ? 440  ASN A  O   1 
ATOM   3302  C CB  . ASN A  1 440  ? 209.414 202.703 130.909 1.00 55.74  ? 440  ASN A  CB  1 
ATOM   3303  C CG  . ASN A  1 440  ? 209.788 203.319 132.241 1.00 60.54  ? 440  ASN A  CG  1 
ATOM   3304  O OD1 . ASN A  1 440  ? 209.626 202.700 133.292 1.00 60.65  ? 440  ASN A  OD1 1 
ATOM   3305  N ND2 . ASN A  1 440  ? 210.297 204.546 132.203 1.00 58.73  ? 440  ASN A  ND2 1 
ATOM   3306  N N   . LEU A  1 441  ? 211.985 200.873 131.893 1.00 58.26  ? 441  LEU A  N   1 
ATOM   3307  C CA  . LEU A  1 441  ? 213.441 200.840 131.974 1.00 55.11  ? 441  LEU A  CA  1 
ATOM   3308  C C   . LEU A  1 441  ? 214.009 199.437 131.802 1.00 55.94  ? 441  LEU A  C   1 
ATOM   3309  O O   . LEU A  1 441  ? 214.905 199.226 130.981 1.00 67.33  ? 441  LEU A  O   1 
ATOM   3310  C CB  . LEU A  1 441  ? 213.904 201.412 133.318 1.00 51.32  ? 441  LEU A  CB  1 
ATOM   3311  C CG  . LEU A  1 441  ? 213.459 202.834 133.657 1.00 54.75  ? 441  LEU A  CG  1 
ATOM   3312  C CD1 . LEU A  1 441  ? 213.884 203.191 135.073 1.00 53.72  ? 441  LEU A  CD1 1 
ATOM   3313  C CD2 . LEU A  1 441  ? 214.027 203.829 132.658 1.00 53.19  ? 441  LEU A  CD2 1 
ATOM   3314  N N   . ASP A  1 442  ? 213.508 198.472 132.570 1.00 53.47  ? 442  ASP A  N   1 
ATOM   3315  C CA  . ASP A  1 442  ? 214.105 197.145 132.617 1.00 55.58  ? 442  ASP A  CA  1 
ATOM   3316  C C   . ASP A  1 442  ? 213.547 196.193 131.567 1.00 57.94  ? 442  ASP A  C   1 
ATOM   3317  O O   . ASP A  1 442  ? 214.254 195.269 131.150 1.00 63.26  ? 442  ASP A  O   1 
ATOM   3318  C CB  . ASP A  1 442  ? 213.905 196.538 134.008 1.00 54.71  ? 442  ASP A  CB  1 
ATOM   3319  C CG  . ASP A  1 442  ? 214.649 197.298 135.087 1.00 58.23  ? 442  ASP A  CG  1 
ATOM   3320  O OD1 . ASP A  1 442  ? 215.831 197.641 134.870 1.00 56.22  ? 442  ASP A  OD1 1 
ATOM   3321  O OD2 . ASP A  1 442  ? 214.050 197.560 136.150 1.00 54.67  ? 442  ASP A  OD2 1 
ATOM   3322  N N   . SER A  1 443  ? 212.306 196.388 131.131 1.00 52.85  ? 443  SER A  N   1 
ATOM   3323  C CA  . SER A  1 443  ? 211.683 195.441 130.218 1.00 59.99  ? 443  SER A  CA  1 
ATOM   3324  C C   . SER A  1 443  ? 212.279 195.549 128.820 1.00 64.60  ? 443  SER A  C   1 
ATOM   3325  O O   . SER A  1 443  ? 212.676 196.624 128.363 1.00 65.19  ? 443  SER A  O   1 
ATOM   3326  C CB  . SER A  1 443  ? 210.174 195.670 130.154 1.00 64.74  ? 443  SER A  CB  1 
ATOM   3327  O OG  . SER A  1 443  ? 209.591 195.566 131.440 1.00 68.13  ? 443  SER A  OG  1 
ATOM   3328  N N   . LYS A  1 444  ? 212.333 194.407 128.141 1.00 64.28  ? 444  LYS A  N   1 
ATOM   3329  C CA  . LYS A  1 444  ? 212.871 194.297 126.796 1.00 59.84  ? 444  LYS A  CA  1 
ATOM   3330  C C   . LYS A  1 444  ? 211.854 193.583 125.918 1.00 59.50  ? 444  LYS A  C   1 
ATOM   3331  O O   . LYS A  1 444  ? 211.183 192.647 126.360 1.00 63.84  ? 444  LYS A  O   1 
ATOM   3332  C CB  . LYS A  1 444  ? 214.207 193.542 126.817 1.00 61.27  ? 444  LYS A  CB  1 
ATOM   3333  C CG  . LYS A  1 444  ? 214.863 193.322 125.471 1.00 61.12  ? 444  LYS A  CG  1 
ATOM   3334  C CD  . LYS A  1 444  ? 216.170 192.569 125.660 1.00 55.12  ? 444  LYS A  CD  1 
ATOM   3335  C CE  . LYS A  1 444  ? 216.788 192.145 124.343 1.00 70.73  ? 444  LYS A  CE  1 
ATOM   3336  N NZ  . LYS A  1 444  ? 217.999 191.309 124.572 1.00 68.85  ? 444  LYS A  NZ  1 
ATOM   3337  N N   . VAL A  1 445  ? 211.745 194.031 124.665 1.00 59.11  ? 445  VAL A  N   1 
ATOM   3338  C CA  . VAL A  1 445  ? 210.695 193.519 123.789 1.00 62.50  ? 445  VAL A  CA  1 
ATOM   3339  C C   . VAL A  1 445  ? 210.827 192.013 123.617 1.00 73.43  ? 445  VAL A  C   1 
ATOM   3340  O O   . VAL A  1 445  ? 209.821 191.297 123.537 1.00 79.31  ? 445  VAL A  O   1 
ATOM   3341  C CB  . VAL A  1 445  ? 210.728 194.246 122.430 1.00 59.54  ? 445  VAL A  CB  1 
ATOM   3342  C CG1 . VAL A  1 445  ? 212.012 193.928 121.677 1.00 65.33  ? 445  VAL A  CG1 1 
ATOM   3343  C CG2 . VAL A  1 445  ? 209.506 193.883 121.600 1.00 61.19  ? 445  VAL A  CG2 1 
ATOM   3344  N N   . GLY A  1 446  ? 212.052 191.507 123.559 1.00 66.79  ? 446  GLY A  N   1 
ATOM   3345  C CA  . GLY A  1 446  ? 212.276 190.080 123.553 1.00 67.20  ? 446  GLY A  CA  1 
ATOM   3346  C C   . GLY A  1 446  ? 212.296 189.447 124.922 1.00 73.54  ? 446  GLY A  C   1 
ATOM   3347  O O   . GLY A  1 446  ? 212.554 188.246 125.041 1.00 83.28  ? 446  GLY A  O   1 
ATOM   3348  N N   . GLY A  1 447  ? 212.027 190.228 125.965 1.00 68.36  ? 447  GLY A  N   1 
ATOM   3349  C CA  . GLY A  1 447  ? 212.119 189.753 127.330 1.00 67.19  ? 447  GLY A  CA  1 
ATOM   3350  C C   . GLY A  1 447  ? 213.520 189.898 127.884 1.00 63.35  ? 447  GLY A  C   1 
ATOM   3351  O O   . GLY A  1 447  ? 214.481 189.385 127.305 1.00 69.87  ? 447  GLY A  O   1 
ATOM   3352  N N   . ASN A  1 448  ? 213.647 190.586 129.015 1.00 61.09  ? 448  ASN A  N   1 
ATOM   3353  C CA  . ASN A  1 448  ? 214.944 190.842 129.632 1.00 65.21  ? 448  ASN A  CA  1 
ATOM   3354  C C   . ASN A  1 448  ? 215.219 189.744 130.651 1.00 68.02  ? 448  ASN A  C   1 
ATOM   3355  O O   . ASN A  1 448  ? 214.584 189.694 131.709 1.00 56.64  ? 448  ASN A  O   1 
ATOM   3356  C CB  . ASN A  1 448  ? 214.967 192.221 130.285 1.00 58.86  ? 448  ASN A  CB  1 
ATOM   3357  C CG  . ASN A  1 448  ? 216.329 192.580 130.837 1.00 62.28  ? 448  ASN A  CG  1 
ATOM   3358  O OD1 . ASN A  1 448  ? 217.262 191.779 130.787 1.00 64.41  ? 448  ASN A  OD1 1 
ATOM   3359  N ND2 . ASN A  1 448  ? 216.456 193.794 131.359 1.00 57.50  ? 448  ASN A  ND2 1 
ATOM   3360  N N   . TYR A  1 449  ? 216.164 188.864 130.331 1.00 74.26  ? 449  TYR A  N   1 
ATOM   3361  C CA  . TYR A  1 449  ? 216.503 187.732 131.182 1.00 63.54  ? 449  TYR A  CA  1 
ATOM   3362  C C   . TYR A  1 449  ? 217.736 187.982 132.040 1.00 57.30  ? 449  TYR A  C   1 
ATOM   3363  O O   . TYR A  1 449  ? 218.213 187.054 132.701 1.00 56.15  ? 449  TYR A  O   1 
ATOM   3364  C CB  . TYR A  1 449  ? 216.711 186.484 130.323 1.00 66.22  ? 449  TYR A  CB  1 
ATOM   3365  C CG  . TYR A  1 449  ? 215.534 186.178 129.430 1.00 68.55  ? 449  TYR A  CG  1 
ATOM   3366  C CD1 . TYR A  1 449  ? 214.374 185.623 129.946 1.00 63.57  ? 449  TYR A  CD1 1 
ATOM   3367  C CD2 . TYR A  1 449  ? 215.579 186.449 128.073 1.00 74.85  ? 449  TYR A  CD2 1 
ATOM   3368  C CE1 . TYR A  1 449  ? 213.297 185.344 129.138 1.00 69.92  ? 449  TYR A  CE1 1 
ATOM   3369  C CE2 . TYR A  1 449  ? 214.504 186.173 127.256 1.00 75.74  ? 449  TYR A  CE2 1 
ATOM   3370  C CZ  . TYR A  1 449  ? 213.366 185.620 127.794 1.00 77.50  ? 449  TYR A  CZ  1 
ATOM   3371  O OH  . TYR A  1 449  ? 212.289 185.342 126.986 1.00 81.31  ? 449  TYR A  OH  1 
ATOM   3372  N N   . ASN A  1 450  ? 218.265 189.206 132.046 1.00 56.64  ? 450  ASN A  N   1 
ATOM   3373  C CA  . ASN A  1 450  ? 219.417 189.520 132.880 1.00 56.46  ? 450  ASN A  CA  1 
ATOM   3374  C C   . ASN A  1 450  ? 219.082 189.555 134.364 1.00 55.05  ? 450  ASN A  C   1 
ATOM   3375  O O   . ASN A  1 450  ? 220.004 189.623 135.184 1.00 49.86  ? 450  ASN A  O   1 
ATOM   3376  C CB  . ASN A  1 450  ? 220.015 190.866 132.469 1.00 60.37  ? 450  ASN A  CB  1 
ATOM   3377  C CG  . ASN A  1 450  ? 220.840 190.777 131.204 1.00 71.16  ? 450  ASN A  CG  1 
ATOM   3378  O OD1 . ASN A  1 450  ? 222.027 190.459 131.248 1.00 65.47  ? 450  ASN A  OD1 1 
ATOM   3379  N ND2 . ASN A  1 450  ? 220.218 191.062 130.067 1.00 67.95  ? 450  ASN A  ND2 1 
ATOM   3380  N N   . TYR A  1 451  ? 217.805 189.513 134.731 1.00 60.20  ? 451  TYR A  N   1 
ATOM   3381  C CA  . TYR A  1 451  ? 217.389 189.598 136.125 1.00 51.42  ? 451  TYR A  CA  1 
ATOM   3382  C C   . TYR A  1 451  ? 217.012 188.208 136.622 1.00 51.90  ? 451  TYR A  C   1 
ATOM   3383  O O   . TYR A  1 451  ? 216.107 187.570 136.073 1.00 53.85  ? 451  TYR A  O   1 
ATOM   3384  C CB  . TYR A  1 451  ? 216.226 190.574 136.288 1.00 40.45  ? 451  TYR A  CB  1 
ATOM   3385  C CG  . TYR A  1 451  ? 216.647 192.018 136.146 1.00 39.12  ? 451  TYR A  CG  1 
ATOM   3386  C CD1 . TYR A  1 451  ? 217.426 192.628 137.115 1.00 40.88  ? 451  TYR A  CD1 1 
ATOM   3387  C CD2 . TYR A  1 451  ? 216.273 192.769 135.044 1.00 50.35  ? 451  TYR A  CD2 1 
ATOM   3388  C CE1 . TYR A  1 451  ? 217.817 193.939 136.993 1.00 37.62  ? 451  TYR A  CE1 1 
ATOM   3389  C CE2 . TYR A  1 451  ? 216.661 194.085 134.916 1.00 56.54  ? 451  TYR A  CE2 1 
ATOM   3390  C CZ  . TYR A  1 451  ? 217.433 194.664 135.894 1.00 44.75  ? 451  TYR A  CZ  1 
ATOM   3391  O OH  . TYR A  1 451  ? 217.823 195.976 135.774 1.00 51.41  ? 451  TYR A  OH  1 
ATOM   3392  N N   . LEU A  1 452  ? 217.704 187.748 137.661 1.00 46.54  ? 452  LEU A  N   1 
ATOM   3393  C CA  . LEU A  1 452  ? 217.596 186.385 138.160 1.00 46.32  ? 452  LEU A  CA  1 
ATOM   3394  C C   . LEU A  1 452  ? 217.064 186.386 139.584 1.00 42.40  ? 452  LEU A  C   1 
ATOM   3395  O O   . LEU A  1 452  ? 217.301 187.328 140.347 1.00 47.16  ? 452  LEU A  O   1 
ATOM   3396  C CB  . LEU A  1 452  ? 218.957 185.676 138.131 1.00 48.94  ? 452  LEU A  CB  1 
ATOM   3397  C CG  . LEU A  1 452  ? 219.455 185.137 136.790 1.00 36.93  ? 452  LEU A  CG  1 
ATOM   3398  C CD1 . LEU A  1 452  ? 218.641 183.930 136.377 1.00 34.13  ? 452  LEU A  CD1 1 
ATOM   3399  C CD2 . LEU A  1 452  ? 219.403 186.209 135.719 1.00 40.85  ? 452  LEU A  CD2 1 
ATOM   3400  N N   . TYR A  1 453  ? 216.334 185.330 139.931 1.00 37.60  ? 453  TYR A  N   1 
ATOM   3401  C CA  . TYR A  1 453  ? 215.913 185.078 141.299 1.00 34.51  ? 453  TYR A  CA  1 
ATOM   3402  C C   . TYR A  1 453  ? 216.125 183.605 141.619 1.00 44.13  ? 453  TYR A  C   1 
ATOM   3403  O O   . TYR A  1 453  ? 216.142 182.752 140.730 1.00 55.73  ? 453  TYR A  O   1 
ATOM   3404  C CB  . TYR A  1 453  ? 214.447 185.464 141.518 1.00 41.73  ? 453  TYR A  CB  1 
ATOM   3405  C CG  . TYR A  1 453  ? 213.460 184.619 140.748 1.00 45.37  ? 453  TYR A  CG  1 
ATOM   3406  C CD1 . TYR A  1 453  ? 212.924 183.469 141.302 1.00 52.78  ? 453  TYR A  CD1 1 
ATOM   3407  C CD2 . TYR A  1 453  ? 213.057 184.977 139.473 1.00 47.23  ? 453  TYR A  CD2 1 
ATOM   3408  C CE1 . TYR A  1 453  ? 212.022 182.700 140.606 1.00 51.16  ? 453  TYR A  CE1 1 
ATOM   3409  C CE2 . TYR A  1 453  ? 212.154 184.213 138.771 1.00 51.20  ? 453  TYR A  CE2 1 
ATOM   3410  C CZ  . TYR A  1 453  ? 211.640 183.077 139.342 1.00 52.87  ? 453  TYR A  CZ  1 
ATOM   3411  O OH  . TYR A  1 453  ? 210.739 182.311 138.641 1.00 61.04  ? 453  TYR A  OH  1 
ATOM   3412  N N   . ARG A  1 454  ? 216.282 183.312 142.907 1.00 46.93  ? 454  ARG A  N   1 
ATOM   3413  C CA  . ARG A  1 454  ? 216.549 181.956 143.368 1.00 36.88  ? 454  ARG A  CA  1 
ATOM   3414  C C   . ARG A  1 454  ? 215.233 181.256 143.678 1.00 44.31  ? 454  ARG A  C   1 
ATOM   3415  O O   . ARG A  1 454  ? 214.440 181.741 144.491 1.00 50.51  ? 454  ARG A  O   1 
ATOM   3416  C CB  . ARG A  1 454  ? 217.450 181.970 144.599 1.00 40.18  ? 454  ARG A  CB  1 
ATOM   3417  C CG  . ARG A  1 454  ? 217.815 180.586 145.105 1.00 38.25  ? 454  ARG A  CG  1 
ATOM   3418  C CD  . ARG A  1 454  ? 218.795 180.659 146.255 1.00 47.99  ? 454  ARG A  CD  1 
ATOM   3419  N NE  . ARG A  1 454  ? 220.034 181.330 145.885 1.00 52.79  ? 454  ARG A  NE  1 
ATOM   3420  C CZ  . ARG A  1 454  ? 221.060 180.732 145.291 1.00 50.15  ? 454  ARG A  CZ  1 
ATOM   3421  N NH1 . ARG A  1 454  ? 221.005 179.443 144.988 1.00 61.05  ? 454  ARG A  NH1 1 
ATOM   3422  N NH2 . ARG A  1 454  ? 222.146 181.429 144.997 1.00 52.80  ? 454  ARG A  NH2 1 
ATOM   3423  N N   . LEU A  1 455  ? 215.007 180.117 143.029 1.00 44.57  ? 455  LEU A  N   1 
ATOM   3424  C CA  . LEU A  1 455  ? 213.757 179.384 143.164 1.00 48.67  ? 455  LEU A  CA  1 
ATOM   3425  C C   . LEU A  1 455  ? 213.848 178.204 144.122 1.00 50.76  ? 455  LEU A  C   1 
ATOM   3426  O O   . LEU A  1 455  ? 212.807 177.714 144.573 1.00 45.32  ? 455  LEU A  O   1 
ATOM   3427  C CB  . LEU A  1 455  ? 213.307 178.890 141.785 1.00 58.23  ? 455  LEU A  CB  1 
ATOM   3428  C CG  . LEU A  1 455  ? 211.965 178.169 141.667 1.00 52.17  ? 455  LEU A  CG  1 
ATOM   3429  C CD1 . LEU A  1 455  ? 210.852 178.979 142.303 1.00 52.98  ? 455  LEU A  CD1 1 
ATOM   3430  C CD2 . LEU A  1 455  ? 211.664 177.906 140.202 1.00 62.39  ? 455  LEU A  CD2 1 
ATOM   3431  N N   . PHE A  1 456  ? 215.055 177.742 144.450 1.00 54.18  ? 456  PHE A  N   1 
ATOM   3432  C CA  . PHE A  1 456  ? 215.236 176.542 145.256 1.00 48.52  ? 456  PHE A  CA  1 
ATOM   3433  C C   . PHE A  1 456  ? 216.297 176.781 146.318 1.00 47.50  ? 456  PHE A  C   1 
ATOM   3434  O O   . PHE A  1 456  ? 217.315 177.427 146.055 1.00 54.41  ? 456  PHE A  O   1 
ATOM   3435  C CB  . PHE A  1 456  ? 215.641 175.345 144.386 1.00 52.46  ? 456  PHE A  CB  1 
ATOM   3436  C CG  . PHE A  1 456  ? 214.610 174.960 143.364 1.00 52.62  ? 456  PHE A  CG  1 
ATOM   3437  C CD1 . PHE A  1 456  ? 213.523 174.184 143.717 1.00 52.78  ? 456  PHE A  CD1 1 
ATOM   3438  C CD2 . PHE A  1 456  ? 214.731 175.373 142.051 1.00 52.52  ? 456  PHE A  CD2 1 
ATOM   3439  C CE1 . PHE A  1 456  ? 212.577 173.832 142.784 1.00 53.54  ? 456  PHE A  CE1 1 
ATOM   3440  C CE2 . PHE A  1 456  ? 213.787 175.022 141.114 1.00 51.32  ? 456  PHE A  CE2 1 
ATOM   3441  C CZ  . PHE A  1 456  ? 212.709 174.250 141.480 1.00 55.86  ? 456  PHE A  CZ  1 
ATOM   3442  N N   . ARG A  1 457  ? 216.058 176.243 147.513 1.00 45.61  ? 457  ARG A  N   1 
ATOM   3443  C CA  . ARG A  1 457  ? 217.001 176.334 148.619 1.00 56.08  ? 457  ARG A  CA  1 
ATOM   3444  C C   . ARG A  1 457  ? 216.721 175.206 149.596 1.00 54.68  ? 457  ARG A  C   1 
ATOM   3445  O O   . ARG A  1 457  ? 215.575 174.772 149.739 1.00 50.02  ? 457  ARG A  O   1 
ATOM   3446  C CB  . ARG A  1 457  ? 216.904 177.676 149.353 1.00 58.05  ? 457  ARG A  CB  1 
ATOM   3447  C CG  . ARG A  1 457  ? 217.839 178.752 148.845 1.00 51.28  ? 457  ARG A  CG  1 
ATOM   3448  C CD  . ARG A  1 457  ? 219.147 178.795 149.617 1.00 46.68  ? 457  ARG A  CD  1 
ATOM   3449  N NE  . ARG A  1 457  ? 218.941 179.041 151.040 1.00 47.69  ? 457  ARG A  NE  1 
ATOM   3450  C CZ  . ARG A  1 457  ? 219.920 179.207 151.923 1.00 55.45  ? 457  ARG A  CZ  1 
ATOM   3451  N NH1 . ARG A  1 457  ? 221.187 179.162 151.538 1.00 49.28  ? 457  ARG A  NH1 1 
ATOM   3452  N NH2 . ARG A  1 457  ? 219.630 179.423 153.197 1.00 66.93  ? 457  ARG A  NH2 1 
ATOM   3453  N N   . LYS A  1 458  ? 217.775 174.735 150.262 1.00 57.88  ? 458  LYS A  N   1 
ATOM   3454  C CA  . LYS A  1 458  ? 217.600 173.726 151.299 1.00 57.81  ? 458  LYS A  CA  1 
ATOM   3455  C C   . LYS A  1 458  ? 216.913 174.285 152.536 1.00 62.36  ? 458  LYS A  C   1 
ATOM   3456  O O   . LYS A  1 458  ? 216.280 173.524 153.275 1.00 67.52  ? 458  LYS A  O   1 
ATOM   3457  C CB  . LYS A  1 458  ? 218.953 173.128 151.681 1.00 66.24  ? 458  LYS A  CB  1 
ATOM   3458  C CG  . LYS A  1 458  ? 219.628 172.368 150.550 1.00 59.41  ? 458  LYS A  CG  1 
ATOM   3459  C CD  . LYS A  1 458  ? 220.945 171.750 150.989 1.00 58.14  ? 458  LYS A  CD  1 
ATOM   3460  C CE  . LYS A  1 458  ? 221.974 172.810 151.342 1.00 73.88  ? 458  LYS A  CE  1 
ATOM   3461  N NZ  . LYS A  1 458  ? 223.329 172.228 151.533 1.00 71.40  ? 458  LYS A  NZ  1 
ATOM   3462  N N   . SER A  1 459  ? 217.022 175.589 152.781 1.00 59.05  ? 459  SER A  N   1 
ATOM   3463  C CA  . SER A  1 459  ? 216.399 176.195 153.949 1.00 60.47  ? 459  SER A  CA  1 
ATOM   3464  C C   . SER A  1 459  ? 216.243 177.688 153.711 1.00 58.16  ? 459  SER A  C   1 
ATOM   3465  O O   . SER A  1 459  ? 216.936 178.281 152.882 1.00 63.64  ? 459  SER A  O   1 
ATOM   3466  C CB  . SER A  1 459  ? 217.218 175.941 155.219 1.00 69.52  ? 459  SER A  CB  1 
ATOM   3467  O OG  . SER A  1 459  ? 218.540 176.436 155.082 1.00 60.77  ? 459  SER A  OG  1 
ATOM   3468  N N   . ASN A  1 460  ? 215.321 178.288 154.459 1.00 58.99  ? 460  ASN A  N   1 
ATOM   3469  C CA  . ASN A  1 460  ? 215.121 179.728 154.388 1.00 53.78  ? 460  ASN A  CA  1 
ATOM   3470  C C   . ASN A  1 460  ? 216.379 180.443 154.860 1.00 53.45  ? 460  ASN A  C   1 
ATOM   3471  O O   . ASN A  1 460  ? 216.981 180.060 155.867 1.00 57.41  ? 460  ASN A  O   1 
ATOM   3472  C CB  . ASN A  1 460  ? 213.923 180.138 155.243 1.00 58.89  ? 460  ASN A  CB  1 
ATOM   3473  C CG  . ASN A  1 460  ? 212.688 179.321 154.943 1.00 57.63  ? 460  ASN A  CG  1 
ATOM   3474  O OD1 . ASN A  1 460  ? 212.007 179.547 153.945 1.00 49.47  ? 460  ASN A  OD1 1 
ATOM   3475  N ND2 . ASN A  1 460  ? 212.388 178.363 155.811 1.00 64.99  ? 460  ASN A  ND2 1 
ATOM   3476  N N   . LEU A  1 461  ? 216.785 181.475 154.127 1.00 44.59  ? 461  LEU A  N   1 
ATOM   3477  C CA  . LEU A  1 461  ? 218.011 182.178 154.466 1.00 48.41  ? 461  LEU A  CA  1 
ATOM   3478  C C   . LEU A  1 461  ? 217.779 183.175 155.595 1.00 49.23  ? 461  LEU A  C   1 
ATOM   3479  O O   . LEU A  1 461  ? 216.650 183.577 155.890 1.00 49.31  ? 461  LEU A  O   1 
ATOM   3480  C CB  . LEU A  1 461  ? 218.586 182.893 153.245 1.00 50.27  ? 461  LEU A  CB  1 
ATOM   3481  C CG  . LEU A  1 461  ? 217.729 183.916 152.505 1.00 38.48  ? 461  LEU A  CG  1 
ATOM   3482  C CD1 . LEU A  1 461  ? 217.699 185.259 153.207 1.00 43.51  ? 461  LEU A  CD1 1 
ATOM   3483  C CD2 . LEU A  1 461  ? 218.271 184.074 151.114 1.00 54.58  ? 461  LEU A  CD2 1 
ATOM   3484  N N   . LYS A  1 462  ? 218.877 183.565 156.235 1.00 48.86  ? 462  LYS A  N   1 
ATOM   3485  C CA  . LYS A  1 462  ? 218.817 184.471 157.366 1.00 47.39  ? 462  LYS A  CA  1 
ATOM   3486  C C   . LYS A  1 462  ? 218.666 185.918 156.902 1.00 51.57  ? 462  LYS A  C   1 
ATOM   3487  O O   . LYS A  1 462  ? 218.942 186.244 155.746 1.00 55.97  ? 462  LYS A  O   1 
ATOM   3488  C CB  . LYS A  1 462  ? 220.067 184.316 158.225 1.00 45.75  ? 462  LYS A  CB  1 
ATOM   3489  C CG  . LYS A  1 462  ? 220.068 183.034 159.037 1.00 46.34  ? 462  LYS A  CG  1 
ATOM   3490  C CD  . LYS A  1 462  ? 221.348 182.852 159.829 1.00 56.17  ? 462  LYS A  CD  1 
ATOM   3491  C CE  . LYS A  1 462  ? 222.500 182.425 158.938 1.00 60.53  ? 462  LYS A  CE  1 
ATOM   3492  N NZ  . LYS A  1 462  ? 223.651 181.917 159.731 1.00 53.51  ? 462  LYS A  NZ  1 
ATOM   3493  N N   . PRO A  1 463  ? 218.219 186.803 157.790 1.00 51.95  ? 463  PRO A  N   1 
ATOM   3494  C CA  . PRO A  1 463  ? 218.040 188.210 157.412 1.00 43.64  ? 463  PRO A  CA  1 
ATOM   3495  C C   . PRO A  1 463  ? 219.308 188.818 156.837 1.00 46.50  ? 463  PRO A  C   1 
ATOM   3496  O O   . PRO A  1 463  ? 220.413 188.586 157.330 1.00 47.14  ? 463  PRO A  O   1 
ATOM   3497  C CB  . PRO A  1 463  ? 217.646 188.876 158.731 1.00 38.20  ? 463  PRO A  CB  1 
ATOM   3498  C CG  . PRO A  1 463  ? 217.022 187.801 159.517 1.00 39.55  ? 463  PRO A  CG  1 
ATOM   3499  C CD  . PRO A  1 463  ? 217.746 186.542 159.158 1.00 55.95  ? 463  PRO A  CD  1 
ATOM   3500  N N   . PHE A  1 464  ? 219.137 189.608 155.778 1.00 46.94  ? 464  PHE A  N   1 
ATOM   3501  C CA  . PHE A  1 464  ? 220.249 190.306 155.136 1.00 42.82  ? 464  PHE A  CA  1 
ATOM   3502  C C   . PHE A  1 464  ? 221.337 189.336 154.687 1.00 43.87  ? 464  PHE A  C   1 
ATOM   3503  O O   . PHE A  1 464  ? 222.506 189.705 154.569 1.00 45.67  ? 464  PHE A  O   1 
ATOM   3504  C CB  . PHE A  1 464  ? 220.832 191.370 156.069 1.00 44.91  ? 464  PHE A  CB  1 
ATOM   3505  C CG  . PHE A  1 464  ? 219.933 192.560 156.271 1.00 45.19  ? 464  PHE A  CG  1 
ATOM   3506  C CD1 . PHE A  1 464  ? 219.235 193.108 155.210 1.00 42.74  ? 464  PHE A  CD1 1 
ATOM   3507  C CD2 . PHE A  1 464  ? 219.779 193.124 157.523 1.00 51.25  ? 464  PHE A  CD2 1 
ATOM   3508  C CE1 . PHE A  1 464  ? 218.411 194.193 155.393 1.00 40.25  ? 464  PHE A  CE1 1 
ATOM   3509  C CE2 . PHE A  1 464  ? 218.950 194.213 157.709 1.00 52.29  ? 464  PHE A  CE2 1 
ATOM   3510  C CZ  . PHE A  1 464  ? 218.266 194.745 156.642 1.00 42.09  ? 464  PHE A  CZ  1 
ATOM   3511  N N   . GLU A  1 465  ? 220.960 188.086 154.437 1.00 46.75  ? 465  GLU A  N   1 
ATOM   3512  C CA  . GLU A  1 465  ? 221.891 187.116 153.881 1.00 44.41  ? 465  GLU A  CA  1 
ATOM   3513  C C   . GLU A  1 465  ? 221.815 187.129 152.361 1.00 43.51  ? 465  GLU A  C   1 
ATOM   3514  O O   . GLU A  1 465  ? 220.729 187.203 151.780 1.00 48.94  ? 465  GLU A  O   1 
ATOM   3515  C CB  . GLU A  1 465  ? 221.587 185.713 154.404 1.00 49.40  ? 465  GLU A  CB  1 
ATOM   3516  C CG  . GLU A  1 465  ? 222.594 184.673 153.955 1.00 58.30  ? 465  GLU A  CG  1 
ATOM   3517  C CD  . GLU A  1 465  ? 222.290 183.291 154.488 1.00 60.36  ? 465  GLU A  CD  1 
ATOM   3518  O OE1 . GLU A  1 465  ? 222.706 182.304 153.848 1.00 64.72  ? 465  GLU A  OE1 1 
ATOM   3519  O OE2 . GLU A  1 465  ? 221.633 183.191 155.544 1.00 63.73  ? 465  GLU A  OE2 1 
ATOM   3520  N N   . ARG A  1 466  ? 222.977 187.045 151.719 1.00 48.31  ? 466  ARG A  N   1 
ATOM   3521  C CA  . ARG A  1 466  ? 223.085 187.029 150.265 1.00 52.62  ? 466  ARG A  CA  1 
ATOM   3522  C C   . ARG A  1 466  ? 223.676 185.691 149.848 1.00 60.95  ? 466  ARG A  C   1 
ATOM   3523  O O   . ARG A  1 466  ? 224.791 185.350 150.258 1.00 64.81  ? 466  ARG A  O   1 
ATOM   3524  C CB  . ARG A  1 466  ? 223.956 188.186 149.769 1.00 48.06  ? 466  ARG A  CB  1 
ATOM   3525  C CG  . ARG A  1 466  ? 223.997 188.339 148.262 1.00 45.91  ? 466  ARG A  CG  1 
ATOM   3526  C CD  . ARG A  1 466  ? 225.022 189.375 147.823 1.00 50.73  ? 466  ARG A  CD  1 
ATOM   3527  N NE  . ARG A  1 466  ? 224.926 190.624 148.576 1.00 44.61  ? 466  ARG A  NE  1 
ATOM   3528  C CZ  . ARG A  1 466  ? 225.662 190.920 149.644 1.00 46.03  ? 466  ARG A  CZ  1 
ATOM   3529  N NH1 . ARG A  1 466  ? 225.501 192.084 150.259 1.00 56.73  ? 466  ARG A  NH1 1 
ATOM   3530  N NH2 . ARG A  1 466  ? 226.559 190.059 150.107 1.00 50.84  ? 466  ARG A  NH2 1 
ATOM   3531  N N   . ASP A  1 467  ? 222.939 184.941 149.033 1.00 55.25  ? 467  ASP A  N   1 
ATOM   3532  C CA  . ASP A  1 467  ? 223.351 183.614 148.590 1.00 53.53  ? 467  ASP A  CA  1 
ATOM   3533  C C   . ASP A  1 467  ? 223.624 183.645 147.093 1.00 57.56  ? 467  ASP A  C   1 
ATOM   3534  O O   . ASP A  1 467  ? 222.710 183.878 146.295 1.00 61.26  ? 467  ASP A  O   1 
ATOM   3535  C CB  . ASP A  1 467  ? 222.280 182.575 148.917 1.00 63.73  ? 467  ASP A  CB  1 
ATOM   3536  C CG  . ASP A  1 467  ? 222.746 181.157 148.656 1.00 65.99  ? 467  ASP A  CG  1 
ATOM   3537  O OD1 . ASP A  1 467  ? 223.916 180.976 148.261 1.00 62.95  ? 467  ASP A  OD1 1 
ATOM   3538  O OD2 . ASP A  1 467  ? 221.943 180.221 148.849 1.00 65.37  ? 467  ASP A  OD2 1 
ATOM   3539  N N   . ILE A  1 468  ? 224.879 183.392 146.716 1.00 61.76  ? 468  ILE A  N   1 
ATOM   3540  C CA  . ILE A  1 468  ? 225.287 183.399 145.314 1.00 55.42  ? 468  ILE A  CA  1 
ATOM   3541  C C   . ILE A  1 468  ? 225.435 181.995 144.742 1.00 61.34  ? 468  ILE A  C   1 
ATOM   3542  O O   . ILE A  1 468  ? 225.622 181.851 143.523 1.00 68.01  ? 468  ILE A  O   1 
ATOM   3543  C CB  . ILE A  1 468  ? 226.610 184.175 145.131 1.00 51.81  ? 468  ILE A  CB  1 
ATOM   3544  C CG1 . ILE A  1 468  ? 226.508 185.576 145.742 1.00 50.75  ? 468  ILE A  CG1 1 
ATOM   3545  C CG2 . ILE A  1 468  ? 226.978 184.274 143.663 1.00 66.06  ? 468  ILE A  CG2 1 
ATOM   3546  C CD1 . ILE A  1 468  ? 225.469 186.462 145.095 1.00 55.70  ? 468  ILE A  CD1 1 
ATOM   3547  N N   . SER A  1 469  ? 225.351 180.958 145.573 1.00 59.95  ? 469  SER A  N   1 
ATOM   3548  C CA  . SER A  1 469  ? 225.597 179.598 145.116 1.00 60.09  ? 469  SER A  CA  1 
ATOM   3549  C C   . SER A  1 469  ? 224.688 179.236 143.949 1.00 64.99  ? 469  SER A  C   1 
ATOM   3550  O O   . SER A  1 469  ? 223.486 179.517 143.963 1.00 65.30  ? 469  SER A  O   1 
ATOM   3551  C CB  . SER A  1 469  ? 225.381 178.614 146.267 1.00 63.56  ? 469  SER A  CB  1 
ATOM   3552  O OG  . SER A  1 469  ? 225.534 177.276 145.829 1.00 65.29  ? 469  SER A  OG  1 
ATOM   3553  N N   . THR A  1 470  ? 225.280 178.608 142.933 1.00 66.40  ? 470  THR A  N   1 
ATOM   3554  C CA  . THR A  1 470  ? 224.547 178.053 141.804 1.00 64.38  ? 470  THR A  CA  1 
ATOM   3555  C C   . THR A  1 470  ? 224.522 176.532 141.816 1.00 65.81  ? 470  THR A  C   1 
ATOM   3556  O O   . THR A  1 470  ? 224.038 175.925 140.855 1.00 66.35  ? 470  THR A  O   1 
ATOM   3557  C CB  . THR A  1 470  ? 225.158 178.535 140.484 1.00 64.54  ? 470  THR A  CB  1 
ATOM   3558  O OG1 . THR A  1 470  ? 226.508 178.062 140.380 1.00 76.01  ? 470  THR A  OG1 1 
ATOM   3559  C CG2 . THR A  1 470  ? 225.149 180.051 140.410 1.00 62.60  ? 470  THR A  CG2 1 
ATOM   3560  N N   . GLU A  1 471  ? 225.028 175.901 142.871 1.00 66.83  ? 471  GLU A  N   1 
ATOM   3561  C CA  . GLU A  1 471  ? 225.095 174.448 142.913 1.00 59.68  ? 471  GLU A  CA  1 
ATOM   3562  C C   . GLU A  1 471  ? 223.696 173.848 142.848 1.00 57.96  ? 471  GLU A  C   1 
ATOM   3563  O O   . GLU A  1 471  ? 222.730 174.419 143.360 1.00 63.21  ? 471  GLU A  O   1 
ATOM   3564  C CB  . GLU A  1 471  ? 225.816 173.990 144.182 1.00 63.27  ? 471  GLU A  CB  1 
ATOM   3565  C CG  . GLU A  1 471  ? 227.338 174.114 144.120 1.00 68.87  ? 471  GLU A  CG  1 
ATOM   3566  C CD  . GLU A  1 471  ? 227.804 175.497 143.706 1.00 65.45  ? 471  GLU A  CD  1 
ATOM   3567  O OE1 . GLU A  1 471  ? 228.653 175.595 142.795 1.00 67.41  ? 471  GLU A  OE1 1 
ATOM   3568  O OE2 . GLU A  1 471  ? 227.311 176.489 144.282 1.00 66.97  ? 471  GLU A  OE2 1 
ATOM   3569  N N   . ILE A  1 472  ? 223.594 172.685 142.205 1.00 59.75  ? 472  ILE A  N   1 
ATOM   3570  C CA  . ILE A  1 472  ? 222.295 172.115 141.869 1.00 59.73  ? 472  ILE A  CA  1 
ATOM   3571  C C   . ILE A  1 472  ? 221.531 171.752 143.135 1.00 59.23  ? 472  ILE A  C   1 
ATOM   3572  O O   . ILE A  1 472  ? 222.116 171.350 144.150 1.00 57.53  ? 472  ILE A  O   1 
ATOM   3573  C CB  . ILE A  1 472  ? 222.469 170.887 140.959 1.00 57.40  ? 472  ILE A  CB  1 
ATOM   3574  C CG1 . ILE A  1 472  ? 223.408 171.208 139.793 1.00 68.82  ? 472  ILE A  CG1 1 
ATOM   3575  C CG2 . ILE A  1 472  ? 221.125 170.432 140.428 1.00 56.19  ? 472  ILE A  CG2 1 
ATOM   3576  C CD1 . ILE A  1 472  ? 222.981 172.399 138.968 1.00 68.88  ? 472  ILE A  CD1 1 
ATOM   3577  N N   . TYR A  1 473  ? 220.210 171.904 143.076 1.00 56.92  ? 473  TYR A  N   1 
ATOM   3578  C CA  . TYR A  1 473  ? 219.324 171.578 144.184 1.00 59.00  ? 473  TYR A  CA  1 
ATOM   3579  C C   . TYR A  1 473  ? 218.794 170.155 144.042 1.00 59.06  ? 473  TYR A  C   1 
ATOM   3580  O O   . TYR A  1 473  ? 218.428 169.724 142.946 1.00 58.40  ? 473  TYR A  O   1 
ATOM   3581  C CB  . TYR A  1 473  ? 218.161 172.568 144.235 1.00 54.87  ? 473  TYR A  CB  1 
ATOM   3582  C CG  . TYR A  1 473  ? 217.088 172.204 145.229 1.00 50.73  ? 473  TYR A  CG  1 
ATOM   3583  C CD1 . TYR A  1 473  ? 217.315 172.302 146.592 1.00 53.22  ? 473  TYR A  CD1 1 
ATOM   3584  C CD2 . TYR A  1 473  ? 215.843 171.771 144.803 1.00 51.86  ? 473  TYR A  CD2 1 
ATOM   3585  C CE1 . TYR A  1 473  ? 216.336 171.969 147.501 1.00 57.41  ? 473  TYR A  CE1 1 
ATOM   3586  C CE2 . TYR A  1 473  ? 214.859 171.439 145.704 1.00 52.93  ? 473  TYR A  CE2 1 
ATOM   3587  C CZ  . TYR A  1 473  ? 215.109 171.540 147.052 1.00 51.03  ? 473  TYR A  CZ  1 
ATOM   3588  O OH  . TYR A  1 473  ? 214.126 171.207 147.955 1.00 44.67  ? 473  TYR A  OH  1 
ATOM   3589  N N   . GLN A  1 474  ? 218.751 169.432 145.161 1.00 57.91  ? 474  GLN A  N   1 
ATOM   3590  C CA  . GLN A  1 474  ? 218.316 168.035 145.190 1.00 58.78  ? 474  GLN A  CA  1 
ATOM   3591  C C   . GLN A  1 474  ? 216.889 167.992 145.729 1.00 61.72  ? 474  GLN A  C   1 
ATOM   3592  O O   . GLN A  1 474  ? 216.657 168.092 146.934 1.00 58.51  ? 474  GLN A  O   1 
ATOM   3593  C CB  . GLN A  1 474  ? 219.262 167.191 146.037 1.00 68.48  ? 474  GLN A  CB  1 
ATOM   3594  C CG  . GLN A  1 474  ? 220.726 167.549 145.844 1.00 68.39  ? 474  GLN A  CG  1 
ATOM   3595  C CD  . GLN A  1 474  ? 221.679 166.576 146.513 1.00 73.54  ? 474  GLN A  CD  1 
ATOM   3596  O OE1 . GLN A  1 474  ? 222.804 166.391 146.052 1.00 82.88  ? 474  GLN A  OE1 1 
ATOM   3597  N NE2 . GLN A  1 474  ? 221.244 165.957 147.608 1.00 66.42  ? 474  GLN A  NE2 1 
ATOM   3598  N N   . ALA A  1 475  ? 215.922 167.846 144.821 1.00 63.09  ? 475  ALA A  N   1 
ATOM   3599  C CA  . ALA A  1 475  ? 214.523 167.794 145.231 1.00 63.29  ? 475  ALA A  CA  1 
ATOM   3600  C C   . ALA A  1 475  ? 214.124 166.421 145.755 1.00 79.52  ? 475  ALA A  C   1 
ATOM   3601  O O   . ALA A  1 475  ? 213.367 166.332 146.728 1.00 81.20  ? 475  ALA A  O   1 
ATOM   3602  C CB  . ALA A  1 475  ? 213.615 168.178 144.062 1.00 60.91  ? 475  ALA A  CB  1 
ATOM   3603  N N   . GLY A  1 476  ? 214.616 165.350 145.138 1.00 78.43  ? 476  GLY A  N   1 
ATOM   3604  C CA  . GLY A  1 476  ? 214.294 164.004 145.556 1.00 69.18  ? 476  GLY A  CA  1 
ATOM   3605  C C   . GLY A  1 476  ? 215.222 163.508 146.647 1.00 75.17  ? 476  GLY A  C   1 
ATOM   3606  O O   . GLY A  1 476  ? 216.078 164.230 147.162 1.00 76.60  ? 476  GLY A  O   1 
ATOM   3607  N N   . SER A  1 477  ? 215.036 162.239 147.003 1.00 84.31  ? 477  SER A  N   1 
ATOM   3608  C CA  . SER A  1 477  ? 215.906 161.588 147.972 1.00 80.80  ? 477  SER A  CA  1 
ATOM   3609  C C   . SER A  1 477  ? 217.245 161.178 147.378 1.00 79.56  ? 477  SER A  C   1 
ATOM   3610  O O   . SER A  1 477  ? 218.184 160.907 148.134 1.00 72.84  ? 477  SER A  O   1 
ATOM   3611  C CB  . SER A  1 477  ? 215.206 160.357 148.549 1.00 77.17  ? 477  SER A  CB  1 
ATOM   3612  O OG  . SER A  1 477  ? 214.774 159.490 147.515 1.00 87.08  ? 477  SER A  OG  1 
ATOM   3613  N N   . THR A  1 478  ? 217.355 161.125 146.055 1.00 78.68  ? 478  THR A  N   1 
ATOM   3614  C CA  . THR A  1 478  ? 218.605 160.748 145.424 1.00 80.38  ? 478  THR A  CA  1 
ATOM   3615  C C   . THR A  1 478  ? 219.646 161.856 145.587 1.00 78.95  ? 478  THR A  C   1 
ATOM   3616  O O   . THR A  1 478  ? 219.302 163.040 145.642 1.00 75.63  ? 478  THR A  O   1 
ATOM   3617  C CB  . THR A  1 478  ? 218.391 160.470 143.939 1.00 78.49  ? 478  THR A  CB  1 
ATOM   3618  O OG1 . THR A  1 478  ? 219.630 160.069 143.342 1.00 73.68  ? 478  THR A  OG1 1 
ATOM   3619  C CG2 . THR A  1 478  ? 217.871 161.716 143.229 1.00 74.57  ? 478  THR A  CG2 1 
ATOM   3620  N N   . PRO A  1 479  ? 220.928 161.502 145.667 1.00 84.13  ? 479  PRO A  N   1 
ATOM   3621  C CA  . PRO A  1 479  ? 221.972 162.521 145.530 1.00 78.51  ? 479  PRO A  CA  1 
ATOM   3622  C C   . PRO A  1 479  ? 222.000 163.062 144.109 1.00 71.73  ? 479  PRO A  C   1 
ATOM   3623  O O   . PRO A  1 479  ? 221.511 162.433 143.168 1.00 70.11  ? 479  PRO A  O   1 
ATOM   3624  C CB  . PRO A  1 479  ? 223.261 161.766 145.872 1.00 74.34  ? 479  PRO A  CB  1 
ATOM   3625  C CG  . PRO A  1 479  ? 222.951 160.340 145.581 1.00 70.19  ? 479  PRO A  CG  1 
ATOM   3626  C CD  . PRO A  1 479  ? 221.494 160.159 145.884 1.00 80.33  ? 479  PRO A  CD  1 
ATOM   3627  N N   . CYS A  1 480  ? 222.573 164.253 143.959 1.00 75.50  ? 480  CYS A  N   1 
ATOM   3628  C CA  . CYS A  1 480  ? 222.740 164.866 142.649 1.00 84.15  ? 480  CYS A  CA  1 
ATOM   3629  C C   . CYS A  1 480  ? 224.192 165.277 142.473 1.00 85.18  ? 480  CYS A  C   1 
ATOM   3630  O O   . CYS A  1 480  ? 224.801 165.835 143.391 1.00 86.86  ? 480  CYS A  O   1 
ATOM   3631  C CB  . CYS A  1 480  ? 221.829 166.081 142.459 1.00 78.85  ? 480  CYS A  CB  1 
ATOM   3632  S SG  . CYS A  1 480  ? 221.817 166.637 140.741 1.00 86.01  ? 480  CYS A  SG  1 
ATOM   3633  N N   . ASN A  1 481  ? 224.738 164.994 141.294 1.00 84.47  ? 481  ASN A  N   1 
ATOM   3634  C CA  . ASN A  1 481  ? 226.111 165.320 140.944 1.00 81.81  ? 481  ASN A  CA  1 
ATOM   3635  C C   . ASN A  1 481  ? 226.121 165.994 139.579 1.00 86.63  ? 481  ASN A  C   1 
ATOM   3636  O O   . ASN A  1 481  ? 225.073 166.288 138.995 1.00 82.96  ? 481  ASN A  O   1 
ATOM   3637  C CB  . ASN A  1 481  ? 226.993 164.065 140.938 1.00 82.03  ? 481  ASN A  CB  1 
ATOM   3638  C CG  . ASN A  1 481  ? 227.063 163.395 142.292 1.00 83.82  ? 481  ASN A  CG  1 
ATOM   3639  O OD1 . ASN A  1 481  ? 226.228 162.556 142.627 1.00 80.89  ? 481  ASN A  OD1 1 
ATOM   3640  N ND2 . ASN A  1 481  ? 228.067 163.760 143.081 1.00 84.43  ? 481  ASN A  ND2 1 
ATOM   3641  N N   . GLY A  1 482  ? 227.324 166.236 139.071 1.00 86.83  ? 482  GLY A  N   1 
ATOM   3642  C CA  . GLY A  1 482  ? 227.467 166.819 137.747 1.00 85.98  ? 482  GLY A  CA  1 
ATOM   3643  C C   . GLY A  1 482  ? 226.724 168.131 137.617 1.00 81.91  ? 482  GLY A  C   1 
ATOM   3644  O O   . GLY A  1 482  ? 226.791 169.002 138.493 1.00 83.39  ? 482  GLY A  O   1 
ATOM   3645  N N   . VAL A  1 483  ? 226.000 168.281 136.508 1.00 81.71  ? 483  VAL A  N   1 
ATOM   3646  C CA  . VAL A  1 483  ? 225.355 169.542 136.164 1.00 87.07  ? 483  VAL A  CA  1 
ATOM   3647  C C   . VAL A  1 483  ? 223.840 169.404 136.204 1.00 84.94  ? 483  VAL A  C   1 
ATOM   3648  O O   . VAL A  1 483  ? 223.131 170.361 136.532 1.00 84.89  ? 483  VAL A  O   1 
ATOM   3649  C CB  . VAL A  1 483  ? 225.816 170.031 134.778 1.00 87.84  ? 483  VAL A  CB  1 
ATOM   3650  C CG1 . VAL A  1 483  ? 227.279 170.426 134.818 1.00 84.63  ? 483  VAL A  CG1 1 
ATOM   3651  C CG2 . VAL A  1 483  ? 225.578 168.955 133.724 1.00 79.82  ? 483  VAL A  CG2 1 
ATOM   3652  N N   . GLU A  1 484  ? 223.329 168.223 135.868 1.00 79.00  ? 484  GLU A  N   1 
ATOM   3653  C CA  . GLU A  1 484  ? 221.892 168.065 135.691 1.00 85.84  ? 484  GLU A  CA  1 
ATOM   3654  C C   . GLU A  1 484  ? 221.492 166.625 135.965 1.00 84.79  ? 484  GLU A  C   1 
ATOM   3655  O O   . GLU A  1 484  ? 222.327 165.718 136.009 1.00 82.92  ? 484  GLU A  O   1 
ATOM   3656  C CB  . GLU A  1 484  ? 221.450 168.472 134.279 1.00 88.80  ? 484  GLU A  CB  1 
ATOM   3657  C CG  . GLU A  1 484  ? 221.526 169.964 133.990 1.00 93.30  ? 484  GLU A  CG  1 
ATOM   3658  C CD  . GLU A  1 484  ? 220.649 170.785 134.911 1.00 81.99  ? 484  GLU A  CD  1 
ATOM   3659  O OE1 . GLU A  1 484  ? 219.734 170.207 135.531 1.00 78.22  ? 484  GLU A  OE1 1 
ATOM   3660  O OE2 . GLU A  1 484  ? 220.878 172.008 135.017 1.00 74.77  ? 484  GLU A  OE2 1 
ATOM   3661  N N   . GLY A  1 485  ? 220.191 166.441 136.150 1.00 80.06  ? 485  GLY A  N   1 
ATOM   3662  C CA  . GLY A  1 485  ? 219.622 165.125 136.369 1.00 84.84  ? 485  GLY A  CA  1 
ATOM   3663  C C   . GLY A  1 485  ? 218.136 165.253 136.618 1.00 83.04  ? 485  GLY A  C   1 
ATOM   3664  O O   . GLY A  1 485  ? 217.572 166.352 136.608 1.00 79.53  ? 485  GLY A  O   1 
ATOM   3665  N N   . PHE A  1 486  ? 217.501 164.105 136.830 1.00 84.50  ? 486  PHE A  N   1 
ATOM   3666  C CA  . PHE A  1 486  ? 216.086 164.099 137.172 1.00 77.82  ? 486  PHE A  CA  1 
ATOM   3667  C C   . PHE A  1 486  ? 215.885 164.647 138.579 1.00 76.55  ? 486  PHE A  C   1 
ATOM   3668  O O   . PHE A  1 486  ? 216.551 164.220 139.526 1.00 76.30  ? 486  PHE A  O   1 
ATOM   3669  C CB  . PHE A  1 486  ? 215.523 162.684 137.055 1.00 82.44  ? 486  PHE A  CB  1 
ATOM   3670  C CG  . PHE A  1 486  ? 214.180 162.513 137.697 1.00 81.61  ? 486  PHE A  CG  1 
ATOM   3671  C CD1 . PHE A  1 486  ? 213.065 163.157 137.189 1.00 73.04  ? 486  PHE A  CD1 1 
ATOM   3672  C CD2 . PHE A  1 486  ? 214.032 161.701 138.806 1.00 75.71  ? 486  PHE A  CD2 1 
ATOM   3673  C CE1 . PHE A  1 486  ? 211.826 162.997 137.783 1.00 73.80  ? 486  PHE A  CE1 1 
ATOM   3674  C CE2 . PHE A  1 486  ? 212.800 161.537 139.403 1.00 72.44  ? 486  PHE A  CE2 1 
ATOM   3675  C CZ  . PHE A  1 486  ? 211.695 162.185 138.892 1.00 72.52  ? 486  PHE A  CZ  1 
ATOM   3676  N N   . ASN A  1 487  ? 214.968 165.608 138.708 1.00 76.03  ? 487  ASN A  N   1 
ATOM   3677  C CA  . ASN A  1 487  ? 214.717 166.304 139.967 1.00 78.14  ? 487  ASN A  CA  1 
ATOM   3678  C C   . ASN A  1 487  ? 215.929 167.113 140.421 1.00 73.74  ? 487  ASN A  C   1 
ATOM   3679  O O   . ASN A  1 487  ? 215.934 167.662 141.528 1.00 73.85  ? 487  ASN A  O   1 
ATOM   3680  C CB  . ASN A  1 487  ? 214.294 165.316 141.060 1.00 74.16  ? 487  ASN A  CB  1 
ATOM   3681  C CG  . ASN A  1 487  ? 212.832 164.926 140.955 1.00 79.82  ? 487  ASN A  CG  1 
ATOM   3682  O OD1 . ASN A  1 487  ? 212.028 165.644 140.359 1.00 75.24  ? 487  ASN A  OD1 1 
ATOM   3683  N ND2 . ASN A  1 487  ? 212.478 163.789 141.542 1.00 78.91  ? 487  ASN A  ND2 1 
ATOM   3684  N N   . CYS A  1 488  ? 216.958 167.190 139.581 1.00 71.22  ? 488  CYS A  N   1 
ATOM   3685  C CA  . CYS A  1 488  ? 218.087 168.083 139.809 1.00 66.47  ? 488  CYS A  CA  1 
ATOM   3686  C C   . CYS A  1 488  ? 217.761 169.425 139.166 1.00 71.60  ? 488  CYS A  C   1 
ATOM   3687  O O   . CYS A  1 488  ? 217.742 169.540 137.937 1.00 81.09  ? 488  CYS A  O   1 
ATOM   3688  C CB  . CYS A  1 488  ? 219.361 167.494 139.211 1.00 71.86  ? 488  CYS A  CB  1 
ATOM   3689  S SG  . CYS A  1 488  ? 220.031 166.014 140.000 1.00 84.04  ? 488  CYS A  SG  1 
ATOM   3690  N N   . TYR A  1 489  ? 217.494 170.437 139.984 1.00 66.71  ? 489  TYR A  N   1 
ATOM   3691  C CA  . TYR A  1 489  ? 217.069 171.741 139.500 1.00 53.51  ? 489  TYR A  CA  1 
ATOM   3692  C C   . TYR A  1 489  ? 218.179 172.765 139.673 1.00 59.63  ? 489  TYR A  C   1 
ATOM   3693  O O   . TYR A  1 489  ? 218.825 172.825 140.723 1.00 62.05  ? 489  TYR A  O   1 
ATOM   3694  C CB  . TYR A  1 489  ? 215.815 172.213 140.238 1.00 56.23  ? 489  TYR A  CB  1 
ATOM   3695  C CG  . TYR A  1 489  ? 214.618 171.334 139.993 1.00 62.97  ? 489  TYR A  CG  1 
ATOM   3696  C CD1 . TYR A  1 489  ? 214.005 171.299 138.749 1.00 76.05  ? 489  TYR A  CD1 1 
ATOM   3697  C CD2 . TYR A  1 489  ? 214.100 170.538 141.001 1.00 63.51  ? 489  TYR A  CD2 1 
ATOM   3698  C CE1 . TYR A  1 489  ? 212.913 170.493 138.518 1.00 73.67  ? 489  TYR A  CE1 1 
ATOM   3699  C CE2 . TYR A  1 489  ? 213.007 169.731 140.779 1.00 72.49  ? 489  TYR A  CE2 1 
ATOM   3700  C CZ  . TYR A  1 489  ? 212.418 169.711 139.536 1.00 72.81  ? 489  TYR A  CZ  1 
ATOM   3701  O OH  . TYR A  1 489  ? 211.326 168.905 139.309 1.00 73.43  ? 489  TYR A  OH  1 
ATOM   3702  N N   . PHE A  1 490  ? 218.396 173.565 138.638 1.00 60.32  ? 490  PHE A  N   1 
ATOM   3703  C CA  . PHE A  1 490  ? 219.273 174.717 138.771 1.00 59.12  ? 490  PHE A  CA  1 
ATOM   3704  C C   . PHE A  1 490  ? 218.592 175.739 139.674 1.00 64.51  ? 490  PHE A  C   1 
ATOM   3705  O O   . PHE A  1 490  ? 217.436 176.100 139.427 1.00 66.98  ? 490  PHE A  O   1 
ATOM   3706  C CB  . PHE A  1 490  ? 219.579 175.323 137.404 1.00 59.35  ? 490  PHE A  CB  1 
ATOM   3707  C CG  . PHE A  1 490  ? 220.711 176.308 137.417 1.00 60.21  ? 490  PHE A  CG  1 
ATOM   3708  C CD1 . PHE A  1 490  ? 222.013 175.885 137.611 1.00 60.85  ? 490  PHE A  CD1 1 
ATOM   3709  C CD2 . PHE A  1 490  ? 220.476 177.656 137.225 1.00 59.70  ? 490  PHE A  CD2 1 
ATOM   3710  C CE1 . PHE A  1 490  ? 223.056 176.788 137.621 1.00 62.21  ? 490  PHE A  CE1 1 
ATOM   3711  C CE2 . PHE A  1 490  ? 221.516 178.562 137.233 1.00 56.11  ? 490  PHE A  CE2 1 
ATOM   3712  C CZ  . PHE A  1 490  ? 222.806 178.128 137.432 1.00 49.63  ? 490  PHE A  CZ  1 
ATOM   3713  N N   . PRO A  1 491  ? 219.260 176.230 140.722 1.00 61.79  ? 491  PRO A  N   1 
ATOM   3714  C CA  . PRO A  1 491  ? 218.539 177.001 141.744 1.00 52.75  ? 491  PRO A  CA  1 
ATOM   3715  C C   . PRO A  1 491  ? 218.062 178.367 141.285 1.00 54.44  ? 491  PRO A  C   1 
ATOM   3716  O O   . PRO A  1 491  ? 217.139 178.912 141.904 1.00 59.53  ? 491  PRO A  O   1 
ATOM   3717  C CB  . PRO A  1 491  ? 219.568 177.131 142.873 1.00 54.36  ? 491  PRO A  CB  1 
ATOM   3718  C CG  . PRO A  1 491  ? 220.883 177.057 142.187 1.00 52.68  ? 491  PRO A  CG  1 
ATOM   3719  C CD  . PRO A  1 491  ? 220.703 176.147 141.008 1.00 55.74  ? 491  PRO A  CD  1 
ATOM   3720  N N   . LEU A  1 492  ? 218.639 178.932 140.230 1.00 53.84  ? 492  LEU A  N   1 
ATOM   3721  C CA  . LEU A  1 492  ? 218.292 180.269 139.775 1.00 48.87  ? 492  LEU A  CA  1 
ATOM   3722  C C   . LEU A  1 492  ? 217.371 180.206 138.564 1.00 51.94  ? 492  LEU A  C   1 
ATOM   3723  O O   . LEU A  1 492  ? 217.500 179.330 137.705 1.00 58.98  ? 492  LEU A  O   1 
ATOM   3724  C CB  . LEU A  1 492  ? 219.546 181.067 139.420 1.00 37.12  ? 492  LEU A  CB  1 
ATOM   3725  C CG  . LEU A  1 492  ? 220.598 181.211 140.517 1.00 48.81  ? 492  LEU A  CG  1 
ATOM   3726  C CD1 . LEU A  1 492  ? 221.728 182.092 140.026 1.00 55.43  ? 492  LEU A  CD1 1 
ATOM   3727  C CD2 . LEU A  1 492  ? 219.988 181.774 141.785 1.00 59.89  ? 492  LEU A  CD2 1 
ATOM   3728  N N   . GLN A  1 493  ? 216.433 181.148 138.508 1.00 44.88  ? 493  GLN A  N   1 
ATOM   3729  C CA  . GLN A  1 493  ? 215.548 181.300 137.365 1.00 48.74  ? 493  GLN A  CA  1 
ATOM   3730  C C   . GLN A  1 493  ? 215.411 182.781 137.047 1.00 51.61  ? 493  GLN A  C   1 
ATOM   3731  O O   . GLN A  1 493  ? 215.559 183.635 137.924 1.00 59.32  ? 493  GLN A  O   1 
ATOM   3732  C CB  . GLN A  1 493  ? 214.175 180.674 137.631 1.00 51.92  ? 493  GLN A  CB  1 
ATOM   3733  C CG  . GLN A  1 493  ? 213.237 180.739 136.444 1.00 56.98  ? 493  GLN A  CG  1 
ATOM   3734  C CD  . GLN A  1 493  ? 212.133 179.711 136.519 1.00 71.05  ? 493  GLN A  CD  1 
ATOM   3735  O OE1 . GLN A  1 493  ? 212.224 178.738 137.269 1.00 64.93  ? 493  GLN A  OE1 1 
ATOM   3736  N NE2 . GLN A  1 493  ? 211.078 179.915 135.739 1.00 62.58  ? 493  GLN A  NE2 1 
ATOM   3737  N N   . SER A  1 494  ? 215.129 183.078 135.782 1.00 51.42  ? 494  SER A  N   1 
ATOM   3738  C CA  . SER A  1 494  ? 215.128 184.445 135.281 1.00 47.26  ? 494  SER A  CA  1 
ATOM   3739  C C   . SER A  1 494  ? 213.709 184.954 135.070 1.00 44.20  ? 494  SER A  C   1 
ATOM   3740  O O   . SER A  1 494  ? 212.828 184.210 134.630 1.00 43.77  ? 494  SER A  O   1 
ATOM   3741  C CB  . SER A  1 494  ? 215.902 184.532 133.966 1.00 48.91  ? 494  SER A  CB  1 
ATOM   3742  O OG  . SER A  1 494  ? 215.358 183.646 133.005 1.00 52.41  ? 494  SER A  OG  1 
ATOM   3743  N N   . TYR A  1 495  ? 213.497 186.229 135.385 1.00 45.07  ? 495  TYR A  N   1 
ATOM   3744  C CA  . TYR A  1 495  ? 212.239 186.884 135.057 1.00 49.10  ? 495  TYR A  CA  1 
ATOM   3745  C C   . TYR A  1 495  ? 212.145 187.125 133.557 1.00 56.86  ? 495  TYR A  C   1 
ATOM   3746  O O   . TYR A  1 495  ? 213.118 187.530 132.914 1.00 60.58  ? 495  TYR A  O   1 
ATOM   3747  C CB  . TYR A  1 495  ? 212.115 188.220 135.787 1.00 50.73  ? 495  TYR A  CB  1 
ATOM   3748  C CG  . TYR A  1 495  ? 212.031 188.132 137.291 1.00 47.58  ? 495  TYR A  CG  1 
ATOM   3749  C CD1 . TYR A  1 495  ? 210.929 187.569 137.912 1.00 53.36  ? 495  TYR A  CD1 1 
ATOM   3750  C CD2 . TYR A  1 495  ? 213.039 188.644 138.091 1.00 42.16  ? 495  TYR A  CD2 1 
ATOM   3751  C CE1 . TYR A  1 495  ? 210.843 187.501 139.282 1.00 50.07  ? 495  TYR A  CE1 1 
ATOM   3752  C CE2 . TYR A  1 495  ? 212.960 188.580 139.461 1.00 40.19  ? 495  TYR A  CE2 1 
ATOM   3753  C CZ  . TYR A  1 495  ? 211.861 188.009 140.052 1.00 45.86  ? 495  TYR A  CZ  1 
ATOM   3754  O OH  . TYR A  1 495  ? 211.782 187.947 141.423 1.00 51.57  ? 495  TYR A  OH  1 
ATOM   3755  N N   . GLY A  1 496  ? 210.963 186.879 132.999 1.00 51.86  ? 496  GLY A  N   1 
ATOM   3756  C CA  . GLY A  1 496  ? 210.707 187.188 131.606 1.00 52.10  ? 496  GLY A  CA  1 
ATOM   3757  C C   . GLY A  1 496  ? 210.097 188.562 131.424 1.00 55.67  ? 496  GLY A  C   1 
ATOM   3758  O O   . GLY A  1 496  ? 208.916 188.679 131.086 1.00 69.51  ? 496  GLY A  O   1 
ATOM   3759  N N   . PHE A  1 497  ? 210.885 189.614 131.644 1.00 60.98  ? 497  PHE A  N   1 
ATOM   3760  C CA  . PHE A  1 497  ? 210.360 190.979 131.676 1.00 63.44  ? 497  PHE A  CA  1 
ATOM   3761  C C   . PHE A  1 497  ? 210.128 191.483 130.256 1.00 71.06  ? 497  PHE A  C   1 
ATOM   3762  O O   . PHE A  1 497  ? 210.946 192.192 129.665 1.00 73.79  ? 497  PHE A  O   1 
ATOM   3763  C CB  . PHE A  1 497  ? 211.310 191.900 132.432 1.00 55.86  ? 497  PHE A  CB  1 
ATOM   3764  C CG  . PHE A  1 497  ? 211.301 191.697 133.922 1.00 53.33  ? 497  PHE A  CG  1 
ATOM   3765  C CD1 . PHE A  1 497  ? 210.115 191.497 134.605 1.00 44.78  ? 497  PHE A  CD1 1 
ATOM   3766  C CD2 . PHE A  1 497  ? 212.481 191.703 134.638 1.00 47.80  ? 497  PHE A  CD2 1 
ATOM   3767  C CE1 . PHE A  1 497  ? 210.108 191.311 135.966 1.00 40.74  ? 497  PHE A  CE1 1 
ATOM   3768  C CE2 . PHE A  1 497  ? 212.476 191.516 136.001 1.00 45.35  ? 497  PHE A  CE2 1 
ATOM   3769  C CZ  . PHE A  1 497  ? 211.288 191.321 136.664 1.00 45.80  ? 497  PHE A  CZ  1 
ATOM   3770  N N   . GLN A  1 498  ? 208.978 191.116 129.704 1.00 74.98  ? 498  GLN A  N   1 
ATOM   3771  C CA  . GLN A  1 498  ? 208.527 191.703 128.452 1.00 62.80  ? 498  GLN A  CA  1 
ATOM   3772  C C   . GLN A  1 498  ? 207.651 192.917 128.742 1.00 67.08  ? 498  GLN A  C   1 
ATOM   3773  O O   . GLN A  1 498  ? 206.855 192.893 129.684 1.00 71.94  ? 498  GLN A  O   1 
ATOM   3774  C CB  . GLN A  1 498  ? 207.736 190.691 127.634 1.00 61.88  ? 498  GLN A  CB  1 
ATOM   3775  C CG  . GLN A  1 498  ? 208.456 189.374 127.418 1.00 67.45  ? 498  GLN A  CG  1 
ATOM   3776  C CD  . GLN A  1 498  ? 207.509 188.256 127.057 1.00 77.41  ? 498  GLN A  CD  1 
ATOM   3777  O OE1 . GLN A  1 498  ? 207.239 187.372 127.869 1.00 73.74  ? 498  GLN A  OE1 1 
ATOM   3778  N NE2 . GLN A  1 498  ? 206.992 188.286 125.835 1.00 79.02  ? 498  GLN A  NE2 1 
ATOM   3779  N N   . PRO A  1 499  ? 207.760 193.999 127.964 1.00 69.66  ? 499  PRO A  N   1 
ATOM   3780  C CA  . PRO A  1 499  ? 206.934 195.181 128.251 1.00 67.03  ? 499  PRO A  CA  1 
ATOM   3781  C C   . PRO A  1 499  ? 205.444 194.920 128.129 1.00 69.80  ? 499  PRO A  C   1 
ATOM   3782  O O   . PRO A  1 499  ? 204.652 195.686 128.690 1.00 74.82  ? 499  PRO A  O   1 
ATOM   3783  C CB  . PRO A  1 499  ? 207.413 196.210 127.218 1.00 59.93  ? 499  PRO A  CB  1 
ATOM   3784  C CG  . PRO A  1 499  ? 208.059 195.412 126.143 1.00 58.21  ? 499  PRO A  CG  1 
ATOM   3785  C CD  . PRO A  1 499  ? 208.648 194.213 126.810 1.00 67.93  ? 499  PRO A  CD  1 
ATOM   3786  N N   . THR A  1 500  ? 205.038 193.867 127.419 1.00 65.93  ? 500  THR A  N   1 
ATOM   3787  C CA  . THR A  1 500  ? 203.629 193.510 127.325 1.00 59.69  ? 500  THR A  CA  1 
ATOM   3788  C C   . THR A  1 500  ? 203.117 192.795 128.569 1.00 66.14  ? 500  THR A  C   1 
ATOM   3789  O O   . THR A  1 500  ? 201.911 192.539 128.659 1.00 71.67  ? 500  THR A  O   1 
ATOM   3790  C CB  . THR A  1 500  ? 203.393 192.628 126.096 1.00 66.94  ? 500  THR A  CB  1 
ATOM   3791  O OG1 . THR A  1 500  ? 201.988 192.407 125.925 1.00 73.98  ? 500  THR A  OG1 1 
ATOM   3792  C CG2 . THR A  1 500  ? 204.103 191.289 126.247 1.00 61.36  ? 500  THR A  CG2 1 
ATOM   3793  N N   . ASN A  1 501  ? 203.991 192.465 129.517 1.00 68.11  ? 501  ASN A  N   1 
ATOM   3794  C CA  . ASN A  1 501  ? 203.573 191.734 130.705 1.00 63.07  ? 501  ASN A  CA  1 
ATOM   3795  C C   . ASN A  1 501  ? 202.490 192.492 131.461 1.00 63.49  ? 501  ASN A  C   1 
ATOM   3796  O O   . ASN A  1 501  ? 202.525 193.720 131.569 1.00 59.18  ? 501  ASN A  O   1 
ATOM   3797  C CB  . ASN A  1 501  ? 204.765 191.495 131.632 1.00 61.73  ? 501  ASN A  CB  1 
ATOM   3798  C CG  . ASN A  1 501  ? 205.592 190.293 131.227 1.00 67.58  ? 501  ASN A  CG  1 
ATOM   3799  O OD1 . ASN A  1 501  ? 205.158 189.463 130.428 1.00 66.61  ? 501  ASN A  OD1 1 
ATOM   3800  N ND2 . ASN A  1 501  ? 206.789 190.185 131.792 1.00 66.94  ? 501  ASN A  ND2 1 
ATOM   3801  N N   . GLY A  1 502  ? 201.527 191.743 131.990 1.00 59.90  ? 502  GLY A  N   1 
ATOM   3802  C CA  . GLY A  1 502  ? 200.481 192.356 132.788 1.00 60.30  ? 502  GLY A  CA  1 
ATOM   3803  C C   . GLY A  1 502  ? 201.055 193.064 134.002 1.00 63.23  ? 502  GLY A  C   1 
ATOM   3804  O O   . GLY A  1 502  ? 202.041 192.624 134.595 1.00 69.98  ? 502  GLY A  O   1 
ATOM   3805  N N   . VAL A  1 503  ? 200.423 194.179 134.371 1.00 58.39  ? 503  VAL A  N   1 
ATOM   3806  C CA  . VAL A  1 503  ? 200.892 194.960 135.510 1.00 65.77  ? 503  VAL A  CA  1 
ATOM   3807  C C   . VAL A  1 503  ? 200.884 194.073 136.745 1.00 61.07  ? 503  VAL A  C   1 
ATOM   3808  O O   . VAL A  1 503  ? 199.838 193.544 137.144 1.00 60.54  ? 503  VAL A  O   1 
ATOM   3809  C CB  . VAL A  1 503  ? 200.026 196.207 135.709 1.00 69.10  ? 503  VAL A  CB  1 
ATOM   3810  C CG1 . VAL A  1 503  ? 200.616 197.088 136.800 1.00 49.76  ? 503  VAL A  CG1 1 
ATOM   3811  C CG2 . VAL A  1 503  ? 199.900 196.984 134.404 1.00 72.26  ? 503  VAL A  CG2 1 
ATOM   3812  N N   . GLY A  1 504  ? 202.056 193.908 137.359 1.00 53.05  ? 504  GLY A  N   1 
ATOM   3813  C CA  . GLY A  1 504  ? 202.272 192.944 138.424 1.00 49.06  ? 504  GLY A  CA  1 
ATOM   3814  C C   . GLY A  1 504  ? 203.311 191.903 138.066 1.00 44.42  ? 504  GLY A  C   1 
ATOM   3815  O O   . GLY A  1 504  ? 204.041 191.432 138.943 1.00 44.93  ? 504  GLY A  O   1 
ATOM   3816  N N   . TYR A  1 505  ? 203.386 191.534 136.792 1.00 50.61  ? 505  TYR A  N   1 
ATOM   3817  C CA  . TYR A  1 505  ? 204.526 190.815 136.251 1.00 53.91  ? 505  TYR A  CA  1 
ATOM   3818  C C   . TYR A  1 505  ? 205.552 191.771 135.657 1.00 53.59  ? 505  TYR A  C   1 
ATOM   3819  O O   . TYR A  1 505  ? 206.587 191.326 135.154 1.00 51.75  ? 505  TYR A  O   1 
ATOM   3820  C CB  . TYR A  1 505  ? 204.054 189.811 135.190 1.00 61.33  ? 505  TYR A  CB  1 
ATOM   3821  C CG  . TYR A  1 505  ? 205.071 188.755 134.787 1.00 69.49  ? 505  TYR A  CG  1 
ATOM   3822  C CD1 . TYR A  1 505  ? 206.248 188.572 135.504 1.00 61.33  ? 505  TYR A  CD1 1 
ATOM   3823  C CD2 . TYR A  1 505  ? 204.852 187.945 133.680 1.00 83.53  ? 505  TYR A  CD2 1 
ATOM   3824  C CE1 . TYR A  1 505  ? 207.171 187.618 135.132 1.00 56.56  ? 505  TYR A  CE1 1 
ATOM   3825  C CE2 . TYR A  1 505  ? 205.773 186.986 133.301 1.00 77.70  ? 505  TYR A  CE2 1 
ATOM   3826  C CZ  . TYR A  1 505  ? 206.930 186.827 134.032 1.00 60.70  ? 505  TYR A  CZ  1 
ATOM   3827  O OH  . TYR A  1 505  ? 207.849 185.874 133.659 1.00 56.88  ? 505  TYR A  OH  1 
ATOM   3828  N N   . GLN A  1 506  ? 205.284 193.073 135.708 1.00 56.10  ? 506  GLN A  N   1 
ATOM   3829  C CA  . GLN A  1 506  ? 206.241 194.062 135.250 1.00 44.95  ? 506  GLN A  CA  1 
ATOM   3830  C C   . GLN A  1 506  ? 207.347 194.246 136.289 1.00 44.40  ? 506  GLN A  C   1 
ATOM   3831  O O   . GLN A  1 506  ? 207.120 194.066 137.487 1.00 50.25  ? 506  GLN A  O   1 
ATOM   3832  C CB  . GLN A  1 506  ? 205.548 195.395 134.993 1.00 49.02  ? 506  GLN A  CB  1 
ATOM   3833  C CG  . GLN A  1 506  ? 204.515 195.362 133.883 1.00 58.13  ? 506  GLN A  CG  1 
ATOM   3834  C CD  . GLN A  1 506  ? 203.808 196.688 133.721 1.00 60.89  ? 506  GLN A  CD  1 
ATOM   3835  O OE1 . GLN A  1 506  ? 203.894 197.556 134.588 1.00 57.94  ? 506  GLN A  OE1 1 
ATOM   3836  N NE2 . GLN A  1 506  ? 203.108 196.857 132.607 1.00 69.90  ? 506  GLN A  NE2 1 
ATOM   3837  N N   . PRO A  1 507  ? 208.554 194.601 135.855 1.00 43.90  ? 507  PRO A  N   1 
ATOM   3838  C CA  . PRO A  1 507  ? 209.658 194.757 136.808 1.00 34.62  ? 507  PRO A  CA  1 
ATOM   3839  C C   . PRO A  1 507  ? 209.453 195.950 137.727 1.00 44.80  ? 507  PRO A  C   1 
ATOM   3840  O O   . PRO A  1 507  ? 209.041 197.028 137.294 1.00 57.00  ? 507  PRO A  O   1 
ATOM   3841  C CB  . PRO A  1 507  ? 210.876 194.955 135.902 1.00 32.49  ? 507  PRO A  CB  1 
ATOM   3842  C CG  . PRO A  1 507  ? 210.315 195.550 134.661 1.00 46.23  ? 507  PRO A  CG  1 
ATOM   3843  C CD  . PRO A  1 507  ? 208.964 194.927 134.479 1.00 48.03  ? 507  PRO A  CD  1 
ATOM   3844  N N   . TYR A  1 508  ? 209.751 195.745 139.007 1.00 38.05  ? 508  TYR A  N   1 
ATOM   3845  C CA  . TYR A  1 508  ? 209.723 196.797 140.013 1.00 37.05  ? 508  TYR A  CA  1 
ATOM   3846  C C   . TYR A  1 508  ? 211.104 196.917 140.637 1.00 35.43  ? 508  TYR A  C   1 
ATOM   3847  O O   . TYR A  1 508  ? 211.645 195.931 141.143 1.00 38.61  ? 508  TYR A  O   1 
ATOM   3848  C CB  . TYR A  1 508  ? 208.683 196.503 141.099 1.00 36.38  ? 508  TYR A  CB  1 
ATOM   3849  C CG  . TYR A  1 508  ? 207.272 196.913 140.743 1.00 36.69  ? 508  TYR A  CG  1 
ATOM   3850  C CD1 . TYR A  1 508  ? 206.615 196.349 139.663 1.00 44.75  ? 508  TYR A  CD1 1 
ATOM   3851  C CD2 . TYR A  1 508  ? 206.593 197.856 141.498 1.00 41.26  ? 508  TYR A  CD2 1 
ATOM   3852  C CE1 . TYR A  1 508  ? 205.327 196.716 139.340 1.00 42.00  ? 508  TYR A  CE1 1 
ATOM   3853  C CE2 . TYR A  1 508  ? 205.305 198.228 141.181 1.00 48.82  ? 508  TYR A  CE2 1 
ATOM   3854  C CZ  . TYR A  1 508  ? 204.677 197.654 140.102 1.00 50.64  ? 508  TYR A  CZ  1 
ATOM   3855  O OH  . TYR A  1 508  ? 203.391 198.023 139.783 1.00 67.01  ? 508  TYR A  OH  1 
ATOM   3856  N N   . ARG A  1 509  ? 211.673 198.117 140.590 1.00 34.91  ? 509  ARG A  N   1 
ATOM   3857  C CA  . ARG A  1 509  ? 212.942 198.376 141.253 1.00 30.45  ? 509  ARG A  CA  1 
ATOM   3858  C C   . ARG A  1 509  ? 212.707 198.667 142.727 1.00 35.06  ? 509  ARG A  C   1 
ATOM   3859  O O   . ARG A  1 509  ? 211.768 199.380 143.086 1.00 43.82  ? 509  ARG A  O   1 
ATOM   3860  C CB  . ARG A  1 509  ? 213.661 199.546 140.587 1.00 35.37  ? 509  ARG A  CB  1 
ATOM   3861  C CG  . ARG A  1 509  ? 214.274 199.184 139.257 1.00 40.94  ? 509  ARG A  CG  1 
ATOM   3862  C CD  . ARG A  1 509  ? 214.940 200.362 138.588 1.00 42.41  ? 509  ARG A  CD  1 
ATOM   3863  N NE  . ARG A  1 509  ? 215.601 199.953 137.353 1.00 41.11  ? 509  ARG A  NE  1 
ATOM   3864  C CZ  . ARG A  1 509  ? 216.591 200.621 136.771 1.00 49.78  ? 509  ARG A  CZ  1 
ATOM   3865  N NH1 . ARG A  1 509  ? 217.127 200.162 135.649 1.00 54.98  ? 509  ARG A  NH1 1 
ATOM   3866  N NH2 . ARG A  1 509  ? 217.055 201.739 137.312 1.00 53.36  ? 509  ARG A  NH2 1 
ATOM   3867  N N   . VAL A  1 510  ? 213.564 198.111 143.580 1.00 37.50  ? 510  VAL A  N   1 
ATOM   3868  C CA  . VAL A  1 510  ? 213.408 198.204 145.026 1.00 30.76  ? 510  VAL A  CA  1 
ATOM   3869  C C   . VAL A  1 510  ? 214.710 198.705 145.630 1.00 30.48  ? 510  VAL A  C   1 
ATOM   3870  O O   . VAL A  1 510  ? 215.786 198.192 145.307 1.00 36.46  ? 510  VAL A  O   1 
ATOM   3871  C CB  . VAL A  1 510  ? 213.019 196.849 145.646 1.00 29.06  ? 510  VAL A  CB  1 
ATOM   3872  C CG1 . VAL A  1 510  ? 212.831 196.987 147.144 1.00 33.89  ? 510  VAL A  CG1 1 
ATOM   3873  C CG2 . VAL A  1 510  ? 211.760 196.303 144.995 1.00 27.43  ? 510  VAL A  CG2 1 
ATOM   3874  N N   . VAL A  1 511  ? 214.610 199.705 146.500 1.00 34.65  ? 511  VAL A  N   1 
ATOM   3875  C CA  . VAL A  1 511  ? 215.730 200.183 147.300 1.00 34.11  ? 511  VAL A  CA  1 
ATOM   3876  C C   . VAL A  1 511  ? 215.319 200.114 148.763 1.00 36.06  ? 511  VAL A  C   1 
ATOM   3877  O O   . VAL A  1 511  ? 214.271 200.647 149.142 1.00 39.94  ? 511  VAL A  O   1 
ATOM   3878  C CB  . VAL A  1 511  ? 216.141 201.614 146.911 1.00 31.66  ? 511  VAL A  CB  1 
ATOM   3879  C CG1 . VAL A  1 511  ? 217.142 202.171 147.908 1.00 30.85  ? 511  VAL A  CG1 1 
ATOM   3880  C CG2 . VAL A  1 511  ? 216.721 201.629 145.511 1.00 35.72  ? 511  VAL A  CG2 1 
ATOM   3881  N N   . VAL A  1 512  ? 216.136 199.453 149.577 1.00 34.01  ? 512  VAL A  N   1 
ATOM   3882  C CA  . VAL A  1 512  ? 215.865 199.275 150.998 1.00 30.90  ? 512  VAL A  CA  1 
ATOM   3883  C C   . VAL A  1 512  ? 216.939 200.028 151.769 1.00 36.21  ? 512  VAL A  C   1 
ATOM   3884  O O   . VAL A  1 512  ? 218.113 199.641 151.759 1.00 41.74  ? 512  VAL A  O   1 
ATOM   3885  C CB  . VAL A  1 512  ? 215.834 197.793 151.392 1.00 35.29  ? 512  VAL A  CB  1 
ATOM   3886  C CG1 . VAL A  1 512  ? 215.467 197.642 152.855 1.00 42.04  ? 512  VAL A  CG1 1 
ATOM   3887  C CG2 . VAL A  1 512  ? 214.861 197.027 150.511 1.00 31.70  ? 512  VAL A  CG2 1 
ATOM   3888  N N   . LEU A  1 513  ? 216.539 201.100 152.443 1.00 38.86  ? 513  LEU A  N   1 
ATOM   3889  C CA  . LEU A  1 513  ? 217.447 201.882 153.268 1.00 39.25  ? 513  LEU A  CA  1 
ATOM   3890  C C   . LEU A  1 513  ? 217.361 201.381 154.703 1.00 45.88  ? 513  LEU A  C   1 
ATOM   3891  O O   . LEU A  1 513  ? 216.298 201.457 155.327 1.00 50.98  ? 513  LEU A  O   1 
ATOM   3892  C CB  . LEU A  1 513  ? 217.098 203.368 153.199 1.00 33.10  ? 513  LEU A  CB  1 
ATOM   3893  C CG  . LEU A  1 513  ? 216.932 203.957 151.800 1.00 38.47  ? 513  LEU A  CG  1 
ATOM   3894  C CD1 . LEU A  1 513  ? 216.533 205.418 151.890 1.00 33.73  ? 513  LEU A  CD1 1 
ATOM   3895  C CD2 . LEU A  1 513  ? 218.206 203.795 150.990 1.00 44.03  ? 513  LEU A  CD2 1 
ATOM   3896  N N   . SER A  1 514  ? 218.469 200.863 155.218 1.00 42.69  ? 514  SER A  N   1 
ATOM   3897  C CA  . SER A  1 514  ? 218.557 200.399 156.594 1.00 40.03  ? 514  SER A  CA  1 
ATOM   3898  C C   . SER A  1 514  ? 219.480 201.330 157.364 1.00 48.22  ? 514  SER A  C   1 
ATOM   3899  O O   . SER A  1 514  ? 220.582 201.638 156.899 1.00 47.78  ? 514  SER A  O   1 
ATOM   3900  C CB  . SER A  1 514  ? 219.078 198.965 156.657 1.00 50.92  ? 514  SER A  CB  1 
ATOM   3901  O OG  . SER A  1 514  ? 220.442 198.910 156.283 1.00 62.50  ? 514  SER A  OG  1 
ATOM   3902  N N   . PHE A  1 515  ? 219.034 201.770 158.538 1.00 54.08  ? 515  PHE A  N   1 
ATOM   3903  C CA  . PHE A  1 515  ? 219.788 202.742 159.312 1.00 45.23  ? 515  PHE A  CA  1 
ATOM   3904  C C   . PHE A  1 515  ? 219.461 202.590 160.790 1.00 43.73  ? 515  PHE A  C   1 
ATOM   3905  O O   . PHE A  1 515  ? 218.431 202.026 161.168 1.00 46.92  ? 515  PHE A  O   1 
ATOM   3906  C CB  . PHE A  1 515  ? 219.495 204.172 158.847 1.00 42.72  ? 515  PHE A  CB  1 
ATOM   3907  C CG  . PHE A  1 515  ? 218.046 204.425 158.553 1.00 35.00  ? 515  PHE A  CG  1 
ATOM   3908  C CD1 . PHE A  1 515  ? 217.122 204.505 159.575 1.00 44.89  ? 515  PHE A  CD1 1 
ATOM   3909  C CD2 . PHE A  1 515  ? 217.608 204.582 157.252 1.00 35.28  ? 515  PHE A  CD2 1 
ATOM   3910  C CE1 . PHE A  1 515  ? 215.791 204.733 159.304 1.00 40.37  ? 515  PHE A  CE1 1 
ATOM   3911  C CE2 . PHE A  1 515  ? 216.279 204.810 156.978 1.00 27.97  ? 515  PHE A  CE2 1 
ATOM   3912  C CZ  . PHE A  1 515  ? 215.371 204.887 158.004 1.00 26.67  ? 515  PHE A  CZ  1 
ATOM   3913  N N   . GLU A  1 516  ? 220.361 203.109 161.619 1.00 46.58  ? 516  GLU A  N   1 
ATOM   3914  C CA  . GLU A  1 516  ? 220.201 203.143 163.064 1.00 52.61  ? 516  GLU A  CA  1 
ATOM   3915  C C   . GLU A  1 516  ? 220.157 204.593 163.524 1.00 58.17  ? 516  GLU A  C   1 
ATOM   3916  O O   . GLU A  1 516  ? 220.790 205.468 162.926 1.00 62.13  ? 516  GLU A  O   1 
ATOM   3917  C CB  . GLU A  1 516  ? 221.342 202.403 163.770 1.00 55.06  ? 516  GLU A  CB  1 
ATOM   3918  C CG  . GLU A  1 516  ? 221.171 200.897 163.819 1.00 55.99  ? 516  GLU A  CG  1 
ATOM   3919  C CD  . GLU A  1 516  ? 220.199 200.458 164.893 1.00 67.53  ? 516  GLU A  CD  1 
ATOM   3920  O OE1 . GLU A  1 516  ? 219.525 201.332 165.479 1.00 61.59  ? 516  GLU A  OE1 1 
ATOM   3921  O OE2 . GLU A  1 516  ? 220.111 199.241 165.155 1.00 82.12  ? 516  GLU A  OE2 1 
ATOM   3922  N N   . LEU A  1 517  ? 219.408 204.844 164.594 1.00 57.32  ? 517  LEU A  N   1 
ATOM   3923  C CA  . LEU A  1 517  ? 219.083 206.202 165.006 1.00 53.54  ? 517  LEU A  CA  1 
ATOM   3924  C C   . LEU A  1 517  ? 219.392 206.423 166.478 1.00 53.90  ? 517  LEU A  C   1 
ATOM   3925  O O   . LEU A  1 517  ? 219.085 205.577 167.322 1.00 59.97  ? 517  LEU A  O   1 
ATOM   3926  C CB  . LEU A  1 517  ? 217.602 206.500 164.761 1.00 51.11  ? 517  LEU A  CB  1 
ATOM   3927  C CG  . LEU A  1 517  ? 217.106 206.266 163.335 1.00 36.02  ? 517  LEU A  CG  1 
ATOM   3928  C CD1 . LEU A  1 517  ? 215.633 205.935 163.330 1.00 31.69  ? 517  LEU A  CD1 1 
ATOM   3929  C CD2 . LEU A  1 517  ? 217.372 207.482 162.478 1.00 44.76  ? 517  LEU A  CD2 1 
ATOM   3930  N N   . LEU A  1 518  ? 219.990 207.574 166.774 1.00 58.83  ? 518  LEU A  N   1 
ATOM   3931  C CA  . LEU A  1 518  ? 220.061 208.149 168.114 1.00 56.91  ? 518  LEU A  CA  1 
ATOM   3932  C C   . LEU A  1 518  ? 220.847 207.300 169.106 1.00 59.09  ? 518  LEU A  C   1 
ATOM   3933  O O   . LEU A  1 518  ? 220.811 207.579 170.310 1.00 61.95  ? 518  LEU A  O   1 
ATOM   3934  C CB  . LEU A  1 518  ? 218.655 208.409 168.668 1.00 59.88  ? 518  LEU A  CB  1 
ATOM   3935  C CG  . LEU A  1 518  ? 217.781 209.347 167.831 1.00 53.81  ? 518  LEU A  CG  1 
ATOM   3936  C CD1 . LEU A  1 518  ? 216.410 209.501 168.464 1.00 47.24  ? 518  LEU A  CD1 1 
ATOM   3937  C CD2 . LEU A  1 518  ? 218.451 210.702 167.659 1.00 56.08  ? 518  LEU A  CD2 1 
ATOM   3938  N N   . HIS A  1 519  ? 221.557 206.268 168.646 1.00 58.18  ? 519  HIS A  N   1 
ATOM   3939  C CA  . HIS A  1 519  ? 222.357 205.444 169.539 1.00 62.33  ? 519  HIS A  CA  1 
ATOM   3940  C C   . HIS A  1 519  ? 223.856 205.610 169.348 1.00 58.93  ? 519  HIS A  C   1 
ATOM   3941  O O   . HIS A  1 519  ? 224.615 205.280 170.264 1.00 68.63  ? 519  HIS A  O   1 
ATOM   3942  C CB  . HIS A  1 519  ? 222.004 203.961 169.356 1.00 60.29  ? 519  HIS A  CB  1 
ATOM   3943  C CG  . HIS A  1 519  ? 220.545 203.666 169.497 1.00 59.93  ? 519  HIS A  CG  1 
ATOM   3944  N ND1 . HIS A  1 519  ? 219.826 203.986 170.629 1.00 54.19  ? 519  HIS A  ND1 1 
ATOM   3945  C CD2 . HIS A  1 519  ? 219.670 203.068 168.654 1.00 60.29  ? 519  HIS A  CD2 1 
ATOM   3946  C CE1 . HIS A  1 519  ? 218.571 203.605 170.474 1.00 53.21  ? 519  HIS A  CE1 1 
ATOM   3947  N NE2 . HIS A  1 519  ? 218.450 203.045 169.284 1.00 57.95  ? 519  HIS A  NE2 1 
ATOM   3948  N N   . ALA A  1 520  ? 224.296 206.123 168.210 1.00 56.21  ? 520  ALA A  N   1 
ATOM   3949  C CA  . ALA A  1 520  ? 225.707 206.112 167.859 1.00 55.24  ? 520  ALA A  CA  1 
ATOM   3950  C C   . ALA A  1 520  ? 226.031 207.419 167.161 1.00 57.83  ? 520  ALA A  C   1 
ATOM   3951  O O   . ALA A  1 520  ? 225.129 208.132 166.706 1.00 57.62  ? 520  ALA A  O   1 
ATOM   3952  C CB  . ALA A  1 520  ? 226.042 204.917 166.962 1.00 55.01  ? 520  ALA A  CB  1 
ATOM   3953  N N   . PRO A  1 521  ? 227.311 207.774 167.069 1.00 55.90  ? 521  PRO A  N   1 
ATOM   3954  C CA  . PRO A  1 521  ? 227.673 208.987 166.328 1.00 50.30  ? 521  PRO A  CA  1 
ATOM   3955  C C   . PRO A  1 521  ? 227.156 208.909 164.900 1.00 52.95  ? 521  PRO A  C   1 
ATOM   3956  O O   . PRO A  1 521  ? 227.276 207.880 164.233 1.00 59.18  ? 521  PRO A  O   1 
ATOM   3957  C CB  . PRO A  1 521  ? 229.205 208.997 166.386 1.00 47.66  ? 521  PRO A  CB  1 
ATOM   3958  C CG  . PRO A  1 521  ? 229.593 207.601 166.748 1.00 50.27  ? 521  PRO A  CG  1 
ATOM   3959  C CD  . PRO A  1 521  ? 228.499 207.120 167.640 1.00 55.26  ? 521  PRO A  CD  1 
ATOM   3960  N N   . ALA A  1 522  ? 226.577 210.009 164.436 1.00 51.38  ? 522  ALA A  N   1 
ATOM   3961  C CA  . ALA A  1 522  ? 225.863 210.038 163.171 1.00 48.27  ? 522  ALA A  CA  1 
ATOM   3962  C C   . ALA A  1 522  ? 226.754 210.558 162.054 1.00 51.63  ? 522  ALA A  C   1 
ATOM   3963  O O   . ALA A  1 522  ? 227.658 211.368 162.276 1.00 63.41  ? 522  ALA A  O   1 
ATOM   3964  C CB  . ALA A  1 522  ? 224.610 210.906 163.275 1.00 49.97  ? 522  ALA A  CB  1 
ATOM   3965  N N   . THR A  1 523  ? 226.480 210.081 160.840 1.00 57.09  ? 523  THR A  N   1 
ATOM   3966  C CA  . THR A  1 523  ? 227.247 210.450 159.661 1.00 61.79  ? 523  THR A  CA  1 
ATOM   3967  C C   . THR A  1 523  ? 226.373 210.858 158.482 1.00 55.69  ? 523  THR A  C   1 
ATOM   3968  O O   . THR A  1 523  ? 226.909 211.355 157.486 1.00 53.47  ? 523  THR A  O   1 
ATOM   3969  C CB  . THR A  1 523  ? 228.157 209.283 159.242 1.00 64.61  ? 523  THR A  CB  1 
ATOM   3970  O OG1 . THR A  1 523  ? 228.798 208.739 160.403 1.00 58.08  ? 523  THR A  OG1 1 
ATOM   3971  C CG2 . THR A  1 523  ? 229.220 209.734 158.263 1.00 54.39  ? 523  THR A  CG2 1 
ATOM   3972  N N   . VAL A  1 524  ? 225.057 210.675 158.563 1.00 54.10  ? 524  VAL A  N   1 
ATOM   3973  C CA  . VAL A  1 524  ? 224.113 211.119 157.544 1.00 43.33  ? 524  VAL A  CA  1 
ATOM   3974  C C   . VAL A  1 524  ? 223.007 211.886 158.251 1.00 45.35  ? 524  VAL A  C   1 
ATOM   3975  O O   . VAL A  1 524  ? 222.552 211.479 159.325 1.00 58.17  ? 524  VAL A  O   1 
ATOM   3976  C CB  . VAL A  1 524  ? 223.537 209.933 156.743 1.00 49.84  ? 524  VAL A  CB  1 
ATOM   3977  C CG1 . VAL A  1 524  ? 222.427 210.396 155.815 1.00 50.99  ? 524  VAL A  CG1 1 
ATOM   3978  C CG2 . VAL A  1 524  ? 224.638 209.242 155.957 1.00 50.02  ? 524  VAL A  CG2 1 
ATOM   3979  N N   . CYS A  1 525  ? 222.574 212.998 157.660 1.00 42.80  ? 525  CYS A  N   1 
ATOM   3980  C CA  . CYS A  1 525  ? 221.678 213.900 158.370 1.00 58.86  ? 525  CYS A  CA  1 
ATOM   3981  C C   . CYS A  1 525  ? 220.730 214.600 157.410 1.00 49.70  ? 525  CYS A  C   1 
ATOM   3982  O O   . CYS A  1 525  ? 220.991 214.698 156.210 1.00 58.03  ? 525  CYS A  O   1 
ATOM   3983  C CB  . CYS A  1 525  ? 222.462 214.946 159.163 1.00 52.99  ? 525  CYS A  CB  1 
ATOM   3984  S SG  . CYS A  1 525  ? 223.177 214.321 160.692 1.00 75.41  ? 525  CYS A  SG  1 
ATOM   3985  N N   . GLY A  1 526  ? 219.620 215.078 157.967 1.00 48.40  ? 526  GLY A  N   1 
ATOM   3986  C CA  . GLY A  1 526  ? 218.636 215.832 157.231 1.00 53.25  ? 526  GLY A  CA  1 
ATOM   3987  C C   . GLY A  1 526  ? 219.098 217.237 156.899 1.00 59.51  ? 526  GLY A  C   1 
ATOM   3988  O O   . GLY A  1 526  ? 220.133 217.710 157.377 1.00 60.23  ? 526  GLY A  O   1 
ATOM   3989  N N   . PRO A  1 527  ? 218.332 217.930 156.046 1.00 56.22  ? 527  PRO A  N   1 
ATOM   3990  C CA  . PRO A  1 527  ? 218.694 219.270 155.568 1.00 60.85  ? 527  PRO A  CA  1 
ATOM   3991  C C   . PRO A  1 527  ? 218.291 220.415 156.499 1.00 59.30  ? 527  PRO A  C   1 
ATOM   3992  O O   . PRO A  1 527  ? 217.631 221.371 156.088 1.00 58.40  ? 527  PRO A  O   1 
ATOM   3993  C CB  . PRO A  1 527  ? 217.954 219.350 154.230 1.00 59.34  ? 527  PRO A  CB  1 
ATOM   3994  C CG  . PRO A  1 527  ? 216.703 218.572 154.480 1.00 58.09  ? 527  PRO A  CG  1 
ATOM   3995  C CD  . PRO A  1 527  ? 217.073 217.461 155.441 1.00 56.79  ? 527  PRO A  CD  1 
ATOM   3996  N N   . LYS A  1 528  ? 218.676 220.313 157.769 1.00 52.73  ? 528  LYS A  N   1 
ATOM   3997  C CA  . LYS A  1 528  ? 218.414 221.363 158.748 1.00 57.00  ? 528  LYS A  CA  1 
ATOM   3998  C C   . LYS A  1 528  ? 219.707 222.084 159.108 1.00 68.20  ? 528  LYS A  C   1 
ATOM   3999  O O   . LYS A  1 528  ? 220.725 221.442 159.386 1.00 65.93  ? 528  LYS A  O   1 
ATOM   4000  C CB  . LYS A  1 528  ? 217.761 220.787 160.004 1.00 55.77  ? 528  LYS A  CB  1 
ATOM   4001  C CG  . LYS A  1 528  ? 216.363 220.249 159.767 1.00 55.67  ? 528  LYS A  CG  1 
ATOM   4002  C CD  . LYS A  1 528  ? 215.746 219.720 161.045 1.00 46.82  ? 528  LYS A  CD  1 
ATOM   4003  C CE  . LYS A  1 528  ? 215.251 220.841 161.938 1.00 48.88  ? 528  LYS A  CE  1 
ATOM   4004  N NZ  . LYS A  1 528  ? 213.994 221.439 161.408 1.00 59.38  ? 528  LYS A  NZ  1 
ATOM   4005  N N   . LYS A  1 529  ? 219.658 223.415 159.102 1.00 66.87  ? 529  LYS A  N   1 
ATOM   4006  C CA  . LYS A  1 529  ? 220.826 224.219 159.440 1.00 63.76  ? 529  LYS A  CA  1 
ATOM   4007  C C   . LYS A  1 529  ? 221.079 224.199 160.943 1.00 51.98  ? 529  LYS A  C   1 
ATOM   4008  O O   . LYS A  1 529  ? 220.146 224.314 161.743 1.00 52.40  ? 529  LYS A  O   1 
ATOM   4009  C CB  . LYS A  1 529  ? 220.632 225.657 158.965 1.00 63.22  ? 529  LYS A  CB  1 
ATOM   4010  C CG  . LYS A  1 529  ? 220.453 225.802 157.465 1.00 59.16  ? 529  LYS A  CG  1 
ATOM   4011  C CD  . LYS A  1 529  ? 221.738 225.487 156.720 1.00 59.76  ? 529  LYS A  CD  1 
ATOM   4012  C CE  . LYS A  1 529  ? 221.596 225.750 155.231 1.00 62.67  ? 529  LYS A  CE  1 
ATOM   4013  N NZ  . LYS A  1 529  ? 222.843 225.414 154.486 1.00 63.63  ? 529  LYS A  NZ  1 
ATOM   4014  N N   . SER A  1 530  ? 222.345 224.053 161.322 1.00 48.89  ? 530  SER A  N   1 
ATOM   4015  C CA  . SER A  1 530  ? 222.722 224.110 162.727 1.00 53.68  ? 530  SER A  CA  1 
ATOM   4016  C C   . SER A  1 530  ? 222.690 225.544 163.243 1.00 56.81  ? 530  SER A  C   1 
ATOM   4017  O O   . SER A  1 530  ? 223.146 226.475 162.574 1.00 68.01  ? 530  SER A  O   1 
ATOM   4018  C CB  . SER A  1 530  ? 224.117 223.517 162.922 1.00 53.29  ? 530  SER A  CB  1 
ATOM   4019  O OG  . SER A  1 530  ? 224.135 222.138 162.603 1.00 52.79  ? 530  SER A  OG  1 
ATOM   4020  N N   . THR A  1 531  ? 222.134 225.720 164.438 1.00 54.06  ? 531  THR A  N   1 
ATOM   4021  C CA  . THR A  1 531  ? 222.196 226.996 165.131 1.00 51.27  ? 531  THR A  CA  1 
ATOM   4022  C C   . THR A  1 531  ? 223.524 227.124 165.875 1.00 55.01  ? 531  THR A  C   1 
ATOM   4023  O O   . THR A  1 531  ? 224.285 226.163 166.012 1.00 54.88  ? 531  THR A  O   1 
ATOM   4024  C CB  . THR A  1 531  ? 221.033 227.135 166.110 1.00 50.70  ? 531  THR A  CB  1 
ATOM   4025  O OG1 . THR A  1 531  ? 221.184 226.179 167.164 1.00 50.30  ? 531  THR A  OG1 1 
ATOM   4026  C CG2 . THR A  1 531  ? 219.704 226.902 165.408 1.00 41.67  ? 531  THR A  CG2 1 
ATOM   4027  N N   . ASN A  1 532  ? 223.812 228.334 166.349 1.00 58.15  ? 532  ASN A  N   1 
ATOM   4028  C CA  . ASN A  1 532  ? 224.986 228.522 167.190 1.00 59.79  ? 532  ASN A  CA  1 
ATOM   4029  C C   . ASN A  1 532  ? 224.754 227.899 168.561 1.00 60.23  ? 532  ASN A  C   1 
ATOM   4030  O O   . ASN A  1 532  ? 223.622 227.794 169.040 1.00 58.44  ? 532  ASN A  O   1 
ATOM   4031  C CB  . ASN A  1 532  ? 225.325 230.005 167.337 1.00 64.22  ? 532  ASN A  CB  1 
ATOM   4032  C CG  . ASN A  1 532  ? 226.677 230.227 167.990 1.00 71.87  ? 532  ASN A  CG  1 
ATOM   4033  O OD1 . ASN A  1 532  ? 227.419 229.276 168.238 1.00 60.48  ? 532  ASN A  OD1 1 
ATOM   4034  N ND2 . ASN A  1 532  ? 227.009 231.483 168.266 1.00 71.74  ? 532  ASN A  ND2 1 
ATOM   4035  N N   . LEU A  1 533  ? 225.845 227.489 169.199 1.00 66.58  ? 533  LEU A  N   1 
ATOM   4036  C CA  . LEU A  1 533  ? 225.760 226.786 170.472 1.00 55.68  ? 533  LEU A  CA  1 
ATOM   4037  C C   . LEU A  1 533  ? 225.613 227.776 171.622 1.00 58.94  ? 533  LEU A  C   1 
ATOM   4038  O O   . LEU A  1 533  ? 226.350 228.764 171.702 1.00 69.70  ? 533  LEU A  O   1 
ATOM   4039  C CB  . LEU A  1 533  ? 226.996 225.911 170.674 1.00 54.74  ? 533  LEU A  CB  1 
ATOM   4040  C CG  . LEU A  1 533  ? 227.079 225.124 171.982 1.00 54.69  ? 533  LEU A  CG  1 
ATOM   4041  C CD1 . LEU A  1 533  ? 225.871 224.221 172.161 1.00 55.01  ? 533  LEU A  CD1 1 
ATOM   4042  C CD2 . LEU A  1 533  ? 228.361 224.315 172.013 1.00 56.34  ? 533  LEU A  CD2 1 
ATOM   4043  N N   . VAL A  1 534  ? 224.659 227.507 172.512 1.00 60.24  ? 534  VAL A  N   1 
ATOM   4044  C CA  . VAL A  1 534  ? 224.425 228.317 173.700 1.00 63.14  ? 534  VAL A  CA  1 
ATOM   4045  C C   . VAL A  1 534  ? 224.452 227.409 174.920 1.00 61.83  ? 534  VAL A  C   1 
ATOM   4046  O O   . VAL A  1 534  ? 224.031 226.249 174.864 1.00 66.33  ? 534  VAL A  O   1 
ATOM   4047  C CB  . VAL A  1 534  ? 223.090 229.088 173.626 1.00 63.35  ? 534  VAL A  CB  1 
ATOM   4048  C CG1 . VAL A  1 534  ? 223.167 230.179 172.572 1.00 57.81  ? 534  VAL A  CG1 1 
ATOM   4049  C CG2 . VAL A  1 534  ? 221.941 228.140 173.331 1.00 54.10  ? 534  VAL A  CG2 1 
ATOM   4050  N N   . LYS A  1 535  ? 224.949 227.947 176.031 1.00 56.42  ? 535  LYS A  N   1 
ATOM   4051  C CA  . LYS A  1 535  ? 225.102 227.191 177.264 1.00 56.08  ? 535  LYS A  CA  1 
ATOM   4052  C C   . LYS A  1 535  ? 224.573 228.005 178.436 1.00 60.75  ? 535  LYS A  C   1 
ATOM   4053  O O   . LYS A  1 535  ? 224.450 229.230 178.368 1.00 62.77  ? 535  LYS A  O   1 
ATOM   4054  C CB  . LYS A  1 535  ? 226.567 226.814 177.513 1.00 52.65  ? 535  LYS A  CB  1 
ATOM   4055  C CG  . LYS A  1 535  ? 227.205 226.040 176.374 1.00 43.96  ? 535  LYS A  CG  1 
ATOM   4056  C CD  . LYS A  1 535  ? 228.708 225.934 176.553 1.00 53.91  ? 535  LYS A  CD  1 
ATOM   4057  C CE  . LYS A  1 535  ? 229.372 225.363 175.315 1.00 52.69  ? 535  LYS A  CE  1 
ATOM   4058  N NZ  . LYS A  1 535  ? 230.854 225.406 175.418 1.00 55.37  ? 535  LYS A  NZ  1 
ATOM   4059  N N   . ASN A  1 536  ? 224.261 227.298 179.521 1.00 52.56  ? 536  ASN A  N   1 
ATOM   4060  C CA  . ASN A  1 536  ? 223.744 227.912 180.739 1.00 52.94  ? 536  ASN A  CA  1 
ATOM   4061  C C   . ASN A  1 536  ? 222.435 228.656 180.483 1.00 59.41  ? 536  ASN A  C   1 
ATOM   4062  O O   . ASN A  1 536  ? 222.129 229.648 181.148 1.00 59.32  ? 536  ASN A  O   1 
ATOM   4063  C CB  . ASN A  1 536  ? 224.785 228.846 181.360 1.00 59.51  ? 536  ASN A  CB  1 
ATOM   4064  C CG  . ASN A  1 536  ? 226.115 228.158 181.585 1.00 56.40  ? 536  ASN A  CG  1 
ATOM   4065  O OD1 . ASN A  1 536  ? 226.555 227.351 180.767 1.00 49.68  ? 536  ASN A  OD1 1 
ATOM   4066  N ND2 . ASN A  1 536  ? 226.758 228.464 182.706 1.00 64.45  ? 536  ASN A  ND2 1 
ATOM   4067  N N   . LYS A  1 537  ? 221.655 228.178 179.517 1.00 55.01  ? 537  LYS A  N   1 
ATOM   4068  C CA  . LYS A  1 537  ? 220.328 228.702 179.235 1.00 54.14  ? 537  LYS A  CA  1 
ATOM   4069  C C   . LYS A  1 537  ? 219.391 227.536 178.970 1.00 55.52  ? 537  LYS A  C   1 
ATOM   4070  O O   . LYS A  1 537  ? 219.802 226.525 178.396 1.00 57.02  ? 537  LYS A  O   1 
ATOM   4071  C CB  . LYS A  1 537  ? 220.323 229.637 178.019 1.00 55.30  ? 537  LYS A  CB  1 
ATOM   4072  C CG  . LYS A  1 537  ? 220.965 230.997 178.225 1.00 56.77  ? 537  LYS A  CG  1 
ATOM   4073  C CD  . LYS A  1 537  ? 220.859 231.807 176.941 1.00 63.44  ? 537  LYS A  CD  1 
ATOM   4074  C CE  . LYS A  1 537  ? 221.450 233.198 177.067 1.00 66.94  ? 537  LYS A  CE  1 
ATOM   4075  N NZ  . LYS A  1 537  ? 221.329 233.941 175.780 1.00 60.65  ? 537  LYS A  NZ  1 
ATOM   4076  N N   . CYS A  1 538  ? 218.134 227.678 179.381 1.00 54.42  ? 538  CYS A  N   1 
ATOM   4077  C CA  . CYS A  1 538  ? 217.141 226.651 179.098 1.00 51.76  ? 538  CYS A  CA  1 
ATOM   4078  C C   . CYS A  1 538  ? 216.702 226.757 177.642 1.00 60.25  ? 538  CYS A  C   1 
ATOM   4079  O O   . CYS A  1 538  ? 216.154 227.784 177.227 1.00 60.09  ? 538  CYS A  O   1 
ATOM   4080  C CB  . CYS A  1 538  ? 215.947 226.796 180.037 1.00 45.13  ? 538  CYS A  CB  1 
ATOM   4081  S SG  . CYS A  1 538  ? 214.823 225.375 180.027 1.00 59.05  ? 538  CYS A  SG  1 
ATOM   4082  N N   . VAL A  1 539  ? 216.940 225.697 176.867 1.00 63.24  ? 539  VAL A  N   1 
ATOM   4083  C CA  . VAL A  1 539  ? 216.715 225.711 175.427 1.00 49.09  ? 539  VAL A  CA  1 
ATOM   4084  C C   . VAL A  1 539  ? 216.118 224.381 174.986 1.00 44.16  ? 539  VAL A  C   1 
ATOM   4085  O O   . VAL A  1 539  ? 216.357 223.337 175.598 1.00 52.29  ? 539  VAL A  O   1 
ATOM   4086  C CB  . VAL A  1 539  ? 218.026 225.987 174.659 1.00 52.05  ? 539  VAL A  CB  1 
ATOM   4087  C CG1 . VAL A  1 539  ? 218.462 227.429 174.853 1.00 58.70  ? 539  VAL A  CG1 1 
ATOM   4088  C CG2 . VAL A  1 539  ? 219.120 225.034 175.123 1.00 43.85  ? 539  VAL A  CG2 1 
ATOM   4089  N N   . ASN A  1 540  ? 215.334 224.427 173.908 1.00 46.29  ? 540  ASN A  N   1 
ATOM   4090  C CA  . ASN A  1 540  ? 214.824 223.221 173.254 1.00 44.76  ? 540  ASN A  CA  1 
ATOM   4091  C C   . ASN A  1 540  ? 215.893 222.719 172.293 1.00 46.59  ? 540  ASN A  C   1 
ATOM   4092  O O   . ASN A  1 540  ? 215.963 223.130 171.134 1.00 48.56  ? 540  ASN A  O   1 
ATOM   4093  C CB  . ASN A  1 540  ? 213.513 223.503 172.530 1.00 53.60  ? 540  ASN A  CB  1 
ATOM   4094  C CG  . ASN A  1 540  ? 212.336 223.608 173.473 1.00 52.32  ? 540  ASN A  CG  1 
ATOM   4095  O OD1 . ASN A  1 540  ? 212.308 222.964 174.521 1.00 58.74  ? 540  ASN A  OD1 1 
ATOM   4096  N ND2 . ASN A  1 540  ? 211.351 224.418 173.105 1.00 47.04  ? 540  ASN A  ND2 1 
ATOM   4097  N N   . PHE A  1 541  ? 216.738 221.818 172.780 1.00 50.62  ? 541  PHE A  N   1 
ATOM   4098  C CA  . PHE A  1 541  ? 217.889 221.381 172.007 1.00 42.71  ? 541  PHE A  CA  1 
ATOM   4099  C C   . PHE A  1 541  ? 217.521 220.265 171.036 1.00 39.17  ? 541  PHE A  C   1 
ATOM   4100  O O   . PHE A  1 541  ? 216.521 219.563 171.195 1.00 44.34  ? 541  PHE A  O   1 
ATOM   4101  C CB  . PHE A  1 541  ? 219.016 220.919 172.933 1.00 41.52  ? 541  PHE A  CB  1 
ATOM   4102  C CG  . PHE A  1 541  ? 218.644 219.764 173.820 1.00 52.74  ? 541  PHE A  CG  1 
ATOM   4103  C CD1 . PHE A  1 541  ? 218.645 218.469 173.335 1.00 54.34  ? 541  PHE A  CD1 1 
ATOM   4104  C CD2 . PHE A  1 541  ? 218.309 219.973 175.144 1.00 54.89  ? 541  PHE A  CD2 1 
ATOM   4105  C CE1 . PHE A  1 541  ? 218.306 217.411 174.148 1.00 47.39  ? 541  PHE A  CE1 1 
ATOM   4106  C CE2 . PHE A  1 541  ? 217.972 218.917 175.960 1.00 57.76  ? 541  PHE A  CE2 1 
ATOM   4107  C CZ  . PHE A  1 541  ? 217.971 217.635 175.461 1.00 55.62  ? 541  PHE A  CZ  1 
ATOM   4108  N N   . ASN A  1 542  ? 218.356 220.122 170.008 1.00 40.39  ? 542  ASN A  N   1 
ATOM   4109  C CA  . ASN A  1 542  ? 218.239 219.051 169.021 1.00 39.85  ? 542  ASN A  CA  1 
ATOM   4110  C C   . ASN A  1 542  ? 219.647 218.688 168.574 1.00 41.19  ? 542  ASN A  C   1 
ATOM   4111  O O   . ASN A  1 542  ? 220.262 219.430 167.803 1.00 43.18  ? 542  ASN A  O   1 
ATOM   4112  C CB  . ASN A  1 542  ? 217.378 219.487 167.833 1.00 47.22  ? 542  ASN A  CB  1 
ATOM   4113  C CG  . ASN A  1 542  ? 217.249 218.411 166.771 1.00 39.61  ? 542  ASN A  CG  1 
ATOM   4114  O OD1 . ASN A  1 542  ? 218.099 217.532 166.650 1.00 49.67  ? 542  ASN A  OD1 1 
ATOM   4115  N ND2 . ASN A  1 542  ? 216.182 218.483 165.987 1.00 38.66  ? 542  ASN A  ND2 1 
ATOM   4116  N N   . PHE A  1 543  ? 220.155 217.552 169.047 1.00 45.59  ? 543  PHE A  N   1 
ATOM   4117  C CA  . PHE A  1 543  ? 221.481 217.058 168.685 1.00 42.83  ? 543  PHE A  CA  1 
ATOM   4118  C C   . PHE A  1 543  ? 221.310 215.795 167.855 1.00 44.11  ? 543  PHE A  C   1 
ATOM   4119  O O   . PHE A  1 543  ? 220.858 214.767 168.368 1.00 55.62  ? 543  PHE A  O   1 
ATOM   4120  C CB  . PHE A  1 543  ? 222.323 216.767 169.925 1.00 45.73  ? 543  PHE A  CB  1 
ATOM   4121  C CG  . PHE A  1 543  ? 222.830 217.993 170.620 1.00 45.77  ? 543  PHE A  CG  1 
ATOM   4122  C CD1 . PHE A  1 543  ? 222.065 218.629 171.577 1.00 44.09  ? 543  PHE A  CD1 1 
ATOM   4123  C CD2 . PHE A  1 543  ? 224.079 218.500 170.328 1.00 41.15  ? 543  PHE A  CD2 1 
ATOM   4124  C CE1 . PHE A  1 543  ? 222.534 219.751 172.220 1.00 44.51  ? 543  PHE A  CE1 1 
ATOM   4125  C CE2 . PHE A  1 543  ? 224.551 219.621 170.968 1.00 47.14  ? 543  PHE A  CE2 1 
ATOM   4126  C CZ  . PHE A  1 543  ? 223.778 220.247 171.915 1.00 53.47  ? 543  PHE A  CZ  1 
ATOM   4127  N N   . ASN A  1 544  ? 221.679 215.864 166.581 1.00 45.82  ? 544  ASN A  N   1 
ATOM   4128  C CA  . ASN A  1 544  ? 221.582 214.704 165.701 1.00 56.31  ? 544  ASN A  CA  1 
ATOM   4129  C C   . ASN A  1 544  ? 220.176 214.114 165.749 1.00 50.58  ? 544  ASN A  C   1 
ATOM   4130  O O   . ASN A  1 544  ? 219.985 212.897 165.780 1.00 51.17  ? 544  ASN A  O   1 
ATOM   4131  C CB  . ASN A  1 544  ? 222.629 213.655 166.074 1.00 57.59  ? 544  ASN A  CB  1 
ATOM   4132  C CG  . ASN A  1 544  ? 224.021 214.046 165.634 1.00 48.97  ? 544  ASN A  CG  1 
ATOM   4133  O OD1 . ASN A  1 544  ? 224.405 213.823 164.489 1.00 47.31  ? 544  ASN A  OD1 1 
ATOM   4134  N ND2 . ASN A  1 544  ? 224.788 214.634 166.538 1.00 57.82  ? 544  ASN A  ND2 1 
ATOM   4135  N N   . GLY A  1 545  ? 219.179 214.993 165.772 1.00 52.20  ? 545  GLY A  N   1 
ATOM   4136  C CA  . GLY A  1 545  ? 217.803 214.579 165.894 1.00 49.15  ? 545  GLY A  CA  1 
ATOM   4137  C C   . GLY A  1 545  ? 217.348 214.310 167.309 1.00 49.38  ? 545  GLY A  C   1 
ATOM   4138  O O   . GLY A  1 545  ? 216.150 214.088 167.525 1.00 58.57  ? 545  GLY A  O   1 
ATOM   4139  N N   . LEU A  1 546  ? 218.258 214.322 168.283 1.00 47.87  ? 546  LEU A  N   1 
ATOM   4140  C CA  . LEU A  1 546  ? 217.928 214.064 169.683 1.00 48.06  ? 546  LEU A  CA  1 
ATOM   4141  C C   . LEU A  1 546  ? 217.288 215.312 170.283 1.00 48.58  ? 546  LEU A  C   1 
ATOM   4142  O O   . LEU A  1 546  ? 217.912 216.087 171.010 1.00 49.19  ? 546  LEU A  O   1 
ATOM   4143  C CB  . LEU A  1 546  ? 219.178 213.665 170.455 1.00 55.50  ? 546  LEU A  CB  1 
ATOM   4144  C CG  . LEU A  1 546  ? 219.013 213.373 171.943 1.00 63.77  ? 546  LEU A  CG  1 
ATOM   4145  C CD1 . LEU A  1 546  ? 219.075 211.877 172.195 1.00 69.74  ? 546  LEU A  CD1 1 
ATOM   4146  C CD2 . LEU A  1 546  ? 220.081 214.113 172.735 1.00 41.57  ? 546  LEU A  CD2 1 
ATOM   4147  N N   . THR A  1 547  ? 216.011 215.504 169.976 1.00 47.16  ? 547  THR A  N   1 
ATOM   4148  C CA  . THR A  1 547  ? 215.295 216.660 170.489 1.00 49.67  ? 547  THR A  CA  1 
ATOM   4149  C C   . THR A  1 547  ? 215.075 216.534 171.992 1.00 48.32  ? 547  THR A  C   1 
ATOM   4150  O O   . THR A  1 547  ? 215.008 215.434 172.545 1.00 55.27  ? 547  THR A  O   1 
ATOM   4151  C CB  . THR A  1 547  ? 213.948 216.816 169.786 1.00 44.39  ? 547  THR A  CB  1 
ATOM   4152  O OG1 . THR A  1 547  ? 213.158 215.640 170.000 1.00 42.25  ? 547  THR A  OG1 1 
ATOM   4153  C CG2 . THR A  1 547  ? 214.136 217.037 168.294 1.00 42.90  ? 547  THR A  CG2 1 
ATOM   4154  N N   . GLY A  1 548  ? 214.970 217.679 172.654 1.00 52.75  ? 548  GLY A  N   1 
ATOM   4155  C CA  . GLY A  1 548  ? 214.704 217.681 174.078 1.00 47.93  ? 548  GLY A  CA  1 
ATOM   4156  C C   . GLY A  1 548  ? 214.623 219.094 174.609 1.00 52.80  ? 548  GLY A  C   1 
ATOM   4157  O O   . GLY A  1 548  ? 214.573 220.063 173.850 1.00 57.91  ? 548  GLY A  O   1 
ATOM   4158  N N   . THR A  1 549  ? 214.602 219.193 175.935 1.00 51.25  ? 549  THR A  N   1 
ATOM   4159  C CA  . THR A  1 549  ? 214.609 220.473 176.628 1.00 50.43  ? 549  THR A  CA  1 
ATOM   4160  C C   . THR A  1 549  ? 215.505 220.357 177.850 1.00 48.54  ? 549  THR A  C   1 
ATOM   4161  O O   . THR A  1 549  ? 215.470 219.346 178.556 1.00 58.47  ? 549  THR A  O   1 
ATOM   4162  C CB  . THR A  1 549  ? 213.194 220.893 177.054 1.00 52.39  ? 549  THR A  CB  1 
ATOM   4163  O OG1 . THR A  1 549  ? 212.310 220.816 175.929 1.00 51.36  ? 549  THR A  OG1 1 
ATOM   4164  C CG2 . THR A  1 549  ? 213.193 222.316 177.597 1.00 49.85  ? 549  THR A  CG2 1 
ATOM   4165  N N   . GLY A  1 550  ? 216.306 221.380 178.093 1.00 42.15  ? 550  GLY A  N   1 
ATOM   4166  C CA  . GLY A  1 550  ? 217.163 221.383 179.259 1.00 44.52  ? 550  GLY A  CA  1 
ATOM   4167  C C   . GLY A  1 550  ? 218.290 222.381 179.117 1.00 45.28  ? 550  GLY A  C   1 
ATOM   4168  O O   . GLY A  1 550  ? 218.441 223.049 178.095 1.00 54.59  ? 550  GLY A  O   1 
ATOM   4169  N N   . VAL A  1 551  ? 219.082 222.464 180.179 1.00 39.64  ? 551  VAL A  N   1 
ATOM   4170  C CA  . VAL A  1 551  ? 220.210 223.384 180.250 1.00 44.62  ? 551  VAL A  CA  1 
ATOM   4171  C C   . VAL A  1 551  ? 221.468 222.657 179.793 1.00 50.81  ? 551  VAL A  C   1 
ATOM   4172  O O   . VAL A  1 551  ? 221.796 221.583 180.306 1.00 55.40  ? 551  VAL A  O   1 
ATOM   4173  C CB  . VAL A  1 551  ? 220.382 223.939 181.672 1.00 46.37  ? 551  VAL A  CB  1 
ATOM   4174  C CG1 . VAL A  1 551  ? 221.708 224.678 181.808 1.00 48.74  ? 551  VAL A  CG1 1 
ATOM   4175  C CG2 . VAL A  1 551  ? 219.214 224.847 182.026 1.00 47.77  ? 551  VAL A  CG2 1 
ATOM   4176  N N   . LEU A  1 552  ? 222.172 223.245 178.831 1.00 55.37  ? 552  LEU A  N   1 
ATOM   4177  C CA  . LEU A  1 552  ? 223.434 222.703 178.350 1.00 51.71  ? 552  LEU A  CA  1 
ATOM   4178  C C   . LEU A  1 552  ? 224.595 223.276 179.152 1.00 52.35  ? 552  LEU A  C   1 
ATOM   4179  O O   . LEU A  1 552  ? 224.581 224.439 179.563 1.00 61.57  ? 552  LEU A  O   1 
ATOM   4180  C CB  . LEU A  1 552  ? 223.621 223.015 176.866 1.00 49.66  ? 552  LEU A  CB  1 
ATOM   4181  C CG  . LEU A  1 552  ? 222.479 222.556 175.959 1.00 53.03  ? 552  LEU A  CG  1 
ATOM   4182  C CD1 . LEU A  1 552  ? 222.743 222.959 174.521 1.00 64.50  ? 552  LEU A  CD1 1 
ATOM   4183  C CD2 . LEU A  1 552  ? 222.270 221.055 176.062 1.00 44.89  ? 552  LEU A  CD2 1 
ATOM   4184  N N   . THR A  1 553  ? 225.608 222.443 179.373 1.00 45.22  ? 553  THR A  N   1 
ATOM   4185  C CA  . THR A  1 553  ? 226.747 222.833 180.186 1.00 43.09  ? 553  THR A  CA  1 
ATOM   4186  C C   . THR A  1 553  ? 227.975 222.066 179.723 1.00 50.48  ? 553  THR A  C   1 
ATOM   4187  O O   . THR A  1 553  ? 227.867 220.974 179.161 1.00 57.29  ? 553  THR A  O   1 
ATOM   4188  C CB  . THR A  1 553  ? 226.476 222.575 181.676 1.00 52.17  ? 553  THR A  CB  1 
ATOM   4189  O OG1 . THR A  1 553  ? 225.465 223.478 182.144 1.00 56.09  ? 553  THR A  OG1 1 
ATOM   4190  C CG2 . THR A  1 553  ? 227.737 222.759 182.504 1.00 60.32  ? 553  THR A  CG2 1 
ATOM   4191  N N   . GLU A  1 554  ? 229.145 222.654 179.960 1.00 58.03  ? 554  GLU A  N   1 
ATOM   4192  C CA  . GLU A  1 554  ? 230.404 222.032 179.573 1.00 52.76  ? 554  GLU A  CA  1 
ATOM   4193  C C   . GLU A  1 554  ? 230.719 220.867 180.503 1.00 58.28  ? 554  GLU A  C   1 
ATOM   4194  O O   . GLU A  1 554  ? 230.840 221.047 181.720 1.00 59.20  ? 554  GLU A  O   1 
ATOM   4195  C CB  . GLU A  1 554  ? 231.525 223.068 179.600 1.00 56.64  ? 554  GLU A  CB  1 
ATOM   4196  C CG  . GLU A  1 554  ? 231.268 224.263 178.697 1.00 59.87  ? 554  GLU A  CG  1 
ATOM   4197  C CD  . GLU A  1 554  ? 232.459 225.193 178.602 1.00 67.12  ? 554  GLU A  CD  1 
ATOM   4198  O OE1 . GLU A  1 554  ? 233.300 225.179 179.525 1.00 69.22  ? 554  GLU A  OE1 1 
ATOM   4199  O OE2 . GLU A  1 554  ? 232.557 225.936 177.603 1.00 64.92  ? 554  GLU A  OE2 1 
ATOM   4200  N N   . SER A  1 555  ? 230.847 219.675 179.930 1.00 63.16  ? 555  SER A  N   1 
ATOM   4201  C CA  . SER A  1 555  ? 231.087 218.469 180.706 1.00 61.66  ? 555  SER A  CA  1 
ATOM   4202  C C   . SER A  1 555  ? 232.578 218.217 180.887 1.00 61.50  ? 555  SER A  C   1 
ATOM   4203  O O   . SER A  1 555  ? 233.403 218.614 180.060 1.00 61.09  ? 555  SER A  O   1 
ATOM   4204  C CB  . SER A  1 555  ? 230.455 217.260 180.020 1.00 57.67  ? 555  SER A  CB  1 
ATOM   4205  O OG  . SER A  1 555  ? 230.401 216.148 180.895 1.00 55.27  ? 555  SER A  OG  1 
ATOM   4206  N N   . ASN A  1 556  ? 232.917 217.544 181.984 1.00 59.96  ? 556  ASN A  N   1 
ATOM   4207  C CA  . ASN A  1 556  ? 234.259 217.021 182.192 1.00 64.12  ? 556  ASN A  CA  1 
ATOM   4208  C C   . ASN A  1 556  ? 234.348 215.526 181.915 1.00 64.42  ? 556  ASN A  C   1 
ATOM   4209  O O   . ASN A  1 556  ? 235.400 214.926 182.155 1.00 63.71  ? 556  ASN A  O   1 
ATOM   4210  C CB  . ASN A  1 556  ? 234.730 217.321 183.620 1.00 69.79  ? 556  ASN A  CB  1 
ATOM   4211  C CG  . ASN A  1 556  ? 233.900 216.619 184.670 1.00 70.71  ? 556  ASN A  CG  1 
ATOM   4212  O OD1 . ASN A  1 556  ? 232.708 216.885 184.816 1.00 78.40  ? 556  ASN A  OD1 1 
ATOM   4213  N ND2 . ASN A  1 556  ? 234.530 215.724 185.423 1.00 66.87  ? 556  ASN A  ND2 1 
ATOM   4214  N N   . LYS A  1 557  ? 233.273 214.915 181.423 1.00 66.00  ? 557  LYS A  N   1 
ATOM   4215  C CA  . LYS A  1 557  ? 233.308 213.512 181.036 1.00 58.06  ? 557  LYS A  CA  1 
ATOM   4216  C C   . LYS A  1 557  ? 234.181 213.319 179.804 1.00 58.63  ? 557  LYS A  C   1 
ATOM   4217  O O   . LYS A  1 557  ? 234.372 214.233 178.998 1.00 59.66  ? 557  LYS A  O   1 
ATOM   4218  C CB  . LYS A  1 557  ? 231.900 212.996 180.741 1.00 45.54  ? 557  LYS A  CB  1 
ATOM   4219  C CG  . LYS A  1 557  ? 230.966 213.016 181.926 1.00 48.44  ? 557  LYS A  CG  1 
ATOM   4220  C CD  . LYS A  1 557  ? 229.631 212.405 181.563 1.00 55.25  ? 557  LYS A  CD  1 
ATOM   4221  C CE  . LYS A  1 557  ? 228.642 212.523 182.703 1.00 51.55  ? 557  LYS A  CE  1 
ATOM   4222  N NZ  . LYS A  1 557  ? 227.398 211.756 182.419 1.00 66.99  ? 557  LYS A  NZ  1 
ATOM   4223  N N   . LYS A  1 558  ? 234.711 212.109 179.662 1.00 55.73  ? 558  LYS A  N   1 
ATOM   4224  C CA  . LYS A  1 558  ? 235.562 211.748 178.537 1.00 54.90  ? 558  LYS A  CA  1 
ATOM   4225  C C   . LYS A  1 558  ? 234.933 210.577 177.799 1.00 52.67  ? 558  LYS A  C   1 
ATOM   4226  O O   . LYS A  1 558  ? 234.785 209.490 178.365 1.00 64.35  ? 558  LYS A  O   1 
ATOM   4227  C CB  . LYS A  1 558  ? 236.969 211.399 179.018 1.00 53.94  ? 558  LYS A  CB  1 
ATOM   4228  C CG  . LYS A  1 558  ? 237.659 212.555 179.717 1.00 60.42  ? 558  LYS A  CG  1 
ATOM   4229  C CD  . LYS A  1 558  ? 239.059 212.186 180.165 1.00 57.00  ? 558  LYS A  CD  1 
ATOM   4230  C CE  . LYS A  1 558  ? 239.034 211.204 181.323 1.00 59.63  ? 558  LYS A  CE  1 
ATOM   4231  N NZ  . LYS A  1 558  ? 238.340 211.767 182.513 1.00 71.90  ? 558  LYS A  NZ  1 
ATOM   4232  N N   . PHE A  1 559  ? 234.576 210.798 176.538 1.00 47.02  ? 559  PHE A  N   1 
ATOM   4233  C CA  . PHE A  1 559  ? 233.945 209.783 175.705 1.00 46.01  ? 559  PHE A  CA  1 
ATOM   4234  C C   . PHE A  1 559  ? 234.991 209.155 174.797 1.00 53.63  ? 559  PHE A  C   1 
ATOM   4235  O O   . PHE A  1 559  ? 235.736 209.868 174.117 1.00 70.14  ? 559  PHE A  O   1 
ATOM   4236  C CB  . PHE A  1 559  ? 232.829 210.377 174.848 1.00 49.43  ? 559  PHE A  CB  1 
ATOM   4237  C CG  . PHE A  1 559  ? 231.571 210.684 175.600 1.00 46.89  ? 559  PHE A  CG  1 
ATOM   4238  C CD1 . PHE A  1 559  ? 231.571 210.827 176.974 1.00 54.03  ? 559  PHE A  CD1 1 
ATOM   4239  C CD2 . PHE A  1 559  ? 230.379 210.826 174.919 1.00 42.95  ? 559  PHE A  CD2 1 
ATOM   4240  C CE1 . PHE A  1 559  ? 230.408 211.109 177.651 1.00 56.14  ? 559  PHE A  CE1 1 
ATOM   4241  C CE2 . PHE A  1 559  ? 229.216 211.107 175.590 1.00 47.78  ? 559  PHE A  CE2 1 
ATOM   4242  C CZ  . PHE A  1 559  ? 229.227 211.248 176.956 1.00 47.05  ? 559  PHE A  CZ  1 
ATOM   4243  N N   . LEU A  1 560  ? 235.043 207.832 174.783 1.00 56.93  ? 560  LEU A  N   1 
ATOM   4244  C CA  . LEU A  1 560  ? 235.787 207.157 173.737 1.00 57.49  ? 560  LEU A  CA  1 
ATOM   4245  C C   . LEU A  1 560  ? 235.159 207.503 172.388 1.00 57.44  ? 560  LEU A  C   1 
ATOM   4246  O O   . LEU A  1 560  ? 233.941 207.698 172.306 1.00 60.66  ? 560  LEU A  O   1 
ATOM   4247  C CB  . LEU A  1 560  ? 235.795 205.644 173.962 1.00 53.00  ? 560  LEU A  CB  1 
ATOM   4248  C CG  . LEU A  1 560  ? 236.696 205.190 175.115 1.00 64.61  ? 560  LEU A  CG  1 
ATOM   4249  C CD1 . LEU A  1 560  ? 236.082 205.518 176.470 1.00 51.44  ? 560  LEU A  CD1 1 
ATOM   4250  C CD2 . LEU A  1 560  ? 237.006 203.708 175.013 1.00 56.00  ? 560  LEU A  CD2 1 
ATOM   4251  N N   . PRO A  1 561  ? 235.950 207.608 171.318 1.00 54.92  ? 561  PRO A  N   1 
ATOM   4252  C CA  . PRO A  1 561  ? 235.426 208.214 170.083 1.00 58.33  ? 561  PRO A  CA  1 
ATOM   4253  C C   . PRO A  1 561  ? 234.175 207.548 169.529 1.00 58.08  ? 561  PRO A  C   1 
ATOM   4254  O O   . PRO A  1 561  ? 233.376 208.228 168.875 1.00 55.35  ? 561  PRO A  O   1 
ATOM   4255  C CB  . PRO A  1 561  ? 236.606 208.090 169.110 1.00 69.24  ? 561  PRO A  CB  1 
ATOM   4256  C CG  . PRO A  1 561  ? 237.802 208.098 169.991 1.00 64.83  ? 561  PRO A  CG  1 
ATOM   4257  C CD  . PRO A  1 561  ? 237.397 207.342 171.222 1.00 58.31  ? 561  PRO A  CD  1 
ATOM   4258  N N   . PHE A  1 562  ? 233.963 206.254 169.772 1.00 57.83  ? 562  PHE A  N   1 
ATOM   4259  C CA  . PHE A  1 562  ? 232.792 205.588 169.211 1.00 53.94  ? 562  PHE A  CA  1 
ATOM   4260  C C   . PHE A  1 562  ? 231.495 205.955 169.925 1.00 56.83  ? 562  PHE A  C   1 
ATOM   4261  O O   . PHE A  1 562  ? 230.433 205.472 169.519 1.00 54.23  ? 562  PHE A  O   1 
ATOM   4262  C CB  . PHE A  1 562  ? 232.989 204.067 169.225 1.00 47.96  ? 562  PHE A  CB  1 
ATOM   4263  C CG  . PHE A  1 562  ? 233.018 203.462 170.600 1.00 39.10  ? 562  PHE A  CG  1 
ATOM   4264  C CD1 . PHE A  1 562  ? 234.197 203.399 171.320 1.00 48.86  ? 562  PHE A  CD1 1 
ATOM   4265  C CD2 . PHE A  1 562  ? 231.871 202.936 171.163 1.00 49.54  ? 562  PHE A  CD2 1 
ATOM   4266  C CE1 . PHE A  1 562  ? 234.226 202.837 172.578 1.00 50.64  ? 562  PHE A  CE1 1 
ATOM   4267  C CE2 . PHE A  1 562  ? 231.896 202.372 172.421 1.00 51.72  ? 562  PHE A  CE2 1 
ATOM   4268  C CZ  . PHE A  1 562  ? 233.075 202.323 173.129 1.00 44.74  ? 562  PHE A  CZ  1 
ATOM   4269  N N   . GLN A  1 563  ? 231.549 206.785 170.964 1.00 60.60  ? 563  GLN A  N   1 
ATOM   4270  C CA  . GLN A  1 563  ? 230.380 207.154 171.751 1.00 55.61  ? 563  GLN A  CA  1 
ATOM   4271  C C   . GLN A  1 563  ? 230.001 208.610 171.506 1.00 53.21  ? 563  GLN A  C   1 
ATOM   4272  O O   . GLN A  1 563  ? 230.873 209.477 171.392 1.00 53.85  ? 563  GLN A  O   1 
ATOM   4273  C CB  . GLN A  1 563  ? 230.646 206.942 173.242 1.00 48.23  ? 563  GLN A  CB  1 
ATOM   4274  C CG  . GLN A  1 563  ? 231.024 205.519 173.598 1.00 50.65  ? 563  GLN A  CG  1 
ATOM   4275  C CD  . GLN A  1 563  ? 231.481 205.382 175.033 1.00 49.99  ? 563  GLN A  CD  1 
ATOM   4276  O OE1 . GLN A  1 563  ? 230.842 204.709 175.841 1.00 54.31  ? 563  GLN A  OE1 1 
ATOM   4277  N NE2 . GLN A  1 563  ? 232.597 206.020 175.359 1.00 45.94  ? 563  GLN A  NE2 1 
ATOM   4278  N N   . GLN A  1 564  ? 228.695 208.872 171.418 1.00 57.44  ? 564  GLN A  N   1 
ATOM   4279  C CA  . GLN A  1 564  ? 228.184 210.228 171.254 1.00 53.27  ? 564  GLN A  CA  1 
ATOM   4280  C C   . GLN A  1 564  ? 227.269 210.690 172.377 1.00 51.26  ? 564  GLN A  C   1 
ATOM   4281  O O   . GLN A  1 564  ? 227.240 211.885 172.673 1.00 51.07  ? 564  GLN A  O   1 
ATOM   4282  C CB  . GLN A  1 564  ? 227.422 210.359 169.930 1.00 51.94  ? 564  GLN A  CB  1 
ATOM   4283  C CG  . GLN A  1 564  ? 226.822 211.739 169.713 1.00 48.87  ? 564  GLN A  CG  1 
ATOM   4284  C CD  . GLN A  1 564  ? 226.693 212.094 168.250 1.00 56.97  ? 564  GLN A  CD  1 
ATOM   4285  O OE1 . GLN A  1 564  ? 225.738 211.697 167.587 1.00 70.15  ? 564  GLN A  OE1 1 
ATOM   4286  N NE2 . GLN A  1 564  ? 227.659 212.847 167.734 1.00 55.86  ? 564  GLN A  NE2 1 
ATOM   4287  N N   . PHE A  1 565  ? 226.527 209.784 173.011 1.00 52.60  ? 565  PHE A  N   1 
ATOM   4288  C CA  . PHE A  1 565  ? 225.544 210.148 174.022 1.00 46.70  ? 565  PHE A  CA  1 
ATOM   4289  C C   . PHE A  1 565  ? 225.856 209.436 175.328 1.00 39.20  ? 565  PHE A  C   1 
ATOM   4290  O O   . PHE A  1 565  ? 226.363 208.312 175.336 1.00 51.04  ? 565  PHE A  O   1 
ATOM   4291  C CB  . PHE A  1 565  ? 224.116 209.782 173.588 1.00 51.39  ? 565  PHE A  CB  1 
ATOM   4292  C CG  . PHE A  1 565  ? 223.690 210.410 172.292 1.00 51.31  ? 565  PHE A  CG  1 
ATOM   4293  C CD1 . PHE A  1 565  ? 223.404 211.760 172.222 1.00 57.26  ? 565  PHE A  CD1 1 
ATOM   4294  C CD2 . PHE A  1 565  ? 223.559 209.645 171.147 1.00 60.25  ? 565  PHE A  CD2 1 
ATOM   4295  C CE1 . PHE A  1 565  ? 223.006 212.336 171.033 1.00 54.08  ? 565  PHE A  CE1 1 
ATOM   4296  C CE2 . PHE A  1 565  ? 223.161 210.217 169.955 1.00 55.46  ? 565  PHE A  CE2 1 
ATOM   4297  C CZ  . PHE A  1 565  ? 222.884 211.564 169.899 1.00 52.78  ? 565  PHE A  CZ  1 
ATOM   4298  N N   . GLY A  1 566  ? 225.554 210.109 176.436 1.00 41.02  ? 566  GLY A  N   1 
ATOM   4299  C CA  . GLY A  1 566  ? 225.600 209.510 177.757 1.00 48.76  ? 566  GLY A  CA  1 
ATOM   4300  C C   . GLY A  1 566  ? 224.206 209.477 178.353 1.00 57.57  ? 566  GLY A  C   1 
ATOM   4301  O O   . GLY A  1 566  ? 223.402 210.383 178.123 1.00 64.02  ? 566  GLY A  O   1 
ATOM   4302  N N   . ARG A  1 567  ? 223.916 208.428 179.123 1.00 50.93  ? 567  ARG A  N   1 
ATOM   4303  C CA  . ARG A  1 567  ? 222.581 208.215 179.664 1.00 45.38  ? 567  ARG A  CA  1 
ATOM   4304  C C   . ARG A  1 567  ? 222.630 208.025 181.173 1.00 51.27  ? 567  ARG A  C   1 
ATOM   4305  O O   . ARG A  1 567  ? 223.600 207.487 181.715 1.00 54.71  ? 567  ARG A  O   1 
ATOM   4306  C CB  . ARG A  1 567  ? 221.902 207.020 178.993 1.00 45.80  ? 567  ARG A  CB  1 
ATOM   4307  C CG  . ARG A  1 567  ? 221.336 207.394 177.639 1.00 48.87  ? 567  ARG A  CG  1 
ATOM   4308  C CD  . ARG A  1 567  ? 220.624 206.260 176.936 1.00 55.62  ? 567  ARG A  CD  1 
ATOM   4309  N NE  . ARG A  1 567  ? 219.828 206.773 175.822 1.00 67.53  ? 567  ARG A  NE  1 
ATOM   4310  C CZ  . ARG A  1 567  ? 220.333 207.205 174.669 1.00 69.80  ? 567  ARG A  CZ  1 
ATOM   4311  N NH1 . ARG A  1 567  ? 219.527 207.658 173.717 1.00 73.87  ? 567  ARG A  NH1 1 
ATOM   4312  N NH2 . ARG A  1 567  ? 221.643 207.187 174.461 1.00 56.86  ? 567  ARG A  NH2 1 
ATOM   4313  N N   . ASP A  1 568  ? 221.570 208.483 181.837 1.00 54.62  ? 568  ASP A  N   1 
ATOM   4314  C CA  . ASP A  1 568  ? 221.493 208.551 183.289 1.00 51.12  ? 568  ASP A  CA  1 
ATOM   4315  C C   . ASP A  1 568  ? 221.138 207.185 183.878 1.00 54.38  ? 568  ASP A  C   1 
ATOM   4316  O O   . ASP A  1 568  ? 221.007 206.180 183.174 1.00 45.50  ? 568  ASP A  O   1 
ATOM   4317  C CB  . ASP A  1 568  ? 220.458 209.599 183.697 1.00 48.72  ? 568  ASP A  CB  1 
ATOM   4318  C CG  . ASP A  1 568  ? 220.563 209.996 185.156 1.00 63.61  ? 568  ASP A  CG  1 
ATOM   4319  O OD1 . ASP A  1 568  ? 221.445 209.456 185.856 1.00 65.72  ? 568  ASP A  OD1 1 
ATOM   4320  O OD2 . ASP A  1 568  ? 219.758 210.840 185.604 1.00 62.09  ? 568  ASP A  OD2 1 
ATOM   4321  N N   . ILE A  1 569  ? 220.994 207.155 185.205 1.00 63.34  ? 569  ILE A  N   1 
ATOM   4322  C CA  . ILE A  1 569  ? 220.388 206.003 185.866 1.00 51.07  ? 569  ILE A  CA  1 
ATOM   4323  C C   . ILE A  1 569  ? 218.972 205.796 185.346 1.00 57.97  ? 569  ILE A  C   1 
ATOM   4324  O O   . ILE A  1 569  ? 218.556 204.667 185.060 1.00 49.78  ? 569  ILE A  O   1 
ATOM   4325  C CB  . ILE A  1 569  ? 220.400 206.194 187.394 1.00 42.09  ? 569  ILE A  CB  1 
ATOM   4326  C CG1 . ILE A  1 569  ? 221.812 206.505 187.904 1.00 43.88  ? 569  ILE A  CG1 1 
ATOM   4327  C CG2 . ILE A  1 569  ? 219.838 204.964 188.092 1.00 39.46  ? 569  ILE A  CG2 1 
ATOM   4328  C CD1 . ILE A  1 569  ? 222.805 205.377 187.735 1.00 43.95  ? 569  ILE A  CD1 1 
ATOM   4329  N N   . ALA A  1 570  ? 218.211 206.886 185.212 1.00 57.90  ? 570  ALA A  N   1 
ATOM   4330  C CA  . ALA A  1 570  ? 216.898 206.849 184.580 1.00 39.72  ? 570  ALA A  CA  1 
ATOM   4331  C C   . ALA A  1 570  ? 216.974 206.613 183.080 1.00 51.47  ? 570  ALA A  C   1 
ATOM   4332  O O   . ALA A  1 570  ? 215.931 206.597 182.419 1.00 49.39  ? 570  ALA A  O   1 
ATOM   4333  C CB  . ALA A  1 570  ? 216.146 208.154 184.847 1.00 35.16  ? 570  ALA A  CB  1 
ATOM   4334  N N   . ASP A  1 571  ? 218.174 206.441 182.530 1.00 51.72  ? 571  ASP A  N   1 
ATOM   4335  C CA  . ASP A  1 571  ? 218.349 206.187 181.108 1.00 47.51  ? 571  ASP A  CA  1 
ATOM   4336  C C   . ASP A  1 571  ? 218.024 207.421 180.271 1.00 45.31  ? 571  ASP A  C   1 
ATOM   4337  O O   . ASP A  1 571  ? 218.079 207.365 179.039 1.00 41.71  ? 571  ASP A  O   1 
ATOM   4338  C CB  . ASP A  1 571  ? 217.471 205.008 180.682 1.00 42.56  ? 571  ASP A  CB  1 
ATOM   4339  C CG  . ASP A  1 571  ? 218.137 204.120 179.646 1.00 47.63  ? 571  ASP A  CG  1 
ATOM   4340  O OD1 . ASP A  1 571  ? 219.379 204.164 179.521 1.00 61.84  ? 571  ASP A  OD1 1 
ATOM   4341  O OD2 . ASP A  1 571  ? 217.413 203.373 178.956 1.00 44.15  ? 571  ASP A  OD2 1 
ATOM   4342  N N   . THR A  1 572  ? 217.687 208.534 180.918 1.00 43.83  ? 572  THR A  N   1 
ATOM   4343  C CA  . THR A  1 572  ? 217.521 209.792 180.202 1.00 41.63  ? 572  THR A  CA  1 
ATOM   4344  C C   . THR A  1 572  ? 218.876 210.317 179.743 1.00 49.03  ? 572  THR A  C   1 
ATOM   4345  O O   . THR A  1 572  ? 219.834 210.355 180.520 1.00 49.73  ? 572  THR A  O   1 
ATOM   4346  C CB  . THR A  1 572  ? 216.834 210.828 181.093 1.00 43.33  ? 572  THR A  CB  1 
ATOM   4347  O OG1 . THR A  1 572  ? 217.599 211.018 182.290 1.00 51.06  ? 572  THR A  OG1 1 
ATOM   4348  C CG2 . THR A  1 572  ? 215.425 210.380 181.459 1.00 44.63  ? 572  THR A  CG2 1 
ATOM   4349  N N   . THR A  1 573  ? 218.954 210.734 178.481 1.00 50.31  ? 573  THR A  N   1 
ATOM   4350  C CA  . THR A  1 573  ? 220.201 211.273 177.954 1.00 49.31  ? 573  THR A  CA  1 
ATOM   4351  C C   . THR A  1 573  ? 220.639 212.470 178.784 1.00 50.28  ? 573  THR A  C   1 
ATOM   4352  O O   . THR A  1 573  ? 219.922 213.471 178.871 1.00 55.77  ? 573  THR A  O   1 
ATOM   4353  C CB  . THR A  1 573  ? 220.031 211.680 176.492 1.00 49.69  ? 573  THR A  CB  1 
ATOM   4354  O OG1 . THR A  1 573  ? 219.378 210.627 175.774 1.00 51.20  ? 573  THR A  OG1 1 
ATOM   4355  C CG2 . THR A  1 573  ? 221.384 211.965 175.851 1.00 46.22  ? 573  THR A  CG2 1 
ATOM   4356  N N   . ASP A  1 574  ? 221.822 212.370 179.384 1.00 45.43  ? 574  ASP A  N   1 
ATOM   4357  C CA  . ASP A  1 574  ? 222.334 213.407 180.264 1.00 44.57  ? 574  ASP A  CA  1 
ATOM   4358  C C   . ASP A  1 574  ? 223.604 214.057 179.739 1.00 55.28  ? 574  ASP A  C   1 
ATOM   4359  O O   . ASP A  1 574  ? 224.082 215.022 180.346 1.00 64.99  ? 574  ASP A  O   1 
ATOM   4360  C CB  . ASP A  1 574  ? 222.606 212.828 181.656 1.00 54.11  ? 574  ASP A  CB  1 
ATOM   4361  C CG  . ASP A  1 574  ? 223.839 211.958 181.687 1.00 58.77  ? 574  ASP A  CG  1 
ATOM   4362  O OD1 . ASP A  1 574  ? 224.107 211.281 180.674 1.00 65.34  ? 574  ASP A  OD1 1 
ATOM   4363  O OD2 . ASP A  1 574  ? 224.542 211.954 182.718 1.00 58.23  ? 574  ASP A  OD2 1 
ATOM   4364  N N   . ALA A  1 575  ? 224.167 213.561 178.641 1.00 48.99  ? 575  ALA A  N   1 
ATOM   4365  C CA  . ALA A  1 575  ? 225.354 214.157 178.053 1.00 50.45  ? 575  ALA A  CA  1 
ATOM   4366  C C   . ALA A  1 575  ? 225.346 213.874 176.560 1.00 51.88  ? 575  ALA A  C   1 
ATOM   4367  O O   . ALA A  1 575  ? 224.782 212.876 176.106 1.00 59.57  ? 575  ALA A  O   1 
ATOM   4368  C CB  . ALA A  1 575  ? 226.639 213.619 178.695 1.00 54.38  ? 575  ALA A  CB  1 
ATOM   4369  N N   . VAL A  1 576  ? 225.972 214.767 175.800 1.00 52.25  ? 576  VAL A  N   1 
ATOM   4370  C CA  . VAL A  1 576  ? 226.020 214.646 174.349 1.00 56.03  ? 576  VAL A  CA  1 
ATOM   4371  C C   . VAL A  1 576  ? 227.305 215.287 173.854 1.00 54.72  ? 576  VAL A  C   1 
ATOM   4372  O O   . VAL A  1 576  ? 227.743 216.316 174.375 1.00 59.75  ? 576  VAL A  O   1 
ATOM   4373  C CB  . VAL A  1 576  ? 224.787 215.295 173.685 1.00 52.18  ? 576  VAL A  CB  1 
ATOM   4374  C CG1 . VAL A  1 576  ? 224.703 216.769 174.051 1.00 48.33  ? 576  VAL A  CG1 1 
ATOM   4375  C CG2 . VAL A  1 576  ? 224.840 215.117 172.177 1.00 52.81  ? 576  VAL A  CG2 1 
ATOM   4376  N N   . ARG A  1 577  ? 227.907 214.671 172.842 1.00 47.12  ? 577  ARG A  N   1 
ATOM   4377  C CA  . ARG A  1 577  ? 229.084 215.218 172.183 1.00 53.45  ? 577  ARG A  CA  1 
ATOM   4378  C C   . ARG A  1 577  ? 228.632 216.136 171.056 1.00 62.62  ? 577  ARG A  C   1 
ATOM   4379  O O   . ARG A  1 577  ? 227.963 215.689 170.118 1.00 68.50  ? 577  ARG A  O   1 
ATOM   4380  C CB  . ARG A  1 577  ? 229.967 214.094 171.646 1.00 51.35  ? 577  ARG A  CB  1 
ATOM   4381  C CG  . ARG A  1 577  ? 230.953 214.526 170.581 1.00 50.11  ? 577  ARG A  CG  1 
ATOM   4382  C CD  . ARG A  1 577  ? 231.926 213.413 170.262 1.00 55.77  ? 577  ARG A  CD  1 
ATOM   4383  N NE  . ARG A  1 577  ? 232.824 213.143 171.379 1.00 62.64  ? 577  ARG A  NE  1 
ATOM   4384  C CZ  . ARG A  1 577  ? 233.825 212.272 171.335 1.00 57.58  ? 577  ARG A  CZ  1 
ATOM   4385  N NH1 . ARG A  1 577  ? 234.063 211.587 170.227 1.00 57.25  ? 577  ARG A  NH1 1 
ATOM   4386  N NH2 . ARG A  1 577  ? 234.594 212.089 172.400 1.00 50.39  ? 577  ARG A  NH2 1 
ATOM   4387  N N   . ASP A  1 578  ? 228.985 217.411 171.150 1.00 55.89  ? 578  ASP A  N   1 
ATOM   4388  C CA  . ASP A  1 578  ? 228.616 218.353 170.105 1.00 53.65  ? 578  ASP A  CA  1 
ATOM   4389  C C   . ASP A  1 578  ? 229.198 217.884 168.774 1.00 60.94  ? 578  ASP A  C   1 
ATOM   4390  O O   . ASP A  1 578  ? 230.394 217.568 168.705 1.00 66.85  ? 578  ASP A  O   1 
ATOM   4391  C CB  . ASP A  1 578  ? 229.116 219.755 170.449 1.00 55.72  ? 578  ASP A  CB  1 
ATOM   4392  C CG  . ASP A  1 578  ? 228.801 220.772 169.369 1.00 63.65  ? 578  ASP A  CG  1 
ATOM   4393  O OD1 . ASP A  1 578  ? 229.327 220.637 168.244 1.00 69.82  ? 578  ASP A  OD1 1 
ATOM   4394  O OD2 . ASP A  1 578  ? 228.018 221.706 169.642 1.00 64.10  ? 578  ASP A  OD2 1 
ATOM   4395  N N   . PRO A  1 579  ? 228.402 217.820 167.701 1.00 56.10  ? 579  PRO A  N   1 
ATOM   4396  C CA  . PRO A  1 579  ? 228.890 217.201 166.461 1.00 58.61  ? 579  PRO A  CA  1 
ATOM   4397  C C   . PRO A  1 579  ? 229.787 218.090 165.613 1.00 68.61  ? 579  PRO A  C   1 
ATOM   4398  O O   . PRO A  1 579  ? 230.458 217.568 164.713 1.00 71.29  ? 579  PRO A  O   1 
ATOM   4399  C CB  . PRO A  1 579  ? 227.594 216.867 165.715 1.00 56.37  ? 579  PRO A  CB  1 
ATOM   4400  C CG  . PRO A  1 579  ? 226.637 217.906 166.161 1.00 57.24  ? 579  PRO A  CG  1 
ATOM   4401  C CD  . PRO A  1 579  ? 226.995 218.246 167.583 1.00 61.35  ? 579  PRO A  CD  1 
ATOM   4402  N N   . GLN A  1 580  ? 229.837 219.398 165.866 1.00 65.77  ? 580  GLN A  N   1 
ATOM   4403  C CA  . GLN A  1 580  ? 230.656 220.302 165.066 1.00 62.60  ? 580  GLN A  CA  1 
ATOM   4404  C C   . GLN A  1 580  ? 231.968 220.677 165.742 1.00 69.35  ? 580  GLN A  C   1 
ATOM   4405  O O   . GLN A  1 580  ? 233.021 220.638 165.101 1.00 74.66  ? 580  GLN A  O   1 
ATOM   4406  C CB  . GLN A  1 580  ? 229.877 221.577 164.744 1.00 57.31  ? 580  GLN A  CB  1 
ATOM   4407  C CG  . GLN A  1 580  ? 228.573 221.334 164.019 1.00 55.17  ? 580  GLN A  CG  1 
ATOM   4408  C CD  . GLN A  1 580  ? 228.025 222.594 163.393 1.00 63.41  ? 580  GLN A  CD  1 
ATOM   4409  O OE1 . GLN A  1 580  ? 228.322 223.702 163.840 1.00 74.07  ? 580  GLN A  OE1 1 
ATOM   4410  N NE2 . GLN A  1 580  ? 227.232 222.437 162.340 1.00 62.40  ? 580  GLN A  NE2 1 
ATOM   4411  N N   . THR A  1 581  ? 231.931 221.037 167.022 1.00 70.18  ? 581  THR A  N   1 
ATOM   4412  C CA  . THR A  1 581  ? 233.129 221.320 167.807 1.00 65.27  ? 581  THR A  CA  1 
ATOM   4413  C C   . THR A  1 581  ? 233.149 220.290 168.925 1.00 61.02  ? 581  THR A  C   1 
ATOM   4414  O O   . THR A  1 581  ? 232.530 220.490 169.974 1.00 67.79  ? 581  THR A  O   1 
ATOM   4415  C CB  . THR A  1 581  ? 233.119 222.742 168.358 1.00 66.70  ? 581  THR A  CB  1 
ATOM   4416  O OG1 . THR A  1 581  ? 231.876 222.987 169.030 1.00 65.32  ? 581  THR A  OG1 1 
ATOM   4417  C CG2 . THR A  1 581  ? 233.292 223.759 167.231 1.00 64.58  ? 581  THR A  CG2 1 
ATOM   4418  N N   . LEU A  1 582  ? 233.871 219.196 168.703 1.00 63.11  ? 582  LEU A  N   1 
ATOM   4419  C CA  . LEU A  1 582  ? 233.707 218.021 169.544 1.00 67.60  ? 582  LEU A  CA  1 
ATOM   4420  C C   . LEU A  1 582  ? 234.096 218.360 170.975 1.00 68.48  ? 582  LEU A  C   1 
ATOM   4421  O O   . LEU A  1 582  ? 235.280 218.514 171.293 1.00 69.71  ? 582  LEU A  O   1 
ATOM   4422  C CB  . LEU A  1 582  ? 234.541 216.865 169.001 1.00 65.80  ? 582  LEU A  CB  1 
ATOM   4423  C CG  . LEU A  1 582  ? 234.372 216.589 167.502 1.00 66.76  ? 582  LEU A  CG  1 
ATOM   4424  C CD1 . LEU A  1 582  ? 235.137 215.334 167.113 1.00 56.93  ? 582  LEU A  CD1 1 
ATOM   4425  C CD2 . LEU A  1 582  ? 232.910 216.465 167.099 1.00 57.02  ? 582  LEU A  CD2 1 
ATOM   4426  N N   . GLU A  1 583  ? 233.087 218.480 171.834 1.00 57.96  ? 583  GLU A  N   1 
ATOM   4427  C CA  . GLU A  1 583  ? 233.285 218.738 173.250 1.00 58.74  ? 583  GLU A  CA  1 
ATOM   4428  C C   . GLU A  1 583  ? 232.035 218.261 173.966 1.00 63.06  ? 583  GLU A  C   1 
ATOM   4429  O O   . GLU A  1 583  ? 230.918 218.559 173.535 1.00 67.30  ? 583  GLU A  O   1 
ATOM   4430  C CB  . GLU A  1 583  ? 233.546 220.224 173.531 1.00 64.63  ? 583  GLU A  CB  1 
ATOM   4431  C CG  . GLU A  1 583  ? 232.365 221.144 173.314 1.00 55.40  ? 583  GLU A  CG  1 
ATOM   4432  C CD  . GLU A  1 583  ? 232.721 222.589 173.608 1.00 70.08  ? 583  GLU A  CD  1 
ATOM   4433  O OE1 . GLU A  1 583  ? 233.872 222.841 174.027 1.00 73.81  ? 583  GLU A  OE1 1 
ATOM   4434  O OE2 . GLU A  1 583  ? 231.857 223.473 173.425 1.00 66.86  ? 583  GLU A  OE2 1 
ATOM   4435  N N   . ILE A  1 584  ? 232.229 217.520 175.046 1.00 59.58  ? 584  ILE A  N   1 
ATOM   4436  C CA  . ILE A  1 584  ? 231.126 216.825 175.695 1.00 51.03  ? 584  ILE A  CA  1 
ATOM   4437  C C   . ILE A  1 584  ? 230.322 217.823 176.515 1.00 52.47  ? 584  ILE A  C   1 
ATOM   4438  O O   . ILE A  1 584  ? 230.876 218.557 177.340 1.00 54.11  ? 584  ILE A  O   1 
ATOM   4439  C CB  . ILE A  1 584  ? 231.651 215.677 176.572 1.00 45.76  ? 584  ILE A  CB  1 
ATOM   4440  C CG1 . ILE A  1 584  ? 232.676 214.842 175.799 1.00 40.92  ? 584  ILE A  CG1 1 
ATOM   4441  C CG2 . ILE A  1 584  ? 230.507 214.801 177.043 1.00 46.23  ? 584  ILE A  CG2 1 
ATOM   4442  C CD1 . ILE A  1 584  ? 232.178 214.312 174.476 1.00 51.40  ? 584  ILE A  CD1 1 
ATOM   4443  N N   . LEU A  1 585  ? 229.012 217.849 176.289 1.00 48.68  ? 585  LEU A  N   1 
ATOM   4444  C CA  . LEU A  1 585  ? 228.102 218.745 176.986 1.00 49.79  ? 585  LEU A  CA  1 
ATOM   4445  C C   . LEU A  1 585  ? 227.221 217.951 177.939 1.00 47.96  ? 585  LEU A  C   1 
ATOM   4446  O O   . LEU A  1 585  ? 226.723 216.878 177.587 1.00 55.05  ? 585  LEU A  O   1 
ATOM   4447  C CB  . LEU A  1 585  ? 227.212 219.509 175.998 1.00 55.88  ? 585  LEU A  CB  1 
ATOM   4448  C CG  . LEU A  1 585  ? 227.897 220.357 174.928 1.00 51.61  ? 585  LEU A  CG  1 
ATOM   4449  C CD1 . LEU A  1 585  ? 226.874 220.821 173.906 1.00 41.18  ? 585  LEU A  CD1 1 
ATOM   4450  C CD2 . LEU A  1 585  ? 228.616 221.546 175.543 1.00 45.91  ? 585  LEU A  CD2 1 
ATOM   4451  N N   . ASP A  1 586  ? 227.043 218.475 179.148 1.00 52.17  ? 586  ASP A  N   1 
ATOM   4452  C CA  . ASP A  1 586  ? 226.039 217.946 180.058 1.00 49.65  ? 586  ASP A  CA  1 
ATOM   4453  C C   . ASP A  1 586  ? 224.668 218.519 179.723 1.00 50.52  ? 586  ASP A  C   1 
ATOM   4454  O O   . ASP A  1 586  ? 224.544 219.649 179.246 1.00 60.47  ? 586  ASP A  O   1 
ATOM   4455  C CB  . ASP A  1 586  ? 226.386 218.280 181.509 1.00 53.99  ? 586  ASP A  CB  1 
ATOM   4456  C CG  . ASP A  1 586  ? 227.639 217.583 181.984 1.00 64.58  ? 586  ASP A  CG  1 
ATOM   4457  O OD1 . ASP A  1 586  ? 228.065 216.613 181.327 1.00 62.44  ? 586  ASP A  OD1 1 
ATOM   4458  O OD2 . ASP A  1 586  ? 228.190 217.996 183.025 1.00 64.36  ? 586  ASP A  OD2 1 
ATOM   4459  N N   . ILE A  1 587  ? 223.633 217.727 179.982 1.00 51.07  ? 587  ILE A  N   1 
ATOM   4460  C CA  . ILE A  1 587  ? 222.251 218.163 179.832 1.00 52.38  ? 587  ILE A  CA  1 
ATOM   4461  C C   . ILE A  1 587  ? 221.574 218.020 181.186 1.00 55.50  ? 587  ILE A  C   1 
ATOM   4462  O O   . ILE A  1 587  ? 221.480 216.910 181.724 1.00 64.69  ? 587  ILE A  O   1 
ATOM   4463  C CB  . ILE A  1 587  ? 221.503 217.355 178.762 1.00 52.42  ? 587  ILE A  CB  1 
ATOM   4464  C CG1 . ILE A  1 587  ? 222.183 217.513 177.400 1.00 45.46  ? 587  ILE A  CG1 1 
ATOM   4465  C CG2 . ILE A  1 587  ? 220.051 217.803 178.692 1.00 44.94  ? 587  ILE A  CG2 1 
ATOM   4466  C CD1 . ILE A  1 587  ? 221.701 216.527 176.353 1.00 43.06  ? 587  ILE A  CD1 1 
ATOM   4467  N N   . THR A  1 588  ? 221.100 219.140 181.734 1.00 54.52  ? 588  THR A  N   1 
ATOM   4468  C CA  . THR A  1 588  ? 220.351 219.151 182.974 1.00 54.90  ? 588  THR A  CA  1 
ATOM   4469  C C   . THR A  1 588  ? 218.966 219.746 182.742 1.00 53.53  ? 588  THR A  C   1 
ATOM   4470  O O   . THR A  1 588  ? 218.852 220.824 182.151 1.00 57.94  ? 588  THR A  O   1 
ATOM   4471  C CB  . THR A  1 588  ? 221.079 219.970 184.051 1.00 49.07  ? 588  THR A  CB  1 
ATOM   4472  O OG1 . THR A  1 588  ? 222.406 219.458 184.226 1.00 54.61  ? 588  THR A  OG1 1 
ATOM   4473  C CG2 . THR A  1 588  ? 220.338 219.905 185.376 1.00 43.29  ? 588  THR A  CG2 1 
ATOM   4474  N N   . PRO A  1 589  ? 217.903 219.087 183.196 1.00 44.87  ? 589  PRO A  N   1 
ATOM   4475  C CA  . PRO A  1 589  ? 216.561 219.641 182.987 1.00 48.51  ? 589  PRO A  CA  1 
ATOM   4476  C C   . PRO A  1 589  ? 216.360 220.926 183.773 1.00 50.22  ? 589  PRO A  C   1 
ATOM   4477  O O   . PRO A  1 589  ? 216.959 221.138 184.830 1.00 48.59  ? 589  PRO A  O   1 
ATOM   4478  C CB  . PRO A  1 589  ? 215.633 218.528 183.486 1.00 39.08  ? 589  PRO A  CB  1 
ATOM   4479  C CG  . PRO A  1 589  ? 216.462 217.730 184.420 1.00 40.90  ? 589  PRO A  CG  1 
ATOM   4480  C CD  . PRO A  1 589  ? 217.862 217.800 183.910 1.00 42.27  ? 589  PRO A  CD  1 
ATOM   4481  N N   . CYS A  1 590  ? 215.503 221.795 183.234 1.00 53.20  ? 590  CYS A  N   1 
ATOM   4482  C CA  . CYS A  1 590  ? 215.260 223.088 183.863 1.00 52.95  ? 590  CYS A  CA  1 
ATOM   4483  C C   . CYS A  1 590  ? 214.227 222.998 184.980 1.00 58.43  ? 590  CYS A  C   1 
ATOM   4484  O O   . CYS A  1 590  ? 214.286 223.780 185.936 1.00 62.43  ? 590  CYS A  O   1 
ATOM   4485  C CB  . CYS A  1 590  ? 214.807 224.103 182.810 1.00 51.82  ? 590  CYS A  CB  1 
ATOM   4486  S SG  . CYS A  1 590  ? 215.711 224.002 181.237 1.00 75.26  ? 590  CYS A  SG  1 
ATOM   4487  N N   . SER A  1 591  ? 213.263 222.083 184.859 1.00 60.36  ? 591  SER A  N   1 
ATOM   4488  C CA  . SER A  1 591  ? 212.219 221.909 185.879 1.00 58.60  ? 591  SER A  CA  1 
ATOM   4489  C C   . SER A  1 591  ? 212.829 221.279 187.127 1.00 62.84  ? 591  SER A  C   1 
ATOM   4490  O O   . SER A  1 591  ? 213.287 220.134 187.072 1.00 61.38  ? 591  SER A  O   1 
ATOM   4491  C CB  . SER A  1 591  ? 211.083 221.036 185.345 1.00 64.99  ? 591  SER A  CB  1 
ATOM   4492  O OG  . SER A  1 591  ? 210.407 221.676 184.277 1.00 60.07  ? 591  SER A  OG  1 
ATOM   4493  N N   . PHE A  1 592  ? 212.776 222.001 188.251 1.00 58.48  ? 592  PHE A  N   1 
ATOM   4494  C CA  . PHE A  1 592  ? 213.422 221.563 189.483 1.00 55.32  ? 592  PHE A  CA  1 
ATOM   4495  C C   . PHE A  1 592  ? 212.922 222.426 190.633 1.00 54.06  ? 592  PHE A  C   1 
ATOM   4496  O O   . PHE A  1 592  ? 212.659 223.618 190.458 1.00 60.55  ? 592  PHE A  O   1 
ATOM   4497  C CB  . PHE A  1 592  ? 214.950 221.652 189.356 1.00 58.79  ? 592  PHE A  CB  1 
ATOM   4498  C CG  . PHE A  1 592  ? 215.699 221.366 190.630 1.00 50.98  ? 592  PHE A  CG  1 
ATOM   4499  C CD1 . PHE A  1 592  ? 215.994 222.384 191.519 1.00 49.22  ? 592  PHE A  CD1 1 
ATOM   4500  C CD2 . PHE A  1 592  ? 216.134 220.088 190.924 1.00 49.85  ? 592  PHE A  CD2 1 
ATOM   4501  C CE1 . PHE A  1 592  ? 216.688 222.128 192.681 1.00 50.59  ? 592  PHE A  CE1 1 
ATOM   4502  C CE2 . PHE A  1 592  ? 216.831 219.830 192.086 1.00 40.69  ? 592  PHE A  CE2 1 
ATOM   4503  C CZ  . PHE A  1 592  ? 217.108 220.850 192.964 1.00 42.87  ? 592  PHE A  CZ  1 
ATOM   4504  N N   . GLY A  1 593  ? 212.798 221.809 191.808 1.00 45.42  ? 593  GLY A  N   1 
ATOM   4505  C CA  . GLY A  1 593  ? 212.372 222.511 193.005 1.00 35.81  ? 593  GLY A  CA  1 
ATOM   4506  C C   . GLY A  1 593  ? 210.871 222.509 193.217 1.00 41.90  ? 593  GLY A  C   1 
ATOM   4507  O O   . GLY A  1 593  ? 210.105 222.707 192.271 1.00 54.08  ? 593  GLY A  O   1 
ATOM   4508  N N   . GLY A  1 594  ? 210.440 222.284 194.467 1.00 49.16  ? 594  GLY A  N   1 
ATOM   4509  C CA  . GLY A  1 594  ? 209.026 222.253 194.776 1.00 49.72  ? 594  GLY A  CA  1 
ATOM   4510  C C   . GLY A  1 594  ? 208.449 223.624 195.089 1.00 42.30  ? 594  GLY A  C   1 
ATOM   4511  O O   . GLY A  1 594  ? 209.164 224.592 195.338 1.00 49.46  ? 594  GLY A  O   1 
ATOM   4512  N N   . VAL A  1 595  ? 207.119 223.696 195.072 1.00 38.46  ? 595  VAL A  N   1 
ATOM   4513  C CA  . VAL A  1 595  ? 206.389 224.919 195.393 1.00 43.37  ? 595  VAL A  CA  1 
ATOM   4514  C C   . VAL A  1 595  ? 205.138 224.553 196.182 1.00 39.31  ? 595  VAL A  C   1 
ATOM   4515  O O   . VAL A  1 595  ? 204.426 223.608 195.831 1.00 41.54  ? 595  VAL A  O   1 
ATOM   4516  C CB  . VAL A  1 595  ? 206.016 225.708 194.122 1.00 36.48  ? 595  VAL A  CB  1 
ATOM   4517  C CG1 . VAL A  1 595  ? 205.330 227.011 194.485 1.00 28.42  ? 595  VAL A  CG1 1 
ATOM   4518  C CG2 . VAL A  1 595  ? 207.249 225.969 193.278 1.00 40.90  ? 595  VAL A  CG2 1 
ATOM   4519  N N   . SER A  1 596  ? 204.870 225.307 197.248 1.00 39.62  ? 596  SER A  N   1 
ATOM   4520  C CA  . SER A  1 596  ? 203.668 225.139 198.051 1.00 29.36  ? 596  SER A  CA  1 
ATOM   4521  C C   . SER A  1 596  ? 203.030 226.496 198.302 1.00 25.89  ? 596  SER A  C   1 
ATOM   4522  O O   . SER A  1 596  ? 203.722 227.508 198.427 1.00 34.10  ? 596  SER A  O   1 
ATOM   4523  C CB  . SER A  1 596  ? 203.971 224.462 199.391 1.00 37.07  ? 596  SER A  CB  1 
ATOM   4524  O OG  . SER A  1 596  ? 204.801 223.330 199.212 1.00 50.35  ? 596  SER A  OG  1 
ATOM   4525  N N   . VAL A  1 597  ? 201.704 226.506 198.392 1.00 25.47  ? 597  VAL A  N   1 
ATOM   4526  C CA  . VAL A  1 597  ? 200.928 227.728 198.574 1.00 27.97  ? 597  VAL A  CA  1 
ATOM   4527  C C   . VAL A  1 597  ? 200.287 227.693 199.954 1.00 29.48  ? 597  VAL A  C   1 
ATOM   4528  O O   . VAL A  1 597  ? 199.509 226.783 200.262 1.00 35.54  ? 597  VAL A  O   1 
ATOM   4529  C CB  . VAL A  1 597  ? 199.863 227.884 197.480 1.00 29.15  ? 597  VAL A  CB  1 
ATOM   4530  C CG1 . VAL A  1 597  ? 198.983 229.088 197.757 1.00 36.76  ? 597  VAL A  CG1 1 
ATOM   4531  C CG2 . VAL A  1 597  ? 200.522 228.010 196.124 1.00 41.38  ? 597  VAL A  CG2 1 
ATOM   4532  N N   . ILE A  1 598  ? 200.606 228.685 200.778 1.00 33.70  ? 598  ILE A  N   1 
ATOM   4533  C CA  . ILE A  1 598  ? 199.963 228.867 202.074 1.00 33.00  ? 598  ILE A  CA  1 
ATOM   4534  C C   . ILE A  1 598  ? 198.793 229.821 201.891 1.00 31.49  ? 598  ILE A  C   1 
ATOM   4535  O O   . ILE A  1 598  ? 198.952 230.907 201.323 1.00 39.31  ? 598  ILE A  O   1 
ATOM   4536  C CB  . ILE A  1 598  ? 200.953 229.411 203.117 1.00 20.01  ? 598  ILE A  CB  1 
ATOM   4537  C CG1 . ILE A  1 598  ? 202.052 228.391 203.415 1.00 18.01  ? 598  ILE A  CG1 1 
ATOM   4538  C CG2 . ILE A  1 598  ? 200.225 229.780 204.397 1.00 22.92  ? 598  ILE A  CG2 1 
ATOM   4539  C CD1 . ILE A  1 598  ? 203.182 228.399 202.424 1.00 21.04  ? 598  ILE A  CD1 1 
ATOM   4540  N N   . THR A  1 599  ? 197.616 229.420 202.364 1.00 24.16  ? 599  THR A  N   1 
ATOM   4541  C CA  . THR A  1 599  ? 196.433 230.240 202.212 1.00 30.64  ? 599  THR A  CA  1 
ATOM   4542  C C   . THR A  1 599  ? 195.565 230.161 203.460 1.00 44.12  ? 599  THR A  C   1 
ATOM   4543  O O   . THR A  1 599  ? 195.410 229.075 204.035 1.00 57.75  ? 599  THR A  O   1 
ATOM   4544  C CB  . THR A  1 599  ? 195.610 229.794 200.995 1.00 39.64  ? 599  THR A  CB  1 
ATOM   4545  O OG1 . THR A  1 599  ? 194.473 230.649 200.844 1.00 49.97  ? 599  THR A  OG1 1 
ATOM   4546  C CG2 . THR A  1 599  ? 195.135 228.364 201.165 1.00 48.56  ? 599  THR A  CG2 1 
ATOM   4547  N N   . PRO A  1 600  ? 194.997 231.284 203.914 1.00 51.13  ? 600  PRO A  N   1 
ATOM   4548  C CA  . PRO A  1 600  ? 193.828 231.190 204.794 1.00 50.49  ? 600  PRO A  CA  1 
ATOM   4549  C C   . PRO A  1 600  ? 192.624 230.724 203.994 1.00 53.92  ? 600  PRO A  C   1 
ATOM   4550  O O   . PRO A  1 600  ? 192.728 230.534 202.779 1.00 59.92  ? 600  PRO A  O   1 
ATOM   4551  C CB  . PRO A  1 600  ? 193.661 232.619 205.320 1.00 45.40  ? 600  PRO A  CB  1 
ATOM   4552  C CG  . PRO A  1 600  ? 194.261 233.470 204.266 1.00 44.11  ? 600  PRO A  CG  1 
ATOM   4553  C CD  . PRO A  1 600  ? 195.414 232.685 203.715 1.00 42.47  ? 600  PRO A  CD  1 
ATOM   4554  N N   . GLY A  1 601  ? 191.483 230.526 204.642 1.00 48.48  ? 601  GLY A  N   1 
ATOM   4555  C CA  . GLY A  1 601  ? 190.304 230.125 203.904 1.00 51.58  ? 601  GLY A  CA  1 
ATOM   4556  C C   . GLY A  1 601  ? 189.940 231.149 202.849 1.00 48.57  ? 601  GLY A  C   1 
ATOM   4557  O O   . GLY A  1 601  ? 190.028 232.358 203.067 1.00 58.48  ? 601  GLY A  O   1 
ATOM   4558  N N   . THR A  1 602  ? 189.456 230.645 201.717 1.00 50.82  ? 602  THR A  N   1 
ATOM   4559  C CA  . THR A  1 602  ? 189.011 231.495 200.625 1.00 47.54  ? 602  THR A  CA  1 
ATOM   4560  C C   . THR A  1 602  ? 187.920 232.409 201.168 1.00 54.84  ? 602  THR A  C   1 
ATOM   4561  O O   . THR A  1 602  ? 187.900 233.605 200.878 1.00 61.51  ? 602  THR A  O   1 
ATOM   4562  C CB  . THR A  1 602  ? 188.451 230.671 199.453 1.00 46.82  ? 602  THR A  CB  1 
ATOM   4563  O OG1 . THR A  1 602  ? 189.417 229.693 199.049 1.00 54.95  ? 602  THR A  OG1 1 
ATOM   4564  C CG2 . THR A  1 602  ? 188.128 231.575 198.273 1.00 55.66  ? 602  THR A  CG2 1 
ATOM   4565  N N   . ASN A  1 603  ? 187.010 231.842 201.959 1.00 52.60  ? 603  ASN A  N   1 
ATOM   4566  C CA  . ASN A  1 603  ? 185.950 232.639 202.563 1.00 51.36  ? 603  ASN A  CA  1 
ATOM   4567  C C   . ASN A  1 603  ? 186.501 233.758 203.441 1.00 59.06  ? 603  ASN A  C   1 
ATOM   4568  O O   . ASN A  1 603  ? 185.778 234.720 203.721 1.00 69.52  ? 603  ASN A  O   1 
ATOM   4569  C CB  . ASN A  1 603  ? 185.030 231.729 203.383 1.00 69.24  ? 603  ASN A  CB  1 
ATOM   4570  C CG  . ASN A  1 603  ? 183.737 232.408 203.800 1.00 76.45  ? 603  ASN A  CG  1 
ATOM   4571  O OD1 . ASN A  1 603  ? 183.311 233.397 203.201 1.00 74.91  ? 603  ASN A  OD1 1 
ATOM   4572  N ND2 . ASN A  1 603  ? 183.102 231.864 204.838 1.00 85.76  ? 603  ASN A  ND2 1 
ATOM   4573  N N   . THR A  1 604  ? 187.760 233.614 203.841 1.00 52.29  ? 604  THR A  N   1 
ATOM   4574  C CA  . THR A  1 604  ? 188.430 234.587 204.688 1.00 50.39  ? 604  THR A  CA  1 
ATOM   4575  C C   . THR A  1 604  ? 189.232 235.603 203.882 1.00 51.05  ? 604  THR A  C   1 
ATOM   4576  O O   . THR A  1 604  ? 189.073 236.808 204.082 1.00 53.66  ? 604  THR A  O   1 
ATOM   4577  C CB  . THR A  1 604  ? 189.366 233.899 205.700 1.00 39.44  ? 604  THR A  CB  1 
ATOM   4578  O OG1 . THR A  1 604  ? 188.590 233.132 206.629 1.00 42.48  ? 604  THR A  OG1 1 
ATOM   4579  C CG2 . THR A  1 604  ? 190.181 234.935 206.460 1.00 42.16  ? 604  THR A  CG2 1 
ATOM   4580  N N   . SER A  1 605  ? 190.082 235.133 202.969 1.00 45.72  ? 605  SER A  N   1 
ATOM   4581  C CA  . SER A  1 605  ? 190.887 236.068 202.195 1.00 49.64  ? 605  SER A  CA  1 
ATOM   4582  C C   . SER A  1 605  ? 191.358 235.414 200.907 1.00 56.59  ? 605  SER A  C   1 
ATOM   4583  O O   . SER A  1 605  ? 191.406 234.187 200.788 1.00 66.27  ? 605  SER A  O   1 
ATOM   4584  C CB  . SER A  1 605  ? 192.093 236.559 202.999 1.00 51.97  ? 605  SER A  CB  1 
ATOM   4585  O OG  . SER A  1 605  ? 192.945 237.354 202.194 1.00 58.04  ? 605  SER A  OG  1 
ATOM   4586  N N   . ASN A  1 606  ? 191.708 236.263 199.941 1.00 52.33  ? 606  ASN A  N   1 
ATOM   4587  C CA  . ASN A  1 606  ? 192.338 235.830 198.703 1.00 54.88  ? 606  ASN A  CA  1 
ATOM   4588  C C   . ASN A  1 606  ? 193.856 235.956 198.739 1.00 56.34  ? 606  ASN A  C   1 
ATOM   4589  O O   . ASN A  1 606  ? 194.519 235.547 197.781 1.00 51.47  ? 606  ASN A  O   1 
ATOM   4590  C CB  . ASN A  1 606  ? 191.790 236.637 197.522 1.00 58.30  ? 606  ASN A  CB  1 
ATOM   4591  C CG  . ASN A  1 606  ? 190.327 236.354 197.252 1.00 66.34  ? 606  ASN A  CG  1 
ATOM   4592  O OD1 . ASN A  1 606  ? 189.975 235.296 196.734 1.00 60.48  ? 606  ASN A  OD1 1 
ATOM   4593  N ND2 . ASN A  1 606  ? 189.464 237.305 197.593 1.00 69.73  ? 606  ASN A  ND2 1 
ATOM   4594  N N   . GLN A  1 607  ? 194.415 236.518 199.806 1.00 53.50  ? 607  GLN A  N   1 
ATOM   4595  C CA  . GLN A  1 607  ? 195.859 236.653 199.917 1.00 47.52  ? 607  GLN A  CA  1 
ATOM   4596  C C   . GLN A  1 607  ? 196.497 235.302 200.217 1.00 46.27  ? 607  GLN A  C   1 
ATOM   4597  O O   . GLN A  1 607  ? 195.927 234.473 200.932 1.00 46.63  ? 607  GLN A  O   1 
ATOM   4598  C CB  . GLN A  1 607  ? 196.203 237.664 201.012 1.00 53.54  ? 607  GLN A  CB  1 
ATOM   4599  C CG  . GLN A  1 607  ? 197.690 237.925 201.197 1.00 46.09  ? 607  GLN A  CG  1 
ATOM   4600  C CD  . GLN A  1 607  ? 197.985 238.851 202.362 1.00 56.95  ? 607  GLN A  CD  1 
ATOM   4601  O OE1 . GLN A  1 607  ? 197.178 239.720 202.693 1.00 63.78  ? 607  GLN A  OE1 1 
ATOM   4602  N NE2 . GLN A  1 607  ? 199.141 238.670 202.998 1.00 57.86  ? 607  GLN A  NE2 1 
ATOM   4603  N N   . VAL A  1 608  ? 197.685 235.075 199.653 1.00 43.51  ? 608  VAL A  N   1 
ATOM   4604  C CA  . VAL A  1 608  ? 198.400 233.816 199.813 1.00 28.65  ? 608  VAL A  CA  1 
ATOM   4605  C C   . VAL A  1 608  ? 199.890 234.084 199.970 1.00 36.77  ? 608  VAL A  C   1 
ATOM   4606  O O   . VAL A  1 608  ? 200.401 235.143 199.603 1.00 45.13  ? 608  VAL A  O   1 
ATOM   4607  C CB  . VAL A  1 608  ? 198.170 232.863 198.620 1.00 25.43  ? 608  VAL A  CB  1 
ATOM   4608  C CG1 . VAL A  1 608  ? 196.699 232.558 198.460 1.00 37.95  ? 608  VAL A  CG1 1 
ATOM   4609  C CG2 . VAL A  1 608  ? 198.733 233.463 197.344 1.00 31.95  ? 608  VAL A  CG2 1 
ATOM   4610  N N   . ALA A  1 609  ? 200.583 233.097 200.528 1.00 34.78  ? 609  ALA A  N   1 
ATOM   4611  C CA  . ALA A  1 609  ? 202.035 233.052 200.565 1.00 26.25  ? 609  ALA A  CA  1 
ATOM   4612  C C   . ALA A  1 609  ? 202.514 231.830 199.795 1.00 29.80  ? 609  ALA A  C   1 
ATOM   4613  O O   . ALA A  1 609  ? 201.772 230.862 199.618 1.00 36.52  ? 609  ALA A  O   1 
ATOM   4614  C CB  . ALA A  1 609  ? 202.560 233.000 202.000 1.00 26.07  ? 609  ALA A  CB  1 
ATOM   4615  N N   . VAL A  1 610  ? 203.755 231.884 199.326 1.00 30.35  ? 610  VAL A  N   1 
ATOM   4616  C CA  . VAL A  1 610  ? 204.339 230.823 198.517 1.00 16.95  ? 610  VAL A  CA  1 
ATOM   4617  C C   . VAL A  1 610  ? 205.622 230.353 199.184 1.00 28.97  ? 610  VAL A  C   1 
ATOM   4618  O O   . VAL A  1 610  ? 206.453 231.173 199.591 1.00 39.75  ? 610  VAL A  O   1 
ATOM   4619  C CB  . VAL A  1 610  ? 204.613 231.292 197.078 1.00 22.83  ? 610  VAL A  CB  1 
ATOM   4620  C CG1 . VAL A  1 610  ? 205.148 230.149 196.246 1.00 34.26  ? 610  VAL A  CG1 1 
ATOM   4621  C CG2 . VAL A  1 610  ? 203.349 231.855 196.461 1.00 41.03  ? 610  VAL A  CG2 1 
ATOM   4622  N N   . LEU A  1 611  ? 205.779 229.038 199.296 1.00 36.36  ? 611  LEU A  N   1 
ATOM   4623  C CA  . LEU A  1 611  ? 206.973 228.424 199.857 1.00 32.32  ? 611  LEU A  CA  1 
ATOM   4624  C C   . LEU A  1 611  ? 207.721 227.700 198.750 1.00 33.97  ? 611  LEU A  C   1 
ATOM   4625  O O   . LEU A  1 611  ? 207.141 226.866 198.048 1.00 34.71  ? 611  LEU A  O   1 
ATOM   4626  C CB  . LEU A  1 611  ? 206.611 227.451 200.980 1.00 26.61  ? 611  LEU A  CB  1 
ATOM   4627  C CG  . LEU A  1 611  ? 207.762 226.650 201.591 1.00 21.59  ? 611  LEU A  CG  1 
ATOM   4628  C CD1 . LEU A  1 611  ? 208.671 227.542 202.411 1.00 31.94  ? 611  LEU A  CD1 1 
ATOM   4629  C CD2 . LEU A  1 611  ? 207.211 225.522 202.432 1.00 30.94  ? 611  LEU A  CD2 1 
ATOM   4630  N N   . TYR A  1 612  ? 208.998 228.026 198.592 1.00 40.59  ? 612  TYR A  N   1 
ATOM   4631  C CA  . TYR A  1 612  ? 209.860 227.415 197.584 1.00 41.09  ? 612  TYR A  CA  1 
ATOM   4632  C C   . TYR A  1 612  ? 210.858 226.510 198.293 1.00 43.95  ? 612  TYR A  C   1 
ATOM   4633  O O   . TYR A  1 612  ? 211.856 226.983 198.842 1.00 49.81  ? 612  TYR A  O   1 
ATOM   4634  C CB  . TYR A  1 612  ? 210.584 228.475 196.760 1.00 44.51  ? 612  TYR A  CB  1 
ATOM   4635  C CG  . TYR A  1 612  ? 209.677 229.287 195.877 1.00 35.46  ? 612  TYR A  CG  1 
ATOM   4636  C CD1 . TYR A  1 612  ? 209.319 228.834 194.619 1.00 36.03  ? 612  TYR A  CD1 1 
ATOM   4637  C CD2 . TYR A  1 612  ? 209.179 230.506 196.298 1.00 40.43  ? 612  TYR A  CD2 1 
ATOM   4638  C CE1 . TYR A  1 612  ? 208.489 229.570 193.810 1.00 36.29  ? 612  TYR A  CE1 1 
ATOM   4639  C CE2 . TYR A  1 612  ? 208.349 231.248 195.495 1.00 39.62  ? 612  TYR A  CE2 1 
ATOM   4640  C CZ  . TYR A  1 612  ? 208.007 230.776 194.253 1.00 37.26  ? 612  TYR A  CZ  1 
ATOM   4641  O OH  . TYR A  1 612  ? 207.179 231.516 193.448 1.00 46.96  ? 612  TYR A  OH  1 
ATOM   4642  N N   . GLN A  1 613  ? 210.586 225.211 198.288 1.00 44.41  ? 613  GLN A  N   1 
ATOM   4643  C CA  . GLN A  1 613  ? 211.596 224.265 198.720 1.00 43.92  ? 613  GLN A  CA  1 
ATOM   4644  C C   . GLN A  1 613  ? 212.730 224.227 197.700 1.00 43.62  ? 613  GLN A  C   1 
ATOM   4645  O O   . GLN A  1 613  ? 212.544 224.510 196.514 1.00 49.34  ? 613  GLN A  O   1 
ATOM   4646  C CB  . GLN A  1 613  ? 210.995 222.870 198.900 1.00 43.11  ? 613  GLN A  CB  1 
ATOM   4647  C CG  . GLN A  1 613  ? 209.857 222.794 199.911 1.00 33.82  ? 613  GLN A  CG  1 
ATOM   4648  C CD  . GLN A  1 613  ? 208.515 223.164 199.312 1.00 40.83  ? 613  GLN A  CD  1 
ATOM   4649  O OE1 . GLN A  1 613  ? 208.433 223.604 198.165 1.00 38.57  ? 613  GLN A  OE1 1 
ATOM   4650  N NE2 . GLN A  1 613  ? 207.451 222.982 200.085 1.00 40.82  ? 613  GLN A  NE2 1 
ATOM   4651  N N   . ASP A  1 614  ? 213.920 223.878 198.177 1.00 46.66  ? 614  ASP A  N   1 
ATOM   4652  C CA  . ASP A  1 614  ? 215.117 223.788 197.344 1.00 54.43  ? 614  ASP A  CA  1 
ATOM   4653  C C   . ASP A  1 614  ? 215.520 225.135 196.751 1.00 53.59  ? 614  ASP A  C   1 
ATOM   4654  O O   . ASP A  1 614  ? 216.191 225.183 195.716 1.00 53.55  ? 614  ASP A  O   1 
ATOM   4655  C CB  . ASP A  1 614  ? 214.928 222.761 196.223 1.00 54.60  ? 614  ASP A  CB  1 
ATOM   4656  C CG  . ASP A  1 614  ? 214.787 221.349 196.748 1.00 56.76  ? 614  ASP A  CG  1 
ATOM   4657  O OD1 . ASP A  1 614  ? 215.557 220.974 197.657 1.00 65.16  ? 614  ASP A  OD1 1 
ATOM   4658  O OD2 . ASP A  1 614  ? 213.907 220.614 196.257 1.00 58.69  ? 614  ASP A  OD2 1 
ATOM   4659  N N   . VAL A  1 615  ? 215.110 226.235 197.377 1.00 58.33  ? 615  VAL A  N   1 
ATOM   4660  C CA  . VAL A  1 615  ? 215.505 227.577 196.973 1.00 53.69  ? 615  VAL A  CA  1 
ATOM   4661  C C   . VAL A  1 615  ? 215.996 228.319 198.202 1.00 55.33  ? 615  VAL A  C   1 
ATOM   4662  O O   . VAL A  1 615  ? 215.270 228.438 199.194 1.00 62.37  ? 615  VAL A  O   1 
ATOM   4663  C CB  . VAL A  1 615  ? 214.335 228.339 196.320 1.00 38.03  ? 615  VAL A  CB  1 
ATOM   4664  C CG1 . VAL A  1 615  ? 214.713 229.791 196.054 1.00 47.21  ? 615  VAL A  CG1 1 
ATOM   4665  C CG2 . VAL A  1 615  ? 213.916 227.644 195.048 1.00 53.12  ? 615  VAL A  CG2 1 
ATOM   4666  N N   . ASN A  1 616  ? 217.215 228.843 198.131 1.00 50.03  ? 616  ASN A  N   1 
ATOM   4667  C CA  . ASN A  1 616  ? 217.780 229.640 199.208 1.00 61.57  ? 616  ASN A  CA  1 
ATOM   4668  C C   . ASN A  1 616  ? 217.781 231.100 198.784 1.00 64.49  ? 616  ASN A  C   1 
ATOM   4669  O O   . ASN A  1 616  ? 218.427 231.465 197.796 1.00 67.54  ? 616  ASN A  O   1 
ATOM   4670  C CB  . ASN A  1 616  ? 219.192 229.176 199.555 1.00 66.50  ? 616  ASN A  CB  1 
ATOM   4671  C CG  . ASN A  1 616  ? 219.750 229.885 200.761 1.00 64.02  ? 616  ASN A  CG  1 
ATOM   4672  O OD1 . ASN A  1 616  ? 219.278 230.959 201.136 1.00 67.96  ? 616  ASN A  OD1 1 
ATOM   4673  N ND2 . ASN A  1 616  ? 220.757 229.299 201.386 1.00 76.40  ? 616  ASN A  ND2 1 
ATOM   4674  N N   . CYS A  1 617  ? 217.071 231.929 199.545 1.00 63.49  ? 617  CYS A  N   1 
ATOM   4675  C CA  . CYS A  1 617  ? 216.988 233.362 199.305 1.00 57.06  ? 617  CYS A  CA  1 
ATOM   4676  C C   . CYS A  1 617  ? 217.952 234.143 200.186 1.00 63.85  ? 617  CYS A  C   1 
ATOM   4677  O O   . CYS A  1 617  ? 217.865 235.374 200.242 1.00 77.53  ? 617  CYS A  O   1 
ATOM   4678  C CB  . CYS A  1 617  ? 215.554 233.846 199.534 1.00 62.10  ? 617  CYS A  CB  1 
ATOM   4679  S SG  . CYS A  1 617  ? 214.368 233.249 198.316 1.00 74.95  ? 617  CYS A  SG  1 
ATOM   4680  N N   . THR A  1 618  ? 218.868 233.454 200.863 1.00 74.51  ? 618  THR A  N   1 
ATOM   4681  C CA  . THR A  1 618  ? 219.839 234.065 201.771 1.00 81.05  ? 618  THR A  CA  1 
ATOM   4682  C C   . THR A  1 618  ? 219.241 235.229 202.556 1.00 67.60  ? 618  THR A  C   1 
ATOM   4683  O O   . THR A  1 618  ? 218.615 235.031 203.596 1.00 68.15  ? 618  THR A  O   1 
ATOM   4684  C CB  . THR A  1 618  ? 221.095 234.559 201.010 1.00 78.90  ? 618  THR A  CB  1 
ATOM   4685  O OG1 . THR A  1 618  ? 222.198 234.654 201.919 1.00 89.13  ? 618  THR A  OG1 1 
ATOM   4686  C CG2 . THR A  1 618  ? 220.859 235.925 200.371 1.00 78.29  ? 618  THR A  CG2 1 
ATOM   4687  N N   . TRP A  1 633  ? 216.159 235.183 191.698 1.00 69.29  ? 633  TRP A  N   1 
ATOM   4688  C CA  . TRP A  1 633  ? 216.018 233.833 192.228 1.00 64.40  ? 633  TRP A  CA  1 
ATOM   4689  C C   . TRP A  1 633  ? 215.091 233.011 191.347 1.00 58.93  ? 633  TRP A  C   1 
ATOM   4690  O O   . TRP A  1 633  ? 214.394 233.550 190.488 1.00 61.31  ? 633  TRP A  O   1 
ATOM   4691  C CB  . TRP A  1 633  ? 215.480 233.869 193.661 1.00 57.81  ? 633  TRP A  CB  1 
ATOM   4692  C CG  . TRP A  1 633  ? 216.247 234.785 194.551 1.00 61.70  ? 633  TRP A  CG  1 
ATOM   4693  C CD1 . TRP A  1 633  ? 215.851 236.007 195.016 1.00 65.40  ? 633  TRP A  CD1 1 
ATOM   4694  C CD2 . TRP A  1 633  ? 217.558 234.563 195.076 1.00 60.11  ? 633  TRP A  CD2 1 
ATOM   4695  N NE1 . TRP A  1 633  ? 216.833 236.554 195.801 1.00 65.55  ? 633  TRP A  NE1 1 
ATOM   4696  C CE2 . TRP A  1 633  ? 217.892 235.688 195.853 1.00 61.80  ? 633  TRP A  CE2 1 
ATOM   4697  C CE3 . TRP A  1 633  ? 218.482 233.522 194.964 1.00 64.80  ? 633  TRP A  CE3 1 
ATOM   4698  C CZ2 . TRP A  1 633  ? 219.108 235.800 196.517 1.00 62.72  ? 633  TRP A  CZ2 1 
ATOM   4699  C CZ3 . TRP A  1 633  ? 219.689 233.636 195.624 1.00 70.26  ? 633  TRP A  CZ3 1 
ATOM   4700  C CH2 . TRP A  1 633  ? 219.992 234.767 196.391 1.00 69.56  ? 633  TRP A  CH2 1 
ATOM   4701  N N   . ARG A  1 634  ? 215.093 231.698 191.562 1.00 54.04  ? 634  ARG A  N   1 
ATOM   4702  C CA  . ARG A  1 634  ? 214.152 230.823 190.878 1.00 52.89  ? 634  ARG A  CA  1 
ATOM   4703  C C   . ARG A  1 634  ? 212.792 230.924 191.553 1.00 53.13  ? 634  ARG A  C   1 
ATOM   4704  O O   . ARG A  1 634  ? 212.379 230.012 192.275 1.00 61.56  ? 634  ARG A  O   1 
ATOM   4705  C CB  . ARG A  1 634  ? 214.656 229.379 190.880 1.00 53.63  ? 634  ARG A  CB  1 
ATOM   4706  C CG  . ARG A  1 634  ? 215.712 229.088 189.826 1.00 53.53  ? 634  ARG A  CG  1 
ATOM   4707  C CD  . ARG A  1 634  ? 216.289 227.696 190.000 1.00 42.68  ? 634  ARG A  CD  1 
ATOM   4708  N NE  . ARG A  1 634  ? 215.298 226.664 189.706 1.00 53.69  ? 634  ARG A  NE  1 
ATOM   4709  C CZ  . ARG A  1 634  ? 215.135 226.087 188.518 1.00 55.07  ? 634  ARG A  CZ  1 
ATOM   4710  N NH1 . ARG A  1 634  ? 215.904 226.425 187.491 1.00 54.14  ? 634  ARG A  NH1 1 
ATOM   4711  N NH2 . ARG A  1 634  ? 214.200 225.161 188.354 1.00 56.42  ? 634  ARG A  NH2 1 
ATOM   4712  N N   . VAL A  1 635  ? 212.093 232.037 191.327 1.00 56.88  ? 635  VAL A  N   1 
ATOM   4713  C CA  . VAL A  1 635  ? 210.800 232.294 191.941 1.00 51.93  ? 635  VAL A  CA  1 
ATOM   4714  C C   . VAL A  1 635  ? 209.833 232.781 190.873 1.00 53.27  ? 635  VAL A  C   1 
ATOM   4715  O O   . VAL A  1 635  ? 210.229 233.256 189.808 1.00 59.43  ? 635  VAL A  O   1 
ATOM   4716  C CB  . VAL A  1 635  ? 210.888 233.328 193.084 1.00 50.23  ? 635  VAL A  CB  1 
ATOM   4717  C CG1 . VAL A  1 635  ? 211.787 232.825 194.194 1.00 48.41  ? 635  VAL A  CG1 1 
ATOM   4718  C CG2 . VAL A  1 635  ? 211.387 234.665 192.559 1.00 52.12  ? 635  VAL A  CG2 1 
ATOM   4719  N N   . TYR A  1 636  ? 208.542 232.652 191.177 1.00 49.94  ? 636  TYR A  N   1 
ATOM   4720  C CA  . TYR A  1 636  ? 207.509 233.195 190.307 1.00 50.84  ? 636  TYR A  CA  1 
ATOM   4721  C C   . TYR A  1 636  ? 207.363 234.703 190.448 1.00 57.64  ? 636  TYR A  C   1 
ATOM   4722  O O   . TYR A  1 636  ? 206.891 235.354 189.510 1.00 58.23  ? 636  TYR A  O   1 
ATOM   4723  C CB  . TYR A  1 636  ? 206.160 232.533 190.606 1.00 51.11  ? 636  TYR A  CB  1 
ATOM   4724  C CG  . TYR A  1 636  ? 206.074 231.069 190.229 1.00 59.73  ? 636  TYR A  CG  1 
ATOM   4725  C CD1 . TYR A  1 636  ? 206.673 230.590 189.074 1.00 54.18  ? 636  TYR A  CD1 1 
ATOM   4726  C CD2 . TYR A  1 636  ? 205.390 230.165 191.030 1.00 61.98  ? 636  TYR A  CD2 1 
ATOM   4727  C CE1 . TYR A  1 636  ? 206.594 229.259 188.729 1.00 57.03  ? 636  TYR A  CE1 1 
ATOM   4728  C CE2 . TYR A  1 636  ? 205.309 228.831 190.693 1.00 46.81  ? 636  TYR A  CE2 1 
ATOM   4729  C CZ  . TYR A  1 636  ? 205.913 228.383 189.541 1.00 52.74  ? 636  TYR A  CZ  1 
ATOM   4730  O OH  . TYR A  1 636  ? 205.837 227.053 189.194 1.00 58.27  ? 636  TYR A  OH  1 
ATOM   4731  N N   . SER A  1 637  ? 207.759 235.271 191.584 1.00 58.89  ? 637  SER A  N   1 
ATOM   4732  C CA  . SER A  1 637  ? 207.514 236.679 191.854 1.00 60.14  ? 637  SER A  CA  1 
ATOM   4733  C C   . SER A  1 637  ? 208.510 237.192 192.881 1.00 62.92  ? 637  SER A  C   1 
ATOM   4734  O O   . SER A  1 637  ? 208.913 236.459 193.788 1.00 55.89  ? 637  SER A  O   1 
ATOM   4735  C CB  . SER A  1 637  ? 206.086 236.902 192.365 1.00 63.03  ? 637  SER A  CB  1 
ATOM   4736  O OG  . SER A  1 637  ? 205.890 236.247 193.607 1.00 80.98  ? 637  SER A  OG  1 
ATOM   4737  N N   . THR A  1 638  ? 208.901 238.454 192.724 1.00 73.15  ? 638  THR A  N   1 
ATOM   4738  C CA  . THR A  1 638  ? 209.676 239.152 193.738 1.00 78.62  ? 638  THR A  CA  1 
ATOM   4739  C C   . THR A  1 638  ? 208.739 239.691 194.811 1.00 77.23  ? 638  THR A  C   1 
ATOM   4740  O O   . THR A  1 638  ? 207.677 240.240 194.506 1.00 75.64  ? 638  THR A  O   1 
ATOM   4741  C CB  . THR A  1 638  ? 210.469 240.298 193.106 1.00 82.93  ? 638  THR A  CB  1 
ATOM   4742  O OG1 . THR A  1 638  ? 211.387 239.776 192.138 1.00 87.23  ? 638  THR A  OG1 1 
ATOM   4743  C CG2 . THR A  1 638  ? 211.240 241.073 194.162 1.00 82.01  ? 638  THR A  CG2 1 
ATOM   4744  N N   . GLY A  1 639  ? 209.134 239.533 196.070 1.00 71.69  ? 639  GLY A  N   1 
ATOM   4745  C CA  . GLY A  1 639  ? 208.297 239.890 197.200 1.00 68.64  ? 639  GLY A  CA  1 
ATOM   4746  C C   . GLY A  1 639  ? 208.887 241.021 198.020 1.00 80.08  ? 639  GLY A  C   1 
ATOM   4747  O O   . GLY A  1 639  ? 210.107 241.141 198.153 1.00 73.44  ? 639  GLY A  O   1 
ATOM   4748  N N   . SER A  1 640  ? 208.005 241.859 198.571 1.00 82.83  ? 640  SER A  N   1 
ATOM   4749  C CA  . SER A  1 640  ? 208.452 242.893 199.498 1.00 68.18  ? 640  SER A  CA  1 
ATOM   4750  C C   . SER A  1 640  ? 209.021 242.274 200.767 1.00 65.72  ? 640  SER A  C   1 
ATOM   4751  O O   . SER A  1 640  ? 210.001 242.776 201.330 1.00 71.02  ? 640  SER A  O   1 
ATOM   4752  C CB  . SER A  1 640  ? 207.294 243.830 199.836 1.00 69.08  ? 640  SER A  CB  1 
ATOM   4753  O OG  . SER A  1 640  ? 207.678 244.781 200.813 1.00 65.67  ? 640  SER A  OG  1 
ATOM   4754  N N   . ASN A  1 641  ? 208.410 241.189 201.233 1.00 68.09  ? 641  ASN A  N   1 
ATOM   4755  C CA  . ASN A  1 641  ? 208.853 240.460 202.412 1.00 65.14  ? 641  ASN A  CA  1 
ATOM   4756  C C   . ASN A  1 641  ? 209.234 239.048 201.996 1.00 62.60  ? 641  ASN A  C   1 
ATOM   4757  O O   . ASN A  1 641  ? 208.426 238.336 201.393 1.00 57.20  ? 641  ASN A  O   1 
ATOM   4758  C CB  . ASN A  1 641  ? 207.751 240.425 203.475 1.00 55.65  ? 641  ASN A  CB  1 
ATOM   4759  C CG  . ASN A  1 641  ? 206.381 240.220 202.873 1.00 51.62  ? 641  ASN A  CG  1 
ATOM   4760  O OD1 . ASN A  1 641  ? 206.258 239.867 201.701 1.00 61.44  ? 641  ASN A  OD1 1 
ATOM   4761  N ND2 . ASN A  1 641  ? 205.339 240.445 203.665 1.00 42.50  ? 641  ASN A  ND2 1 
ATOM   4762  N N   . VAL A  1 642  ? 210.461 238.650 202.316 1.00 60.32  ? 642  VAL A  N   1 
ATOM   4763  C CA  . VAL A  1 642  ? 210.959 237.316 202.005 1.00 51.52  ? 642  VAL A  CA  1 
ATOM   4764  C C   . VAL A  1 642  ? 211.607 236.751 203.257 1.00 52.47  ? 642  VAL A  C   1 
ATOM   4765  O O   . VAL A  1 642  ? 212.429 237.418 203.894 1.00 61.15  ? 642  VAL A  O   1 
ATOM   4766  C CB  . VAL A  1 642  ? 211.961 237.325 200.836 1.00 48.01  ? 642  VAL A  CB  1 
ATOM   4767  C CG1 . VAL A  1 642  ? 212.575 235.950 200.664 1.00 57.59  ? 642  VAL A  CG1 1 
ATOM   4768  C CG2 . VAL A  1 642  ? 211.274 237.765 199.561 1.00 49.40  ? 642  VAL A  CG2 1 
ATOM   4769  N N   . PHE A  1 643  ? 211.243 235.522 203.604 1.00 48.05  ? 643  PHE A  N   1 
ATOM   4770  C CA  . PHE A  1 643  ? 211.731 234.856 204.801 1.00 47.10  ? 643  PHE A  CA  1 
ATOM   4771  C C   . PHE A  1 643  ? 212.333 233.520 204.395 1.00 49.43  ? 643  PHE A  C   1 
ATOM   4772  O O   . PHE A  1 643  ? 211.612 232.622 203.949 1.00 49.03  ? 643  PHE A  O   1 
ATOM   4773  C CB  . PHE A  1 643  ? 210.594 234.662 205.807 1.00 44.68  ? 643  PHE A  CB  1 
ATOM   4774  C CG  . PHE A  1 643  ? 210.989 233.906 207.043 1.00 48.84  ? 643  PHE A  CG  1 
ATOM   4775  C CD1 . PHE A  1 643  ? 212.304 233.868 207.473 1.00 53.45  ? 643  PHE A  CD1 1 
ATOM   4776  C CD2 . PHE A  1 643  ? 210.036 233.227 207.774 1.00 45.49  ? 643  PHE A  CD2 1 
ATOM   4777  C CE1 . PHE A  1 643  ? 212.654 233.168 208.607 1.00 49.81  ? 643  PHE A  CE1 1 
ATOM   4778  C CE2 . PHE A  1 643  ? 210.381 232.529 208.906 1.00 44.66  ? 643  PHE A  CE2 1 
ATOM   4779  C CZ  . PHE A  1 643  ? 211.691 232.498 209.324 1.00 46.03  ? 643  PHE A  CZ  1 
ATOM   4780  N N   . GLN A  1 644  ? 213.647 233.393 204.547 1.00 49.61  ? 644  GLN A  N   1 
ATOM   4781  C CA  . GLN A  1 644  ? 214.314 232.128 204.289 1.00 43.24  ? 644  GLN A  CA  1 
ATOM   4782  C C   . GLN A  1 644  ? 214.171 231.220 205.502 1.00 47.07  ? 644  GLN A  C   1 
ATOM   4783  O O   . GLN A  1 644  ? 214.487 231.618 206.627 1.00 54.53  ? 644  GLN A  O   1 
ATOM   4784  C CB  . GLN A  1 644  ? 215.789 232.356 203.968 1.00 49.04  ? 644  GLN A  CB  1 
ATOM   4785  C CG  . GLN A  1 644  ? 216.550 231.085 203.645 1.00 48.16  ? 644  GLN A  CG  1 
ATOM   4786  C CD  . GLN A  1 644  ? 216.003 230.377 202.431 1.00 49.28  ? 644  GLN A  CD  1 
ATOM   4787  O OE1 . GLN A  1 644  ? 215.609 231.012 201.454 1.00 58.35  ? 644  GLN A  OE1 1 
ATOM   4788  N NE2 . GLN A  1 644  ? 215.967 229.051 202.482 1.00 53.67  ? 644  GLN A  NE2 1 
ATOM   4789  N N   . THR A  1 645  ? 213.697 230.001 205.269 1.00 45.28  ? 645  THR A  N   1 
ATOM   4790  C CA  . THR A  1 645  ? 213.500 229.015 206.317 1.00 45.41  ? 645  THR A  CA  1 
ATOM   4791  C C   . THR A  1 645  ? 214.292 227.760 205.984 1.00 48.32  ? 645  THR A  C   1 
ATOM   4792  O O   . THR A  1 645  ? 214.685 227.535 204.837 1.00 51.04  ? 645  THR A  O   1 
ATOM   4793  C CB  . THR A  1 645  ? 212.017 228.658 206.477 1.00 40.90  ? 645  THR A  CB  1 
ATOM   4794  O OG1 . THR A  1 645  ? 211.636 227.726 205.458 1.00 53.23  ? 645  THR A  OG1 1 
ATOM   4795  C CG2 . THR A  1 645  ? 211.148 229.899 206.361 1.00 37.07  ? 645  THR A  CG2 1 
ATOM   4796  N N   . ARG A  1 646  ? 214.520 226.930 207.003 1.00 39.62  ? 646  ARG A  N   1 
ATOM   4797  C CA  . ARG A  1 646  ? 215.162 225.646 206.753 1.00 39.90  ? 646  ARG A  CA  1 
ATOM   4798  C C   . ARG A  1 646  ? 214.319 224.792 205.818 1.00 55.40  ? 646  ARG A  C   1 
ATOM   4799  O O   . ARG A  1 646  ? 214.846 223.896 205.148 1.00 60.39  ? 646  ARG A  O   1 
ATOM   4800  C CB  . ARG A  1 646  ? 215.411 224.914 208.072 1.00 55.99  ? 646  ARG A  CB  1 
ATOM   4801  C CG  . ARG A  1 646  ? 216.475 225.555 208.953 1.00 67.96  ? 646  ARG A  CG  1 
ATOM   4802  C CD  . ARG A  1 646  ? 216.717 224.741 210.219 1.00 73.65  ? 646  ARG A  CD  1 
ATOM   4803  N NE  . ARG A  1 646  ? 217.830 225.263 211.012 1.00 73.43  ? 646  ARG A  NE  1 
ATOM   4804  C CZ  . ARG A  1 646  ? 217.721 226.199 211.953 1.00 70.38  ? 646  ARG A  CZ  1 
ATOM   4805  N NH1 . ARG A  1 646  ? 218.800 226.598 212.613 1.00 77.84  ? 646  ARG A  NH1 1 
ATOM   4806  N NH2 . ARG A  1 646  ? 216.544 226.740 212.238 1.00 60.66  ? 646  ARG A  NH2 1 
ATOM   4807  N N   . ALA A  1 647  ? 213.012 225.053 205.762 1.00 53.38  ? 647  ALA A  N   1 
ATOM   4808  C CA  . ALA A  1 647  ? 212.119 224.341 204.860 1.00 42.03  ? 647  ALA A  CA  1 
ATOM   4809  C C   . ALA A  1 647  ? 212.112 224.918 203.453 1.00 48.14  ? 647  ALA A  C   1 
ATOM   4810  O O   . ALA A  1 647  ? 211.630 224.252 202.530 1.00 61.12  ? 647  ALA A  O   1 
ATOM   4811  C CB  . ALA A  1 647  ? 210.698 224.360 205.422 1.00 42.06  ? 647  ALA A  CB  1 
ATOM   4812  N N   . GLY A  1 648  ? 212.619 226.123 203.265 1.00 49.09  ? 648  GLY A  N   1 
ATOM   4813  C CA  . GLY A  1 648  ? 212.616 226.752 201.960 1.00 45.18  ? 648  GLY A  CA  1 
ATOM   4814  C C   . GLY A  1 648  ? 212.446 228.250 202.093 1.00 44.95  ? 648  GLY A  C   1 
ATOM   4815  O O   . GLY A  1 648  ? 212.330 228.793 203.187 1.00 60.30  ? 648  GLY A  O   1 
ATOM   4816  N N   . CYS A  1 649  ? 212.439 228.912 200.940 1.00 35.48  ? 649  CYS A  N   1 
ATOM   4817  C CA  . CYS A  1 649  ? 212.253 230.356 200.884 1.00 43.37  ? 649  CYS A  CA  1 
ATOM   4818  C C   . CYS A  1 649  ? 210.764 230.679 200.870 1.00 39.73  ? 649  CYS A  C   1 
ATOM   4819  O O   . CYS A  1 649  ? 210.042 230.273 199.954 1.00 38.31  ? 649  CYS A  O   1 
ATOM   4820  C CB  . CYS A  1 649  ? 212.949 230.928 199.651 1.00 51.37  ? 649  CYS A  CB  1 
ATOM   4821  S SG  . CYS A  1 649  ? 212.738 232.708 199.401 1.00 50.79  ? 649  CYS A  SG  1 
ATOM   4822  N N   . LEU A  1 650  ? 210.310 231.413 201.879 1.00 38.93  ? 650  LEU A  N   1 
ATOM   4823  C CA  . LEU A  1 650  ? 208.901 231.742 202.052 1.00 40.33  ? 650  LEU A  CA  1 
ATOM   4824  C C   . LEU A  1 650  ? 208.672 233.180 201.608 1.00 39.65  ? 650  LEU A  C   1 
ATOM   4825  O O   . LEU A  1 650  ? 209.308 234.102 202.128 1.00 44.80  ? 650  LEU A  O   1 
ATOM   4826  C CB  . LEU A  1 650  ? 208.484 231.551 203.508 1.00 39.63  ? 650  LEU A  CB  1 
ATOM   4827  C CG  . LEU A  1 650  ? 207.046 231.895 203.894 1.00 22.30  ? 650  LEU A  CG  1 
ATOM   4828  C CD1 . LEU A  1 650  ? 206.060 231.000 203.179 1.00 21.78  ? 650  LEU A  CD1 1 
ATOM   4829  C CD2 . LEU A  1 650  ? 206.887 231.776 205.394 1.00 39.61  ? 650  LEU A  CD2 1 
ATOM   4830  N N   . ILE A  1 651  ? 207.764 233.369 200.655 1.00 40.43  ? 651  ILE A  N   1 
ATOM   4831  C CA  . ILE A  1 651  ? 207.518 234.667 200.040 1.00 40.23  ? 651  ILE A  CA  1 
ATOM   4832  C C   . ILE A  1 651  ? 206.056 235.038 200.235 1.00 40.77  ? 651  ILE A  C   1 
ATOM   4833  O O   . ILE A  1 651  ? 205.162 234.207 200.045 1.00 40.81  ? 651  ILE A  O   1 
ATOM   4834  C CB  . ILE A  1 651  ? 207.894 234.659 198.544 1.00 33.86  ? 651  ILE A  CB  1 
ATOM   4835  C CG1 . ILE A  1 651  ? 209.379 234.322 198.392 1.00 36.79  ? 651  ILE A  CG1 1 
ATOM   4836  C CG2 . ILE A  1 651  ? 207.569 236.000 197.903 1.00 48.85  ? 651  ILE A  CG2 1 
ATOM   4837  C CD1 . ILE A  1 651  ? 209.905 234.431 196.986 1.00 42.79  ? 651  ILE A  CD1 1 
ATOM   4838  N N   . GLY A  1 652  ? 205.818 236.294 200.606 1.00 40.73  ? 652  GLY A  N   1 
ATOM   4839  C CA  . GLY A  1 652  ? 204.479 236.783 200.853 1.00 37.20  ? 652  GLY A  CA  1 
ATOM   4840  C C   . GLY A  1 652  ? 203.991 236.634 202.275 1.00 34.02  ? 652  GLY A  C   1 
ATOM   4841  O O   . GLY A  1 652  ? 202.791 236.791 202.519 1.00 33.57  ? 652  GLY A  O   1 
ATOM   4842  N N   . ALA A  1 653  ? 204.881 236.344 203.221 1.00 31.56  ? 653  ALA A  N   1 
ATOM   4843  C CA  . ALA A  1 653  ? 204.527 236.214 204.625 1.00 32.19  ? 653  ALA A  CA  1 
ATOM   4844  C C   . ALA A  1 653  ? 205.508 237.013 205.470 1.00 46.59  ? 653  ALA A  C   1 
ATOM   4845  O O   . ALA A  1 653  ? 206.716 236.991 205.220 1.00 56.85  ? 653  ALA A  O   1 
ATOM   4846  C CB  . ALA A  1 653  ? 204.530 234.746 205.060 1.00 36.71  ? 653  ALA A  CB  1 
ATOM   4847  N N   . GLU A  1 654  ? 204.984 237.714 206.473 1.00 44.25  ? 654  GLU A  N   1 
ATOM   4848  C CA  . GLU A  1 654  ? 205.804 238.556 207.335 1.00 44.55  ? 654  GLU A  CA  1 
ATOM   4849  C C   . GLU A  1 654  ? 206.397 237.718 208.462 1.00 44.85  ? 654  GLU A  C   1 
ATOM   4850  O O   . GLU A  1 654  ? 205.662 237.094 209.233 1.00 49.83  ? 654  GLU A  O   1 
ATOM   4851  C CB  . GLU A  1 654  ? 204.969 239.701 207.906 1.00 51.91  ? 654  GLU A  CB  1 
ATOM   4852  C CG  . GLU A  1 654  ? 205.735 240.643 208.831 1.00 54.66  ? 654  GLU A  CG  1 
ATOM   4853  C CD  . GLU A  1 654  ? 204.816 241.554 209.620 1.00 75.62  ? 654  GLU A  CD  1 
ATOM   4854  O OE1 . GLU A  1 654  ? 203.624 241.650 209.258 1.00 76.44  ? 654  GLU A  OE1 1 
ATOM   4855  O OE2 . GLU A  1 654  ? 205.281 242.165 210.606 1.00 73.89  ? 654  GLU A  OE2 1 
ATOM   4856  N N   . HIS A  1 655  ? 207.722 237.704 208.559 1.00 39.53  ? 655  HIS A  N   1 
ATOM   4857  C CA  . HIS A  1 655  ? 208.387 236.998 209.646 1.00 41.51  ? 655  HIS A  CA  1 
ATOM   4858  C C   . HIS A  1 655  ? 208.198 237.760 210.951 1.00 44.35  ? 655  HIS A  C   1 
ATOM   4859  O O   . HIS A  1 655  ? 208.615 238.915 211.068 1.00 55.78  ? 655  HIS A  O   1 
ATOM   4860  C CB  . HIS A  1 655  ? 209.873 236.841 209.346 1.00 42.58  ? 655  HIS A  CB  1 
ATOM   4861  C CG  . HIS A  1 655  ? 210.620 236.082 210.397 1.00 49.39  ? 655  HIS A  CG  1 
ATOM   4862  N ND1 . HIS A  1 655  ? 211.944 236.325 210.691 1.00 59.69  ? 655  HIS A  ND1 1 
ATOM   4863  C CD2 . HIS A  1 655  ? 210.228 235.083 211.222 1.00 50.33  ? 655  HIS A  CD2 1 
ATOM   4864  C CE1 . HIS A  1 655  ? 212.334 235.509 211.653 1.00 66.17  ? 655  HIS A  CE1 1 
ATOM   4865  N NE2 . HIS A  1 655  ? 211.312 234.745 211.993 1.00 57.98  ? 655  HIS A  NE2 1 
ATOM   4866  N N   . VAL A  1 656  ? 207.583 237.123 211.936 1.00 47.75  ? 656  VAL A  N   1 
ATOM   4867  C CA  . VAL A  1 656  ? 207.438 237.723 213.257 1.00 48.21  ? 656  VAL A  CA  1 
ATOM   4868  C C   . VAL A  1 656  ? 208.221 236.886 214.252 1.00 55.68  ? 656  VAL A  C   1 
ATOM   4869  O O   . VAL A  1 656  ? 208.233 235.655 214.176 1.00 60.61  ? 656  VAL A  O   1 
ATOM   4870  C CB  . VAL A  1 656  ? 205.965 237.848 213.691 1.00 43.16  ? 656  VAL A  CB  1 
ATOM   4871  C CG1 . VAL A  1 656  ? 205.244 238.851 212.822 1.00 47.11  ? 656  VAL A  CG1 1 
ATOM   4872  C CG2 . VAL A  1 656  ? 205.267 236.500 213.655 1.00 46.82  ? 656  VAL A  CG2 1 
ATOM   4873  N N   . ASN A  1 657  ? 208.856 237.569 215.200 1.00 61.55  ? 657  ASN A  N   1 
ATOM   4874  C CA  . ASN A  1 657  ? 209.624 236.919 216.252 1.00 61.13  ? 657  ASN A  CA  1 
ATOM   4875  C C   . ASN A  1 657  ? 208.762 236.283 217.331 1.00 61.67  ? 657  ASN A  C   1 
ATOM   4876  O O   . ASN A  1 657  ? 209.125 235.249 217.885 1.00 55.83  ? 657  ASN A  O   1 
ATOM   4877  C CB  . ASN A  1 657  ? 210.558 237.933 216.912 1.00 61.74  ? 657  ASN A  CB  1 
ATOM   4878  C CG  . ASN A  1 657  ? 211.408 238.669 215.914 1.00 77.05  ? 657  ASN A  CG  1 
ATOM   4879  O OD1 . ASN A  1 657  ? 212.048 238.068 215.047 1.00 77.57  ? 657  ASN A  OD1 1 
ATOM   4880  N ND2 . ASN A  1 657  ? 211.425 239.993 216.032 1.00 81.94  ? 657  ASN A  ND2 1 
ATOM   4881  N N   . ASN A  1 658  ? 207.604 236.895 217.621 1.00 59.30  ? 658  ASN A  N   1 
ATOM   4882  C CA  . ASN A  1 658  ? 206.612 236.381 218.535 1.00 54.29  ? 658  ASN A  CA  1 
ATOM   4883  C C   . ASN A  1 658  ? 206.190 234.977 218.127 1.00 54.40  ? 658  ASN A  C   1 
ATOM   4884  O O   . ASN A  1 658  ? 205.678 234.786 217.017 1.00 50.94  ? 658  ASN A  O   1 
ATOM   4885  C CB  . ASN A  1 658  ? 205.417 237.338 218.558 1.00 55.56  ? 658  ASN A  CB  1 
ATOM   4886  C CG  . ASN A  1 658  ? 204.532 237.124 219.752 1.00 64.03  ? 658  ASN A  CG  1 
ATOM   4887  O OD1 . ASN A  1 658  ? 203.476 237.719 219.858 1.00 67.68  ? 658  ASN A  OD1 1 
ATOM   4888  N ND2 . ASN A  1 658  ? 204.956 236.277 220.655 1.00 64.62  ? 658  ASN A  ND2 1 
ATOM   4889  N N   . SER A  1 659  ? 206.448 233.993 218.981 1.00 55.12  ? 659  SER A  N   1 
ATOM   4890  C CA  . SER A  1 659  ? 206.085 232.607 218.704 1.00 39.78  ? 659  SER A  CA  1 
ATOM   4891  C C   . SER A  1 659  ? 204.665 232.328 219.186 1.00 40.74  ? 659  SER A  C   1 
ATOM   4892  O O   . SER A  1 659  ? 204.353 232.534 220.364 1.00 47.87  ? 659  SER A  O   1 
ATOM   4893  C CB  . SER A  1 659  ? 207.069 231.653 219.375 1.00 37.05  ? 659  SER A  CB  1 
ATOM   4894  O OG  . SER A  1 659  ? 208.376 231.818 218.860 1.00 24.93  ? 659  SER A  OG  1 
ATOM   4895  N N   . TYR A  1 660  ? 203.809 231.877 218.278 1.00 42.55  ? 660  TYR A  N   1 
ATOM   4896  C CA  . TYR A  1 660  ? 202.440 231.487 218.587 1.00 48.87  ? 660  TYR A  CA  1 
ATOM   4897  C C   . TYR A  1 660  ? 202.300 229.972 218.479 1.00 44.81  ? 660  TYR A  C   1 
ATOM   4898  O O   . TYR A  1 660  ? 203.236 229.256 218.111 1.00 35.66  ? 660  TYR A  O   1 
ATOM   4899  C CB  . TYR A  1 660  ? 201.448 232.179 217.649 1.00 53.49  ? 660  TYR A  CB  1 
ATOM   4900  C CG  . TYR A  1 660  ? 201.495 233.686 217.689 1.00 44.96  ? 660  TYR A  CG  1 
ATOM   4901  C CD1 . TYR A  1 660  ? 200.740 234.400 218.607 1.00 58.33  ? 660  TYR A  CD1 1 
ATOM   4902  C CD2 . TYR A  1 660  ? 202.288 234.397 216.804 1.00 43.88  ? 660  TYR A  CD2 1 
ATOM   4903  C CE1 . TYR A  1 660  ? 200.779 235.775 218.644 1.00 67.11  ? 660  TYR A  CE1 1 
ATOM   4904  C CE2 . TYR A  1 660  ? 202.331 235.769 216.834 1.00 48.35  ? 660  TYR A  CE2 1 
ATOM   4905  C CZ  . TYR A  1 660  ? 201.574 236.455 217.754 1.00 62.01  ? 660  TYR A  CZ  1 
ATOM   4906  O OH  . TYR A  1 660  ? 201.617 237.829 217.786 1.00 72.80  ? 660  TYR A  OH  1 
ATOM   4907  N N   . GLU A  1 661  ? 201.100 229.490 218.782 1.00 46.70  ? 661  GLU A  N   1 
ATOM   4908  C CA  . GLU A  1 661  ? 200.780 228.091 218.545 1.00 51.05  ? 661  GLU A  CA  1 
ATOM   4909  C C   . GLU A  1 661  ? 200.644 227.843 217.051 1.00 58.89  ? 661  GLU A  C   1 
ATOM   4910  O O   . GLU A  1 661  ? 200.146 228.692 216.309 1.00 58.36  ? 661  GLU A  O   1 
ATOM   4911  C CB  . GLU A  1 661  ? 199.487 227.715 219.266 1.00 48.45  ? 661  GLU A  CB  1 
ATOM   4912  C CG  . GLU A  1 661  ? 199.112 226.251 219.158 1.00 55.15  ? 661  GLU A  CG  1 
ATOM   4913  C CD  . GLU A  1 661  ? 197.725 225.972 219.692 1.00 70.51  ? 661  GLU A  CD  1 
ATOM   4914  O OE1 . GLU A  1 661  ? 197.211 224.859 219.462 1.00 79.04  ? 661  GLU A  OE1 1 
ATOM   4915  O OE2 . GLU A  1 661  ? 197.148 226.870 220.333 1.00 69.56  ? 661  GLU A  OE2 1 
ATOM   4916  N N   . CYS A  1 662  ? 201.091 226.670 216.613 1.00 61.95  ? 662  CYS A  N   1 
ATOM   4917  C CA  . CYS A  1 662  ? 201.098 226.361 215.191 1.00 59.39  ? 662  CYS A  CA  1 
ATOM   4918  C C   . CYS A  1 662  ? 199.690 226.410 214.615 1.00 58.96  ? 662  CYS A  C   1 
ATOM   4919  O O   . CYS A  1 662  ? 198.755 225.826 215.170 1.00 61.24  ? 662  CYS A  O   1 
ATOM   4920  C CB  . CYS A  1 662  ? 201.706 224.982 214.961 1.00 56.00  ? 662  CYS A  CB  1 
ATOM   4921  S SG  . CYS A  1 662  ? 202.026 224.620 213.226 1.00 73.14  ? 662  CYS A  SG  1 
ATOM   4922  N N   . ASP A  1 663  ? 199.544 227.107 213.487 1.00 50.54  ? 663  ASP A  N   1 
ATOM   4923  C CA  . ASP A  1 663  ? 198.257 227.189 212.808 1.00 46.53  ? 663  ASP A  CA  1 
ATOM   4924  C C   . ASP A  1 663  ? 198.309 226.506 211.446 1.00 50.30  ? 663  ASP A  C   1 
ATOM   4925  O O   . ASP A  1 663  ? 197.522 225.594 211.175 1.00 62.93  ? 663  ASP A  O   1 
ATOM   4926  C CB  . ASP A  1 663  ? 197.844 228.653 212.654 1.00 54.24  ? 663  ASP A  CB  1 
ATOM   4927  C CG  . ASP A  1 663  ? 196.438 228.807 212.131 1.00 57.75  ? 663  ASP A  CG  1 
ATOM   4928  O OD1 . ASP A  1 663  ? 195.743 227.783 211.981 1.00 51.75  ? 663  ASP A  OD1 1 
ATOM   4929  O OD2 . ASP A  1 663  ? 196.029 229.956 211.871 1.00 59.40  ? 663  ASP A  OD2 1 
ATOM   4930  N N   . ILE A  1 664  ? 199.218 226.943 210.584 1.00 45.82  ? 664  ILE A  N   1 
ATOM   4931  C CA  . ILE A  1 664  ? 199.488 226.285 209.309 1.00 41.57  ? 664  ILE A  CA  1 
ATOM   4932  C C   . ILE A  1 664  ? 200.937 225.809 209.337 1.00 39.82  ? 664  ILE A  C   1 
ATOM   4933  O O   . ILE A  1 664  ? 201.847 226.650 209.350 1.00 48.05  ? 664  ILE A  O   1 
ATOM   4934  C CB  . ILE A  1 664  ? 199.239 227.225 208.120 1.00 33.22  ? 664  ILE A  CB  1 
ATOM   4935  C CG1 . ILE A  1 664  ? 197.773 227.662 208.096 1.00 42.15  ? 664  ILE A  CG1 1 
ATOM   4936  C CG2 . ILE A  1 664  ? 199.602 226.537 206.818 1.00 27.83  ? 664  ILE A  CG2 1 
ATOM   4937  C CD1 . ILE A  1 664  ? 197.476 228.778 207.123 1.00 33.96  ? 664  ILE A  CD1 1 
ATOM   4938  N N   . PRO A  1 665  ? 201.200 224.503 209.338 1.00 31.00  ? 665  PRO A  N   1 
ATOM   4939  C CA  . PRO A  1 665  ? 202.584 224.027 209.458 1.00 30.32  ? 665  PRO A  CA  1 
ATOM   4940  C C   . PRO A  1 665  ? 203.340 224.188 208.150 1.00 44.48  ? 665  PRO A  C   1 
ATOM   4941  O O   . PRO A  1 665  ? 203.017 223.551 207.143 1.00 34.25  ? 665  PRO A  O   1 
ATOM   4942  C CB  . PRO A  1 665  ? 202.407 222.553 209.841 1.00 34.27  ? 665  PRO A  CB  1 
ATOM   4943  C CG  . PRO A  1 665  ? 201.128 222.172 209.217 1.00 39.09  ? 665  PRO A  CG  1 
ATOM   4944  C CD  . PRO A  1 665  ? 200.246 223.384 209.277 1.00 36.11  ? 665  PRO A  CD  1 
ATOM   4945  N N   . ILE A  1 666  ? 204.358 225.046 208.163 1.00 21.46  ? 666  ILE A  N   1 
ATOM   4946  C CA  . ILE A  1 666  ? 205.216 225.212 206.998 1.00 19.77  ? 666  ILE A  CA  1 
ATOM   4947  C C   . ILE A  1 666  ? 206.392 224.241 207.003 1.00 23.98  ? 666  ILE A  C   1 
ATOM   4948  O O   . ILE A  1 666  ? 206.948 223.950 205.935 1.00 24.62  ? 666  ILE A  O   1 
ATOM   4949  C CB  . ILE A  1 666  ? 205.710 226.667 206.913 1.00 20.16  ? 666  ILE A  CB  1 
ATOM   4950  C CG1 . ILE A  1 666  ? 204.613 227.547 206.317 1.00 19.43  ? 666  ILE A  CG1 1 
ATOM   4951  C CG2 . ILE A  1 666  ? 206.986 226.762 206.095 1.00 20.82  ? 666  ILE A  CG2 1 
ATOM   4952  C CD1 . ILE A  1 666  ? 204.883 229.022 206.418 1.00 24.83  ? 666  ILE A  CD1 1 
ATOM   4953  N N   . GLY A  1 667  ? 206.779 223.730 208.160 1.00 20.22  ? 667  GLY A  N   1 
ATOM   4954  C CA  . GLY A  1 667  ? 207.835 222.748 208.259 1.00 22.12  ? 667  GLY A  CA  1 
ATOM   4955  C C   . GLY A  1 667  ? 209.105 223.335 208.852 1.00 27.15  ? 667  GLY A  C   1 
ATOM   4956  O O   . GLY A  1 667  ? 209.345 224.544 208.827 1.00 41.48  ? 667  GLY A  O   1 
ATOM   4957  N N   . ALA A  1 668  ? 209.933 222.443 209.384 1.00 29.00  ? 668  ALA A  N   1 
ATOM   4958  C CA  . ALA A  1 668  ? 211.196 222.818 210.012 1.00 27.26  ? 668  ALA A  CA  1 
ATOM   4959  C C   . ALA A  1 668  ? 210.989 223.904 211.062 1.00 31.34  ? 668  ALA A  C   1 
ATOM   4960  O O   . ALA A  1 668  ? 211.745 224.872 211.153 1.00 45.52  ? 668  ALA A  O   1 
ATOM   4961  C CB  . ALA A  1 668  ? 212.209 223.267 208.962 1.00 34.22  ? 668  ALA A  CB  1 
ATOM   4962  N N   . GLY A  1 669  ? 209.939 223.739 211.864 1.00 34.92  ? 669  GLY A  N   1 
ATOM   4963  C CA  . GLY A  1 669  ? 209.687 224.612 212.987 1.00 32.03  ? 669  GLY A  CA  1 
ATOM   4964  C C   . GLY A  1 669  ? 208.855 225.838 212.682 1.00 29.95  ? 669  GLY A  C   1 
ATOM   4965  O O   . GLY A  1 669  ? 208.466 226.546 213.617 1.00 41.82  ? 669  GLY A  O   1 
ATOM   4966  N N   . ILE A  1 670  ? 208.573 226.113 211.417 1.00 32.67  ? 670  ILE A  N   1 
ATOM   4967  C CA  . ILE A  1 670  ? 207.848 227.314 211.022 1.00 26.39  ? 670  ILE A  CA  1 
ATOM   4968  C C   . ILE A  1 670  ? 206.383 226.970 210.811 1.00 31.21  ? 670  ILE A  C   1 
ATOM   4969  O O   . ILE A  1 670  ? 206.054 225.999 210.120 1.00 36.33  ? 670  ILE A  O   1 
ATOM   4970  C CB  . ILE A  1 670  ? 208.448 227.923 209.745 1.00 24.54  ? 670  ILE A  CB  1 
ATOM   4971  C CG1 . ILE A  1 670  ? 209.957 228.112 209.891 1.00 26.75  ? 670  ILE A  CG1 1 
ATOM   4972  C CG2 . ILE A  1 670  ? 207.777 229.249 209.436 1.00 32.27  ? 670  ILE A  CG2 1 
ATOM   4973  C CD1 . ILE A  1 670  ? 210.353 229.052 211.001 1.00 26.18  ? 670  ILE A  CD1 1 
ATOM   4974  N N   . CYS A  1 671  ? 205.505 227.759 211.413 1.00 31.11  ? 671  CYS A  N   1 
ATOM   4975  C CA  . CYS A  1 671  ? 204.087 227.744 211.104 1.00 27.96  ? 671  CYS A  CA  1 
ATOM   4976  C C   . CYS A  1 671  ? 203.670 229.153 210.708 1.00 31.75  ? 671  CYS A  C   1 
ATOM   4977  O O   . CYS A  1 671  ? 204.375 230.126 210.984 1.00 46.87  ? 671  CYS A  O   1 
ATOM   4978  C CB  . CYS A  1 671  ? 203.262 227.236 212.291 1.00 32.92  ? 671  CYS A  CB  1 
ATOM   4979  S SG  . CYS A  1 671  ? 203.765 225.593 212.841 1.00 53.71  ? 671  CYS A  SG  1 
ATOM   4980  N N   . ALA A  1 672  ? 202.526 229.259 210.036 1.00 31.73  ? 672  ALA A  N   1 
ATOM   4981  C CA  . ALA A  1 672  ? 202.057 230.543 209.537 1.00 36.03  ? 672  ALA A  CA  1 
ATOM   4982  C C   . ALA A  1 672  ? 200.591 230.725 209.890 1.00 41.30  ? 672  ALA A  C   1 
ATOM   4983  O O   . ALA A  1 672  ? 199.863 229.760 210.130 1.00 47.97  ? 672  ALA A  O   1 
ATOM   4984  C CB  . ALA A  1 672  ? 202.255 230.663 208.023 1.00 33.46  ? 672  ALA A  CB  1 
ATOM   4985  N N   . SER A  1 673  ? 200.163 231.985 209.913 1.00 44.00  ? 673  SER A  N   1 
ATOM   4986  C CA  . SER A  1 673  ? 198.810 232.328 210.327 1.00 48.08  ? 673  SER A  CA  1 
ATOM   4987  C C   . SER A  1 673  ? 198.444 233.683 209.744 1.00 48.56  ? 673  SER A  C   1 
ATOM   4988  O O   . SER A  1 673  ? 199.307 234.447 209.305 1.00 51.10  ? 673  SER A  O   1 
ATOM   4989  C CB  . SER A  1 673  ? 198.674 232.356 211.851 1.00 53.70  ? 673  SER A  CB  1 
ATOM   4990  O OG  . SER A  1 673  ? 197.330 232.579 212.238 1.00 52.25  ? 673  SER A  OG  1 
ATOM   4991  N N   . TYR A  1 674  ? 197.145 233.966 209.751 1.00 50.11  ? 674  TYR A  N   1 
ATOM   4992  C CA  . TYR A  1 674  ? 196.593 235.199 209.202 1.00 48.70  ? 674  TYR A  CA  1 
ATOM   4993  C C   . TYR A  1 674  ? 196.201 236.106 210.362 1.00 49.51  ? 674  TYR A  C   1 
ATOM   4994  O O   . TYR A  1 674  ? 195.292 235.780 211.133 1.00 51.78  ? 674  TYR A  O   1 
ATOM   4995  C CB  . TYR A  1 674  ? 195.395 234.884 208.310 1.00 59.96  ? 674  TYR A  CB  1 
ATOM   4996  C CG  . TYR A  1 674  ? 194.963 236.011 207.402 1.00 56.29  ? 674  TYR A  CG  1 
ATOM   4997  C CD1 . TYR A  1 674  ? 195.856 236.605 206.525 1.00 52.86  ? 674  TYR A  CD1 1 
ATOM   4998  C CD2 . TYR A  1 674  ? 193.651 236.459 207.399 1.00 51.04  ? 674  TYR A  CD2 1 
ATOM   4999  C CE1 . TYR A  1 674  ? 195.461 237.621 205.688 1.00 57.58  ? 674  TYR A  CE1 1 
ATOM   5000  C CE2 . TYR A  1 674  ? 193.248 237.474 206.563 1.00 54.22  ? 674  TYR A  CE2 1 
ATOM   5001  C CZ  . TYR A  1 674  ? 194.156 238.050 205.707 1.00 61.97  ? 674  TYR A  CZ  1 
ATOM   5002  O OH  . TYR A  1 674  ? 193.764 239.068 204.867 1.00 66.66  ? 674  TYR A  OH  1 
ATOM   5003  N N   . GLN A  1 675  ? 196.889 237.239 210.492 1.00 54.08  ? 675  GLN A  N   1 
ATOM   5004  C CA  . GLN A  1 675  ? 196.635 238.161 211.589 1.00 56.17  ? 675  GLN A  CA  1 
ATOM   5005  C C   . GLN A  1 675  ? 196.925 239.584 211.139 1.00 64.91  ? 675  GLN A  C   1 
ATOM   5006  O O   . GLN A  1 675  ? 197.548 239.818 210.100 1.00 62.65  ? 675  GLN A  O   1 
ATOM   5007  C CB  . GLN A  1 675  ? 197.477 237.823 212.824 1.00 59.38  ? 675  GLN A  CB  1 
ATOM   5008  C CG  . GLN A  1 675  ? 197.244 236.425 213.359 1.00 67.61  ? 675  GLN A  CG  1 
ATOM   5009  C CD  . GLN A  1 675  ? 197.865 236.209 214.720 1.00 68.17  ? 675  GLN A  CD  1 
ATOM   5010  O OE1 . GLN A  1 675  ? 198.160 237.163 215.441 1.00 68.68  ? 675  GLN A  OE1 1 
ATOM   5011  N NE2 . GLN A  1 675  ? 198.071 234.947 215.083 1.00 63.36  ? 675  GLN A  NE2 1 
ATOM   5012  N N   . THR A  1 676  ? 196.455 240.533 211.944 1.00 74.84  ? 676  THR A  N   1 
ATOM   5013  C CA  . THR A  1 676  ? 196.662 241.953 211.690 1.00 71.47  ? 676  THR A  CA  1 
ATOM   5014  C C   . THR A  1 676  ? 198.133 242.261 211.434 1.00 65.25  ? 676  THR A  C   1 
ATOM   5015  O O   . THR A  1 676  ? 198.826 242.782 212.306 1.00 67.99  ? 676  THR A  O   1 
ATOM   5016  C CB  . THR A  1 676  ? 196.175 242.809 212.875 1.00 70.84  ? 676  THR A  CB  1 
ATOM   5017  O OG1 . THR A  1 676  ? 196.805 242.364 214.083 1.00 74.87  ? 676  THR A  OG1 1 
ATOM   5018  C CG2 . THR A  1 676  ? 194.664 242.713 213.029 1.00 59.87  ? 676  THR A  CG2 1 
ATOM   5019  N N   . SER A  1 689  ? 193.840 245.318 207.191 1.00 76.39  ? 689  SER A  N   1 
ATOM   5020  C CA  . SER A  1 689  ? 195.127 245.351 207.876 1.00 76.81  ? 689  SER A  CA  1 
ATOM   5021  C C   . SER A  1 689  ? 195.644 243.940 208.150 1.00 68.04  ? 689  SER A  C   1 
ATOM   5022  O O   . SER A  1 689  ? 196.705 243.764 208.747 1.00 63.06  ? 689  SER A  O   1 
ATOM   5023  C CB  . SER A  1 689  ? 195.011 246.134 209.187 1.00 77.80  ? 689  SER A  CB  1 
ATOM   5024  O OG  . SER A  1 689  ? 193.971 245.621 210.001 1.00 64.09  ? 689  SER A  OG  1 
ATOM   5025  N N   . GLN A  1 690  ? 194.885 242.938 207.711 1.00 69.06  ? 690  GLN A  N   1 
ATOM   5026  C CA  . GLN A  1 690  ? 195.278 241.550 207.910 1.00 66.20  ? 690  GLN A  CA  1 
ATOM   5027  C C   . GLN A  1 690  ? 196.372 241.151 206.925 1.00 60.31  ? 690  GLN A  C   1 
ATOM   5028  O O   . GLN A  1 690  ? 196.366 241.566 205.763 1.00 58.19  ? 690  GLN A  O   1 
ATOM   5029  C CB  . GLN A  1 690  ? 194.067 240.632 207.738 1.00 70.94  ? 690  GLN A  CB  1 
ATOM   5030  C CG  . GLN A  1 690  ? 192.891 240.940 208.658 1.00 61.77  ? 690  GLN A  CG  1 
ATOM   5031  C CD  . GLN A  1 690  ? 193.062 240.357 210.045 1.00 65.93  ? 690  GLN A  CD  1 
ATOM   5032  O OE1 . GLN A  1 690  ? 194.171 240.019 210.458 1.00 57.03  ? 690  GLN A  OE1 1 
ATOM   5033  N NE2 . GLN A  1 690  ? 191.957 240.228 210.775 1.00 71.23  ? 690  GLN A  NE2 1 
ATOM   5034  N N   . SER A  1 691  ? 197.316 240.337 207.395 1.00 56.34  ? 691  SER A  N   1 
ATOM   5035  C CA  . SER A  1 691  ? 198.349 239.793 206.527 1.00 46.57  ? 691  SER A  CA  1 
ATOM   5036  C C   . SER A  1 691  ? 198.829 238.464 207.093 1.00 47.55  ? 691  SER A  C   1 
ATOM   5037  O O   . SER A  1 691  ? 198.646 238.167 208.276 1.00 53.73  ? 691  SER A  O   1 
ATOM   5038  C CB  . SER A  1 691  ? 199.524 240.765 206.370 1.00 51.53  ? 691  SER A  CB  1 
ATOM   5039  O OG  . SER A  1 691  ? 200.148 241.013 207.616 1.00 53.72  ? 691  SER A  OG  1 
ATOM   5040  N N   . ILE A  1 692  ? 199.448 237.667 206.229 1.00 51.04  ? 692  ILE A  N   1 
ATOM   5041  C CA  . ILE A  1 692  ? 199.951 236.351 206.612 1.00 50.09  ? 692  ILE A  CA  1 
ATOM   5042  C C   . ILE A  1 692  ? 201.275 236.526 207.342 1.00 47.05  ? 692  ILE A  C   1 
ATOM   5043  O O   . ILE A  1 692  ? 202.205 237.150 206.821 1.00 53.80  ? 692  ILE A  O   1 
ATOM   5044  C CB  . ILE A  1 692  ? 200.112 235.445 205.383 1.00 38.73  ? 692  ILE A  CB  1 
ATOM   5045  C CG1 . ILE A  1 692  ? 198.747 235.199 204.740 1.00 38.35  ? 692  ILE A  CG1 1 
ATOM   5046  C CG2 . ILE A  1 692  ? 200.774 234.131 205.767 1.00 33.79  ? 692  ILE A  CG2 1 
ATOM   5047  C CD1 . ILE A  1 692  ? 198.789 234.340 203.503 1.00 37.41  ? 692  ILE A  CD1 1 
ATOM   5048  N N   . ILE A  1 693  ? 201.362 235.979 208.552 1.00 42.88  ? 693  ILE A  N   1 
ATOM   5049  C CA  . ILE A  1 693  ? 202.579 236.033 209.351 1.00 47.01  ? 693  ILE A  CA  1 
ATOM   5050  C C   . ILE A  1 693  ? 203.209 234.649 209.395 1.00 48.50  ? 693  ILE A  C   1 
ATOM   5051  O O   . ILE A  1 693  ? 202.522 233.624 209.347 1.00 49.44  ? 693  ILE A  O   1 
ATOM   5052  C CB  . ILE A  1 693  ? 202.300 236.560 210.774 1.00 50.97  ? 693  ILE A  CB  1 
ATOM   5053  C CG1 . ILE A  1 693  ? 201.179 235.759 211.434 1.00 54.68  ? 693  ILE A  CG1 1 
ATOM   5054  C CG2 . ILE A  1 693  ? 201.934 238.029 210.723 1.00 59.79  ? 693  ILE A  CG2 1 
ATOM   5055  C CD1 . ILE A  1 693  ? 201.143 235.893 212.937 1.00 63.32  ? 693  ILE A  CD1 1 
ATOM   5056  N N   . ALA A  1 694  ? 204.536 234.624 209.492 1.00 41.93  ? 694  ALA A  N   1 
ATOM   5057  C CA  . ALA A  1 694  ? 205.302 233.394 209.613 1.00 31.67  ? 694  ALA A  CA  1 
ATOM   5058  C C   . ALA A  1 694  ? 206.189 233.487 210.843 1.00 37.58  ? 694  ALA A  C   1 
ATOM   5059  O O   . ALA A  1 694  ? 206.821 234.518 211.084 1.00 48.61  ? 694  ALA A  O   1 
ATOM   5060  C CB  . ALA A  1 694  ? 206.152 233.143 208.368 1.00 31.69  ? 694  ALA A  CB  1 
ATOM   5061  N N   . TYR A  1 695  ? 206.232 232.408 211.621 1.00 40.93  ? 695  TYR A  N   1 
ATOM   5062  C CA  . TYR A  1 695  ? 206.892 232.435 212.917 1.00 32.93  ? 695  TYR A  CA  1 
ATOM   5063  C C   . TYR A  1 695  ? 207.375 231.041 213.282 1.00 32.79  ? 695  TYR A  C   1 
ATOM   5064  O O   . TYR A  1 695  ? 206.885 230.036 212.764 1.00 43.48  ? 695  TYR A  O   1 
ATOM   5065  C CB  . TYR A  1 695  ? 205.948 232.954 214.002 1.00 35.25  ? 695  TYR A  CB  1 
ATOM   5066  C CG  . TYR A  1 695  ? 204.629 232.223 214.041 1.00 29.89  ? 695  TYR A  CG  1 
ATOM   5067  C CD1 . TYR A  1 695  ? 204.483 231.055 214.768 1.00 31.03  ? 695  TYR A  CD1 1 
ATOM   5068  C CD2 . TYR A  1 695  ? 203.533 232.697 213.344 1.00 34.41  ? 695  TYR A  CD2 1 
ATOM   5069  C CE1 . TYR A  1 695  ? 203.283 230.384 214.800 1.00 36.83  ? 695  TYR A  CE1 1 
ATOM   5070  C CE2 . TYR A  1 695  ? 202.331 232.033 213.372 1.00 35.20  ? 695  TYR A  CE2 1 
ATOM   5071  C CZ  . TYR A  1 695  ? 202.211 230.877 214.101 1.00 35.48  ? 695  TYR A  CZ  1 
ATOM   5072  O OH  . TYR A  1 695  ? 201.010 230.209 214.131 1.00 43.55  ? 695  TYR A  OH  1 
ATOM   5073  N N   . THR A  1 696  ? 208.349 230.998 214.186 1.00 25.16  ? 696  THR A  N   1 
ATOM   5074  C CA  . THR A  1 696  ? 208.775 229.739 214.782 1.00 23.30  ? 696  THR A  CA  1 
ATOM   5075  C C   . THR A  1 696  ? 207.770 229.324 215.850 1.00 29.38  ? 696  THR A  C   1 
ATOM   5076  O O   . THR A  1 696  ? 207.528 230.068 216.806 1.00 43.71  ? 696  THR A  O   1 
ATOM   5077  C CB  . THR A  1 696  ? 210.171 229.885 215.379 1.00 25.37  ? 696  THR A  CB  1 
ATOM   5078  O OG1 . THR A  1 696  ? 211.071 230.370 214.376 1.00 30.12  ? 696  THR A  OG1 1 
ATOM   5079  C CG2 . THR A  1 696  ? 210.678 228.552 215.896 1.00 38.27  ? 696  THR A  CG2 1 
ATOM   5080  N N   . MET A  1 697  ? 207.192 228.137 215.693 1.00 32.68  ? 697  MET A  N   1 
ATOM   5081  C CA  . MET A  1 697  ? 206.105 227.712 216.564 1.00 37.79  ? 697  MET A  CA  1 
ATOM   5082  C C   . MET A  1 697  ? 206.576 227.586 218.007 1.00 42.06  ? 697  MET A  C   1 
ATOM   5083  O O   . MET A  1 697  ? 207.721 227.220 218.285 1.00 37.82  ? 697  MET A  O   1 
ATOM   5084  C CB  . MET A  1 697  ? 205.539 226.373 216.091 1.00 43.57  ? 697  MET A  CB  1 
ATOM   5085  C CG  . MET A  1 697  ? 206.559 225.248 216.062 1.00 37.85  ? 697  MET A  CG  1 
ATOM   5086  S SD  . MET A  1 697  ? 205.864 223.677 215.520 1.00 69.28  ? 697  MET A  SD  1 
ATOM   5087  C CE  . MET A  1 697  ? 204.964 223.171 216.983 1.00 52.14  ? 697  MET A  CE  1 
ATOM   5088  N N   . SER A  1 698  ? 205.673 227.902 218.930 1.00 46.30  ? 698  SER A  N   1 
ATOM   5089  C CA  . SER A  1 698  ? 205.932 227.707 220.348 1.00 39.87  ? 698  SER A  CA  1 
ATOM   5090  C C   . SER A  1 698  ? 205.545 226.294 220.760 1.00 36.35  ? 698  SER A  C   1 
ATOM   5091  O O   . SER A  1 698  ? 204.499 225.778 220.357 1.00 35.34  ? 698  SER A  O   1 
ATOM   5092  C CB  . SER A  1 698  ? 205.146 228.715 221.182 1.00 45.04  ? 698  SER A  CB  1 
ATOM   5093  O OG  . SER A  1 698  ? 203.756 228.463 221.089 1.00 52.12  ? 698  SER A  OG  1 
ATOM   5094  N N   . LEU A  1 699  ? 206.397 225.671 221.573 1.00 34.57  ? 699  LEU A  N   1 
ATOM   5095  C CA  . LEU A  1 699  ? 206.085 224.346 222.093 1.00 25.36  ? 699  LEU A  CA  1 
ATOM   5096  C C   . LEU A  1 699  ? 205.174 224.435 223.309 1.00 35.82  ? 699  LEU A  C   1 
ATOM   5097  O O   . LEU A  1 699  ? 204.294 223.588 223.495 1.00 40.58  ? 699  LEU A  O   1 
ATOM   5098  C CB  . LEU A  1 699  ? 207.376 223.612 222.451 1.00 31.04  ? 699  LEU A  CB  1 
ATOM   5099  C CG  . LEU A  1 699  ? 208.477 223.668 221.392 1.00 23.65  ? 699  LEU A  CG  1 
ATOM   5100  C CD1 . LEU A  1 699  ? 209.723 222.944 221.869 1.00 24.89  ? 699  LEU A  CD1 1 
ATOM   5101  C CD2 . LEU A  1 699  ? 207.993 223.087 220.079 1.00 24.86  ? 699  LEU A  CD2 1 
ATOM   5102  N N   . GLY A  1 700  ? 205.371 225.450 224.140 1.00 42.91  ? 700  GLY A  N   1 
ATOM   5103  C CA  . GLY A  1 700  ? 204.531 225.645 225.301 1.00 37.18  ? 700  GLY A  CA  1 
ATOM   5104  C C   . GLY A  1 700  ? 205.156 226.666 226.228 1.00 47.22  ? 700  GLY A  C   1 
ATOM   5105  O O   . GLY A  1 700  ? 206.153 227.309 225.892 1.00 43.80  ? 700  GLY A  O   1 
ATOM   5106  N N   . ALA A  1 701  ? 204.548 226.802 227.401 1.00 49.27  ? 701  ALA A  N   1 
ATOM   5107  C CA  . ALA A  1 701  ? 205.113 227.657 228.432 1.00 39.71  ? 701  ALA A  CA  1 
ATOM   5108  C C   . ALA A  1 701  ? 206.347 227.003 229.043 1.00 44.61  ? 701  ALA A  C   1 
ATOM   5109  O O   . ALA A  1 701  ? 206.409 225.783 229.217 1.00 49.70  ? 701  ALA A  O   1 
ATOM   5110  C CB  . ALA A  1 701  ? 204.073 227.940 229.514 1.00 32.38  ? 701  ALA A  CB  1 
ATOM   5111  N N   . GLU A  1 702  ? 207.338 227.828 229.369 1.00 33.45  ? 702  GLU A  N   1 
ATOM   5112  C CA  . GLU A  1 702  ? 208.576 227.363 229.980 1.00 40.75  ? 702  GLU A  CA  1 
ATOM   5113  C C   . GLU A  1 702  ? 208.481 227.555 231.488 1.00 45.08  ? 702  GLU A  C   1 
ATOM   5114  O O   . GLU A  1 702  ? 208.085 228.628 231.956 1.00 52.07  ? 702  GLU A  O   1 
ATOM   5115  C CB  . GLU A  1 702  ? 209.782 228.112 229.412 1.00 44.25  ? 702  GLU A  CB  1 
ATOM   5116  C CG  . GLU A  1 702  ? 211.123 227.493 229.783 1.00 63.03  ? 702  GLU A  CG  1 
ATOM   5117  C CD  . GLU A  1 702  ? 212.257 227.975 228.898 1.00 72.72  ? 702  GLU A  CD  1 
ATOM   5118  O OE1 . GLU A  1 702  ? 212.047 228.100 227.673 1.00 71.30  ? 702  GLU A  OE1 1 
ATOM   5119  O OE2 . GLU A  1 702  ? 213.358 228.234 229.430 1.00 54.34  ? 702  GLU A  OE2 1 
ATOM   5120  N N   . ASN A  1 703  ? 208.848 226.517 232.242 1.00 49.29  ? 703  ASN A  N   1 
ATOM   5121  C CA  . ASN A  1 703  ? 208.478 226.429 233.655 1.00 48.16  ? 703  ASN A  CA  1 
ATOM   5122  C C   . ASN A  1 703  ? 209.581 225.694 234.413 1.00 49.92  ? 703  ASN A  C   1 
ATOM   5123  O O   . ASN A  1 703  ? 209.685 224.469 234.323 1.00 46.14  ? 703  ASN A  O   1 
ATOM   5124  C CB  . ASN A  1 703  ? 207.141 225.717 233.803 1.00 42.61  ? 703  ASN A  CB  1 
ATOM   5125  C CG  . ASN A  1 703  ? 206.601 225.775 235.211 1.00 46.17  ? 703  ASN A  CG  1 
ATOM   5126  O OD1 . ASN A  1 703  ? 207.356 225.732 236.181 1.00 51.77  ? 703  ASN A  OD1 1 
ATOM   5127  N ND2 . ASN A  1 703  ? 205.284 225.870 235.334 1.00 35.66  ? 703  ASN A  ND2 1 
ATOM   5128  N N   . SER A  1 704  ? 210.390 226.439 235.163 1.00 58.95  ? 704  SER A  N   1 
ATOM   5129  C CA  . SER A  1 704  ? 211.374 225.821 236.044 1.00 52.91  ? 704  SER A  CA  1 
ATOM   5130  C C   . SER A  1 704  ? 210.689 225.299 237.304 1.00 52.79  ? 704  SER A  C   1 
ATOM   5131  O O   . SER A  1 704  ? 210.054 226.065 238.036 1.00 52.51  ? 704  SER A  O   1 
ATOM   5132  C CB  . SER A  1 704  ? 212.468 226.821 236.407 1.00 45.03  ? 704  SER A  CB  1 
ATOM   5133  O OG  . SER A  1 704  ? 213.483 226.196 237.173 1.00 47.16  ? 704  SER A  OG  1 
ATOM   5134  N N   . VAL A  1 705  ? 210.814 223.994 237.553 1.00 49.67  ? 705  VAL A  N   1 
ATOM   5135  C CA  . VAL A  1 705  ? 210.227 223.388 238.743 1.00 45.66  ? 705  VAL A  CA  1 
ATOM   5136  C C   . VAL A  1 705  ? 211.014 223.801 239.982 1.00 38.59  ? 705  VAL A  C   1 
ATOM   5137  O O   . VAL A  1 705  ? 212.205 224.132 239.906 1.00 45.51  ? 705  VAL A  O   1 
ATOM   5138  C CB  . VAL A  1 705  ? 210.175 221.858 238.591 1.00 39.88  ? 705  VAL A  CB  1 
ATOM   5139  C CG1 . VAL A  1 705  ? 209.538 221.222 239.816 1.00 26.29  ? 705  VAL A  CG1 1 
ATOM   5140  C CG2 . VAL A  1 705  ? 209.405 221.474 237.333 1.00 35.80  ? 705  VAL A  CG2 1 
ATOM   5141  N N   . ALA A  1 706  ? 210.345 223.778 241.137 1.00 29.28  ? 706  ALA A  N   1 
ATOM   5142  C CA  . ALA A  1 706  ? 210.862 224.338 242.385 1.00 24.17  ? 706  ALA A  CA  1 
ATOM   5143  C C   . ALA A  1 706  ? 211.735 223.363 243.169 1.00 26.06  ? 706  ALA A  C   1 
ATOM   5144  O O   . ALA A  1 706  ? 211.873 223.493 244.388 1.00 31.26  ? 706  ALA A  O   1 
ATOM   5145  C CB  . ALA A  1 706  ? 209.699 224.800 243.264 1.00 30.99  ? 706  ALA A  CB  1 
ATOM   5146  N N   . TYR A  1 707  ? 212.331 222.396 242.481 1.00 31.45  ? 707  TYR A  N   1 
ATOM   5147  C CA  . TYR A  1 707  ? 212.927 221.237 243.135 1.00 28.73  ? 707  TYR A  CA  1 
ATOM   5148  C C   . TYR A  1 707  ? 214.026 221.610 244.127 1.00 35.14  ? 707  TYR A  C   1 
ATOM   5149  O O   . TYR A  1 707  ? 214.867 222.470 243.857 1.00 35.00  ? 707  TYR A  O   1 
ATOM   5150  C CB  . TYR A  1 707  ? 213.499 220.304 242.073 1.00 28.70  ? 707  TYR A  CB  1 
ATOM   5151  C CG  . TYR A  1 707  ? 214.267 219.142 242.639 1.00 33.31  ? 707  TYR A  CG  1 
ATOM   5152  C CD1 . TYR A  1 707  ? 213.619 217.976 243.001 1.00 31.91  ? 707  TYR A  CD1 1 
ATOM   5153  C CD2 . TYR A  1 707  ? 215.638 219.208 242.810 1.00 36.54  ? 707  TYR A  CD2 1 
ATOM   5154  C CE1 . TYR A  1 707  ? 214.311 216.913 243.519 1.00 27.60  ? 707  TYR A  CE1 1 
ATOM   5155  C CE2 . TYR A  1 707  ? 216.338 218.147 243.328 1.00 30.56  ? 707  TYR A  CE2 1 
ATOM   5156  C CZ  . TYR A  1 707  ? 215.669 217.001 243.681 1.00 22.15  ? 707  TYR A  CZ  1 
ATOM   5157  O OH  . TYR A  1 707  ? 216.362 215.936 244.199 1.00 27.45  ? 707  TYR A  OH  1 
ATOM   5158  N N   . SER A  1 708  ? 213.929 220.978 245.294 1.00 33.23  ? 708  SER A  N   1 
ATOM   5159  C CA  . SER A  1 708  ? 214.852 221.126 246.404 1.00 31.42  ? 708  SER A  CA  1 
ATOM   5160  C C   . SER A  1 708  ? 215.001 219.730 247.003 1.00 32.46  ? 708  SER A  C   1 
ATOM   5161  O O   . SER A  1 708  ? 214.082 218.913 246.927 1.00 38.72  ? 708  SER A  O   1 
ATOM   5162  C CB  . SER A  1 708  ? 214.298 222.098 247.444 1.00 44.08  ? 708  SER A  CB  1 
ATOM   5163  O OG  . SER A  1 708  ? 215.336 222.637 248.243 1.00 54.84  ? 708  SER A  OG  1 
ATOM   5164  N N   . ASN A  1 709  ? 216.151 219.457 247.603 1.00 27.13  ? 709  ASN A  N   1 
ATOM   5165  C CA  . ASN A  1 709  ? 216.417 218.140 248.172 1.00 30.54  ? 709  ASN A  CA  1 
ATOM   5166  C C   . ASN A  1 709  ? 215.537 217.820 249.378 1.00 32.62  ? 709  ASN A  C   1 
ATOM   5167  O O   . ASN A  1 709  ? 215.521 216.664 249.817 1.00 43.17  ? 709  ASN A  O   1 
ATOM   5168  C CB  . ASN A  1 709  ? 217.901 218.006 248.541 1.00 42.56  ? 709  ASN A  CB  1 
ATOM   5169  C CG  . ASN A  1 709  ? 218.351 219.013 249.583 1.00 53.17  ? 709  ASN A  CG  1 
ATOM   5170  O OD1 . ASN A  1 709  ? 217.585 219.869 250.024 1.00 62.86  ? 709  ASN A  OD1 1 
ATOM   5171  N ND2 . ASN A  1 709  ? 219.613 218.905 249.985 1.00 53.13  ? 709  ASN A  ND2 1 
ATOM   5172  N N   . ASN A  1 710  ? 214.822 218.814 249.899 1.00 38.92  ? 710  ASN A  N   1 
ATOM   5173  C CA  . ASN A  1 710  ? 213.957 218.605 251.059 1.00 26.65  ? 710  ASN A  CA  1 
ATOM   5174  C C   . ASN A  1 710  ? 212.628 219.357 250.982 1.00 25.86  ? 710  ASN A  C   1 
ATOM   5175  O O   . ASN A  1 710  ? 212.034 219.692 252.007 1.00 32.60  ? 710  ASN A  O   1 
ATOM   5176  C CB  . ASN A  1 710  ? 214.694 218.974 252.349 1.00 36.79  ? 710  ASN A  CB  1 
ATOM   5177  C CG  . ASN A  1 710  ? 215.093 220.436 252.395 1.00 34.76  ? 710  ASN A  CG  1 
ATOM   5178  O OD1 . ASN A  1 710  ? 214.821 221.195 251.466 1.00 39.06  ? 710  ASN A  OD1 1 
ATOM   5179  N ND2 . ASN A  1 710  ? 215.741 220.838 253.482 1.00 39.22  ? 710  ASN A  ND2 1 
ATOM   5180  N N   . SER A  1 711  ? 212.168 219.619 249.763 1.00 25.36  ? 711  SER A  N   1 
ATOM   5181  C CA  . SER A  1 711  ? 210.908 220.319 249.542 1.00 16.65  ? 711  SER A  CA  1 
ATOM   5182  C C   . SER A  1 711  ? 209.949 219.426 248.773 1.00 19.30  ? 711  SER A  C   1 
ATOM   5183  O O   . SER A  1 711  ? 210.339 218.803 247.782 1.00 25.20  ? 711  SER A  O   1 
ATOM   5184  C CB  . SER A  1 711  ? 211.133 221.622 248.769 1.00 32.22  ? 711  SER A  CB  1 
ATOM   5185  O OG  . SER A  1 711  ? 209.911 222.305 248.550 1.00 31.41  ? 711  SER A  OG  1 
ATOM   5186  N N   . ILE A  1 712  ? 208.699 219.371 249.227 1.00 17.07  ? 712  ILE A  N   1 
ATOM   5187  C CA  . ILE A  1 712  ? 207.656 218.599 248.568 1.00 10.49  ? 712  ILE A  CA  1 
ATOM   5188  C C   . ILE A  1 712  ? 206.390 219.436 248.496 1.00 19.98  ? 712  ILE A  C   1 
ATOM   5189  O O   . ILE A  1 712  ? 206.069 220.192 249.417 1.00 23.00  ? 712  ILE A  O   1 
ATOM   5190  C CB  . ILE A  1 712  ? 207.378 217.270 249.297 1.00 16.42  ? 712  ILE A  CB  1 
ATOM   5191  C CG1 . ILE A  1 712  ? 206.550 216.343 248.410 1.00 18.42  ? 712  ILE A  CG1 1 
ATOM   5192  C CG2 . ILE A  1 712  ? 206.647 217.526 250.599 1.00 16.89  ? 712  ILE A  CG2 1 
ATOM   5193  C CD1 . ILE A  1 712  ? 206.395 214.955 248.971 1.00 20.34  ? 712  ILE A  CD1 1 
ATOM   5194  N N   . ALA A  1 713  ? 205.667 219.295 247.388 1.00 17.00  ? 713  ALA A  N   1 
ATOM   5195  C CA  . ALA A  1 713  ? 204.381 219.946 247.188 1.00 14.79  ? 713  ALA A  CA  1 
ATOM   5196  C C   . ALA A  1 713  ? 203.282 218.895 247.221 1.00 17.86  ? 713  ALA A  C   1 
ATOM   5197  O O   . ALA A  1 713  ? 203.402 217.852 246.572 1.00 22.31  ? 713  ALA A  O   1 
ATOM   5198  C CB  . ALA A  1 713  ? 204.351 220.704 245.862 1.00 17.86  ? 713  ALA A  CB  1 
ATOM   5199  N N   . ILE A  1 714  ? 202.220 219.168 247.972 1.00 21.49  ? 714  ILE A  N   1 
ATOM   5200  C CA  . ILE A  1 714  ? 201.130 218.210 248.132 1.00 21.94  ? 714  ILE A  CA  1 
ATOM   5201  C C   . ILE A  1 714  ? 199.803 218.924 247.900 1.00 21.83  ? 714  ILE A  C   1 
ATOM   5202  O O   . ILE A  1 714  ? 199.570 219.991 248.482 1.00 31.05  ? 714  ILE A  O   1 
ATOM   5203  C CB  . ILE A  1 714  ? 201.177 217.549 249.519 1.00 23.47  ? 714  ILE A  CB  1 
ATOM   5204  C CG1 . ILE A  1 714  ? 202.542 216.897 249.739 1.00 26.67  ? 714  ILE A  CG1 1 
ATOM   5205  C CG2 . ILE A  1 714  ? 200.077 216.510 249.655 1.00 25.34  ? 714  ILE A  CG2 1 
ATOM   5206  C CD1 . ILE A  1 714  ? 202.640 216.102 251.008 1.00 32.99  ? 714  ILE A  CD1 1 
ATOM   5207  N N   . PRO A  1 715  ? 198.905 218.381 247.077 1.00 14.89  ? 715  PRO A  N   1 
ATOM   5208  C CA  . PRO A  1 715  ? 197.644 219.078 246.780 1.00 23.63  ? 715  PRO A  CA  1 
ATOM   5209  C C   . PRO A  1 715  ? 196.719 219.114 247.986 1.00 23.39  ? 715  PRO A  C   1 
ATOM   5210  O O   . PRO A  1 715  ? 196.501 218.100 248.650 1.00 24.76  ? 715  PRO A  O   1 
ATOM   5211  C CB  . PRO A  1 715  ? 197.048 218.253 245.638 1.00 45.43  ? 715  PRO A  CB  1 
ATOM   5212  C CG  . PRO A  1 715  ? 197.598 216.898 245.849 1.00 24.09  ? 715  PRO A  CG  1 
ATOM   5213  C CD  . PRO A  1 715  ? 198.984 217.090 246.375 1.00 22.21  ? 715  PRO A  CD  1 
ATOM   5214  N N   . THR A  1 716  ? 196.185 220.298 248.269 1.00 26.00  ? 716  THR A  N   1 
ATOM   5215  C CA  . THR A  1 716  ? 195.203 220.482 249.329 1.00 33.28  ? 716  THR A  CA  1 
ATOM   5216  C C   . THR A  1 716  ? 193.768 220.301 248.852 1.00 34.75  ? 716  THR A  C   1 
ATOM   5217  O O   . THR A  1 716  ? 192.854 220.306 249.681 1.00 50.01  ? 716  THR A  O   1 
ATOM   5218  C CB  . THR A  1 716  ? 195.363 221.874 249.943 1.00 43.79  ? 716  THR A  CB  1 
ATOM   5219  O OG1 . THR A  1 716  ? 195.044 222.870 248.965 1.00 45.37  ? 716  THR A  OG1 1 
ATOM   5220  C CG2 . THR A  1 716  ? 196.787 222.084 250.416 1.00 30.21  ? 716  THR A  CG2 1 
ATOM   5221  N N   . ASN A  1 717  ? 193.548 220.128 247.553 1.00 30.96  ? 717  ASN A  N   1 
ATOM   5222  C CA  . ASN A  1 717  ? 192.208 220.149 246.982 1.00 21.81  ? 717  ASN A  CA  1 
ATOM   5223  C C   . ASN A  1 717  ? 192.233 219.294 245.722 1.00 24.36  ? 717  ASN A  C   1 
ATOM   5224  O O   . ASN A  1 717  ? 193.264 218.720 245.365 1.00 23.99  ? 717  ASN A  O   1 
ATOM   5225  C CB  . ASN A  1 717  ? 191.771 221.588 246.694 1.00 38.21  ? 717  ASN A  CB  1 
ATOM   5226  C CG  . ASN A  1 717  ? 190.273 221.733 246.534 1.00 41.09  ? 717  ASN A  CG  1 
ATOM   5227  O OD1 . ASN A  1 717  ? 189.499 220.885 246.977 1.00 37.30  ? 717  ASN A  OD1 1 
ATOM   5228  N ND2 . ASN A  1 717  ? 189.855 222.819 245.895 1.00 39.96  ? 717  ASN A  ND2 1 
ATOM   5229  N N   . PHE A  1 718  ? 191.086 219.197 245.055 1.00 37.53  ? 718  PHE A  N   1 
ATOM   5230  C CA  . PHE A  1 718  ? 190.973 218.406 243.840 1.00 24.65  ? 718  PHE A  CA  1 
ATOM   5231  C C   . PHE A  1 718  ? 189.970 219.043 242.893 1.00 35.10  ? 718  PHE A  C   1 
ATOM   5232  O O   . PHE A  1 718  ? 189.078 219.782 243.315 1.00 41.44  ? 718  PHE A  O   1 
ATOM   5233  C CB  . PHE A  1 718  ? 190.544 216.969 244.143 1.00 14.50  ? 718  PHE A  CB  1 
ATOM   5234  C CG  . PHE A  1 718  ? 189.467 216.865 245.179 1.00 25.74  ? 718  PHE A  CG  1 
ATOM   5235  C CD1 . PHE A  1 718  ? 188.177 217.275 244.904 1.00 33.70  ? 718  PHE A  CD1 1 
ATOM   5236  C CD2 . PHE A  1 718  ? 189.746 216.349 246.430 1.00 36.76  ? 718  PHE A  CD2 1 
ATOM   5237  C CE1 . PHE A  1 718  ? 187.190 217.179 245.860 1.00 39.01  ? 718  PHE A  CE1 1 
ATOM   5238  C CE2 . PHE A  1 718  ? 188.765 216.251 247.387 1.00 37.40  ? 718  PHE A  CE2 1 
ATOM   5239  C CZ  . PHE A  1 718  ? 187.485 216.665 247.102 1.00 41.94  ? 718  PHE A  CZ  1 
ATOM   5240  N N   . THR A  1 719  ? 190.133 218.751 241.606 1.00 25.43  ? 719  THR A  N   1 
ATOM   5241  C CA  . THR A  1 719  ? 189.158 219.100 240.582 1.00 27.72  ? 719  THR A  CA  1 
ATOM   5242  C C   . THR A  1 719  ? 188.730 217.822 239.880 1.00 26.01  ? 719  THR A  C   1 
ATOM   5243  O O   . THR A  1 719  ? 189.565 217.126 239.296 1.00 26.98  ? 719  THR A  O   1 
ATOM   5244  C CB  . THR A  1 719  ? 189.733 220.093 239.569 1.00 31.03  ? 719  THR A  CB  1 
ATOM   5245  O OG1 . THR A  1 719  ? 191.071 219.714 239.230 1.00 35.47  ? 719  THR A  OG1 1 
ATOM   5246  C CG2 . THR A  1 719  ? 189.732 221.503 240.129 1.00 42.18  ? 719  THR A  CG2 1 
ATOM   5247  N N   . ILE A  1 720  ? 187.440 217.506 239.951 1.00 31.72  ? 720  ILE A  N   1 
ATOM   5248  C CA  . ILE A  1 720  ? 186.893 216.449 239.114 1.00 17.70  ? 720  ILE A  CA  1 
ATOM   5249  C C   . ILE A  1 720  ? 186.692 217.005 237.713 1.00 31.36  ? 720  ILE A  C   1 
ATOM   5250  O O   . ILE A  1 720  ? 185.975 217.995 237.517 1.00 35.46  ? 720  ILE A  O   1 
ATOM   5251  C CB  . ILE A  1 720  ? 185.581 215.915 239.706 1.00 14.09  ? 720  ILE A  CB  1 
ATOM   5252  C CG1 . ILE A  1 720  ? 185.828 215.309 241.090 1.00 24.53  ? 720  ILE A  CG1 1 
ATOM   5253  C CG2 . ILE A  1 720  ? 184.954 214.891 238.780 1.00 16.67  ? 720  ILE A  CG2 1 
ATOM   5254  C CD1 . ILE A  1 720  ? 186.767 214.119 241.104 1.00 24.05  ? 720  ILE A  CD1 1 
ATOM   5255  N N   . SER A  1 721  ? 187.331 216.378 236.731 1.00 27.90  ? 721  SER A  N   1 
ATOM   5256  C CA  . SER A  1 721  ? 187.351 216.883 235.367 1.00 15.21  ? 721  SER A  CA  1 
ATOM   5257  C C   . SER A  1 721  ? 186.926 215.775 234.422 1.00 17.47  ? 721  SER A  C   1 
ATOM   5258  O O   . SER A  1 721  ? 187.499 214.682 234.444 1.00 18.95  ? 721  SER A  O   1 
ATOM   5259  C CB  . SER A  1 721  ? 188.745 217.397 234.992 1.00 12.26  ? 721  SER A  CB  1 
ATOM   5260  O OG  . SER A  1 721  ? 188.784 217.842 233.649 1.00 23.75  ? 721  SER A  OG  1 
ATOM   5261  N N   . VAL A  1 722  ? 185.923 216.058 233.599 1.00 18.53  ? 722  VAL A  N   1 
ATOM   5262  C CA  . VAL A  1 722  ? 185.425 215.112 232.611 1.00 10.28  ? 722  VAL A  CA  1 
ATOM   5263  C C   . VAL A  1 722  ? 185.937 215.536 231.244 1.00 9.87   ? 722  VAL A  C   1 
ATOM   5264  O O   . VAL A  1 722  ? 185.794 216.701 230.854 1.00 10.13  ? 722  VAL A  O   1 
ATOM   5265  C CB  . VAL A  1 722  ? 183.891 215.041 232.628 1.00 10.12  ? 722  VAL A  CB  1 
ATOM   5266  C CG1 . VAL A  1 722  ? 183.402 214.011 231.633 1.00 11.69  ? 722  VAL A  CG1 1 
ATOM   5267  C CG2 . VAL A  1 722  ? 183.395 214.715 234.024 1.00 11.82  ? 722  VAL A  CG2 1 
ATOM   5268  N N   . THR A  1 723  ? 186.541 214.598 230.521 1.00 10.39  ? 723  THR A  N   1 
ATOM   5269  C CA  . THR A  1 723  ? 187.092 214.855 229.201 1.00 7.88   ? 723  THR A  CA  1 
ATOM   5270  C C   . THR A  1 723  ? 186.511 213.860 228.212 1.00 9.36   ? 723  THR A  C   1 
ATOM   5271  O O   . THR A  1 723  ? 186.306 212.690 228.541 1.00 15.11  ? 723  THR A  O   1 
ATOM   5272  C CB  . THR A  1 723  ? 188.620 214.753 229.198 1.00 9.01   ? 723  THR A  CB  1 
ATOM   5273  O OG1 . THR A  1 723  ? 189.016 213.448 229.636 1.00 20.73  ? 723  THR A  OG1 1 
ATOM   5274  C CG2 . THR A  1 723  ? 189.227 215.796 230.115 1.00 16.56  ? 723  THR A  CG2 1 
ATOM   5275  N N   . THR A  1 724  ? 186.258 214.333 226.998 1.00 9.64   ? 724  THR A  N   1 
ATOM   5276  C CA  . THR A  1 724  ? 185.628 213.538 225.953 1.00 11.69  ? 724  THR A  CA  1 
ATOM   5277  C C   . THR A  1 724  ? 186.679 213.073 224.953 1.00 21.10  ? 724  THR A  C   1 
ATOM   5278  O O   . THR A  1 724  ? 187.460 213.883 224.445 1.00 24.20  ? 724  THR A  O   1 
ATOM   5279  C CB  . THR A  1 724  ? 184.538 214.344 225.243 1.00 27.69  ? 724  THR A  CB  1 
ATOM   5280  O OG1 . THR A  1 724  ? 184.092 213.638 224.080 1.00 47.41  ? 724  THR A  OG1 1 
ATOM   5281  C CG2 . THR A  1 724  ? 185.050 215.718 224.836 1.00 28.76  ? 724  THR A  CG2 1 
ATOM   5282  N N   . GLU A  1 725  ? 186.701 211.771 224.684 1.00 16.35  ? 725  GLU A  N   1 
ATOM   5283  C CA  . GLU A  1 725  ? 187.621 211.168 223.728 1.00 14.92  ? 725  GLU A  CA  1 
ATOM   5284  C C   . GLU A  1 725  ? 186.825 210.453 222.643 1.00 19.57  ? 725  GLU A  C   1 
ATOM   5285  O O   . GLU A  1 725  ? 185.989 209.599 222.949 1.00 22.02  ? 725  GLU A  O   1 
ATOM   5286  C CB  . GLU A  1 725  ? 188.567 210.197 224.428 1.00 11.65  ? 725  GLU A  CB  1 
ATOM   5287  C CG  . GLU A  1 725  ? 189.209 209.198 223.499 1.00 14.43  ? 725  GLU A  CG  1 
ATOM   5288  C CD  . GLU A  1 725  ? 190.410 208.533 224.114 1.00 22.16  ? 725  GLU A  CD  1 
ATOM   5289  O OE1 . GLU A  1 725  ? 191.369 208.236 223.371 1.00 22.62  ? 725  GLU A  OE1 1 
ATOM   5290  O OE2 . GLU A  1 725  ? 190.404 208.310 225.343 1.00 14.35  ? 725  GLU A  OE2 1 
ATOM   5291  N N   . ILE A  1 726  ? 187.105 210.784 221.385 1.00 19.41  ? 726  ILE A  N   1 
ATOM   5292  C CA  . ILE A  1 726  ? 186.352 210.285 220.239 1.00 17.08  ? 726  ILE A  CA  1 
ATOM   5293  C C   . ILE A  1 726  ? 187.229 209.317 219.458 1.00 21.73  ? 726  ILE A  C   1 
ATOM   5294  O O   . ILE A  1 726  ? 188.376 209.638 219.127 1.00 24.00  ? 726  ILE A  O   1 
ATOM   5295  C CB  . ILE A  1 726  ? 185.874 211.440 219.343 1.00 17.21  ? 726  ILE A  CB  1 
ATOM   5296  C CG1 . ILE A  1 726  ? 185.060 212.441 220.162 1.00 19.81  ? 726  ILE A  CG1 1 
ATOM   5297  C CG2 . ILE A  1 726  ? 185.049 210.910 218.193 1.00 19.13  ? 726  ILE A  CG2 1 
ATOM   5298  C CD1 . ILE A  1 726  ? 185.796 213.721 220.463 1.00 27.47  ? 726  ILE A  CD1 1 
ATOM   5299  N N   . LEU A  1 727  ? 186.691 208.132 219.165 1.00 21.48  ? 727  LEU A  N   1 
ATOM   5300  C CA  . LEU A  1 727  ? 187.425 207.093 218.455 1.00 17.50  ? 727  LEU A  CA  1 
ATOM   5301  C C   . LEU A  1 727  ? 186.584 206.542 217.310 1.00 15.99  ? 727  LEU A  C   1 
ATOM   5302  O O   . LEU A  1 727  ? 185.439 206.121 217.536 1.00 25.05  ? 727  LEU A  O   1 
ATOM   5303  C CB  . LEU A  1 727  ? 187.810 205.954 219.408 1.00 16.56  ? 727  LEU A  CB  1 
ATOM   5304  C CG  . LEU A  1 727  ? 188.910 206.227 220.430 1.00 12.80  ? 727  LEU A  CG  1 
ATOM   5305  C CD1 . LEU A  1 727  ? 189.165 204.984 221.254 1.00 9.28   ? 727  LEU A  CD1 1 
ATOM   5306  C CD2 . LEU A  1 727  ? 190.182 206.683 219.745 1.00 26.10  ? 727  LEU A  CD2 1 
ATOM   5307  N N   . PRO A  1 728  ? 187.098 206.520 216.078 1.00 16.54  ? 728  PRO A  N   1 
ATOM   5308  C CA  . PRO A  1 728  ? 186.416 205.768 215.019 1.00 18.66  ? 728  PRO A  CA  1 
ATOM   5309  C C   . PRO A  1 728  ? 186.336 204.291 215.368 1.00 18.28  ? 728  PRO A  C   1 
ATOM   5310  O O   . PRO A  1 728  ? 187.293 203.705 215.877 1.00 41.21  ? 728  PRO A  O   1 
ATOM   5311  C CB  . PRO A  1 728  ? 187.295 206.010 213.789 1.00 13.00  ? 728  PRO A  CB  1 
ATOM   5312  C CG  . PRO A  1 728  ? 188.009 207.267 214.077 1.00 13.91  ? 728  PRO A  CG  1 
ATOM   5313  C CD  . PRO A  1 728  ? 188.237 207.286 215.551 1.00 16.07  ? 728  PRO A  CD  1 
ATOM   5314  N N   . VAL A  1 729  ? 185.184 203.686 215.088 1.00 11.84  ? 729  VAL A  N   1 
ATOM   5315  C CA  . VAL A  1 729  ? 184.984 202.269 215.368 1.00 12.14  ? 729  VAL A  CA  1 
ATOM   5316  C C   . VAL A  1 729  ? 184.784 201.512 214.065 1.00 24.69  ? 729  VAL A  C   1 
ATOM   5317  O O   . VAL A  1 729  ? 185.306 200.406 213.891 1.00 37.17  ? 729  VAL A  O   1 
ATOM   5318  C CB  . VAL A  1 729  ? 183.791 202.041 216.311 1.00 11.69  ? 729  VAL A  CB  1 
ATOM   5319  C CG1 . VAL A  1 729  ? 183.452 200.567 216.375 1.00 19.96  ? 729  VAL A  CG1 1 
ATOM   5320  C CG2 . VAL A  1 729  ? 184.103 202.565 217.693 1.00 17.30  ? 729  VAL A  CG2 1 
ATOM   5321  N N   . SER A  1 730  ? 184.021 202.092 213.146 1.00 23.36  ? 730  SER A  N   1 
ATOM   5322  C CA  . SER A  1 730  ? 183.698 201.433 211.893 1.00 19.11  ? 730  SER A  CA  1 
ATOM   5323  C C   . SER A  1 730  ? 183.659 202.466 210.780 1.00 22.90  ? 730  SER A  C   1 
ATOM   5324  O O   . SER A  1 730  ? 183.669 203.675 211.020 1.00 28.55  ? 730  SER A  O   1 
ATOM   5325  C CB  . SER A  1 730  ? 182.359 200.693 211.979 1.00 30.18  ? 730  SER A  CB  1 
ATOM   5326  O OG  . SER A  1 730  ? 181.289 201.596 212.178 1.00 31.82  ? 730  SER A  OG  1 
ATOM   5327  N N   . MET A  1 731  ? 183.626 201.972 209.548 1.00 23.97  ? 731  MET A  N   1 
ATOM   5328  C CA  . MET A  1 731  ? 183.486 202.804 208.367 1.00 18.44  ? 731  MET A  CA  1 
ATOM   5329  C C   . MET A  1 731  ? 182.418 202.197 207.470 1.00 32.66  ? 731  MET A  C   1 
ATOM   5330  O O   . MET A  1 731  ? 182.017 201.043 207.638 1.00 36.33  ? 731  MET A  O   1 
ATOM   5331  C CB  . MET A  1 731  ? 184.816 202.937 207.618 1.00 23.63  ? 731  MET A  CB  1 
ATOM   5332  C CG  . MET A  1 731  ? 185.367 201.634 207.079 1.00 20.43  ? 731  MET A  CG  1 
ATOM   5333  S SD  . MET A  1 731  ? 186.869 201.903 206.129 1.00 11.63  ? 731  MET A  SD  1 
ATOM   5334  C CE  . MET A  1 731  ? 187.045 200.313 205.342 1.00 17.90  ? 731  MET A  CE  1 
ATOM   5335  N N   . THR A  1 732  ? 181.955 202.987 206.508 1.00 37.75  ? 732  THR A  N   1 
ATOM   5336  C CA  . THR A  1 732  ? 180.831 202.568 205.684 1.00 27.61  ? 732  THR A  CA  1 
ATOM   5337  C C   . THR A  1 732  ? 181.172 201.308 204.901 1.00 35.96  ? 732  THR A  C   1 
ATOM   5338  O O   . THR A  1 732  ? 182.224 201.222 204.261 1.00 40.82  ? 732  THR A  O   1 
ATOM   5339  C CB  . THR A  1 732  ? 180.436 203.681 204.719 1.00 33.30  ? 732  THR A  CB  1 
ATOM   5340  O OG1 . THR A  1 732  ? 181.513 203.929 203.809 1.00 50.19  ? 732  THR A  OG1 1 
ATOM   5341  C CG2 . THR A  1 732  ? 180.110 204.955 205.477 1.00 39.15  ? 732  THR A  CG2 1 
ATOM   5342  N N   . LYS A  1 733  ? 180.277 200.326 204.962 1.00 42.44  ? 733  LYS A  N   1 
ATOM   5343  C CA  . LYS A  1 733  ? 180.371 199.166 204.090 1.00 31.56  ? 733  LYS A  CA  1 
ATOM   5344  C C   . LYS A  1 733  ? 180.099 199.581 202.653 1.00 32.56  ? 733  LYS A  C   1 
ATOM   5345  O O   . LYS A  1 733  ? 179.191 200.375 202.391 1.00 33.46  ? 733  LYS A  O   1 
ATOM   5346  C CB  . LYS A  1 733  ? 179.360 198.103 204.498 1.00 28.40  ? 733  LYS A  CB  1 
ATOM   5347  C CG  . LYS A  1 733  ? 179.421 197.625 205.924 1.00 17.96  ? 733  LYS A  CG  1 
ATOM   5348  C CD  . LYS A  1 733  ? 178.203 196.765 206.188 1.00 15.60  ? 733  LYS A  CD  1 
ATOM   5349  C CE  . LYS A  1 733  ? 178.326 195.949 207.445 1.00 14.62  ? 733  LYS A  CE  1 
ATOM   5350  N NZ  . LYS A  1 733  ? 177.196 194.991 207.552 1.00 31.77  ? 733  LYS A  NZ  1 
ATOM   5351  N N   . THR A  1 734  ? 180.881 199.054 201.722 1.00 38.55  ? 734  THR A  N   1 
ATOM   5352  C CA  . THR A  1 734  ? 180.620 199.243 200.305 1.00 41.00  ? 734  THR A  CA  1 
ATOM   5353  C C   . THR A  1 734  ? 180.675 197.909 199.577 1.00 27.45  ? 734  THR A  C   1 
ATOM   5354  O O   . THR A  1 734  ? 181.412 196.998 199.962 1.00 26.55  ? 734  THR A  O   1 
ATOM   5355  C CB  . THR A  1 734  ? 181.620 200.215 199.677 1.00 35.38  ? 734  THR A  CB  1 
ATOM   5356  O OG1 . THR A  1 734  ? 182.953 199.819 200.016 1.00 33.64  ? 734  THR A  OG1 1 
ATOM   5357  C CG2 . THR A  1 734  ? 181.368 201.623 200.176 1.00 38.51  ? 734  THR A  CG2 1 
ATOM   5358  N N   . SER A  1 735  ? 179.876 197.806 198.521 1.00 31.65  ? 735  SER A  N   1 
ATOM   5359  C CA  . SER A  1 735  ? 179.910 196.669 197.615 1.00 28.41  ? 735  SER A  CA  1 
ATOM   5360  C C   . SER A  1 735  ? 179.797 197.197 196.197 1.00 27.12  ? 735  SER A  C   1 
ATOM   5361  O O   . SER A  1 735  ? 179.003 198.101 195.929 1.00 35.40  ? 735  SER A  O   1 
ATOM   5362  C CB  . SER A  1 735  ? 178.780 195.676 197.905 1.00 28.71  ? 735  SER A  CB  1 
ATOM   5363  O OG  . SER A  1 735  ? 178.843 194.563 197.032 1.00 30.20  ? 735  SER A  OG  1 
ATOM   5364  N N   . VAL A  1 736  ? 180.595 196.637 195.295 1.00 24.51  ? 736  VAL A  N   1 
ATOM   5365  C CA  . VAL A  1 736  ? 180.677 197.101 193.917 1.00 28.41  ? 736  VAL A  CA  1 
ATOM   5366  C C   . VAL A  1 736  ? 180.266 195.960 193.003 1.00 35.05  ? 736  VAL A  C   1 
ATOM   5367  O O   . VAL A  1 736  ? 180.807 194.853 193.102 1.00 41.64  ? 736  VAL A  O   1 
ATOM   5368  C CB  . VAL A  1 736  ? 182.086 197.596 193.564 1.00 20.83  ? 736  VAL A  CB  1 
ATOM   5369  C CG1 . VAL A  1 736  ? 182.154 197.989 192.103 1.00 19.57  ? 736  VAL A  CG1 1 
ATOM   5370  C CG2 . VAL A  1 736  ? 182.474 198.762 194.452 1.00 23.79  ? 736  VAL A  CG2 1 
ATOM   5371  N N   . ASP A  1 737  ? 179.302 196.225 192.124 1.00 25.53  ? 737  ASP A  N   1 
ATOM   5372  C CA  . ASP A  1 737  ? 179.031 195.319 191.020 1.00 24.88  ? 737  ASP A  CA  1 
ATOM   5373  C C   . ASP A  1 737  ? 180.105 195.523 189.961 1.00 32.03  ? 737  ASP A  C   1 
ATOM   5374  O O   . ASP A  1 737  ? 180.001 196.429 189.129 1.00 31.65  ? 737  ASP A  O   1 
ATOM   5375  C CB  . ASP A  1 737  ? 177.636 195.559 190.447 1.00 36.57  ? 737  ASP A  CB  1 
ATOM   5376  C CG  . ASP A  1 737  ? 177.206 194.470 189.492 1.00 43.45  ? 737  ASP A  CG  1 
ATOM   5377  O OD1 . ASP A  1 737  ? 178.034 194.028 188.671 1.00 50.68  ? 737  ASP A  OD1 1 
ATOM   5378  O OD2 . ASP A  1 737  ? 176.039 194.043 189.572 1.00 51.81  ? 737  ASP A  OD2 1 
ATOM   5379  N N   . CYS A  1 738  ? 181.146 194.690 189.996 1.00 41.79  ? 738  CYS A  N   1 
ATOM   5380  C CA  . CYS A  1 738  ? 182.310 194.901 189.142 1.00 30.88  ? 738  CYS A  CA  1 
ATOM   5381  C C   . CYS A  1 738  ? 181.903 195.078 187.686 1.00 28.61  ? 738  CYS A  C   1 
ATOM   5382  O O   . CYS A  1 738  ? 182.359 196.003 187.007 1.00 30.54  ? 738  CYS A  O   1 
ATOM   5383  C CB  . CYS A  1 738  ? 183.267 193.722 189.287 1.00 29.42  ? 738  CYS A  CB  1 
ATOM   5384  S SG  . CYS A  1 738  ? 184.894 193.949 188.553 1.00 69.08  ? 738  CYS A  SG  1 
ATOM   5385  N N   . THR A  1 739  ? 181.045 194.190 187.186 1.00 30.74  ? 739  THR A  N   1 
ATOM   5386  C CA  . THR A  1 739  ? 180.629 194.278 185.792 1.00 20.58  ? 739  THR A  CA  1 
ATOM   5387  C C   . THR A  1 739  ? 179.891 195.580 185.514 1.00 26.87  ? 739  THR A  C   1 
ATOM   5388  O O   . THR A  1 739  ? 180.114 196.218 184.480 1.00 38.31  ? 739  THR A  O   1 
ATOM   5389  C CB  . THR A  1 739  ? 179.749 193.085 185.429 1.00 22.25  ? 739  THR A  CB  1 
ATOM   5390  O OG1 . THR A  1 739  ? 180.436 191.867 185.740 1.00 23.75  ? 739  THR A  OG1 1 
ATOM   5391  C CG2 . THR A  1 739  ? 179.415 193.107 183.949 1.00 37.22  ? 739  THR A  CG2 1 
ATOM   5392  N N   . MET A  1 740  ? 179.007 195.992 186.423 1.00 22.51  ? 740  MET A  N   1 
ATOM   5393  C CA  . MET A  1 740  ? 178.185 197.168 186.161 1.00 20.22  ? 740  MET A  CA  1 
ATOM   5394  C C   . MET A  1 740  ? 179.007 198.445 186.185 1.00 19.48  ? 740  MET A  C   1 
ATOM   5395  O O   . MET A  1 740  ? 178.721 199.377 185.427 1.00 26.12  ? 740  MET A  O   1 
ATOM   5396  C CB  . MET A  1 740  ? 177.056 197.253 187.182 1.00 32.50  ? 740  MET A  CB  1 
ATOM   5397  C CG  . MET A  1 740  ? 175.975 198.248 186.814 1.00 37.47  ? 740  MET A  CG  1 
ATOM   5398  S SD  . MET A  1 740  ? 174.451 197.980 187.730 1.00 73.00  ? 740  MET A  SD  1 
ATOM   5399  C CE  . MET A  1 740  ? 173.979 196.357 187.131 1.00 64.31  ? 740  MET A  CE  1 
ATOM   5400  N N   . TYR A  1 741  ? 180.020 198.517 187.047 1.00 23.20  ? 741  TYR A  N   1 
ATOM   5401  C CA  . TYR A  1 741  ? 180.900 199.679 187.047 1.00 16.35  ? 741  TYR A  CA  1 
ATOM   5402  C C   . TYR A  1 741  ? 181.698 199.752 185.753 1.00 25.06  ? 741  TYR A  C   1 
ATOM   5403  O O   . TYR A  1 741  ? 181.720 200.785 185.077 1.00 26.79  ? 741  TYR A  O   1 
ATOM   5404  C CB  . TYR A  1 741  ? 181.839 199.634 188.253 1.00 14.44  ? 741  TYR A  CB  1 
ATOM   5405  C CG  . TYR A  1 741  ? 182.876 200.733 188.242 1.00 20.65  ? 741  TYR A  CG  1 
ATOM   5406  C CD1 . TYR A  1 741  ? 182.576 201.999 188.712 1.00 21.97  ? 741  TYR A  CD1 1 
ATOM   5407  C CD2 . TYR A  1 741  ? 184.153 200.505 187.758 1.00 22.65  ? 741  TYR A  CD2 1 
ATOM   5408  C CE1 . TYR A  1 741  ? 183.515 203.003 188.699 1.00 18.65  ? 741  TYR A  CE1 1 
ATOM   5409  C CE2 . TYR A  1 741  ? 185.097 201.506 187.744 1.00 16.12  ? 741  TYR A  CE2 1 
ATOM   5410  C CZ  . TYR A  1 741  ? 184.771 202.752 188.215 1.00 13.07  ? 741  TYR A  CZ  1 
ATOM   5411  O OH  . TYR A  1 741  ? 185.709 203.757 188.204 1.00 14.75  ? 741  TYR A  OH  1 
ATOM   5412  N N   . ILE A  1 742  ? 182.363 198.654 185.392 1.00 26.05  ? 742  ILE A  N   1 
ATOM   5413  C CA  . ILE A  1 742  ? 183.235 198.655 184.220 1.00 23.37  ? 742  ILE A  CA  1 
ATOM   5414  C C   . ILE A  1 742  ? 182.414 198.812 182.947 1.00 30.30  ? 742  ILE A  C   1 
ATOM   5415  O O   . ILE A  1 742  ? 182.655 199.712 182.135 1.00 48.63  ? 742  ILE A  O   1 
ATOM   5416  C CB  . ILE A  1 742  ? 184.083 197.371 184.181 1.00 21.81  ? 742  ILE A  CB  1 
ATOM   5417  C CG1 . ILE A  1 742  ? 184.872 197.218 185.477 1.00 20.00  ? 742  ILE A  CG1 1 
ATOM   5418  C CG2 . ILE A  1 742  ? 185.048 197.394 183.007 1.00 22.31  ? 742  ILE A  CG2 1 
ATOM   5419  C CD1 . ILE A  1 742  ? 185.707 195.975 185.531 1.00 16.58  ? 742  ILE A  CD1 1 
ATOM   5420  N N   . CYS A  1 743  ? 181.420 197.943 182.766 1.00 27.53  ? 743  CYS A  N   1 
ATOM   5421  C CA  . CYS A  1 743  ? 180.727 197.774 181.492 1.00 20.34  ? 743  CYS A  CA  1 
ATOM   5422  C C   . CYS A  1 743  ? 179.224 197.956 181.684 1.00 27.70  ? 743  CYS A  C   1 
ATOM   5423  O O   . CYS A  1 743  ? 178.417 197.154 181.218 1.00 31.04  ? 743  CYS A  O   1 
ATOM   5424  C CB  . CYS A  1 743  ? 180.957 196.396 180.883 1.00 32.20  ? 743  CYS A  CB  1 
ATOM   5425  S SG  . CYS A  1 743  ? 182.656 195.852 180.609 1.00 68.08  ? 743  CYS A  SG  1 
ATOM   5426  N N   . GLY A  1 744  ? 178.836 199.013 182.388 1.00 39.32  ? 744  GLY A  N   1 
ATOM   5427  C CA  . GLY A  1 744  ? 177.432 199.247 182.653 1.00 36.56  ? 744  GLY A  CA  1 
ATOM   5428  C C   . GLY A  1 744  ? 176.656 199.304 181.352 1.00 49.34  ? 744  GLY A  C   1 
ATOM   5429  O O   . GLY A  1 744  ? 177.011 200.076 180.446 1.00 58.56  ? 744  GLY A  O   1 
ATOM   5430  N N   . ASP A  1 745  ? 175.637 198.451 181.215 1.00 57.34  ? 745  ASP A  N   1 
ATOM   5431  C CA  . ASP A  1 745  ? 174.650 198.405 180.120 1.00 44.63  ? 745  ASP A  CA  1 
ATOM   5432  C C   . ASP A  1 745  ? 175.240 198.006 178.771 1.00 45.60  ? 745  ASP A  C   1 
ATOM   5433  O O   . ASP A  1 745  ? 174.568 198.192 177.749 1.00 56.46  ? 745  ASP A  O   1 
ATOM   5434  C CB  . ASP A  1 745  ? 173.883 199.726 179.953 1.00 49.44  ? 745  ASP A  CB  1 
ATOM   5435  C CG  . ASP A  1 745  ? 174.743 200.855 179.421 1.00 58.20  ? 745  ASP A  CG  1 
ATOM   5436  O OD1 . ASP A  1 745  ? 175.184 200.781 178.256 1.00 61.20  ? 745  ASP A  OD1 1 
ATOM   5437  O OD2 . ASP A  1 745  ? 174.978 201.820 180.179 1.00 62.25  ? 745  ASP A  OD2 1 
ATOM   5438  N N   . SER A  1 746  ? 176.455 197.464 178.720 1.00 48.05  ? 746  SER A  N   1 
ATOM   5439  C CA  . SER A  1 746  ? 177.057 196.995 177.475 1.00 37.88  ? 746  SER A  CA  1 
ATOM   5440  C C   . SER A  1 746  ? 177.206 195.479 177.522 1.00 41.71  ? 746  SER A  C   1 
ATOM   5441  O O   . SER A  1 746  ? 177.867 194.946 178.419 1.00 45.75  ? 746  SER A  O   1 
ATOM   5442  C CB  . SER A  1 746  ? 178.416 197.656 177.249 1.00 35.85  ? 746  SER A  CB  1 
ATOM   5443  O OG  . SER A  1 746  ? 179.083 197.083 176.140 1.00 32.12  ? 746  SER A  OG  1 
ATOM   5444  N N   . THR A  1 747  ? 176.593 194.786 176.555 1.00 47.58  ? 747  THR A  N   1 
ATOM   5445  C CA  . THR A  1 747  ? 176.756 193.338 176.464 1.00 39.69  ? 747  THR A  CA  1 
ATOM   5446  C C   . THR A  1 747  ? 178.084 192.957 175.819 1.00 42.12  ? 747  THR A  C   1 
ATOM   5447  O O   . THR A  1 747  ? 178.699 191.959 176.207 1.00 47.02  ? 747  THR A  O   1 
ATOM   5448  C CB  . THR A  1 747  ? 175.599 192.714 175.681 1.00 50.40  ? 747  THR A  CB  1 
ATOM   5449  O OG1 . THR A  1 747  ? 174.366 192.947 176.372 1.00 62.86  ? 747  THR A  OG1 1 
ATOM   5450  C CG2 . THR A  1 747  ? 175.812 191.212 175.518 1.00 59.49  ? 747  THR A  CG2 1 
ATOM   5451  N N   . GLU A  1 748  ? 178.535 193.726 174.825 1.00 44.61  ? 748  GLU A  N   1 
ATOM   5452  C CA  . GLU A  1 748  ? 179.819 193.435 174.195 1.00 42.00  ? 748  GLU A  CA  1 
ATOM   5453  C C   . GLU A  1 748  ? 180.958 193.543 175.198 1.00 43.39  ? 748  GLU A  C   1 
ATOM   5454  O O   . GLU A  1 748  ? 181.847 192.686 175.234 1.00 41.11  ? 748  GLU A  O   1 
ATOM   5455  C CB  . GLU A  1 748  ? 180.065 194.383 173.021 1.00 42.90  ? 748  GLU A  CB  1 
ATOM   5456  C CG  . GLU A  1 748  ? 179.030 194.311 171.906 1.00 34.27  ? 748  GLU A  CG  1 
ATOM   5457  C CD  . GLU A  1 748  ? 177.808 195.161 172.184 1.00 42.47  ? 748  GLU A  CD  1 
ATOM   5458  O OE1 . GLU A  1 748  ? 177.441 195.309 173.369 1.00 45.68  ? 748  GLU A  OE1 1 
ATOM   5459  O OE2 . GLU A  1 748  ? 177.221 195.690 171.217 1.00 44.31  ? 748  GLU A  OE2 1 
ATOM   5460  N N   . CYS A  1 749  ? 180.943 194.587 176.026 1.00 46.18  ? 749  CYS A  N   1 
ATOM   5461  C CA  . CYS A  1 749  ? 181.998 194.764 177.015 1.00 44.16  ? 749  CYS A  CA  1 
ATOM   5462  C C   . CYS A  1 749  ? 181.925 193.690 178.090 1.00 47.20  ? 749  CYS A  C   1 
ATOM   5463  O O   . CYS A  1 749  ? 182.961 193.221 178.575 1.00 55.71  ? 749  CYS A  O   1 
ATOM   5464  C CB  . CYS A  1 749  ? 181.891 196.155 177.632 1.00 47.75  ? 749  CYS A  CB  1 
ATOM   5465  S SG  . CYS A  1 749  ? 183.190 196.633 178.808 1.00 50.68  ? 749  CYS A  SG  1 
ATOM   5466  N N   . SER A  1 750  ? 180.713 193.296 178.486 1.00 45.48  ? 750  SER A  N   1 
ATOM   5467  C CA  . SER A  1 750  ? 180.575 192.276 179.519 1.00 37.10  ? 750  SER A  CA  1 
ATOM   5468  C C   . SER A  1 750  ? 181.196 190.960 179.075 1.00 38.66  ? 750  SER A  C   1 
ATOM   5469  O O   . SER A  1 750  ? 181.850 190.276 179.869 1.00 43.89  ? 750  SER A  O   1 
ATOM   5470  C CB  . SER A  1 750  ? 179.100 192.078 179.865 1.00 48.66  ? 750  SER A  CB  1 
ATOM   5471  O OG  . SER A  1 750  ? 178.534 193.256 180.420 1.00 52.69  ? 750  SER A  OG  1 
ATOM   5472  N N   . ASN A  1 751  ? 181.000 190.584 177.808 1.00 46.13  ? 751  ASN A  N   1 
ATOM   5473  C CA  . ASN A  1 751  ? 181.610 189.356 177.314 1.00 42.78  ? 751  ASN A  CA  1 
ATOM   5474  C C   . ASN A  1 751  ? 183.127 189.466 177.270 1.00 37.36  ? 751  ASN A  C   1 
ATOM   5475  O O   . ASN A  1 751  ? 183.825 188.461 177.439 1.00 47.40  ? 751  ASN A  O   1 
ATOM   5476  C CB  . ASN A  1 751  ? 181.072 189.015 175.927 1.00 42.66  ? 751  ASN A  CB  1 
ATOM   5477  C CG  . ASN A  1 751  ? 179.594 188.704 175.937 1.00 55.09  ? 751  ASN A  CG  1 
ATOM   5478  O OD1 . ASN A  1 751  ? 179.005 188.462 176.990 1.00 59.17  ? 751  ASN A  OD1 1 
ATOM   5479  N ND2 . ASN A  1 751  ? 178.984 188.699 174.758 1.00 69.42  ? 751  ASN A  ND2 1 
ATOM   5480  N N   . LEU A  1 752  ? 183.655 190.669 177.047 1.00 36.98  ? 752  LEU A  N   1 
ATOM   5481  C CA  . LEU A  1 752  ? 185.098 190.860 177.069 1.00 39.74  ? 752  LEU A  CA  1 
ATOM   5482  C C   . LEU A  1 752  ? 185.646 190.829 178.487 1.00 43.14  ? 752  LEU A  C   1 
ATOM   5483  O O   . LEU A  1 752  ? 186.783 190.398 178.699 1.00 46.22  ? 752  LEU A  O   1 
ATOM   5484  C CB  . LEU A  1 752  ? 185.467 192.184 176.403 1.00 40.12  ? 752  LEU A  CB  1 
ATOM   5485  C CG  . LEU A  1 752  ? 185.291 192.255 174.888 1.00 36.75  ? 752  LEU A  CG  1 
ATOM   5486  C CD1 . LEU A  1 752  ? 185.420 193.688 174.420 1.00 28.69  ? 752  LEU A  CD1 1 
ATOM   5487  C CD2 . LEU A  1 752  ? 186.308 191.372 174.185 1.00 51.87  ? 752  LEU A  CD2 1 
ATOM   5488  N N   . LEU A  1 753  ? 184.856 191.275 179.463 1.00 40.49  ? 753  LEU A  N   1 
ATOM   5489  C CA  . LEU A  1 753  ? 185.312 191.253 180.846 1.00 34.11  ? 753  LEU A  CA  1 
ATOM   5490  C C   . LEU A  1 753  ? 185.526 189.828 181.335 1.00 40.46  ? 753  LEU A  C   1 
ATOM   5491  O O   . LEU A  1 753  ? 186.354 189.596 182.222 1.00 49.85  ? 753  LEU A  O   1 
ATOM   5492  C CB  . LEU A  1 753  ? 184.304 191.977 181.735 1.00 41.10  ? 753  LEU A  CB  1 
ATOM   5493  C CG  . LEU A  1 753  ? 184.685 192.132 183.206 1.00 33.25  ? 753  LEU A  CG  1 
ATOM   5494  C CD1 . LEU A  1 753  ? 185.973 192.924 183.340 1.00 36.33  ? 753  LEU A  CD1 1 
ATOM   5495  C CD2 . LEU A  1 753  ? 183.559 192.797 183.970 1.00 29.91  ? 753  LEU A  CD2 1 
ATOM   5496  N N   . LEU A  1 754  ? 184.795 188.864 180.772 1.00 44.11  ? 754  LEU A  N   1 
ATOM   5497  C CA  . LEU A  1 754  ? 184.991 187.474 181.161 1.00 41.85  ? 754  LEU A  CA  1 
ATOM   5498  C C   . LEU A  1 754  ? 186.422 187.024 180.911 1.00 44.94  ? 754  LEU A  C   1 
ATOM   5499  O O   . LEU A  1 754  ? 186.912 186.113 181.586 1.00 51.13  ? 754  LEU A  O   1 
ATOM   5500  C CB  . LEU A  1 754  ? 184.018 186.570 180.405 1.00 42.61  ? 754  LEU A  CB  1 
ATOM   5501  C CG  . LEU A  1 754  ? 182.713 186.239 181.129 1.00 39.10  ? 754  LEU A  CG  1 
ATOM   5502  C CD1 . LEU A  1 754  ? 181.890 187.491 181.361 1.00 41.02  ? 754  LEU A  CD1 1 
ATOM   5503  C CD2 . LEU A  1 754  ? 181.913 185.209 180.353 1.00 35.31  ? 754  LEU A  CD2 1 
ATOM   5504  N N   . GLN A  1 755  ? 187.110 187.652 179.958 1.00 48.21  ? 755  GLN A  N   1 
ATOM   5505  C CA  . GLN A  1 755  ? 188.482 187.274 179.651 1.00 42.00  ? 755  GLN A  CA  1 
ATOM   5506  C C   . GLN A  1 755  ? 189.447 187.642 180.767 1.00 41.17  ? 755  GLN A  C   1 
ATOM   5507  O O   . GLN A  1 755  ? 190.602 187.209 180.731 1.00 43.44  ? 755  GLN A  O   1 
ATOM   5508  C CB  . GLN A  1 755  ? 188.929 187.935 178.346 1.00 43.06  ? 755  GLN A  CB  1 
ATOM   5509  C CG  . GLN A  1 755  ? 187.923 187.835 177.199 1.00 49.11  ? 755  GLN A  CG  1 
ATOM   5510  C CD  . GLN A  1 755  ? 187.635 186.409 176.774 1.00 56.95  ? 755  GLN A  CD  1 
ATOM   5511  O OE1 . GLN A  1 755  ? 187.802 185.466 177.546 1.00 62.24  ? 755  GLN A  OE1 1 
ATOM   5512  N NE2 . GLN A  1 755  ? 187.203 186.244 175.531 1.00 66.95  ? 755  GLN A  NE2 1 
ATOM   5513  N N   . TYR A  1 756  ? 189.004 188.431 181.742 1.00 45.98  ? 756  TYR A  N   1 
ATOM   5514  C CA  . TYR A  1 756  ? 189.754 188.689 182.964 1.00 41.93  ? 756  TYR A  CA  1 
ATOM   5515  C C   . TYR A  1 756  ? 189.281 187.819 184.119 1.00 41.85  ? 756  TYR A  C   1 
ATOM   5516  O O   . TYR A  1 756  ? 190.105 187.272 184.857 1.00 33.22  ? 756  TYR A  O   1 
ATOM   5517  C CB  . TYR A  1 756  ? 189.633 190.165 183.351 1.00 35.87  ? 756  TYR A  CB  1 
ATOM   5518  C CG  . TYR A  1 756  ? 190.344 191.107 182.408 1.00 34.34  ? 756  TYR A  CG  1 
ATOM   5519  C CD1 . TYR A  1 756  ? 189.862 191.337 181.127 1.00 34.15  ? 756  TYR A  CD1 1 
ATOM   5520  C CD2 . TYR A  1 756  ? 191.489 191.775 182.801 1.00 35.10  ? 756  TYR A  CD2 1 
ATOM   5521  C CE1 . TYR A  1 756  ? 190.507 192.196 180.267 1.00 24.31  ? 756  TYR A  CE1 1 
ATOM   5522  C CE2 . TYR A  1 756  ? 192.138 192.638 181.947 1.00 42.26  ? 756  TYR A  CE2 1 
ATOM   5523  C CZ  . TYR A  1 756  ? 191.642 192.844 180.682 1.00 39.00  ? 756  TYR A  CZ  1 
ATOM   5524  O OH  . TYR A  1 756  ? 192.288 193.703 179.826 1.00 50.64  ? 756  TYR A  OH  1 
ATOM   5525  N N   . GLY A  1 757  ? 187.967 187.683 184.288 1.00 42.42  ? 757  GLY A  N   1 
ATOM   5526  C CA  . GLY A  1 757  ? 187.402 186.644 185.126 1.00 47.58  ? 757  GLY A  CA  1 
ATOM   5527  C C   . GLY A  1 757  ? 187.477 186.873 186.620 1.00 42.98  ? 757  GLY A  C   1 
ATOM   5528  O O   . GLY A  1 757  ? 186.755 187.707 187.173 1.00 45.68  ? 757  GLY A  O   1 
ATOM   5529  N N   . SER A  1 758  ? 188.347 186.111 187.285 1.00 39.60  ? 758  SER A  N   1 
ATOM   5530  C CA  . SER A  1 758  ? 188.385 186.097 188.742 1.00 30.19  ? 758  SER A  CA  1 
ATOM   5531  C C   . SER A  1 758  ? 188.761 187.445 189.338 1.00 33.26  ? 758  SER A  C   1 
ATOM   5532  O O   . SER A  1 758  ? 188.553 187.652 190.537 1.00 31.18  ? 758  SER A  O   1 
ATOM   5533  C CB  . SER A  1 758  ? 189.367 185.030 189.222 1.00 42.29  ? 758  SER A  CB  1 
ATOM   5534  O OG  . SER A  1 758  ? 190.635 185.193 188.614 1.00 31.86  ? 758  SER A  OG  1 
ATOM   5535  N N   . PHE A  1 759  ? 189.318 188.360 188.544 1.00 41.33  ? 759  PHE A  N   1 
ATOM   5536  C CA  . PHE A  1 759  ? 189.692 189.663 189.080 1.00 34.16  ? 759  PHE A  CA  1 
ATOM   5537  C C   . PHE A  1 759  ? 188.512 190.331 189.768 1.00 28.59  ? 759  PHE A  C   1 
ATOM   5538  O O   . PHE A  1 759  ? 188.636 190.838 190.888 1.00 42.25  ? 759  PHE A  O   1 
ATOM   5539  C CB  . PHE A  1 759  ? 190.239 190.552 187.967 1.00 27.00  ? 759  PHE A  CB  1 
ATOM   5540  C CG  . PHE A  1 759  ? 191.728 190.470 187.817 1.00 38.77  ? 759  PHE A  CG  1 
ATOM   5541  C CD1 . PHE A  1 759  ? 192.313 189.415 187.139 1.00 46.40  ? 759  PHE A  CD1 1 
ATOM   5542  C CD2 . PHE A  1 759  ? 192.545 191.443 188.366 1.00 43.93  ? 759  PHE A  CD2 1 
ATOM   5543  C CE1 . PHE A  1 759  ? 193.684 189.337 187.006 1.00 57.20  ? 759  PHE A  CE1 1 
ATOM   5544  C CE2 . PHE A  1 759  ? 193.916 191.369 188.237 1.00 49.94  ? 759  PHE A  CE2 1 
ATOM   5545  C CZ  . PHE A  1 759  ? 194.485 190.315 187.556 1.00 57.43  ? 759  PHE A  CZ  1 
ATOM   5546  N N   . CYS A  1 760  ? 187.352 190.337 189.114 1.00 29.17  ? 760  CYS A  N   1 
ATOM   5547  C CA  . CYS A  1 760  ? 186.174 190.939 189.724 1.00 24.71  ? 760  CYS A  CA  1 
ATOM   5548  C C   . CYS A  1 760  ? 185.765 190.200 190.990 1.00 27.78  ? 760  CYS A  C   1 
ATOM   5549  O O   . CYS A  1 760  ? 185.396 190.828 191.987 1.00 37.54  ? 760  CYS A  O   1 
ATOM   5550  C CB  . CYS A  1 760  ? 185.024 190.957 188.722 1.00 29.82  ? 760  CYS A  CB  1 
ATOM   5551  S SG  . CYS A  1 760  ? 185.150 192.249 187.476 1.00 51.99  ? 760  CYS A  SG  1 
ATOM   5552  N N   . THR A  1 761  ? 185.816 188.867 190.972 1.00 30.73  ? 761  THR A  N   1 
ATOM   5553  C CA  . THR A  1 761  ? 185.464 188.110 192.168 1.00 23.11  ? 761  THR A  CA  1 
ATOM   5554  C C   . THR A  1 761  ? 186.444 188.387 193.296 1.00 21.45  ? 761  THR A  C   1 
ATOM   5555  O O   . THR A  1 761  ? 186.053 188.456 194.466 1.00 24.63  ? 761  THR A  O   1 
ATOM   5556  C CB  . THR A  1 761  ? 185.425 186.616 191.856 1.00 28.81  ? 761  THR A  CB  1 
ATOM   5557  O OG1 . THR A  1 761  ? 184.746 186.405 190.614 1.00 37.45  ? 761  THR A  OG1 1 
ATOM   5558  C CG2 . THR A  1 761  ? 184.690 185.869 192.953 1.00 20.50  ? 761  THR A  CG2 1 
ATOM   5559  N N   . GLN A  1 762  ? 187.727 188.535 192.968 1.00 25.86  ? 762  GLN A  N   1 
ATOM   5560  C CA  . GLN A  1 762  ? 188.712 188.871 193.987 1.00 25.75  ? 762  GLN A  CA  1 
ATOM   5561  C C   . GLN A  1 762  ? 188.422 190.235 194.602 1.00 27.44  ? 762  GLN A  C   1 
ATOM   5562  O O   . GLN A  1 762  ? 188.608 190.433 195.806 1.00 29.58  ? 762  GLN A  O   1 
ATOM   5563  C CB  . GLN A  1 762  ? 190.113 188.836 193.382 1.00 34.40  ? 762  GLN A  CB  1 
ATOM   5564  C CG  . GLN A  1 762  ? 191.231 188.968 194.397 1.00 52.27  ? 762  GLN A  CG  1 
ATOM   5565  C CD  . GLN A  1 762  ? 192.598 189.047 193.749 1.00 67.86  ? 762  GLN A  CD  1 
ATOM   5566  O OE1 . GLN A  1 762  ? 192.712 189.155 192.529 1.00 52.62  ? 762  GLN A  OE1 1 
ATOM   5567  N NE2 . GLN A  1 762  ? 193.645 188.996 194.564 1.00 67.48  ? 762  GLN A  NE2 1 
ATOM   5568  N N   . LEU A  1 763  ? 187.994 191.197 193.784 1.00 26.84  ? 763  LEU A  N   1 
ATOM   5569  C CA  . LEU A  1 763  ? 187.648 192.515 194.305 1.00 19.28  ? 763  LEU A  CA  1 
ATOM   5570  C C   . LEU A  1 763  ? 186.534 192.429 195.339 1.00 18.66  ? 763  LEU A  C   1 
ATOM   5571  O O   . LEU A  1 763  ? 186.626 193.019 196.419 1.00 29.09  ? 763  LEU A  O   1 
ATOM   5572  C CB  . LEU A  1 763  ? 187.232 193.433 193.158 1.00 17.70  ? 763  LEU A  CB  1 
ATOM   5573  C CG  . LEU A  1 763  ? 188.344 193.851 192.204 1.00 17.11  ? 763  LEU A  CG  1 
ATOM   5574  C CD1 . LEU A  1 763  ? 187.768 194.408 190.920 1.00 20.33  ? 763  LEU A  CD1 1 
ATOM   5575  C CD2 . LEU A  1 763  ? 189.224 194.879 192.872 1.00 25.80  ? 763  LEU A  CD2 1 
ATOM   5576  N N   . ASN A  1 764  ? 185.464 191.699 195.021 1.00 18.85  ? 764  ASN A  N   1 
ATOM   5577  C CA  . ASN A  1 764  ? 184.340 191.615 195.944 1.00 21.75  ? 764  ASN A  CA  1 
ATOM   5578  C C   . ASN A  1 764  ? 184.676 190.775 197.163 1.00 18.60  ? 764  ASN A  C   1 
ATOM   5579  O O   . ASN A  1 764  ? 184.108 190.990 198.238 1.00 20.09  ? 764  ASN A  O   1 
ATOM   5580  C CB  . ASN A  1 764  ? 183.120 191.042 195.233 1.00 32.42  ? 764  ASN A  CB  1 
ATOM   5581  C CG  . ASN A  1 764  ? 182.320 192.101 194.509 1.00 40.46  ? 764  ASN A  CG  1 
ATOM   5582  O OD1 . ASN A  1 764  ? 181.440 192.731 195.092 1.00 35.93  ? 764  ASN A  OD1 1 
ATOM   5583  N ND2 . ASN A  1 764  ? 182.619 192.307 193.232 1.00 41.80  ? 764  ASN A  ND2 1 
ATOM   5584  N N   . ARG A  1 765  ? 185.581 189.812 197.019 1.00 18.75  ? 765  ARG A  N   1 
ATOM   5585  C CA  . ARG A  1 765  ? 186.010 189.039 198.176 1.00 15.19  ? 765  ARG A  CA  1 
ATOM   5586  C C   . ARG A  1 765  ? 186.728 189.927 199.180 1.00 15.68  ? 765  ARG A  C   1 
ATOM   5587  O O   . ARG A  1 765  ? 186.582 189.746 200.393 1.00 14.89  ? 765  ARG A  O   1 
ATOM   5588  C CB  . ARG A  1 765  ? 186.904 187.889 197.724 1.00 14.47  ? 765  ARG A  CB  1 
ATOM   5589  C CG  . ARG A  1 765  ? 187.252 186.894 198.813 1.00 18.29  ? 765  ARG A  CG  1 
ATOM   5590  C CD  . ARG A  1 765  ? 187.738 185.590 198.214 1.00 25.42  ? 765  ARG A  CD  1 
ATOM   5591  N NE  . ARG A  1 765  ? 188.629 185.818 197.082 1.00 34.20  ? 765  ARG A  NE  1 
ATOM   5592  C CZ  . ARG A  1 765  ? 188.976 184.886 196.200 1.00 39.79  ? 765  ARG A  CZ  1 
ATOM   5593  N NH1 . ARG A  1 765  ? 189.790 185.193 195.201 1.00 53.43  ? 765  ARG A  NH1 1 
ATOM   5594  N NH2 . ARG A  1 765  ? 188.509 183.650 196.310 1.00 40.19  ? 765  ARG A  NH2 1 
ATOM   5595  N N   . ALA A  1 766  ? 187.517 190.887 198.692 1.00 17.71  ? 766  ALA A  N   1 
ATOM   5596  C CA  . ALA A  1 766  ? 188.172 191.838 199.582 1.00 10.60  ? 766  ALA A  CA  1 
ATOM   5597  C C   . ALA A  1 766  ? 187.159 192.766 200.236 1.00 12.69  ? 766  ALA A  C   1 
ATOM   5598  O O   . ALA A  1 766  ? 187.194 192.978 201.453 1.00 21.11  ? 766  ALA A  O   1 
ATOM   5599  C CB  . ALA A  1 766  ? 189.210 192.646 198.808 1.00 15.70  ? 766  ALA A  CB  1 
ATOM   5600  N N   . LEU A  1 767  ? 186.248 193.335 199.444 1.00 13.52  ? 767  LEU A  N   1 
ATOM   5601  C CA  . LEU A  1 767  ? 185.270 194.264 199.999 1.00 9.95   ? 767  LEU A  CA  1 
ATOM   5602  C C   . LEU A  1 767  ? 184.345 193.577 200.992 1.00 10.08  ? 767  LEU A  C   1 
ATOM   5603  O O   . LEU A  1 767  ? 183.916 194.200 201.968 1.00 22.77  ? 767  LEU A  O   1 
ATOM   5604  C CB  . LEU A  1 767  ? 184.450 194.903 198.880 1.00 6.50   ? 767  LEU A  CB  1 
ATOM   5605  C CG  . LEU A  1 767  ? 185.144 195.964 198.027 1.00 6.91   ? 767  LEU A  CG  1 
ATOM   5606  C CD1 . LEU A  1 767  ? 184.205 196.455 196.945 1.00 8.70   ? 767  LEU A  CD1 1 
ATOM   5607  C CD2 . LEU A  1 767  ? 185.623 197.122 198.884 1.00 7.57   ? 767  LEU A  CD2 1 
ATOM   5608  N N   . THR A  1 768  ? 184.019 192.306 200.763 1.00 13.20  ? 768  THR A  N   1 
ATOM   5609  C CA  . THR A  1 768  ? 183.203 191.582 201.730 1.00 10.22  ? 768  THR A  CA  1 
ATOM   5610  C C   . THR A  1 768  ? 183.963 191.373 203.032 1.00 15.17  ? 768  THR A  C   1 
ATOM   5611  O O   . THR A  1 768  ? 183.391 191.508 204.119 1.00 20.34  ? 768  THR A  O   1 
ATOM   5612  C CB  . THR A  1 768  ? 182.763 190.242 201.148 1.00 12.54  ? 768  THR A  CB  1 
ATOM   5613  O OG1 . THR A  1 768  ? 182.025 190.464 199.940 1.00 22.95  ? 768  THR A  OG1 1 
ATOM   5614  C CG2 . THR A  1 768  ? 181.891 189.492 202.136 1.00 13.23  ? 768  THR A  CG2 1 
ATOM   5615  N N   . GLY A  1 769  ? 185.252 191.044 202.942 1.00 13.82  ? 769  GLY A  N   1 
ATOM   5616  C CA  . GLY A  1 769  ? 186.062 190.957 204.145 1.00 11.08  ? 769  GLY A  CA  1 
ATOM   5617  C C   . GLY A  1 769  ? 186.093 192.265 204.908 1.00 18.52  ? 769  GLY A  C   1 
ATOM   5618  O O   . GLY A  1 769  ? 186.051 192.278 206.140 1.00 16.66  ? 769  GLY A  O   1 
ATOM   5619  N N   . ILE A  1 770  ? 186.163 193.383 204.188 1.00 10.80  ? 770  ILE A  N   1 
ATOM   5620  C CA  . ILE A  1 770  ? 186.116 194.688 204.837 1.00 9.70   ? 770  ILE A  CA  1 
ATOM   5621  C C   . ILE A  1 770  ? 184.757 194.902 205.484 1.00 10.76  ? 770  ILE A  C   1 
ATOM   5622  O O   . ILE A  1 770  ? 184.660 195.257 206.663 1.00 18.75  ? 770  ILE A  O   1 
ATOM   5623  C CB  . ILE A  1 770  ? 186.432 195.804 203.828 1.00 6.82   ? 770  ILE A  CB  1 
ATOM   5624  C CG1 . ILE A  1 770  ? 187.895 195.743 203.404 1.00 4.97   ? 770  ILE A  CG1 1 
ATOM   5625  C CG2 . ILE A  1 770  ? 186.115 197.165 204.425 1.00 5.88   ? 770  ILE A  CG2 1 
ATOM   5626  C CD1 . ILE A  1 770  ? 188.177 196.487 202.129 1.00 4.67   ? 770  ILE A  CD1 1 
ATOM   5627  N N   . ALA A  1 771  ? 183.685 194.677 204.722 1.00 11.73  ? 771  ALA A  N   1 
ATOM   5628  C CA  . ALA A  1 771  ? 182.344 194.946 205.227 1.00 12.72  ? 771  ALA A  CA  1 
ATOM   5629  C C   . ALA A  1 771  ? 181.996 194.039 206.397 1.00 14.16  ? 771  ALA A  C   1 
ATOM   5630  O O   . ALA A  1 771  ? 181.429 194.493 207.396 1.00 21.59  ? 771  ALA A  O   1 
ATOM   5631  C CB  . ALA A  1 771  ? 181.323 194.778 204.105 1.00 9.65   ? 771  ALA A  CB  1 
ATOM   5632  N N   . VAL A  1 772  ? 182.333 192.754 206.297 1.00 19.19  ? 772  VAL A  N   1 
ATOM   5633  C CA  . VAL A  1 772  ? 181.941 191.815 207.340 1.00 13.95  ? 772  VAL A  CA  1 
ATOM   5634  C C   . VAL A  1 772  ? 182.607 192.171 208.661 1.00 17.41  ? 772  VAL A  C   1 
ATOM   5635  O O   . VAL A  1 772  ? 182.001 192.033 209.729 1.00 35.61  ? 772  VAL A  O   1 
ATOM   5636  C CB  . VAL A  1 772  ? 182.272 190.376 206.909 1.00 18.42  ? 772  VAL A  CB  1 
ATOM   5637  C CG1 . VAL A  1 772  ? 182.229 189.441 208.103 1.00 40.31  ? 772  VAL A  CG1 1 
ATOM   5638  C CG2 . VAL A  1 772  ? 181.302 189.916 205.840 1.00 19.40  ? 772  VAL A  CG2 1 
ATOM   5639  N N   . GLU A  1 773  ? 183.857 192.628 208.619 1.00 16.76  ? 773  GLU A  N   1 
ATOM   5640  C CA  . GLU A  1 773  ? 184.565 192.940 209.853 1.00 14.87  ? 773  GLU A  CA  1 
ATOM   5641  C C   . GLU A  1 773  ? 184.151 194.275 210.455 1.00 16.66  ? 773  GLU A  C   1 
ATOM   5642  O O   . GLU A  1 773  ? 184.467 194.527 211.620 1.00 26.65  ? 773  GLU A  O   1 
ATOM   5643  C CB  . GLU A  1 773  ? 186.076 192.929 209.619 1.00 15.96  ? 773  GLU A  CB  1 
ATOM   5644  C CG  . GLU A  1 773  ? 186.701 194.281 209.313 1.00 16.87  ? 773  GLU A  CG  1 
ATOM   5645  C CD  . GLU A  1 773  ? 188.196 194.178 209.121 1.00 25.91  ? 773  GLU A  CD  1 
ATOM   5646  O OE1 . GLU A  1 773  ? 188.749 194.935 208.296 1.00 28.81  ? 773  GLU A  OE1 1 
ATOM   5647  O OE2 . GLU A  1 773  ? 188.817 193.329 209.795 1.00 21.24  ? 773  GLU A  OE2 1 
ATOM   5648  N N   . GLN A  1 774  ? 183.466 195.136 209.702 1.00 18.44  ? 774  GLN A  N   1 
ATOM   5649  C CA  . GLN A  1 774  ? 182.916 196.340 210.312 1.00 15.00  ? 774  GLN A  CA  1 
ATOM   5650  C C   . GLN A  1 774  ? 181.867 195.988 211.350 1.00 17.67  ? 774  GLN A  C   1 
ATOM   5651  O O   . GLN A  1 774  ? 181.707 196.708 212.340 1.00 26.72  ? 774  GLN A  O   1 
ATOM   5652  C CB  . GLN A  1 774  ? 182.314 197.256 209.251 1.00 11.88  ? 774  GLN A  CB  1 
ATOM   5653  C CG  . GLN A  1 774  ? 183.283 197.677 208.167 1.00 15.15  ? 774  GLN A  CG  1 
ATOM   5654  C CD  . GLN A  1 774  ? 184.633 198.073 208.714 1.00 15.41  ? 774  GLN A  CD  1 
ATOM   5655  O OE1 . GLN A  1 774  ? 184.755 199.057 209.438 1.00 25.76  ? 774  GLN A  OE1 1 
ATOM   5656  N NE2 . GLN A  1 774  ? 185.659 197.303 208.378 1.00 12.58  ? 774  GLN A  NE2 1 
ATOM   5657  N N   . ASP A  1 775  ? 181.139 194.893 211.133 1.00 20.92  ? 775  ASP A  N   1 
ATOM   5658  C CA  . ASP A  1 775  ? 180.222 194.398 212.151 1.00 16.33  ? 775  ASP A  CA  1 
ATOM   5659  C C   . ASP A  1 775  ? 180.983 193.814 213.331 1.00 17.99  ? 775  ASP A  C   1 
ATOM   5660  O O   . ASP A  1 775  ? 180.565 193.969 214.482 1.00 25.20  ? 775  ASP A  O   1 
ATOM   5661  C CB  . ASP A  1 775  ? 179.287 193.360 211.540 1.00 27.88  ? 775  ASP A  CB  1 
ATOM   5662  C CG  . ASP A  1 775  ? 178.484 193.917 210.384 1.00 30.86  ? 775  ASP A  CG  1 
ATOM   5663  O OD1 . ASP A  1 775  ? 178.182 195.129 210.395 1.00 41.39  ? 775  ASP A  OD1 1 
ATOM   5664  O OD2 . ASP A  1 775  ? 178.159 193.144 209.459 1.00 27.91  ? 775  ASP A  OD2 1 
ATOM   5665  N N   . LYS A  1 776  ? 182.100 193.136 213.066 1.00 17.55  ? 776  LYS A  N   1 
ATOM   5666  C CA  . LYS A  1 776  ? 182.952 192.651 214.146 1.00 16.20  ? 776  LYS A  CA  1 
ATOM   5667  C C   . LYS A  1 776  ? 183.455 193.809 214.996 1.00 18.17  ? 776  LYS A  C   1 
ATOM   5668  O O   . LYS A  1 776  ? 183.358 193.783 216.226 1.00 25.46  ? 776  LYS A  O   1 
ATOM   5669  C CB  . LYS A  1 776  ? 184.124 191.859 213.565 1.00 19.42  ? 776  LYS A  CB  1 
ATOM   5670  C CG  . LYS A  1 776  ? 185.111 191.323 214.597 1.00 23.87  ? 776  LYS A  CG  1 
ATOM   5671  C CD  . LYS A  1 776  ? 186.427 190.913 213.950 1.00 34.95  ? 776  LYS A  CD  1 
ATOM   5672  C CE  . LYS A  1 776  ? 187.278 192.121 213.566 1.00 25.65  ? 776  LYS A  CE  1 
ATOM   5673  N NZ  . LYS A  1 776  ? 187.729 192.904 214.753 1.00 9.55   ? 776  LYS A  NZ  1 
ATOM   5674  N N   . ASN A  1 777  ? 184.003 194.841 214.350 1.00 19.03  ? 777  ASN A  N   1 
ATOM   5675  C CA  . ASN A  1 777  ? 184.532 195.978 215.094 1.00 16.72  ? 777  ASN A  CA  1 
ATOM   5676  C C   . ASN A  1 777  ? 183.472 196.580 215.999 1.00 18.79  ? 777  ASN A  C   1 
ATOM   5677  O O   . ASN A  1 777  ? 183.738 196.879 217.167 1.00 30.58  ? 777  ASN A  O   1 
ATOM   5678  C CB  . ASN A  1 777  ? 185.063 197.037 214.130 1.00 13.09  ? 777  ASN A  CB  1 
ATOM   5679  C CG  . ASN A  1 777  ? 186.265 196.567 213.354 1.00 14.10  ? 777  ASN A  CG  1 
ATOM   5680  O OD1 . ASN A  1 777  ? 186.855 195.536 213.667 1.00 12.17  ? 777  ASN A  OD1 1 
ATOM   5681  N ND2 . ASN A  1 777  ? 186.644 197.328 212.338 1.00 16.80  ? 777  ASN A  ND2 1 
ATOM   5682  N N   . THR A  1 778  ? 182.262 196.768 215.477 1.00 14.38  ? 778  THR A  N   1 
ATOM   5683  C CA  . THR A  1 778  ? 181.187 197.314 216.294 1.00 9.16   ? 778  THR A  CA  1 
ATOM   5684  C C   . THR A  1 778  ? 180.795 196.345 217.401 1.00 18.79  ? 778  THR A  C   1 
ATOM   5685  O O   . THR A  1 778  ? 180.483 196.766 218.520 1.00 36.58  ? 778  THR A  O   1 
ATOM   5686  C CB  . THR A  1 778  ? 179.984 197.640 215.417 1.00 19.01  ? 778  THR A  CB  1 
ATOM   5687  O OG1 . THR A  1 778  ? 180.415 198.391 214.277 1.00 22.68  ? 778  THR A  OG1 1 
ATOM   5688  C CG2 . THR A  1 778  ? 178.972 198.454 216.187 1.00 31.72  ? 778  THR A  CG2 1 
ATOM   5689  N N   . GLN A  1 779  ? 180.804 195.045 217.109 1.00 15.10  ? 779  GLN A  N   1 
ATOM   5690  C CA  . GLN A  1 779  ? 180.469 194.059 218.129 1.00 17.52  ? 779  GLN A  CA  1 
ATOM   5691  C C   . GLN A  1 779  ? 181.516 194.033 219.234 1.00 17.75  ? 779  GLN A  C   1 
ATOM   5692  O O   . GLN A  1 779  ? 181.176 193.957 220.418 1.00 26.28  ? 779  GLN A  O   1 
ATOM   5693  C CB  . GLN A  1 779  ? 180.343 192.677 217.493 1.00 22.45  ? 779  GLN A  CB  1 
ATOM   5694  C CG  . GLN A  1 779  ? 179.718 191.630 218.396 1.00 37.78  ? 779  GLN A  CG  1 
ATOM   5695  C CD  . GLN A  1 779  ? 178.210 191.595 218.286 1.00 52.04  ? 779  GLN A  CD  1 
ATOM   5696  O OE1 . GLN A  1 779  ? 177.570 192.617 218.039 1.00 51.66  ? 779  GLN A  OE1 1 
ATOM   5697  N NE2 . GLN A  1 779  ? 177.630 190.411 218.462 1.00 56.22  ? 779  GLN A  NE2 1 
ATOM   5698  N N   . GLU A  1 780  ? 182.794 194.089 218.864 1.00 14.62  ? 780  GLU A  N   1 
ATOM   5699  C CA  . GLU A  1 780  ? 183.855 194.005 219.860 1.00 18.73  ? 780  GLU A  CA  1 
ATOM   5700  C C   . GLU A  1 780  ? 183.820 195.195 220.808 1.00 21.40  ? 780  GLU A  C   1 
ATOM   5701  O O   . GLU A  1 780  ? 184.068 195.045 222.009 1.00 28.32  ? 780  GLU A  O   1 
ATOM   5702  C CB  . GLU A  1 780  ? 185.210 193.913 219.162 1.00 25.40  ? 780  GLU A  CB  1 
ATOM   5703  C CG  . GLU A  1 780  ? 185.409 192.634 218.365 1.00 33.53  ? 780  GLU A  CG  1 
ATOM   5704  C CD  . GLU A  1 780  ? 185.740 191.445 219.242 1.00 36.94  ? 780  GLU A  CD  1 
ATOM   5705  O OE1 . GLU A  1 780  ? 186.908 191.002 219.225 1.00 46.48  ? 780  GLU A  OE1 1 
ATOM   5706  O OE2 . GLU A  1 780  ? 184.836 190.958 219.953 1.00 42.27  ? 780  GLU A  OE2 1 
ATOM   5707  N N   . VAL A  1 781  ? 183.517 196.385 220.292 1.00 17.33  ? 781  VAL A  N   1 
ATOM   5708  C CA  . VAL A  1 781  ? 183.529 197.582 221.124 1.00 12.79  ? 781  VAL A  CA  1 
ATOM   5709  C C   . VAL A  1 781  ? 182.305 197.615 222.028 1.00 13.22  ? 781  VAL A  C   1 
ATOM   5710  O O   . VAL A  1 781  ? 182.417 197.761 223.250 1.00 20.13  ? 781  VAL A  O   1 
ATOM   5711  C CB  . VAL A  1 781  ? 183.606 198.845 220.251 1.00 11.25  ? 781  VAL A  CB  1 
ATOM   5712  C CG1 . VAL A  1 781  ? 183.509 200.091 221.115 1.00 9.84   ? 781  VAL A  CG1 1 
ATOM   5713  C CG2 . VAL A  1 781  ? 184.888 198.851 219.450 1.00 14.63  ? 781  VAL A  CG2 1 
ATOM   5714  N N   . PHE A  1 782  ? 181.118 197.481 221.443 1.00 14.54  ? 782  PHE A  N   1 
ATOM   5715  C CA  . PHE A  1 782  ? 179.885 197.760 222.168 1.00 14.73  ? 782  PHE A  CA  1 
ATOM   5716  C C   . PHE A  1 782  ? 179.292 196.528 222.835 1.00 20.16  ? 782  PHE A  C   1 
ATOM   5717  O O   . PHE A  1 782  ? 178.852 196.607 223.985 1.00 27.69  ? 782  PHE A  O   1 
ATOM   5718  C CB  . PHE A  1 782  ? 178.862 198.383 221.220 1.00 18.40  ? 782  PHE A  CB  1 
ATOM   5719  C CG  . PHE A  1 782  ? 179.177 199.798 220.854 1.00 14.32  ? 782  PHE A  CG  1 
ATOM   5720  C CD1 . PHE A  1 782  ? 178.875 200.827 221.718 1.00 14.32  ? 782  PHE A  CD1 1 
ATOM   5721  C CD2 . PHE A  1 782  ? 179.789 200.097 219.655 1.00 12.77  ? 782  PHE A  CD2 1 
ATOM   5722  C CE1 . PHE A  1 782  ? 179.169 202.125 221.391 1.00 16.25  ? 782  PHE A  CE1 1 
ATOM   5723  C CE2 . PHE A  1 782  ? 180.084 201.396 219.325 1.00 13.36  ? 782  PHE A  CE2 1 
ATOM   5724  C CZ  . PHE A  1 782  ? 179.774 202.411 220.194 1.00 15.90  ? 782  PHE A  CZ  1 
ATOM   5725  N N   . ALA A  1 783  ? 179.270 195.391 222.153 1.00 20.14  ? 783  ALA A  N   1 
ATOM   5726  C CA  . ALA A  1 783  ? 178.684 194.184 222.730 1.00 20.54  ? 783  ALA A  CA  1 
ATOM   5727  C C   . ALA A  1 783  ? 179.646 193.454 223.650 1.00 27.63  ? 783  ALA A  C   1 
ATOM   5728  O O   . ALA A  1 783  ? 179.877 192.254 223.493 1.00 60.26  ? 783  ALA A  O   1 
ATOM   5729  C CB  . ALA A  1 783  ? 178.213 193.266 221.606 1.00 24.95  ? 783  ALA A  CB  1 
ATOM   5730  N N   . GLN A  1 784  ? 180.225 194.165 224.618 1.00 24.77  ? 784  GLN A  N   1 
ATOM   5731  C CA  . GLN A  1 784  ? 181.097 193.530 225.594 1.00 31.16  ? 784  GLN A  CA  1 
ATOM   5732  C C   . GLN A  1 784  ? 180.314 192.784 226.665 1.00 35.67  ? 784  GLN A  C   1 
ATOM   5733  O O   . GLN A  1 784  ? 180.824 191.804 227.218 1.00 46.50  ? 784  GLN A  O   1 
ATOM   5734  C CB  . GLN A  1 784  ? 182.008 194.582 226.224 1.00 26.77  ? 784  GLN A  CB  1 
ATOM   5735  C CG  . GLN A  1 784  ? 182.908 195.269 225.209 1.00 18.97  ? 784  GLN A  CG  1 
ATOM   5736  C CD  . GLN A  1 784  ? 184.301 195.523 225.732 1.00 12.80  ? 784  GLN A  CD  1 
ATOM   5737  O OE1 . GLN A  1 784  ? 184.554 195.431 226.932 1.00 12.72  ? 784  GLN A  OE1 1 
ATOM   5738  N NE2 . GLN A  1 784  ? 185.223 195.838 224.829 1.00 18.10  ? 784  GLN A  NE2 1 
ATOM   5739  N N   . VAL A  1 785  ? 179.094 193.222 226.965 1.00 41.59  ? 785  VAL A  N   1 
ATOM   5740  C CA  . VAL A  1 785  ? 178.189 192.523 227.869 1.00 38.29  ? 785  VAL A  CA  1 
ATOM   5741  C C   . VAL A  1 785  ? 176.986 192.075 227.054 1.00 46.52  ? 785  VAL A  C   1 
ATOM   5742  O O   . VAL A  1 785  ? 176.345 192.892 226.382 1.00 47.38  ? 785  VAL A  O   1 
ATOM   5743  C CB  . VAL A  1 785  ? 177.748 193.400 229.051 1.00 35.53  ? 785  VAL A  CB  1 
ATOM   5744  C CG1 . VAL A  1 785  ? 178.888 193.584 230.041 1.00 36.00  ? 785  VAL A  CG1 1 
ATOM   5745  C CG2 . VAL A  1 785  ? 177.234 194.748 228.560 1.00 26.61  ? 785  VAL A  CG2 1 
ATOM   5746  N N   . LYS A  1 786  ? 176.685 190.780 227.106 1.00 46.73  ? 786  LYS A  N   1 
ATOM   5747  C CA  . LYS A  1 786  ? 175.539 190.240 226.389 1.00 48.40  ? 786  LYS A  CA  1 
ATOM   5748  C C   . LYS A  1 786  ? 174.317 190.244 227.298 1.00 54.36  ? 786  LYS A  C   1 
ATOM   5749  O O   . LYS A  1 786  ? 173.409 189.424 227.134 1.00 51.28  ? 786  LYS A  O   1 
ATOM   5750  C CB  . LYS A  1 786  ? 175.833 188.824 225.885 1.00 41.49  ? 786  LYS A  CB  1 
ATOM   5751  C CG  . LYS A  1 786  ? 177.081 188.712 225.015 1.00 54.58  ? 786  LYS A  CG  1 
ATOM   5752  C CD  . LYS A  1 786  ? 176.989 189.556 223.750 1.00 58.18  ? 786  LYS A  CD  1 
ATOM   5753  C CE  . LYS A  1 786  ? 175.888 189.074 222.821 1.00 45.92  ? 786  LYS A  CE  1 
ATOM   5754  N NZ  . LYS A  1 786  ? 175.777 189.919 221.603 1.00 53.49  ? 786  LYS A  NZ  1 
ATOM   5755  N N   . GLN A  1 787  ? 174.296 191.161 228.264 1.00 45.78  ? 787  GLN A  N   1 
ATOM   5756  C CA  . GLN A  1 787  ? 173.206 191.276 229.227 1.00 36.57  ? 787  GLN A  CA  1 
ATOM   5757  C C   . GLN A  1 787  ? 172.783 192.737 229.269 1.00 32.85  ? 787  GLN A  C   1 
ATOM   5758  O O   . GLN A  1 787  ? 173.529 193.584 229.767 1.00 40.72  ? 787  GLN A  O   1 
ATOM   5759  C CB  . GLN A  1 787  ? 173.647 190.803 230.611 1.00 39.24  ? 787  GLN A  CB  1 
ATOM   5760  C CG  . GLN A  1 787  ? 172.529 190.733 231.656 1.00 42.45  ? 787  GLN A  CG  1 
ATOM   5761  C CD  . GLN A  1 787  ? 171.737 189.423 231.673 1.00 46.69  ? 787  GLN A  CD  1 
ATOM   5762  O OE1 . GLN A  1 787  ? 170.661 189.365 232.266 1.00 56.89  ? 787  GLN A  OE1 1 
ATOM   5763  N NE2 . GLN A  1 787  ? 172.261 188.374 231.042 1.00 46.19  ? 787  GLN A  NE2 1 
ATOM   5764  N N   . ILE A  1 788  ? 171.597 193.035 228.748 1.00 37.73  ? 788  ILE A  N   1 
ATOM   5765  C CA  . ILE A  1 788  ? 171.107 194.408 228.753 1.00 42.96  ? 788  ILE A  CA  1 
ATOM   5766  C C   . ILE A  1 788  ? 170.739 194.793 230.179 1.00 45.62  ? 788  ILE A  C   1 
ATOM   5767  O O   . ILE A  1 788  ? 169.810 194.230 230.768 1.00 50.50  ? 788  ILE A  O   1 
ATOM   5768  C CB  . ILE A  1 788  ? 169.907 194.568 227.812 1.00 41.96  ? 788  ILE A  CB  1 
ATOM   5769  C CG1 . ILE A  1 788  ? 170.314 194.306 226.358 1.00 34.22  ? 788  ILE A  CG1 1 
ATOM   5770  C CG2 . ILE A  1 788  ? 169.303 195.957 227.954 1.00 47.35  ? 788  ILE A  CG2 1 
ATOM   5771  C CD1 . ILE A  1 788  ? 171.326 195.286 225.804 1.00 40.82  ? 788  ILE A  CD1 1 
ATOM   5772  N N   . TYR A  1 789  ? 171.460 195.759 230.736 1.00 42.16  ? 789  TYR A  N   1 
ATOM   5773  C CA  . TYR A  1 789  ? 171.147 196.315 232.042 1.00 29.54  ? 789  TYR A  CA  1 
ATOM   5774  C C   . TYR A  1 789  ? 170.343 197.594 231.869 1.00 29.49  ? 789  TYR A  C   1 
ATOM   5775  O O   . TYR A  1 789  ? 170.450 198.279 230.850 1.00 29.51  ? 789  TYR A  O   1 
ATOM   5776  C CB  . TYR A  1 789  ? 172.415 196.615 232.843 1.00 30.96  ? 789  TYR A  CB  1 
ATOM   5777  C CG  . TYR A  1 789  ? 173.295 195.418 233.100 1.00 27.30  ? 789  TYR A  CG  1 
ATOM   5778  C CD1 . TYR A  1 789  ? 172.944 194.464 234.039 1.00 28.85  ? 789  TYR A  CD1 1 
ATOM   5779  C CD2 . TYR A  1 789  ? 174.487 195.252 232.414 1.00 34.88  ? 789  TYR A  CD2 1 
ATOM   5780  C CE1 . TYR A  1 789  ? 173.748 193.375 234.278 1.00 34.19  ? 789  TYR A  CE1 1 
ATOM   5781  C CE2 . TYR A  1 789  ? 175.297 194.166 232.647 1.00 34.66  ? 789  TYR A  CE2 1 
ATOM   5782  C CZ  . TYR A  1 789  ? 174.922 193.229 233.580 1.00 37.54  ? 789  TYR A  CZ  1 
ATOM   5783  O OH  . TYR A  1 789  ? 175.727 192.141 233.817 1.00 45.19  ? 789  TYR A  OH  1 
ATOM   5784  N N   . LYS A  1 790  ? 169.528 197.908 232.871 1.00 44.16  ? 790  LYS A  N   1 
ATOM   5785  C CA  . LYS A  1 790  ? 168.742 199.131 232.859 1.00 50.20  ? 790  LYS A  CA  1 
ATOM   5786  C C   . LYS A  1 790  ? 168.753 199.759 234.243 1.00 49.89  ? 790  LYS A  C   1 
ATOM   5787  O O   . LYS A  1 790  ? 168.785 199.064 235.261 1.00 58.42  ? 790  LYS A  O   1 
ATOM   5788  C CB  . LYS A  1 790  ? 167.304 198.871 232.403 1.00 52.76  ? 790  LYS A  CB  1 
ATOM   5789  C CG  . LYS A  1 790  ? 166.570 197.829 233.216 1.00 50.81  ? 790  LYS A  CG  1 
ATOM   5790  C CD  . LYS A  1 790  ? 165.357 197.313 232.463 1.00 55.12  ? 790  LYS A  CD  1 
ATOM   5791  C CE  . LYS A  1 790  ? 164.379 198.432 232.142 1.00 54.93  ? 790  LYS A  CE  1 
ATOM   5792  N NZ  . LYS A  1 790  ? 163.172 197.928 231.434 1.00 72.03  ? 790  LYS A  NZ  1 
ATOM   5793  N N   . THR A  1 791  ? 168.735 201.087 234.263 1.00 47.48  ? 791  THR A  N   1 
ATOM   5794  C CA  . THR A  1 791  ? 168.822 201.821 235.513 1.00 55.62  ? 791  THR A  CA  1 
ATOM   5795  C C   . THR A  1 791  ? 167.538 201.655 236.324 1.00 60.46  ? 791  THR A  C   1 
ATOM   5796  O O   . THR A  1 791  ? 166.461 201.447 235.758 1.00 66.95  ? 791  THR A  O   1 
ATOM   5797  C CB  . THR A  1 791  ? 169.066 203.302 235.243 1.00 53.31  ? 791  THR A  CB  1 
ATOM   5798  O OG1 . THR A  1 791  ? 169.112 204.014 236.485 1.00 58.99  ? 791  THR A  OG1 1 
ATOM   5799  C CG2 . THR A  1 791  ? 167.953 203.883 234.376 1.00 47.12  ? 791  THR A  CG2 1 
ATOM   5800  N N   . PRO A  1 792  ? 167.616 201.751 237.650 1.00 60.93  ? 792  PRO A  N   1 
ATOM   5801  C CA  . PRO A  1 792  ? 166.394 201.881 238.430 1.00 59.12  ? 792  PRO A  CA  1 
ATOM   5802  C C   . PRO A  1 792  ? 165.730 203.210 238.139 1.00 66.66  ? 792  PRO A  C   1 
ATOM   5803  O O   . PRO A  1 792  ? 166.401 204.191 237.767 1.00 72.86  ? 792  PRO A  O   1 
ATOM   5804  C CB  . PRO A  1 792  ? 166.891 201.804 239.879 1.00 58.63  ? 792  PRO A  CB  1 
ATOM   5805  C CG  . PRO A  1 792  ? 168.283 202.282 239.811 1.00 56.56  ? 792  PRO A  CG  1 
ATOM   5806  C CD  . PRO A  1 792  ? 168.811 201.764 238.510 1.00 55.08  ? 792  PRO A  CD  1 
ATOM   5807  N N   . PRO A  1 793  ? 164.406 203.294 238.289 1.00 63.75  ? 793  PRO A  N   1 
ATOM   5808  C CA  . PRO A  1 793  ? 163.742 204.577 238.025 1.00 57.07  ? 793  PRO A  CA  1 
ATOM   5809  C C   . PRO A  1 793  ? 164.106 205.658 239.026 1.00 60.91  ? 793  PRO A  C   1 
ATOM   5810  O O   . PRO A  1 793  ? 164.109 206.842 238.667 1.00 60.50  ? 793  PRO A  O   1 
ATOM   5811  C CB  . PRO A  1 793  ? 162.253 204.219 238.086 1.00 60.32  ? 793  PRO A  CB  1 
ATOM   5812  C CG  . PRO A  1 793  ? 162.189 203.033 238.972 1.00 62.60  ? 793  PRO A  CG  1 
ATOM   5813  C CD  . PRO A  1 793  ? 163.461 202.264 238.750 1.00 60.40  ? 793  PRO A  CD  1 
ATOM   5814  N N   . ILE A  1 794  ? 164.414 205.294 240.267 1.00 59.78  ? 794  ILE A  N   1 
ATOM   5815  C CA  . ILE A  1 794  ? 164.771 206.277 241.287 1.00 63.82  ? 794  ILE A  CA  1 
ATOM   5816  C C   . ILE A  1 794  ? 166.271 206.544 241.205 1.00 65.72  ? 794  ILE A  C   1 
ATOM   5817  O O   . ILE A  1 794  ? 167.090 205.649 241.442 1.00 58.71  ? 794  ILE A  O   1 
ATOM   5818  C CB  . ILE A  1 794  ? 164.355 205.801 242.688 1.00 65.70  ? 794  ILE A  CB  1 
ATOM   5819  C CG1 . ILE A  1 794  ? 164.847 206.777 243.763 1.00 59.99  ? 794  ILE A  CG1 1 
ATOM   5820  C CG2 . ILE A  1 794  ? 164.863 204.389 242.967 1.00 54.41  ? 794  ILE A  CG2 1 
ATOM   5821  C CD1 . ILE A  1 794  ? 164.338 208.195 243.587 1.00 61.42  ? 794  ILE A  CD1 1 
ATOM   5822  N N   . LYS A  1 795  ? 166.632 207.779 240.869 1.00 62.16  ? 795  LYS A  N   1 
ATOM   5823  C CA  . LYS A  1 795  ? 168.021 208.163 240.609 1.00 52.47  ? 795  LYS A  CA  1 
ATOM   5824  C C   . LYS A  1 795  ? 168.707 208.723 241.852 1.00 49.60  ? 795  LYS A  C   1 
ATOM   5825  O O   . LYS A  1 795  ? 169.219 209.840 241.852 1.00 51.93  ? 795  LYS A  O   1 
ATOM   5826  C CB  . LYS A  1 795  ? 168.063 209.170 239.467 1.00 46.46  ? 795  LYS A  CB  1 
ATOM   5827  C CG  . LYS A  1 795  ? 167.225 208.775 238.258 1.00 48.66  ? 795  LYS A  CG  1 
ATOM   5828  C CD  . LYS A  1 795  ? 167.756 207.524 237.579 1.00 52.34  ? 795  LYS A  CD  1 
ATOM   5829  C CE  . LYS A  1 795  ? 166.757 206.978 236.574 1.00 54.09  ? 795  LYS A  CE  1 
ATOM   5830  N NZ  . LYS A  1 795  ? 166.457 207.960 235.496 1.00 56.46  ? 795  LYS A  NZ  1 
ATOM   5831  N N   . ASP A  1 796  ? 168.712 207.944 242.933 1.00 56.75  ? 796  ASP A  N   1 
ATOM   5832  C CA  . ASP A  1 796  ? 169.402 208.318 244.168 1.00 51.31  ? 796  ASP A  CA  1 
ATOM   5833  C C   . ASP A  1 796  ? 170.872 207.897 244.107 1.00 42.17  ? 796  ASP A  C   1 
ATOM   5834  O O   . ASP A  1 796  ? 171.319 206.968 244.778 1.00 47.28  ? 796  ASP A  O   1 
ATOM   5835  C CB  . ASP A  1 796  ? 168.700 207.696 245.367 1.00 58.40  ? 796  ASP A  CB  1 
ATOM   5836  C CG  . ASP A  1 796  ? 168.529 206.199 245.224 1.00 59.52  ? 796  ASP A  CG  1 
ATOM   5837  O OD1 . ASP A  1 796  ? 168.924 205.659 244.169 1.00 48.83  ? 796  ASP A  OD1 1 
ATOM   5838  O OD2 . ASP A  1 796  ? 167.997 205.563 246.157 1.00 52.29  ? 796  ASP A  OD2 1 
ATOM   5839  N N   . PHE A  1 797  ? 171.630 208.607 243.273 1.00 37.97  ? 797  PHE A  N   1 
ATOM   5840  C CA  . PHE A  1 797  ? 173.034 208.281 243.028 1.00 27.81  ? 797  PHE A  CA  1 
ATOM   5841  C C   . PHE A  1 797  ? 173.983 209.162 243.825 1.00 27.74  ? 797  PHE A  C   1 
ATOM   5842  O O   . PHE A  1 797  ? 175.062 209.516 243.346 1.00 26.00  ? 797  PHE A  O   1 
ATOM   5843  C CB  . PHE A  1 797  ? 173.331 208.375 241.535 1.00 27.09  ? 797  PHE A  CB  1 
ATOM   5844  C CG  . PHE A  1 797  ? 172.644 207.317 240.719 1.00 31.13  ? 797  PHE A  CG  1 
ATOM   5845  C CD1 . PHE A  1 797  ? 172.916 205.977 240.926 1.00 33.73  ? 797  PHE A  CD1 1 
ATOM   5846  C CD2 . PHE A  1 797  ? 171.729 207.661 239.746 1.00 38.91  ? 797  PHE A  CD2 1 
ATOM   5847  C CE1 . PHE A  1 797  ? 172.283 205.005 240.180 1.00 40.13  ? 797  PHE A  CE1 1 
ATOM   5848  C CE2 . PHE A  1 797  ? 171.097 206.691 238.998 1.00 37.00  ? 797  PHE A  CE2 1 
ATOM   5849  C CZ  . PHE A  1 797  ? 171.374 205.363 239.217 1.00 38.16  ? 797  PHE A  CZ  1 
ATOM   5850  N N   . GLY A  1 798  ? 173.604 209.535 245.044 1.00 34.76  ? 798  GLY A  N   1 
ATOM   5851  C CA  . GLY A  1 798  ? 174.511 210.264 245.909 1.00 36.07  ? 798  GLY A  CA  1 
ATOM   5852  C C   . GLY A  1 798  ? 174.815 211.674 245.472 1.00 31.02  ? 798  GLY A  C   1 
ATOM   5853  O O   . GLY A  1 798  ? 175.856 212.216 245.846 1.00 24.74  ? 798  GLY A  O   1 
ATOM   5854  N N   . GLY A  1 799  ? 173.936 212.292 244.689 1.00 34.76  ? 799  GLY A  N   1 
ATOM   5855  C CA  . GLY A  1 799  ? 174.143 213.648 244.231 1.00 34.26  ? 799  GLY A  CA  1 
ATOM   5856  C C   . GLY A  1 799  ? 174.806 213.763 242.880 1.00 34.69  ? 799  GLY A  C   1 
ATOM   5857  O O   . GLY A  1 799  ? 174.945 214.883 242.373 1.00 41.76  ? 799  GLY A  O   1 
ATOM   5858  N N   . PHE A  1 800  ? 175.217 212.650 242.282 1.00 27.61  ? 800  PHE A  N   1 
ATOM   5859  C CA  . PHE A  1 800  ? 175.784 212.654 240.943 1.00 23.46  ? 800  PHE A  CA  1 
ATOM   5860  C C   . PHE A  1 800  ? 174.657 212.589 239.926 1.00 27.55  ? 800  PHE A  C   1 
ATOM   5861  O O   . PHE A  1 800  ? 173.772 211.734 240.021 1.00 35.91  ? 800  PHE A  O   1 
ATOM   5862  C CB  . PHE A  1 800  ? 176.744 211.480 240.761 1.00 19.61  ? 800  PHE A  CB  1 
ATOM   5863  C CG  . PHE A  1 800  ? 177.947 211.545 241.654 1.00 22.03  ? 800  PHE A  CG  1 
ATOM   5864  C CD1 . PHE A  1 800  ? 177.859 211.176 242.983 1.00 28.16  ? 800  PHE A  CD1 1 
ATOM   5865  C CD2 . PHE A  1 800  ? 179.164 211.979 241.167 1.00 24.65  ? 800  PHE A  CD2 1 
ATOM   5866  C CE1 . PHE A  1 800  ? 178.961 211.237 243.807 1.00 25.18  ? 800  PHE A  CE1 1 
ATOM   5867  C CE2 . PHE A  1 800  ? 180.267 212.040 241.988 1.00 27.00  ? 800  PHE A  CE2 1 
ATOM   5868  C CZ  . PHE A  1 800  ? 180.164 211.670 243.309 1.00 22.51  ? 800  PHE A  CZ  1 
ATOM   5869  N N   . ASN A  1 801  ? 174.687 213.501 238.964 1.00 31.42  ? 801  ASN A  N   1 
ATOM   5870  C CA  . ASN A  1 801  ? 173.594 213.698 238.021 1.00 27.86  ? 801  ASN A  CA  1 
ATOM   5871  C C   . ASN A  1 801  ? 173.979 213.081 236.682 1.00 39.08  ? 801  ASN A  C   1 
ATOM   5872  O O   . ASN A  1 801  ? 174.804 213.635 235.949 1.00 45.14  ? 801  ASN A  O   1 
ATOM   5873  C CB  . ASN A  1 801  ? 173.298 215.189 237.890 1.00 43.84  ? 801  ASN A  CB  1 
ATOM   5874  C CG  . ASN A  1 801  ? 172.064 215.472 237.078 1.00 46.23  ? 801  ASN A  CG  1 
ATOM   5875  O OD1 . ASN A  1 801  ? 171.737 214.749 236.139 1.00 47.31  ? 801  ASN A  OD1 1 
ATOM   5876  N ND2 . ASN A  1 801  ? 171.366 216.538 237.433 1.00 51.44  ? 801  ASN A  ND2 1 
ATOM   5877  N N   . PHE A  1 802  ? 173.376 211.937 236.365 1.00 40.60  ? 802  PHE A  N   1 
ATOM   5878  C CA  . PHE A  1 802  ? 173.635 211.236 235.116 1.00 31.59  ? 802  PHE A  CA  1 
ATOM   5879  C C   . PHE A  1 802  ? 172.520 211.412 234.098 1.00 33.64  ? 802  PHE A  C   1 
ATOM   5880  O O   . PHE A  1 802  ? 172.559 210.771 233.045 1.00 39.56  ? 802  PHE A  O   1 
ATOM   5881  C CB  . PHE A  1 802  ? 173.843 209.741 235.380 1.00 25.11  ? 802  PHE A  CB  1 
ATOM   5882  C CG  . PHE A  1 802  ? 174.906 209.448 236.389 1.00 22.18  ? 802  PHE A  CG  1 
ATOM   5883  C CD1 . PHE A  1 802  ? 176.239 209.653 236.091 1.00 17.11  ? 802  PHE A  CD1 1 
ATOM   5884  C CD2 . PHE A  1 802  ? 174.573 208.956 237.634 1.00 24.44  ? 802  PHE A  CD2 1 
ATOM   5885  C CE1 . PHE A  1 802  ? 177.210 209.383 237.018 1.00 12.55  ? 802  PHE A  CE1 1 
ATOM   5886  C CE2 . PHE A  1 802  ? 175.544 208.685 238.559 1.00 24.77  ? 802  PHE A  CE2 1 
ATOM   5887  C CZ  . PHE A  1 802  ? 176.860 208.898 238.251 1.00 17.43  ? 802  PHE A  CZ  1 
ATOM   5888  N N   . SER A  1 803  ? 171.522 212.249 234.385 1.00 42.52  ? 803  SER A  N   1 
ATOM   5889  C CA  . SER A  1 803  ? 170.425 212.436 233.444 1.00 43.02  ? 803  SER A  CA  1 
ATOM   5890  C C   . SER A  1 803  ? 170.908 212.949 232.097 1.00 42.41  ? 803  SER A  C   1 
ATOM   5891  O O   . SER A  1 803  ? 170.231 212.737 231.086 1.00 43.89  ? 803  SER A  O   1 
ATOM   5892  C CB  . SER A  1 803  ? 169.398 213.406 234.020 1.00 41.09  ? 803  SER A  CB  1 
ATOM   5893  O OG  . SER A  1 803  ? 169.985 214.669 234.278 1.00 40.82  ? 803  SER A  OG  1 
ATOM   5894  N N   . GLN A  1 804  ? 172.061 213.613 232.061 1.00 35.91  ? 804  GLN A  N   1 
ATOM   5895  C CA  . GLN A  1 804  ? 172.580 214.163 230.817 1.00 30.16  ? 804  GLN A  CA  1 
ATOM   5896  C C   . GLN A  1 804  ? 173.222 213.106 229.929 1.00 30.14  ? 804  GLN A  C   1 
ATOM   5897  O O   . GLN A  1 804  ? 173.493 213.387 228.758 1.00 29.40  ? 804  GLN A  O   1 
ATOM   5898  C CB  . GLN A  1 804  ? 173.597 215.262 231.125 1.00 36.15  ? 804  GLN A  CB  1 
ATOM   5899  C CG  . GLN A  1 804  ? 173.040 216.396 231.969 1.00 45.42  ? 804  GLN A  CG  1 
ATOM   5900  C CD  . GLN A  1 804  ? 174.100 217.061 232.816 1.00 53.03  ? 804  GLN A  CD  1 
ATOM   5901  O OE1 . GLN A  1 804  ? 174.602 218.131 232.475 1.00 59.26  ? 804  GLN A  OE1 1 
ATOM   5902  N NE2 . GLN A  1 804  ? 174.450 216.432 233.933 1.00 36.15  ? 804  GLN A  NE2 1 
ATOM   5903  N N   . ILE A  1 805  ? 173.468 211.905 230.451 1.00 31.31  ? 805  ILE A  N   1 
ATOM   5904  C CA  . ILE A  1 805  ? 174.054 210.831 229.654 1.00 29.00  ? 805  ILE A  CA  1 
ATOM   5905  C C   . ILE A  1 805  ? 173.220 209.565 229.659 1.00 35.46  ? 805  ILE A  C   1 
ATOM   5906  O O   . ILE A  1 805  ? 173.457 208.674 228.826 1.00 39.35  ? 805  ILE A  O   1 
ATOM   5907  C CB  . ILE A  1 805  ? 175.490 210.517 230.131 1.00 24.26  ? 805  ILE A  CB  1 
ATOM   5908  C CG1 . ILE A  1 805  ? 175.488 210.086 231.598 1.00 23.94  ? 805  ILE A  CG1 1 
ATOM   5909  C CG2 . ILE A  1 805  ? 176.396 211.714 229.915 1.00 31.66  ? 805  ILE A  CG2 1 
ATOM   5910  C CD1 . ILE A  1 805  ? 176.866 209.841 232.169 1.00 18.68  ? 805  ILE A  CD1 1 
ATOM   5911  N N   . LEU A  1 806  ? 172.255 209.411 230.559 1.00 35.76  ? 806  LEU A  N   1 
ATOM   5912  C CA  . LEU A  1 806  ? 171.367 208.267 230.512 1.00 33.51  ? 806  LEU A  CA  1 
ATOM   5913  C C   . LEU A  1 806  ? 170.341 208.439 229.394 1.00 40.42  ? 806  LEU A  C   1 
ATOM   5914  O O   . LEU A  1 806  ? 170.111 209.551 228.915 1.00 50.05  ? 806  LEU A  O   1 
ATOM   5915  C CB  . LEU A  1 806  ? 170.662 208.089 231.852 1.00 38.63  ? 806  LEU A  CB  1 
ATOM   5916  C CG  . LEU A  1 806  ? 171.495 207.440 232.956 1.00 31.59  ? 806  LEU A  CG  1 
ATOM   5917  C CD1 . LEU A  1 806  ? 170.900 207.772 234.308 1.00 33.79  ? 806  LEU A  CD1 1 
ATOM   5918  C CD2 . LEU A  1 806  ? 171.564 205.934 232.758 1.00 19.89  ? 806  LEU A  CD2 1 
ATOM   5919  N N   . PRO A  1 807  ? 169.714 207.346 228.960 1.00 38.69  ? 807  PRO A  N   1 
ATOM   5920  C CA  . PRO A  1 807  ? 168.739 207.438 227.869 1.00 48.51  ? 807  PRO A  CA  1 
ATOM   5921  C C   . PRO A  1 807  ? 167.695 208.518 228.116 1.00 55.60  ? 807  PRO A  C   1 
ATOM   5922  O O   . PRO A  1 807  ? 167.385 208.867 229.256 1.00 64.44  ? 807  PRO A  O   1 
ATOM   5923  C CB  . PRO A  1 807  ? 168.103 206.047 227.849 1.00 51.55  ? 807  PRO A  CB  1 
ATOM   5924  C CG  . PRO A  1 807  ? 169.140 205.156 228.401 1.00 50.67  ? 807  PRO A  CG  1 
ATOM   5925  C CD  . PRO A  1 807  ? 169.901 205.958 229.413 1.00 37.55  ? 807  PRO A  CD  1 
ATOM   5926  N N   . ASP A  1 808  ? 167.160 209.054 227.017 1.00 60.97  ? 808  ASP A  N   1 
ATOM   5927  C CA  . ASP A  1 808  ? 166.060 210.014 227.035 1.00 70.47  ? 808  ASP A  CA  1 
ATOM   5928  C C   . ASP A  1 808  ? 164.823 209.302 226.500 1.00 70.39  ? 808  ASP A  C   1 
ATOM   5929  O O   . ASP A  1 808  ? 164.595 209.272 225.282 1.00 64.93  ? 808  ASP A  O   1 
ATOM   5930  C CB  . ASP A  1 808  ? 166.393 211.248 226.195 1.00 68.78  ? 808  ASP A  CB  1 
ATOM   5931  C CG  . ASP A  1 808  ? 165.455 212.404 226.467 1.00 77.16  ? 808  ASP A  CG  1 
ATOM   5932  O OD1 . ASP A  1 808  ? 164.398 212.175 227.093 1.00 78.27  ? 808  ASP A  OD1 1 
ATOM   5933  O OD2 . ASP A  1 808  ? 165.779 213.542 226.067 1.00 86.07  ? 808  ASP A  OD2 1 
ATOM   5934  N N   . PRO A  1 809  ? 163.995 208.710 227.365 1.00 66.89  ? 809  PRO A  N   1 
ATOM   5935  C CA  . PRO A  1 809  ? 162.968 207.775 226.870 1.00 62.29  ? 809  PRO A  CA  1 
ATOM   5936  C C   . PRO A  1 809  ? 161.976 208.388 225.898 1.00 76.30  ? 809  PRO A  C   1 
ATOM   5937  O O   . PRO A  1 809  ? 161.513 207.693 224.985 1.00 75.43  ? 809  PRO A  O   1 
ATOM   5938  C CB  . PRO A  1 809  ? 162.271 207.313 228.158 1.00 60.10  ? 809  PRO A  CB  1 
ATOM   5939  C CG  . PRO A  1 809  ? 163.221 207.635 229.263 1.00 66.20  ? 809  PRO A  CG  1 
ATOM   5940  C CD  . PRO A  1 809  ? 163.949 208.854 228.830 1.00 62.45  ? 809  PRO A  CD  1 
ATOM   5941  N N   . SER A  1 810  ? 161.633 209.666 226.059 1.00 76.50  ? 810  SER A  N   1 
ATOM   5942  C CA  . SER A  1 810  ? 160.560 210.257 225.266 1.00 69.12  ? 810  SER A  CA  1 
ATOM   5943  C C   . SER A  1 810  ? 160.879 210.304 223.777 1.00 70.63  ? 810  SER A  C   1 
ATOM   5944  O O   . SER A  1 810  ? 159.955 210.368 222.960 1.00 72.74  ? 810  SER A  O   1 
ATOM   5945  C CB  . SER A  1 810  ? 160.263 211.667 225.773 1.00 75.22  ? 810  SER A  CB  1 
ATOM   5946  O OG  . SER A  1 810  ? 161.425 212.476 225.721 1.00 73.24  ? 810  SER A  OG  1 
ATOM   5947  N N   . LYS A  1 811  ? 162.151 210.270 223.405 1.00 73.78  ? 811  LYS A  N   1 
ATOM   5948  C CA  . LYS A  1 811  ? 162.525 210.426 222.010 1.00 79.91  ? 811  LYS A  CA  1 
ATOM   5949  C C   . LYS A  1 811  ? 162.310 209.124 221.240 1.00 76.13  ? 811  LYS A  C   1 
ATOM   5950  O O   . LYS A  1 811  ? 162.349 208.037 221.822 1.00 80.58  ? 811  LYS A  O   1 
ATOM   5951  C CB  . LYS A  1 811  ? 163.983 210.857 221.905 1.00 78.09  ? 811  LYS A  CB  1 
ATOM   5952  C CG  . LYS A  1 811  ? 164.278 212.181 222.596 1.00 79.30  ? 811  LYS A  CG  1 
ATOM   5953  C CD  . LYS A  1 811  ? 163.563 213.334 221.912 1.00 75.16  ? 811  LYS A  CD  1 
ATOM   5954  C CE  . LYS A  1 811  ? 163.843 214.658 222.601 1.00 81.87  ? 811  LYS A  CE  1 
ATOM   5955  N NZ  . LYS A  1 811  ? 163.198 215.797 221.890 1.00 83.56  ? 811  LYS A  NZ  1 
ATOM   5956  N N   . PRO A  1 812  ? 162.079 209.207 219.925 1.00 72.36  ? 812  PRO A  N   1 
ATOM   5957  C CA  . PRO A  1 812  ? 161.810 207.979 219.160 1.00 78.32  ? 812  PRO A  CA  1 
ATOM   5958  C C   . PRO A  1 812  ? 162.942 206.976 219.228 1.00 81.80  ? 812  PRO A  C   1 
ATOM   5959  O O   . PRO A  1 812  ? 162.684 205.766 219.265 1.00 79.35  ? 812  PRO A  O   1 
ATOM   5960  C CB  . PRO A  1 812  ? 161.597 208.491 217.729 1.00 82.94  ? 812  PRO A  CB  1 
ATOM   5961  C CG  . PRO A  1 812  ? 162.265 209.822 217.691 1.00 77.78  ? 812  PRO A  CG  1 
ATOM   5962  C CD  . PRO A  1 812  ? 162.110 210.399 219.061 1.00 79.26  ? 812  PRO A  CD  1 
ATOM   5963  N N   . SER A  1 813  ? 164.187 207.439 219.247 1.00 91.33  ? 813  SER A  N   1 
ATOM   5964  C CA  . SER A  1 813  ? 165.343 206.600 219.521 1.00 78.38  ? 813  SER A  CA  1 
ATOM   5965  C C   . SER A  1 813  ? 165.809 206.905 220.934 1.00 71.79  ? 813  SER A  C   1 
ATOM   5966  O O   . SER A  1 813  ? 166.044 208.069 221.277 1.00 63.91  ? 813  SER A  O   1 
ATOM   5967  C CB  . SER A  1 813  ? 166.467 206.853 218.514 1.00 61.05  ? 813  SER A  CB  1 
ATOM   5968  O OG  . SER A  1 813  ? 166.880 208.207 218.541 1.00 58.46  ? 813  SER A  OG  1 
ATOM   5969  N N   . LYS A  1 814  ? 165.950 205.865 221.748 1.00 76.95  ? 814  LYS A  N   1 
ATOM   5970  C CA  . LYS A  1 814  ? 166.191 206.065 223.169 1.00 71.52  ? 814  LYS A  CA  1 
ATOM   5971  C C   . LYS A  1 814  ? 167.658 206.371 223.434 1.00 63.27  ? 814  LYS A  C   1 
ATOM   5972  O O   . LYS A  1 814  ? 168.310 205.683 224.227 1.00 62.42  ? 814  LYS A  O   1 
ATOM   5973  C CB  . LYS A  1 814  ? 165.748 204.831 223.954 1.00 64.96  ? 814  LYS A  CB  1 
ATOM   5974  C CG  . LYS A  1 814  ? 164.262 204.544 223.841 1.00 75.90  ? 814  LYS A  CG  1 
ATOM   5975  C CD  . LYS A  1 814  ? 163.861 203.331 224.655 1.00 78.86  ? 814  LYS A  CD  1 
ATOM   5976  C CE  . LYS A  1 814  ? 162.352 203.165 224.673 1.00 80.40  ? 814  LYS A  CE  1 
ATOM   5977  N NZ  . LYS A  1 814  ? 161.799 202.862 223.324 1.00 91.04  ? 814  LYS A  NZ  1 
ATOM   5978  N N   . ARG A  1 815  ? 168.184 207.392 222.767 1.00 59.49  ? 815  ARG A  N   1 
ATOM   5979  C CA  . ARG A  1 815  ? 169.537 207.867 223.000 1.00 49.70  ? 815  ARG A  CA  1 
ATOM   5980  C C   . ARG A  1 815  ? 169.546 208.903 224.116 1.00 49.59  ? 815  ARG A  C   1 
ATOM   5981  O O   . ARG A  1 815  ? 168.531 209.523 224.434 1.00 53.89  ? 815  ARG A  O   1 
ATOM   5982  C CB  . ARG A  1 815  ? 170.126 208.469 221.723 1.00 54.14  ? 815  ARG A  CB  1 
ATOM   5983  C CG  . ARG A  1 815  ? 170.427 207.444 220.649 1.00 60.83  ? 815  ARG A  CG  1 
ATOM   5984  C CD  . ARG A  1 815  ? 171.419 207.978 219.633 1.00 43.80  ? 815  ARG A  CD  1 
ATOM   5985  N NE  . ARG A  1 815  ? 170.850 209.040 218.810 1.00 37.46  ? 815  ARG A  NE  1 
ATOM   5986  C CZ  . ARG A  1 815  ? 170.315 208.864 217.605 1.00 45.47  ? 815  ARG A  CZ  1 
ATOM   5987  N NH1 . ARG A  1 815  ? 170.263 207.659 217.052 1.00 42.05  ? 815  ARG A  NH1 1 
ATOM   5988  N NH2 . ARG A  1 815  ? 169.829 209.905 216.948 1.00 48.37  ? 815  ARG A  NH2 1 
ATOM   5989  N N   . SER A  1 816  ? 170.719 209.087 224.709 1.00 38.33  ? 816  SER A  N   1 
ATOM   5990  C CA  . SER A  1 816  ? 170.872 210.056 225.777 1.00 36.84  ? 816  SER A  CA  1 
ATOM   5991  C C   . SER A  1 816  ? 170.879 211.465 225.197 1.00 39.17  ? 816  SER A  C   1 
ATOM   5992  O O   . SER A  1 816  ? 170.840 211.669 223.982 1.00 53.23  ? 816  SER A  O   1 
ATOM   5993  C CB  . SER A  1 816  ? 172.148 209.780 226.562 1.00 30.93  ? 816  SER A  CB  1 
ATOM   5994  O OG  . SER A  1 816  ? 173.285 209.868 225.727 1.00 38.13  ? 816  SER A  OG  1 
ATOM   5995  N N   . PHE A  1 817  ? 170.914 212.459 226.082 1.00 38.86  ? 817  PHE A  N   1 
ATOM   5996  C CA  . PHE A  1 817  ? 170.951 213.842 225.625 1.00 30.85  ? 817  PHE A  CA  1 
ATOM   5997  C C   . PHE A  1 817  ? 172.246 214.133 224.881 1.00 33.82  ? 817  PHE A  C   1 
ATOM   5998  O O   . PHE A  1 817  ? 172.230 214.656 223.762 1.00 40.28  ? 817  PHE A  O   1 
ATOM   5999  C CB  . PHE A  1 817  ? 170.790 214.786 226.814 1.00 38.42  ? 817  PHE A  CB  1 
ATOM   6000  C CG  . PHE A  1 817  ? 170.766 216.235 226.436 1.00 41.48  ? 817  PHE A  CG  1 
ATOM   6001  C CD1 . PHE A  1 817  ? 171.938 216.964 226.354 1.00 43.65  ? 817  PHE A  CD1 1 
ATOM   6002  C CD2 . PHE A  1 817  ? 169.571 216.871 226.167 1.00 41.28  ? 817  PHE A  CD2 1 
ATOM   6003  C CE1 . PHE A  1 817  ? 171.918 218.295 226.008 1.00 42.90  ? 817  PHE A  CE1 1 
ATOM   6004  C CE2 . PHE A  1 817  ? 169.544 218.203 225.820 1.00 40.09  ? 817  PHE A  CE2 1 
ATOM   6005  C CZ  . PHE A  1 817  ? 170.719 218.916 225.740 1.00 41.30  ? 817  PHE A  CZ  1 
ATOM   6006  N N   . ILE A  1 818  ? 173.382 213.788 225.486 1.00 37.05  ? 818  ILE A  N   1 
ATOM   6007  C CA  . ILE A  1 818  ? 174.669 214.102 224.878 1.00 33.85  ? 818  ILE A  CA  1 
ATOM   6008  C C   . ILE A  1 818  ? 174.857 213.322 223.584 1.00 33.33  ? 818  ILE A  C   1 
ATOM   6009  O O   . ILE A  1 818  ? 175.443 213.828 222.622 1.00 41.07  ? 818  ILE A  O   1 
ATOM   6010  C CB  . ILE A  1 818  ? 175.805 213.841 225.884 1.00 23.56  ? 818  ILE A  CB  1 
ATOM   6011  C CG1 . ILE A  1 818  ? 175.964 215.058 226.799 1.00 32.10  ? 818  ILE A  CG1 1 
ATOM   6012  C CG2 . ILE A  1 818  ? 177.106 213.533 225.162 1.00 33.96  ? 818  ILE A  CG2 1 
ATOM   6013  C CD1 . ILE A  1 818  ? 176.832 214.832 228.017 1.00 39.65  ? 818  ILE A  CD1 1 
ATOM   6014  N N   . GLU A  1 819  ? 174.366 212.082 223.534 1.00 42.19  ? 819  GLU A  N   1 
ATOM   6015  C CA  . GLU A  1 819  ? 174.481 211.302 222.306 1.00 37.49  ? 819  GLU A  CA  1 
ATOM   6016  C C   . GLU A  1 819  ? 173.753 211.981 221.154 1.00 36.20  ? 819  GLU A  C   1 
ATOM   6017  O O   . GLU A  1 819  ? 174.222 211.950 220.011 1.00 43.83  ? 819  GLU A  O   1 
ATOM   6018  C CB  . GLU A  1 819  ? 173.930 209.894 222.518 1.00 34.09  ? 819  GLU A  CB  1 
ATOM   6019  C CG  . GLU A  1 819  ? 174.867 208.959 223.252 1.00 32.85  ? 819  GLU A  CG  1 
ATOM   6020  C CD  . GLU A  1 819  ? 174.258 207.590 223.471 1.00 38.99  ? 819  GLU A  CD  1 
ATOM   6021  O OE1 . GLU A  1 819  ? 174.635 206.648 222.747 1.00 35.03  ? 819  GLU A  OE1 1 
ATOM   6022  O OE2 . GLU A  1 819  ? 173.393 207.456 224.360 1.00 49.92  ? 819  GLU A  OE2 1 
ATOM   6023  N N   . ASP A  1 820  ? 172.604 212.601 221.433 1.00 34.62  ? 820  ASP A  N   1 
ATOM   6024  C CA  . ASP A  1 820  ? 171.852 213.273 220.380 1.00 34.76  ? 820  ASP A  CA  1 
ATOM   6025  C C   . ASP A  1 820  ? 172.596 214.476 219.824 1.00 37.85  ? 820  ASP A  C   1 
ATOM   6026  O O   . ASP A  1 820  ? 172.384 214.836 218.662 1.00 37.95  ? 820  ASP A  O   1 
ATOM   6027  C CB  . ASP A  1 820  ? 170.485 213.707 220.905 1.00 36.74  ? 820  ASP A  CB  1 
ATOM   6028  C CG  . ASP A  1 820  ? 169.543 212.543 221.102 1.00 46.63  ? 820  ASP A  CG  1 
ATOM   6029  O OD1 . ASP A  1 820  ? 169.951 211.396 220.825 1.00 50.90  ? 820  ASP A  OD1 1 
ATOM   6030  O OD2 . ASP A  1 820  ? 168.396 212.776 221.538 1.00 62.98  ? 820  ASP A  OD2 1 
ATOM   6031  N N   . LEU A  1 821  ? 173.462 215.104 220.619 1.00 31.21  ? 821  LEU A  N   1 
ATOM   6032  C CA  . LEU A  1 821  ? 174.363 216.107 220.068 1.00 30.24  ? 821  LEU A  CA  1 
ATOM   6033  C C   . LEU A  1 821  ? 175.378 215.458 219.141 1.00 33.84  ? 821  LEU A  C   1 
ATOM   6034  O O   . LEU A  1 821  ? 175.605 215.932 218.023 1.00 50.93  ? 821  LEU A  O   1 
ATOM   6035  C CB  . LEU A  1 821  ? 175.077 216.857 221.192 1.00 26.11  ? 821  LEU A  CB  1 
ATOM   6036  C CG  . LEU A  1 821  ? 174.341 218.049 221.799 1.00 37.70  ? 821  LEU A  CG  1 
ATOM   6037  C CD1 . LEU A  1 821  ? 173.150 217.598 222.624 1.00 39.36  ? 821  LEU A  CD1 1 
ATOM   6038  C CD2 . LEU A  1 821  ? 175.298 218.878 222.635 1.00 40.68  ? 821  LEU A  CD2 1 
ATOM   6039  N N   . LEU A  1 822  ? 175.982 214.353 219.582 1.00 35.39  ? 822  LEU A  N   1 
ATOM   6040  C CA  . LEU A  1 822  ? 176.998 213.691 218.775 1.00 27.46  ? 822  LEU A  CA  1 
ATOM   6041  C C   . LEU A  1 822  ? 176.448 213.296 217.413 1.00 28.26  ? 822  LEU A  C   1 
ATOM   6042  O O   . LEU A  1 822  ? 177.116 213.478 216.390 1.00 34.16  ? 822  LEU A  O   1 
ATOM   6043  C CB  . LEU A  1 822  ? 177.523 212.462 219.512 1.00 29.93  ? 822  LEU A  CB  1 
ATOM   6044  C CG  . LEU A  1 822  ? 178.224 212.739 220.841 1.00 21.45  ? 822  LEU A  CG  1 
ATOM   6045  C CD1 . LEU A  1 822  ? 178.541 211.439 221.554 1.00 27.71  ? 822  LEU A  CD1 1 
ATOM   6046  C CD2 . LEU A  1 822  ? 179.488 213.553 220.623 1.00 24.33  ? 822  LEU A  CD2 1 
ATOM   6047  N N   . PHE A  1 823  ? 175.229 212.759 217.377 1.00 27.35  ? 823  PHE A  N   1 
ATOM   6048  C CA  . PHE A  1 823  ? 174.660 212.327 216.109 1.00 32.54  ? 823  PHE A  CA  1 
ATOM   6049  C C   . PHE A  1 823  ? 174.328 213.500 215.200 1.00 35.21  ? 823  PHE A  C   1 
ATOM   6050  O O   . PHE A  1 823  ? 174.139 213.299 213.997 1.00 36.50  ? 823  PHE A  O   1 
ATOM   6051  C CB  . PHE A  1 823  ? 173.419 211.472 216.355 1.00 31.63  ? 823  PHE A  CB  1 
ATOM   6052  C CG  . PHE A  1 823  ? 173.712 210.000 216.410 1.00 36.33  ? 823  PHE A  CG  1 
ATOM   6053  C CD1 . PHE A  1 823  ? 174.266 209.431 217.544 1.00 36.98  ? 823  PHE A  CD1 1 
ATOM   6054  C CD2 . PHE A  1 823  ? 173.448 209.186 215.323 1.00 37.94  ? 823  PHE A  CD2 1 
ATOM   6055  C CE1 . PHE A  1 823  ? 174.545 208.079 217.592 1.00 36.87  ? 823  PHE A  CE1 1 
ATOM   6056  C CE2 . PHE A  1 823  ? 173.726 207.835 215.368 1.00 43.87  ? 823  PHE A  CE2 1 
ATOM   6057  C CZ  . PHE A  1 823  ? 174.275 207.282 216.504 1.00 43.04  ? 823  PHE A  CZ  1 
ATOM   6058  N N   . ASN A  1 824  ? 174.263 214.715 215.739 1.00 28.87  ? 824  ASN A  N   1 
ATOM   6059  C CA  . ASN A  1 824  ? 174.084 215.902 214.914 1.00 32.11  ? 824  ASN A  CA  1 
ATOM   6060  C C   . ASN A  1 824  ? 175.402 216.455 214.395 1.00 35.79  ? 824  ASN A  C   1 
ATOM   6061  O O   . ASN A  1 824  ? 175.415 217.151 213.373 1.00 39.40  ? 824  ASN A  O   1 
ATOM   6062  C CB  . ASN A  1 824  ? 173.366 216.998 215.704 1.00 47.64  ? 824  ASN A  CB  1 
ATOM   6063  C CG  . ASN A  1 824  ? 171.903 216.696 215.921 1.00 50.52  ? 824  ASN A  CG  1 
ATOM   6064  O OD1 . ASN A  1 824  ? 171.424 215.608 215.601 1.00 36.41  ? 824  ASN A  OD1 1 
ATOM   6065  N ND2 . ASN A  1 824  ? 171.180 217.661 216.477 1.00 64.15  ? 824  ASN A  ND2 1 
ATOM   6066  N N   . LYS A  1 825  ? 176.509 216.169 215.076 1.00 33.13  ? 825  LYS A  N   1 
ATOM   6067  C CA  . LYS A  1 825  ? 177.798 216.735 214.709 1.00 39.04  ? 825  LYS A  CA  1 
ATOM   6068  C C   . LYS A  1 825  ? 178.491 215.967 213.593 1.00 46.36  ? 825  LYS A  C   1 
ATOM   6069  O O   . LYS A  1 825  ? 179.517 216.436 213.088 1.00 60.21  ? 825  LYS A  O   1 
ATOM   6070  C CB  . LYS A  1 825  ? 178.704 216.791 215.940 1.00 37.24  ? 825  LYS A  CB  1 
ATOM   6071  C CG  . LYS A  1 825  ? 178.106 217.567 217.105 1.00 29.85  ? 825  LYS A  CG  1 
ATOM   6072  C CD  . LYS A  1 825  ? 178.076 219.062 216.851 1.00 48.06  ? 825  LYS A  CD  1 
ATOM   6073  C CE  . LYS A  1 825  ? 179.411 219.706 217.163 1.00 45.94  ? 825  LYS A  CE  1 
ATOM   6074  N NZ  . LYS A  1 825  ? 179.277 221.181 217.295 1.00 62.77  ? 825  LYS A  NZ  1 
ATOM   6075  N N   . VAL A  1 826  ? 177.970 214.811 213.197 1.00 40.12  ? 826  VAL A  N   1 
ATOM   6076  C CA  . VAL A  1 826  ? 178.465 214.071 212.042 1.00 45.95  ? 826  VAL A  CA  1 
ATOM   6077  C C   . VAL A  1 826  ? 177.365 214.077 210.991 1.00 51.60  ? 826  VAL A  C   1 
ATOM   6078  O O   . VAL A  1 826  ? 176.244 213.624 211.253 1.00 47.24  ? 826  VAL A  O   1 
ATOM   6079  C CB  . VAL A  1 826  ? 178.870 212.636 212.410 1.00 44.86  ? 826  VAL A  CB  1 
ATOM   6080  C CG1 . VAL A  1 826  ? 179.648 211.994 211.271 1.00 37.03  ? 826  VAL A  CG1 1 
ATOM   6081  C CG2 . VAL A  1 826  ? 179.681 212.622 213.695 1.00 44.22  ? 826  VAL A  CG2 1 
ATOM   6082  N N   . THR A  1 827  ? 177.682 214.590 209.807 1.00 60.59  ? 827  THR A  N   1 
ATOM   6083  C CA  . THR A  1 827  ? 176.722 214.697 208.717 1.00 55.48  ? 827  THR A  CA  1 
ATOM   6084  C C   . THR A  1 827  ? 177.052 213.675 207.638 1.00 61.22  ? 827  THR A  C   1 
ATOM   6085  O O   . THR A  1 827  ? 178.162 213.675 207.095 1.00 60.44  ? 827  THR A  O   1 
ATOM   6086  C CB  . THR A  1 827  ? 176.728 216.108 208.128 1.00 58.52  ? 827  THR A  CB  1 
ATOM   6087  O OG1 . THR A  1 827  ? 178.064 216.468 207.753 1.00 49.55  ? 827  THR A  OG1 1 
ATOM   6088  C CG2 . THR A  1 827  ? 176.203 217.112 209.142 1.00 58.40  ? 827  THR A  CG2 1 
ATOM   6089  N N   . LEU A  1 828  ? 176.083 212.821 207.322 1.00 61.40  ? 828  LEU A  N   1 
ATOM   6090  C CA  . LEU A  1 828  ? 176.246 211.768 206.333 1.00 67.24  ? 828  LEU A  CA  1 
ATOM   6091  C C   . LEU A  1 828  ? 175.444 212.097 205.081 1.00 77.03  ? 828  LEU A  C   1 
ATOM   6092  O O   . LEU A  1 828  ? 174.393 212.741 205.145 1.00 71.48  ? 828  LEU A  O   1 
ATOM   6093  C CB  . LEU A  1 828  ? 175.803 210.409 206.885 1.00 58.25  ? 828  LEU A  CB  1 
ATOM   6094  C CG  . LEU A  1 828  ? 176.712 209.766 207.934 1.00 56.15  ? 828  LEU A  CG  1 
ATOM   6095  C CD1 . LEU A  1 828  ? 176.741 210.585 209.216 1.00 55.15  ? 828  LEU A  CD1 1 
ATOM   6096  C CD2 . LEU A  1 828  ? 176.273 208.337 208.217 1.00 61.61  ? 828  LEU A  CD2 1 
ATOM   6097  N N   . ALA A  1 829  ? 175.956 211.646 203.934 1.00 80.71  ? 829  ALA A  N   1 
ATOM   6098  C CA  . ALA A  1 829  ? 175.347 211.993 202.656 1.00 85.03  ? 829  ALA A  CA  1 
ATOM   6099  C C   . ALA A  1 829  ? 174.016 211.291 202.420 1.00 84.64  ? 829  ALA A  C   1 
ATOM   6100  O O   . ALA A  1 829  ? 173.188 211.808 201.662 1.00 84.49  ? 829  ALA A  O   1 
ATOM   6101  C CB  . ALA A  1 829  ? 176.307 211.662 201.511 1.00 87.35  ? 829  ALA A  CB  1 
ATOM   6102  N N   . ASP A  1 830  ? 173.786 210.136 203.043 1.00 76.83  ? 830  ASP A  N   1 
ATOM   6103  C CA  . ASP A  1 830  ? 172.584 209.352 202.805 1.00 81.87  ? 830  ASP A  CA  1 
ATOM   6104  C C   . ASP A  1 830  ? 171.909 209.008 204.127 1.00 83.86  ? 830  ASP A  C   1 
ATOM   6105  O O   . ASP A  1 830  ? 172.542 208.978 205.185 1.00 78.40  ? 830  ASP A  O   1 
ATOM   6106  C CB  . ASP A  1 830  ? 172.912 208.070 202.030 1.00 96.44  ? 830  ASP A  CB  1 
ATOM   6107  C CG  . ASP A  1 830  ? 174.139 207.367 202.570 1.00 79.05  ? 830  ASP A  CG  1 
ATOM   6108  O OD1 . ASP A  1 830  ? 174.682 207.832 203.593 1.00 81.69  ? 830  ASP A  OD1 1 
ATOM   6109  O OD2 . ASP A  1 830  ? 174.562 206.355 201.972 1.00 63.50  ? 830  ASP A  OD2 1 
ATOM   6110  N N   . ALA A  1 831  ? 170.604 208.742 204.050 1.00 80.77  ? 831  ALA A  N   1 
ATOM   6111  C CA  . ALA A  1 831  ? 169.798 208.454 205.228 1.00 84.45  ? 831  ALA A  CA  1 
ATOM   6112  C C   . ALA A  1 831  ? 168.882 207.268 204.968 1.00 86.23  ? 831  ALA A  C   1 
ATOM   6113  O O   . ALA A  1 831  ? 168.278 207.157 203.897 1.00 91.73  ? 831  ALA A  O   1 
ATOM   6114  C CB  . ALA A  1 831  ? 168.956 209.667 205.639 1.00 70.73  ? 831  ALA A  CB  1 
ATOM   6115  N N   . GLY A  1 832  ? 168.783 206.385 205.961 1.00 86.00  ? 832  GLY A  N   1 
ATOM   6116  C CA  . GLY A  1 832  ? 167.878 205.256 205.919 1.00 72.53  ? 832  GLY A  CA  1 
ATOM   6117  C C   . GLY A  1 832  ? 168.273 204.132 204.987 1.00 71.27  ? 832  GLY A  C   1 
ATOM   6118  O O   . GLY A  1 832  ? 167.609 203.089 204.994 1.00 79.68  ? 832  GLY A  O   1 
ATOM   6119  N N   . PHE A  1 833  ? 169.315 204.309 204.173 1.00 70.42  ? 833  PHE A  N   1 
ATOM   6120  C CA  . PHE A  1 833  ? 169.873 203.234 203.359 1.00 72.45  ? 833  PHE A  CA  1 
ATOM   6121  C C   . PHE A  1 833  ? 168.929 202.729 202.270 1.00 77.05  ? 833  PHE A  C   1 
ATOM   6122  O O   . PHE A  1 833  ? 169.287 201.809 201.529 1.00 57.92  ? 833  PHE A  O   1 
ATOM   6123  C CB  . PHE A  1 833  ? 170.302 202.066 204.250 1.00 69.22  ? 833  PHE A  CB  1 
ATOM   6124  C CG  . PHE A  1 833  ? 171.512 202.364 205.085 1.00 76.93  ? 833  PHE A  CG  1 
ATOM   6125  C CD1 . PHE A  1 833  ? 172.769 202.396 204.510 1.00 54.03  ? 833  PHE A  CD1 1 
ATOM   6126  C CD2 . PHE A  1 833  ? 171.394 202.618 206.440 1.00 75.67  ? 833  PHE A  CD2 1 
ATOM   6127  C CE1 . PHE A  1 833  ? 173.883 202.674 205.268 1.00 49.88  ? 833  PHE A  CE1 1 
ATOM   6128  C CE2 . PHE A  1 833  ? 172.508 202.895 207.203 1.00 52.25  ? 833  PHE A  CE2 1 
ATOM   6129  C CZ  . PHE A  1 833  ? 173.753 202.923 206.616 1.00 50.85  ? 833  PHE A  CZ  1 
ATOM   6130  N N   . ILE A  1 834  ? 167.731 203.299 202.159 1.00 86.04  ? 834  ILE A  N   1 
ATOM   6131  C CA  . ILE A  1 834  ? 166.798 202.959 201.089 1.00 71.09  ? 834  ILE A  CA  1 
ATOM   6132  C C   . ILE A  1 834  ? 166.700 204.149 200.146 1.00 66.64  ? 834  ILE A  C   1 
ATOM   6133  O O   . ILE A  1 834  ? 166.321 205.251 200.559 1.00 73.69  ? 834  ILE A  O   1 
ATOM   6134  C CB  . ILE A  1 834  ? 165.415 202.579 201.641 1.00 70.07  ? 834  ILE A  CB  1 
ATOM   6135  C CG1 . ILE A  1 834  ? 165.503 201.315 202.501 1.00 62.14  ? 834  ILE A  CG1 1 
ATOM   6136  C CG2 . ILE A  1 834  ? 164.421 202.386 200.502 1.00 67.84  ? 834  ILE A  CG2 1 
ATOM   6137  C CD1 . ILE A  1 834  ? 165.960 200.082 201.757 1.00 58.79  ? 834  ILE A  CD1 1 
ATOM   6138  N N   . LYS A  1 835  ? 167.041 203.928 198.878 1.00 54.37  ? 835  LYS A  N   1 
ATOM   6139  C CA  . LYS A  1 835  ? 166.867 204.931 197.831 1.00 59.63  ? 835  LYS A  CA  1 
ATOM   6140  C C   . LYS A  1 835  ? 166.348 204.206 196.600 1.00 57.84  ? 835  LYS A  C   1 
ATOM   6141  O O   . LYS A  1 835  ? 167.113 203.526 195.907 1.00 60.37  ? 835  LYS A  O   1 
ATOM   6142  C CB  . LYS A  1 835  ? 168.171 205.669 197.530 1.00 69.33  ? 835  LYS A  CB  1 
ATOM   6143  C CG  . LYS A  1 835  ? 168.089 206.605 196.333 1.00 68.04  ? 835  LYS A  CG  1 
ATOM   6144  C CD  . LYS A  1 835  ? 169.218 207.619 196.349 1.00 62.74  ? 835  LYS A  CD  1 
ATOM   6145  C CE  . LYS A  1 835  ? 168.902 208.782 197.273 1.00 53.26  ? 835  LYS A  CE  1 
ATOM   6146  N NZ  . LYS A  1 835  ? 167.885 209.690 196.677 1.00 72.17  ? 835  LYS A  NZ  1 
ATOM   6147  N N   . GLN A  1 836  ? 165.058 204.355 196.327 1.00 61.26  ? 836  GLN A  N   1 
ATOM   6148  C CA  . GLN A  1 836  ? 164.403 203.556 195.309 1.00 60.72  ? 836  GLN A  CA  1 
ATOM   6149  C C   . GLN A  1 836  ? 164.715 204.094 193.918 1.00 61.99  ? 836  GLN A  C   1 
ATOM   6150  O O   . GLN A  1 836  ? 165.179 205.223 193.744 1.00 69.37  ? 836  GLN A  O   1 
ATOM   6151  C CB  . GLN A  1 836  ? 162.891 203.544 195.533 1.00 66.37  ? 836  GLN A  CB  1 
ATOM   6152  C CG  . GLN A  1 836  ? 162.473 203.169 196.944 1.00 64.40  ? 836  GLN A  CG  1 
ATOM   6153  C CD  . GLN A  1 836  ? 161.125 203.744 197.314 1.00 61.91  ? 836  GLN A  CD  1 
ATOM   6154  O OE1 . GLN A  1 836  ? 160.287 203.994 196.449 1.00 56.79  ? 836  GLN A  OE1 1 
ATOM   6155  N NE2 . GLN A  1 836  ? 160.913 203.971 198.605 1.00 70.70  ? 836  GLN A  NE2 1 
ATOM   6156  N N   . TYR A  1 837  ? 164.452 203.255 192.918 1.00 52.07  ? 837  TYR A  N   1 
ATOM   6157  C CA  . TYR A  1 837  ? 164.640 203.672 191.534 1.00 56.25  ? 837  TYR A  CA  1 
ATOM   6158  C C   . TYR A  1 837  ? 163.744 204.860 191.201 1.00 62.18  ? 837  TYR A  C   1 
ATOM   6159  O O   . TYR A  1 837  ? 164.182 205.824 190.565 1.00 70.08  ? 837  TYR A  O   1 
ATOM   6160  C CB  . TYR A  1 837  ? 164.361 202.491 190.604 1.00 60.72  ? 837  TYR A  CB  1 
ATOM   6161  C CG  . TYR A  1 837  ? 164.706 202.738 189.156 1.00 58.79  ? 837  TYR A  CG  1 
ATOM   6162  C CD1 . TYR A  1 837  ? 166.012 202.983 188.766 1.00 56.45  ? 837  TYR A  CD1 1 
ATOM   6163  C CD2 . TYR A  1 837  ? 163.726 202.707 188.177 1.00 65.59  ? 837  TYR A  CD2 1 
ATOM   6164  C CE1 . TYR A  1 837  ? 166.332 203.205 187.443 1.00 57.16  ? 837  TYR A  CE1 1 
ATOM   6165  C CE2 . TYR A  1 837  ? 164.035 202.925 186.852 1.00 61.97  ? 837  TYR A  CE2 1 
ATOM   6166  C CZ  . TYR A  1 837  ? 165.338 203.173 186.489 1.00 63.36  ? 837  TYR A  CZ  1 
ATOM   6167  O OH  . TYR A  1 837  ? 165.649 203.391 185.168 1.00 70.83  ? 837  TYR A  OH  1 
ATOM   6168  N N   . GLY A  1 838  ? 162.480 204.806 191.625 1.00 59.45  ? 838  GLY A  N   1 
ATOM   6169  C CA  . GLY A  1 838  ? 161.582 205.926 191.393 1.00 61.61  ? 838  GLY A  CA  1 
ATOM   6170  C C   . GLY A  1 838  ? 162.083 207.219 192.004 1.00 64.09  ? 838  GLY A  C   1 
ATOM   6171  O O   . GLY A  1 838  ? 161.951 208.290 191.409 1.00 68.51  ? 838  GLY A  O   1 
ATOM   6172  N N   . ASP A  1 839  ? 162.676 207.137 193.196 1.00 61.60  ? 839  ASP A  N   1 
ATOM   6173  C CA  . ASP A  1 839  ? 163.153 208.323 193.896 1.00 62.21  ? 839  ASP A  CA  1 
ATOM   6174  C C   . ASP A  1 839  ? 164.366 208.956 193.227 1.00 71.14  ? 839  ASP A  C   1 
ATOM   6175  O O   . ASP A  1 839  ? 164.751 210.065 193.611 1.00 76.57  ? 839  ASP A  O   1 
ATOM   6176  C CB  . ASP A  1 839  ? 163.516 207.969 195.343 1.00 57.27  ? 839  ASP A  CB  1 
ATOM   6177  C CG  . ASP A  1 839  ? 162.390 207.271 196.077 1.00 62.59  ? 839  ASP A  CG  1 
ATOM   6178  O OD1 . ASP A  1 839  ? 161.283 207.164 195.512 1.00 67.50  ? 839  ASP A  OD1 1 
ATOM   6179  O OD2 . ASP A  1 839  ? 162.613 206.824 197.221 1.00 67.71  ? 839  ASP A  OD2 1 
ATOM   6180  N N   . CYS A  1 840  ? 164.967 208.285 192.242 1.00 68.85  ? 840  CYS A  N   1 
ATOM   6181  C CA  . CYS A  1 840  ? 166.342 208.573 191.858 1.00 65.45  ? 840  CYS A  CA  1 
ATOM   6182  C C   . CYS A  1 840  ? 166.572 208.539 190.347 1.00 61.78  ? 840  CYS A  C   1 
ATOM   6183  O O   . CYS A  1 840  ? 167.729 208.530 189.913 1.00 63.33  ? 840  CYS A  O   1 
ATOM   6184  C CB  . CYS A  1 840  ? 167.240 207.568 192.603 1.00 69.97  ? 840  CYS A  CB  1 
ATOM   6185  S SG  . CYS A  1 840  ? 168.975 207.378 192.158 1.00 72.49  ? 840  CYS A  SG  1 
ATOM   6186  N N   . LEU A  1 841  ? 165.519 208.539 189.534 1.00 61.23  ? 841  LEU A  N   1 
ATOM   6187  C CA  . LEU A  1 841  ? 165.645 208.469 188.086 1.00 64.47  ? 841  LEU A  CA  1 
ATOM   6188  C C   . LEU A  1 841  ? 165.273 209.795 187.435 1.00 67.11  ? 841  LEU A  C   1 
ATOM   6189  O O   . LEU A  1 841  ? 164.522 210.603 187.986 1.00 71.25  ? 841  LEU A  O   1 
ATOM   6190  C CB  . LEU A  1 841  ? 164.766 207.349 187.519 1.00 60.79  ? 841  LEU A  CB  1 
ATOM   6191  C CG  . LEU A  1 841  ? 163.256 207.467 187.739 1.00 60.59  ? 841  LEU A  CG  1 
ATOM   6192  C CD1 . LEU A  1 841  ? 162.605 208.373 186.704 1.00 62.64  ? 841  LEU A  CD1 1 
ATOM   6193  C CD2 . LEU A  1 841  ? 162.619 206.090 187.722 1.00 62.76  ? 841  LEU A  CD2 1 
ATOM   6194  N N   . GLY A  1 842  ? 165.821 210.008 186.241 1.00 63.89  ? 842  GLY A  N   1 
ATOM   6195  C CA  . GLY A  1 842  ? 165.485 211.164 185.437 1.00 63.74  ? 842  GLY A  CA  1 
ATOM   6196  C C   . GLY A  1 842  ? 166.155 212.442 185.893 1.00 69.37  ? 842  GLY A  C   1 
ATOM   6197  O O   . GLY A  1 842  ? 167.374 212.593 185.765 1.00 70.01  ? 842  GLY A  O   1 
ATOM   6198  N N   . ASP A  1 843  ? 165.365 213.372 186.431 1.00 86.11  ? 843  ASP A  N   1 
ATOM   6199  C CA  . ASP A  1 843  ? 165.922 214.653 186.851 1.00 82.47  ? 843  ASP A  CA  1 
ATOM   6200  C C   . ASP A  1 843  ? 166.943 214.469 187.964 1.00 79.38  ? 843  ASP A  C   1 
ATOM   6201  O O   . ASP A  1 843  ? 167.925 215.216 188.041 1.00 76.40  ? 843  ASP A  O   1 
ATOM   6202  C CB  . ASP A  1 843  ? 164.805 215.592 187.309 1.00 67.31  ? 843  ASP A  CB  1 
ATOM   6203  C CG  . ASP A  1 843  ? 163.705 215.744 186.276 1.00 75.89  ? 843  ASP A  CG  1 
ATOM   6204  O OD1 . ASP A  1 843  ? 163.979 215.543 185.075 1.00 73.30  ? 843  ASP A  OD1 1 
ATOM   6205  O OD2 . ASP A  1 843  ? 162.565 216.068 186.668 1.00 91.57  ? 843  ASP A  OD2 1 
ATOM   6206  N N   . ILE A  1 844  ? 166.730 213.481 188.836 1.00 75.04  ? 844  ILE A  N   1 
ATOM   6207  C CA  . ILE A  1 844  ? 167.607 213.268 189.982 1.00 72.59  ? 844  ILE A  CA  1 
ATOM   6208  C C   . ILE A  1 844  ? 168.689 212.239 189.701 1.00 64.82  ? 844  ILE A  C   1 
ATOM   6209  O O   . ILE A  1 844  ? 169.543 212.001 190.565 1.00 63.62  ? 844  ILE A  O   1 
ATOM   6210  C CB  . ILE A  1 844  ? 166.810 212.860 191.238 1.00 71.20  ? 844  ILE A  CB  1 
ATOM   6211  C CG1 . ILE A  1 844  ? 165.317 213.161 191.069 1.00 68.51  ? 844  ILE A  CG1 1 
ATOM   6212  C CG2 . ILE A  1 844  ? 167.359 213.588 192.457 1.00 63.48  ? 844  ILE A  CG2 1 
ATOM   6213  C CD1 . ILE A  1 844  ? 164.543 213.145 192.367 1.00 73.69  ? 844  ILE A  CD1 1 
ATOM   6214  N N   . ALA A  1 845  ? 168.686 211.625 188.517 1.00 66.94  ? 845  ALA A  N   1 
ATOM   6215  C CA  . ALA A  1 845  ? 169.831 210.820 188.111 1.00 68.39  ? 845  ALA A  CA  1 
ATOM   6216  C C   . ALA A  1 845  ? 171.023 211.711 187.798 1.00 81.49  ? 845  ALA A  C   1 
ATOM   6217  O O   . ALA A  1 845  ? 172.169 211.349 188.084 1.00 72.64  ? 845  ALA A  O   1 
ATOM   6218  C CB  . ALA A  1 845  ? 169.473 209.962 186.897 1.00 65.52  ? 845  ALA A  CB  1 
ATOM   6219  N N   . ALA A  1 846  ? 170.761 212.879 187.207 1.00 83.81  ? 846  ALA A  N   1 
ATOM   6220  C CA  . ALA A  1 846  ? 171.826 213.827 186.906 1.00 79.67  ? 846  ALA A  CA  1 
ATOM   6221  C C   . ALA A  1 846  ? 172.404 214.459 188.167 1.00 83.52  ? 846  ALA A  C   1 
ATOM   6222  O O   . ALA A  1 846  ? 173.591 214.804 188.193 1.00 78.85  ? 846  ALA A  O   1 
ATOM   6223  C CB  . ALA A  1 846  ? 171.297 214.914 185.970 1.00 77.95  ? 846  ALA A  CB  1 
ATOM   6224  N N   . ARG A  1 847  ? 171.597 214.613 189.216 1.00 77.18  ? 847  ARG A  N   1 
ATOM   6225  C CA  . ARG A  1 847  ? 171.980 215.455 190.344 1.00 70.32  ? 847  ARG A  CA  1 
ATOM   6226  C C   . ARG A  1 847  ? 172.668 214.695 191.472 1.00 65.37  ? 847  ARG A  C   1 
ATOM   6227  O O   . ARG A  1 847  ? 173.820 214.983 191.811 1.00 62.46  ? 847  ARG A  O   1 
ATOM   6228  C CB  . ARG A  1 847  ? 170.742 216.154 190.911 1.00 70.11  ? 847  ARG A  CB  1 
ATOM   6229  C CG  . ARG A  1 847  ? 170.126 217.203 190.004 1.00 69.75  ? 847  ARG A  CG  1 
ATOM   6230  C CD  . ARG A  1 847  ? 169.106 218.034 190.767 1.00 77.35  ? 847  ARG A  CD  1 
ATOM   6231  N NE  . ARG A  1 847  ? 167.899 217.272 191.081 1.00 74.38  ? 847  ARG A  NE  1 
ATOM   6232  C CZ  . ARG A  1 847  ? 166.792 217.267 190.342 1.00 79.83  ? 847  ARG A  CZ  1 
ATOM   6233  N NH1 . ARG A  1 847  ? 166.714 217.986 189.229 1.00 85.54  ? 847  ARG A  NH1 1 
ATOM   6234  N NH2 . ARG A  1 847  ? 165.753 216.538 190.722 1.00 71.82  ? 847  ARG A  NH2 1 
ATOM   6235  N N   . ASP A  1 848  ? 171.969 213.727 192.056 1.00 68.71  ? 848  ASP A  N   1 
ATOM   6236  C CA  . ASP A  1 848  ? 172.392 213.164 193.332 1.00 58.74  ? 848  ASP A  CA  1 
ATOM   6237  C C   . ASP A  1 848  ? 173.675 212.353 193.192 1.00 45.41  ? 848  ASP A  C   1 
ATOM   6238  O O   . ASP A  1 848  ? 173.857 211.600 192.231 1.00 45.06  ? 848  ASP A  O   1 
ATOM   6239  C CB  . ASP A  1 848  ? 171.273 212.299 193.909 1.00 52.43  ? 848  ASP A  CB  1 
ATOM   6240  C CG  . ASP A  1 848  ? 171.599 211.764 195.286 1.00 52.34  ? 848  ASP A  CG  1 
ATOM   6241  O OD1 . ASP A  1 848  ? 171.967 212.570 196.164 1.00 60.62  ? 848  ASP A  OD1 1 
ATOM   6242  O OD2 . ASP A  1 848  ? 171.474 210.540 195.494 1.00 53.94  ? 848  ASP A  OD2 1 
ATOM   6243  N N   . LEU A  1 849  ? 174.569 212.515 194.170 1.00 53.91  ? 849  LEU A  N   1 
ATOM   6244  C CA  . LEU A  1 849  ? 175.801 211.732 194.195 1.00 42.19  ? 849  LEU A  CA  1 
ATOM   6245  C C   . LEU A  1 849  ? 175.511 210.257 194.434 1.00 35.88  ? 849  LEU A  C   1 
ATOM   6246  O O   . LEU A  1 849  ? 176.045 209.388 193.737 1.00 47.97  ? 849  LEU A  O   1 
ATOM   6247  C CB  . LEU A  1 849  ? 176.740 212.269 195.272 1.00 37.12  ? 849  LEU A  CB  1 
ATOM   6248  C CG  . LEU A  1 849  ? 177.442 213.593 194.971 1.00 53.63  ? 849  LEU A  CG  1 
ATOM   6249  C CD1 . LEU A  1 849  ? 178.223 214.056 196.187 1.00 66.85  ? 849  LEU A  CD1 1 
ATOM   6250  C CD2 . LEU A  1 849  ? 178.358 213.455 193.766 1.00 47.09  ? 849  LEU A  CD2 1 
ATOM   6251  N N   . ILE A  1 850  ? 174.668 209.951 195.422 1.00 37.03  ? 850  ILE A  N   1 
ATOM   6252  C CA  . ILE A  1 850  ? 174.347 208.560 195.710 1.00 40.10  ? 850  ILE A  CA  1 
ATOM   6253  C C   . ILE A  1 850  ? 173.624 207.906 194.541 1.00 41.22  ? 850  ILE A  C   1 
ATOM   6254  O O   . ILE A  1 850  ? 173.557 206.674 194.469 1.00 54.48  ? 850  ILE A  O   1 
ATOM   6255  C CB  . ILE A  1 850  ? 173.508 208.459 196.997 1.00 48.22  ? 850  ILE A  CB  1 
ATOM   6256  C CG1 . ILE A  1 850  ? 174.294 209.012 198.187 1.00 67.10  ? 850  ILE A  CG1 1 
ATOM   6257  C CG2 . ILE A  1 850  ? 173.112 207.020 197.263 1.00 56.88  ? 850  ILE A  CG2 1 
ATOM   6258  C CD1 . ILE A  1 850  ? 173.883 210.405 198.604 1.00 56.35  ? 850  ILE A  CD1 1 
ATOM   6259  N N   . CYS A  1 851  ? 173.073 208.701 193.624 1.00 38.93  ? 851  CYS A  N   1 
ATOM   6260  C CA  . CYS A  1 851  ? 172.460 208.154 192.419 1.00 34.89  ? 851  CYS A  CA  1 
ATOM   6261  C C   . CYS A  1 851  ? 173.509 207.855 191.358 1.00 36.26  ? 851  CYS A  C   1 
ATOM   6262  O O   . CYS A  1 851  ? 173.489 206.786 190.740 1.00 48.68  ? 851  CYS A  O   1 
ATOM   6263  C CB  . CYS A  1 851  ? 171.397 209.120 191.896 1.00 55.89  ? 851  CYS A  CB  1 
ATOM   6264  S SG  . CYS A  1 851  ? 169.904 209.021 192.900 1.00 77.03  ? 851  CYS A  SG  1 
ATOM   6265  N N   . ALA A  1 852  ? 174.431 208.792 191.128 1.00 35.37  ? 852  ALA A  N   1 
ATOM   6266  C CA  . ALA A  1 852  ? 175.555 208.516 190.241 1.00 22.58  ? 852  ALA A  CA  1 
ATOM   6267  C C   . ALA A  1 852  ? 176.314 207.279 190.696 1.00 29.94  ? 852  ALA A  C   1 
ATOM   6268  O O   . ALA A  1 852  ? 176.774 206.481 189.872 1.00 32.73  ? 852  ALA A  O   1 
ATOM   6269  C CB  . ALA A  1 852  ? 176.488 209.724 190.188 1.00 24.32  ? 852  ALA A  CB  1 
ATOM   6270  N N   . GLN A  1 853  ? 176.460 207.108 192.009 1.00 30.60  ? 853  GLN A  N   1 
ATOM   6271  C CA  . GLN A  1 853  ? 177.151 205.940 192.540 1.00 27.19  ? 853  GLN A  CA  1 
ATOM   6272  C C   . GLN A  1 853  ? 176.385 204.659 192.237 1.00 26.57  ? 853  GLN A  C   1 
ATOM   6273  O O   . GLN A  1 853  ? 176.935 203.709 191.671 1.00 38.49  ? 853  GLN A  O   1 
ATOM   6274  C CB  . GLN A  1 853  ? 177.348 206.096 194.047 1.00 27.89  ? 853  GLN A  CB  1 
ATOM   6275  C CG  . GLN A  1 853  ? 178.391 207.123 194.447 1.00 25.01  ? 853  GLN A  CG  1 
ATOM   6276  C CD  . GLN A  1 853  ? 178.475 207.297 195.945 1.00 25.70  ? 853  GLN A  CD  1 
ATOM   6277  O OE1 . GLN A  1 853  ? 177.935 206.494 196.704 1.00 33.61  ? 853  GLN A  OE1 1 
ATOM   6278  N NE2 . GLN A  1 853  ? 179.150 208.352 196.383 1.00 25.93  ? 853  GLN A  NE2 1 
ATOM   6279  N N   . LYS A  1 854  ? 175.103 204.615 192.611 1.00 29.16  ? 854  LYS A  N   1 
ATOM   6280  C CA  . LYS A  1 854  ? 174.346 203.372 192.502 1.00 39.02  ? 854  LYS A  CA  1 
ATOM   6281  C C   . LYS A  1 854  ? 174.127 202.968 191.054 1.00 35.92  ? 854  LYS A  C   1 
ATOM   6282  O O   . LYS A  1 854  ? 174.060 201.773 190.748 1.00 36.81  ? 854  LYS A  O   1 
ATOM   6283  C CB  . LYS A  1 854  ? 173.007 203.507 193.223 1.00 37.63  ? 854  LYS A  CB  1 
ATOM   6284  C CG  . LYS A  1 854  ? 173.112 203.353 194.728 1.00 48.99  ? 854  LYS A  CG  1 
ATOM   6285  C CD  . LYS A  1 854  ? 171.838 203.775 195.439 1.00 53.36  ? 854  LYS A  CD  1 
ATOM   6286  C CE  . LYS A  1 854  ? 172.045 203.811 196.946 1.00 73.24  ? 854  LYS A  CE  1 
ATOM   6287  N NZ  . LYS A  1 854  ? 172.170 202.450 197.538 1.00 59.60  ? 854  LYS A  NZ  1 
ATOM   6288  N N   . PHE A  1 855  ? 174.007 203.940 190.149 1.00 34.55  ? 855  PHE A  N   1 
ATOM   6289  C CA  . PHE A  1 855  ? 173.848 203.601 188.741 1.00 31.14  ? 855  PHE A  CA  1 
ATOM   6290  C C   . PHE A  1 855  ? 175.092 202.921 188.192 1.00 39.55  ? 855  PHE A  C   1 
ATOM   6291  O O   . PHE A  1 855  ? 174.988 202.054 187.318 1.00 47.02  ? 855  PHE A  O   1 
ATOM   6292  C CB  . PHE A  1 855  ? 173.533 204.856 187.927 1.00 35.19  ? 855  PHE A  CB  1 
ATOM   6293  C CG  . PHE A  1 855  ? 172.113 205.336 188.062 1.00 40.42  ? 855  PHE A  CG  1 
ATOM   6294  C CD1 . PHE A  1 855  ? 171.056 204.445 188.104 1.00 41.30  ? 855  PHE A  CD1 1 
ATOM   6295  C CD2 . PHE A  1 855  ? 171.840 206.687 188.141 1.00 38.28  ? 855  PHE A  CD2 1 
ATOM   6296  C CE1 . PHE A  1 855  ? 169.759 204.893 188.225 1.00 47.98  ? 855  PHE A  CE1 1 
ATOM   6297  C CE2 . PHE A  1 855  ? 170.545 207.138 188.262 1.00 52.39  ? 855  PHE A  CE2 1 
ATOM   6298  C CZ  . PHE A  1 855  ? 169.504 206.240 188.304 1.00 56.54  ? 855  PHE A  CZ  1 
ATOM   6299  N N   . ASN A  1 856  ? 176.270 203.292 188.692 1.00 38.38  ? 856  ASN A  N   1 
ATOM   6300  C CA  . ASN A  1 856  ? 177.531 202.700 188.263 1.00 24.06  ? 856  ASN A  CA  1 
ATOM   6301  C C   . ASN A  1 856  ? 177.966 201.541 189.150 1.00 23.64  ? 856  ASN A  C   1 
ATOM   6302  O O   . ASN A  1 856  ? 179.163 201.240 189.227 1.00 28.99  ? 856  ASN A  O   1 
ATOM   6303  C CB  . ASN A  1 856  ? 178.616 203.775 188.216 1.00 28.29  ? 856  ASN A  CB  1 
ATOM   6304  C CG  . ASN A  1 856  ? 178.332 204.841 187.181 1.00 35.12  ? 856  ASN A  CG  1 
ATOM   6305  O OD1 . ASN A  1 856  ? 178.157 204.543 186.000 1.00 47.25  ? 856  ASN A  OD1 1 
ATOM   6306  N ND2 . ASN A  1 856  ? 178.272 206.093 187.617 1.00 32.02  ? 856  ASN A  ND2 1 
ATOM   6307  N N   . GLY A  1 857  ? 177.026 200.885 189.827 1.00 29.97  ? 857  GLY A  N   1 
ATOM   6308  C CA  . GLY A  1 857  ? 177.300 199.664 190.552 1.00 25.27  ? 857  GLY A  CA  1 
ATOM   6309  C C   . GLY A  1 857  ? 177.862 199.828 191.946 1.00 25.92  ? 857  GLY A  C   1 
ATOM   6310  O O   . GLY A  1 857  ? 178.119 198.817 192.608 1.00 26.56  ? 857  GLY A  O   1 
ATOM   6311  N N   . LEU A  1 858  ? 178.062 201.053 192.419 1.00 33.44  ? 858  LEU A  N   1 
ATOM   6312  C CA  . LEU A  1 858  ? 178.614 201.291 193.747 1.00 25.28  ? 858  LEU A  CA  1 
ATOM   6313  C C   . LEU A  1 858  ? 177.474 201.405 194.753 1.00 30.23  ? 858  LEU A  C   1 
ATOM   6314  O O   . LEU A  1 858  ? 176.585 202.247 194.594 1.00 34.24  ? 858  LEU A  O   1 
ATOM   6315  C CB  . LEU A  1 858  ? 179.466 202.558 193.748 1.00 23.57  ? 858  LEU A  CB  1 
ATOM   6316  C CG  . LEU A  1 858  ? 180.430 202.689 192.567 1.00 24.75  ? 858  LEU A  CG  1 
ATOM   6317  C CD1 . LEU A  1 858  ? 181.148 204.022 192.598 1.00 23.60  ? 858  LEU A  CD1 1 
ATOM   6318  C CD2 . LEU A  1 858  ? 181.425 201.546 192.569 1.00 31.85  ? 858  LEU A  CD2 1 
ATOM   6319  N N   . THR A  1 859  ? 177.499 200.562 195.784 1.00 32.97  ? 859  THR A  N   1 
ATOM   6320  C CA  . THR A  1 859  ? 176.446 200.522 196.791 1.00 35.63  ? 859  THR A  CA  1 
ATOM   6321  C C   . THR A  1 859  ? 177.054 200.595 198.183 1.00 35.29  ? 859  THR A  C   1 
ATOM   6322  O O   . THR A  1 859  ? 178.169 200.118 198.407 1.00 34.78  ? 859  THR A  O   1 
ATOM   6323  C CB  . THR A  1 859  ? 175.601 199.248 196.672 1.00 36.42  ? 859  THR A  CB  1 
ATOM   6324  O OG1 . THR A  1 859  ? 176.391 198.110 197.035 1.00 25.40  ? 859  THR A  OG1 1 
ATOM   6325  C CG2 . THR A  1 859  ? 175.091 199.075 195.253 1.00 46.65  ? 859  THR A  CG2 1 
ATOM   6326  N N   . VAL A  1 860  ? 176.316 201.198 199.111 1.00 35.68  ? 860  VAL A  N   1 
ATOM   6327  C CA  . VAL A  1 860  ? 176.715 201.303 200.511 1.00 30.25  ? 860  VAL A  CA  1 
ATOM   6328  C C   . VAL A  1 860  ? 175.766 200.440 201.331 1.00 38.83  ? 860  VAL A  C   1 
ATOM   6329  O O   . VAL A  1 860  ? 174.544 200.624 201.276 1.00 51.07  ? 860  VAL A  O   1 
ATOM   6330  C CB  . VAL A  1 860  ? 176.696 202.760 200.995 1.00 31.13  ? 860  VAL A  CB  1 
ATOM   6331  C CG1 . VAL A  1 860  ? 177.183 202.851 202.429 1.00 37.36  ? 860  VAL A  CG1 1 
ATOM   6332  C CG2 . VAL A  1 860  ? 177.547 203.627 200.087 1.00 42.83  ? 860  VAL A  CG2 1 
ATOM   6333  N N   . LEU A  1 861  ? 176.320 199.508 202.091 1.00 31.96  ? 861  LEU A  N   1 
ATOM   6334  C CA  . LEU A  1 861  ? 175.486 198.579 202.835 1.00 23.45  ? 861  LEU A  CA  1 
ATOM   6335  C C   . LEU A  1 861  ? 175.219 199.094 204.247 1.00 28.38  ? 861  LEU A  C   1 
ATOM   6336  O O   . LEU A  1 861  ? 176.000 199.882 204.786 1.00 40.65  ? 861  LEU A  O   1 
ATOM   6337  C CB  . LEU A  1 861  ? 176.155 197.211 202.914 1.00 29.04  ? 861  LEU A  CB  1 
ATOM   6338  C CG  . LEU A  1 861  ? 176.552 196.588 201.577 1.00 24.40  ? 861  LEU A  CG  1 
ATOM   6339  C CD1 . LEU A  1 861  ? 177.404 195.360 201.802 1.00 11.48  ? 861  LEU A  CD1 1 
ATOM   6340  C CD2 . LEU A  1 861  ? 175.320 196.240 200.767 1.00 44.07  ? 861  LEU A  CD2 1 
ATOM   6341  N N   . PRO A  1 862  ? 174.119 198.673 204.864 1.00 25.34  ? 862  PRO A  N   1 
ATOM   6342  C CA  . PRO A  1 862  ? 173.818 199.104 206.228 1.00 37.41  ? 862  PRO A  CA  1 
ATOM   6343  C C   . PRO A  1 862  ? 174.578 198.276 207.247 1.00 32.43  ? 862  PRO A  C   1 
ATOM   6344  O O   . PRO A  1 862  ? 174.845 197.087 207.016 1.00 41.02  ? 862  PRO A  O   1 
ATOM   6345  C CB  . PRO A  1 862  ? 172.307 198.871 206.335 1.00 39.46  ? 862  PRO A  CB  1 
ATOM   6346  C CG  . PRO A  1 862  ? 172.074 197.704 205.451 1.00 32.65  ? 862  PRO A  CG  1 
ATOM   6347  C CD  . PRO A  1 862  ? 173.033 197.851 204.302 1.00 39.57  ? 862  PRO A  CD  1 
ATOM   6348  N N   . PRO A  1 863  ? 174.949 198.861 208.384 1.00 17.31  ? 863  PRO A  N   1 
ATOM   6349  C CA  . PRO A  1 863  ? 175.564 198.064 209.449 1.00 23.86  ? 863  PRO A  CA  1 
ATOM   6350  C C   . PRO A  1 863  ? 174.564 197.107 210.075 1.00 25.88  ? 863  PRO A  C   1 
ATOM   6351  O O   . PRO A  1 863  ? 173.351 197.320 210.029 1.00 31.69  ? 863  PRO A  O   1 
ATOM   6352  C CB  . PRO A  1 863  ? 176.036 199.119 210.454 1.00 21.49  ? 863  PRO A  CB  1 
ATOM   6353  C CG  . PRO A  1 863  ? 175.152 200.278 210.216 1.00 21.67  ? 863  PRO A  CG  1 
ATOM   6354  C CD  . PRO A  1 863  ? 174.866 200.285 208.750 1.00 28.51  ? 863  PRO A  CD  1 
ATOM   6355  N N   . LEU A  1 864  ? 175.090 196.032 210.662 1.00 25.51  ? 864  LEU A  N   1 
ATOM   6356  C CA  . LEU A  1 864  ? 174.225 195.050 211.305 1.00 25.06  ? 864  LEU A  CA  1 
ATOM   6357  C C   . LEU A  1 864  ? 173.466 195.669 212.472 1.00 32.44  ? 864  LEU A  C   1 
ATOM   6358  O O   . LEU A  1 864  ? 172.239 195.554 212.559 1.00 40.43  ? 864  LEU A  O   1 
ATOM   6359  C CB  . LEU A  1 864  ? 175.050 193.853 211.775 1.00 25.98  ? 864  LEU A  CB  1 
ATOM   6360  C CG  . LEU A  1 864  ? 174.291 192.800 212.584 1.00 28.17  ? 864  LEU A  CG  1 
ATOM   6361  C CD1 . LEU A  1 864  ? 173.099 192.260 211.810 1.00 24.48  ? 864  LEU A  CD1 1 
ATOM   6362  C CD2 . LEU A  1 864  ? 175.226 191.671 212.989 1.00 40.93  ? 864  LEU A  CD2 1 
ATOM   6363  N N   . LEU A  1 865  ? 174.179 196.326 213.384 1.00 45.01  ? 865  LEU A  N   1 
ATOM   6364  C CA  . LEU A  1 865  ? 173.538 196.974 214.518 1.00 22.51  ? 865  LEU A  CA  1 
ATOM   6365  C C   . LEU A  1 865  ? 173.075 198.370 214.130 1.00 21.27  ? 865  LEU A  C   1 
ATOM   6366  O O   . LEU A  1 865  ? 173.863 199.179 213.634 1.00 21.12  ? 865  LEU A  O   1 
ATOM   6367  C CB  . LEU A  1 865  ? 174.491 197.059 215.709 1.00 17.16  ? 865  LEU A  CB  1 
ATOM   6368  C CG  . LEU A  1 865  ? 174.930 195.753 216.372 1.00 18.66  ? 865  LEU A  CG  1 
ATOM   6369  C CD1 . LEU A  1 865  ? 175.847 196.054 217.540 1.00 25.62  ? 865  LEU A  CD1 1 
ATOM   6370  C CD2 . LEU A  1 865  ? 173.739 194.933 216.833 1.00 26.74  ? 865  LEU A  CD2 1 
ATOM   6371  N N   . THR A  1 866  ? 171.799 198.651 214.364 1.00 29.21  ? 866  THR A  N   1 
ATOM   6372  C CA  . THR A  1 866  ? 171.267 199.978 214.111 1.00 23.34  ? 866  THR A  CA  1 
ATOM   6373  C C   . THR A  1 866  ? 171.752 200.948 215.182 1.00 34.67  ? 866  THR A  C   1 
ATOM   6374  O O   . THR A  1 866  ? 172.241 200.552 216.242 1.00 40.96  ? 866  THR A  O   1 
ATOM   6375  C CB  . THR A  1 866  ? 169.740 199.953 214.092 1.00 34.25  ? 866  THR A  CB  1 
ATOM   6376  O OG1 . THR A  1 866  ? 169.248 199.917 215.436 1.00 55.50  ? 866  THR A  OG1 1 
ATOM   6377  C CG2 . THR A  1 866  ? 169.233 198.731 213.355 1.00 32.66  ? 866  THR A  CG2 1 
ATOM   6378  N N   . ASP A  1 867  ? 171.609 202.242 214.896 1.00 41.85  ? 867  ASP A  N   1 
ATOM   6379  C CA  . ASP A  1 867  ? 171.980 203.247 215.884 1.00 31.16  ? 867  ASP A  CA  1 
ATOM   6380  C C   . ASP A  1 867  ? 171.168 203.109 217.161 1.00 34.43  ? 867  ASP A  C   1 
ATOM   6381  O O   . ASP A  1 867  ? 171.591 203.608 218.208 1.00 40.77  ? 867  ASP A  O   1 
ATOM   6382  C CB  . ASP A  1 867  ? 171.794 204.650 215.313 1.00 47.99  ? 867  ASP A  CB  1 
ATOM   6383  C CG  . ASP A  1 867  ? 172.708 204.928 214.141 1.00 62.03  ? 867  ASP A  CG  1 
ATOM   6384  O OD1 . ASP A  1 867  ? 173.847 204.414 214.141 1.00 68.25  ? 867  ASP A  OD1 1 
ATOM   6385  O OD2 . ASP A  1 867  ? 172.287 205.663 213.222 1.00 65.37  ? 867  ASP A  OD2 1 
ATOM   6386  N N   . GLU A  1 868  ? 170.006 202.458 217.094 1.00 45.67  ? 868  GLU A  N   1 
ATOM   6387  C CA  . GLU A  1 868  ? 169.230 202.189 218.296 1.00 33.39  ? 868  GLU A  CA  1 
ATOM   6388  C C   . GLU A  1 868  ? 169.843 201.055 219.103 1.00 32.25  ? 868  GLU A  C   1 
ATOM   6389  O O   . GLU A  1 868  ? 169.931 201.140 220.332 1.00 39.36  ? 868  GLU A  O   1 
ATOM   6390  C CB  . GLU A  1 868  ? 167.786 201.848 217.929 1.00 31.04  ? 868  GLU A  CB  1 
ATOM   6391  C CG  . GLU A  1 868  ? 167.018 202.967 217.242 1.00 47.73  ? 868  GLU A  CG  1 
ATOM   6392  C CD  . GLU A  1 868  ? 167.433 203.163 215.798 1.00 59.46  ? 868  GLU A  CD  1 
ATOM   6393  O OE1 . GLU A  1 868  ? 167.806 204.297 215.433 1.00 60.95  ? 868  GLU A  OE1 1 
ATOM   6394  O OE2 . GLU A  1 868  ? 167.394 202.180 215.030 1.00 69.74  ? 868  GLU A  OE2 1 
ATOM   6395  N N   . MET A  1 869  ? 170.274 199.988 218.427 1.00 27.92  ? 869  MET A  N   1 
ATOM   6396  C CA  . MET A  1 869  ? 170.885 198.868 219.131 1.00 22.77  ? 869  MET A  CA  1 
ATOM   6397  C C   . MET A  1 869  ? 172.220 199.269 219.739 1.00 24.35  ? 869  MET A  C   1 
ATOM   6398  O O   . MET A  1 869  ? 172.586 198.788 220.816 1.00 30.96  ? 869  MET A  O   1 
ATOM   6399  C CB  . MET A  1 869  ? 171.060 197.686 218.182 1.00 23.13  ? 869  MET A  CB  1 
ATOM   6400  C CG  . MET A  1 869  ? 169.753 197.146 217.642 1.00 26.96  ? 869  MET A  CG  1 
ATOM   6401  S SD  . MET A  1 869  ? 169.957 195.717 216.566 1.00 36.83  ? 869  MET A  SD  1 
ATOM   6402  C CE  . MET A  1 869  ? 168.244 195.296 216.266 1.00 37.49  ? 869  MET A  CE  1 
ATOM   6403  N N   . ILE A  1 870  ? 172.963 200.146 219.065 1.00 20.63  ? 870  ILE A  N   1 
ATOM   6404  C CA  . ILE A  1 870  ? 174.198 200.659 219.646 1.00 13.81  ? 870  ILE A  CA  1 
ATOM   6405  C C   . ILE A  1 870  ? 173.893 201.425 220.924 1.00 23.17  ? 870  ILE A  C   1 
ATOM   6406  O O   . ILE A  1 870  ? 174.609 201.308 221.924 1.00 29.97  ? 870  ILE A  O   1 
ATOM   6407  C CB  . ILE A  1 870  ? 174.947 201.536 218.626 1.00 14.72  ? 870  ILE A  CB  1 
ATOM   6408  C CG1 . ILE A  1 870  ? 175.332 200.725 217.387 1.00 21.91  ? 870  ILE A  CG1 1 
ATOM   6409  C CG2 . ILE A  1 870  ? 176.183 202.139 219.251 1.00 22.26  ? 870  ILE A  CG2 1 
ATOM   6410  C CD1 . ILE A  1 870  ? 176.373 199.664 217.635 1.00 26.42  ? 870  ILE A  CD1 1 
ATOM   6411  N N   . ALA A  1 871  ? 172.823 202.221 220.913 1.00 24.83  ? 871  ALA A  N   1 
ATOM   6412  C CA  . ALA A  1 871  ? 172.445 202.971 222.103 1.00 21.77  ? 871  ALA A  CA  1 
ATOM   6413  C C   . ALA A  1 871  ? 171.982 202.052 223.223 1.00 26.84  ? 871  ALA A  C   1 
ATOM   6414  O O   . ALA A  1 871  ? 172.237 202.335 224.397 1.00 30.10  ? 871  ALA A  O   1 
ATOM   6415  C CB  . ALA A  1 871  ? 171.348 203.974 221.763 1.00 33.09  ? 871  ALA A  CB  1 
ATOM   6416  N N   . GLN A  1 872  ? 171.293 200.960 222.889 1.00 26.73  ? 872  GLN A  N   1 
ATOM   6417  C CA  . GLN A  1 872  ? 170.887 200.011 223.918 1.00 21.29  ? 872  GLN A  CA  1 
ATOM   6418  C C   . GLN A  1 872  ? 172.098 199.342 224.549 1.00 25.20  ? 872  GLN A  C   1 
ATOM   6419  O O   . GLN A  1 872  ? 172.127 199.116 225.763 1.00 36.65  ? 872  GLN A  O   1 
ATOM   6420  C CB  . GLN A  1 872  ? 169.945 198.966 223.330 1.00 24.48  ? 872  GLN A  CB  1 
ATOM   6421  C CG  . GLN A  1 872  ? 168.560 199.488 223.027 1.00 30.53  ? 872  GLN A  CG  1 
ATOM   6422  C CD  . GLN A  1 872  ? 167.649 198.414 222.484 1.00 35.62  ? 872  GLN A  CD  1 
ATOM   6423  O OE1 . GLN A  1 872  ? 167.202 198.482 221.339 1.00 56.60  ? 872  GLN A  OE1 1 
ATOM   6424  N NE2 . GLN A  1 872  ? 167.364 197.410 223.304 1.00 34.57  ? 872  GLN A  NE2 1 
ATOM   6425  N N   . TYR A  1 873  ? 173.104 199.006 223.741 1.00 21.52  ? 873  TYR A  N   1 
ATOM   6426  C CA  . TYR A  1 873  ? 174.346 198.487 224.300 1.00 22.83  ? 873  TYR A  CA  1 
ATOM   6427  C C   . TYR A  1 873  ? 175.034 199.535 225.161 1.00 21.28  ? 873  TYR A  C   1 
ATOM   6428  O O   . TYR A  1 873  ? 175.536 199.223 226.245 1.00 43.37  ? 873  TYR A  O   1 
ATOM   6429  C CB  . TYR A  1 873  ? 175.280 198.032 223.181 1.00 25.60  ? 873  TYR A  CB  1 
ATOM   6430  C CG  . TYR A  1 873  ? 175.069 196.610 222.717 1.00 23.72  ? 873  TYR A  CG  1 
ATOM   6431  C CD1 . TYR A  1 873  ? 174.962 195.569 223.622 1.00 26.69  ? 873  TYR A  CD1 1 
ATOM   6432  C CD2 . TYR A  1 873  ? 174.988 196.311 221.368 1.00 20.62  ? 873  TYR A  CD2 1 
ATOM   6433  C CE1 . TYR A  1 873  ? 174.780 194.278 223.200 1.00 27.95  ? 873  TYR A  CE1 1 
ATOM   6434  C CE2 . TYR A  1 873  ? 174.805 195.020 220.939 1.00 27.54  ? 873  TYR A  CE2 1 
ATOM   6435  C CZ  . TYR A  1 873  ? 174.702 194.007 221.859 1.00 29.50  ? 873  TYR A  CZ  1 
ATOM   6436  O OH  . TYR A  1 873  ? 174.518 192.714 221.434 1.00 37.87  ? 873  TYR A  OH  1 
ATOM   6437  N N   . THR A  1 874  ? 175.072 200.782 224.692 1.00 20.85  ? 874  THR A  N   1 
ATOM   6438  C CA  . THR A  1 874  ? 175.687 201.846 225.477 1.00 14.44  ? 874  THR A  CA  1 
ATOM   6439  C C   . THR A  1 874  ? 174.903 202.097 226.755 1.00 24.13  ? 874  THR A  C   1 
ATOM   6440  O O   . THR A  1 874  ? 175.488 202.375 227.807 1.00 23.37  ? 874  THR A  O   1 
ATOM   6441  C CB  . THR A  1 874  ? 175.782 203.121 224.645 1.00 14.69  ? 874  THR A  CB  1 
ATOM   6442  O OG1 . THR A  1 874  ? 176.591 202.878 223.490 1.00 14.12  ? 874  THR A  OG1 1 
ATOM   6443  C CG2 . THR A  1 874  ? 176.398 204.243 225.450 1.00 14.24  ? 874  THR A  CG2 1 
ATOM   6444  N N   . SER A  1 875  ? 173.574 202.014 226.682 1.00 27.59  ? 875  SER A  N   1 
ATOM   6445  C CA  . SER A  1 875  ? 172.760 202.169 227.881 1.00 20.04  ? 875  SER A  CA  1 
ATOM   6446  C C   . SER A  1 875  ? 173.069 201.080 228.898 1.00 16.96  ? 875  SER A  C   1 
ATOM   6447  O O   . SER A  1 875  ? 173.140 201.347 230.102 1.00 20.91  ? 875  SER A  O   1 
ATOM   6448  C CB  . SER A  1 875  ? 171.280 202.144 227.510 1.00 31.74  ? 875  SER A  CB  1 
ATOM   6449  O OG  . SER A  1 875  ? 170.467 202.176 228.668 1.00 42.07  ? 875  SER A  OG  1 
ATOM   6450  N N   . ALA A  1 876  ? 173.248 199.843 228.435 1.00 14.77  ? 876  ALA A  N   1 
ATOM   6451  C CA  . ALA A  1 876  ? 173.545 198.749 229.351 1.00 16.26  ? 876  ALA A  CA  1 
ATOM   6452  C C   . ALA A  1 876  ? 174.897 198.942 230.017 1.00 16.89  ? 876  ALA A  C   1 
ATOM   6453  O O   . ALA A  1 876  ? 175.031 198.751 231.230 1.00 20.63  ? 876  ALA A  O   1 
ATOM   6454  C CB  . ALA A  1 876  ? 173.511 197.420 228.604 1.00 30.82  ? 876  ALA A  CB  1 
ATOM   6455  N N   . LEU A  1 877  ? 175.912 199.318 229.241 1.00 19.31  ? 877  LEU A  N   1 
ATOM   6456  C CA  . LEU A  1 877  ? 177.227 199.562 229.819 1.00 16.18  ? 877  LEU A  CA  1 
ATOM   6457  C C   . LEU A  1 877  ? 177.180 200.711 230.814 1.00 18.75  ? 877  LEU A  C   1 
ATOM   6458  O O   . LEU A  1 877  ? 177.732 200.614 231.914 1.00 33.12  ? 877  LEU A  O   1 
ATOM   6459  C CB  . LEU A  1 877  ? 178.233 199.860 228.711 1.00 17.47  ? 877  LEU A  CB  1 
ATOM   6460  C CG  . LEU A  1 877  ? 178.572 198.688 227.792 1.00 20.24  ? 877  LEU A  CG  1 
ATOM   6461  C CD1 . LEU A  1 877  ? 179.027 199.191 226.438 1.00 31.30  ? 877  LEU A  CD1 1 
ATOM   6462  C CD2 . LEU A  1 877  ? 179.641 197.819 228.424 1.00 24.53  ? 877  LEU A  CD2 1 
ATOM   6463  N N   . LEU A  1 878  ? 176.513 201.804 230.450 1.00 19.17  ? 878  LEU A  N   1 
ATOM   6464  C CA  . LEU A  1 878  ? 176.444 202.954 231.341 1.00 18.85  ? 878  LEU A  CA  1 
ATOM   6465  C C   . LEU A  1 878  ? 175.584 202.655 232.561 1.00 22.98  ? 878  LEU A  C   1 
ATOM   6466  O O   . LEU A  1 878  ? 175.910 203.077 233.674 1.00 42.87  ? 878  LEU A  O   1 
ATOM   6467  C CB  . LEU A  1 878  ? 175.901 204.162 230.583 1.00 27.20  ? 878  LEU A  CB  1 
ATOM   6468  C CG  . LEU A  1 878  ? 176.105 205.518 231.252 1.00 30.89  ? 878  LEU A  CG  1 
ATOM   6469  C CD1 . LEU A  1 878  ? 176.369 206.577 230.201 1.00 32.86  ? 878  LEU A  CD1 1 
ATOM   6470  C CD2 . LEU A  1 878  ? 174.897 205.886 232.086 1.00 27.50  ? 878  LEU A  CD2 1 
ATOM   6471  N N   . ALA A  1 879  ? 174.475 201.939 232.371 1.00 20.19  ? 879  ALA A  N   1 
ATOM   6472  C CA  . ALA A  1 879  ? 173.608 201.617 233.498 1.00 16.38  ? 879  ALA A  CA  1 
ATOM   6473  C C   . ALA A  1 879  ? 174.303 200.687 234.481 1.00 21.89  ? 879  ALA A  C   1 
ATOM   6474  O O   . ALA A  1 879  ? 174.163 200.847 235.697 1.00 29.52  ? 879  ALA A  O   1 
ATOM   6475  C CB  . ALA A  1 879  ? 172.309 200.989 233.000 1.00 21.16  ? 879  ALA A  CB  1 
ATOM   6476  N N   . GLY A  1 880  ? 175.052 199.707 233.977 1.00 23.66  ? 880  GLY A  N   1 
ATOM   6477  C CA  . GLY A  1 880  ? 175.783 198.820 234.865 1.00 17.40  ? 880  GLY A  CA  1 
ATOM   6478  C C   . GLY A  1 880  ? 176.885 199.535 235.623 1.00 20.72  ? 880  GLY A  C   1 
ATOM   6479  O O   . GLY A  1 880  ? 177.164 199.213 236.780 1.00 26.42  ? 880  GLY A  O   1 
ATOM   6480  N N   . THR A  1 881  ? 177.531 200.508 234.981 1.00 16.85  ? 881  THR A  N   1 
ATOM   6481  C CA  . THR A  1 881  ? 178.619 201.229 235.631 1.00 22.22  ? 881  THR A  CA  1 
ATOM   6482  C C   . THR A  1 881  ? 178.122 201.977 236.858 1.00 22.54  ? 881  THR A  C   1 
ATOM   6483  O O   . THR A  1 881  ? 178.697 201.865 237.945 1.00 26.06  ? 881  THR A  O   1 
ATOM   6484  C CB  . THR A  1 881  ? 179.262 202.202 234.644 1.00 31.16  ? 881  THR A  CB  1 
ATOM   6485  O OG1 . THR A  1 881  ? 179.832 201.473 233.551 1.00 42.13  ? 881  THR A  OG1 1 
ATOM   6486  C CG2 . THR A  1 881  ? 180.351 203.022 235.318 1.00 33.83  ? 881  THR A  CG2 1 
ATOM   6487  N N   . ILE A  1 882  ? 177.048 202.751 236.701 1.00 25.01  ? 882  ILE A  N   1 
ATOM   6488  C CA  . ILE A  1 882  ? 176.593 203.604 237.790 1.00 19.62  ? 882  ILE A  CA  1 
ATOM   6489  C C   . ILE A  1 882  ? 175.955 202.782 238.902 1.00 20.38  ? 882  ILE A  C   1 
ATOM   6490  O O   . ILE A  1 882  ? 176.016 203.166 240.075 1.00 23.70  ? 882  ILE A  O   1 
ATOM   6491  C CB  . ILE A  1 882  ? 175.636 204.680 237.246 1.00 18.15  ? 882  ILE A  CB  1 
ATOM   6492  C CG1 . ILE A  1 882  ? 174.381 204.045 236.649 1.00 26.42  ? 882  ILE A  CG1 1 
ATOM   6493  C CG2 . ILE A  1 882  ? 176.339 205.511 236.194 1.00 16.59  ? 882  ILE A  CG2 1 
ATOM   6494  C CD1 . ILE A  1 882  ? 173.408 205.047 236.063 1.00 30.69  ? 882  ILE A  CD1 1 
ATOM   6495  N N   . THR A  1 883  ? 175.340 201.647 238.571 1.00 24.44  ? 883  THR A  N   1 
ATOM   6496  C CA  . THR A  1 883  ? 174.659 200.845 239.580 1.00 23.02  ? 883  THR A  CA  1 
ATOM   6497  C C   . THR A  1 883  ? 175.508 199.720 240.153 1.00 22.57  ? 883  THR A  C   1 
ATOM   6498  O O   . THR A  1 883  ? 175.173 199.212 241.227 1.00 30.19  ? 883  THR A  O   1 
ATOM   6499  C CB  . THR A  1 883  ? 173.383 200.222 239.008 1.00 25.84  ? 883  THR A  CB  1 
ATOM   6500  O OG1 . THR A  1 883  ? 173.725 199.294 237.973 1.00 41.44  ? 883  THR A  OG1 1 
ATOM   6501  C CG2 . THR A  1 883  ? 172.462 201.284 238.451 1.00 25.33  ? 883  THR A  CG2 1 
ATOM   6502  N N   . SER A  1 884  ? 176.582 199.308 239.479 1.00 20.12  ? 884  SER A  N   1 
ATOM   6503  C CA  . SER A  1 884  ? 177.303 198.118 239.916 1.00 16.84  ? 884  SER A  CA  1 
ATOM   6504  C C   . SER A  1 884  ? 178.818 198.280 239.893 1.00 18.77  ? 884  SER A  C   1 
ATOM   6505  O O   . SER A  1 884  ? 179.542 197.367 240.299 1.00 25.04  ? 884  SER A  O   1 
ATOM   6506  C CB  . SER A  1 884  ? 176.912 196.930 239.041 1.00 22.26  ? 884  SER A  CB  1 
ATOM   6507  O OG  . SER A  1 884  ? 177.586 195.756 239.453 1.00 27.56  ? 884  SER A  OG  1 
ATOM   6508  N N   . GLY A  1 885  ? 179.312 199.427 239.441 1.00 18.63  ? 885  GLY A  N   1 
ATOM   6509  C CA  . GLY A  1 885  ? 180.753 199.595 239.345 1.00 24.12  ? 885  GLY A  CA  1 
ATOM   6510  C C   . GLY A  1 885  ? 181.355 198.640 238.333 1.00 20.90  ? 885  GLY A  C   1 
ATOM   6511  O O   . GLY A  1 885  ? 180.768 198.350 237.287 1.00 29.49  ? 885  GLY A  O   1 
ATOM   6512  N N   . TRP A  1 886  ? 182.551 198.144 238.646 1.00 19.34  ? 886  TRP A  N   1 
ATOM   6513  C CA  . TRP A  1 886  ? 183.254 197.228 237.756 1.00 26.52  ? 886  TRP A  CA  1 
ATOM   6514  C C   . TRP A  1 886  ? 182.846 195.776 237.947 1.00 29.39  ? 886  TRP A  C   1 
ATOM   6515  O O   . TRP A  1 886  ? 183.360 194.911 237.232 1.00 39.17  ? 886  TRP A  O   1 
ATOM   6516  C CB  . TRP A  1 886  ? 184.769 197.352 237.942 1.00 28.45  ? 886  TRP A  CB  1 
ATOM   6517  C CG  . TRP A  1 886  ? 185.232 197.325 239.363 1.00 23.28  ? 886  TRP A  CG  1 
ATOM   6518  C CD1 . TRP A  1 886  ? 185.197 196.266 240.221 1.00 22.80  ? 886  TRP A  CD1 1 
ATOM   6519  C CD2 . TRP A  1 886  ? 185.819 198.410 240.091 1.00 12.90  ? 886  TRP A  CD2 1 
ATOM   6520  N NE1 . TRP A  1 886  ? 185.717 196.625 241.437 1.00 32.11  ? 886  TRP A  NE1 1 
ATOM   6521  C CE2 . TRP A  1 886  ? 186.107 197.937 241.384 1.00 18.67  ? 886  TRP A  CE2 1 
ATOM   6522  C CE3 . TRP A  1 886  ? 186.123 199.736 239.777 1.00 14.80  ? 886  TRP A  CE3 1 
ATOM   6523  C CZ2 . TRP A  1 886  ? 186.686 198.739 242.359 1.00 16.24  ? 886  TRP A  CZ2 1 
ATOM   6524  C CZ3 . TRP A  1 886  ? 186.696 200.530 240.747 1.00 14.57  ? 886  TRP A  CZ3 1 
ATOM   6525  C CH2 . TRP A  1 886  ? 186.972 200.029 242.022 1.00 21.30  ? 886  TRP A  CH2 1 
ATOM   6526  N N   . THR A  1 887  ? 181.950 195.484 238.887 1.00 25.02  ? 887  THR A  N   1 
ATOM   6527  C CA  . THR A  1 887  ? 181.598 194.095 239.158 1.00 23.46  ? 887  THR A  CA  1 
ATOM   6528  C C   . THR A  1 887  ? 180.881 193.448 237.982 1.00 28.60  ? 887  THR A  C   1 
ATOM   6529  O O   . THR A  1 887  ? 181.069 192.254 237.730 1.00 34.49  ? 887  THR A  O   1 
ATOM   6530  C CB  . THR A  1 887  ? 180.727 194.012 240.405 1.00 27.05  ? 887  THR A  CB  1 
ATOM   6531  O OG1 . THR A  1 887  ? 179.554 194.812 240.220 1.00 25.26  ? 887  THR A  OG1 1 
ATOM   6532  C CG2 . THR A  1 887  ? 181.491 194.509 241.617 1.00 41.22  ? 887  THR A  CG2 1 
ATOM   6533  N N   . PHE A  1 888  ? 180.063 194.208 237.251 1.00 32.28  ? 888  PHE A  N   1 
ATOM   6534  C CA  . PHE A  1 888  ? 179.310 193.623 236.149 1.00 29.59  ? 888  PHE A  CA  1 
ATOM   6535  C C   . PHE A  1 888  ? 180.213 193.178 235.008 1.00 21.19  ? 888  PHE A  C   1 
ATOM   6536  O O   . PHE A  1 888  ? 179.782 192.384 234.169 1.00 24.39  ? 888  PHE A  O   1 
ATOM   6537  C CB  . PHE A  1 888  ? 178.257 194.613 235.645 1.00 28.02  ? 888  PHE A  CB  1 
ATOM   6538  C CG  . PHE A  1 888  ? 178.796 195.666 234.724 1.00 21.46  ? 888  PHE A  CG  1 
ATOM   6539  C CD1 . PHE A  1 888  ? 179.584 196.691 235.205 1.00 29.30  ? 888  PHE A  CD1 1 
ATOM   6540  C CD2 . PHE A  1 888  ? 178.489 195.644 233.378 1.00 26.62  ? 888  PHE A  CD2 1 
ATOM   6541  C CE1 . PHE A  1 888  ? 180.069 197.662 234.359 1.00 19.21  ? 888  PHE A  CE1 1 
ATOM   6542  C CE2 . PHE A  1 888  ? 178.971 196.613 232.530 1.00 26.99  ? 888  PHE A  CE2 1 
ATOM   6543  C CZ  . PHE A  1 888  ? 179.762 197.622 233.020 1.00 24.39  ? 888  PHE A  CZ  1 
ATOM   6544  N N   . GLY A  1 889  ? 181.447 193.669 234.956 1.00 20.36  ? 889  GLY A  N   1 
ATOM   6545  C CA  . GLY A  1 889  ? 182.406 193.194 233.980 1.00 25.61  ? 889  GLY A  CA  1 
ATOM   6546  C C   . GLY A  1 889  ? 183.075 191.910 234.421 1.00 32.20  ? 889  GLY A  C   1 
ATOM   6547  O O   . GLY A  1 889  ? 183.261 190.987 233.625 1.00 33.61  ? 889  GLY A  O   1 
ATOM   6548  N N   . ALA A  1 890  ? 183.444 191.848 235.701 1.00 42.27  ? 890  ALA A  N   1 
ATOM   6549  C CA  . ALA A  1 890  ? 184.130 190.684 236.242 1.00 37.10  ? 890  ALA A  CA  1 
ATOM   6550  C C   . ALA A  1 890  ? 183.210 189.487 236.431 1.00 31.58  ? 890  ALA A  C   1 
ATOM   6551  O O   . ALA A  1 890  ? 183.699 188.356 236.505 1.00 40.69  ? 890  ALA A  O   1 
ATOM   6552  C CB  . ALA A  1 890  ? 184.777 191.036 237.583 1.00 29.84  ? 890  ALA A  CB  1 
ATOM   6553  N N   . GLY A  1 891  ? 181.901 189.704 236.508 1.00 36.90  ? 891  GLY A  N   1 
ATOM   6554  C CA  . GLY A  1 891  ? 180.969 188.622 236.760 1.00 30.06  ? 891  GLY A  CA  1 
ATOM   6555  C C   . GLY A  1 891  ? 179.531 189.094 236.779 1.00 24.61  ? 891  GLY A  C   1 
ATOM   6556  O O   . GLY A  1 891  ? 179.104 189.835 235.890 1.00 27.41  ? 891  GLY A  O   1 
ATOM   6557  N N   . ALA A  1 892  ? 178.768 188.654 237.773 1.00 25.51  ? 892  ALA A  N   1 
ATOM   6558  C CA  . ALA A  1 892  ? 177.409 189.145 237.946 1.00 25.37  ? 892  ALA A  CA  1 
ATOM   6559  C C   . ALA A  1 892  ? 177.427 190.559 238.510 1.00 24.65  ? 892  ALA A  C   1 
ATOM   6560  O O   . ALA A  1 892  ? 178.243 190.892 239.371 1.00 32.70  ? 892  ALA A  O   1 
ATOM   6561  C CB  . ALA A  1 892  ? 176.623 188.221 238.872 1.00 31.46  ? 892  ALA A  CB  1 
ATOM   6562  N N   . ALA A  1 893  ? 176.512 191.392 238.023 1.00 24.06  ? 893  ALA A  N   1 
ATOM   6563  C CA  . ALA A  1 893  ? 176.450 192.789 238.438 1.00 22.67  ? 893  ALA A  CA  1 
ATOM   6564  C C   . ALA A  1 893  ? 175.990 192.878 239.887 1.00 33.28  ? 893  ALA A  C   1 
ATOM   6565  O O   . ALA A  1 893  ? 174.814 192.653 240.190 1.00 29.55  ? 893  ALA A  O   1 
ATOM   6566  C CB  . ALA A  1 893  ? 175.511 193.564 237.523 1.00 27.07  ? 893  ALA A  CB  1 
ATOM   6567  N N   . LEU A  1 894  ? 176.912 193.212 240.784 1.00 43.47  ? 894  LEU A  N   1 
ATOM   6568  C CA  . LEU A  1 894  ? 176.603 193.388 242.197 1.00 24.49  ? 894  LEU A  CA  1 
ATOM   6569  C C   . LEU A  1 894  ? 176.346 194.864 242.470 1.00 17.83  ? 894  LEU A  C   1 
ATOM   6570  O O   . LEU A  1 894  ? 177.230 195.698 242.255 1.00 24.07  ? 894  LEU A  O   1 
ATOM   6571  C CB  . LEU A  1 894  ? 177.756 192.879 243.059 1.00 20.96  ? 894  LEU A  CB  1 
ATOM   6572  C CG  . LEU A  1 894  ? 178.305 191.504 242.692 1.00 15.75  ? 894  LEU A  CG  1 
ATOM   6573  C CD1 . LEU A  1 894  ? 179.534 191.200 243.516 1.00 29.42  ? 894  LEU A  CD1 1 
ATOM   6574  C CD2 . LEU A  1 894  ? 177.249 190.442 242.897 1.00 30.20  ? 894  LEU A  CD2 1 
ATOM   6575  N N   . GLN A  1 895  ? 175.148 195.186 242.953 1.00 17.85  ? 895  GLN A  N   1 
ATOM   6576  C CA  . GLN A  1 895  ? 174.813 196.579 243.207 1.00 15.64  ? 895  GLN A  CA  1 
ATOM   6577  C C   . GLN A  1 895  ? 175.702 197.139 244.309 1.00 18.25  ? 895  GLN A  C   1 
ATOM   6578  O O   . GLN A  1 895  ? 176.232 196.404 245.145 1.00 21.10  ? 895  GLN A  O   1 
ATOM   6579  C CB  . GLN A  1 895  ? 173.335 196.726 243.587 1.00 12.87  ? 895  GLN A  CB  1 
ATOM   6580  C CG  . GLN A  1 895  ? 172.950 196.292 245.002 1.00 19.25  ? 895  GLN A  CG  1 
ATOM   6581  C CD  . GLN A  1 895  ? 172.633 194.822 245.102 1.00 20.36  ? 895  GLN A  CD  1 
ATOM   6582  O OE1 . GLN A  1 895  ? 172.973 194.040 244.218 1.00 20.72  ? 895  GLN A  OE1 1 
ATOM   6583  N NE2 . GLN A  1 895  ? 171.969 194.434 246.184 1.00 28.13  ? 895  GLN A  NE2 1 
ATOM   6584  N N   . ILE A  1 896  ? 175.889 198.452 244.288 1.00 15.77  ? 896  ILE A  N   1 
ATOM   6585  C CA  . ILE A  1 896  ? 176.675 199.126 245.317 1.00 17.94  ? 896  ILE A  CA  1 
ATOM   6586  C C   . ILE A  1 896  ? 176.343 200.612 245.275 1.00 24.10  ? 896  ILE A  C   1 
ATOM   6587  O O   . ILE A  1 896  ? 176.296 201.193 244.182 1.00 35.68  ? 896  ILE A  O   1 
ATOM   6588  C CB  . ILE A  1 896  ? 178.177 198.879 245.120 1.00 15.97  ? 896  ILE A  CB  1 
ATOM   6589  C CG1 . ILE A  1 896  ? 178.986 199.629 246.178 1.00 20.40  ? 896  ILE A  CG1 1 
ATOM   6590  C CG2 . ILE A  1 896  ? 178.605 199.295 243.725 1.00 19.39  ? 896  ILE A  CG2 1 
ATOM   6591  C CD1 . ILE A  1 896  ? 180.444 199.261 246.203 1.00 27.98  ? 896  ILE A  CD1 1 
ATOM   6592  N N   . PRO A  1 897  ? 176.110 201.270 246.412 1.00 18.39  ? 897  PRO A  N   1 
ATOM   6593  C CA  . PRO A  1 897  ? 175.785 202.700 246.369 1.00 18.01  ? 897  PRO A  CA  1 
ATOM   6594  C C   . PRO A  1 897  ? 176.881 203.481 245.666 1.00 20.60  ? 897  PRO A  C   1 
ATOM   6595  O O   . PRO A  1 897  ? 178.070 203.224 245.854 1.00 31.46  ? 897  PRO A  O   1 
ATOM   6596  C CB  . PRO A  1 897  ? 175.671 203.084 247.847 1.00 17.90  ? 897  PRO A  CB  1 
ATOM   6597  C CG  . PRO A  1 897  ? 175.415 201.808 248.555 1.00 22.11  ? 897  PRO A  CG  1 
ATOM   6598  C CD  . PRO A  1 897  ? 176.137 200.758 247.792 1.00 21.14  ? 897  PRO A  CD  1 
ATOM   6599  N N   . PHE A  1 898  ? 176.471 204.449 244.848 1.00 24.65  ? 898  PHE A  N   1 
ATOM   6600  C CA  . PHE A  1 898  ? 177.440 205.128 243.998 1.00 24.85  ? 898  PHE A  CA  1 
ATOM   6601  C C   . PHE A  1 898  ? 178.469 205.893 244.816 1.00 31.37  ? 898  PHE A  C   1 
ATOM   6602  O O   . PHE A  1 898  ? 179.649 205.921 244.450 1.00 51.69  ? 898  PHE A  O   1 
ATOM   6603  C CB  . PHE A  1 898  ? 176.738 206.071 243.029 1.00 21.52  ? 898  PHE A  CB  1 
ATOM   6604  C CG  . PHE A  1 898  ? 177.645 206.630 241.982 1.00 15.74  ? 898  PHE A  CG  1 
ATOM   6605  C CD1 . PHE A  1 898  ? 177.987 205.880 240.879 1.00 17.56  ? 898  PHE A  CD1 1 
ATOM   6606  C CD2 . PHE A  1 898  ? 178.166 207.900 242.104 1.00 19.41  ? 898  PHE A  CD2 1 
ATOM   6607  C CE1 . PHE A  1 898  ? 178.824 206.384 239.919 1.00 17.80  ? 898  PHE A  CE1 1 
ATOM   6608  C CE2 . PHE A  1 898  ? 179.004 208.408 241.144 1.00 26.16  ? 898  PHE A  CE2 1 
ATOM   6609  C CZ  . PHE A  1 898  ? 179.336 207.647 240.053 1.00 26.94  ? 898  PHE A  CZ  1 
ATOM   6610  N N   . ALA A  1 899  ? 178.057 206.515 245.919 1.00 27.49  ? 899  ALA A  N   1 
ATOM   6611  C CA  . ALA A  1 899  ? 179.041 207.125 246.803 1.00 19.83  ? 899  ALA A  CA  1 
ATOM   6612  C C   . ALA A  1 899  ? 179.972 206.073 247.381 1.00 25.19  ? 899  ALA A  C   1 
ATOM   6613  O O   . ALA A  1 899  ? 181.165 206.330 247.564 1.00 32.22  ? 899  ALA A  O   1 
ATOM   6614  C CB  . ALA A  1 899  ? 178.343 207.889 247.925 1.00 36.65  ? 899  ALA A  CB  1 
ATOM   6615  N N   . MET A  1 900  ? 179.450 204.881 247.660 1.00 26.20  ? 900  MET A  N   1 
ATOM   6616  C CA  . MET A  1 900  ? 180.312 203.781 248.067 1.00 23.10  ? 900  MET A  CA  1 
ATOM   6617  C C   . MET A  1 900  ? 181.220 203.364 246.922 1.00 24.40  ? 900  MET A  C   1 
ATOM   6618  O O   . MET A  1 900  ? 182.404 203.082 247.129 1.00 29.19  ? 900  MET A  O   1 
ATOM   6619  C CB  . MET A  1 900  ? 179.462 202.600 248.529 1.00 30.43  ? 900  MET A  CB  1 
ATOM   6620  C CG  . MET A  1 900  ? 180.191 201.589 249.393 1.00 23.29  ? 900  MET A  CG  1 
ATOM   6621  S SD  . MET A  1 900  ? 180.059 201.961 251.145 1.00 61.82  ? 900  MET A  SD  1 
ATOM   6622  C CE  . MET A  1 900  ? 178.290 201.834 251.369 1.00 38.22  ? 900  MET A  CE  1 
ATOM   6623  N N   . GLN A  1 901  ? 180.680 203.326 245.704 1.00 23.50  ? 901  GLN A  N   1 
ATOM   6624  C CA  . GLN A  1 901  ? 181.488 202.969 244.545 1.00 25.33  ? 901  GLN A  CA  1 
ATOM   6625  C C   . GLN A  1 901  ? 182.585 203.996 244.310 1.00 22.98  ? 901  GLN A  C   1 
ATOM   6626  O O   . GLN A  1 901  ? 183.753 203.640 244.122 1.00 31.88  ? 901  GLN A  O   1 
ATOM   6627  C CB  . GLN A  1 901  ? 180.600 202.850 243.310 1.00 26.09  ? 901  GLN A  CB  1 
ATOM   6628  C CG  . GLN A  1 901  ? 181.292 202.242 242.112 1.00 32.48  ? 901  GLN A  CG  1 
ATOM   6629  C CD  . GLN A  1 901  ? 180.582 202.547 240.812 1.00 24.74  ? 901  GLN A  CD  1 
ATOM   6630  O OE1 . GLN A  1 901  ? 181.216 202.865 239.809 1.00 22.35  ? 901  GLN A  OE1 1 
ATOM   6631  N NE2 . GLN A  1 901  ? 179.260 202.447 240.818 1.00 21.34  ? 901  GLN A  NE2 1 
ATOM   6632  N N   . MET A  1 902  ? 182.226 205.281 244.316 1.00 21.18  ? 902  MET A  N   1 
ATOM   6633  C CA  . MET A  1 902  ? 183.229 206.324 244.141 1.00 20.10  ? 902  MET A  CA  1 
ATOM   6634  C C   . MET A  1 902  ? 184.276 206.280 245.240 1.00 17.86  ? 902  MET A  C   1 
ATOM   6635  O O   . MET A  1 902  ? 185.421 206.683 245.019 1.00 25.88  ? 902  MET A  O   1 
ATOM   6636  C CB  . MET A  1 902  ? 182.560 207.694 244.109 1.00 26.18  ? 902  MET A  CB  1 
ATOM   6637  C CG  . MET A  1 902  ? 182.078 208.106 242.736 1.00 23.46  ? 902  MET A  CG  1 
ATOM   6638  S SD  . MET A  1 902  ? 183.420 208.660 241.669 1.00 27.02  ? 902  MET A  SD  1 
ATOM   6639  C CE  . MET A  1 902  ? 183.812 210.236 242.419 1.00 24.25  ? 902  MET A  CE  1 
ATOM   6640  N N   . ALA A  1 903  ? 183.908 205.806 246.430 1.00 18.61  ? 903  ALA A  N   1 
ATOM   6641  C CA  . ALA A  1 903  ? 184.889 205.670 247.497 1.00 16.49  ? 903  ALA A  CA  1 
ATOM   6642  C C   . ALA A  1 903  ? 185.900 204.581 247.181 1.00 14.05  ? 903  ALA A  C   1 
ATOM   6643  O O   . ALA A  1 903  ? 187.075 204.705 247.540 1.00 18.07  ? 903  ALA A  O   1 
ATOM   6644  C CB  . ALA A  1 903  ? 184.191 205.367 248.819 1.00 26.69  ? 903  ALA A  CB  1 
ATOM   6645  N N   . TYR A  1 904  ? 185.468 203.513 246.512 1.00 20.11  ? 904  TYR A  N   1 
ATOM   6646  C CA  . TYR A  1 904  ? 186.410 202.497 246.066 1.00 16.87  ? 904  TYR A  CA  1 
ATOM   6647  C C   . TYR A  1 904  ? 187.311 203.037 244.969 1.00 14.98  ? 904  TYR A  C   1 
ATOM   6648  O O   . TYR A  1 904  ? 188.475 202.640 244.872 1.00 16.47  ? 904  TYR A  O   1 
ATOM   6649  C CB  . TYR A  1 904  ? 185.670 201.260 245.556 1.00 19.00  ? 904  TYR A  CB  1 
ATOM   6650  C CG  . TYR A  1 904  ? 184.816 200.528 246.572 1.00 27.74  ? 904  TYR A  CG  1 
ATOM   6651  C CD1 . TYR A  1 904  ? 184.562 201.059 247.831 1.00 29.75  ? 904  TYR A  CD1 1 
ATOM   6652  C CD2 . TYR A  1 904  ? 184.268 199.289 246.265 1.00 28.31  ? 904  TYR A  CD2 1 
ATOM   6653  C CE1 . TYR A  1 904  ? 183.784 200.382 248.745 1.00 26.75  ? 904  TYR A  CE1 1 
ATOM   6654  C CE2 . TYR A  1 904  ? 183.494 198.606 247.176 1.00 27.64  ? 904  TYR A  CE2 1 
ATOM   6655  C CZ  . TYR A  1 904  ? 183.256 199.157 248.412 1.00 28.58  ? 904  TYR A  CZ  1 
ATOM   6656  O OH  . TYR A  1 904  ? 182.482 198.482 249.324 1.00 39.40  ? 904  TYR A  OH  1 
ATOM   6657  N N   . ARG A  1 905  ? 186.785 203.934 244.132 1.00 20.67  ? 905  ARG A  N   1 
ATOM   6658  C CA  . ARG A  1 905  ? 187.584 204.513 243.059 1.00 11.45  ? 905  ARG A  CA  1 
ATOM   6659  C C   . ARG A  1 905  ? 188.651 205.444 243.611 1.00 11.03  ? 905  ARG A  C   1 
ATOM   6660  O O   . ARG A  1 905  ? 189.761 205.509 243.076 1.00 21.56  ? 905  ARG A  O   1 
ATOM   6661  C CB  . ARG A  1 905  ? 186.681 205.263 242.084 1.00 10.59  ? 905  ARG A  CB  1 
ATOM   6662  C CG  . ARG A  1 905  ? 185.494 204.459 241.604 1.00 10.02  ? 905  ARG A  CG  1 
ATOM   6663  C CD  . ARG A  1 905  ? 185.528 204.281 240.110 1.00 8.71   ? 905  ARG A  CD  1 
ATOM   6664  N NE  . ARG A  1 905  ? 184.421 203.457 239.637 1.00 11.09  ? 905  ARG A  NE  1 
ATOM   6665  C CZ  . ARG A  1 905  ? 184.405 202.824 238.469 1.00 14.45  ? 905  ARG A  CZ  1 
ATOM   6666  N NH1 . ARG A  1 905  ? 185.439 202.912 237.644 1.00 13.49  ? 905  ARG A  NH1 1 
ATOM   6667  N NH2 . ARG A  1 905  ? 183.354 202.095 238.125 1.00 17.92  ? 905  ARG A  NH2 1 
ATOM   6668  N N   . PHE A  1 906  ? 188.327 206.187 244.669 1.00 10.34  ? 906  PHE A  N   1 
ATOM   6669  C CA  . PHE A  1 906  ? 189.323 207.047 245.296 1.00 14.19  ? 906  PHE A  CA  1 
ATOM   6670  C C   . PHE A  1 906  ? 190.461 206.220 245.878 1.00 11.75  ? 906  PHE A  C   1 
ATOM   6671  O O   . PHE A  1 906  ? 191.635 206.581 245.746 1.00 25.57  ? 906  PHE A  O   1 
ATOM   6672  C CB  . PHE A  1 906  ? 188.666 207.907 246.373 1.00 9.60   ? 906  PHE A  CB  1 
ATOM   6673  C CG  . PHE A  1 906  ? 188.286 209.278 245.897 1.00 6.95   ? 906  PHE A  CG  1 
ATOM   6674  C CD1 . PHE A  1 906  ? 187.462 209.443 244.800 1.00 7.53   ? 906  PHE A  CD1 1 
ATOM   6675  C CD2 . PHE A  1 906  ? 188.753 210.403 246.547 1.00 9.22   ? 906  PHE A  CD2 1 
ATOM   6676  C CE1 . PHE A  1 906  ? 187.117 210.700 244.362 1.00 5.77   ? 906  PHE A  CE1 1 
ATOM   6677  C CE2 . PHE A  1 906  ? 188.408 211.661 246.112 1.00 11.64  ? 906  PHE A  CE2 1 
ATOM   6678  C CZ  . PHE A  1 906  ? 187.590 211.809 245.019 1.00 12.14  ? 906  PHE A  CZ  1 
ATOM   6679  N N   . ASN A  1 907  ? 190.134 205.104 246.531 1.00 26.03  ? 907  ASN A  N   1 
ATOM   6680  C CA  . ASN A  1 907  ? 191.179 204.191 246.982 1.00 11.68  ? 907  ASN A  CA  1 
ATOM   6681  C C   . ASN A  1 907  ? 192.041 203.737 245.815 1.00 15.76  ? 907  ASN A  C   1 
ATOM   6682  O O   . ASN A  1 907  ? 193.252 203.545 245.966 1.00 34.26  ? 907  ASN A  O   1 
ATOM   6683  C CB  . ASN A  1 907  ? 190.565 202.984 247.686 1.00 22.65  ? 907  ASN A  CB  1 
ATOM   6684  C CG  . ASN A  1 907  ? 190.146 203.290 249.102 1.00 22.52  ? 907  ASN A  CG  1 
ATOM   6685  O OD1 . ASN A  1 907  ? 188.968 203.217 249.441 1.00 19.57  ? 907  ASN A  OD1 1 
ATOM   6686  N ND2 . ASN A  1 907  ? 191.113 203.634 249.943 1.00 44.77  ? 907  ASN A  ND2 1 
ATOM   6687  N N   . GLY A  1 908  ? 191.433 203.551 244.643 1.00 13.52  ? 908  GLY A  N   1 
ATOM   6688  C CA  . GLY A  1 908  ? 192.186 203.124 243.480 1.00 14.60  ? 908  GLY A  CA  1 
ATOM   6689  C C   . GLY A  1 908  ? 193.267 204.094 243.061 1.00 18.61  ? 908  GLY A  C   1 
ATOM   6690  O O   . GLY A  1 908  ? 194.286 203.669 242.508 1.00 22.67  ? 908  GLY A  O   1 
ATOM   6691  N N   . ILE A  1 909  ? 193.077 205.389 243.315 1.00 17.65  ? 909  ILE A  N   1 
ATOM   6692  C CA  . ILE A  1 909  ? 194.039 206.407 242.916 1.00 13.66  ? 909  ILE A  CA  1 
ATOM   6693  C C   . ILE A  1 909  ? 194.910 206.855 244.083 1.00 14.96  ? 909  ILE A  C   1 
ATOM   6694  O O   . ILE A  1 909  ? 195.617 207.859 243.974 1.00 18.46  ? 909  ILE A  O   1 
ATOM   6695  C CB  . ILE A  1 909  ? 193.335 207.609 242.269 1.00 12.13  ? 909  ILE A  CB  1 
ATOM   6696  C CG1 . ILE A  1 909  ? 192.428 208.315 243.277 1.00 16.97  ? 909  ILE A  CG1 1 
ATOM   6697  C CG2 . ILE A  1 909  ? 192.519 207.154 241.079 1.00 19.61  ? 909  ILE A  CG2 1 
ATOM   6698  C CD1 . ILE A  1 909  ? 191.943 209.658 242.810 1.00 12.11  ? 909  ILE A  CD1 1 
ATOM   6699  N N   . GLY A  1 910  ? 194.869 206.137 245.201 1.00 16.49  ? 910  GLY A  N   1 
ATOM   6700  C CA  . GLY A  1 910  ? 195.719 206.458 246.331 1.00 16.22  ? 910  GLY A  CA  1 
ATOM   6701  C C   . GLY A  1 910  ? 195.265 207.644 247.150 1.00 13.22  ? 910  GLY A  C   1 
ATOM   6702  O O   . GLY A  1 910  ? 196.091 208.288 247.804 1.00 9.28   ? 910  GLY A  O   1 
ATOM   6703  N N   . VAL A  1 911  ? 193.974 207.955 247.132 1.00 13.71  ? 911  VAL A  N   1 
ATOM   6704  C CA  . VAL A  1 911  ? 193.382 208.955 248.010 1.00 14.43  ? 911  VAL A  CA  1 
ATOM   6705  C C   . VAL A  1 911  ? 192.400 208.236 248.920 1.00 12.06  ? 911  VAL A  C   1 
ATOM   6706  O O   . VAL A  1 911  ? 191.527 207.503 248.442 1.00 21.06  ? 911  VAL A  O   1 
ATOM   6707  C CB  . VAL A  1 911  ? 192.686 210.071 247.214 1.00 12.33  ? 911  VAL A  CB  1 
ATOM   6708  C CG1 . VAL A  1 911  ? 192.112 211.117 248.151 1.00 16.34  ? 911  VAL A  CG1 1 
ATOM   6709  C CG2 . VAL A  1 911  ? 193.653 210.712 246.240 1.00 14.21  ? 911  VAL A  CG2 1 
ATOM   6710  N N   . THR A  1 912  ? 192.539 208.446 250.225 1.00 25.50  ? 912  THR A  N   1 
ATOM   6711  C CA  . THR A  1 912  ? 191.754 207.689 251.188 1.00 21.23  ? 912  THR A  CA  1 
ATOM   6712  C C   . THR A  1 912  ? 190.272 207.993 251.022 1.00 29.07  ? 912  THR A  C   1 
ATOM   6713  O O   . THR A  1 912  ? 189.879 209.126 250.733 1.00 34.37  ? 912  THR A  O   1 
ATOM   6714  C CB  . THR A  1 912  ? 192.201 208.011 252.611 1.00 14.45  ? 912  THR A  CB  1 
ATOM   6715  O OG1 . THR A  1 912  ? 193.629 208.098 252.658 1.00 19.58  ? 912  THR A  OG1 1 
ATOM   6716  C CG2 . THR A  1 912  ? 191.753 206.926 253.559 1.00 23.38  ? 912  THR A  CG2 1 
ATOM   6717  N N   . GLN A  1 913  ? 189.446 206.964 251.208 1.00 27.27  ? 913  GLN A  N   1 
ATOM   6718  C CA  . GLN A  1 913  ? 188.031 207.079 250.884 1.00 23.09  ? 913  GLN A  CA  1 
ATOM   6719  C C   . GLN A  1 913  ? 187.320 208.140 251.708 1.00 21.91  ? 913  GLN A  C   1 
ATOM   6720  O O   . GLN A  1 913  ? 186.310 208.682 251.248 1.00 35.42  ? 913  GLN A  O   1 
ATOM   6721  C CB  . GLN A  1 913  ? 187.338 205.732 251.074 1.00 28.40  ? 913  GLN A  CB  1 
ATOM   6722  C CG  . GLN A  1 913  ? 187.504 205.123 252.445 1.00 16.13  ? 913  GLN A  CG  1 
ATOM   6723  C CD  . GLN A  1 913  ? 186.870 203.756 252.536 1.00 20.99  ? 913  GLN A  CD  1 
ATOM   6724  O OE1 . GLN A  1 913  ? 185.696 203.582 252.211 1.00 26.67  ? 913  GLN A  OE1 1 
ATOM   6725  N NE2 . GLN A  1 913  ? 187.648 202.768 252.965 1.00 36.70  ? 913  GLN A  NE2 1 
ATOM   6726  N N   . ASN A  1 914  ? 187.809 208.458 252.906 1.00 28.43  ? 914  ASN A  N   1 
ATOM   6727  C CA  . ASN A  1 914  ? 187.162 209.502 253.689 1.00 22.24  ? 914  ASN A  CA  1 
ATOM   6728  C C   . ASN A  1 914  ? 187.275 210.863 253.021 1.00 32.53  ? 914  ASN A  C   1 
ATOM   6729  O O   . ASN A  1 914  ? 186.505 211.767 253.354 1.00 37.46  ? 914  ASN A  O   1 
ATOM   6730  C CB  . ASN A  1 914  ? 187.750 209.557 255.099 1.00 23.80  ? 914  ASN A  CB  1 
ATOM   6731  C CG  . ASN A  1 914  ? 189.195 209.990 255.114 1.00 25.28  ? 914  ASN A  CG  1 
ATOM   6732  O OD1 . ASN A  1 914  ? 190.098 209.190 254.877 1.00 29.30  ? 914  ASN A  OD1 1 
ATOM   6733  N ND2 . ASN A  1 914  ? 189.427 211.261 255.413 1.00 36.31  ? 914  ASN A  ND2 1 
ATOM   6734  N N   . VAL A  1 915  ? 188.216 211.028 252.089 1.00 30.19  ? 915  VAL A  N   1 
ATOM   6735  C CA  . VAL A  1 915  ? 188.317 212.275 251.344 1.00 20.41  ? 915  VAL A  CA  1 
ATOM   6736  C C   . VAL A  1 915  ? 187.135 212.466 250.406 1.00 21.79  ? 915  VAL A  C   1 
ATOM   6737  O O   . VAL A  1 915  ? 186.825 213.601 250.031 1.00 28.48  ? 915  VAL A  O   1 
ATOM   6738  C CB  . VAL A  1 915  ? 189.641 212.315 250.563 1.00 21.02  ? 915  VAL A  CB  1 
ATOM   6739  C CG1 . VAL A  1 915  ? 189.741 213.595 249.760 1.00 30.13  ? 915  VAL A  CG1 1 
ATOM   6740  C CG2 . VAL A  1 915  ? 190.815 212.183 251.516 1.00 27.33  ? 915  VAL A  CG2 1 
ATOM   6741  N N   . LEU A  1 916  ? 186.473 211.382 250.002 1.00 21.78  ? 916  LEU A  N   1 
ATOM   6742  C CA  . LEU A  1 916  ? 185.238 211.504 249.234 1.00 19.01  ? 916  LEU A  CA  1 
ATOM   6743  C C   . LEU A  1 916  ? 184.081 211.896 250.140 1.00 23.74  ? 916  LEU A  C   1 
ATOM   6744  O O   . LEU A  1 916  ? 183.378 212.880 249.888 1.00 24.04  ? 916  LEU A  O   1 
ATOM   6745  C CB  . LEU A  1 916  ? 184.930 210.187 248.521 1.00 14.33  ? 916  LEU A  CB  1 
ATOM   6746  C CG  . LEU A  1 916  ? 183.533 210.071 247.902 1.00 15.98  ? 916  LEU A  CG  1 
ATOM   6747  C CD1 . LEU A  1 916  ? 183.390 211.010 246.725 1.00 16.95  ? 916  LEU A  CD1 1 
ATOM   6748  C CD2 . LEU A  1 916  ? 183.251 208.650 247.484 1.00 22.19  ? 916  LEU A  CD2 1 
ATOM   6749  N N   . TYR A  1 917  ? 183.866 211.121 251.204 1.00 23.22  ? 917  TYR A  N   1 
ATOM   6750  C CA  . TYR A  1 917  ? 182.709 211.342 252.061 1.00 20.17  ? 917  TYR A  CA  1 
ATOM   6751  C C   . TYR A  1 917  ? 182.751 212.723 252.696 1.00 27.07  ? 917  TYR A  C   1 
ATOM   6752  O O   . TYR A  1 917  ? 181.723 213.403 252.792 1.00 42.82  ? 917  TYR A  O   1 
ATOM   6753  C CB  . TYR A  1 917  ? 182.651 210.263 253.137 1.00 28.08  ? 917  TYR A  CB  1 
ATOM   6754  C CG  . TYR A  1 917  ? 182.531 208.865 252.587 1.00 19.07  ? 917  TYR A  CG  1 
ATOM   6755  C CD1 . TYR A  1 917  ? 181.520 208.530 251.704 1.00 18.24  ? 917  TYR A  CD1 1 
ATOM   6756  C CD2 . TYR A  1 917  ? 183.438 207.881 252.942 1.00 16.82  ? 917  TYR A  CD2 1 
ATOM   6757  C CE1 . TYR A  1 917  ? 181.410 207.258 251.202 1.00 18.18  ? 917  TYR A  CE1 1 
ATOM   6758  C CE2 . TYR A  1 917  ? 183.334 206.606 252.442 1.00 17.76  ? 917  TYR A  CE2 1 
ATOM   6759  C CZ  . TYR A  1 917  ? 182.318 206.300 251.575 1.00 20.00  ? 917  TYR A  CZ  1 
ATOM   6760  O OH  . TYR A  1 917  ? 182.216 205.026 251.076 1.00 29.43  ? 917  TYR A  OH  1 
ATOM   6761  N N   . GLU A  1 918  ? 183.931 213.157 253.133 1.00 29.27  ? 918  GLU A  N   1 
ATOM   6762  C CA  . GLU A  1 918  ? 184.062 214.476 253.733 1.00 30.40  ? 918  GLU A  CA  1 
ATOM   6763  C C   . GLU A  1 918  ? 183.938 215.597 252.712 1.00 35.98  ? 918  GLU A  C   1 
ATOM   6764  O O   . GLU A  1 918  ? 183.878 216.765 253.108 1.00 52.82  ? 918  GLU A  O   1 
ATOM   6765  C CB  . GLU A  1 918  ? 185.399 214.575 254.469 1.00 35.04  ? 918  GLU A  CB  1 
ATOM   6766  C CG  . GLU A  1 918  ? 185.486 213.655 255.677 1.00 35.16  ? 918  GLU A  CG  1 
ATOM   6767  C CD  . GLU A  1 918  ? 186.746 213.867 256.490 1.00 40.43  ? 918  GLU A  CD  1 
ATOM   6768  O OE1 . GLU A  1 918  ? 187.656 213.016 256.412 1.00 44.98  ? 918  GLU A  OE1 1 
ATOM   6769  O OE2 . GLU A  1 918  ? 186.828 214.889 257.204 1.00 49.96  ? 918  GLU A  OE2 1 
ATOM   6770  N N   . ASN A  1 919  ? 183.893 215.271 251.415 1.00 21.22  ? 919  ASN A  N   1 
ATOM   6771  C CA  . ASN A  1 919  ? 183.720 216.277 250.373 1.00 21.97  ? 919  ASN A  CA  1 
ATOM   6772  C C   . ASN A  1 919  ? 182.718 215.828 249.313 1.00 23.12  ? 919  ASN A  C   1 
ATOM   6773  O O   . ASN A  1 919  ? 182.848 216.219 248.148 1.00 22.88  ? 919  ASN A  O   1 
ATOM   6774  C CB  . ASN A  1 919  ? 185.058 216.603 249.704 1.00 20.02  ? 919  ASN A  CB  1 
ATOM   6775  C CG  . ASN A  1 919  ? 186.054 217.220 250.659 1.00 28.02  ? 919  ASN A  CG  1 
ATOM   6776  O OD1 . ASN A  1 919  ? 187.050 216.597 251.022 1.00 25.38  ? 919  ASN A  OD1 1 
ATOM   6777  N ND2 . ASN A  1 919  ? 185.799 218.458 251.063 1.00 36.36  ? 919  ASN A  ND2 1 
ATOM   6778  N N   . GLN A  1 920  ? 181.725 215.014 249.681 1.00 25.35  ? 920  GLN A  N   1 
ATOM   6779  C CA  . GLN A  1 920  ? 180.846 214.419 248.679 1.00 20.18  ? 920  GLN A  CA  1 
ATOM   6780  C C   . GLN A  1 920  ? 180.059 215.479 247.922 1.00 24.90  ? 920  GLN A  C   1 
ATOM   6781  O O   . GLN A  1 920  ? 179.896 215.385 246.701 1.00 36.66  ? 920  GLN A  O   1 
ATOM   6782  C CB  . GLN A  1 920  ? 179.892 213.425 249.337 1.00 24.82  ? 920  GLN A  CB  1 
ATOM   6783  C CG  . GLN A  1 920  ? 179.032 212.658 248.350 1.00 20.64  ? 920  GLN A  CG  1 
ATOM   6784  C CD  . GLN A  1 920  ? 178.152 211.630 249.019 1.00 22.25  ? 920  GLN A  CD  1 
ATOM   6785  O OE1 . GLN A  1 920  ? 178.444 211.171 250.121 1.00 23.15  ? 920  GLN A  OE1 1 
ATOM   6786  N NE2 . GLN A  1 920  ? 177.061 211.264 248.358 1.00 26.13  ? 920  GLN A  NE2 1 
ATOM   6787  N N   . LYS A  1 921  ? 179.552 216.491 248.626 1.00 25.75  ? 921  LYS A  N   1 
ATOM   6788  C CA  . LYS A  1 921  ? 178.788 217.534 247.950 1.00 29.54  ? 921  LYS A  CA  1 
ATOM   6789  C C   . LYS A  1 921  ? 179.633 218.228 246.891 1.00 31.09  ? 921  LYS A  C   1 
ATOM   6790  O O   . LYS A  1 921  ? 179.164 218.477 245.775 1.00 32.20  ? 921  LYS A  O   1 
ATOM   6791  C CB  . LYS A  1 921  ? 178.273 218.551 248.966 1.00 28.39  ? 921  LYS A  CB  1 
ATOM   6792  C CG  . LYS A  1 921  ? 177.234 218.010 249.932 1.00 35.34  ? 921  LYS A  CG  1 
ATOM   6793  C CD  . LYS A  1 921  ? 175.914 217.739 249.236 1.00 45.79  ? 921  LYS A  CD  1 
ATOM   6794  C CE  . LYS A  1 921  ? 174.792 217.543 250.240 1.00 55.20  ? 921  LYS A  CE  1 
ATOM   6795  N NZ  . LYS A  1 921  ? 174.456 218.808 250.952 1.00 68.10  ? 921  LYS A  NZ  1 
ATOM   6796  N N   . LEU A  1 922  ? 180.883 218.548 247.224 1.00 29.94  ? 922  LEU A  N   1 
ATOM   6797  C CA  . LEU A  1 922  ? 181.757 219.222 246.272 1.00 22.32  ? 922  LEU A  CA  1 
ATOM   6798  C C   . LEU A  1 922  ? 182.109 218.314 245.103 1.00 29.05  ? 922  LEU A  C   1 
ATOM   6799  O O   . LEU A  1 922  ? 182.141 218.761 243.951 1.00 42.81  ? 922  LEU A  O   1 
ATOM   6800  C CB  . LEU A  1 922  ? 183.020 219.690 246.989 1.00 26.55  ? 922  LEU A  CB  1 
ATOM   6801  C CG  . LEU A  1 922  ? 184.148 220.275 246.140 1.00 29.73  ? 922  LEU A  CG  1 
ATOM   6802  C CD1 . LEU A  1 922  ? 183.682 221.520 245.414 1.00 41.10  ? 922  LEU A  CD1 1 
ATOM   6803  C CD2 . LEU A  1 922  ? 185.349 220.577 247.017 1.00 33.27  ? 922  LEU A  CD2 1 
ATOM   6804  N N   . ILE A  1 923  ? 182.382 217.038 245.375 1.00 25.86  ? 923  ILE A  N   1 
ATOM   6805  C CA  . ILE A  1 923  ? 182.732 216.116 244.301 1.00 19.52  ? 923  ILE A  CA  1 
ATOM   6806  C C   . ILE A  1 923  ? 181.531 215.876 243.399 1.00 21.95  ? 923  ILE A  C   1 
ATOM   6807  O O   . ILE A  1 923  ? 181.659 215.832 242.170 1.00 25.36  ? 923  ILE A  O   1 
ATOM   6808  C CB  . ILE A  1 923  ? 183.280 214.804 244.888 1.00 19.55  ? 923  ILE A  CB  1 
ATOM   6809  C CG1 . ILE A  1 923  ? 184.677 215.037 245.465 1.00 19.90  ? 923  ILE A  CG1 1 
ATOM   6810  C CG2 . ILE A  1 923  ? 183.318 213.721 243.827 1.00 18.15  ? 923  ILE A  CG2 1 
ATOM   6811  C CD1 . ILE A  1 923  ? 185.167 213.936 246.368 1.00 17.23  ? 923  ILE A  CD1 1 
ATOM   6812  N N   . ALA A  1 924  ? 180.347 215.719 243.988 1.00 17.96  ? 924  ALA A  N   1 
ATOM   6813  C CA  . ALA A  1 924  ? 179.144 215.529 243.189 1.00 19.54  ? 924  ALA A  CA  1 
ATOM   6814  C C   . ALA A  1 924  ? 178.866 216.748 242.323 1.00 19.72  ? 924  ALA A  C   1 
ATOM   6815  O O   . ALA A  1 924  ? 178.524 216.622 241.143 1.00 23.01  ? 924  ALA A  O   1 
ATOM   6816  C CB  . ALA A  1 924  ? 177.955 215.238 244.099 1.00 21.77  ? 924  ALA A  CB  1 
ATOM   6817  N N   . ASN A  1 925  ? 178.995 217.944 242.900 1.00 23.85  ? 925  ASN A  N   1 
ATOM   6818  C CA  . ASN A  1 925  ? 178.728 219.160 242.140 1.00 19.39  ? 925  ASN A  CA  1 
ATOM   6819  C C   . ASN A  1 925  ? 179.764 219.367 241.044 1.00 17.89  ? 925  ASN A  C   1 
ATOM   6820  O O   . ASN A  1 925  ? 179.430 219.820 239.944 1.00 22.24  ? 925  ASN A  O   1 
ATOM   6821  C CB  . ASN A  1 925  ? 178.687 220.365 243.077 1.00 20.78  ? 925  ASN A  CB  1 
ATOM   6822  C CG  . ASN A  1 925  ? 177.472 220.356 243.979 1.00 26.52  ? 925  ASN A  CG  1 
ATOM   6823  O OD1 . ASN A  1 925  ? 176.496 219.656 243.714 1.00 27.24  ? 925  ASN A  OD1 1 
ATOM   6824  N ND2 . ASN A  1 925  ? 177.521 221.139 245.049 1.00 27.44  ? 925  ASN A  ND2 1 
ATOM   6825  N N   . GLN A  1 926  ? 181.027 219.043 241.323 1.00 17.37  ? 926  GLN A  N   1 
ATOM   6826  C CA  . GLN A  1 926  ? 182.060 219.206 240.308 1.00 16.89  ? 926  GLN A  CA  1 
ATOM   6827  C C   . GLN A  1 926  ? 181.840 218.264 239.134 1.00 22.55  ? 926  GLN A  C   1 
ATOM   6828  O O   . GLN A  1 926  ? 182.114 218.633 237.987 1.00 23.62  ? 926  GLN A  O   1 
ATOM   6829  C CB  . GLN A  1 926  ? 183.442 218.977 240.915 1.00 13.57  ? 926  GLN A  CB  1 
ATOM   6830  C CG  . GLN A  1 926  ? 183.962 220.159 241.694 1.00 22.14  ? 926  GLN A  CG  1 
ATOM   6831  C CD  . GLN A  1 926  ? 185.455 220.106 241.894 1.00 32.64  ? 926  GLN A  CD  1 
ATOM   6832  O OE1 . GLN A  1 926  ? 186.209 220.763 241.180 1.00 45.52  ? 926  GLN A  OE1 1 
ATOM   6833  N NE2 . GLN A  1 926  ? 185.897 219.321 242.866 1.00 26.91  ? 926  GLN A  NE2 1 
ATOM   6834  N N   . PHE A  1 927  ? 181.364 217.047 239.394 1.00 23.93  ? 927  PHE A  N   1 
ATOM   6835  C CA  . PHE A  1 927  ? 181.031 216.143 238.302 1.00 17.79  ? 927  PHE A  CA  1 
ATOM   6836  C C   . PHE A  1 927  ? 179.868 216.687 237.487 1.00 21.43  ? 927  PHE A  C   1 
ATOM   6837  O O   . PHE A  1 927  ? 179.904 216.684 236.252 1.00 33.95  ? 927  PHE A  O   1 
ATOM   6838  C CB  . PHE A  1 927  ? 180.696 214.757 238.847 1.00 18.43  ? 927  PHE A  CB  1 
ATOM   6839  C CG  . PHE A  1 927  ? 180.169 213.811 237.809 1.00 22.92  ? 927  PHE A  CG  1 
ATOM   6840  C CD1 . PHE A  1 927  ? 181.026 213.177 236.931 1.00 26.16  ? 927  PHE A  CD1 1 
ATOM   6841  C CD2 . PHE A  1 927  ? 178.817 213.548 237.715 1.00 17.20  ? 927  PHE A  CD2 1 
ATOM   6842  C CE1 . PHE A  1 927  ? 180.544 212.309 235.980 1.00 18.49  ? 927  PHE A  CE1 1 
ATOM   6843  C CE2 . PHE A  1 927  ? 178.332 212.679 236.766 1.00 18.25  ? 927  PHE A  CE2 1 
ATOM   6844  C CZ  . PHE A  1 927  ? 179.196 212.060 235.899 1.00 14.93  ? 927  PHE A  CZ  1 
ATOM   6845  N N   . ASN A  1 928  ? 178.822 217.161 238.165 1.00 17.25  ? 928  ASN A  N   1 
ATOM   6846  C CA  . ASN A  1 928  ? 177.676 217.714 237.453 1.00 19.53  ? 928  ASN A  CA  1 
ATOM   6847  C C   . ASN A  1 928  ? 178.075 218.946 236.658 1.00 23.02  ? 928  ASN A  C   1 
ATOM   6848  O O   . ASN A  1 928  ? 177.630 219.134 235.520 1.00 32.98  ? 928  ASN A  O   1 
ATOM   6849  C CB  . ASN A  1 928  ? 176.562 218.048 238.440 1.00 29.26  ? 928  ASN A  CB  1 
ATOM   6850  C CG  . ASN A  1 928  ? 176.129 216.849 239.250 1.00 27.48  ? 928  ASN A  CG  1 
ATOM   6851  O OD1 . ASN A  1 928  ? 176.292 215.710 238.822 1.00 36.88  ? 928  ASN A  OD1 1 
ATOM   6852  N ND2 . ASN A  1 928  ? 175.576 217.098 240.429 1.00 29.64  ? 928  ASN A  ND2 1 
ATOM   6853  N N   . SER A  1 929  ? 178.912 219.803 237.240 1.00 20.43  ? 929  SER A  N   1 
ATOM   6854  C CA  . SER A  1 929  ? 179.386 220.969 236.507 1.00 18.86  ? 929  SER A  CA  1 
ATOM   6855  C C   . SER A  1 929  ? 180.227 220.554 235.308 1.00 22.51  ? 929  SER A  C   1 
ATOM   6856  O O   . SER A  1 929  ? 180.090 221.122 234.219 1.00 41.95  ? 929  SER A  O   1 
ATOM   6857  C CB  . SER A  1 929  ? 180.188 221.878 237.433 1.00 20.98  ? 929  SER A  CB  1 
ATOM   6858  O OG  . SER A  1 929  ? 180.715 222.983 236.723 1.00 39.79  ? 929  SER A  OG  1 
ATOM   6859  N N   . ALA A  1 930  ? 181.099 219.559 235.487 1.00 25.21  ? 930  ALA A  N   1 
ATOM   6860  C CA  . ALA A  1 930  ? 181.970 219.133 234.397 1.00 18.80  ? 930  ALA A  CA  1 
ATOM   6861  C C   . ALA A  1 930  ? 181.170 218.526 233.254 1.00 23.63  ? 930  ALA A  C   1 
ATOM   6862  O O   . ALA A  1 930  ? 181.482 218.758 232.081 1.00 29.61  ? 930  ALA A  O   1 
ATOM   6863  C CB  . ALA A  1 930  ? 183.001 218.132 234.915 1.00 23.90  ? 930  ALA A  CB  1 
ATOM   6864  N N   . ILE A  1 931  ? 180.139 217.742 233.571 1.00 25.60  ? 931  ILE A  N   1 
ATOM   6865  C CA  . ILE A  1 931  ? 179.292 217.190 232.521 1.00 24.17  ? 931  ILE A  CA  1 
ATOM   6866  C C   . ILE A  1 931  ? 178.551 218.305 231.800 1.00 26.39  ? 931  ILE A  C   1 
ATOM   6867  O O   . ILE A  1 931  ? 178.313 218.220 230.591 1.00 36.98  ? 931  ILE A  O   1 
ATOM   6868  C CB  . ILE A  1 931  ? 178.315 216.156 233.106 1.00 29.33  ? 931  ILE A  CB  1 
ATOM   6869  C CG1 . ILE A  1 931  ? 179.066 214.921 233.607 1.00 24.46  ? 931  ILE A  CG1 1 
ATOM   6870  C CG2 . ILE A  1 931  ? 177.286 215.753 232.071 1.00 41.24  ? 931  ILE A  CG2 1 
ATOM   6871  C CD1 . ILE A  1 931  ? 179.630 214.044 232.510 1.00 36.41  ? 931  ILE A  CD1 1 
ATOM   6872  N N   . GLY A  1 932  ? 178.164 219.357 232.521 1.00 34.52  ? 932  GLY A  N   1 
ATOM   6873  C CA  . GLY A  1 932  ? 177.541 220.495 231.866 1.00 36.81  ? 932  GLY A  CA  1 
ATOM   6874  C C   . GLY A  1 932  ? 178.431 221.098 230.799 1.00 30.00  ? 932  GLY A  C   1 
ATOM   6875  O O   . GLY A  1 932  ? 177.989 221.371 229.681 1.00 36.00  ? 932  GLY A  O   1 
ATOM   6876  N N   . LYS A  1 933  ? 179.706 221.305 231.129 1.00 29.69  ? 933  LYS A  N   1 
ATOM   6877  C CA  . LYS A  1 933  ? 180.635 221.869 230.160 1.00 31.11  ? 933  LYS A  CA  1 
ATOM   6878  C C   . LYS A  1 933  ? 180.766 220.983 228.930 1.00 33.99  ? 933  LYS A  C   1 
ATOM   6879  O O   . LYS A  1 933  ? 181.061 221.480 227.838 1.00 41.73  ? 933  LYS A  O   1 
ATOM   6880  C CB  . LYS A  1 933  ? 182.001 222.081 230.810 1.00 34.73  ? 933  LYS A  CB  1 
ATOM   6881  C CG  . LYS A  1 933  ? 182.127 223.389 231.575 1.00 44.83  ? 933  LYS A  CG  1 
ATOM   6882  C CD  . LYS A  1 933  ? 183.532 223.582 232.128 1.00 51.59  ? 933  LYS A  CD  1 
ATOM   6883  C CE  . LYS A  1 933  ? 183.692 222.932 233.488 1.00 37.76  ? 933  LYS A  CE  1 
ATOM   6884  N NZ  . LYS A  1 933  ? 182.908 223.648 234.532 1.00 32.05  ? 933  LYS A  NZ  1 
ATOM   6885  N N   . ILE A  1 934  ? 180.558 219.675 229.081 1.00 40.18  ? 934  ILE A  N   1 
ATOM   6886  C CA  . ILE A  1 934  ? 180.602 218.788 227.924 1.00 34.52  ? 934  ILE A  CA  1 
ATOM   6887  C C   . ILE A  1 934  ? 179.469 219.118 226.963 1.00 36.75  ? 934  ILE A  C   1 
ATOM   6888  O O   . ILE A  1 934  ? 179.674 219.206 225.747 1.00 37.88  ? 934  ILE A  O   1 
ATOM   6889  C CB  . ILE A  1 934  ? 180.548 217.317 228.377 1.00 29.79  ? 934  ILE A  CB  1 
ATOM   6890  C CG1 . ILE A  1 934  ? 181.833 216.924 229.114 1.00 32.81  ? 934  ILE A  CG1 1 
ATOM   6891  C CG2 . ILE A  1 934  ? 180.297 216.403 227.191 1.00 28.32  ? 934  ILE A  CG2 1 
ATOM   6892  C CD1 . ILE A  1 934  ? 183.097 217.033 228.285 1.00 23.15  ? 934  ILE A  CD1 1 
ATOM   6893  N N   . GLN A  1 935  ? 178.258 219.315 227.488 1.00 48.43  ? 935  GLN A  N   1 
ATOM   6894  C CA  . GLN A  1 935  ? 177.146 219.740 226.645 1.00 35.42  ? 935  GLN A  CA  1 
ATOM   6895  C C   . GLN A  1 935  ? 177.444 221.086 226.000 1.00 45.99  ? 935  GLN A  C   1 
ATOM   6896  O O   . GLN A  1 935  ? 177.227 221.277 224.798 1.00 43.47  ? 935  GLN A  O   1 
ATOM   6897  C CB  . GLN A  1 935  ? 175.863 219.819 227.472 1.00 41.99  ? 935  GLN A  CB  1 
ATOM   6898  C CG  . GLN A  1 935  ? 175.425 218.499 228.085 1.00 50.90  ? 935  GLN A  CG  1 
ATOM   6899  C CD  . GLN A  1 935  ? 174.098 218.591 228.824 1.00 63.74  ? 935  GLN A  CD  1 
ATOM   6900  O OE1 . GLN A  1 935  ? 173.469 217.572 229.107 1.00 66.39  ? 935  GLN A  OE1 1 
ATOM   6901  N NE2 . GLN A  1 935  ? 173.664 219.809 229.145 1.00 62.04  ? 935  GLN A  NE2 1 
ATOM   6902  N N   . ASP A  1 936  ? 177.951 222.036 226.789 1.00 54.22  ? 936  ASP A  N   1 
ATOM   6903  C CA  . ASP A  1 936  ? 178.277 223.350 226.248 1.00 46.21  ? 936  ASP A  CA  1 
ATOM   6904  C C   . ASP A  1 936  ? 179.360 223.253 225.182 1.00 45.55  ? 936  ASP A  C   1 
ATOM   6905  O O   . ASP A  1 936  ? 179.283 223.924 224.147 1.00 54.49  ? 936  ASP A  O   1 
ATOM   6906  C CB  . ASP A  1 936  ? 178.718 224.280 227.376 1.00 48.59  ? 936  ASP A  CB  1 
ATOM   6907  C CG  . ASP A  1 936  ? 177.606 224.562 228.367 1.00 57.16  ? 936  ASP A  CG  1 
ATOM   6908  O OD1 . ASP A  1 936  ? 176.462 224.126 228.117 1.00 54.43  ? 936  ASP A  OD1 1 
ATOM   6909  O OD2 . ASP A  1 936  ? 177.876 225.217 229.396 1.00 61.45  ? 936  ASP A  OD2 1 
ATOM   6910  N N   . SER A  1 937  ? 180.381 222.429 225.419 1.00 37.35  ? 937  SER A  N   1 
ATOM   6911  C CA  . SER A  1 937  ? 181.454 222.287 224.441 1.00 38.64  ? 937  SER A  CA  1 
ATOM   6912  C C   . SER A  1 937  ? 180.923 221.722 223.132 1.00 46.32  ? 937  SER A  C   1 
ATOM   6913  O O   . SER A  1 937  ? 181.152 222.290 222.059 1.00 53.77  ? 937  SER A  O   1 
ATOM   6914  C CB  . SER A  1 937  ? 182.559 221.393 225.005 1.00 54.14  ? 937  SER A  CB  1 
ATOM   6915  O OG  . SER A  1 937  ? 183.557 221.133 224.035 1.00 56.69  ? 937  SER A  OG  1 
ATOM   6916  N N   . LEU A  1 938  ? 180.190 220.611 223.203 1.00 48.45  ? 938  LEU A  N   1 
ATOM   6917  C CA  . LEU A  1 938  ? 179.669 219.996 221.987 1.00 47.07  ? 938  LEU A  CA  1 
ATOM   6918  C C   . LEU A  1 938  ? 178.719 220.939 221.263 1.00 50.01  ? 938  LEU A  C   1 
ATOM   6919  O O   . LEU A  1 938  ? 178.686 220.973 220.027 1.00 45.04  ? 938  LEU A  O   1 
ATOM   6920  C CB  . LEU A  1 938  ? 178.968 218.681 222.326 1.00 44.93  ? 938  LEU A  CB  1 
ATOM   6921  C CG  . LEU A  1 938  ? 179.884 217.526 222.742 1.00 44.72  ? 938  LEU A  CG  1 
ATOM   6922  C CD1 . LEU A  1 938  ? 179.082 216.373 223.326 1.00 34.01  ? 938  LEU A  CD1 1 
ATOM   6923  C CD2 . LEU A  1 938  ? 180.713 217.048 221.561 1.00 42.75  ? 938  LEU A  CD2 1 
ATOM   6924  N N   . SER A  1 939  ? 177.935 221.711 222.016 1.00 56.54  ? 939  SER A  N   1 
ATOM   6925  C CA  . SER A  1 939  ? 177.034 222.677 221.396 1.00 60.39  ? 939  SER A  CA  1 
ATOM   6926  C C   . SER A  1 939  ? 177.809 223.777 220.678 1.00 55.91  ? 939  SER A  C   1 
ATOM   6927  O O   . SER A  1 939  ? 177.382 224.261 219.624 1.00 50.63  ? 939  SER A  O   1 
ATOM   6928  C CB  . SER A  1 939  ? 176.111 223.278 222.457 1.00 50.10  ? 939  SER A  CB  1 
ATOM   6929  O OG  . SER A  1 939  ? 175.297 224.301 221.912 1.00 58.14  ? 939  SER A  OG  1 
ATOM   6930  N N   . SER A  1 940  ? 178.950 224.183 221.233 1.00 57.75  ? 940  SER A  N   1 
ATOM   6931  C CA  . SER A  1 940  ? 179.651 225.378 220.778 1.00 59.30  ? 940  SER A  CA  1 
ATOM   6932  C C   . SER A  1 940  ? 180.632 225.103 219.641 1.00 61.79  ? 940  SER A  C   1 
ATOM   6933  O O   . SER A  1 940  ? 180.460 225.623 218.534 1.00 71.63  ? 940  SER A  O   1 
ATOM   6934  C CB  . SER A  1 940  ? 180.396 226.013 221.956 1.00 64.44  ? 940  SER A  CB  1 
ATOM   6935  O OG  . SER A  1 940  ? 179.500 226.364 222.997 1.00 63.02  ? 940  SER A  OG  1 
ATOM   6936  N N   . THR A  1 941  ? 181.655 224.287 219.888 1.00 63.49  ? 941  THR A  N   1 
ATOM   6937  C CA  . THR A  1 941  ? 182.763 224.141 218.951 1.00 68.60  ? 941  THR A  CA  1 
ATOM   6938  C C   . THR A  1 941  ? 182.362 223.249 217.783 1.00 64.88  ? 941  THR A  C   1 
ATOM   6939  O O   . THR A  1 941  ? 181.666 222.245 217.959 1.00 63.90  ? 941  THR A  O   1 
ATOM   6940  C CB  . THR A  1 941  ? 184.000 223.569 219.650 1.00 70.41  ? 941  THR A  CB  1 
ATOM   6941  O OG1 . THR A  1 941  ? 185.105 223.556 218.738 1.00 69.45  ? 941  THR A  OG1 1 
ATOM   6942  C CG2 . THR A  1 941  ? 183.742 222.155 220.141 1.00 59.72  ? 941  THR A  CG2 1 
ATOM   6943  N N   . ALA A  1 942  ? 182.805 223.633 216.584 1.00 61.30  ? 942  ALA A  N   1 
ATOM   6944  C CA  . ALA A  1 942  ? 182.347 222.977 215.365 1.00 60.62  ? 942  ALA A  CA  1 
ATOM   6945  C C   . ALA A  1 942  ? 183.136 221.717 215.026 1.00 71.80  ? 942  ALA A  C   1 
ATOM   6946  O O   . ALA A  1 942  ? 182.610 220.837 214.337 1.00 64.70  ? 942  ALA A  O   1 
ATOM   6947  C CB  . ALA A  1 942  ? 182.423 223.952 214.189 1.00 69.29  ? 942  ALA A  CB  1 
ATOM   6948  N N   . SER A  1 943  ? 184.381 221.604 215.488 1.00 77.90  ? 943  SER A  N   1 
ATOM   6949  C CA  . SER A  1 943  ? 185.316 220.612 214.969 1.00 67.77  ? 943  SER A  CA  1 
ATOM   6950  C C   . SER A  1 943  ? 185.646 219.499 215.954 1.00 64.30  ? 943  SER A  C   1 
ATOM   6951  O O   . SER A  1 943  ? 186.641 218.794 215.754 1.00 79.56  ? 943  SER A  O   1 
ATOM   6952  C CB  . SER A  1 943  ? 186.612 221.302 214.527 1.00 64.23  ? 943  SER A  CB  1 
ATOM   6953  O OG  . SER A  1 943  ? 187.179 222.052 215.587 1.00 85.19  ? 943  SER A  OG  1 
ATOM   6954  N N   . ALA A  1 944  ? 184.853 219.320 217.011 1.00 54.24  ? 944  ALA A  N   1 
ATOM   6955  C CA  . ALA A  1 944  ? 185.193 218.328 218.028 1.00 64.75  ? 944  ALA A  CA  1 
ATOM   6956  C C   . ALA A  1 944  ? 185.284 216.924 217.434 1.00 51.52  ? 944  ALA A  C   1 
ATOM   6957  O O   . ALA A  1 944  ? 186.240 216.187 217.700 1.00 52.03  ? 944  ALA A  O   1 
ATOM   6958  C CB  . ALA A  1 944  ? 184.166 218.369 219.160 1.00 64.18  ? 944  ALA A  CB  1 
ATOM   6959  N N   . LEU A  1 945  ? 184.300 216.538 216.623 1.00 54.14  ? 945  LEU A  N   1 
ATOM   6960  C CA  . LEU A  1 945  ? 184.193 215.166 216.138 1.00 40.99  ? 945  LEU A  CA  1 
ATOM   6961  C C   . LEU A  1 945  ? 184.990 214.933 214.860 1.00 34.08  ? 945  LEU A  C   1 
ATOM   6962  O O   . LEU A  1 945  ? 184.658 214.038 214.079 1.00 29.96  ? 945  LEU A  O   1 
ATOM   6963  C CB  . LEU A  1 945  ? 182.728 214.797 215.907 1.00 36.60  ? 945  LEU A  CB  1 
ATOM   6964  C CG  . LEU A  1 945  ? 181.958 214.434 217.175 1.00 29.53  ? 945  LEU A  CG  1 
ATOM   6965  C CD1 . LEU A  1 945  ? 181.618 215.676 217.975 1.00 46.17  ? 945  LEU A  CD1 1 
ATOM   6966  C CD2 . LEU A  1 945  ? 180.708 213.647 216.833 1.00 38.53  ? 945  LEU A  CD2 1 
ATOM   6967  N N   . GLY A  1 946  ? 186.023 215.745 214.628 1.00 32.50  ? 946  GLY A  N   1 
ATOM   6968  C CA  . GLY A  1 946  ? 186.788 215.634 213.394 1.00 26.08  ? 946  GLY A  CA  1 
ATOM   6969  C C   . GLY A  1 946  ? 187.110 214.204 213.006 1.00 34.12  ? 946  GLY A  C   1 
ATOM   6970  O O   . GLY A  1 946  ? 187.027 213.834 211.833 1.00 40.04  ? 946  GLY A  O   1 
ATOM   6971  N N   . LYS A  1 947  ? 187.491 213.378 213.982 1.00 32.02  ? 947  LYS A  N   1 
ATOM   6972  C CA  . LYS A  1 947  ? 187.891 212.011 213.662 1.00 20.80  ? 947  LYS A  CA  1 
ATOM   6973  C C   . LYS A  1 947  ? 186.778 211.257 212.949 1.00 25.42  ? 947  LYS A  C   1 
ATOM   6974  O O   . LYS A  1 947  ? 187.029 210.550 211.967 1.00 33.63  ? 947  LYS A  O   1 
ATOM   6975  C CB  . LYS A  1 947  ? 188.290 211.260 214.930 1.00 19.72  ? 947  LYS A  CB  1 
ATOM   6976  C CG  . LYS A  1 947  ? 189.675 211.577 215.443 1.00 23.67  ? 947  LYS A  CG  1 
ATOM   6977  C CD  . LYS A  1 947  ? 190.253 210.380 216.172 1.00 27.72  ? 947  LYS A  CD  1 
ATOM   6978  C CE  . LYS A  1 947  ? 191.368 210.787 217.104 1.00 19.35  ? 947  LYS A  CE  1 
ATOM   6979  N NZ  . LYS A  1 947  ? 190.840 211.503 218.295 1.00 17.50  ? 947  LYS A  NZ  1 
ATOM   6980  N N   . LEU A  1 948  ? 185.542 211.393 213.423 1.00 23.16  ? 948  LEU A  N   1 
ATOM   6981  C CA  . LEU A  1 948  ? 184.454 210.611 212.851 1.00 16.66  ? 948  LEU A  CA  1 
ATOM   6982  C C   . LEU A  1 948  ? 183.991 211.190 211.523 1.00 24.03  ? 948  LEU A  C   1 
ATOM   6983  O O   . LEU A  1 948  ? 183.610 210.441 210.618 1.00 32.37  ? 948  LEU A  O   1 
ATOM   6984  C CB  . LEU A  1 948  ? 183.296 210.531 213.841 1.00 22.40  ? 948  LEU A  CB  1 
ATOM   6985  C CG  . LEU A  1 948  ? 183.675 209.947 215.202 1.00 13.33  ? 948  LEU A  CG  1 
ATOM   6986  C CD1 . LEU A  1 948  ? 182.475 209.902 216.122 1.00 15.95  ? 948  LEU A  CD1 1 
ATOM   6987  C CD2 . LEU A  1 948  ? 184.275 208.564 215.044 1.00 18.22  ? 948  LEU A  CD2 1 
ATOM   6988  N N   . GLN A  1 949  ? 184.012 212.514 211.383 1.00 25.46  ? 949  GLN A  N   1 
ATOM   6989  C CA  . GLN A  1 949  ? 183.691 213.106 210.091 1.00 20.93  ? 949  GLN A  CA  1 
ATOM   6990  C C   . GLN A  1 949  ? 184.762 212.775 209.063 1.00 27.26  ? 949  GLN A  C   1 
ATOM   6991  O O   . GLN A  1 949  ? 184.454 212.543 207.890 1.00 47.92  ? 949  GLN A  O   1 
ATOM   6992  C CB  . GLN A  1 949  ? 183.529 214.618 210.228 1.00 26.01  ? 949  GLN A  CB  1 
ATOM   6993  C CG  . GLN A  1 949  ? 182.863 215.269 209.028 1.00 36.82  ? 949  GLN A  CG  1 
ATOM   6994  C CD  . GLN A  1 949  ? 181.425 214.827 208.853 1.00 40.87  ? 949  GLN A  CD  1 
ATOM   6995  O OE1 . GLN A  1 949  ? 180.574 215.107 209.694 1.00 53.45  ? 949  GLN A  OE1 1 
ATOM   6996  N NE2 . GLN A  1 949  ? 181.146 214.126 207.763 1.00 35.55  ? 949  GLN A  NE2 1 
ATOM   6997  N N   . ASP A  1 950  ? 186.027 212.745 209.485 1.00 21.55  ? 950  ASP A  N   1 
ATOM   6998  C CA  . ASP A  1 950  ? 187.103 212.434 208.552 1.00 21.26  ? 950  ASP A  CA  1 
ATOM   6999  C C   . ASP A  1 950  ? 186.936 211.047 207.950 1.00 25.79  ? 950  ASP A  C   1 
ATOM   7000  O O   . ASP A  1 950  ? 187.409 210.794 206.838 1.00 32.23  ? 950  ASP A  O   1 
ATOM   7001  C CB  . ASP A  1 950  ? 188.454 212.544 209.256 1.00 33.78  ? 950  ASP A  CB  1 
ATOM   7002  C CG  . ASP A  1 950  ? 189.609 212.662 208.282 1.00 52.00  ? 950  ASP A  CG  1 
ATOM   7003  O OD1 . ASP A  1 950  ? 189.355 212.711 207.059 1.00 56.45  ? 950  ASP A  OD1 1 
ATOM   7004  O OD2 . ASP A  1 950  ? 190.771 212.711 208.737 1.00 43.91  ? 950  ASP A  OD2 1 
ATOM   7005  N N   . VAL A  1 951  ? 186.277 210.136 208.664 1.00 27.62  ? 951  VAL A  N   1 
ATOM   7006  C CA  . VAL A  1 951  ? 186.023 208.806 208.121 1.00 23.17  ? 951  VAL A  CA  1 
ATOM   7007  C C   . VAL A  1 951  ? 184.872 208.845 207.126 1.00 28.66  ? 951  VAL A  C   1 
ATOM   7008  O O   . VAL A  1 951  ? 184.960 208.281 206.031 1.00 42.24  ? 951  VAL A  O   1 
ATOM   7009  C CB  . VAL A  1 951  ? 185.749 207.806 209.259 1.00 18.08  ? 951  VAL A  CB  1 
ATOM   7010  C CG1 . VAL A  1 951  ? 185.188 206.510 208.703 1.00 21.55  ? 951  VAL A  CG1 1 
ATOM   7011  C CG2 . VAL A  1 951  ? 187.022 207.538 210.038 1.00 29.39  ? 951  VAL A  CG2 1 
ATOM   7012  N N   . VAL A  1 952  ? 183.773 209.507 207.489 1.00 27.03  ? 952  VAL A  N   1 
ATOM   7013  C CA  . VAL A  1 952  ? 182.646 209.619 206.571 1.00 27.09  ? 952  VAL A  CA  1 
ATOM   7014  C C   . VAL A  1 952  ? 183.065 210.354 205.307 1.00 29.50  ? 952  VAL A  C   1 
ATOM   7015  O O   . VAL A  1 952  ? 182.655 209.996 204.197 1.00 38.86  ? 952  VAL A  O   1 
ATOM   7016  C CB  . VAL A  1 952  ? 181.462 210.318 207.262 1.00 28.15  ? 952  VAL A  CB  1 
ATOM   7017  C CG1 . VAL A  1 952  ? 180.391 210.679 206.251 1.00 37.90  ? 952  VAL A  CG1 1 
ATOM   7018  C CG2 . VAL A  1 952  ? 180.884 209.427 208.342 1.00 30.50  ? 952  VAL A  CG2 1 
ATOM   7019  N N   . ASN A  1 953  ? 183.887 211.393 205.451 1.00 22.17  ? 953  ASN A  N   1 
ATOM   7020  C CA  . ASN A  1 953  ? 184.304 212.171 204.290 1.00 20.80  ? 953  ASN A  CA  1 
ATOM   7021  C C   . ASN A  1 953  ? 185.209 211.356 203.378 1.00 26.77  ? 953  ASN A  C   1 
ATOM   7022  O O   . ASN A  1 953  ? 185.032 211.355 202.156 1.00 34.57  ? 953  ASN A  O   1 
ATOM   7023  C CB  . ASN A  1 953  ? 185.008 213.446 204.744 1.00 21.88  ? 953  ASN A  CB  1 
ATOM   7024  C CG  . ASN A  1 953  ? 184.050 214.463 205.323 1.00 35.83  ? 953  ASN A  CG  1 
ATOM   7025  O OD1 . ASN A  1 953  ? 182.862 214.190 205.479 1.00 43.16  ? 953  ASN A  OD1 1 
ATOM   7026  N ND2 . ASN A  1 953  ? 184.563 215.642 205.650 1.00 40.78  ? 953  ASN A  ND2 1 
ATOM   7027  N N   . GLN A  1 954  ? 186.190 210.658 203.952 1.00 20.98  ? 954  GLN A  N   1 
ATOM   7028  C CA  . GLN A  1 954  ? 187.123 209.898 203.126 1.00 22.10  ? 954  GLN A  CA  1 
ATOM   7029  C C   . GLN A  1 954  ? 186.411 208.782 202.376 1.00 24.77  ? 954  GLN A  C   1 
ATOM   7030  O O   . GLN A  1 954  ? 186.712 208.522 201.206 1.00 40.35  ? 954  GLN A  O   1 
ATOM   7031  C CB  . GLN A  1 954  ? 188.251 209.334 203.988 1.00 32.19  ? 954  GLN A  CB  1 
ATOM   7032  C CG  . GLN A  1 954  ? 189.416 210.293 204.170 1.00 41.29  ? 954  GLN A  CG  1 
ATOM   7033  C CD  . GLN A  1 954  ? 190.500 209.733 205.068 1.00 42.92  ? 954  GLN A  CD  1 
ATOM   7034  O OE1 . GLN A  1 954  ? 191.603 209.429 204.614 1.00 39.41  ? 954  GLN A  OE1 1 
ATOM   7035  N NE2 . GLN A  1 954  ? 190.193 209.593 206.351 1.00 50.79  ? 954  GLN A  NE2 1 
ATOM   7036  N N   . ASN A  1 955  ? 185.468 208.105 203.030 1.00 24.71  ? 955  ASN A  N   1 
ATOM   7037  C CA  . ASN A  1 955  ? 184.712 207.064 202.344 1.00 23.48  ? 955  ASN A  CA  1 
ATOM   7038  C C   . ASN A  1 955  ? 183.902 207.645 201.198 1.00 24.63  ? 955  ASN A  C   1 
ATOM   7039  O O   . ASN A  1 955  ? 183.837 207.057 200.114 1.00 33.58  ? 955  ASN A  O   1 
ATOM   7040  C CB  . ASN A  1 955  ? 183.797 206.341 203.331 1.00 38.41  ? 955  ASN A  CB  1 
ATOM   7041  C CG  . ASN A  1 955  ? 184.546 205.391 204.250 1.00 30.14  ? 955  ASN A  CG  1 
ATOM   7042  O OD1 . ASN A  1 955  ? 183.927 204.639 204.997 1.00 44.17  ? 955  ASN A  OD1 1 
ATOM   7043  N ND2 . ASN A  1 955  ? 185.875 205.420 204.208 1.00 24.68  ? 955  ASN A  ND2 1 
ATOM   7044  N N   . ALA A  1 956  ? 183.273 208.798 201.420 1.00 29.60  ? 956  ALA A  N   1 
ATOM   7045  C CA  . ALA A  1 956  ? 182.529 209.453 200.351 1.00 20.64  ? 956  ALA A  CA  1 
ATOM   7046  C C   . ALA A  1 956  ? 183.463 209.910 199.241 1.00 21.64  ? 956  ALA A  C   1 
ATOM   7047  O O   . ALA A  1 956  ? 183.173 209.724 198.055 1.00 33.97  ? 956  ALA A  O   1 
ATOM   7048  C CB  . ALA A  1 956  ? 181.741 210.636 200.911 1.00 27.10  ? 956  ALA A  CB  1 
ATOM   7049  N N   . GLN A  1 957  ? 184.597 210.509 199.607 1.00 19.61  ? 957  GLN A  N   1 
ATOM   7050  C CA  . GLN A  1 957  ? 185.522 211.007 198.598 1.00 19.33  ? 957  GLN A  CA  1 
ATOM   7051  C C   . GLN A  1 957  ? 186.029 209.878 197.712 1.00 22.67  ? 957  GLN A  C   1 
ATOM   7052  O O   . GLN A  1 957  ? 186.165 210.047 196.496 1.00 34.04  ? 957  GLN A  O   1 
ATOM   7053  C CB  . GLN A  1 957  ? 186.689 211.728 199.268 1.00 29.25  ? 957  GLN A  CB  1 
ATOM   7054  C CG  . GLN A  1 957  ? 187.765 212.193 198.303 1.00 45.66  ? 957  GLN A  CG  1 
ATOM   7055  C CD  . GLN A  1 957  ? 188.797 213.076 198.968 1.00 56.11  ? 957  GLN A  CD  1 
ATOM   7056  O OE1 . GLN A  1 957  ? 188.985 214.229 198.580 1.00 59.05  ? 957  GLN A  OE1 1 
ATOM   7057  N NE2 . GLN A  1 957  ? 189.478 212.541 199.976 1.00 52.75  ? 957  GLN A  NE2 1 
ATOM   7058  N N   . ALA A  1 958  ? 186.310 208.715 198.302 1.00 24.54  ? 958  ALA A  N   1 
ATOM   7059  C CA  . ALA A  1 958  ? 186.856 207.611 197.522 1.00 21.85  ? 958  ALA A  CA  1 
ATOM   7060  C C   . ALA A  1 958  ? 185.856 207.096 196.500 1.00 19.76  ? 958  ALA A  C   1 
ATOM   7061  O O   . ALA A  1 958  ? 186.246 206.712 195.393 1.00 27.29  ? 958  ALA A  O   1 
ATOM   7062  C CB  . ALA A  1 958  ? 187.290 206.476 198.444 1.00 23.98  ? 958  ALA A  CB  1 
ATOM   7063  N N   . LEU A  1 959  ? 184.570 207.069 196.846 1.00 18.72  ? 959  LEU A  N   1 
ATOM   7064  C CA  . LEU A  1 959  ? 183.563 206.635 195.886 1.00 18.84  ? 959  LEU A  CA  1 
ATOM   7065  C C   . LEU A  1 959  ? 183.314 207.697 194.826 1.00 21.19  ? 959  LEU A  C   1 
ATOM   7066  O O   . LEU A  1 959  ? 183.189 207.375 193.642 1.00 26.83  ? 959  LEU A  O   1 
ATOM   7067  C CB  . LEU A  1 959  ? 182.259 206.297 196.605 1.00 20.17  ? 959  LEU A  CB  1 
ATOM   7068  C CG  . LEU A  1 959  ? 182.197 204.968 197.353 1.00 19.37  ? 959  LEU A  CG  1 
ATOM   7069  C CD1 . LEU A  1 959  ? 180.902 204.875 198.129 1.00 28.73  ? 959  LEU A  CD1 1 
ATOM   7070  C CD2 . LEU A  1 959  ? 182.324 203.799 196.397 1.00 25.02  ? 959  LEU A  CD2 1 
ATOM   7071  N N   . ASN A  1 960  ? 183.239 208.966 195.227 1.00 20.63  ? 960  ASN A  N   1 
ATOM   7072  C CA  . ASN A  1 960  ? 183.013 210.023 194.250 1.00 19.74  ? 960  ASN A  CA  1 
ATOM   7073  C C   . ASN A  1 960  ? 184.204 210.180 193.318 1.00 21.65  ? 960  ASN A  C   1 
ATOM   7074  O O   . ASN A  1 960  ? 184.038 210.605 192.171 1.00 30.77  ? 960  ASN A  O   1 
ATOM   7075  C CB  . ASN A  1 960  ? 182.709 211.337 194.965 1.00 28.65  ? 960  ASN A  CB  1 
ATOM   7076  C CG  . ASN A  1 960  ? 181.444 211.265 195.792 1.00 40.64  ? 960  ASN A  CG  1 
ATOM   7077  O OD1 . ASN A  1 960  ? 180.524 210.516 195.469 1.00 42.48  ? 960  ASN A  OD1 1 
ATOM   7078  N ND2 . ASN A  1 960  ? 181.392 212.041 196.867 1.00 32.83  ? 960  ASN A  ND2 1 
ATOM   7079  N N   . THR A  1 961  ? 185.406 209.848 193.787 1.00 22.21  ? 961  THR A  N   1 
ATOM   7080  C CA  . THR A  1 961  ? 186.546 209.746 192.882 1.00 22.96  ? 961  THR A  CA  1 
ATOM   7081  C C   . THR A  1 961  ? 186.350 208.600 191.902 1.00 20.61  ? 961  THR A  C   1 
ATOM   7082  O O   . THR A  1 961  ? 186.667 208.720 190.714 1.00 31.63  ? 961  THR A  O   1 
ATOM   7083  C CB  . THR A  1 961  ? 187.836 209.549 193.675 1.00 31.32  ? 961  THR A  CB  1 
ATOM   7084  O OG1 . THR A  1 961  ? 188.065 210.688 194.512 1.00 46.92  ? 961  THR A  OG1 1 
ATOM   7085  C CG2 . THR A  1 961  ? 189.017 209.368 192.741 1.00 38.64  ? 961  THR A  CG2 1 
ATOM   7086  N N   . LEU A  1 962  ? 185.829 207.475 192.389 1.00 21.16  ? 962  LEU A  N   1 
ATOM   7087  C CA  . LEU A  1 962  ? 185.674 206.296 191.547 1.00 18.93  ? 962  LEU A  CA  1 
ATOM   7088  C C   . LEU A  1 962  ? 184.670 206.532 190.429 1.00 13.59  ? 962  LEU A  C   1 
ATOM   7089  O O   . LEU A  1 962  ? 184.827 205.988 189.332 1.00 19.92  ? 962  LEU A  O   1 
ATOM   7090  C CB  . LEU A  1 962  ? 185.249 205.113 192.415 1.00 12.17  ? 962  LEU A  CB  1 
ATOM   7091  C CG  . LEU A  1 962  ? 185.366 203.701 191.851 1.00 9.82   ? 962  LEU A  CG  1 
ATOM   7092  C CD1 . LEU A  1 962  ? 186.776 203.422 191.388 1.00 17.13  ? 962  LEU A  CD1 1 
ATOM   7093  C CD2 . LEU A  1 962  ? 184.947 202.695 192.899 1.00 6.01   ? 962  LEU A  CD2 1 
ATOM   7094  N N   . VAL A  1 963  ? 183.632 207.327 190.685 1.00 17.42  ? 963  VAL A  N   1 
ATOM   7095  C CA  . VAL A  1 963  ? 182.660 207.635 189.643 1.00 15.66  ? 963  VAL A  CA  1 
ATOM   7096  C C   . VAL A  1 963  ? 183.272 208.555 188.597 1.00 14.87  ? 963  VAL A  C   1 
ATOM   7097  O O   . VAL A  1 963  ? 183.061 208.373 187.393 1.00 26.78  ? 963  VAL A  O   1 
ATOM   7098  C CB  . VAL A  1 963  ? 181.395 208.249 190.266 1.00 19.13  ? 963  VAL A  CB  1 
ATOM   7099  C CG1 . VAL A  1 963  ? 180.445 208.719 189.183 1.00 32.86  ? 963  VAL A  CG1 1 
ATOM   7100  C CG2 . VAL A  1 963  ? 180.714 207.241 191.169 1.00 23.12  ? 963  VAL A  CG2 1 
ATOM   7101  N N   . LYS A  1 964  ? 184.040 209.555 189.033 1.00 14.59  ? 964  LYS A  N   1 
ATOM   7102  C CA  . LYS A  1 964  ? 184.657 210.475 188.084 1.00 16.14  ? 964  LYS A  CA  1 
ATOM   7103  C C   . LYS A  1 964  ? 185.648 209.765 187.177 1.00 14.53  ? 964  LYS A  C   1 
ATOM   7104  O O   . LYS A  1 964  ? 185.812 210.153 186.016 1.00 24.27  ? 964  LYS A  O   1 
ATOM   7105  C CB  . LYS A  1 964  ? 185.356 211.610 188.824 1.00 14.13  ? 964  LYS A  CB  1 
ATOM   7106  C CG  . LYS A  1 964  ? 184.448 212.771 189.166 1.00 27.97  ? 964  LYS A  CG  1 
ATOM   7107  C CD  . LYS A  1 964  ? 185.230 213.938 189.742 1.00 28.40  ? 964  LYS A  CD  1 
ATOM   7108  C CE  . LYS A  1 964  ? 185.642 213.683 191.179 1.00 36.24  ? 964  LYS A  CE  1 
ATOM   7109  N NZ  . LYS A  1 964  ? 184.462 213.613 192.082 1.00 53.16  ? 964  LYS A  NZ  1 
ATOM   7110  N N   . GLN A  1 965  ? 186.318 208.730 187.681 1.00 16.29  ? 965  GLN A  N   1 
ATOM   7111  C CA  . GLN A  1 965  ? 187.295 208.012 186.877 1.00 15.83  ? 965  GLN A  CA  1 
ATOM   7112  C C   . GLN A  1 965  ? 186.657 207.224 185.744 1.00 19.82  ? 965  GLN A  C   1 
ATOM   7113  O O   . GLN A  1 965  ? 187.384 206.634 184.940 1.00 37.36  ? 965  GLN A  O   1 
ATOM   7114  C CB  . GLN A  1 965  ? 188.115 207.083 187.768 1.00 13.47  ? 965  GLN A  CB  1 
ATOM   7115  C CG  . GLN A  1 965  ? 189.143 207.817 188.608 1.00 30.07  ? 965  GLN A  CG  1 
ATOM   7116  C CD  . GLN A  1 965  ? 189.784 206.938 189.657 1.00 42.79  ? 965  GLN A  CD  1 
ATOM   7117  O OE1 . GLN A  1 965  ? 189.267 205.874 189.994 1.00 31.02  ? 965  GLN A  OE1 1 
ATOM   7118  N NE2 . GLN A  1 965  ? 190.922 207.379 190.183 1.00 49.65  ? 965  GLN A  NE2 1 
ATOM   7119  N N   . LEU A  1 966  ? 185.325 207.187 185.665 1.00 18.40  ? 966  LEU A  N   1 
ATOM   7120  C CA  . LEU A  1 966  ? 184.671 206.649 184.480 1.00 15.98  ? 966  LEU A  CA  1 
ATOM   7121  C C   . LEU A  1 966  ? 184.810 207.583 183.287 1.00 22.17  ? 966  LEU A  C   1 
ATOM   7122  O O   . LEU A  1 966  ? 184.598 207.152 182.151 1.00 46.39  ? 966  LEU A  O   1 
ATOM   7123  C CB  . LEU A  1 966  ? 183.191 206.389 184.759 1.00 13.47  ? 966  LEU A  CB  1 
ATOM   7124  C CG  . LEU A  1 966  ? 182.868 205.261 185.734 1.00 15.10  ? 966  LEU A  CG  1 
ATOM   7125  C CD1 . LEU A  1 966  ? 181.397 205.287 186.092 1.00 29.90  ? 966  LEU A  CD1 1 
ATOM   7126  C CD2 . LEU A  1 966  ? 183.242 203.917 185.147 1.00 18.19  ? 966  LEU A  CD2 1 
ATOM   7127  N N   . SER A  1 967  ? 185.147 208.849 183.523 1.00 28.17  ? 967  SER A  N   1 
ATOM   7128  C CA  . SER A  1 967  ? 185.364 209.811 182.452 1.00 24.67  ? 967  SER A  CA  1 
ATOM   7129  C C   . SER A  1 967  ? 186.734 209.681 181.798 1.00 30.43  ? 967  SER A  C   1 
ATOM   7130  O O   . SER A  1 967  ? 186.964 210.308 180.760 1.00 32.95  ? 967  SER A  O   1 
ATOM   7131  C CB  . SER A  1 967  ? 185.192 211.230 182.994 1.00 26.51  ? 967  SER A  CB  1 
ATOM   7132  O OG  . SER A  1 967  ? 186.223 211.553 183.909 1.00 38.70  ? 967  SER A  OG  1 
ATOM   7133  N N   . SER A  1 968  ? 187.646 208.904 182.375 1.00 29.42  ? 968  SER A  N   1 
ATOM   7134  C CA  . SER A  1 968  ? 188.981 208.771 181.810 1.00 21.42  ? 968  SER A  CA  1 
ATOM   7135  C C   . SER A  1 968  ? 188.954 207.913 180.552 1.00 30.72  ? 968  SER A  C   1 
ATOM   7136  O O   . SER A  1 968  ? 188.188 206.952 180.451 1.00 31.68  ? 968  SER A  O   1 
ATOM   7137  C CB  . SER A  1 968  ? 189.929 208.158 182.836 1.00 25.98  ? 968  SER A  CB  1 
ATOM   7138  O OG  . SER A  1 968  ? 190.065 208.995 183.970 1.00 37.84  ? 968  SER A  OG  1 
ATOM   7139  N N   . ASN A  1 969  ? 189.803 208.272 179.584 1.00 39.77  ? 969  ASN A  N   1 
ATOM   7140  C CA  . ASN A  1 969  ? 189.892 207.513 178.341 1.00 23.73  ? 969  ASN A  CA  1 
ATOM   7141  C C   . ASN A  1 969  ? 190.813 206.309 178.464 1.00 27.24  ? 969  ASN A  C   1 
ATOM   7142  O O   . ASN A  1 969  ? 190.547 205.269 177.854 1.00 34.56  ? 969  ASN A  O   1 
ATOM   7143  C CB  . ASN A  1 969  ? 190.399 208.404 177.206 1.00 24.27  ? 969  ASN A  CB  1 
ATOM   7144  C CG  . ASN A  1 969  ? 189.363 209.392 176.732 1.00 30.08  ? 969  ASN A  CG  1 
ATOM   7145  O OD1 . ASN A  1 969  ? 188.577 209.914 177.519 1.00 35.66  ? 969  ASN A  OD1 1 
ATOM   7146  N ND2 . ASN A  1 969  ? 189.354 209.655 175.431 1.00 36.95  ? 969  ASN A  ND2 1 
ATOM   7147  N N   . PHE A  1 970  ? 191.895 206.427 179.231 1.00 25.67  ? 970  PHE A  N   1 
ATOM   7148  C CA  . PHE A  1 970  ? 192.893 205.368 179.343 1.00 33.86  ? 970  PHE A  CA  1 
ATOM   7149  C C   . PHE A  1 970  ? 193.494 205.018 177.986 1.00 36.89  ? 970  PHE A  C   1 
ATOM   7150  O O   . PHE A  1 970  ? 193.881 203.874 177.742 1.00 33.20  ? 970  PHE A  O   1 
ATOM   7151  C CB  . PHE A  1 970  ? 192.304 204.117 179.994 1.00 26.78  ? 970  PHE A  CB  1 
ATOM   7152  C CG  . PHE A  1 970  ? 191.732 204.357 181.358 1.00 30.84  ? 970  PHE A  CG  1 
ATOM   7153  C CD1 . PHE A  1 970  ? 192.551 204.695 182.416 1.00 29.59  ? 970  PHE A  CD1 1 
ATOM   7154  C CD2 . PHE A  1 970  ? 190.377 204.226 181.587 1.00 33.08  ? 970  PHE A  CD2 1 
ATOM   7155  C CE1 . PHE A  1 970  ? 192.028 204.909 183.668 1.00 24.45  ? 970  PHE A  CE1 1 
ATOM   7156  C CE2 . PHE A  1 970  ? 189.853 204.440 182.839 1.00 21.88  ? 970  PHE A  CE2 1 
ATOM   7157  C CZ  . PHE A  1 970  ? 190.679 204.781 183.880 1.00 25.58  ? 970  PHE A  CZ  1 
ATOM   7158  N N   . GLY A  1 971  ? 193.583 206.003 177.096 1.00 37.50  ? 971  GLY A  N   1 
ATOM   7159  C CA  . GLY A  1 971  ? 194.109 205.800 175.766 1.00 36.51  ? 971  GLY A  CA  1 
ATOM   7160  C C   . GLY A  1 971  ? 193.087 205.409 174.722 1.00 34.74  ? 971  GLY A  C   1 
ATOM   7161  O O   . GLY A  1 971  ? 193.420 205.400 173.531 1.00 40.07  ? 971  GLY A  O   1 
ATOM   7162  N N   . ALA A  1 972  ? 191.859 205.092 175.117 1.00 33.63  ? 972  ALA A  N   1 
ATOM   7163  C CA  . ALA A  1 972  ? 190.819 204.811 174.144 1.00 27.82  ? 972  ALA A  CA  1 
ATOM   7164  C C   . ALA A  1 972  ? 190.350 206.100 173.480 1.00 34.32  ? 972  ALA A  C   1 
ATOM   7165  O O   . ALA A  1 972  ? 190.617 207.208 173.951 1.00 37.04  ? 972  ALA A  O   1 
ATOM   7166  C CB  . ALA A  1 972  ? 189.638 204.101 174.802 1.00 27.11  ? 972  ALA A  CB  1 
ATOM   7167  N N   . ILE A  1 973  ? 189.645 205.943 172.359 1.00 40.64  ? 973  ILE A  N   1 
ATOM   7168  C CA  . ILE A  1 973  ? 189.157 207.107 171.630 1.00 29.91  ? 973  ILE A  CA  1 
ATOM   7169  C C   . ILE A  1 973  ? 188.145 207.884 172.457 1.00 29.43  ? 973  ILE A  C   1 
ATOM   7170  O O   . ILE A  1 973  ? 188.000 209.101 172.290 1.00 23.74  ? 973  ILE A  O   1 
ATOM   7171  C CB  . ILE A  1 973  ? 188.556 206.683 170.275 1.00 35.95  ? 973  ILE A  CB  1 
ATOM   7172  C CG1 . ILE A  1 973  ? 187.485 205.608 170.473 1.00 31.05  ? 973  ILE A  CG1 1 
ATOM   7173  C CG2 . ILE A  1 973  ? 189.645 206.178 169.353 1.00 23.43  ? 973  ILE A  CG2 1 
ATOM   7174  C CD1 . ILE A  1 973  ? 186.560 205.435 169.288 1.00 33.04  ? 973  ILE A  CD1 1 
ATOM   7175  N N   . SER A  1 974  ? 187.429 207.210 173.354 1.00 28.58  ? 974  SER A  N   1 
ATOM   7176  C CA  . SER A  1 974  ? 186.344 207.848 174.083 1.00 33.68  ? 974  SER A  CA  1 
ATOM   7177  C C   . SER A  1 974  ? 186.240 207.259 175.480 1.00 31.70  ? 974  SER A  C   1 
ATOM   7178  O O   . SER A  1 974  ? 186.563 206.090 175.706 1.00 25.60  ? 974  SER A  O   1 
ATOM   7179  C CB  . SER A  1 974  ? 185.009 207.674 173.351 1.00 37.17  ? 974  SER A  CB  1 
ATOM   7180  O OG  . SER A  1 974  ? 183.952 208.294 174.061 1.00 37.30  ? 974  SER A  OG  1 
ATOM   7181  N N   . SER A  1 975  ? 185.787 208.092 176.419 1.00 38.15  ? 975  SER A  N   1 
ATOM   7182  C CA  . SER A  1 975  ? 185.440 207.597 177.746 1.00 26.88  ? 975  SER A  CA  1 
ATOM   7183  C C   . SER A  1 975  ? 184.117 206.847 177.731 1.00 36.94  ? 975  SER A  C   1 
ATOM   7184  O O   . SER A  1 975  ? 183.907 205.947 178.549 1.00 37.17  ? 975  SER A  O   1 
ATOM   7185  C CB  . SER A  1 975  ? 185.372 208.756 178.738 1.00 35.81  ? 975  SER A  CB  1 
ATOM   7186  O OG  . SER A  1 975  ? 184.391 209.702 178.352 1.00 36.89  ? 975  SER A  OG  1 
ATOM   7187  N N   . VAL A  1 976  ? 183.223 207.200 176.814 1.00 50.66  ? 976  VAL A  N   1 
ATOM   7188  C CA  . VAL A  1 976  ? 181.885 206.625 176.758 1.00 36.98  ? 976  VAL A  CA  1 
ATOM   7189  C C   . VAL A  1 976  ? 181.988 205.274 176.064 1.00 28.83  ? 976  VAL A  C   1 
ATOM   7190  O O   . VAL A  1 976  ? 182.440 205.182 174.921 1.00 31.68  ? 976  VAL A  O   1 
ATOM   7191  C CB  . VAL A  1 976  ? 180.906 207.553 176.032 1.00 34.44  ? 976  VAL A  CB  1 
ATOM   7192  C CG1 . VAL A  1 976  ? 179.513 206.954 176.029 1.00 35.94  ? 976  VAL A  CG1 1 
ATOM   7193  C CG2 . VAL A  1 976  ? 180.900 208.926 176.685 1.00 37.09  ? 976  VAL A  CG2 1 
ATOM   7194  N N   . LEU A  1 977  ? 181.576 204.219 176.766 1.00 33.18  ? 977  LEU A  N   1 
ATOM   7195  C CA  . LEU A  1 977  ? 181.671 202.875 176.210 1.00 27.60  ? 977  LEU A  CA  1 
ATOM   7196  C C   . LEU A  1 977  ? 180.830 202.740 174.948 1.00 26.08  ? 977  LEU A  C   1 
ATOM   7197  O O   . LEU A  1 977  ? 181.238 202.077 173.989 1.00 28.95  ? 977  LEU A  O   1 
ATOM   7198  C CB  . LEU A  1 977  ? 181.231 201.855 177.259 1.00 29.75  ? 977  LEU A  CB  1 
ATOM   7199  C CG  . LEU A  1 977  ? 181.725 200.417 177.116 1.00 31.65  ? 977  LEU A  CG  1 
ATOM   7200  C CD1 . LEU A  1 977  ? 183.234 200.346 177.249 1.00 31.60  ? 977  LEU A  CD1 1 
ATOM   7201  C CD2 . LEU A  1 977  ? 181.054 199.554 178.163 1.00 44.55  ? 977  LEU A  CD2 1 
ATOM   7202  N N   . ASN A  1 978  ? 179.651 203.363 174.929 1.00 40.94  ? 978  ASN A  N   1 
ATOM   7203  C CA  . ASN A  1 978  ? 178.739 203.198 173.804 1.00 39.59  ? 978  ASN A  CA  1 
ATOM   7204  C C   . ASN A  1 978  ? 179.185 203.973 172.572 1.00 40.23  ? 978  ASN A  C   1 
ATOM   7205  O O   . ASN A  1 978  ? 178.906 203.545 171.448 1.00 42.84  ? 978  ASN A  O   1 
ATOM   7206  C CB  . ASN A  1 978  ? 177.331 203.632 174.208 1.00 33.33  ? 978  ASN A  CB  1 
ATOM   7207  C CG  . ASN A  1 978  ? 176.712 202.702 175.223 1.00 45.99  ? 978  ASN A  CG  1 
ATOM   7208  O OD1 . ASN A  1 978  ? 176.815 201.481 175.104 1.00 39.79  ? 978  ASN A  OD1 1 
ATOM   7209  N ND2 . ASN A  1 978  ? 176.071 203.270 176.238 1.00 57.12  ? 978  ASN A  ND2 1 
ATOM   7210  N N   . ASP A  1 979  ? 179.875 205.100 172.750 1.00 44.25  ? 979  ASP A  N   1 
ATOM   7211  C CA  . ASP A  1 979  ? 180.358 205.846 171.595 1.00 31.64  ? 979  ASP A  CA  1 
ATOM   7212  C C   . ASP A  1 979  ? 181.419 205.075 170.829 1.00 34.94  ? 979  ASP A  C   1 
ATOM   7213  O O   . ASP A  1 979  ? 181.588 205.303 169.628 1.00 52.61  ? 979  ASP A  O   1 
ATOM   7214  C CB  . ASP A  1 979  ? 180.918 207.198 172.031 1.00 41.50  ? 979  ASP A  CB  1 
ATOM   7215  C CG  . ASP A  1 979  ? 179.850 208.120 172.572 1.00 60.75  ? 979  ASP A  CG  1 
ATOM   7216  O OD1 . ASP A  1 979  ? 178.677 207.695 172.637 1.00 62.84  ? 979  ASP A  OD1 1 
ATOM   7217  O OD2 . ASP A  1 979  ? 180.182 209.270 172.931 1.00 68.43  ? 979  ASP A  OD2 1 
ATOM   7218  N N   . ILE A  1 980  ? 182.134 204.170 171.493 1.00 34.26  ? 980  ILE A  N   1 
ATOM   7219  C CA  . ILE A  1 980  ? 183.053 203.285 170.787 1.00 28.56  ? 980  ILE A  CA  1 
ATOM   7220  C C   . ILE A  1 980  ? 182.274 202.287 169.944 1.00 35.30  ? 980  ILE A  C   1 
ATOM   7221  O O   . ILE A  1 980  ? 182.549 202.101 168.754 1.00 43.72  ? 980  ILE A  O   1 
ATOM   7222  C CB  . ILE A  1 980  ? 183.976 202.567 171.786 1.00 25.53  ? 980  ILE A  CB  1 
ATOM   7223  C CG1 . ILE A  1 980  ? 184.994 203.545 172.371 1.00 23.29  ? 980  ILE A  CG1 1 
ATOM   7224  C CG2 . ILE A  1 980  ? 184.671 201.401 171.112 1.00 24.45  ? 980  ILE A  CG2 1 
ATOM   7225  C CD1 . ILE A  1 980  ? 185.630 203.060 173.646 1.00 19.01  ? 980  ILE A  CD1 1 
ATOM   7226  N N   . LEU A  1 981  ? 181.282 201.636 170.552 1.00 41.11  ? 981  LEU A  N   1 
ATOM   7227  C CA  . LEU A  1 981  ? 180.557 200.567 169.879 1.00 36.32  ? 981  LEU A  CA  1 
ATOM   7228  C C   . LEU A  1 981  ? 179.676 201.078 168.750 1.00 41.65  ? 981  LEU A  C   1 
ATOM   7229  O O   . LEU A  1 981  ? 179.415 200.331 167.802 1.00 57.24  ? 981  LEU A  O   1 
ATOM   7230  C CB  . LEU A  1 981  ? 179.712 199.801 170.895 1.00 34.02  ? 981  LEU A  CB  1 
ATOM   7231  C CG  . LEU A  1 981  ? 180.526 199.099 171.982 1.00 28.55  ? 981  LEU A  CG  1 
ATOM   7232  C CD1 . LEU A  1 981  ? 179.634 198.651 173.121 1.00 28.56  ? 981  LEU A  CD1 1 
ATOM   7233  C CD2 . LEU A  1 981  ? 181.287 197.917 171.403 1.00 34.71  ? 981  LEU A  CD2 1 
ATOM   7234  N N   . SER A  1 982  ? 179.214 202.324 168.825 1.00 39.61  ? 982  SER A  N   1 
ATOM   7235  C CA  . SER A  1 982  ? 178.397 202.882 167.758 1.00 40.51  ? 982  SER A  CA  1 
ATOM   7236  C C   . SER A  1 982  ? 179.226 203.364 166.578 1.00 41.11  ? 982  SER A  C   1 
ATOM   7237  O O   . SER A  1 982  ? 178.658 203.659 165.522 1.00 53.87  ? 982  SER A  O   1 
ATOM   7238  C CB  . SER A  1 982  ? 177.548 204.038 168.289 1.00 37.10  ? 982  SER A  CB  1 
ATOM   7239  O OG  . SER A  1 982  ? 178.314 204.917 169.090 1.00 38.48  ? 982  SER A  OG  1 
ATOM   7240  N N   . ARG A  1 983  ? 180.546 203.454 166.731 1.00 36.47  ? 983  ARG A  N   1 
ATOM   7241  C CA  . ARG A  1 983  ? 181.426 203.923 165.671 1.00 26.93  ? 983  ARG A  CA  1 
ATOM   7242  C C   . ARG A  1 983  ? 182.348 202.852 165.115 1.00 30.54  ? 983  ARG A  C   1 
ATOM   7243  O O   . ARG A  1 983  ? 182.799 202.983 163.977 1.00 40.67  ? 983  ARG A  O   1 
ATOM   7244  C CB  . ARG A  1 983  ? 182.283 205.090 166.172 1.00 29.58  ? 983  ARG A  CB  1 
ATOM   7245  C CG  . ARG A  1 983  ? 181.538 206.402 166.235 1.00 29.88  ? 983  ARG A  CG  1 
ATOM   7246  C CD  . ARG A  1 983  ? 182.445 207.539 166.649 1.00 35.11  ? 983  ARG A  CD  1 
ATOM   7247  N NE  . ARG A  1 983  ? 182.843 207.433 168.048 1.00 40.18  ? 983  ARG A  NE  1 
ATOM   7248  C CZ  . ARG A  1 983  ? 183.429 208.406 168.738 1.00 44.69  ? 983  ARG A  CZ  1 
ATOM   7249  N NH1 . ARG A  1 983  ? 183.687 209.572 168.159 1.00 47.41  ? 983  ARG A  NH1 1 
ATOM   7250  N NH2 . ARG A  1 983  ? 183.753 208.216 170.010 1.00 49.25  ? 983  ARG A  NH2 1 
ATOM   7251  N N   . LEU A  1 984  ? 182.641 201.805 165.880 1.00 39.85  ? 984  LEU A  N   1 
ATOM   7252  C CA  . LEU A  1 984  ? 183.619 200.799 165.495 1.00 39.30  ? 984  LEU A  CA  1 
ATOM   7253  C C   . LEU A  1 984  ? 182.994 199.412 165.517 1.00 42.33  ? 984  LEU A  C   1 
ATOM   7254  O O   . LEU A  1 984  ? 182.077 199.137 166.296 1.00 42.06  ? 984  LEU A  O   1 
ATOM   7255  C CB  . LEU A  1 984  ? 184.833 200.829 166.426 1.00 34.69  ? 984  LEU A  CB  1 
ATOM   7256  C CG  . LEU A  1 984  ? 185.604 202.148 166.462 1.00 31.93  ? 984  LEU A  CG  1 
ATOM   7257  C CD1 . LEU A  1 984  ? 186.754 202.062 167.445 1.00 31.58  ? 984  LEU A  CD1 1 
ATOM   7258  C CD2 . LEU A  1 984  ? 186.112 202.515 165.080 1.00 47.94  ? 984  LEU A  CD2 1 
ATOM   7259  N N   . ASP A  1 985  ? 183.502 198.540 164.651 1.00 48.91  ? 985  ASP A  N   1 
ATOM   7260  C CA  . ASP A  1 985  ? 183.051 197.159 164.586 1.00 48.42  ? 985  ASP A  CA  1 
ATOM   7261  C C   . ASP A  1 985  ? 183.860 196.287 165.544 1.00 48.33  ? 985  ASP A  C   1 
ATOM   7262  O O   . ASP A  1 985  ? 184.810 196.735 166.188 1.00 53.08  ? 985  ASP A  O   1 
ATOM   7263  C CB  . ASP A  1 985  ? 183.150 196.622 163.158 1.00 46.97  ? 985  ASP A  CB  1 
ATOM   7264  C CG  . ASP A  1 985  ? 184.567 196.636 162.624 1.00 52.62  ? 985  ASP A  CG  1 
ATOM   7265  O OD1 . ASP A  1 985  ? 185.490 196.987 163.387 1.00 48.62  ? 985  ASP A  OD1 1 
ATOM   7266  O OD2 . ASP A  1 985  ? 184.758 196.298 161.437 1.00 58.02  ? 985  ASP A  OD2 1 
ATOM   7267  N N   . LYS A  1 986  ? 183.473 195.012 165.615 1.00 46.12  ? 986  LYS A  N   1 
ATOM   7268  C CA  . LYS A  1 986  ? 183.963 194.134 166.673 1.00 43.93  ? 986  LYS A  CA  1 
ATOM   7269  C C   . LYS A  1 986  ? 185.482 194.156 166.778 1.00 42.90  ? 986  LYS A  C   1 
ATOM   7270  O O   . LYS A  1 986  ? 186.031 194.257 167.880 1.00 54.59  ? 986  LYS A  O   1 
ATOM   7271  C CB  . LYS A  1 986  ? 183.475 192.707 166.427 1.00 45.53  ? 986  LYS A  CB  1 
ATOM   7272  C CG  . LYS A  1 986  ? 183.469 191.831 167.672 1.00 44.94  ? 986  LYS A  CG  1 
ATOM   7273  C CD  . LYS A  1 986  ? 184.192 190.513 167.449 1.00 47.27  ? 986  LYS A  CD  1 
ATOM   7274  C CE  . LYS A  1 986  ? 185.667 190.725 167.159 1.00 51.73  ? 986  LYS A  CE  1 
ATOM   7275  N NZ  . LYS A  1 986  ? 186.488 189.558 167.583 1.00 49.66  ? 986  LYS A  NZ  1 
ATOM   7276  N N   . VAL A  1 987  ? 186.181 194.069 165.649 1.00 37.18  ? 987  VAL A  N   1 
ATOM   7277  C CA  . VAL A  1 987  ? 187.635 193.957 165.708 1.00 42.82  ? 987  VAL A  CA  1 
ATOM   7278  C C   . VAL A  1 987  ? 188.260 195.265 166.168 1.00 33.26  ? 987  VAL A  C   1 
ATOM   7279  O O   . VAL A  1 987  ? 189.194 195.267 166.975 1.00 27.75  ? 987  VAL A  O   1 
ATOM   7280  C CB  . VAL A  1 987  ? 188.204 193.507 164.348 1.00 47.17  ? 987  VAL A  CB  1 
ATOM   7281  C CG1 . VAL A  1 987  ? 187.934 192.031 164.122 1.00 44.83  ? 987  VAL A  CG1 1 
ATOM   7282  C CG2 . VAL A  1 987  ? 187.628 194.340 163.205 1.00 61.44  ? 987  VAL A  CG2 1 
ATOM   7283  N N   . GLU A  1 988  ? 187.759 196.395 165.672 1.00 34.34  ? 988  GLU A  N   1 
ATOM   7284  C CA  . GLU A  1 988  ? 188.333 197.681 166.045 1.00 32.70  ? 988  GLU A  CA  1 
ATOM   7285  C C   . GLU A  1 988  ? 187.819 198.159 167.394 1.00 36.51  ? 988  GLU A  C   1 
ATOM   7286  O O   . GLU A  1 988  ? 188.507 198.924 168.076 1.00 33.96  ? 988  GLU A  O   1 
ATOM   7287  C CB  . GLU A  1 988  ? 188.037 198.716 164.962 1.00 43.21  ? 988  GLU A  CB  1 
ATOM   7288  C CG  . GLU A  1 988  ? 188.855 198.515 163.698 1.00 53.84  ? 988  GLU A  CG  1 
ATOM   7289  C CD  . GLU A  1 988  ? 188.088 198.870 162.441 1.00 72.18  ? 988  GLU A  CD  1 
ATOM   7290  O OE1 . GLU A  1 988  ? 187.231 199.776 162.504 1.00 63.26  ? 988  GLU A  OE1 1 
ATOM   7291  O OE2 . GLU A  1 988  ? 188.337 198.239 161.393 1.00 69.62  ? 988  GLU A  OE2 1 
ATOM   7292  N N   . ALA A  1 989  ? 186.621 197.729 167.792 1.00 41.19  ? 989  ALA A  N   1 
ATOM   7293  C CA  . ALA A  1 989  ? 186.117 198.073 169.116 1.00 27.38  ? 989  ALA A  CA  1 
ATOM   7294  C C   . ALA A  1 989  ? 186.844 197.291 170.201 1.00 29.06  ? 989  ALA A  C   1 
ATOM   7295  O O   . ALA A  1 989  ? 187.114 197.825 171.281 1.00 39.17  ? 989  ALA A  O   1 
ATOM   7296  C CB  . ALA A  1 989  ? 184.614 197.817 169.189 1.00 22.90  ? 989  ALA A  CB  1 
ATOM   7297  N N   . GLU A  1 990  ? 187.171 196.025 169.932 1.00 32.06  ? 990  GLU A  N   1 
ATOM   7298  C CA  . GLU A  1 990  ? 187.856 195.208 170.926 1.00 29.44  ? 990  GLU A  CA  1 
ATOM   7299  C C   . GLU A  1 990  ? 189.132 195.869 171.422 1.00 33.89  ? 990  GLU A  C   1 
ATOM   7300  O O   . GLU A  1 990  ? 189.483 195.734 172.598 1.00 35.62  ? 990  GLU A  O   1 
ATOM   7301  C CB  . GLU A  1 990  ? 188.180 193.833 170.344 1.00 40.46  ? 990  GLU A  CB  1 
ATOM   7302  C CG  . GLU A  1 990  ? 187.217 192.739 170.764 1.00 45.04  ? 990  GLU A  CG  1 
ATOM   7303  C CD  . GLU A  1 990  ? 187.595 191.389 170.194 1.00 58.52  ? 990  GLU A  CD  1 
ATOM   7304  O OE1 . GLU A  1 990  ? 188.602 191.318 169.458 1.00 49.86  ? 990  GLU A  OE1 1 
ATOM   7305  O OE2 . GLU A  1 990  ? 186.888 190.401 170.483 1.00 65.40  ? 990  GLU A  OE2 1 
ATOM   7306  N N   . VAL A  1 991  ? 189.845 196.576 170.546 1.00 39.03  ? 991  VAL A  N   1 
ATOM   7307  C CA  . VAL A  1 991  ? 191.044 197.286 170.978 1.00 34.11  ? 991  VAL A  CA  1 
ATOM   7308  C C   . VAL A  1 991  ? 190.675 198.403 171.944 1.00 34.74  ? 991  VAL A  C   1 
ATOM   7309  O O   . VAL A  1 991  ? 191.267 198.538 173.020 1.00 41.79  ? 991  VAL A  O   1 
ATOM   7310  C CB  . VAL A  1 991  ? 191.811 197.830 169.760 1.00 32.35  ? 991  VAL A  CB  1 
ATOM   7311  C CG1 . VAL A  1 991  ? 192.996 198.677 170.208 1.00 40.66  ? 991  VAL A  CG1 1 
ATOM   7312  C CG2 . VAL A  1 991  ? 192.272 196.687 168.874 1.00 29.93  ? 991  VAL A  CG2 1 
ATOM   7313  N N   . GLN A  1 992  ? 189.685 199.215 171.576 1.00 30.15  ? 992  GLN A  N   1 
ATOM   7314  C CA  . GLN A  1 992  ? 189.320 200.362 172.398 1.00 28.61  ? 992  GLN A  CA  1 
ATOM   7315  C C   . GLN A  1 992  ? 188.656 199.926 173.696 1.00 25.30  ? 992  GLN A  C   1 
ATOM   7316  O O   . GLN A  1 992  ? 188.899 200.520 174.752 1.00 27.84  ? 992  GLN A  O   1 
ATOM   7317  C CB  . GLN A  1 992  ? 188.396 201.286 171.608 1.00 34.32  ? 992  GLN A  CB  1 
ATOM   7318  C CG  . GLN A  1 992  ? 188.968 201.740 170.277 1.00 32.48  ? 992  GLN A  CG  1 
ATOM   7319  C CD  . GLN A  1 992  ? 190.227 202.556 170.436 1.00 32.39  ? 992  GLN A  CD  1 
ATOM   7320  O OE1 . GLN A  1 992  ? 190.466 203.142 171.488 1.00 37.41  ? 992  GLN A  OE1 1 
ATOM   7321  N NE2 . GLN A  1 992  ? 191.045 202.597 169.393 1.00 36.08  ? 992  GLN A  NE2 1 
ATOM   7322  N N   . ILE A  1 993  ? 187.811 198.895 173.642 1.00 25.61  ? 993  ILE A  N   1 
ATOM   7323  C CA  . ILE A  1 993  ? 187.131 198.442 174.849 1.00 19.88  ? 993  ILE A  CA  1 
ATOM   7324  C C   . ILE A  1 993  ? 188.127 197.819 175.815 1.00 27.98  ? 993  ILE A  C   1 
ATOM   7325  O O   . ILE A  1 993  ? 188.021 197.992 177.034 1.00 37.77  ? 993  ILE A  O   1 
ATOM   7326  C CB  . ILE A  1 993  ? 186.005 197.454 174.495 1.00 17.28  ? 993  ILE A  CB  1 
ATOM   7327  C CG1 . ILE A  1 993  ? 184.951 198.117 173.607 1.00 17.22  ? 993  ILE A  CG1 1 
ATOM   7328  C CG2 . ILE A  1 993  ? 185.361 196.917 175.759 1.00 29.83  ? 993  ILE A  CG2 1 
ATOM   7329  C CD1 . ILE A  1 993  ? 184.145 199.196 174.289 1.00 21.21  ? 993  ILE A  CD1 1 
ATOM   7330  N N   . ASP A  1 994  ? 189.107 197.081 175.291 1.00 27.17  ? 994  ASP A  N   1 
ATOM   7331  C CA  . ASP A  1 994  ? 190.077 196.428 176.160 1.00 22.70  ? 994  ASP A  CA  1 
ATOM   7332  C C   . ASP A  1 994  ? 190.868 197.439 176.978 1.00 26.21  ? 994  ASP A  C   1 
ATOM   7333  O O   . ASP A  1 994  ? 191.292 197.132 178.097 1.00 47.69  ? 994  ASP A  O   1 
ATOM   7334  C CB  . ASP A  1 994  ? 191.024 195.559 175.335 1.00 44.40  ? 994  ASP A  CB  1 
ATOM   7335  C CG  . ASP A  1 994  ? 192.107 194.922 176.178 1.00 50.48  ? 994  ASP A  CG  1 
ATOM   7336  O OD1 . ASP A  1 994  ? 191.779 194.395 177.262 1.00 48.56  ? 994  ASP A  OD1 1 
ATOM   7337  O OD2 . ASP A  1 994  ? 193.284 194.944 175.759 1.00 46.82  ? 994  ASP A  OD2 1 
ATOM   7338  N N   . ARG A  1 995  ? 191.095 198.636 176.437 1.00 23.91  ? 995  ARG A  N   1 
ATOM   7339  C CA  . ARG A  1 995  ? 191.765 199.676 177.211 1.00 22.50  ? 995  ARG A  CA  1 
ATOM   7340  C C   . ARG A  1 995  ? 190.895 200.137 178.373 1.00 24.55  ? 995  ARG A  C   1 
ATOM   7341  O O   . ARG A  1 995  ? 191.379 200.287 179.500 1.00 27.12  ? 995  ARG A  O   1 
ATOM   7342  C CB  . ARG A  1 995  ? 192.124 200.857 176.313 1.00 21.01  ? 995  ARG A  CB  1 
ATOM   7343  C CG  . ARG A  1 995  ? 193.018 200.500 175.144 1.00 24.39  ? 995  ARG A  CG  1 
ATOM   7344  C CD  . ARG A  1 995  ? 193.599 201.741 174.493 1.00 27.66  ? 995  ARG A  CD  1 
ATOM   7345  N NE  . ARG A  1 995  ? 194.051 201.482 173.130 1.00 27.98  ? 995  ARG A  NE  1 
ATOM   7346  C CZ  . ARG A  1 995  ? 195.163 200.825 172.819 1.00 29.41  ? 995  ARG A  CZ  1 
ATOM   7347  N NH1 . ARG A  1 995  ? 195.946 200.345 173.774 1.00 38.65  ? 995  ARG A  NH1 1 
ATOM   7348  N NH2 . ARG A  1 995  ? 195.489 200.639 171.548 1.00 29.41  ? 995  ARG A  NH2 1 
ATOM   7349  N N   . LEU A  1 996  ? 189.609 200.380 178.116 1.00 21.07  ? 996  LEU A  N   1 
ATOM   7350  C CA  . LEU A  1 996  ? 188.719 200.831 179.180 1.00 17.30  ? 996  LEU A  CA  1 
ATOM   7351  C C   . LEU A  1 996  ? 188.567 199.769 180.259 1.00 24.59  ? 996  LEU A  C   1 
ATOM   7352  O O   . LEU A  1 996  ? 188.535 200.090 181.453 1.00 30.00  ? 996  LEU A  O   1 
ATOM   7353  C CB  . LEU A  1 996  ? 187.357 201.205 178.602 1.00 20.13  ? 996  LEU A  CB  1 
ATOM   7354  C CG  . LEU A  1 996  ? 187.341 202.416 177.669 1.00 16.57  ? 996  LEU A  CG  1 
ATOM   7355  C CD1 . LEU A  1 996  ? 185.934 202.698 177.198 1.00 14.26  ? 996  LEU A  CD1 1 
ATOM   7356  C CD2 . LEU A  1 996  ? 187.926 203.640 178.348 1.00 19.20  ? 996  LEU A  CD2 1 
ATOM   7357  N N   . ILE A  1 997  ? 188.467 198.499 179.866 1.00 22.70  ? 997  ILE A  N   1 
ATOM   7358  C CA  . ILE A  1 997  ? 188.422 197.428 180.855 1.00 16.44  ? 997  ILE A  CA  1 
ATOM   7359  C C   . ILE A  1 997  ? 189.687 197.448 181.699 1.00 20.29  ? 997  ILE A  C   1 
ATOM   7360  O O   . ILE A  1 997  ? 189.639 197.338 182.929 1.00 26.42  ? 997  ILE A  O   1 
ATOM   7361  C CB  . ILE A  1 997  ? 188.232 196.064 180.169 1.00 24.74  ? 997  ILE A  CB  1 
ATOM   7362  C CG1 . ILE A  1 997  ? 186.868 195.996 179.485 1.00 28.43  ? 997  ILE A  CG1 1 
ATOM   7363  C CG2 . ILE A  1 997  ? 188.378 194.946 181.185 1.00 33.09  ? 997  ILE A  CG2 1 
ATOM   7364  C CD1 . ILE A  1 997  ? 186.660 194.757 178.646 1.00 31.32  ? 997  ILE A  CD1 1 
ATOM   7365  N N   . THR A  1 998  ? 190.842 197.579 181.047 1.00 18.87  ? 998  THR A  N   1 
ATOM   7366  C CA  . THR A  1 998  ? 192.106 197.617 181.773 1.00 21.26  ? 998  THR A  CA  1 
ATOM   7367  C C   . THR A  1 998  ? 192.150 198.794 182.738 1.00 19.80  ? 998  THR A  C   1 
ATOM   7368  O O   . THR A  1 998  ? 192.531 198.642 183.904 1.00 27.87  ? 998  THR A  O   1 
ATOM   7369  C CB  . THR A  1 998  ? 193.267 197.688 180.783 1.00 31.55  ? 998  THR A  CB  1 
ATOM   7370  O OG1 . THR A  1 998  ? 193.257 196.522 179.952 1.00 26.94  ? 998  THR A  OG1 1 
ATOM   7371  C CG2 . THR A  1 998  ? 194.599 197.774 181.507 1.00 40.95  ? 998  THR A  CG2 1 
ATOM   7372  N N   . GLY A  1 999  ? 191.769 199.982 182.269 1.00 19.00  ? 999  GLY A  N   1 
ATOM   7373  C CA  . GLY A  1 999  ? 191.851 201.158 183.115 1.00 17.84  ? 999  GLY A  CA  1 
ATOM   7374  C C   . GLY A  1 999  ? 190.791 201.202 184.194 1.00 16.07  ? 999  GLY A  C   1 
ATOM   7375  O O   . GLY A  1 999  ? 191.057 201.660 185.307 1.00 21.87  ? 999  GLY A  O   1 
ATOM   7376  N N   . ARG A  1 1000 ? 189.581 200.736 183.889 1.00 13.84  ? 1000 ARG A  N   1 
ATOM   7377  C CA  . ARG A  1 1000 ? 188.523 200.731 184.889 1.00 12.14  ? 1000 ARG A  CA  1 
ATOM   7378  C C   . ARG A  1 1000 ? 188.686 199.590 185.880 1.00 22.17  ? 1000 ARG A  C   1 
ATOM   7379  O O   . ARG A  1 1000 ? 188.335 199.740 187.053 1.00 32.78  ? 1000 ARG A  O   1 
ATOM   7380  C CB  . ARG A  1 1000 ? 187.161 200.652 184.206 1.00 12.40  ? 1000 ARG A  CB  1 
ATOM   7381  C CG  . ARG A  1 1000 ? 186.816 201.902 183.439 1.00 12.93  ? 1000 ARG A  CG  1 
ATOM   7382  C CD  . ARG A  1 1000 ? 185.487 201.791 182.737 1.00 12.34  ? 1000 ARG A  CD  1 
ATOM   7383  N NE  . ARG A  1 1000 ? 185.171 203.023 182.025 1.00 19.36  ? 1000 ARG A  NE  1 
ATOM   7384  C CZ  . ARG A  1 1000 ? 184.075 203.213 181.301 1.00 20.82  ? 1000 ARG A  CZ  1 
ATOM   7385  N NH1 . ARG A  1 1000 ? 183.176 202.247 181.190 1.00 29.89  ? 1000 ARG A  NH1 1 
ATOM   7386  N NH2 . ARG A  1 1000 ? 183.878 204.373 180.690 1.00 16.75  ? 1000 ARG A  NH2 1 
ATOM   7387  N N   . LEU A  1 1001 ? 189.210 198.451 185.434 1.00 20.51  ? 1001 LEU A  N   1 
ATOM   7388  C CA  . LEU A  1 1001 ? 189.542 197.385 186.369 1.00 15.19  ? 1001 LEU A  CA  1 
ATOM   7389  C C   . LEU A  1 1001 ? 190.642 197.828 187.322 1.00 18.42  ? 1001 LEU A  C   1 
ATOM   7390  O O   . LEU A  1 1001 ? 190.623 197.484 188.508 1.00 27.93  ? 1001 LEU A  O   1 
ATOM   7391  C CB  . LEU A  1 1001 ? 189.960 196.131 185.603 1.00 22.30  ? 1001 LEU A  CB  1 
ATOM   7392  C CG  . LEU A  1 1001 ? 190.090 194.841 186.414 1.00 32.28  ? 1001 LEU A  CG  1 
ATOM   7393  C CD1 . LEU A  1 1001 ? 188.760 194.460 187.045 1.00 32.22  ? 1001 LEU A  CD1 1 
ATOM   7394  C CD2 . LEU A  1 1001 ? 190.603 193.714 185.539 1.00 42.89  ? 1001 LEU A  CD2 1 
ATOM   7395  N N   . GLN A  1 1002 ? 191.614 198.590 186.820 1.00 14.75  ? 1002 GLN A  N   1 
ATOM   7396  C CA  . GLN A  1 1002 ? 192.665 199.112 187.685 1.00 17.95  ? 1002 GLN A  CA  1 
ATOM   7397  C C   . GLN A  1 1002 ? 192.117 200.130 188.672 1.00 20.92  ? 1002 GLN A  C   1 
ATOM   7398  O O   . GLN A  1 1002 ? 192.592 200.207 189.809 1.00 29.04  ? 1002 GLN A  O   1 
ATOM   7399  C CB  . GLN A  1 1002 ? 193.774 199.739 186.841 1.00 15.06  ? 1002 GLN A  CB  1 
ATOM   7400  C CG  . GLN A  1 1002 ? 194.972 200.238 187.642 1.00 31.95  ? 1002 GLN A  CG  1 
ATOM   7401  C CD  . GLN A  1 1002 ? 195.616 199.157 188.496 1.00 44.15  ? 1002 GLN A  CD  1 
ATOM   7402  O OE1 . GLN A  1 1002 ? 195.600 197.979 188.137 1.00 41.41  ? 1002 GLN A  OE1 1 
ATOM   7403  N NE2 . GLN A  1 1002 ? 196.180 199.549 189.635 1.00 46.45  ? 1002 GLN A  NE2 1 
ATOM   7404  N N   . SER A  1 1003 ? 191.123 200.919 188.260 1.00 27.81  ? 1003 SER A  N   1 
ATOM   7405  C CA  . SER A  1 1003 ? 190.513 201.873 189.177 1.00 15.69  ? 1003 SER A  CA  1 
ATOM   7406  C C   . SER A  1 1003 ? 189.862 201.159 190.352 1.00 16.19  ? 1003 SER A  C   1 
ATOM   7407  O O   . SER A  1 1003 ? 189.954 201.619 191.495 1.00 30.92  ? 1003 SER A  O   1 
ATOM   7408  C CB  . SER A  1 1003 ? 189.487 202.726 188.438 1.00 24.30  ? 1003 SER A  CB  1 
ATOM   7409  O OG  . SER A  1 1003 ? 190.100 203.486 187.415 1.00 42.00  ? 1003 SER A  OG  1 
ATOM   7410  N N   . LEU A  1 1004 ? 189.186 200.039 190.091 1.00 26.99  ? 1004 LEU A  N   1 
ATOM   7411  C CA  . LEU A  1 1004 ? 188.615 199.256 191.180 1.00 13.36  ? 1004 LEU A  CA  1 
ATOM   7412  C C   . LEU A  1 1004 ? 189.704 198.635 192.042 1.00 14.29  ? 1004 LEU A  C   1 
ATOM   7413  O O   . LEU A  1 1004 ? 189.595 198.625 193.272 1.00 18.26  ? 1004 LEU A  O   1 
ATOM   7414  C CB  . LEU A  1 1004 ? 187.696 198.171 190.626 1.00 18.72  ? 1004 LEU A  CB  1 
ATOM   7415  C CG  . LEU A  1 1004 ? 186.370 198.643 190.038 1.00 17.43  ? 1004 LEU A  CG  1 
ATOM   7416  C CD1 . LEU A  1 1004 ? 185.647 197.487 189.381 1.00 19.90  ? 1004 LEU A  CD1 1 
ATOM   7417  C CD2 . LEU A  1 1004 ? 185.510 199.265 191.118 1.00 15.23  ? 1004 LEU A  CD2 1 
ATOM   7418  N N   . GLN A  1 1005 ? 190.761 198.110 191.421 1.00 16.59  ? 1005 GLN A  N   1 
ATOM   7419  C CA  . GLN A  1 1005 ? 191.857 197.549 192.203 1.00 13.53  ? 1005 GLN A  CA  1 
ATOM   7420  C C   . GLN A  1 1005 ? 192.475 198.607 193.103 1.00 13.31  ? 1005 GLN A  C   1 
ATOM   7421  O O   . GLN A  1 1005 ? 192.801 198.332 194.262 1.00 21.27  ? 1005 GLN A  O   1 
ATOM   7422  C CB  . GLN A  1 1005 ? 192.918 196.957 191.276 1.00 17.90  ? 1005 GLN A  CB  1 
ATOM   7423  C CG  . GLN A  1 1005 ? 192.479 195.712 190.514 1.00 18.50  ? 1005 GLN A  CG  1 
ATOM   7424  C CD  . GLN A  1 1005 ? 192.270 194.490 191.395 1.00 23.50  ? 1005 GLN A  CD  1 
ATOM   7425  O OE1 . GLN A  1 1005 ? 192.774 194.439 192.517 1.00 21.13  ? 1005 GLN A  OE1 1 
ATOM   7426  N NE2 . GLN A  1 1005 ? 191.522 193.504 190.903 1.00 26.84  ? 1005 GLN A  NE2 1 
ATOM   7427  N N   . THR A  1 1006 ? 192.643 199.825 192.589 1.00 14.76  ? 1006 THR A  N   1 
ATOM   7428  C CA  . THR A  1 1006 ? 193.188 200.902 193.406 1.00 14.83  ? 1006 THR A  CA  1 
ATOM   7429  C C   . THR A  1 1006 ? 192.242 201.250 194.546 1.00 15.02  ? 1006 THR A  C   1 
ATOM   7430  O O   . THR A  1 1006 ? 192.667 201.395 195.695 1.00 17.51  ? 1006 THR A  O   1 
ATOM   7431  C CB  . THR A  1 1006 ? 193.456 202.132 192.542 1.00 21.24  ? 1006 THR A  CB  1 
ATOM   7432  O OG1 . THR A  1 1006 ? 194.370 201.793 191.493 1.00 28.45  ? 1006 THR A  OG1 1 
ATOM   7433  C CG2 . THR A  1 1006 ? 194.048 203.251 193.369 1.00 29.92  ? 1006 THR A  CG2 1 
ATOM   7434  N N   . TYR A  1 1007 ? 190.951 201.390 194.246 1.00 18.86  ? 1007 TYR A  N   1 
ATOM   7435  C CA  . TYR A  1 1007 ? 189.986 201.715 195.290 1.00 14.06  ? 1007 TYR A  CA  1 
ATOM   7436  C C   . TYR A  1 1007 ? 189.982 200.654 196.382 1.00 21.12  ? 1007 TYR A  C   1 
ATOM   7437  O O   . TYR A  1 1007 ? 189.988 200.975 197.574 1.00 15.86  ? 1007 TYR A  O   1 
ATOM   7438  C CB  . TYR A  1 1007 ? 188.593 201.868 194.684 1.00 7.49   ? 1007 TYR A  CB  1 
ATOM   7439  C CG  . TYR A  1 1007 ? 187.492 201.932 195.712 1.00 11.12  ? 1007 TYR A  CG  1 
ATOM   7440  C CD1 . TYR A  1 1007 ? 187.225 203.104 196.396 1.00 19.36  ? 1007 TYR A  CD1 1 
ATOM   7441  C CD2 . TYR A  1 1007 ? 186.717 200.821 195.997 1.00 14.32  ? 1007 TYR A  CD2 1 
ATOM   7442  C CE1 . TYR A  1 1007 ? 186.225 203.166 197.335 1.00 20.33  ? 1007 TYR A  CE1 1 
ATOM   7443  C CE2 . TYR A  1 1007 ? 185.716 200.876 196.935 1.00 16.04  ? 1007 TYR A  CE2 1 
ATOM   7444  C CZ  . TYR A  1 1007 ? 185.475 202.052 197.600 1.00 19.73  ? 1007 TYR A  CZ  1 
ATOM   7445  O OH  . TYR A  1 1007 ? 184.474 202.116 198.539 1.00 32.10  ? 1007 TYR A  OH  1 
ATOM   7446  N N   . VAL A  1 1008 ? 189.968 199.379 195.993 1.00 12.91  ? 1008 VAL A  N   1 
ATOM   7447  C CA  . VAL A  1 1008 ? 189.945 198.307 196.981 1.00 11.82  ? 1008 VAL A  CA  1 
ATOM   7448  C C   . VAL A  1 1008 ? 191.217 198.314 197.814 1.00 9.28   ? 1008 VAL A  C   1 
ATOM   7449  O O   . VAL A  1 1008 ? 191.175 198.064 199.023 1.00 18.97  ? 1008 VAL A  O   1 
ATOM   7450  C CB  . VAL A  1 1008 ? 189.732 196.951 196.285 1.00 8.53   ? 1008 VAL A  CB  1 
ATOM   7451  C CG1 . VAL A  1 1008 ? 190.042 195.805 197.235 1.00 8.24   ? 1008 VAL A  CG1 1 
ATOM   7452  C CG2 . VAL A  1 1008 ? 188.310 196.846 195.776 1.00 5.65   ? 1008 VAL A  CG2 1 
ATOM   7453  N N   . THR A  1 1009 ? 192.363 198.596 197.194 1.00 38.73  ? 1009 THR A  N   1 
ATOM   7454  C CA  . THR A  1 1009 ? 193.611 198.655 197.948 1.00 5.41   ? 1009 THR A  CA  1 
ATOM   7455  C C   . THR A  1 1009 ? 193.567 199.772 198.980 1.00 7.62   ? 1009 THR A  C   1 
ATOM   7456  O O   . THR A  1 1009 ? 193.963 199.580 200.135 1.00 17.87  ? 1009 THR A  O   1 
ATOM   7457  C CB  . THR A  1 1009 ? 194.789 198.854 196.996 1.00 8.60   ? 1009 THR A  CB  1 
ATOM   7458  O OG1 . THR A  1 1009 ? 194.799 197.808 196.019 1.00 19.20  ? 1009 THR A  OG1 1 
ATOM   7459  C CG2 . THR A  1 1009 ? 196.101 198.836 197.755 1.00 11.45  ? 1009 THR A  CG2 1 
ATOM   7460  N N   . GLN A  1 1010 ? 193.081 200.949 198.583 1.00 10.46  ? 1010 GLN A  N   1 
ATOM   7461  C CA  . GLN A  1 1010 ? 192.932 202.043 199.534 1.00 4.91   ? 1010 GLN A  CA  1 
ATOM   7462  C C   . GLN A  1 1010 ? 192.011 201.647 200.678 1.00 8.60   ? 1010 GLN A  C   1 
ATOM   7463  O O   . GLN A  1 1010 ? 192.268 201.986 201.836 1.00 15.75  ? 1010 GLN A  O   1 
ATOM   7464  C CB  . GLN A  1 1010 ? 192.391 203.284 198.827 1.00 18.39  ? 1010 GLN A  CB  1 
ATOM   7465  C CG  . GLN A  1 1010 ? 193.258 203.788 197.686 1.00 29.87  ? 1010 GLN A  CG  1 
ATOM   7466  C CD  . GLN A  1 1010 ? 194.601 204.295 198.149 1.00 39.97  ? 1010 GLN A  CD  1 
ATOM   7467  O OE1 . GLN A  1 1010 ? 194.685 205.158 199.022 1.00 45.30  ? 1010 GLN A  OE1 1 
ATOM   7468  N NE2 . GLN A  1 1010 ? 195.667 203.759 197.567 1.00 27.26  ? 1010 GLN A  NE2 1 
ATOM   7469  N N   . GLN A  1 1011 ? 190.923 200.938 200.370 1.00 12.68  ? 1011 GLN A  N   1 
ATOM   7470  C CA  . GLN A  1 1011 ? 189.962 200.570 201.403 1.00 8.94   ? 1011 GLN A  CA  1 
ATOM   7471  C C   . GLN A  1 1011 ? 190.490 199.466 202.306 1.00 7.50   ? 1011 GLN A  C   1 
ATOM   7472  O O   . GLN A  1 1011 ? 190.182 199.451 203.500 1.00 12.10  ? 1011 GLN A  O   1 
ATOM   7473  C CB  . GLN A  1 1011 ? 188.647 200.142 200.758 1.00 6.69   ? 1011 GLN A  CB  1 
ATOM   7474  C CG  . GLN A  1 1011 ? 187.854 201.294 200.187 1.00 7.65   ? 1011 GLN A  CG  1 
ATOM   7475  C CD  . GLN A  1 1011 ? 187.235 202.153 201.262 1.00 14.65  ? 1011 GLN A  CD  1 
ATOM   7476  O OE1 . GLN A  1 1011 ? 187.562 203.331 201.398 1.00 14.71  ? 1011 GLN A  OE1 1 
ATOM   7477  N NE2 . GLN A  1 1011 ? 186.326 201.571 202.035 1.00 29.21  ? 1011 GLN A  NE2 1 
ATOM   7478  N N   . LEU A  1 1012 ? 191.274 198.533 201.766 1.00 7.73   ? 1012 LEU A  N   1 
ATOM   7479  C CA  . LEU A  1 1012 ? 191.882 197.515 202.617 1.00 7.91   ? 1012 LEU A  CA  1 
ATOM   7480  C C   . LEU A  1 1012 ? 192.887 198.138 203.570 1.00 8.46   ? 1012 LEU A  C   1 
ATOM   7481  O O   . LEU A  1 1012 ? 192.942 197.775 204.749 1.00 15.92  ? 1012 LEU A  O   1 
ATOM   7482  C CB  . LEU A  1 1012 ? 192.559 196.448 201.761 1.00 7.29   ? 1012 LEU A  CB  1 
ATOM   7483  C CG  . LEU A  1 1012 ? 191.649 195.424 201.091 1.00 7.44   ? 1012 LEU A  CG  1 
ATOM   7484  C CD1 . LEU A  1 1012 ? 192.415 194.682 200.020 1.00 11.79  ? 1012 LEU A  CD1 1 
ATOM   7485  C CD2 . LEU A  1 1012 ? 191.100 194.457 202.115 1.00 5.77   ? 1012 LEU A  CD2 1 
ATOM   7486  N N   . ILE A  1 1013 ? 193.689 199.079 203.077 1.00 7.83   ? 1013 ILE A  N   1 
ATOM   7487  C CA  . ILE A  1 1013 ? 194.605 199.806 203.944 1.00 8.80   ? 1013 ILE A  CA  1 
ATOM   7488  C C   . ILE A  1 1013 ? 193.825 200.633 204.956 1.00 9.96   ? 1013 ILE A  C   1 
ATOM   7489  O O   . ILE A  1 1013 ? 194.149 200.656 206.147 1.00 15.05  ? 1013 ILE A  O   1 
ATOM   7490  C CB  . ILE A  1 1013 ? 195.543 200.685 203.099 1.00 5.77   ? 1013 ILE A  CB  1 
ATOM   7491  C CG1 . ILE A  1 1013 ? 196.539 199.812 202.339 1.00 5.77   ? 1013 ILE A  CG1 1 
ATOM   7492  C CG2 . ILE A  1 1013 ? 196.269 201.681 203.973 1.00 5.77   ? 1013 ILE A  CG2 1 
ATOM   7493  C CD1 . ILE A  1 1013 ? 197.215 200.515 201.200 1.00 5.77   ? 1013 ILE A  CD1 1 
ATOM   7494  N N   . ARG A  1 1014 ? 192.786 201.326 204.492 1.00 10.53  ? 1014 ARG A  N   1 
ATOM   7495  C CA  . ARG A  1 1014 ? 191.984 202.162 205.379 1.00 6.63   ? 1014 ARG A  CA  1 
ATOM   7496  C C   . ARG A  1 1014 ? 191.306 201.327 206.458 1.00 16.10  ? 1014 ARG A  C   1 
ATOM   7497  O O   . ARG A  1 1014 ? 191.269 201.717 207.629 1.00 20.98  ? 1014 ARG A  O   1 
ATOM   7498  C CB  . ARG A  1 1014 ? 190.952 202.928 204.557 1.00 10.27  ? 1014 ARG A  CB  1 
ATOM   7499  C CG  . ARG A  1 1014 ? 190.480 204.221 205.185 1.00 28.07  ? 1014 ARG A  CG  1 
ATOM   7500  C CD  . ARG A  1 1014 ? 189.845 205.128 204.144 1.00 23.03  ? 1014 ARG A  CD  1 
ATOM   7501  N NE  . ARG A  1 1014 ? 190.793 205.492 203.096 1.00 37.45  ? 1014 ARG A  NE  1 
ATOM   7502  C CZ  . ARG A  1 1014 ? 190.463 206.091 201.958 1.00 43.07  ? 1014 ARG A  CZ  1 
ATOM   7503  N NH1 . ARG A  1 1014 ? 189.200 206.398 201.704 1.00 51.73  ? 1014 ARG A  NH1 1 
ATOM   7504  N NH2 . ARG A  1 1014 ? 191.399 206.380 201.066 1.00 32.29  ? 1014 ARG A  NH2 1 
ATOM   7505  N N   . ALA A  1 1015 ? 190.741 200.181 206.076 1.00 10.24  ? 1015 ALA A  N   1 
ATOM   7506  C CA  . ALA A  1 1015 ? 190.082 199.316 207.047 1.00 0.00   ? 1015 ALA A  CA  1 
ATOM   7507  C C   . ALA A  1 1015 ? 191.024 198.896 208.163 1.00 12.45  ? 1015 ALA A  C   1 
ATOM   7508  O O   . ALA A  1 1015 ? 190.575 198.603 209.275 1.00 19.23  ? 1015 ALA A  O   1 
ATOM   7509  C CB  . ALA A  1 1015 ? 189.521 198.076 206.354 1.00 9.93   ? 1015 ALA A  CB  1 
ATOM   7510  N N   . ALA A  1 1016 ? 192.326 198.841 207.889 1.00 23.20  ? 1016 ALA A  N   1 
ATOM   7511  C CA  . ALA A  1 1016 ? 193.285 198.511 208.936 1.00 13.42  ? 1016 ALA A  CA  1 
ATOM   7512  C C   . ALA A  1 1016 ? 193.486 199.672 209.895 1.00 7.47   ? 1016 ALA A  C   1 
ATOM   7513  O O   . ALA A  1 1016 ? 193.768 199.452 211.077 1.00 16.58  ? 1016 ALA A  O   1 
ATOM   7514  C CB  . ALA A  1 1016 ? 194.622 198.105 208.320 1.00 17.21  ? 1016 ALA A  CB  1 
ATOM   7515  N N   . GLU A  1 1017 ? 193.355 200.906 209.411 1.00 21.90  ? 1017 GLU A  N   1 
ATOM   7516  C CA  . GLU A  1 1017 ? 193.341 202.048 210.314 1.00 14.53  ? 1017 GLU A  CA  1 
ATOM   7517  C C   . GLU A  1 1017 ? 192.141 201.979 211.244 1.00 15.49  ? 1017 GLU A  C   1 
ATOM   7518  O O   . GLU A  1 1017 ? 192.258 202.250 212.444 1.00 28.48  ? 1017 GLU A  O   1 
ATOM   7519  C CB  . GLU A  1 1017 ? 193.313 203.351 209.519 1.00 21.53  ? 1017 GLU A  CB  1 
ATOM   7520  C CG  . GLU A  1 1017 ? 194.403 203.488 208.470 1.00 25.91  ? 1017 GLU A  CG  1 
ATOM   7521  C CD  . GLU A  1 1017 ? 194.171 204.680 207.560 1.00 46.02  ? 1017 GLU A  CD  1 
ATOM   7522  O OE1 . GLU A  1 1017 ? 194.748 204.712 206.453 1.00 39.05  ? 1017 GLU A  OE1 1 
ATOM   7523  O OE2 . GLU A  1 1017 ? 193.402 205.582 207.954 1.00 31.88  ? 1017 GLU A  OE2 1 
ATOM   7524  N N   . ILE A  1 1018 ? 190.977 201.614 210.707 1.00 16.43  ? 1018 ILE A  N   1 
ATOM   7525  C CA  . ILE A  1 1018 ? 189.769 201.515 211.517 1.00 13.48  ? 1018 ILE A  CA  1 
ATOM   7526  C C   . ILE A  1 1018 ? 189.847 200.322 212.456 1.00 9.83   ? 1018 ILE A  C   1 
ATOM   7527  O O   . ILE A  1 1018 ? 189.427 200.404 213.612 1.00 19.08  ? 1018 ILE A  O   1 
ATOM   7528  C CB  . ILE A  1 1018 ? 188.530 201.435 210.609 1.00 14.62  ? 1018 ILE A  CB  1 
ATOM   7529  C CG1 . ILE A  1 1018 ? 188.349 202.732 209.817 1.00 12.37  ? 1018 ILE A  CG1 1 
ATOM   7530  C CG2 . ILE A  1 1018 ? 187.292 201.143 211.426 1.00 17.90  ? 1018 ILE A  CG2 1 
ATOM   7531  C CD1 . ILE A  1 1018 ? 187.930 203.923 210.651 1.00 14.84  ? 1018 ILE A  CD1 1 
ATOM   7532  N N   . ARG A  1 1019 ? 190.377 199.194 211.980 1.00 17.58  ? 1019 ARG A  N   1 
ATOM   7533  C CA  . ARG A  1 1019 ? 190.472 198.016 212.835 1.00 11.24  ? 1019 ARG A  CA  1 
ATOM   7534  C C   . ARG A  1 1019 ? 191.339 198.293 214.051 1.00 10.45  ? 1019 ARG A  C   1 
ATOM   7535  O O   . ARG A  1 1019 ? 191.007 197.880 215.167 1.00 28.29  ? 1019 ARG A  O   1 
ATOM   7536  C CB  . ARG A  1 1019 ? 191.032 196.832 212.049 1.00 16.28  ? 1019 ARG A  CB  1 
ATOM   7537  C CG  . ARG A  1 1019 ? 190.912 195.508 212.783 1.00 22.59  ? 1019 ARG A  CG  1 
ATOM   7538  C CD  . ARG A  1 1019 ? 191.644 194.381 212.071 1.00 25.98  ? 1019 ARG A  CD  1 
ATOM   7539  N NE  . ARG A  1 1019 ? 191.368 194.339 210.635 1.00 28.05  ? 1019 ARG A  NE  1 
ATOM   7540  C CZ  . ARG A  1 1019 ? 192.237 194.662 209.679 1.00 22.08  ? 1019 ARG A  CZ  1 
ATOM   7541  N NH1 . ARG A  1 1019 ? 193.468 195.057 209.980 1.00 24.11  ? 1019 ARG A  NH1 1 
ATOM   7542  N NH2 . ARG A  1 1019 ? 191.875 194.585 208.405 1.00 29.09  ? 1019 ARG A  NH2 1 
ATOM   7543  N N   . ALA A  1 1020 ? 192.466 198.977 213.855 1.00 12.05  ? 1020 ALA A  N   1 
ATOM   7544  C CA  . ALA A  1 1020 ? 193.311 199.341 214.986 1.00 14.37  ? 1020 ALA A  CA  1 
ATOM   7545  C C   . ALA A  1 1020 ? 192.582 200.283 215.928 1.00 16.74  ? 1020 ALA A  C   1 
ATOM   7546  O O   . ALA A  1 1020 ? 192.689 200.157 217.152 1.00 35.14  ? 1020 ALA A  O   1 
ATOM   7547  C CB  . ALA A  1 1020 ? 194.602 199.985 214.489 1.00 25.03  ? 1020 ALA A  CB  1 
ATOM   7548  N N   . SER A  1 1021 ? 191.841 201.243 215.377 1.00 18.75  ? 1021 SER A  N   1 
ATOM   7549  C CA  . SER A  1 1021 ? 191.093 202.170 216.216 1.00 10.31  ? 1021 SER A  CA  1 
ATOM   7550  C C   . SER A  1 1021 ? 189.931 201.479 216.915 1.00 17.78  ? 1021 SER A  C   1 
ATOM   7551  O O   . SER A  1 1021 ? 189.571 201.857 218.033 1.00 21.03  ? 1021 SER A  O   1 
ATOM   7552  C CB  . SER A  1 1021 ? 190.583 203.337 215.379 1.00 8.98   ? 1021 SER A  CB  1 
ATOM   7553  O OG  . SER A  1 1021 ? 189.999 204.327 216.201 1.00 10.17  ? 1021 SER A  OG  1 
ATOM   7554  N N   . ALA A  1 1022 ? 189.326 200.480 216.274 1.00 7.96   ? 1022 ALA A  N   1 
ATOM   7555  C CA  . ALA A  1 1022 ? 188.248 199.740 216.918 1.00 7.79   ? 1022 ALA A  CA  1 
ATOM   7556  C C   . ALA A  1 1022 ? 188.780 198.780 217.971 1.00 14.09  ? 1022 ALA A  C   1 
ATOM   7557  O O   . ALA A  1 1022 ? 188.083 198.492 218.948 1.00 13.85  ? 1022 ALA A  O   1 
ATOM   7558  C CB  . ALA A  1 1022 ? 187.435 198.981 215.876 1.00 19.15  ? 1022 ALA A  CB  1 
ATOM   7559  N N   . ASN A  1 1023 ? 189.993 198.256 217.783 1.00 19.16  ? 1023 ASN A  N   1 
ATOM   7560  C CA  . ASN A  1 1023 ? 190.604 197.441 218.826 1.00 13.88  ? 1023 ASN A  CA  1 
ATOM   7561  C C   . ASN A  1 1023 ? 191.040 198.295 220.005 1.00 14.58  ? 1023 ASN A  C   1 
ATOM   7562  O O   . ASN A  1 1023 ? 191.057 197.817 221.143 1.00 59.96  ? 1023 ASN A  O   1 
ATOM   7563  C CB  . ASN A  1 1023 ? 191.797 196.670 218.269 1.00 12.62  ? 1023 ASN A  CB  1 
ATOM   7564  C CG  . ASN A  1 1023 ? 191.400 195.672 217.210 1.00 17.45  ? 1023 ASN A  CG  1 
ATOM   7565  O OD1 . ASN A  1 1023 ? 190.235 195.295 217.104 1.00 26.05  ? 1023 ASN A  OD1 1 
ATOM   7566  N ND2 . ASN A  1 1023 ? 192.369 195.233 216.417 1.00 29.43  ? 1023 ASN A  ND2 1 
ATOM   7567  N N   . LEU A  1 1024 ? 191.411 199.548 219.752 1.00 12.38  ? 1024 LEU A  N   1 
ATOM   7568  C CA  . LEU A  1 1024 ? 191.700 200.468 220.846 1.00 12.23  ? 1024 LEU A  CA  1 
ATOM   7569  C C   . LEU A  1 1024 ? 190.428 200.822 221.599 1.00 9.31   ? 1024 LEU A  C   1 
ATOM   7570  O O   . LEU A  1 1024 ? 190.382 200.754 222.831 1.00 15.10  ? 1024 LEU A  O   1 
ATOM   7571  C CB  . LEU A  1 1024 ? 192.370 201.728 220.302 1.00 11.22  ? 1024 LEU A  CB  1 
ATOM   7572  C CG  . LEU A  1 1024 ? 192.724 202.816 221.314 1.00 10.23  ? 1024 LEU A  CG  1 
ATOM   7573  C CD1 . LEU A  1 1024 ? 193.822 202.336 222.235 1.00 16.79  ? 1024 LEU A  CD1 1 
ATOM   7574  C CD2 . LEU A  1 1024 ? 193.136 204.087 220.602 1.00 10.37  ? 1024 LEU A  CD2 1 
ATOM   7575  N N   . ALA A  1 1025 ? 189.377 201.195 220.868 1.00 12.22  ? 1025 ALA A  N   1 
ATOM   7576  C CA  . ALA A  1 1025 ? 188.116 201.542 221.509 1.00 6.99   ? 1025 ALA A  CA  1 
ATOM   7577  C C   . ALA A  1 1025 ? 187.565 200.376 222.310 1.00 8.43   ? 1025 ALA A  C   1 
ATOM   7578  O O   . ALA A  1 1025 ? 186.959 200.580 223.367 1.00 11.15  ? 1025 ALA A  O   1 
ATOM   7579  C CB  . ALA A  1 1025 ? 187.103 201.988 220.458 1.00 8.10   ? 1025 ALA A  CB  1 
ATOM   7580  N N   . ALA A  1 1026 ? 187.763 199.150 221.828 1.00 12.17  ? 1026 ALA A  N   1 
ATOM   7581  C CA  . ALA A  1 1026 ? 187.317 197.985 222.581 1.00 13.50  ? 1026 ALA A  CA  1 
ATOM   7582  C C   . ALA A  1 1026 ? 188.142 197.802 223.844 1.00 9.17   ? 1026 ALA A  C   1 
ATOM   7583  O O   . ALA A  1 1026 ? 187.612 197.401 224.884 1.00 14.66  ? 1026 ALA A  O   1 
ATOM   7584  C CB  . ALA A  1 1026 ? 187.396 196.737 221.706 1.00 12.79  ? 1026 ALA A  CB  1 
ATOM   7585  N N   . THR A  1 1027 ? 189.445 198.082 223.772 1.00 16.01  ? 1027 THR A  N   1 
ATOM   7586  C CA  . THR A  1 1027 ? 190.286 197.998 224.961 1.00 4.90   ? 1027 THR A  CA  1 
ATOM   7587  C C   . THR A  1 1027 ? 189.936 199.091 225.959 1.00 3.96   ? 1027 THR A  C   1 
ATOM   7588  O O   . THR A  1 1027 ? 189.940 198.854 227.171 1.00 25.13  ? 1027 THR A  O   1 
ATOM   7589  C CB  . THR A  1 1027 ? 191.760 198.083 224.568 1.00 10.75  ? 1027 THR A  CB  1 
ATOM   7590  O OG1 . THR A  1 1027 ? 192.076 197.022 223.660 1.00 22.59  ? 1027 THR A  OG1 1 
ATOM   7591  C CG2 . THR A  1 1027 ? 192.651 197.964 225.788 1.00 6.51   ? 1027 THR A  CG2 1 
ATOM   7592  N N   . LYS A  1 1028 ? 189.634 200.297 225.474 1.00 5.77   ? 1028 LYS A  N   1 
ATOM   7593  C CA  . LYS A  1 1028 ? 189.224 201.366 226.378 1.00 5.77   ? 1028 LYS A  CA  1 
ATOM   7594  C C   . LYS A  1 1028 ? 187.859 201.087 226.985 1.00 7.71   ? 1028 LYS A  C   1 
ATOM   7595  O O   . LYS A  1 1028 ? 187.589 201.503 228.113 1.00 6.67   ? 1028 LYS A  O   1 
ATOM   7596  C CB  . LYS A  1 1028 ? 189.210 202.706 225.650 1.00 5.77   ? 1028 LYS A  CB  1 
ATOM   7597  C CG  . LYS A  1 1028 ? 190.554 203.116 225.100 1.00 6.49   ? 1028 LYS A  CG  1 
ATOM   7598  C CD  . LYS A  1 1028 ? 190.725 204.616 225.114 1.00 5.77   ? 1028 LYS A  CD  1 
ATOM   7599  C CE  . LYS A  1 1028 ? 192.151 204.998 224.768 1.00 8.96   ? 1028 LYS A  CE  1 
ATOM   7600  N NZ  . LYS A  1 1028 ? 192.438 206.434 225.013 1.00 8.05   ? 1028 LYS A  NZ  1 
ATOM   7601  N N   . MET A  1 1029 ? 186.985 200.395 226.257 1.00 5.77   ? 1029 MET A  N   1 
ATOM   7602  C CA  . MET A  1 1029 ? 185.715 199.978 226.838 1.00 8.14   ? 1029 MET A  CA  1 
ATOM   7603  C C   . MET A  1 1029 ? 185.943 198.999 227.982 1.00 9.34   ? 1029 MET A  C   1 
ATOM   7604  O O   . MET A  1 1029 ? 185.355 199.134 229.058 1.00 10.90  ? 1029 MET A  O   1 
ATOM   7605  C CB  . MET A  1 1029 ? 184.833 199.349 225.761 1.00 6.00   ? 1029 MET A  CB  1 
ATOM   7606  C CG  . MET A  1 1029 ? 183.427 199.019 226.218 1.00 8.06   ? 1029 MET A  CG  1 
ATOM   7607  S SD  . MET A  1 1029 ? 182.384 200.475 226.378 1.00 16.73  ? 1029 MET A  SD  1 
ATOM   7608  C CE  . MET A  1 1029 ? 182.029 200.813 224.660 1.00 18.41  ? 1029 MET A  CE  1 
ATOM   7609  N N   . SER A  1 1030 ? 186.799 198.003 227.763 1.00 9.33   ? 1030 SER A  N   1 
ATOM   7610  C CA  . SER A  1 1030 ? 187.034 196.994 228.788 1.00 9.16   ? 1030 SER A  CA  1 
ATOM   7611  C C   . SER A  1 1030 ? 187.692 197.593 230.021 1.00 10.59  ? 1030 SER A  C   1 
ATOM   7612  O O   . SER A  1 1030 ? 187.363 197.219 231.151 1.00 16.22  ? 1030 SER A  O   1 
ATOM   7613  C CB  . SER A  1 1030 ? 187.899 195.871 228.224 1.00 9.00   ? 1030 SER A  CB  1 
ATOM   7614  O OG  . SER A  1 1030 ? 187.259 195.241 227.131 1.00 15.23  ? 1030 SER A  OG  1 
ATOM   7615  N N   . GLU A  1 1031 ? 188.624 198.519 229.830 1.00 10.75  ? 1031 GLU A  N   1 
ATOM   7616  C CA  . GLU A  1 1031 ? 189.494 198.975 230.904 1.00 6.70   ? 1031 GLU A  CA  1 
ATOM   7617  C C   . GLU A  1 1031 ? 189.089 200.319 231.490 1.00 5.83   ? 1031 GLU A  C   1 
ATOM   7618  O O   . GLU A  1 1031 ? 189.062 200.463 232.714 1.00 8.91   ? 1031 GLU A  O   1 
ATOM   7619  C CB  . GLU A  1 1031 ? 190.933 199.041 230.393 1.00 11.57  ? 1031 GLU A  CB  1 
ATOM   7620  C CG  . GLU A  1 1031 ? 191.550 197.664 230.221 1.00 19.07  ? 1031 GLU A  CG  1 
ATOM   7621  C CD  . GLU A  1 1031 ? 192.809 197.676 229.394 1.00 21.42  ? 1031 GLU A  CD  1 
ATOM   7622  O OE1 . GLU A  1 1031 ? 193.012 196.721 228.617 1.00 24.22  ? 1031 GLU A  OE1 1 
ATOM   7623  O OE2 . GLU A  1 1031 ? 193.594 198.637 229.517 1.00 15.83  ? 1031 GLU A  OE2 1 
ATOM   7624  N N   . CYS A  1 1032 ? 188.777 201.313 230.660 1.00 6.90   ? 1032 CYS A  N   1 
ATOM   7625  C CA  . CYS A  1 1032 ? 188.306 202.588 231.191 1.00 8.46   ? 1032 CYS A  CA  1 
ATOM   7626  C C   . CYS A  1 1032 ? 186.885 202.465 231.734 1.00 8.46   ? 1032 CYS A  C   1 
ATOM   7627  O O   . CYS A  1 1032 ? 186.574 202.984 232.810 1.00 9.41   ? 1032 CYS A  O   1 
ATOM   7628  C CB  . CYS A  1 1032 ? 188.394 203.681 230.122 1.00 7.54   ? 1032 CYS A  CB  1 
ATOM   7629  S SG  . CYS A  1 1032 ? 190.053 203.974 229.440 1.00 7.23   ? 1032 CYS A  SG  1 
ATOM   7630  N N   . VAL A  1 1033 ? 185.999 201.791 230.997 1.00 8.21   ? 1033 VAL A  N   1 
ATOM   7631  C CA  . VAL A  1 1033 ? 184.594 201.720 231.401 1.00 6.78   ? 1033 VAL A  CA  1 
ATOM   7632  C C   . VAL A  1 1033 ? 184.357 200.560 232.360 1.00 11.36  ? 1033 VAL A  C   1 
ATOM   7633  O O   . VAL A  1 1033 ? 183.931 200.759 233.503 1.00 33.52  ? 1033 VAL A  O   1 
ATOM   7634  C CB  . VAL A  1 1033 ? 183.678 201.614 230.169 1.00 6.72   ? 1033 VAL A  CB  1 
ATOM   7635  C CG1 . VAL A  1 1033 ? 182.223 201.499 230.600 1.00 9.96   ? 1033 VAL A  CG1 1 
ATOM   7636  C CG2 . VAL A  1 1033 ? 183.870 202.808 229.265 1.00 8.17   ? 1033 VAL A  CG2 1 
ATOM   7637  N N   . LEU A  1 1034 ? 184.621 199.333 231.916 1.00 10.64  ? 1034 LEU A  N   1 
ATOM   7638  C CA  . LEU A  1 1034 ? 184.316 198.168 232.751 1.00 8.97   ? 1034 LEU A  CA  1 
ATOM   7639  C C   . LEU A  1 1034 ? 185.276 197.996 233.899 1.00 13.64  ? 1034 LEU A  C   1 
ATOM   7640  O O   . LEU A  1 1034 ? 185.204 196.976 234.587 1.00 42.13  ? 1034 LEU A  O   1 
ATOM   7641  C CB  . LEU A  1 1034 ? 184.311 196.888 231.910 1.00 10.61  ? 1034 LEU A  CB  1 
ATOM   7642  C CG  . LEU A  1 1034 ? 183.058 196.567 231.096 1.00 13.85  ? 1034 LEU A  CG  1 
ATOM   7643  C CD1 . LEU A  1 1034 ? 183.008 197.403 229.842 1.00 21.77  ? 1034 LEU A  CD1 1 
ATOM   7644  C CD2 . LEU A  1 1034 ? 183.016 195.092 230.753 1.00 21.55  ? 1034 LEU A  CD2 1 
ATOM   7645  N N   . GLY A  1 1035 ? 186.175 198.927 234.150 1.00 10.53  ? 1035 GLY A  N   1 
ATOM   7646  C CA  . GLY A  1 1035 ? 187.089 198.839 235.274 1.00 8.79   ? 1035 GLY A  CA  1 
ATOM   7647  C C   . GLY A  1 1035 ? 187.563 200.212 235.651 1.00 12.84  ? 1035 GLY A  C   1 
ATOM   7648  O O   . GLY A  1 1035 ? 186.858 201.206 235.455 1.00 23.16  ? 1035 GLY A  O   1 
ATOM   7649  N N   . GLN A  1 1036 ? 188.771 200.272 236.198 1.00 11.71  ? 1036 GLN A  N   1 
ATOM   7650  C CA  . GLN A  1 1036 ? 189.412 201.543 236.515 1.00 27.94  ? 1036 GLN A  CA  1 
ATOM   7651  C C   . GLN A  1 1036 ? 190.890 201.365 236.216 1.00 21.84  ? 1036 GLN A  C   1 
ATOM   7652  O O   . GLN A  1 1036 ? 191.570 200.589 236.893 1.00 23.10  ? 1036 GLN A  O   1 
ATOM   7653  C CB  . GLN A  1 1036 ? 189.180 201.939 237.969 1.00 15.55  ? 1036 GLN A  CB  1 
ATOM   7654  C CG  . GLN A  1 1036 ? 189.836 203.247 238.360 1.00 16.59  ? 1036 GLN A  CG  1 
ATOM   7655  C CD  . GLN A  1 1036 ? 189.785 203.500 239.841 1.00 14.40  ? 1036 GLN A  CD  1 
ATOM   7656  O OE1 . GLN A  1 1036 ? 189.418 202.622 240.618 1.00 15.33  ? 1036 GLN A  OE1 1 
ATOM   7657  N NE2 . GLN A  1 1036 ? 190.154 204.707 240.247 1.00 25.55  ? 1036 GLN A  NE2 1 
ATOM   7658  N N   . SER A  1 1037 ? 191.381 202.073 235.207 1.00 12.51  ? 1037 SER A  N   1 
ATOM   7659  C CA  . SER A  1 1037 ? 192.716 201.834 234.685 1.00 14.83  ? 1037 SER A  CA  1 
ATOM   7660  C C   . SER A  1 1037 ? 193.748 202.587 235.510 1.00 21.55  ? 1037 SER A  C   1 
ATOM   7661  O O   . SER A  1 1037 ? 193.602 203.789 235.753 1.00 29.32  ? 1037 SER A  O   1 
ATOM   7662  C CB  . SER A  1 1037 ? 192.798 202.260 233.220 1.00 16.03  ? 1037 SER A  CB  1 
ATOM   7663  O OG  . SER A  1 1037 ? 193.945 201.717 232.596 1.00 16.17  ? 1037 SER A  OG  1 
ATOM   7664  N N   . LYS A  1 1038 ? 194.784 201.873 235.943 1.00 27.39  ? 1038 LYS A  N   1 
ATOM   7665  C CA  . LYS A  1 1038 ? 195.938 202.492 236.574 1.00 15.46  ? 1038 LYS A  CA  1 
ATOM   7666  C C   . LYS A  1 1038 ? 196.953 202.988 235.558 1.00 18.07  ? 1038 LYS A  C   1 
ATOM   7667  O O   . LYS A  1 1038 ? 197.949 203.607 235.947 1.00 39.74  ? 1038 LYS A  O   1 
ATOM   7668  C CB  . LYS A  1 1038 ? 196.617 201.504 237.527 1.00 12.10  ? 1038 LYS A  CB  1 
ATOM   7669  C CG  . LYS A  1 1038 ? 195.663 200.794 238.470 1.00 15.21  ? 1038 LYS A  CG  1 
ATOM   7670  C CD  . LYS A  1 1038 ? 194.835 201.776 239.283 1.00 15.55  ? 1038 LYS A  CD  1 
ATOM   7671  C CE  . LYS A  1 1038 ? 193.950 201.054 240.284 1.00 12.06  ? 1038 LYS A  CE  1 
ATOM   7672  N NZ  . LYS A  1 1038 ? 193.008 200.107 239.624 1.00 12.15  ? 1038 LYS A  NZ  1 
ATOM   7673  N N   . ARG A  1 1039 ? 196.725 202.725 234.275 1.00 14.62  ? 1039 ARG A  N   1 
ATOM   7674  C CA  . ARG A  1 1039 ? 197.624 203.187 233.229 1.00 16.11  ? 1039 ARG A  CA  1 
ATOM   7675  C C   . ARG A  1 1039 ? 197.526 204.697 233.079 1.00 16.26  ? 1039 ARG A  C   1 
ATOM   7676  O O   . ARG A  1 1039 ? 196.432 205.266 233.111 1.00 25.23  ? 1039 ARG A  O   1 
ATOM   7677  C CB  . ARG A  1 1039 ? 197.282 202.500 231.914 1.00 12.30  ? 1039 ARG A  CB  1 
ATOM   7678  C CG  . ARG A  1 1039 ? 197.410 200.997 231.976 1.00 6.88   ? 1039 ARG A  CG  1 
ATOM   7679  C CD  . ARG A  1 1039 ? 196.690 200.336 230.830 1.00 5.77   ? 1039 ARG A  CD  1 
ATOM   7680  N NE  . ARG A  1 1039 ? 197.282 200.677 229.544 1.00 5.77   ? 1039 ARG A  NE  1 
ATOM   7681  C CZ  . ARG A  1 1039 ? 196.829 200.240 228.376 1.00 5.77   ? 1039 ARG A  CZ  1 
ATOM   7682  N NH1 . ARG A  1 1039 ? 195.772 199.445 228.324 1.00 5.77   ? 1039 ARG A  NH1 1 
ATOM   7683  N NH2 . ARG A  1 1039 ? 197.435 200.601 227.256 1.00 5.77   ? 1039 ARG A  NH2 1 
ATOM   7684  N N   . VAL A  1 1040 ? 198.676 205.347 232.917 1.00 18.04  ? 1040 VAL A  N   1 
ATOM   7685  C CA  . VAL A  1 1040 ? 198.715 206.800 232.890 1.00 20.85  ? 1040 VAL A  CA  1 
ATOM   7686  C C   . VAL A  1 1040 ? 198.197 207.313 231.556 1.00 26.27  ? 1040 VAL A  C   1 
ATOM   7687  O O   . VAL A  1 1040 ? 198.564 206.811 230.485 1.00 33.06  ? 1040 VAL A  O   1 
ATOM   7688  C CB  . VAL A  1 1040 ? 200.143 207.298 233.163 1.00 16.81  ? 1040 VAL A  CB  1 
ATOM   7689  C CG1 . VAL A  1 1040 ? 200.270 208.774 232.830 1.00 13.92  ? 1040 VAL A  CG1 1 
ATOM   7690  C CG2 . VAL A  1 1040 ? 200.508 207.043 234.610 1.00 15.06  ? 1040 VAL A  CG2 1 
ATOM   7691  N N   . ASP A  1 1041 ? 197.323 208.314 231.620 1.00 27.64  ? 1041 ASP A  N   1 
ATOM   7692  C CA  . ASP A  1 1041 ? 196.855 209.022 230.436 1.00 19.10  ? 1041 ASP A  CA  1 
ATOM   7693  C C   . ASP A  1 1041 ? 196.227 208.090 229.408 1.00 22.08  ? 1041 ASP A  C   1 
ATOM   7694  O O   . ASP A  1 1041 ? 196.055 208.472 228.247 1.00 32.85  ? 1041 ASP A  O   1 
ATOM   7695  C CB  . ASP A  1 1041 ? 198.008 209.801 229.804 1.00 35.07  ? 1041 ASP A  CB  1 
ATOM   7696  C CG  . ASP A  1 1041 ? 198.401 211.017 230.619 1.00 51.10  ? 1041 ASP A  CG  1 
ATOM   7697  O OD1 . ASP A  1 1041 ? 197.952 211.126 231.780 1.00 45.99  ? 1041 ASP A  OD1 1 
ATOM   7698  O OD2 . ASP A  1 1041 ? 199.153 211.867 230.098 1.00 53.81  ? 1041 ASP A  OD2 1 
ATOM   7699  N N   . PHE A  1 1042 ? 195.880 206.867 229.814 1.00 21.10  ? 1042 PHE A  N   1 
ATOM   7700  C CA  . PHE A  1 1042 ? 195.145 205.989 228.912 1.00 9.00   ? 1042 PHE A  CA  1 
ATOM   7701  C C   . PHE A  1 1042 ? 193.673 206.367 228.843 1.00 12.57  ? 1042 PHE A  C   1 
ATOM   7702  O O   . PHE A  1 1042 ? 193.040 206.199 227.796 1.00 35.00  ? 1042 PHE A  O   1 
ATOM   7703  C CB  . PHE A  1 1042 ? 195.289 204.533 229.337 1.00 7.15   ? 1042 PHE A  CB  1 
ATOM   7704  C CG  . PHE A  1 1042 ? 194.692 203.571 228.363 1.00 7.64   ? 1042 PHE A  CG  1 
ATOM   7705  C CD1 . PHE A  1 1042 ? 195.237 203.426 227.105 1.00 11.40  ? 1042 PHE A  CD1 1 
ATOM   7706  C CD2 . PHE A  1 1042 ? 193.588 202.815 228.699 1.00 5.79   ? 1042 PHE A  CD2 1 
ATOM   7707  C CE1 . PHE A  1 1042 ? 194.694 202.549 226.202 1.00 14.57  ? 1042 PHE A  CE1 1 
ATOM   7708  C CE2 . PHE A  1 1042 ? 193.043 201.935 227.800 1.00 5.77   ? 1042 PHE A  CE2 1 
ATOM   7709  C CZ  . PHE A  1 1042 ? 193.598 201.800 226.550 1.00 7.21   ? 1042 PHE A  CZ  1 
ATOM   7710  N N   . CYS A  1 1043 ? 193.116 206.872 229.940 1.00 10.15  ? 1043 CYS A  N   1 
ATOM   7711  C CA  . CYS A  1 1043 ? 191.723 207.291 229.977 1.00 11.75  ? 1043 CYS A  CA  1 
ATOM   7712  C C   . CYS A  1 1043 ? 191.662 208.781 230.291 1.00 18.85  ? 1043 CYS A  C   1 
ATOM   7713  O O   . CYS A  1 1043 ? 190.922 209.210 231.181 1.00 16.37  ? 1043 CYS A  O   1 
ATOM   7714  C CB  . CYS A  1 1043 ? 190.925 206.482 231.002 1.00 15.91  ? 1043 CYS A  CB  1 
ATOM   7715  S SG  . CYS A  1 1043 ? 191.186 204.684 230.973 1.00 14.15  ? 1043 CYS A  SG  1 
ATOM   7716  N N   . GLY A  1 1044 ? 192.466 209.567 229.579 1.00 19.31  ? 1044 GLY A  N   1 
ATOM   7717  C CA  . GLY A  1 1044 ? 192.517 211.003 229.772 1.00 25.68  ? 1044 GLY A  CA  1 
ATOM   7718  C C   . GLY A  1 1044 ? 193.512 211.407 230.844 1.00 20.56  ? 1044 GLY A  C   1 
ATOM   7719  O O   . GLY A  1 1044 ? 194.090 210.587 231.552 1.00 21.99  ? 1044 GLY A  O   1 
ATOM   7720  N N   . LYS A  1 1045 ? 193.705 212.718 230.957 1.00 20.32  ? 1045 LYS A  N   1 
ATOM   7721  C CA  . LYS A  1 1045 ? 194.712 213.272 231.848 1.00 24.82  ? 1045 LYS A  CA  1 
ATOM   7722  C C   . LYS A  1 1045 ? 194.155 213.409 233.256 1.00 29.27  ? 1045 LYS A  C   1 
ATOM   7723  O O   . LYS A  1 1045 ? 193.010 213.828 233.450 1.00 45.47  ? 1045 LYS A  O   1 
ATOM   7724  C CB  . LYS A  1 1045 ? 195.200 214.627 231.334 1.00 28.68  ? 1045 LYS A  CB  1 
ATOM   7725  C CG  . LYS A  1 1045 ? 195.748 214.558 229.917 1.00 51.52  ? 1045 LYS A  CG  1 
ATOM   7726  C CD  . LYS A  1 1045 ? 196.668 215.719 229.585 1.00 53.91  ? 1045 LYS A  CD  1 
ATOM   7727  C CE  . LYS A  1 1045 ? 197.287 215.533 228.205 1.00 59.11  ? 1045 LYS A  CE  1 
ATOM   7728  N NZ  . LYS A  1 1045 ? 198.388 216.502 227.933 1.00 81.26  ? 1045 LYS A  NZ  1 
ATOM   7729  N N   . GLY A  1 1046 ? 194.976 213.057 234.233 1.00 20.05  ? 1046 GLY A  N   1 
ATOM   7730  C CA  . GLY A  1 1046 ? 194.558 212.952 235.616 1.00 13.44  ? 1046 GLY A  CA  1 
ATOM   7731  C C   . GLY A  1 1046 ? 194.561 211.504 236.067 1.00 21.02  ? 1046 GLY A  C   1 
ATOM   7732  O O   . GLY A  1 1046 ? 194.960 210.593 235.340 1.00 48.78  ? 1046 GLY A  O   1 
ATOM   7733  N N   . TYR A  1 1047 ? 194.113 211.305 237.300 1.00 17.37  ? 1047 TYR A  N   1 
ATOM   7734  C CA  . TYR A  1 1047 ? 193.980 209.968 237.858 1.00 14.39  ? 1047 TYR A  CA  1 
ATOM   7735  C C   . TYR A  1 1047 ? 192.589 209.439 237.535 1.00 19.66  ? 1047 TYR A  C   1 
ATOM   7736  O O   . TYR A  1 1047 ? 191.587 209.979 238.010 1.00 24.70  ? 1047 TYR A  O   1 
ATOM   7737  C CB  . TYR A  1 1047 ? 194.232 209.983 239.363 1.00 24.44  ? 1047 TYR A  CB  1 
ATOM   7738  C CG  . TYR A  1 1047 ? 195.628 210.426 239.723 1.00 20.44  ? 1047 TYR A  CG  1 
ATOM   7739  C CD1 . TYR A  1 1047 ? 196.689 209.540 239.674 1.00 23.70  ? 1047 TYR A  CD1 1 
ATOM   7740  C CD2 . TYR A  1 1047 ? 195.885 211.731 240.106 1.00 24.46  ? 1047 TYR A  CD2 1 
ATOM   7741  C CE1 . TYR A  1 1047 ? 197.964 209.942 239.997 1.00 30.98  ? 1047 TYR A  CE1 1 
ATOM   7742  C CE2 . TYR A  1 1047 ? 197.156 212.139 240.430 1.00 33.72  ? 1047 TYR A  CE2 1 
ATOM   7743  C CZ  . TYR A  1 1047 ? 198.192 211.242 240.373 1.00 26.26  ? 1047 TYR A  CZ  1 
ATOM   7744  O OH  . TYR A  1 1047 ? 199.464 211.647 240.698 1.00 31.51  ? 1047 TYR A  OH  1 
ATOM   7745  N N   . HIS A  1 1048 ? 192.535 208.385 236.726 1.00 18.16  ? 1048 HIS A  N   1 
ATOM   7746  C CA  . HIS A  1 1048 ? 191.264 207.889 236.219 1.00 12.64  ? 1048 HIS A  CA  1 
ATOM   7747  C C   . HIS A  1 1048 ? 190.378 207.397 237.352 1.00 18.47  ? 1048 HIS A  C   1 
ATOM   7748  O O   . HIS A  1 1048 ? 190.802 206.594 238.188 1.00 34.43  ? 1048 HIS A  O   1 
ATOM   7749  C CB  . HIS A  1 1048 ? 191.507 206.760 235.220 1.00 15.02  ? 1048 HIS A  CB  1 
ATOM   7750  C CG  . HIS A  1 1048 ? 190.254 206.192 234.633 1.00 17.89  ? 1048 HIS A  CG  1 
ATOM   7751  N ND1 . HIS A  1 1048 ? 189.917 204.861 234.743 1.00 12.30  ? 1048 HIS A  ND1 1 
ATOM   7752  C CD2 . HIS A  1 1048 ? 189.256 206.775 233.930 1.00 20.32  ? 1048 HIS A  CD2 1 
ATOM   7753  C CE1 . HIS A  1 1048 ? 188.764 204.649 234.135 1.00 14.50  ? 1048 HIS A  CE1 1 
ATOM   7754  N NE2 . HIS A  1 1048 ? 188.342 205.794 233.632 1.00 16.09  ? 1048 HIS A  NE2 1 
ATOM   7755  N N   . LEU A  1 1049 ? 189.138 207.885 237.374 1.00 19.50  ? 1049 LEU A  N   1 
ATOM   7756  C CA  . LEU A  1 1049 ? 188.108 207.370 238.267 1.00 11.54  ? 1049 LEU A  CA  1 
ATOM   7757  C C   . LEU A  1 1049 ? 187.156 206.435 237.533 1.00 15.87  ? 1049 LEU A  C   1 
ATOM   7758  O O   . LEU A  1 1049 ? 187.021 205.265 237.898 1.00 19.56  ? 1049 LEU A  O   1 
ATOM   7759  C CB  . LEU A  1 1049 ? 187.328 208.528 238.896 1.00 12.87  ? 1049 LEU A  CB  1 
ATOM   7760  C CG  . LEU A  1 1049 ? 188.104 209.434 239.848 1.00 8.37   ? 1049 LEU A  CG  1 
ATOM   7761  C CD1 . LEU A  1 1049 ? 187.282 210.658 240.175 1.00 15.51  ? 1049 LEU A  CD1 1 
ATOM   7762  C CD2 . LEU A  1 1049 ? 188.478 208.690 241.108 1.00 7.35   ? 1049 LEU A  CD2 1 
ATOM   7763  N N   . MET A  1 1050 ? 186.508 206.928 236.483 1.00 10.92  ? 1050 MET A  N   1 
ATOM   7764  C CA  . MET A  1 1050 ? 185.558 206.125 235.726 1.00 10.02  ? 1050 MET A  CA  1 
ATOM   7765  C C   . MET A  1 1050 ? 185.333 206.786 234.376 1.00 14.78  ? 1050 MET A  C   1 
ATOM   7766  O O   . MET A  1 1050 ? 185.655 207.958 234.173 1.00 18.47  ? 1050 MET A  O   1 
ATOM   7767  C CB  . MET A  1 1050 ? 184.239 205.973 236.483 1.00 6.97   ? 1050 MET A  CB  1 
ATOM   7768  C CG  . MET A  1 1050 ? 183.472 207.265 236.625 1.00 5.84   ? 1050 MET A  CG  1 
ATOM   7769  S SD  . MET A  1 1050 ? 182.171 207.161 237.855 1.00 20.95  ? 1050 MET A  SD  1 
ATOM   7770  C CE  . MET A  1 1050 ? 181.312 205.700 237.292 1.00 14.59  ? 1050 MET A  CE  1 
ATOM   7771  N N   . SER A  1 1051 ? 184.763 206.016 233.454 1.00 8.67   ? 1051 SER A  N   1 
ATOM   7772  C CA  . SER A  1 1051 ? 184.467 206.490 232.114 1.00 8.84   ? 1051 SER A  CA  1 
ATOM   7773  C C   . SER A  1 1051 ? 183.075 206.028 231.724 1.00 8.60   ? 1051 SER A  C   1 
ATOM   7774  O O   . SER A  1 1051 ? 182.593 204.998 232.199 1.00 14.55  ? 1051 SER A  O   1 
ATOM   7775  C CB  . SER A  1 1051 ? 185.485 205.980 231.090 1.00 7.90   ? 1051 SER A  CB  1 
ATOM   7776  O OG  . SER A  1 1051 ? 186.799 206.343 231.461 1.00 7.59   ? 1051 SER A  OG  1 
ATOM   7777  N N   . PHE A  1 1052 ? 182.431 206.804 230.857 1.00 12.03  ? 1052 PHE A  N   1 
ATOM   7778  C CA  . PHE A  1 1052 ? 181.090 206.504 230.378 1.00 9.36   ? 1052 PHE A  CA  1 
ATOM   7779  C C   . PHE A  1 1052 ? 181.091 206.490 228.856 1.00 7.98   ? 1052 PHE A  C   1 
ATOM   7780  O O   . PHE A  1 1052 ? 181.488 207.492 228.238 1.00 12.82  ? 1052 PHE A  O   1 
ATOM   7781  C CB  . PHE A  1 1052 ? 180.087 207.530 230.901 1.00 10.95  ? 1052 PHE A  CB  1 
ATOM   7782  C CG  . PHE A  1 1052 ? 180.115 207.694 232.390 1.00 9.39   ? 1052 PHE A  CG  1 
ATOM   7783  C CD1 . PHE A  1 1052 ? 179.569 206.730 233.212 1.00 14.40  ? 1052 PHE A  CD1 1 
ATOM   7784  C CD2 . PHE A  1 1052 ? 180.681 208.811 232.967 1.00 8.52   ? 1052 PHE A  CD2 1 
ATOM   7785  C CE1 . PHE A  1 1052 ? 179.591 206.875 234.576 1.00 12.60  ? 1052 PHE A  CE1 1 
ATOM   7786  C CE2 . PHE A  1 1052 ? 180.705 208.958 234.332 1.00 12.62  ? 1052 PHE A  CE2 1 
ATOM   7787  C CZ  . PHE A  1 1052 ? 180.159 207.989 235.137 1.00 9.55   ? 1052 PHE A  CZ  1 
ATOM   7788  N N   . PRO A  1 1053 ? 180.671 205.411 228.205 1.00 6.97   ? 1053 PRO A  N   1 
ATOM   7789  C CA  . PRO A  1 1053 ? 180.627 205.408 226.743 1.00 8.38   ? 1053 PRO A  CA  1 
ATOM   7790  C C   . PRO A  1 1053 ? 179.410 206.140 226.205 1.00 28.55  ? 1053 PRO A  C   1 
ATOM   7791  O O   . PRO A  1 1053 ? 178.330 206.131 226.799 1.00 43.54  ? 1053 PRO A  O   1 
ATOM   7792  C CB  . PRO A  1 1053 ? 180.558 203.916 226.407 1.00 5.88   ? 1053 PRO A  CB  1 
ATOM   7793  C CG  . PRO A  1 1053 ? 179.813 203.338 227.547 1.00 7.66   ? 1053 PRO A  CG  1 
ATOM   7794  C CD  . PRO A  1 1053 ? 180.206 204.129 228.761 1.00 8.18   ? 1053 PRO A  CD  1 
ATOM   7795  N N   . GLN A  1 1054 ? 179.602 206.780 225.056 1.00 17.14  ? 1054 GLN A  N   1 
ATOM   7796  C CA  . GLN A  1 1054 ? 178.513 207.422 224.335 1.00 11.85  ? 1054 GLN A  CA  1 
ATOM   7797  C C   . GLN A  1 1054 ? 178.644 207.070 222.865 1.00 19.30  ? 1054 GLN A  C   1 
ATOM   7798  O O   . GLN A  1 1054 ? 179.715 207.246 222.279 1.00 28.07  ? 1054 GLN A  O   1 
ATOM   7799  C CB  . GLN A  1 1054 ? 178.541 208.943 224.521 1.00 16.09  ? 1054 GLN A  CB  1 
ATOM   7800  C CG  . GLN A  1 1054 ? 178.425 209.400 225.961 1.00 20.63  ? 1054 GLN A  CG  1 
ATOM   7801  C CD  . GLN A  1 1054 ? 177.012 209.324 226.486 1.00 30.50  ? 1054 GLN A  CD  1 
ATOM   7802  O OE1 . GLN A  1 1054 ? 176.296 210.320 226.503 1.00 29.57  ? 1054 GLN A  OE1 1 
ATOM   7803  N NE2 . GLN A  1 1054 ? 176.601 208.144 226.923 1.00 30.22  ? 1054 GLN A  NE2 1 
ATOM   7804  N N   . SER A  1 1055 ? 177.563 206.581 222.269 1.00 25.60  ? 1055 SER A  N   1 
ATOM   7805  C CA  . SER A  1 1055 ? 177.611 206.200 220.867 1.00 16.59  ? 1055 SER A  CA  1 
ATOM   7806  C C   . SER A  1 1055 ? 177.653 207.437 219.979 1.00 30.68  ? 1055 SER A  C   1 
ATOM   7807  O O   . SER A  1 1055 ? 177.062 208.474 220.285 1.00 46.51  ? 1055 SER A  O   1 
ATOM   7808  C CB  . SER A  1 1055 ? 176.404 205.342 220.501 1.00 18.52  ? 1055 SER A  CB  1 
ATOM   7809  O OG  . SER A  1 1055 ? 175.216 206.109 220.490 1.00 39.53  ? 1055 SER A  OG  1 
ATOM   7810  N N   . ALA A  1 1056 ? 178.362 207.316 218.868 1.00 22.55  ? 1056 ALA A  N   1 
ATOM   7811  C CA  . ALA A  1 1056 ? 178.432 208.349 217.850 1.00 20.51  ? 1056 ALA A  CA  1 
ATOM   7812  C C   . ALA A  1 1056 ? 178.388 207.669 216.494 1.00 33.36  ? 1056 ALA A  C   1 
ATOM   7813  O O   . ALA A  1 1056 ? 178.663 206.469 216.388 1.00 45.65  ? 1056 ALA A  O   1 
ATOM   7814  C CB  . ALA A  1 1056 ? 179.704 209.199 217.972 1.00 16.33  ? 1056 ALA A  CB  1 
ATOM   7815  N N   . PRO A  1 1057 ? 178.032 208.400 215.441 1.00 26.92  ? 1057 PRO A  N   1 
ATOM   7816  C CA  . PRO A  1 1057 ? 178.018 207.795 214.103 1.00 32.27  ? 1057 PRO A  CA  1 
ATOM   7817  C C   . PRO A  1 1057 ? 179.383 207.231 213.741 1.00 33.53  ? 1057 PRO A  C   1 
ATOM   7818  O O   . PRO A  1 1057 ? 180.373 207.959 213.648 1.00 23.28  ? 1057 PRO A  O   1 
ATOM   7819  C CB  . PRO A  1 1057 ? 177.616 208.962 213.196 1.00 36.74  ? 1057 PRO A  CB  1 
ATOM   7820  C CG  . PRO A  1 1057 ? 176.874 209.883 214.087 1.00 29.05  ? 1057 PRO A  CG  1 
ATOM   7821  C CD  . PRO A  1 1057 ? 177.528 209.782 215.421 1.00 26.00  ? 1057 PRO A  CD  1 
ATOM   7822  N N   . HIS A  1 1058 ? 179.427 205.916 213.539 1.00 34.31  ? 1058 HIS A  N   1 
ATOM   7823  C CA  . HIS A  1 1058 ? 180.636 205.207 213.136 1.00 30.61  ? 1058 HIS A  CA  1 
ATOM   7824  C C   . HIS A  1 1058 ? 181.746 205.312 214.171 1.00 24.74  ? 1058 HIS A  C   1 
ATOM   7825  O O   . HIS A  1 1058 ? 182.918 205.101 213.849 1.00 33.66  ? 1058 HIS A  O   1 
ATOM   7826  C CB  . HIS A  1 1058 ? 181.138 205.710 211.780 1.00 29.87  ? 1058 HIS A  CB  1 
ATOM   7827  C CG  . HIS A  1 1058 ? 180.202 205.420 210.651 1.00 35.07  ? 1058 HIS A  CG  1 
ATOM   7828  N ND1 . HIS A  1 1058 ? 179.746 204.150 210.375 1.00 41.41  ? 1058 HIS A  ND1 1 
ATOM   7829  C CD2 . HIS A  1 1058 ? 179.632 206.233 209.732 1.00 50.48  ? 1058 HIS A  CD2 1 
ATOM   7830  C CE1 . HIS A  1 1058 ? 178.935 204.192 209.335 1.00 51.78  ? 1058 HIS A  CE1 1 
ATOM   7831  N NE2 . HIS A  1 1058 ? 178.849 205.445 208.925 1.00 61.24  ? 1058 HIS A  NE2 1 
ATOM   7832  N N   . GLY A  1 1059 ? 181.408 205.623 215.417 1.00 17.75  ? 1059 GLY A  N   1 
ATOM   7833  C CA  . GLY A  1 1059 ? 182.425 205.764 216.437 1.00 11.99  ? 1059 GLY A  CA  1 
ATOM   7834  C C   . GLY A  1 1059 ? 181.830 205.682 217.822 1.00 14.36  ? 1059 GLY A  C   1 
ATOM   7835  O O   . GLY A  1 1059 ? 180.630 205.467 218.001 1.00 18.73  ? 1059 GLY A  O   1 
ATOM   7836  N N   . VAL A  1 1060 ? 182.703 205.854 218.811 1.00 12.62  ? 1060 VAL A  N   1 
ATOM   7837  C CA  . VAL A  1 1060 ? 182.327 205.856 220.218 1.00 9.79   ? 1060 VAL A  CA  1 
ATOM   7838  C C   . VAL A  1 1060 ? 183.018 207.026 220.897 1.00 10.82  ? 1060 VAL A  C   1 
ATOM   7839  O O   . VAL A  1 1060 ? 184.158 207.370 220.571 1.00 15.27  ? 1060 VAL A  O   1 
ATOM   7840  C CB  . VAL A  1 1060 ? 182.695 204.531 220.917 1.00 10.51  ? 1060 VAL A  CB  1 
ATOM   7841  C CG1 . VAL A  1 1060 ? 184.199 204.363 220.980 1.00 8.65   ? 1060 VAL A  CG1 1 
ATOM   7842  C CG2 . VAL A  1 1060 ? 182.092 204.476 222.304 1.00 10.83  ? 1060 VAL A  CG2 1 
ATOM   7843  N N   . VAL A  1 1061 ? 182.321 207.639 221.848 1.00 10.67  ? 1061 VAL A  N   1 
ATOM   7844  C CA  . VAL A  1 1061 ? 182.854 208.741 222.639 1.00 7.82   ? 1061 VAL A  CA  1 
ATOM   7845  C C   . VAL A  1 1061 ? 182.910 208.298 224.090 1.00 9.41   ? 1061 VAL A  C   1 
ATOM   7846  O O   . VAL A  1 1061 ? 181.908 207.826 224.641 1.00 14.18  ? 1061 VAL A  O   1 
ATOM   7847  C CB  . VAL A  1 1061 ? 182.004 210.014 222.484 1.00 6.56   ? 1061 VAL A  CB  1 
ATOM   7848  C CG1 . VAL A  1 1061 ? 182.486 211.093 223.433 1.00 5.20   ? 1061 VAL A  CG1 1 
ATOM   7849  C CG2 . VAL A  1 1061 ? 182.061 210.507 221.058 1.00 21.14  ? 1061 VAL A  CG2 1 
ATOM   7850  N N   . PHE A  1 1062 ? 184.078 208.443 224.704 1.00 11.93  ? 1062 PHE A  N   1 
ATOM   7851  C CA  . PHE A  1 1062 ? 184.275 208.127 226.110 1.00 5.77   ? 1062 PHE A  CA  1 
ATOM   7852  C C   . PHE A  1 1062 ? 184.322 209.420 226.907 1.00 7.00   ? 1062 PHE A  C   1 
ATOM   7853  O O   . PHE A  1 1062 ? 185.088 210.328 226.575 1.00 14.67  ? 1062 PHE A  O   1 
ATOM   7854  C CB  . PHE A  1 1062 ? 185.570 207.347 226.329 1.00 6.01   ? 1062 PHE A  CB  1 
ATOM   7855  C CG  . PHE A  1 1062 ? 185.572 205.984 225.716 1.00 5.77   ? 1062 PHE A  CG  1 
ATOM   7856  C CD1 . PHE A  1 1062 ? 184.915 204.939 226.327 1.00 5.77   ? 1062 PHE A  CD1 1 
ATOM   7857  C CD2 . PHE A  1 1062 ? 186.249 205.743 224.539 1.00 8.17   ? 1062 PHE A  CD2 1 
ATOM   7858  C CE1 . PHE A  1 1062 ? 184.917 203.688 225.769 1.00 13.57  ? 1062 PHE A  CE1 1 
ATOM   7859  C CE2 . PHE A  1 1062 ? 186.255 204.492 223.981 1.00 5.77   ? 1062 PHE A  CE2 1 
ATOM   7860  C CZ  . PHE A  1 1062 ? 185.590 203.464 224.596 1.00 6.22   ? 1062 PHE A  CZ  1 
ATOM   7861  N N   . LEU A  1 1063 ? 183.498 209.506 227.944 1.00 8.43   ? 1063 LEU A  N   1 
ATOM   7862  C CA  . LEU A  1 1063 ? 183.557 210.620 228.884 1.00 10.29  ? 1063 LEU A  CA  1 
ATOM   7863  C C   . LEU A  1 1063 ? 184.394 210.170 230.074 1.00 7.03   ? 1063 LEU A  C   1 
ATOM   7864  O O   . LEU A  1 1063 ? 183.887 209.534 230.997 1.00 18.64  ? 1063 LEU A  O   1 
ATOM   7865  C CB  . LEU A  1 1063 ? 182.157 211.049 229.307 1.00 8.44   ? 1063 LEU A  CB  1 
ATOM   7866  C CG  . LEU A  1 1063 ? 181.181 211.393 228.182 1.00 7.92   ? 1063 LEU A  CG  1 
ATOM   7867  C CD1 . LEU A  1 1063 ? 179.834 211.752 228.770 1.00 17.42  ? 1063 LEU A  CD1 1 
ATOM   7868  C CD2 . LEU A  1 1063 ? 181.709 212.527 227.325 1.00 10.80  ? 1063 LEU A  CD2 1 
ATOM   7869  N N   . HIS A  1 1064 ? 185.680 210.500 230.057 1.00 5.77   ? 1064 HIS A  N   1 
ATOM   7870  C CA  . HIS A  1 1064 ? 186.598 210.070 231.100 1.00 6.80   ? 1064 HIS A  CA  1 
ATOM   7871  C C   . HIS A  1 1064 ? 186.500 211.003 232.297 1.00 7.70   ? 1064 HIS A  C   1 
ATOM   7872  O O   . HIS A  1 1064 ? 186.638 212.219 232.151 1.00 14.75  ? 1064 HIS A  O   1 
ATOM   7873  C CB  . HIS A  1 1064 ? 188.035 210.056 230.585 1.00 7.17   ? 1064 HIS A  CB  1 
ATOM   7874  C CG  . HIS A  1 1064 ? 188.251 209.167 229.402 1.00 8.53   ? 1064 HIS A  CG  1 
ATOM   7875  N ND1 . HIS A  1 1064 ? 187.931 207.829 229.405 1.00 5.77   ? 1064 HIS A  ND1 1 
ATOM   7876  C CD2 . HIS A  1 1064 ? 188.780 209.423 228.183 1.00 7.52   ? 1064 HIS A  CD2 1 
ATOM   7877  C CE1 . HIS A  1 1064 ? 188.241 207.301 228.235 1.00 6.20   ? 1064 HIS A  CE1 1 
ATOM   7878  N NE2 . HIS A  1 1064 ? 188.757 208.248 227.475 1.00 5.77   ? 1064 HIS A  NE2 1 
ATOM   7879  N N   . VAL A  1 1065 ? 186.290 210.430 233.479 1.00 8.72   ? 1065 VAL A  N   1 
ATOM   7880  C CA  . VAL A  1 1065 ? 186.267 211.182 234.728 1.00 11.74  ? 1065 VAL A  CA  1 
ATOM   7881  C C   . VAL A  1 1065 ? 187.595 210.956 235.430 1.00 17.71  ? 1065 VAL A  C   1 
ATOM   7882  O O   . VAL A  1 1065 ? 187.987 209.808 235.675 1.00 18.81  ? 1065 VAL A  O   1 
ATOM   7883  C CB  . VAL A  1 1065 ? 185.090 210.751 235.619 1.00 8.11   ? 1065 VAL A  CB  1 
ATOM   7884  C CG1 . VAL A  1 1065 ? 184.966 211.675 236.813 1.00 10.72  ? 1065 VAL A  CG1 1 
ATOM   7885  C CG2 . VAL A  1 1065 ? 183.802 210.733 234.821 1.00 12.42  ? 1065 VAL A  CG2 1 
ATOM   7886  N N   . THR A  1 1066 ? 188.293 212.043 235.751 1.00 18.52  ? 1066 THR A  N   1 
ATOM   7887  C CA  . THR A  1 1066 ? 189.629 211.967 236.318 1.00 16.58  ? 1066 THR A  CA  1 
ATOM   7888  C C   . THR A  1 1066 ? 189.747 212.889 237.521 1.00 22.62  ? 1066 THR A  C   1 
ATOM   7889  O O   . THR A  1 1066 ? 189.220 214.004 237.518 1.00 24.39  ? 1066 THR A  O   1 
ATOM   7890  C CB  . THR A  1 1066 ? 190.688 212.342 235.278 1.00 15.40  ? 1066 THR A  CB  1 
ATOM   7891  O OG1 . THR A  1 1066 ? 190.454 213.675 234.814 1.00 21.44  ? 1066 THR A  OG1 1 
ATOM   7892  C CG2 . THR A  1 1066 ? 190.633 211.391 234.105 1.00 17.03  ? 1066 THR A  CG2 1 
ATOM   7893  N N   . TYR A  1 1067 ? 190.448 212.413 238.544 1.00 19.43  ? 1067 TYR A  N   1 
ATOM   7894  C CA  . TYR A  1 1067 ? 190.750 213.214 239.724 1.00 17.66  ? 1067 TYR A  CA  1 
ATOM   7895  C C   . TYR A  1 1067 ? 192.057 213.959 239.489 1.00 15.52  ? 1067 TYR A  C   1 
ATOM   7896  O O   . TYR A  1 1067 ? 193.101 213.333 239.281 1.00 32.33  ? 1067 TYR A  O   1 
ATOM   7897  C CB  . TYR A  1 1067 ? 190.836 212.307 240.950 1.00 21.29  ? 1067 TYR A  CB  1 
ATOM   7898  C CG  . TYR A  1 1067 ? 191.432 212.936 242.189 1.00 20.43  ? 1067 TYR A  CG  1 
ATOM   7899  C CD1 . TYR A  1 1067 ? 192.799 213.118 242.308 1.00 26.04  ? 1067 TYR A  CD1 1 
ATOM   7900  C CD2 . TYR A  1 1067 ? 190.632 213.315 243.253 1.00 12.50  ? 1067 TYR A  CD2 1 
ATOM   7901  C CE1 . TYR A  1 1067 ? 193.348 213.681 243.431 1.00 18.87  ? 1067 TYR A  CE1 1 
ATOM   7902  C CE2 . TYR A  1 1067 ? 191.177 213.873 244.383 1.00 13.30  ? 1067 TYR A  CE2 1 
ATOM   7903  C CZ  . TYR A  1 1067 ? 192.535 214.056 244.466 1.00 10.20  ? 1067 TYR A  CZ  1 
ATOM   7904  O OH  . TYR A  1 1067 ? 193.086 214.616 245.593 1.00 15.46  ? 1067 TYR A  OH  1 
ATOM   7905  N N   . VAL A  1 1068 ? 192.005 215.285 239.530 1.00 14.61  ? 1068 VAL A  N   1 
ATOM   7906  C CA  . VAL A  1 1068 ? 193.142 216.138 239.212 1.00 16.63  ? 1068 VAL A  CA  1 
ATOM   7907  C C   . VAL A  1 1068 ? 193.530 216.922 240.461 1.00 22.58  ? 1068 VAL A  C   1 
ATOM   7908  O O   . VAL A  1 1068 ? 192.711 217.675 240.992 1.00 27.77  ? 1068 VAL A  O   1 
ATOM   7909  C CB  . VAL A  1 1068 ? 192.826 217.095 238.050 1.00 15.38  ? 1068 VAL A  CB  1 
ATOM   7910  C CG1 . VAL A  1 1068 ? 193.979 218.048 237.818 1.00 23.57  ? 1068 VAL A  CG1 1 
ATOM   7911  C CG2 . VAL A  1 1068 ? 192.524 216.309 236.792 1.00 14.14  ? 1068 VAL A  CG2 1 
ATOM   7912  N N   . PRO A  1 1069 ? 194.756 216.775 240.980 1.00 25.41  ? 1069 PRO A  N   1 
ATOM   7913  C CA  . PRO A  1 1069 ? 195.210 217.652 242.069 1.00 17.93  ? 1069 PRO A  CA  1 
ATOM   7914  C C   . PRO A  1 1069 ? 195.116 219.128 241.716 1.00 30.84  ? 1069 PRO A  C   1 
ATOM   7915  O O   . PRO A  1 1069 ? 195.521 219.527 240.620 1.00 44.80  ? 1069 PRO A  O   1 
ATOM   7916  C CB  . PRO A  1 1069 ? 196.661 217.215 242.276 1.00 25.88  ? 1069 PRO A  CB  1 
ATOM   7917  C CG  . PRO A  1 1069 ? 196.676 215.800 241.868 1.00 28.80  ? 1069 PRO A  CG  1 
ATOM   7918  C CD  . PRO A  1 1069 ? 195.723 215.695 240.719 1.00 27.10  ? 1069 PRO A  CD  1 
ATOM   7919  N N   . ALA A  1 1070 ? 194.596 219.949 242.627 1.00 34.33  ? 1070 ALA A  N   1 
ATOM   7920  C CA  . ALA A  1 1070 ? 194.215 221.320 242.305 1.00 31.27  ? 1070 ALA A  CA  1 
ATOM   7921  C C   . ALA A  1 1070 ? 195.076 222.391 242.954 1.00 37.71  ? 1070 ALA A  C   1 
ATOM   7922  O O   . ALA A  1 1070 ? 195.595 223.259 242.249 1.00 52.55  ? 1070 ALA A  O   1 
ATOM   7923  C CB  . ALA A  1 1070 ? 192.756 221.559 242.705 1.00 34.14  ? 1070 ALA A  CB  1 
ATOM   7924  N N   . GLN A  1 1071 ? 195.251 222.369 244.276 1.00 28.22  ? 1071 GLN A  N   1 
ATOM   7925  C CA  . GLN A  1 1071 ? 195.860 223.486 245.007 1.00 27.83  ? 1071 GLN A  CA  1 
ATOM   7926  C C   . GLN A  1 1071 ? 196.991 222.949 245.881 1.00 35.32  ? 1071 GLN A  C   1 
ATOM   7927  O O   . GLN A  1 1071 ? 196.792 222.647 247.058 1.00 34.03  ? 1071 GLN A  O   1 
ATOM   7928  C CB  . GLN A  1 1071 ? 194.801 224.212 245.830 1.00 33.82  ? 1071 GLN A  CB  1 
ATOM   7929  C CG  . GLN A  1 1071 ? 193.823 225.014 244.994 1.00 37.84  ? 1071 GLN A  CG  1 
ATOM   7930  C CD  . GLN A  1 1071 ? 192.546 225.331 245.736 1.00 43.33  ? 1071 GLN A  CD  1 
ATOM   7931  O OE1 . GLN A  1 1071 ? 191.581 224.572 245.684 1.00 41.06  ? 1071 GLN A  OE1 1 
ATOM   7932  N NE2 . GLN A  1 1071 ? 192.530 226.457 246.434 1.00 64.97  ? 1071 GLN A  NE2 1 
ATOM   7933  N N   . GLU A  1 1072 ? 198.183 222.850 245.301 1.00 37.64  ? 1072 GLU A  N   1 
ATOM   7934  C CA  . GLU A  1 1072 ? 199.328 222.323 246.029 1.00 32.34  ? 1072 GLU A  CA  1 
ATOM   7935  C C   . GLU A  1 1072 ? 199.972 223.397 246.895 1.00 28.59  ? 1072 GLU A  C   1 
ATOM   7936  O O   . GLU A  1 1072 ? 199.991 224.578 246.541 1.00 45.98  ? 1072 GLU A  O   1 
ATOM   7937  C CB  . GLU A  1 1072 ? 200.358 221.741 245.061 1.00 31.25  ? 1072 GLU A  CB  1 
ATOM   7938  C CG  . GLU A  1 1072 ? 201.037 222.748 244.147 1.00 38.93  ? 1072 GLU A  CG  1 
ATOM   7939  C CD  . GLU A  1 1072 ? 200.325 222.908 242.822 1.00 48.75  ? 1072 GLU A  CD  1 
ATOM   7940  O OE1 . GLU A  1 1072 ? 199.115 222.606 242.753 1.00 49.55  ? 1072 GLU A  OE1 1 
ATOM   7941  O OE2 . GLU A  1 1072 ? 200.981 223.328 241.845 1.00 54.34  ? 1072 GLU A  OE2 1 
ATOM   7942  N N   . LYS A  1 1073 ? 200.502 222.974 248.040 1.00 24.28  ? 1073 LYS A  N   1 
ATOM   7943  C CA  . LYS A  1 1073 ? 201.265 223.832 248.931 1.00 27.52  ? 1073 LYS A  CA  1 
ATOM   7944  C C   . LYS A  1 1073 ? 202.676 223.289 249.097 1.00 26.76  ? 1073 LYS A  C   1 
ATOM   7945  O O   . LYS A  1 1073 ? 202.897 222.077 249.065 1.00 30.39  ? 1073 LYS A  O   1 
ATOM   7946  C CB  . LYS A  1 1073 ? 200.613 223.929 250.308 1.00 31.70  ? 1073 LYS A  CB  1 
ATOM   7947  C CG  . LYS A  1 1073 ? 199.598 225.046 250.459 1.00 39.88  ? 1073 LYS A  CG  1 
ATOM   7948  C CD  . LYS A  1 1073 ? 198.942 225.011 251.836 1.00 33.98  ? 1073 LYS A  CD  1 
ATOM   7949  C CE  . LYS A  1 1073 ? 199.951 225.223 252.963 1.00 54.50  ? 1073 LYS A  CE  1 
ATOM   7950  N NZ  . LYS A  1 1073 ? 199.328 225.088 254.304 1.00 72.67  ? 1073 LYS A  NZ  1 
ATOM   7951  N N   . ASN A  1 1074 ? 203.627 224.199 249.284 1.00 28.44  ? 1074 ASN A  N   1 
ATOM   7952  C CA  . ASN A  1 1074 ? 204.987 223.807 249.624 1.00 22.18  ? 1074 ASN A  CA  1 
ATOM   7953  C C   . ASN A  1 1074 ? 205.039 223.252 251.042 1.00 30.15  ? 1074 ASN A  C   1 
ATOM   7954  O O   . ASN A  1 1074 ? 204.394 223.776 251.953 1.00 40.05  ? 1074 ASN A  O   1 
ATOM   7955  C CB  . ASN A  1 1074 ? 205.934 225.004 249.525 1.00 25.85  ? 1074 ASN A  CB  1 
ATOM   7956  C CG  . ASN A  1 1074 ? 206.479 225.225 248.127 1.00 38.52  ? 1074 ASN A  CG  1 
ATOM   7957  O OD1 . ASN A  1 1074 ? 206.294 224.404 247.232 1.00 35.46  ? 1074 ASN A  OD1 1 
ATOM   7958  N ND2 . ASN A  1 1074 ? 207.174 226.349 247.943 1.00 72.42  ? 1074 ASN A  ND2 1 
ATOM   7959  N N   . PHE A  1 1075 ? 205.812 222.186 251.229 1.00 23.51  ? 1075 PHE A  N   1 
ATOM   7960  C CA  . PHE A  1 1075 ? 206.132 221.696 252.562 1.00 18.94  ? 1075 PHE A  CA  1 
ATOM   7961  C C   . PHE A  1 1075 ? 207.578 221.235 252.593 1.00 24.55  ? 1075 PHE A  C   1 
ATOM   7962  O O   . PHE A  1 1075 ? 208.130 220.805 251.578 1.00 35.98  ? 1075 PHE A  O   1 
ATOM   7963  C CB  . PHE A  1 1075 ? 205.231 220.531 252.993 1.00 21.28  ? 1075 PHE A  CB  1 
ATOM   7964  C CG  . PHE A  1 1075 ? 203.769 220.827 252.902 1.00 20.34  ? 1075 PHE A  CG  1 
ATOM   7965  C CD1 . PHE A  1 1075 ? 203.145 221.606 253.853 1.00 22.31  ? 1075 PHE A  CD1 1 
ATOM   7966  C CD2 . PHE A  1 1075 ? 203.015 220.315 251.867 1.00 27.74  ? 1075 PHE A  CD2 1 
ATOM   7967  C CE1 . PHE A  1 1075 ? 201.799 221.876 253.765 1.00 29.95  ? 1075 PHE A  CE1 1 
ATOM   7968  C CE2 . PHE A  1 1075 ? 201.672 220.582 251.776 1.00 35.85  ? 1075 PHE A  CE2 1 
ATOM   7969  C CZ  . PHE A  1 1075 ? 201.062 221.362 252.726 1.00 33.37  ? 1075 PHE A  CZ  1 
ATOM   7970  N N   . THR A  1 1076 ? 208.191 221.346 253.765 1.00 28.80  ? 1076 THR A  N   1 
ATOM   7971  C CA  . THR A  1 1076 ? 209.438 220.651 254.028 1.00 21.95  ? 1076 THR A  CA  1 
ATOM   7972  C C   . THR A  1 1076 ? 209.132 219.190 254.315 1.00 21.58  ? 1076 THR A  C   1 
ATOM   7973  O O   . THR A  1 1076 ? 208.091 218.858 254.885 1.00 29.96  ? 1076 THR A  O   1 
ATOM   7974  C CB  . THR A  1 1076 ? 210.176 221.278 255.210 1.00 40.01  ? 1076 THR A  CB  1 
ATOM   7975  O OG1 . THR A  1 1076 ? 210.464 222.651 254.923 1.00 44.55  ? 1076 THR A  OG1 1 
ATOM   7976  C CG2 . THR A  1 1076 ? 211.477 220.544 255.488 1.00 33.99  ? 1076 THR A  CG2 1 
ATOM   7977  N N   . THR A  1 1077 ? 210.045 218.313 253.911 1.00 21.15  ? 1077 THR A  N   1 
ATOM   7978  C CA  . THR A  1 1077 ? 209.821 216.881 254.031 1.00 23.89  ? 1077 THR A  CA  1 
ATOM   7979  C C   . THR A  1 1077 ? 211.110 216.196 254.453 1.00 27.17  ? 1077 THR A  C   1 
ATOM   7980  O O   . THR A  1 1077 ? 212.202 216.759 254.357 1.00 31.18  ? 1077 THR A  O   1 
ATOM   7981  C CB  . THR A  1 1077 ? 209.307 216.282 252.715 1.00 22.37  ? 1077 THR A  CB  1 
ATOM   7982  O OG1 . THR A  1 1077 ? 208.959 214.908 252.914 1.00 24.22  ? 1077 THR A  OG1 1 
ATOM   7983  C CG2 . THR A  1 1077 ? 210.361 216.378 251.630 1.00 39.18  ? 1077 THR A  CG2 1 
ATOM   7984  N N   . ALA A  1 1078 ? 210.966 214.967 254.933 1.00 31.80  ? 1078 ALA A  N   1 
ATOM   7985  C CA  . ALA A  1 1078 ? 212.087 214.142 255.347 1.00 24.83  ? 1078 ALA A  CA  1 
ATOM   7986  C C   . ALA A  1 1078 ? 211.810 212.698 254.969 1.00 24.23  ? 1078 ALA A  C   1 
ATOM   7987  O O   . ALA A  1 1078 ? 210.648 212.277 254.929 1.00 24.99  ? 1078 ALA A  O   1 
ATOM   7988  C CB  . ALA A  1 1078 ? 212.331 214.233 256.859 1.00 28.13  ? 1078 ALA A  CB  1 
ATOM   7989  N N   . PRO A  1 1079 ? 212.854 211.913 254.686 1.00 16.87  ? 1079 PRO A  N   1 
ATOM   7990  C CA  . PRO A  1 1079 ? 212.633 210.496 254.372 1.00 22.77  ? 1079 PRO A  CA  1 
ATOM   7991  C C   . PRO A  1 1079 ? 212.386 209.625 255.587 1.00 21.35  ? 1079 PRO A  C   1 
ATOM   7992  O O   . PRO A  1 1079 ? 211.760 208.567 255.443 1.00 24.79  ? 1079 PRO A  O   1 
ATOM   7993  C CB  . PRO A  1 1079 ? 213.928 210.093 253.660 1.00 19.16  ? 1079 PRO A  CB  1 
ATOM   7994  C CG  . PRO A  1 1079 ? 214.950 210.992 254.224 1.00 19.50  ? 1079 PRO A  CG  1 
ATOM   7995  C CD  . PRO A  1 1079 ? 214.265 212.296 254.517 1.00 18.58  ? 1079 PRO A  CD  1 
ATOM   7996  N N   . ALA A  1 1080 ? 212.843 210.024 256.769 1.00 21.12  ? 1080 ALA A  N   1 
ATOM   7997  C CA  . ALA A  1 1080 ? 212.670 209.212 257.963 1.00 18.70  ? 1080 ALA A  CA  1 
ATOM   7998  C C   . ALA A  1 1080 ? 212.721 210.121 259.179 1.00 20.12  ? 1080 ALA A  C   1 
ATOM   7999  O O   . ALA A  1 1080 ? 213.139 211.277 259.094 1.00 25.26  ? 1080 ALA A  O   1 
ATOM   8000  C CB  . ALA A  1 1080 ? 213.739 208.122 258.055 1.00 23.92  ? 1080 ALA A  CB  1 
ATOM   8001  N N   . ILE A  1 1081 ? 212.285 209.580 260.314 1.00 22.29  ? 1081 ILE A  N   1 
ATOM   8002  C CA  . ILE A  1 1081 ? 212.244 210.307 261.575 1.00 22.07  ? 1081 ILE A  CA  1 
ATOM   8003  C C   . ILE A  1 1081 ? 212.881 209.447 262.656 1.00 31.20  ? 1081 ILE A  C   1 
ATOM   8004  O O   . ILE A  1 1081 ? 212.748 208.219 262.640 1.00 33.17  ? 1081 ILE A  O   1 
ATOM   8005  C CB  . ILE A  1 1081 ? 210.801 210.691 261.959 1.00 19.62  ? 1081 ILE A  CB  1 
ATOM   8006  C CG1 . ILE A  1 1081 ? 210.163 211.535 260.853 1.00 26.37  ? 1081 ILE A  CG1 1 
ATOM   8007  C CG2 . ILE A  1 1081 ? 210.786 211.452 263.261 1.00 28.21  ? 1081 ILE A  CG2 1 
ATOM   8008  C CD1 . ILE A  1 1081 ? 210.819 212.880 260.644 1.00 25.90  ? 1081 ILE A  CD1 1 
ATOM   8009  N N   . CYS A  1 1082 ? 213.581 210.091 263.589 1.00 36.19  ? 1082 CYS A  N   1 
ATOM   8010  C CA  . CYS A  1 1082 ? 214.293 209.408 264.668 1.00 34.22  ? 1082 CYS A  CA  1 
ATOM   8011  C C   . CYS A  1 1082 ? 213.638 209.750 265.999 1.00 40.40  ? 1082 CYS A  C   1 
ATOM   8012  O O   . CYS A  1 1082 ? 213.865 210.827 266.557 1.00 54.98  ? 1082 CYS A  O   1 
ATOM   8013  C CB  . CYS A  1 1082 ? 215.768 209.789 264.662 1.00 30.99  ? 1082 CYS A  CB  1 
ATOM   8014  S SG  . CYS A  1 1082 ? 216.676 208.784 263.508 1.00 49.54  ? 1082 CYS A  SG  1 
ATOM   8015  N N   . HIS A  1 1083 ? 212.825 208.827 266.506 1.00 42.40  ? 1083 HIS A  N   1 
ATOM   8016  C CA  . HIS A  1 1083 ? 212.170 209.036 267.789 1.00 44.81  ? 1083 HIS A  CA  1 
ATOM   8017  C C   . HIS A  1 1083 ? 213.073 208.657 268.954 1.00 54.00  ? 1083 HIS A  C   1 
ATOM   8018  O O   . HIS A  1 1083 ? 213.469 209.516 269.750 1.00 70.09  ? 1083 HIS A  O   1 
ATOM   8019  C CB  . HIS A  1 1083 ? 210.884 208.216 267.858 1.00 44.43  ? 1083 HIS A  CB  1 
ATOM   8020  C CG  . HIS A  1 1083 ? 210.138 208.375 269.143 1.00 50.44  ? 1083 HIS A  CG  1 
ATOM   8021  N ND1 . HIS A  1 1083 ? 210.154 209.544 269.871 1.00 53.89  ? 1083 HIS A  ND1 1 
ATOM   8022  C CD2 . HIS A  1 1083 ? 209.350 207.514 269.828 1.00 56.74  ? 1083 HIS A  CD2 1 
ATOM   8023  C CE1 . HIS A  1 1083 ? 209.409 209.396 270.952 1.00 59.99  ? 1083 HIS A  CE1 1 
ATOM   8024  N NE2 . HIS A  1 1083 ? 208.909 208.173 270.949 1.00 55.23  ? 1083 HIS A  NE2 1 
ATOM   8025  N N   . ASP A  1 1084 ? 213.409 207.373 269.053 1.00 48.20  ? 1084 ASP A  N   1 
ATOM   8026  C CA  . ASP A  1 1084 ? 214.113 206.853 270.217 1.00 52.80  ? 1084 ASP A  CA  1 
ATOM   8027  C C   . ASP A  1 1084 ? 215.425 206.194 269.819 1.00 50.92  ? 1084 ASP A  C   1 
ATOM   8028  O O   . ASP A  1 1084 ? 215.767 205.128 270.341 1.00 52.19  ? 1084 ASP A  O   1 
ATOM   8029  C CB  . ASP A  1 1084 ? 213.229 205.858 270.966 1.00 53.29  ? 1084 ASP A  CB  1 
ATOM   8030  C CG  . ASP A  1 1084 ? 213.592 205.748 272.432 1.00 77.18  ? 1084 ASP A  CG  1 
ATOM   8031  O OD1 . ASP A  1 1084 ? 214.775 205.965 272.770 1.00 82.85  ? 1084 ASP A  OD1 1 
ATOM   8032  O OD2 . ASP A  1 1084 ? 212.694 205.450 273.247 1.00 71.25  ? 1084 ASP A  OD2 1 
ATOM   8033  N N   . GLY A  1 1085 ? 216.165 206.807 268.903 1.00 43.34  ? 1085 GLY A  N   1 
ATOM   8034  C CA  . GLY A  1 1085 ? 217.327 206.147 268.350 1.00 43.48  ? 1085 GLY A  CA  1 
ATOM   8035  C C   . GLY A  1 1085 ? 217.007 205.121 267.290 1.00 50.50  ? 1085 GLY A  C   1 
ATOM   8036  O O   . GLY A  1 1085 ? 217.830 204.239 267.026 1.00 51.85  ? 1085 GLY A  O   1 
ATOM   8037  N N   . LYS A  1 1086 ? 215.831 205.203 266.680 1.00 46.90  ? 1086 LYS A  N   1 
ATOM   8038  C CA  . LYS A  1 1086 ? 215.426 204.324 265.593 1.00 37.40  ? 1086 LYS A  CA  1 
ATOM   8039  C C   . LYS A  1 1086 ? 215.093 205.179 264.372 1.00 35.17  ? 1086 LYS A  C   1 
ATOM   8040  O O   . LYS A  1 1086 ? 215.255 206.400 264.384 1.00 46.18  ? 1086 LYS A  O   1 
ATOM   8041  C CB  . LYS A  1 1086 ? 214.243 203.453 266.022 1.00 37.07  ? 1086 LYS A  CB  1 
ATOM   8042  C CG  . LYS A  1 1086 ? 214.561 202.531 267.187 1.00 37.80  ? 1086 LYS A  CG  1 
ATOM   8043  C CD  . LYS A  1 1086 ? 213.379 202.363 268.128 1.00 47.42  ? 1086 LYS A  CD  1 
ATOM   8044  C CE  . LYS A  1 1086 ? 212.284 201.513 267.516 1.00 51.57  ? 1086 LYS A  CE  1 
ATOM   8045  N NZ  . LYS A  1 1086 ? 211.226 201.178 268.506 1.00 41.43  ? 1086 LYS A  NZ  1 
ATOM   8046  N N   . ALA A  1 1087 ? 214.623 204.527 263.314 1.00 29.67  ? 1087 ALA A  N   1 
ATOM   8047  C CA  . ALA A  1 1087 ? 214.232 205.200 262.083 1.00 19.03  ? 1087 ALA A  CA  1 
ATOM   8048  C C   . ALA A  1 1087 ? 212.823 204.769 261.719 1.00 21.25  ? 1087 ALA A  C   1 
ATOM   8049  O O   . ALA A  1 1087 ? 212.555 203.573 261.572 1.00 23.02  ? 1087 ALA A  O   1 
ATOM   8050  C CB  . ALA A  1 1087 ? 215.196 204.873 260.943 1.00 22.49  ? 1087 ALA A  CB  1 
ATOM   8051  N N   . HIS A  1 1088 ? 211.931 205.740 261.571 1.00 23.17  ? 1088 HIS A  N   1 
ATOM   8052  C CA  . HIS A  1 1088 ? 210.525 205.488 261.298 1.00 17.48  ? 1088 HIS A  CA  1 
ATOM   8053  C C   . HIS A  1 1088 ? 210.183 205.919 259.880 1.00 24.43  ? 1088 HIS A  C   1 
ATOM   8054  O O   . HIS A  1 1088 ? 210.562 207.010 259.444 1.00 25.79  ? 1088 HIS A  O   1 
ATOM   8055  C CB  . HIS A  1 1088 ? 209.630 206.231 262.290 1.00 23.87  ? 1088 HIS A  CB  1 
ATOM   8056  C CG  . HIS A  1 1088 ? 209.743 205.731 263.696 1.00 34.30  ? 1088 HIS A  CG  1 
ATOM   8057  N ND1 . HIS A  1 1088 ? 210.884 205.880 264.453 1.00 36.52  ? 1088 HIS A  ND1 1 
ATOM   8058  C CD2 . HIS A  1 1088 ? 208.853 205.081 264.482 1.00 45.99  ? 1088 HIS A  CD2 1 
ATOM   8059  C CE1 . HIS A  1 1088 ? 210.693 205.344 265.644 1.00 36.78  ? 1088 HIS A  CE1 1 
ATOM   8060  N NE2 . HIS A  1 1088 ? 209.468 204.851 265.687 1.00 45.91  ? 1088 HIS A  NE2 1 
ATOM   8061  N N   . PHE A  1 1089 ? 209.450 205.068 259.175 1.00 21.80  ? 1089 PHE A  N   1 
ATOM   8062  C CA  . PHE A  1 1089 ? 209.003 205.348 257.823 1.00 15.87  ? 1089 PHE A  CA  1 
ATOM   8063  C C   . PHE A  1 1089 ? 207.490 205.232 257.759 1.00 17.74  ? 1089 PHE A  C   1 
ATOM   8064  O O   . PHE A  1 1089 ? 206.903 204.404 258.459 1.00 32.20  ? 1089 PHE A  O   1 
ATOM   8065  C CB  . PHE A  1 1089 ? 209.625 204.372 256.816 1.00 9.93   ? 1089 PHE A  CB  1 
ATOM   8066  C CG  . PHE A  1 1089 ? 211.112 204.258 256.922 1.00 14.42  ? 1089 PHE A  CG  1 
ATOM   8067  C CD1 . PHE A  1 1089 ? 211.936 205.082 256.185 1.00 9.23   ? 1089 PHE A  CD1 1 
ATOM   8068  C CD2 . PHE A  1 1089 ? 211.685 203.322 257.754 1.00 20.34  ? 1089 PHE A  CD2 1 
ATOM   8069  C CE1 . PHE A  1 1089 ? 213.302 204.976 256.281 1.00 12.48  ? 1089 PHE A  CE1 1 
ATOM   8070  C CE2 . PHE A  1 1089 ? 213.050 203.213 257.852 1.00 28.11  ? 1089 PHE A  CE2 1 
ATOM   8071  C CZ  . PHE A  1 1089 ? 213.859 204.041 257.115 1.00 19.21  ? 1089 PHE A  CZ  1 
ATOM   8072  N N   . PRO A  1 1090 ? 206.829 206.045 256.937 1.00 17.62  ? 1090 PRO A  N   1 
ATOM   8073  C CA  . PRO A  1 1090 ? 205.372 205.947 256.840 1.00 20.61  ? 1090 PRO A  CA  1 
ATOM   8074  C C   . PRO A  1 1090 ? 204.948 204.580 256.333 1.00 25.11  ? 1090 PRO A  C   1 
ATOM   8075  O O   . PRO A  1 1090 ? 205.617 203.971 255.496 1.00 24.31  ? 1090 PRO A  O   1 
ATOM   8076  C CB  . PRO A  1 1090 ? 205.003 207.047 255.839 1.00 20.00  ? 1090 PRO A  CB  1 
ATOM   8077  C CG  . PRO A  1 1090 ? 206.186 207.921 255.759 1.00 20.84  ? 1090 PRO A  CG  1 
ATOM   8078  C CD  . PRO A  1 1090 ? 207.362 207.056 256.011 1.00 15.60  ? 1090 PRO A  CD  1 
ATOM   8079  N N   . ARG A  1 1091 ? 203.819 204.094 256.847 1.00 22.04  ? 1091 ARG A  N   1 
ATOM   8080  C CA  . ARG A  1 1091 ? 203.194 202.934 256.225 1.00 22.81  ? 1091 ARG A  CA  1 
ATOM   8081  C C   . ARG A  1 1091 ? 202.568 203.332 254.896 1.00 31.83  ? 1091 ARG A  C   1 
ATOM   8082  O O   . ARG A  1 1091 ? 202.903 202.775 253.844 1.00 48.38  ? 1091 ARG A  O   1 
ATOM   8083  C CB  . ARG A  1 1091 ? 202.148 202.323 257.159 1.00 29.47  ? 1091 ARG A  CB  1 
ATOM   8084  C CG  . ARG A  1 1091 ? 202.712 201.739 258.447 1.00 20.12  ? 1091 ARG A  CG  1 
ATOM   8085  C CD  . ARG A  1 1091 ? 201.623 201.075 259.276 1.00 17.03  ? 1091 ARG A  CD  1 
ATOM   8086  N NE  . ARG A  1 1091 ? 202.044 200.847 260.657 1.00 30.31  ? 1091 ARG A  NE  1 
ATOM   8087  C CZ  . ARG A  1 1091 ? 202.665 199.753 261.089 1.00 30.40  ? 1091 ARG A  CZ  1 
ATOM   8088  N NH1 . ARG A  1 1091 ? 202.950 198.762 260.252 1.00 28.16  ? 1091 ARG A  NH1 1 
ATOM   8089  N NH2 . ARG A  1 1091 ? 203.006 199.647 262.368 1.00 30.06  ? 1091 ARG A  NH2 1 
ATOM   8090  N N   . GLU A  1 1092 ? 201.667 204.308 254.926 1.00 22.85  ? 1092 GLU A  N   1 
ATOM   8091  C CA  . GLU A  1 1092 ? 201.195 204.995 253.737 1.00 30.75  ? 1092 GLU A  CA  1 
ATOM   8092  C C   . GLU A  1 1092 ? 201.383 206.487 253.951 1.00 30.35  ? 1092 GLU A  C   1 
ATOM   8093  O O   . GLU A  1 1092 ? 201.140 207.006 255.043 1.00 32.95  ? 1092 GLU A  O   1 
ATOM   8094  C CB  . GLU A  1 1092 ? 199.713 204.698 253.443 1.00 37.94  ? 1092 GLU A  CB  1 
ATOM   8095  C CG  . GLU A  1 1092 ? 199.396 203.235 253.180 1.00 40.21  ? 1092 GLU A  CG  1 
ATOM   8096  C CD  . GLU A  1 1092 ? 199.779 202.788 251.781 1.00 49.27  ? 1092 GLU A  CD  1 
ATOM   8097  O OE1 . GLU A  1 1092 ? 199.784 201.564 251.529 1.00 67.26  ? 1092 GLU A  OE1 1 
ATOM   8098  O OE2 . GLU A  1 1092 ? 200.074 203.658 250.935 1.00 44.49  ? 1092 GLU A  OE2 1 
ATOM   8099  N N   . GLY A  1 1093 ? 201.825 207.172 252.909 1.00 27.59  ? 1093 GLY A  N   1 
ATOM   8100  C CA  . GLY A  1 1093 ? 201.959 208.610 252.964 1.00 23.96  ? 1093 GLY A  CA  1 
ATOM   8101  C C   . GLY A  1 1093 ? 203.400 209.063 253.060 1.00 25.87  ? 1093 GLY A  C   1 
ATOM   8102  O O   . GLY A  1 1093 ? 204.350 208.316 252.816 1.00 28.46  ? 1093 GLY A  O   1 
ATOM   8103  N N   . VAL A  1 1094 ? 203.550 210.332 253.435 1.00 22.40  ? 1094 VAL A  N   1 
ATOM   8104  C CA  . VAL A  1 1094 ? 204.846 210.996 253.429 1.00 19.45  ? 1094 VAL A  CA  1 
ATOM   8105  C C   . VAL A  1 1094 ? 204.903 211.969 254.596 1.00 26.99  ? 1094 VAL A  C   1 
ATOM   8106  O O   . VAL A  1 1094 ? 203.880 212.497 255.039 1.00 38.56  ? 1094 VAL A  O   1 
ATOM   8107  C CB  . VAL A  1 1094 ? 205.088 211.716 252.082 1.00 23.52  ? 1094 VAL A  CB  1 
ATOM   8108  C CG1 . VAL A  1 1094 ? 204.033 212.783 251.854 1.00 21.02  ? 1094 VAL A  CG1 1 
ATOM   8109  C CG2 . VAL A  1 1094 ? 206.477 212.312 252.031 1.00 26.52  ? 1094 VAL A  CG2 1 
ATOM   8110  N N   . PHE A  1 1095 ? 206.112 212.196 255.103 1.00 25.98  ? 1095 PHE A  N   1 
ATOM   8111  C CA  . PHE A  1 1095 ? 206.323 213.162 256.170 1.00 19.46  ? 1095 PHE A  CA  1 
ATOM   8112  C C   . PHE A  1 1095 ? 206.346 214.576 255.607 1.00 18.94  ? 1095 PHE A  C   1 
ATOM   8113  O O   . PHE A  1 1095 ? 206.904 214.824 254.536 1.00 25.07  ? 1095 PHE A  O   1 
ATOM   8114  C CB  . PHE A  1 1095 ? 207.637 212.875 256.895 1.00 20.63  ? 1095 PHE A  CB  1 
ATOM   8115  C CG  . PHE A  1 1095 ? 207.644 211.581 257.657 1.00 20.40  ? 1095 PHE A  CG  1 
ATOM   8116  C CD1 . PHE A  1 1095 ? 206.578 211.228 258.458 1.00 22.65  ? 1095 PHE A  CD1 1 
ATOM   8117  C CD2 . PHE A  1 1095 ? 208.714 210.717 257.569 1.00 20.08  ? 1095 PHE A  CD2 1 
ATOM   8118  C CE1 . PHE A  1 1095 ? 206.581 210.047 259.154 1.00 20.08  ? 1095 PHE A  CE1 1 
ATOM   8119  C CE2 . PHE A  1 1095 ? 208.719 209.534 258.265 1.00 18.65  ? 1095 PHE A  CE2 1 
ATOM   8120  C CZ  . PHE A  1 1095 ? 207.651 209.200 259.059 1.00 23.69  ? 1095 PHE A  CZ  1 
ATOM   8121  N N   . VAL A  1 1096 ? 205.730 215.505 256.335 1.00 18.28  ? 1096 VAL A  N   1 
ATOM   8122  C CA  . VAL A  1 1096 ? 205.733 216.912 255.962 1.00 22.66  ? 1096 VAL A  CA  1 
ATOM   8123  C C   . VAL A  1 1096 ? 205.784 217.760 257.222 1.00 22.70  ? 1096 VAL A  C   1 
ATOM   8124  O O   . VAL A  1 1096 ? 205.199 217.414 258.251 1.00 31.95  ? 1096 VAL A  O   1 
ATOM   8125  C CB  . VAL A  1 1096 ? 204.505 217.297 255.110 1.00 23.37  ? 1096 VAL A  CB  1 
ATOM   8126  C CG1 . VAL A  1 1096 ? 204.634 216.737 253.712 1.00 30.66  ? 1096 VAL A  CG1 1 
ATOM   8127  C CG2 . VAL A  1 1096 ? 203.225 216.813 255.764 1.00 20.13  ? 1096 VAL A  CG2 1 
ATOM   8128  N N   . SER A  1 1097 ? 206.501 218.874 257.135 1.00 22.02  ? 1097 SER A  N   1 
ATOM   8129  C CA  . SER A  1 1097 ? 206.523 219.882 258.180 1.00 24.66  ? 1097 SER A  CA  1 
ATOM   8130  C C   . SER A  1 1097 ? 205.877 221.160 257.674 1.00 44.11  ? 1097 SER A  C   1 
ATOM   8131  O O   . SER A  1 1097 ? 206.086 221.568 256.528 1.00 48.23  ? 1097 SER A  O   1 
ATOM   8132  C CB  . SER A  1 1097 ? 207.952 220.186 258.631 1.00 27.07  ? 1097 SER A  CB  1 
ATOM   8133  O OG  . SER A  1 1097 ? 207.957 221.068 259.739 1.00 23.90  ? 1097 SER A  OG  1 
ATOM   8134  N N   . ASN A  1 1098 ? 205.106 221.803 258.545 1.00 41.90  ? 1098 ASN A  N   1 
ATOM   8135  C CA  . ASN A  1 1098 ? 204.531 223.106 258.252 1.00 35.99  ? 1098 ASN A  CA  1 
ATOM   8136  C C   . ASN A  1 1098 ? 205.407 224.239 258.764 1.00 41.90  ? 1098 ASN A  C   1 
ATOM   8137  O O   . ASN A  1 1098 ? 204.940 225.377 258.865 1.00 53.05  ? 1098 ASN A  O   1 
ATOM   8138  C CB  . ASN A  1 1098 ? 203.122 223.209 258.839 1.00 36.56  ? 1098 ASN A  CB  1 
ATOM   8139  C CG  . ASN A  1 1098 ? 203.113 223.241 260.352 1.00 43.74  ? 1098 ASN A  CG  1 
ATOM   8140  O OD1 . ASN A  1 1098 ? 204.089 222.869 261.000 1.00 51.05  ? 1098 ASN A  OD1 1 
ATOM   8141  N ND2 . ASN A  1 1098 ? 201.999 223.686 260.926 1.00 52.23  ? 1098 ASN A  ND2 1 
ATOM   8142  N N   . GLY A  1 1099 ? 206.663 223.946 259.086 1.00 41.12  ? 1099 GLY A  N   1 
ATOM   8143  C CA  . GLY A  1 1099 ? 207.599 224.946 259.552 1.00 43.97  ? 1099 GLY A  CA  1 
ATOM   8144  C C   . GLY A  1 1099 ? 208.052 224.672 260.969 1.00 43.07  ? 1099 GLY A  C   1 
ATOM   8145  O O   . GLY A  1 1099 ? 209.217 224.886 261.312 1.00 45.65  ? 1099 GLY A  O   1 
ATOM   8146  N N   . THR A  1 1100 ? 207.134 224.194 261.799 1.00 40.85  ? 1100 THR A  N   1 
ATOM   8147  C CA  . THR A  1 1100 ? 207.398 223.932 263.207 1.00 46.05  ? 1100 THR A  CA  1 
ATOM   8148  C C   . THR A  1 1100 ? 207.086 222.505 263.621 1.00 45.22  ? 1100 THR A  C   1 
ATOM   8149  O O   . THR A  1 1100 ? 207.810 221.935 264.442 1.00 44.56  ? 1100 THR A  O   1 
ATOM   8150  C CB  . THR A  1 1100 ? 206.583 224.898 264.075 1.00 55.34  ? 1100 THR A  CB  1 
ATOM   8151  O OG1 . THR A  1 1100 ? 205.202 224.827 263.700 1.00 55.78  ? 1100 THR A  OG1 1 
ATOM   8152  C CG2 . THR A  1 1100 ? 207.078 226.325 263.900 1.00 51.86  ? 1100 THR A  CG2 1 
ATOM   8153  N N   . HIS A  1 1101 ? 206.033 221.908 263.071 1.00 45.49  ? 1101 HIS A  N   1 
ATOM   8154  C CA  . HIS A  1 1101 ? 205.559 220.597 263.487 1.00 44.38  ? 1101 HIS A  CA  1 
ATOM   8155  C C   . HIS A  1 1101 ? 205.602 219.628 262.315 1.00 38.59  ? 1101 HIS A  C   1 
ATOM   8156  O O   . HIS A  1 1101 ? 205.405 220.017 261.161 1.00 42.77  ? 1101 HIS A  O   1 
ATOM   8157  C CB  . HIS A  1 1101 ? 204.134 220.676 264.040 1.00 49.04  ? 1101 HIS A  CB  1 
ATOM   8158  C CG  . HIS A  1 1101 ? 204.028 221.440 265.321 1.00 52.18  ? 1101 HIS A  CG  1 
ATOM   8159  N ND1 . HIS A  1 1101 ? 204.025 222.817 265.369 1.00 51.67  ? 1101 HIS A  ND1 1 
ATOM   8160  C CD2 . HIS A  1 1101 ? 203.932 221.019 266.603 1.00 58.85  ? 1101 HIS A  CD2 1 
ATOM   8161  C CE1 . HIS A  1 1101 ? 203.927 223.211 266.627 1.00 61.05  ? 1101 HIS A  CE1 1 
ATOM   8162  N NE2 . HIS A  1 1101 ? 203.868 222.139 267.395 1.00 59.49  ? 1101 HIS A  NE2 1 
ATOM   8163  N N   . TRP A  1 1102 ? 205.866 218.363 262.623 1.00 36.88  ? 1102 TRP A  N   1 
ATOM   8164  C CA  . TRP A  1 1102 ? 205.962 217.311 261.622 1.00 29.76  ? 1102 TRP A  CA  1 
ATOM   8165  C C   . TRP A  1 1102 ? 204.695 216.468 261.611 1.00 31.68  ? 1102 TRP A  C   1 
ATOM   8166  O O   . TRP A  1 1102 ? 204.155 216.123 262.664 1.00 40.77  ? 1102 TRP A  O   1 
ATOM   8167  C CB  . TRP A  1 1102 ? 207.176 216.423 261.889 1.00 27.87  ? 1102 TRP A  CB  1 
ATOM   8168  C CG  . TRP A  1 1102 ? 208.447 217.041 261.445 1.00 31.03  ? 1102 TRP A  CG  1 
ATOM   8169  C CD1 . TRP A  1 1102 ? 209.322 217.763 262.202 1.00 32.15  ? 1102 TRP A  CD1 1 
ATOM   8170  C CD2 . TRP A  1 1102 ? 208.993 217.007 260.125 1.00 27.94  ? 1102 TRP A  CD2 1 
ATOM   8171  N NE1 . TRP A  1 1102 ? 210.379 218.176 261.434 1.00 33.05  ? 1102 TRP A  NE1 1 
ATOM   8172  C CE2 . TRP A  1 1102 ? 210.199 217.725 260.154 1.00 24.79  ? 1102 TRP A  CE2 1 
ATOM   8173  C CE3 . TRP A  1 1102 ? 208.576 216.441 258.920 1.00 29.76  ? 1102 TRP A  CE3 1 
ATOM   8174  C CZ2 . TRP A  1 1102 ? 210.991 217.891 259.029 1.00 26.66  ? 1102 TRP A  CZ2 1 
ATOM   8175  C CZ3 . TRP A  1 1102 ? 209.366 216.605 257.807 1.00 27.21  ? 1102 TRP A  CZ3 1 
ATOM   8176  C CH2 . TRP A  1 1102 ? 210.560 217.324 257.868 1.00 29.63  ? 1102 TRP A  CH2 1 
ATOM   8177  N N   . PHE A  1 1103 ? 204.227 216.142 260.410 1.00 26.34  ? 1103 PHE A  N   1 
ATOM   8178  C CA  . PHE A  1 1103 ? 203.047 215.312 260.236 1.00 20.05  ? 1103 PHE A  CA  1 
ATOM   8179  C C   . PHE A  1 1103 ? 203.308 214.294 259.139 1.00 22.37  ? 1103 PHE A  C   1 
ATOM   8180  O O   . PHE A  1 1103 ? 204.165 214.486 258.275 1.00 32.35  ? 1103 PHE A  O   1 
ATOM   8181  C CB  . PHE A  1 1103 ? 201.816 216.144 259.875 1.00 27.92  ? 1103 PHE A  CB  1 
ATOM   8182  C CG  . PHE A  1 1103 ? 201.644 217.366 260.716 1.00 29.14  ? 1103 PHE A  CG  1 
ATOM   8183  C CD1 . PHE A  1 1103 ? 200.923 217.316 261.891 1.00 37.26  ? 1103 PHE A  CD1 1 
ATOM   8184  C CD2 . PHE A  1 1103 ? 202.200 218.567 260.331 1.00 32.80  ? 1103 PHE A  CD2 1 
ATOM   8185  C CE1 . PHE A  1 1103 ? 200.763 218.438 262.664 1.00 40.47  ? 1103 PHE A  CE1 1 
ATOM   8186  C CE2 . PHE A  1 1103 ? 202.043 219.693 261.100 1.00 39.82  ? 1103 PHE A  CE2 1 
ATOM   8187  C CZ  . PHE A  1 1103 ? 201.324 219.629 262.269 1.00 43.74  ? 1103 PHE A  CZ  1 
ATOM   8188  N N   . VAL A  1 1104 ? 202.549 213.206 259.183 1.00 22.00  ? 1104 VAL A  N   1 
ATOM   8189  C CA  . VAL A  1 1104 ? 202.529 212.207 258.125 1.00 21.60  ? 1104 VAL A  CA  1 
ATOM   8190  C C   . VAL A  1 1104 ? 201.199 212.341 257.400 1.00 26.73  ? 1104 VAL A  C   1 
ATOM   8191  O O   . VAL A  1 1104 ? 200.139 212.372 258.037 1.00 33.73  ? 1104 VAL A  O   1 
ATOM   8192  C CB  . VAL A  1 1104 ? 202.727 210.786 258.682 1.00 15.27  ? 1104 VAL A  CB  1 
ATOM   8193  C CG1 . VAL A  1 1104 ? 201.598 210.415 259.622 1.00 26.26  ? 1104 VAL A  CG1 1 
ATOM   8194  C CG2 . VAL A  1 1104 ? 202.836 209.783 257.556 1.00 20.90  ? 1104 VAL A  CG2 1 
ATOM   8195  N N   . THR A  1 1105 ? 201.253 212.431 256.073 1.00 22.56  ? 1105 THR A  N   1 
ATOM   8196  C CA  . THR A  1 1105 ? 200.063 212.658 255.266 1.00 27.98  ? 1105 THR A  CA  1 
ATOM   8197  C C   . THR A  1 1105 ? 200.093 211.747 254.051 1.00 32.77  ? 1105 THR A  C   1 
ATOM   8198  O O   . THR A  1 1105 ? 201.158 211.308 253.612 1.00 38.16  ? 1105 THR A  O   1 
ATOM   8199  C CB  . THR A  1 1105 ? 199.954 214.116 254.798 1.00 25.83  ? 1105 THR A  CB  1 
ATOM   8200  O OG1 . THR A  1 1105 ? 198.711 214.305 254.112 1.00 30.83  ? 1105 THR A  OG1 1 
ATOM   8201  C CG2 . THR A  1 1105 ? 201.088 214.464 253.858 1.00 22.25  ? 1105 THR A  CG2 1 
ATOM   8202  N N   . GLN A  1 1106 ? 198.910 211.465 253.513 1.00 27.15  ? 1106 GLN A  N   1 
ATOM   8203  C CA  . GLN A  1 1106 ? 198.820 210.700 252.279 1.00 26.42  ? 1106 GLN A  CA  1 
ATOM   8204  C C   . GLN A  1 1106 ? 199.421 211.503 251.132 1.00 29.24  ? 1106 GLN A  C   1 
ATOM   8205  O O   . GLN A  1 1106 ? 199.367 212.735 251.117 1.00 30.89  ? 1106 GLN A  O   1 
ATOM   8206  C CB  . GLN A  1 1106 ? 197.369 210.333 251.975 1.00 25.39  ? 1106 GLN A  CB  1 
ATOM   8207  C CG  . GLN A  1 1106 ? 196.454 211.516 251.773 1.00 19.60  ? 1106 GLN A  CG  1 
ATOM   8208  C CD  . GLN A  1 1106 ? 194.997 211.152 251.931 1.00 17.73  ? 1106 GLN A  CD  1 
ATOM   8209  O OE1 . GLN A  1 1106 ? 194.418 210.479 251.083 1.00 17.24  ? 1106 GLN A  OE1 1 
ATOM   8210  N NE2 . GLN A  1 1106 ? 194.394 211.590 253.027 1.00 15.91  ? 1106 GLN A  NE2 1 
ATOM   8211  N N   . ARG A  1 1107 ? 200.008 210.791 250.172 1.00 27.65  ? 1107 ARG A  N   1 
ATOM   8212  C CA  . ARG A  1 1107 ? 200.844 211.438 249.169 1.00 14.42  ? 1107 ARG A  CA  1 
ATOM   8213  C C   . ARG A  1 1107 ? 200.046 212.333 248.230 1.00 20.75  ? 1107 ARG A  C   1 
ATOM   8214  O O   . ARG A  1 1107 ? 200.570 213.350 247.763 1.00 22.92  ? 1107 ARG A  O   1 
ATOM   8215  C CB  . ARG A  1 1107 ? 201.598 210.373 248.375 1.00 24.80  ? 1107 ARG A  CB  1 
ATOM   8216  C CG  . ARG A  1 1107 ? 202.529 209.548 249.236 1.00 26.18  ? 1107 ARG A  CG  1 
ATOM   8217  C CD  . ARG A  1 1107 ? 203.031 208.308 248.533 1.00 29.03  ? 1107 ARG A  CD  1 
ATOM   8218  N NE  . ARG A  1 1107 ? 203.913 207.539 249.406 1.00 45.91  ? 1107 ARG A  NE  1 
ATOM   8219  C CZ  . ARG A  1 1107 ? 204.405 206.339 249.116 1.00 41.77  ? 1107 ARG A  CZ  1 
ATOM   8220  N NH1 . ARG A  1 1107 ? 205.199 205.722 249.982 1.00 40.31  ? 1107 ARG A  NH1 1 
ATOM   8221  N NH2 . ARG A  1 1107 ? 204.106 205.755 247.963 1.00 42.35  ? 1107 ARG A  NH2 1 
ATOM   8222  N N   . ASN A  1 1108 ? 198.792 211.987 247.941 1.00 34.31  ? 1108 ASN A  N   1 
ATOM   8223  C CA  . ASN A  1 1108 ? 198.031 212.651 246.889 1.00 22.90  ? 1108 ASN A  CA  1 
ATOM   8224  C C   . ASN A  1 1108 ? 196.994 213.633 247.415 1.00 18.42  ? 1108 ASN A  C   1 
ATOM   8225  O O   . ASN A  1 1108 ? 196.196 214.150 246.628 1.00 18.80  ? 1108 ASN A  O   1 
ATOM   8226  C CB  . ASN A  1 1108 ? 197.344 211.611 246.005 1.00 17.25  ? 1108 ASN A  CB  1 
ATOM   8227  C CG  . ASN A  1 1108 ? 198.315 210.871 245.119 1.00 26.85  ? 1108 ASN A  CG  1 
ATOM   8228  O OD1 . ASN A  1 1108 ? 198.796 209.794 245.465 1.00 33.56  ? 1108 ASN A  OD1 1 
ATOM   8229  N ND2 . ASN A  1 1108 ? 198.612 211.447 243.963 1.00 42.70  ? 1108 ASN A  ND2 1 
ATOM   8230  N N   . PHE A  1 1109 ? 196.976 213.905 248.715 1.00 17.75  ? 1109 PHE A  N   1 
ATOM   8231  C CA  . PHE A  1 1109 ? 196.007 214.849 249.267 1.00 21.12  ? 1109 PHE A  CA  1 
ATOM   8232  C C   . PHE A  1 1109 ? 196.488 215.285 250.639 1.00 18.42  ? 1109 PHE A  C   1 
ATOM   8233  O O   . PHE A  1 1109 ? 196.707 214.442 251.512 1.00 29.66  ? 1109 PHE A  O   1 
ATOM   8234  C CB  . PHE A  1 1109 ? 194.625 214.214 249.351 1.00 19.31  ? 1109 PHE A  CB  1 
ATOM   8235  C CG  . PHE A  1 1109 ? 193.550 215.155 249.795 1.00 23.76  ? 1109 PHE A  CG  1 
ATOM   8236  C CD1 . PHE A  1 1109 ? 192.955 216.015 248.898 1.00 23.96  ? 1109 PHE A  CD1 1 
ATOM   8237  C CD2 . PHE A  1 1109 ? 193.125 215.171 251.107 1.00 30.33  ? 1109 PHE A  CD2 1 
ATOM   8238  C CE1 . PHE A  1 1109 ? 191.964 216.876 249.301 1.00 22.00  ? 1109 PHE A  CE1 1 
ATOM   8239  C CE2 . PHE A  1 1109 ? 192.133 216.031 251.514 1.00 28.68  ? 1109 PHE A  CE2 1 
ATOM   8240  C CZ  . PHE A  1 1109 ? 191.552 216.884 250.609 1.00 22.17  ? 1109 PHE A  CZ  1 
ATOM   8241  N N   . TYR A  1 1110 ? 196.650 216.590 250.833 1.00 21.42  ? 1110 TYR A  N   1 
ATOM   8242  C CA  . TYR A  1 1110 ? 197.183 217.102 252.092 1.00 20.41  ? 1110 TYR A  CA  1 
ATOM   8243  C C   . TYR A  1 1110 ? 196.127 216.974 253.178 1.00 22.43  ? 1110 TYR A  C   1 
ATOM   8244  O O   . TYR A  1 1110 ? 195.200 217.782 253.266 1.00 26.36  ? 1110 TYR A  O   1 
ATOM   8245  C CB  . TYR A  1 1110 ? 197.634 218.548 251.945 1.00 24.79  ? 1110 TYR A  CB  1 
ATOM   8246  C CG  . TYR A  1 1110 ? 198.139 219.128 253.243 1.00 25.67  ? 1110 TYR A  CG  1 
ATOM   8247  C CD1 . TYR A  1 1110 ? 199.205 218.551 253.911 1.00 28.45  ? 1110 TYR A  CD1 1 
ATOM   8248  C CD2 . TYR A  1 1110 ? 197.551 220.249 253.802 1.00 33.34  ? 1110 TYR A  CD2 1 
ATOM   8249  C CE1 . TYR A  1 1110 ? 199.671 219.072 255.092 1.00 26.91  ? 1110 TYR A  CE1 1 
ATOM   8250  C CE2 . TYR A  1 1110 ? 198.012 220.778 254.985 1.00 37.07  ? 1110 TYR A  CE2 1 
ATOM   8251  C CZ  . TYR A  1 1110 ? 199.074 220.184 255.626 1.00 37.06  ? 1110 TYR A  CZ  1 
ATOM   8252  O OH  . TYR A  1 1110 ? 199.545 220.702 256.808 1.00 48.30  ? 1110 TYR A  OH  1 
ATOM   8253  N N   . GLU A  1 1111 ? 196.276 215.952 254.015 1.00 27.97  ? 1111 GLU A  N   1 
ATOM   8254  C CA  . GLU A  1 1111 ? 195.424 215.753 255.184 1.00 23.73  ? 1111 GLU A  CA  1 
ATOM   8255  C C   . GLU A  1 1111 ? 196.331 215.259 256.301 1.00 34.23  ? 1111 GLU A  C   1 
ATOM   8256  O O   . GLU A  1 1111 ? 196.489 214.048 256.502 1.00 34.61  ? 1111 GLU A  O   1 
ATOM   8257  C CB  . GLU A  1 1111 ? 194.301 214.759 254.891 1.00 21.79  ? 1111 GLU A  CB  1 
ATOM   8258  C CG  . GLU A  1 1111 ? 193.391 214.462 256.069 1.00 32.44  ? 1111 GLU A  CG  1 
ATOM   8259  C CD  . GLU A  1 1111 ? 192.128 213.733 255.651 1.00 41.28  ? 1111 GLU A  CD  1 
ATOM   8260  O OE1 . GLU A  1 1111 ? 191.210 214.385 255.111 1.00 38.06  ? 1111 GLU A  OE1 1 
ATOM   8261  O OE2 . GLU A  1 1111 ? 192.059 212.503 255.850 1.00 41.70  ? 1111 GLU A  OE2 1 
ATOM   8262  N N   . PRO A  1 1112 ? 196.947 216.170 257.053 1.00 34.36  ? 1112 PRO A  N   1 
ATOM   8263  C CA  . PRO A  1 1112 ? 198.026 215.768 257.958 1.00 30.16  ? 1112 PRO A  CA  1 
ATOM   8264  C C   . PRO A  1 1112 ? 197.515 215.074 259.207 1.00 41.88  ? 1112 PRO A  C   1 
ATOM   8265  O O   . PRO A  1 1112 ? 196.382 215.275 259.648 1.00 48.30  ? 1112 PRO A  O   1 
ATOM   8266  C CB  . PRO A  1 1112 ? 198.697 217.099 258.308 1.00 27.69  ? 1112 PRO A  CB  1 
ATOM   8267  C CG  . PRO A  1 1112 ? 197.597 218.081 258.244 1.00 30.70  ? 1112 PRO A  CG  1 
ATOM   8268  C CD  . PRO A  1 1112 ? 196.669 217.614 257.151 1.00 28.95  ? 1112 PRO A  CD  1 
ATOM   8269  N N   . GLN A  1 1113 ? 198.380 214.236 259.770 1.00 37.50  ? 1113 GLN A  N   1 
ATOM   8270  C CA  . GLN A  1 1113 ? 198.089 213.522 261.001 1.00 31.94  ? 1113 GLN A  CA  1 
ATOM   8271  C C   . GLN A  1 1113 ? 199.337 213.492 261.867 1.00 29.66  ? 1113 GLN A  C   1 
ATOM   8272  O O   . GLN A  1 1113 ? 200.462 213.527 261.363 1.00 38.82  ? 1113 GLN A  O   1 
ATOM   8273  C CB  . GLN A  1 1113 ? 197.613 212.095 260.729 1.00 33.46  ? 1113 GLN A  CB  1 
ATOM   8274  C CG  . GLN A  1 1113 ? 196.310 212.017 259.965 1.00 34.79  ? 1113 GLN A  CG  1 
ATOM   8275  C CD  . GLN A  1 1113 ? 195.857 210.594 259.758 1.00 50.50  ? 1113 GLN A  CD  1 
ATOM   8276  O OE1 . GLN A  1 1113 ? 196.631 209.653 259.941 1.00 70.81  ? 1113 GLN A  OE1 1 
ATOM   8277  N NE2 . GLN A  1 1113 ? 194.596 210.420 259.380 1.00 58.72  ? 1113 GLN A  NE2 1 
ATOM   8278  N N   . ILE A  1 1114 ? 199.128 213.441 263.183 1.00 26.30  ? 1114 ILE A  N   1 
ATOM   8279  C CA  . ILE A  1 1114 ? 200.253 213.317 264.098 1.00 26.90  ? 1114 ILE A  CA  1 
ATOM   8280  C C   . ILE A  1 1114 ? 200.968 212.002 263.832 1.00 29.40  ? 1114 ILE A  C   1 
ATOM   8281  O O   . ILE A  1 1114 ? 200.339 210.965 263.587 1.00 30.07  ? 1114 ILE A  O   1 
ATOM   8282  C CB  . ILE A  1 1114 ? 199.775 213.415 265.556 1.00 28.51  ? 1114 ILE A  CB  1 
ATOM   8283  C CG1 . ILE A  1 1114 ? 199.129 214.778 265.818 1.00 29.60  ? 1114 ILE A  CG1 1 
ATOM   8284  C CG2 . ILE A  1 1114 ? 200.931 213.189 266.512 1.00 26.98  ? 1114 ILE A  CG2 1 
ATOM   8285  C CD1 . ILE A  1 1114 ? 200.073 215.962 265.663 1.00 27.95  ? 1114 ILE A  CD1 1 
ATOM   8286  N N   . ILE A  1 1115 ? 202.296 212.042 263.873 1.00 27.39  ? 1115 ILE A  N   1 
ATOM   8287  C CA  . ILE A  1 1115 ? 203.116 210.871 263.582 1.00 23.10  ? 1115 ILE A  CA  1 
ATOM   8288  C C   . ILE A  1 1115 ? 203.057 209.943 264.790 1.00 31.66  ? 1115 ILE A  C   1 
ATOM   8289  O O   . ILE A  1 1115 ? 203.596 210.258 265.853 1.00 37.38  ? 1115 ILE A  O   1 
ATOM   8290  C CB  . ILE A  1 1115 ? 204.559 211.264 263.253 1.00 18.19  ? 1115 ILE A  CB  1 
ATOM   8291  C CG1 . ILE A  1 1115 ? 204.578 212.270 262.102 1.00 23.66  ? 1115 ILE A  CG1 1 
ATOM   8292  C CG2 . ILE A  1 1115 ? 205.372 210.036 262.897 1.00 31.45  ? 1115 ILE A  CG2 1 
ATOM   8293  C CD1 . ILE A  1 1115 ? 205.950 212.795 261.755 1.00 19.19  ? 1115 ILE A  CD1 1 
ATOM   8294  N N   . THR A  1 1116 ? 202.396 208.803 264.630 1.00 30.49  ? 1116 THR A  N   1 
ATOM   8295  C CA  . THR A  1 1116 ? 202.238 207.812 265.683 1.00 30.73  ? 1116 THR A  CA  1 
ATOM   8296  C C   . THR A  1 1116 ? 202.989 206.539 265.317 1.00 28.85  ? 1116 THR A  C   1 
ATOM   8297  O O   . THR A  1 1116 ? 203.504 206.389 264.207 1.00 34.38  ? 1116 THR A  O   1 
ATOM   8298  C CB  . THR A  1 1116 ? 200.756 207.496 265.918 1.00 33.36  ? 1116 THR A  CB  1 
ATOM   8299  O OG1 . THR A  1 1116 ? 200.244 206.751 264.809 1.00 43.48  ? 1116 THR A  OG1 1 
ATOM   8300  C CG2 . THR A  1 1116 ? 199.955 208.774 266.067 1.00 34.42  ? 1116 THR A  CG2 1 
ATOM   8301  N N   . THR A  1 1117 ? 203.058 205.615 266.275 1.00 25.02  ? 1117 THR A  N   1 
ATOM   8302  C CA  . THR A  1 1117 ? 203.581 204.288 265.982 1.00 24.06  ? 1117 THR A  CA  1 
ATOM   8303  C C   . THR A  1 1117 ? 202.659 203.497 265.065 1.00 30.03  ? 1117 THR A  C   1 
ATOM   8304  O O   . THR A  1 1117 ? 203.083 202.475 264.515 1.00 30.07  ? 1117 THR A  O   1 
ATOM   8305  C CB  . THR A  1 1117 ? 203.806 203.510 267.280 1.00 32.62  ? 1117 THR A  CB  1 
ATOM   8306  O OG1 . THR A  1 1117 ? 204.648 204.269 268.156 1.00 48.96  ? 1117 THR A  OG1 1 
ATOM   8307  C CG2 . THR A  1 1117 ? 204.463 202.168 266.997 1.00 31.40  ? 1117 THR A  CG2 1 
ATOM   8308  N N   . ASP A  1 1118 ? 201.418 203.945 264.884 1.00 39.19  ? 1118 ASP A  N   1 
ATOM   8309  C CA  . ASP A  1 1118 ? 200.488 203.294 263.972 1.00 32.50  ? 1118 ASP A  CA  1 
ATOM   8310  C C   . ASP A  1 1118 ? 200.626 203.803 262.545 1.00 32.82  ? 1118 ASP A  C   1 
ATOM   8311  O O   . ASP A  1 1118 ? 200.388 203.045 261.599 1.00 34.31  ? 1118 ASP A  O   1 
ATOM   8312  C CB  . ASP A  1 1118 ? 199.049 203.505 264.450 1.00 38.75  ? 1118 ASP A  CB  1 
ATOM   8313  C CG  . ASP A  1 1118 ? 198.789 202.892 265.810 1.00 45.69  ? 1118 ASP A  CG  1 
ATOM   8314  O OD1 . ASP A  1 1118 ? 199.459 201.896 266.153 1.00 47.73  ? 1118 ASP A  OD1 1 
ATOM   8315  O OD2 . ASP A  1 1118 ? 197.912 203.406 266.537 1.00 53.74  ? 1118 ASP A  OD2 1 
ATOM   8316  N N   . ASN A  1 1119 ? 201.004 205.070 262.368 1.00 33.05  ? 1119 ASN A  N   1 
ATOM   8317  C CA  . ASN A  1 1119 ? 201.219 205.615 261.035 1.00 20.99  ? 1119 ASN A  CA  1 
ATOM   8318  C C   . ASN A  1 1119 ? 202.519 205.141 260.408 1.00 25.10  ? 1119 ASN A  C   1 
ATOM   8319  O O   . ASN A  1 1119 ? 202.656 205.206 259.183 1.00 29.26  ? 1119 ASN A  O   1 
ATOM   8320  C CB  . ASN A  1 1119 ? 201.239 207.143 261.073 1.00 22.11  ? 1119 ASN A  CB  1 
ATOM   8321  C CG  . ASN A  1 1119 ? 199.928 207.736 261.527 1.00 35.21  ? 1119 ASN A  CG  1 
ATOM   8322  O OD1 . ASN A  1 1119 ? 199.765 208.084 262.693 1.00 52.89  ? 1119 ASN A  OD1 1 
ATOM   8323  N ND2 . ASN A  1 1119 ? 198.982 207.861 260.605 1.00 38.76  ? 1119 ASN A  ND2 1 
ATOM   8324  N N   . THR A  1 1120 ? 203.471 204.676 261.209 1.00 25.39  ? 1120 THR A  N   1 
ATOM   8325  C CA  . THR A  1 1120 ? 204.827 204.421 260.753 1.00 22.14  ? 1120 THR A  CA  1 
ATOM   8326  C C   . THR A  1 1120 ? 205.247 203.002 261.101 1.00 21.93  ? 1120 THR A  C   1 
ATOM   8327  O O   . THR A  1 1120 ? 204.761 202.412 262.069 1.00 27.05  ? 1120 THR A  O   1 
ATOM   8328  C CB  . THR A  1 1120 ? 205.818 205.400 261.391 1.00 24.20  ? 1120 THR A  CB  1 
ATOM   8329  O OG1 . THR A  1 1120 ? 205.871 205.172 262.803 1.00 29.28  ? 1120 THR A  OG1 1 
ATOM   8330  C CG2 . THR A  1 1120 ? 205.406 206.841 261.131 1.00 18.73  ? 1120 THR A  CG2 1 
ATOM   8331  N N   . PHE A  1 1121 ? 206.150 202.456 260.297 1.00 22.78  ? 1121 PHE A  N   1 
ATOM   8332  C CA  . PHE A  1 1121 ? 206.882 201.248 260.639 1.00 23.61  ? 1121 PHE A  CA  1 
ATOM   8333  C C   . PHE A  1 1121 ? 208.342 201.608 260.881 1.00 23.52  ? 1121 PHE A  C   1 
ATOM   8334  O O   . PHE A  1 1121 ? 208.776 202.731 260.619 1.00 25.80  ? 1121 PHE A  O   1 
ATOM   8335  C CB  . PHE A  1 1121 ? 206.737 200.186 259.541 1.00 22.75  ? 1121 PHE A  CB  1 
ATOM   8336  C CG  . PHE A  1 1121 ? 207.552 200.454 258.310 1.00 20.70  ? 1121 PHE A  CG  1 
ATOM   8337  C CD1 . PHE A  1 1121 ? 208.834 199.960 258.197 1.00 32.05  ? 1121 PHE A  CD1 1 
ATOM   8338  C CD2 . PHE A  1 1121 ? 207.025 201.174 257.257 1.00 21.21  ? 1121 PHE A  CD2 1 
ATOM   8339  C CE1 . PHE A  1 1121 ? 209.580 200.194 257.070 1.00 22.27  ? 1121 PHE A  CE1 1 
ATOM   8340  C CE2 . PHE A  1 1121 ? 207.768 201.408 256.126 1.00 18.49  ? 1121 PHE A  CE2 1 
ATOM   8341  C CZ  . PHE A  1 1121 ? 209.047 200.920 256.035 1.00 15.15  ? 1121 PHE A  CZ  1 
ATOM   8342  N N   . VAL A  1 1122 ? 209.103 200.648 261.398 1.00 21.05  ? 1122 VAL A  N   1 
ATOM   8343  C CA  . VAL A  1 1122 ? 210.460 200.895 261.873 1.00 19.78  ? 1122 VAL A  CA  1 
ATOM   8344  C C   . VAL A  1 1122 ? 211.429 199.968 261.156 1.00 25.45  ? 1122 VAL A  C   1 
ATOM   8345  O O   . VAL A  1 1122 ? 211.114 198.801 260.897 1.00 34.86  ? 1122 VAL A  O   1 
ATOM   8346  C CB  . VAL A  1 1122 ? 210.566 200.703 263.399 1.00 18.54  ? 1122 VAL A  CB  1 
ATOM   8347  C CG1 . VAL A  1 1122 ? 212.002 200.868 263.854 1.00 21.35  ? 1122 VAL A  CG1 1 
ATOM   8348  C CG2 . VAL A  1 1122 ? 209.666 201.681 264.119 1.00 25.83  ? 1122 VAL A  CG2 1 
ATOM   8349  N N   . SER A  1 1123 ? 212.612 200.493 260.839 1.00 25.96  ? 1123 SER A  N   1 
ATOM   8350  C CA  . SER A  1 1123 ? 213.699 199.685 260.297 1.00 28.04  ? 1123 SER A  CA  1 
ATOM   8351  C C   . SER A  1 1123 ? 215.020 200.375 260.597 1.00 33.58  ? 1123 SER A  C   1 
ATOM   8352  O O   . SER A  1 1123 ? 215.221 201.528 260.205 1.00 35.41  ? 1123 SER A  O   1 
ATOM   8353  C CB  . SER A  1 1123 ? 213.538 199.474 258.791 1.00 30.60  ? 1123 SER A  CB  1 
ATOM   8354  O OG  . SER A  1 1123 ? 214.558 198.632 258.284 1.00 35.95  ? 1123 SER A  OG  1 
ATOM   8355  N N   . GLY A  1 1124 ? 215.914 199.669 261.281 1.00 34.24  ? 1124 GLY A  N   1 
ATOM   8356  C CA  . GLY A  1 1124 ? 217.264 200.142 261.514 1.00 34.54  ? 1124 GLY A  CA  1 
ATOM   8357  C C   . GLY A  1 1124 ? 217.327 201.342 262.442 1.00 35.87  ? 1124 GLY A  C   1 
ATOM   8358  O O   . GLY A  1 1124 ? 216.437 201.587 263.262 1.00 33.36  ? 1124 GLY A  O   1 
ATOM   8359  N N   . ASN A  1 1125 ? 218.407 202.109 262.299 1.00 49.21  ? 1125 ASN A  N   1 
ATOM   8360  C CA  . ASN A  1 1125 ? 218.727 203.197 263.211 1.00 51.18  ? 1125 ASN A  CA  1 
ATOM   8361  C C   . ASN A  1 1125 ? 219.120 204.432 262.412 1.00 49.28  ? 1125 ASN A  C   1 
ATOM   8362  O O   . ASN A  1 1125 ? 219.160 204.421 261.180 1.00 53.75  ? 1125 ASN A  O   1 
ATOM   8363  C CB  . ASN A  1 1125 ? 219.851 202.809 264.178 1.00 56.87  ? 1125 ASN A  CB  1 
ATOM   8364  C CG  . ASN A  1 1125 ? 221.144 202.503 263.465 1.00 63.01  ? 1125 ASN A  CG  1 
ATOM   8365  O OD1 . ASN A  1 1125 ? 221.141 202.060 262.317 1.00 55.84  ? 1125 ASN A  OD1 1 
ATOM   8366  N ND2 . ASN A  1 1125 ? 222.265 202.735 264.140 1.00 63.07  ? 1125 ASN A  ND2 1 
ATOM   8367  N N   . CYS A  1 1126 ? 219.412 205.502 263.141 1.00 47.54  ? 1126 CYS A  N   1 
ATOM   8368  C CA  . CYS A  1 1126 ? 219.590 206.860 262.635 1.00 42.01  ? 1126 CYS A  CA  1 
ATOM   8369  C C   . CYS A  1 1126 ? 220.896 207.087 261.898 1.00 61.17  ? 1126 CYS A  C   1 
ATOM   8370  O O   . CYS A  1 1126 ? 221.109 208.244 261.524 1.00 63.09  ? 1126 CYS A  O   1 
ATOM   8371  C CB  . CYS A  1 1126 ? 219.482 207.831 263.810 1.00 41.00  ? 1126 CYS A  CB  1 
ATOM   8372  S SG  . CYS A  1 1126 ? 217.914 207.674 264.663 1.00 40.01  ? 1126 CYS A  SG  1 
ATOM   8373  N N   . ASP A  1 1127 ? 221.776 206.118 261.647 1.00 61.84  ? 1127 ASP A  N   1 
ATOM   8374  C CA  . ASP A  1 1127 ? 223.065 206.405 261.032 1.00 54.02  ? 1127 ASP A  CA  1 
ATOM   8375  C C   . ASP A  1 1127 ? 223.079 206.211 259.521 1.00 49.39  ? 1127 ASP A  C   1 
ATOM   8376  O O   . ASP A  1 1127 ? 223.968 206.752 258.855 1.00 65.24  ? 1127 ASP A  O   1 
ATOM   8377  C CB  . ASP A  1 1127 ? 224.152 205.518 261.652 1.00 60.20  ? 1127 ASP A  CB  1 
ATOM   8378  C CG  . ASP A  1 1127 ? 223.947 204.050 261.347 1.00 69.61  ? 1127 ASP A  CG  1 
ATOM   8379  O OD1 . ASP A  1 1127 ? 224.174 203.646 260.188 1.00 67.08  ? 1127 ASP A  OD1 1 
ATOM   8380  O OD2 . ASP A  1 1127 ? 223.560 203.299 262.266 1.00 73.35  ? 1127 ASP A  OD2 1 
ATOM   8381  N N   . VAL A  1 1128 ? 222.129 205.462 258.968 1.00 42.06  ? 1128 VAL A  N   1 
ATOM   8382  C CA  . VAL A  1 1128 ? 222.230 204.999 257.588 1.00 39.44  ? 1128 VAL A  CA  1 
ATOM   8383  C C   . VAL A  1 1128 ? 221.406 205.868 256.645 1.00 42.09  ? 1128 VAL A  C   1 
ATOM   8384  O O   . VAL A  1 1128 ? 221.761 206.029 255.472 1.00 40.14  ? 1128 VAL A  O   1 
ATOM   8385  C CB  . VAL A  1 1128 ? 221.798 203.523 257.489 1.00 35.86  ? 1128 VAL A  CB  1 
ATOM   8386  C CG1 . VAL A  1 1128 ? 220.309 203.377 257.776 1.00 27.13  ? 1128 VAL A  CG1 1 
ATOM   8387  C CG2 . VAL A  1 1128 ? 222.154 202.947 256.130 1.00 36.84  ? 1128 VAL A  CG2 1 
ATOM   8388  N N   . VAL A  1 1129 ? 220.313 206.441 257.141 1.00 45.47  ? 1129 VAL A  N   1 
ATOM   8389  C CA  . VAL A  1 1129 ? 219.348 207.129 256.286 1.00 35.47  ? 1129 VAL A  CA  1 
ATOM   8390  C C   . VAL A  1 1129 ? 219.837 208.551 256.023 1.00 32.90  ? 1129 VAL A  C   1 
ATOM   8391  O O   . VAL A  1 1129 ? 219.913 209.373 256.938 1.00 36.02  ? 1129 VAL A  O   1 
ATOM   8392  C CB  . VAL A  1 1129 ? 217.950 207.134 256.910 1.00 32.30  ? 1129 VAL A  CB  1 
ATOM   8393  C CG1 . VAL A  1 1129 ? 216.987 207.940 256.051 1.00 22.66  ? 1129 VAL A  CG1 1 
ATOM   8394  C CG2 . VAL A  1 1129 ? 217.446 205.713 257.078 1.00 35.60  ? 1129 VAL A  CG2 1 
ATOM   8395  N N   . ILE A  1 1130 ? 220.168 208.839 254.763 1.00 37.09  ? 1130 ILE A  N   1 
ATOM   8396  C CA  . ILE A  1 1130 ? 220.572 210.185 254.369 1.00 34.41  ? 1130 ILE A  CA  1 
ATOM   8397  C C   . ILE A  1 1130 ? 219.376 211.118 254.483 1.00 31.51  ? 1130 ILE A  C   1 
ATOM   8398  O O   . ILE A  1 1130 ? 218.309 210.856 253.915 1.00 35.26  ? 1130 ILE A  O   1 
ATOM   8399  C CB  . ILE A  1 1130 ? 221.143 210.179 252.947 1.00 31.97  ? 1130 ILE A  CB  1 
ATOM   8400  C CG1 . ILE A  1 1130 ? 222.363 209.257 252.865 1.00 18.32  ? 1130 ILE A  CG1 1 
ATOM   8401  C CG2 . ILE A  1 1130 ? 221.520 211.590 252.516 1.00 40.91  ? 1130 ILE A  CG2 1 
ATOM   8402  C CD1 . ILE A  1 1130 ? 222.777 208.906 251.455 1.00 13.72  ? 1130 ILE A  CD1 1 
ATOM   8403  N N   . GLY A  1 1131 ? 219.552 212.220 255.208 1.00 32.90  ? 1131 GLY A  N   1 
ATOM   8404  C CA  . GLY A  1 1131 ? 218.515 213.225 255.338 1.00 38.47  ? 1131 GLY A  CA  1 
ATOM   8405  C C   . GLY A  1 1131 ? 217.530 213.010 256.465 1.00 31.85  ? 1131 GLY A  C   1 
ATOM   8406  O O   . GLY A  1 1131 ? 216.529 213.730 256.532 1.00 21.93  ? 1131 GLY A  O   1 
ATOM   8407  N N   . ILE A  1 1132 ? 217.779 212.048 257.354 1.00 30.56  ? 1132 ILE A  N   1 
ATOM   8408  C CA  . ILE A  1 1132 ? 216.866 211.800 258.461 1.00 23.19  ? 1132 ILE A  CA  1 
ATOM   8409  C C   . ILE A  1 1132 ? 216.867 212.987 259.416 1.00 28.43  ? 1132 ILE A  C   1 
ATOM   8410  O O   . ILE A  1 1132 ? 217.906 213.613 259.657 1.00 40.06  ? 1132 ILE A  O   1 
ATOM   8411  C CB  . ILE A  1 1132 ? 217.263 210.500 259.178 1.00 25.34  ? 1132 ILE A  CB  1 
ATOM   8412  C CG1 . ILE A  1 1132 ? 216.164 210.060 260.137 1.00 29.61  ? 1132 ILE A  CG1 1 
ATOM   8413  C CG2 . ILE A  1 1132 ? 218.567 210.682 259.933 1.00 39.90  ? 1132 ILE A  CG2 1 
ATOM   8414  C CD1 . ILE A  1 1132 ? 216.170 208.581 260.405 1.00 27.71  ? 1132 ILE A  CD1 1 
ATOM   8415  N N   . VAL A  1 1133 ? 215.700 213.267 259.994 1.00 27.98  ? 1133 VAL A  N   1 
ATOM   8416  C CA  . VAL A  1 1133 ? 215.541 214.354 260.955 1.00 28.46  ? 1133 VAL A  CA  1 
ATOM   8417  C C   . VAL A  1 1133 ? 215.112 213.824 262.328 1.00 40.80  ? 1133 VAL A  C   1 
ATOM   8418  O O   . VAL A  1 1133 ? 214.824 212.638 262.487 1.00 34.59  ? 1133 VAL A  O   1 
ATOM   8419  C CB  . VAL A  1 1133 ? 214.512 215.391 260.470 1.00 20.48  ? 1133 VAL A  CB  1 
ATOM   8420  C CG1 . VAL A  1 1133 ? 214.711 215.684 258.991 1.00 24.54  ? 1133 VAL A  CG1 1 
ATOM   8421  C CG2 . VAL A  1 1133 ? 213.097 214.900 260.738 1.00 18.42  ? 1133 VAL A  CG2 1 
ATOM   8422  N N   . ASN A  1 1134 ? 215.076 214.720 263.310 1.00 52.56  ? 1134 ASN A  N   1 
ATOM   8423  C CA  . ASN A  1 1134 ? 214.692 214.399 264.679 1.00 44.84  ? 1134 ASN A  CA  1 
ATOM   8424  C C   . ASN A  1 1134 ? 213.281 214.907 264.946 1.00 40.94  ? 1134 ASN A  C   1 
ATOM   8425  O O   . ASN A  1 1134 ? 213.018 216.108 264.826 1.00 44.61  ? 1134 ASN A  O   1 
ATOM   8426  C CB  . ASN A  1 1134 ? 215.663 215.019 265.684 1.00 50.35  ? 1134 ASN A  CB  1 
ATOM   8427  C CG  . ASN A  1 1134 ? 216.941 214.222 265.840 1.00 51.56  ? 1134 ASN A  CG  1 
ATOM   8428  O OD1 . ASN A  1 1134 ? 217.024 213.060 265.443 1.00 40.84  ? 1134 ASN A  OD1 1 
ATOM   8429  N ND2 . ASN A  1 1134 ? 217.949 214.850 266.433 1.00 65.53  ? 1134 ASN A  ND2 1 
ATOM   8430  N N   . ASN A  1 1135 ? 212.414 214.004 265.405 1.00 37.04  ? 1135 ASN A  N   1 
ATOM   8431  C CA  . ASN A  1 1135 ? 211.029 214.327 265.748 1.00 37.09  ? 1135 ASN A  CA  1 
ATOM   8432  C C   . ASN A  1 1135 ? 210.383 213.221 266.594 1.00 41.96  ? 1135 ASN A  C   1 
ATOM   8433  O O   . ASN A  1 1135 ? 210.620 212.038 266.349 1.00 45.12  ? 1135 ASN A  O   1 
ATOM   8434  C CB  . ASN A  1 1135 ? 210.205 214.577 264.484 1.00 40.61  ? 1135 ASN A  CB  1 
ATOM   8435  C CG  . ASN A  1 1135 ? 208.942 215.370 264.759 1.00 38.58  ? 1135 ASN A  CG  1 
ATOM   8436  O OD1 . ASN A  1 1135 ? 208.969 216.599 264.823 1.00 44.95  ? 1135 ASN A  OD1 1 
ATOM   8437  N ND2 . ASN A  1 1135 ? 207.827 214.668 264.924 1.00 38.71  ? 1135 ASN A  ND2 1 
ATOM   8438  N N   . THR A  1 1136 ? 209.571 213.599 267.583 1.00 49.50  ? 1136 THR A  N   1 
ATOM   8439  C CA  . THR A  1 1136 ? 208.909 212.620 268.434 1.00 47.23  ? 1136 THR A  CA  1 
ATOM   8440  C C   . THR A  1 1136 ? 207.876 211.825 267.642 1.00 39.52  ? 1136 THR A  C   1 
ATOM   8441  O O   . THR A  1 1136 ? 207.299 212.308 266.665 1.00 30.47  ? 1136 THR A  O   1 
ATOM   8442  C CB  . THR A  1 1136 ? 208.236 213.303 269.626 1.00 47.54  ? 1136 THR A  CB  1 
ATOM   8443  O OG1 . THR A  1 1136 ? 207.992 212.337 270.656 1.00 52.89  ? 1136 THR A  OG1 1 
ATOM   8444  C CG2 . THR A  1 1136 ? 206.913 213.932 269.216 1.00 47.46  ? 1136 THR A  CG2 1 
ATOM   8445  N N   . VAL A  1 1137 ? 207.645 210.590 268.080 1.00 48.96  ? 1137 VAL A  N   1 
ATOM   8446  C CA  . VAL A  1 1137 ? 206.646 209.706 267.491 1.00 45.41  ? 1137 VAL A  CA  1 
ATOM   8447  C C   . VAL A  1 1137 ? 205.684 209.289 268.594 1.00 43.41  ? 1137 VAL A  C   1 
ATOM   8448  O O   . VAL A  1 1137 ? 206.074 208.591 269.538 1.00 50.08  ? 1137 VAL A  O   1 
ATOM   8449  C CB  . VAL A  1 1137 ? 207.290 208.480 266.825 1.00 40.57  ? 1137 VAL A  CB  1 
ATOM   8450  C CG1 . VAL A  1 1137 ? 206.229 207.473 266.419 1.00 41.87  ? 1137 VAL A  CG1 1 
ATOM   8451  C CG2 . VAL A  1 1137 ? 208.092 208.909 265.617 1.00 38.80  ? 1137 VAL A  CG2 1 
ATOM   8452  N N   . TYR A  1 1138 ? 204.428 209.700 268.462 1.00 43.44  ? 1138 TYR A  N   1 
ATOM   8453  C CA  . TYR A  1 1138 ? 203.436 209.466 269.502 1.00 40.96  ? 1138 TYR A  CA  1 
ATOM   8454  C C   . TYR A  1 1138 ? 203.089 207.986 269.587 1.00 40.57  ? 1138 TYR A  C   1 
ATOM   8455  O O   . TYR A  1 1138 ? 202.803 207.344 268.575 1.00 48.98  ? 1138 TYR A  O   1 
ATOM   8456  C CB  . TYR A  1 1138 ? 202.187 210.296 269.208 1.00 45.41  ? 1138 TYR A  CB  1 
ATOM   8457  C CG  . TYR A  1 1138 ? 201.008 210.055 270.125 1.00 48.58  ? 1138 TYR A  CG  1 
ATOM   8458  C CD1 . TYR A  1 1138 ? 201.178 209.900 271.492 1.00 49.90  ? 1138 TYR A  CD1 1 
ATOM   8459  C CD2 . TYR A  1 1138 ? 199.718 210.011 269.619 1.00 50.86  ? 1138 TYR A  CD2 1 
ATOM   8460  C CE1 . TYR A  1 1138 ? 200.097 209.691 272.323 1.00 51.89  ? 1138 TYR A  CE1 1 
ATOM   8461  C CE2 . TYR A  1 1138 ? 198.633 209.805 270.443 1.00 50.38  ? 1138 TYR A  CE2 1 
ATOM   8462  C CZ  . TYR A  1 1138 ? 198.828 209.647 271.795 1.00 51.65  ? 1138 TYR A  CZ  1 
ATOM   8463  O OH  . TYR A  1 1138 ? 197.746 209.439 272.620 1.00 61.45  ? 1138 TYR A  OH  1 
ATOM   8464  N N   . ASP A  1 1139 ? 203.113 207.444 270.799 1.00 41.54  ? 1139 ASP A  N   1 
ATOM   8465  C CA  . ASP A  1 1139 ? 202.680 206.073 271.031 1.00 44.19  ? 1139 ASP A  CA  1 
ATOM   8466  C C   . ASP A  1 1139 ? 201.343 206.111 271.754 1.00 53.19  ? 1139 ASP A  C   1 
ATOM   8467  O O   . ASP A  1 1139 ? 201.307 206.425 272.954 1.00 60.35  ? 1139 ASP A  O   1 
ATOM   8468  C CB  . ASP A  1 1139 ? 203.715 205.305 271.854 1.00 51.73  ? 1139 ASP A  CB  1 
ATOM   8469  C CG  . ASP A  1 1139 ? 203.397 203.829 271.957 1.00 54.24  ? 1139 ASP A  CG  1 
ATOM   8470  O OD1 . ASP A  1 1139 ? 202.319 203.418 271.480 1.00 54.06  ? 1139 ASP A  OD1 1 
ATOM   8471  O OD2 . ASP A  1 1139 ? 204.227 203.078 272.509 1.00 56.64  ? 1139 ASP A  OD2 1 
ATOM   8472  N N   . PRO A  1 1140 ? 200.224 205.806 271.091 1.00 48.96  ? 1140 PRO A  N   1 
ATOM   8473  C CA  . PRO A  1 1140 ? 198.921 205.962 271.753 1.00 48.68  ? 1140 PRO A  CA  1 
ATOM   8474  C C   . PRO A  1 1140 ? 198.703 204.999 272.900 1.00 58.37  ? 1140 PRO A  C   1 
ATOM   8475  O O   . PRO A  1 1140 ? 197.816 205.241 273.728 1.00 62.71  ? 1140 PRO A  O   1 
ATOM   8476  C CB  . PRO A  1 1140 ? 197.922 205.710 270.621 1.00 46.61  ? 1140 PRO A  CB  1 
ATOM   8477  C CG  . PRO A  1 1140 ? 198.644 204.816 269.686 1.00 44.34  ? 1140 PRO A  CG  1 
ATOM   8478  C CD  . PRO A  1 1140 ? 200.093 205.199 269.756 1.00 40.94  ? 1140 PRO A  CD  1 
ATOM   8479  N N   . LEU A  1 1141 ? 199.481 203.921 272.983 1.00 64.58  ? 1141 LEU A  N   1 
ATOM   8480  C CA  . LEU A  1 1141 ? 199.360 203.008 274.111 1.00 60.70  ? 1141 LEU A  CA  1 
ATOM   8481  C C   . LEU A  1 1141 ? 199.939 203.608 275.383 1.00 62.55  ? 1141 LEU A  C   1 
ATOM   8482  O O   . LEU A  1 1141 ? 199.497 203.261 276.483 1.00 74.00  ? 1141 LEU A  O   1 
ATOM   8483  C CB  . LEU A  1 1141 ? 200.056 201.688 273.785 1.00 61.66  ? 1141 LEU A  CB  1 
ATOM   8484  C CG  . LEU A  1 1141 ? 199.846 200.536 274.767 1.00 60.27  ? 1141 LEU A  CG  1 
ATOM   8485  C CD1 . LEU A  1 1141 ? 199.811 199.218 274.012 1.00 67.06  ? 1141 LEU A  CD1 1 
ATOM   8486  C CD2 . LEU A  1 1141 ? 200.938 200.515 275.818 1.00 61.41  ? 1141 LEU A  CD2 1 
ATOM   8487  N N   . GLN A  1 1142 ? 200.916 204.506 275.257 1.00 57.26  ? 1142 GLN A  N   1 
ATOM   8488  C CA  . GLN A  1 1142 ? 201.537 205.090 276.444 1.00 60.49  ? 1142 GLN A  CA  1 
ATOM   8489  C C   . GLN A  1 1142 ? 200.520 205.781 277.340 1.00 66.54  ? 1142 GLN A  C   1 
ATOM   8490  O O   . GLN A  1 1142 ? 200.336 205.344 278.489 1.00 73.69  ? 1142 GLN A  O   1 
ATOM   8491  C CB  . GLN A  1 1142 ? 202.657 206.039 276.011 1.00 64.43  ? 1142 GLN A  CB  1 
ATOM   8492  C CG  . GLN A  1 1142 ? 203.247 206.888 277.137 1.00 65.62  ? 1142 GLN A  CG  1 
ATOM   8493  C CD  . GLN A  1 1142 ? 203.894 206.063 278.234 1.00 77.05  ? 1142 GLN A  CD  1 
ATOM   8494  O OE1 . GLN A  1 1142 ? 203.794 204.835 278.252 1.00 81.01  ? 1142 GLN A  OE1 1 
ATOM   8495  N NE2 . GLN A  1 1142 ? 204.569 206.738 279.159 1.00 72.72  ? 1142 GLN A  NE2 1 
ATOM   8496  N N   . PRO A  1 1143 ? 199.824 206.834 276.899 1.00 64.74  ? 1143 PRO A  N   1 
ATOM   8497  C CA  . PRO A  1 1143 ? 198.860 207.476 277.802 1.00 61.58  ? 1143 PRO A  CA  1 
ATOM   8498  C C   . PRO A  1 1143 ? 197.750 206.543 278.238 1.00 70.56  ? 1143 PRO A  C   1 
ATOM   8499  O O   . PRO A  1 1143 ? 197.262 206.664 279.368 1.00 70.21  ? 1143 PRO A  O   1 
ATOM   8500  C CB  . PRO A  1 1143 ? 198.324 208.648 276.971 1.00 58.03  ? 1143 PRO A  CB  1 
ATOM   8501  C CG  . PRO A  1 1143 ? 198.490 208.207 275.568 1.00 58.97  ? 1143 PRO A  CG  1 
ATOM   8502  C CD  . PRO A  1 1143 ? 199.763 207.408 275.544 1.00 63.10  ? 1143 PRO A  CD  1 
ATOM   8503  N N   . GLU A  1 1144 ? 197.343 205.604 277.382 1.00 72.38  ? 1144 GLU A  N   1 
ATOM   8504  C CA  . GLU A  1 1144 ? 196.326 204.639 277.775 1.00 73.29  ? 1144 GLU A  CA  1 
ATOM   8505  C C   . GLU A  1 1144 ? 196.783 203.786 278.949 1.00 71.94  ? 1144 GLU A  C   1 
ATOM   8506  O O   . GLU A  1 1144 ? 195.941 203.266 279.689 1.00 71.91  ? 1144 GLU A  O   1 
ATOM   8507  C CB  . GLU A  1 1144 ? 195.964 203.753 276.583 1.00 70.38  ? 1144 GLU A  CB  1 
ATOM   8508  C CG  . GLU A  1 1144 ? 194.979 202.637 276.893 1.00 68.43  ? 1144 GLU A  CG  1 
ATOM   8509  C CD  . GLU A  1 1144 ? 193.655 203.146 277.427 1.00 78.91  ? 1144 GLU A  CD  1 
ATOM   8510  O OE1 . GLU A  1 1144 ? 192.850 202.316 277.898 1.00 75.76  ? 1144 GLU A  OE1 1 
ATOM   8511  O OE2 . GLU A  1 1144 ? 193.417 204.370 277.373 1.00 76.80  ? 1144 GLU A  OE2 1 
ATOM   8512  N N   . LEU A  1 1145 ? 198.093 203.635 279.136 1.00 72.91  ? 1145 LEU A  N   1 
ATOM   8513  C CA  . LEU A  1 1145 ? 198.631 203.021 280.339 1.00 70.54  ? 1145 LEU A  CA  1 
ATOM   8514  C C   . LEU A  1 1145 ? 199.017 204.046 281.393 1.00 73.58  ? 1145 LEU A  C   1 
ATOM   8515  O O   . LEU A  1 1145 ? 199.073 203.704 282.580 1.00 73.05  ? 1145 LEU A  O   1 
ATOM   8516  C CB  . LEU A  1 1145 ? 199.855 202.167 279.997 1.00 66.37  ? 1145 LEU A  CB  1 
ATOM   8517  C CG  . LEU A  1 1145 ? 199.573 200.688 279.725 1.00 66.58  ? 1145 LEU A  CG  1 
ATOM   8518  C CD1 . LEU A  1 1145 ? 198.638 200.518 278.539 1.00 67.22  ? 1145 LEU A  CD1 1 
ATOM   8519  C CD2 . LEU A  1 1145 ? 200.872 199.929 279.507 1.00 67.79  ? 1145 LEU A  CD2 1 
ATOM   8520  N N   . ASP A  1 1146 ? 199.275 205.294 280.992 1.00 74.80  ? 1146 ASP A  N   1 
ATOM   8521  C CA  . ASP A  1 1146 ? 199.684 206.310 281.955 1.00 77.41  ? 1146 ASP A  CA  1 
ATOM   8522  C C   . ASP A  1 1146 ? 198.542 206.658 282.902 1.00 81.46  ? 1146 ASP A  C   1 
ATOM   8523  O O   . ASP A  1 1146 ? 198.721 206.674 284.125 1.00 76.95  ? 1146 ASP A  O   1 
ATOM   8524  C CB  . ASP A  1 1146 ? 200.174 207.560 281.226 1.00 73.78  ? 1146 ASP A  CB  1 
ATOM   8525  C CG  . ASP A  1 1146 ? 200.877 208.533 282.152 1.00 81.03  ? 1146 ASP A  CG  1 
ATOM   8526  O OD1 . ASP A  1 1146 ? 201.183 208.143 283.298 1.00 77.37  ? 1146 ASP A  OD1 1 
ATOM   8527  O OD2 . ASP A  1 1146 ? 201.119 209.686 281.737 1.00 82.92  ? 1146 ASP A  OD2 1 
ATOM   8528  N N   . SER A  1 1147 ? 197.357 206.940 282.355 1.00 76.85  ? 1147 SER A  N   1 
ATOM   8529  C CA  . SER A  1 1147 ? 196.197 207.156 283.211 1.00 80.73  ? 1147 SER A  CA  1 
ATOM   8530  C C   . SER A  1 1147 ? 195.813 205.889 283.957 1.00 84.69  ? 1147 SER A  C   1 
ATOM   8531  O O   . SER A  1 1147 ? 195.192 205.973 285.023 1.00 89.77  ? 1147 SER A  O   1 
ATOM   8532  C CB  . SER A  1 1147 ? 195.011 207.655 282.388 1.00 78.54  ? 1147 SER A  CB  1 
ATOM   8533  O OG  . SER A  1 1147 ? 194.571 206.667 281.475 1.00 83.42  ? 1147 SER A  OG  1 
ATOM   8534  N N   . PHE A  1 1148 ? 196.172 204.720 283.423 1.00 80.05  ? 1148 PHE A  N   1 
ATOM   8535  C CA  . PHE A  1 1148 ? 196.024 203.488 284.186 1.00 79.72  ? 1148 PHE A  CA  1 
ATOM   8536  C C   . PHE A  1 1148 ? 196.968 203.480 285.376 1.00 83.36  ? 1148 PHE A  C   1 
ATOM   8537  O O   . PHE A  1 1148 ? 196.633 202.936 286.434 1.00 76.95  ? 1148 PHE A  O   1 
ATOM   8538  C CB  . PHE A  1 1148 ? 196.298 202.283 283.287 1.00 81.73  ? 1148 PHE A  CB  1 
ATOM   8539  C CG  . PHE A  1 1148 ? 195.628 201.020 283.742 1.00 87.62  ? 1148 PHE A  CG  1 
ATOM   8540  C CD1 . PHE A  1 1148 ? 196.237 200.185 284.662 1.00 89.40  ? 1148 PHE A  CD1 1 
ATOM   8541  C CD2 . PHE A  1 1148 ? 194.388 200.667 283.244 1.00 79.65  ? 1148 PHE A  CD2 1 
ATOM   8542  C CE1 . PHE A  1 1148 ? 195.617 199.023 285.078 1.00 81.75  ? 1148 PHE A  CE1 1 
ATOM   8543  C CE2 . PHE A  1 1148 ? 193.765 199.508 283.656 1.00 80.91  ? 1148 PHE A  CE2 1 
ATOM   8544  C CZ  . PHE A  1 1148 ? 194.380 198.685 284.574 1.00 76.59  ? 1148 PHE A  CZ  1 
ATOM   8545  N N   . LYS A  1 1149 ? 198.143 204.087 285.218 1.00 87.33  ? 1149 LYS A  N   1 
ATOM   8546  C CA  . LYS A  1 1149 ? 199.077 204.213 286.330 1.00 89.50  ? 1149 LYS A  CA  1 
ATOM   8547  C C   . LYS A  1 1149 ? 198.569 205.218 287.356 1.00 85.85  ? 1149 LYS A  C   1 
ATOM   8548  O O   . LYS A  1 1149 ? 198.668 204.983 288.566 1.00 83.15  ? 1149 LYS A  O   1 
ATOM   8549  C CB  . LYS A  1 1149 ? 200.455 204.602 285.783 1.00 80.99  ? 1149 LYS A  CB  1 
ATOM   8550  C CG  . LYS A  1 1149 ? 201.212 205.702 286.523 1.00 77.16  ? 1149 LYS A  CG  1 
ATOM   8551  C CD  . LYS A  1 1149 ? 201.808 205.208 287.825 1.00 80.93  ? 1149 LYS A  CD  1 
ATOM   8552  C CE  . LYS A  1 1149 ? 202.787 206.222 288.392 1.00 80.83  ? 1149 LYS A  CE  1 
ATOM   8553  N NZ  . LYS A  1 1149 ? 202.117 207.510 288.722 1.00 82.16  ? 1149 LYS A  NZ  1 
ATOM   8554  N N   . GLU A  1 1150 ? 198.014 206.341 286.892 1.00 83.06  ? 1150 GLU A  N   1 
ATOM   8555  C CA  . GLU A  1 1150 ? 197.435 207.313 287.812 1.00 90.68  ? 1150 GLU A  CA  1 
ATOM   8556  C C   . GLU A  1 1150 ? 196.222 206.736 288.530 1.00 95.08  ? 1150 GLU A  C   1 
ATOM   8557  O O   . GLU A  1 1150 ? 196.036 206.971 289.730 1.00 92.08  ? 1150 GLU A  O   1 
ATOM   8558  C CB  . GLU A  1 1150 ? 197.058 208.588 287.056 1.00 88.05  ? 1150 GLU A  CB  1 
ATOM   8559  C CG  . GLU A  1 1150 ? 198.242 209.294 286.409 1.00 84.03  ? 1150 GLU A  CG  1 
ATOM   8560  C CD  . GLU A  1 1150 ? 199.247 209.797 287.426 1.00 78.98  ? 1150 GLU A  CD  1 
ATOM   8561  O OE1 . GLU A  1 1150 ? 198.860 210.611 288.290 1.00 81.62  ? 1150 GLU A  OE1 1 
ATOM   8562  O OE2 . GLU A  1 1150 ? 200.420 209.371 287.369 1.00 82.86  ? 1150 GLU A  OE2 1 
ATOM   8563  N N   . GLU A  1 1151 ? 195.389 205.974 287.819 1.00 88.09  ? 1151 GLU A  N   1 
ATOM   8564  C CA  . GLU A  1 1151 ? 194.307 205.257 288.486 1.00 88.06  ? 1151 GLU A  CA  1 
ATOM   8565  C C   . GLU A  1 1151 ? 194.872 204.310 289.534 1.00 91.11  ? 1151 GLU A  C   1 
ATOM   8566  O O   . GLU A  1 1151 ? 194.347 204.206 290.648 1.00 92.46  ? 1151 GLU A  O   1 
ATOM   8567  C CB  . GLU A  1 1151 ? 193.469 204.493 287.458 1.00 88.41  ? 1151 GLU A  CB  1 
ATOM   8568  C CG  . GLU A  1 1151 ? 192.430 203.546 288.060 1.00 87.68  ? 1151 GLU A  CG  1 
ATOM   8569  C CD  . GLU A  1 1151 ? 191.687 202.749 287.006 1.00 82.45  ? 1151 GLU A  CD  1 
ATOM   8570  O OE1 . GLU A  1 1151 ? 191.777 203.108 285.813 1.00 81.76  ? 1151 GLU A  OE1 1 
ATOM   8571  O OE2 . GLU A  1 1151 ? 191.019 201.758 287.368 1.00 79.48  ? 1151 GLU A  OE2 1 
ATOM   8572  N N   . LEU A  1 1152 ? 195.954 203.612 289.189 1.00 94.01  ? 1152 LEU A  N   1 
ATOM   8573  C CA  . LEU A  1 1152 ? 196.604 202.732 290.151 1.00 91.67  ? 1152 LEU A  CA  1 
ATOM   8574  C C   . LEU A  1 1152 ? 197.159 203.522 291.329 1.00 88.31  ? 1152 LEU A  C   1 
ATOM   8575  O O   . LEU A  1 1152 ? 197.045 203.094 292.484 1.00 84.29  ? 1152 LEU A  O   1 
ATOM   8576  C CB  . LEU A  1 1152 ? 197.715 201.944 289.455 1.00 88.07  ? 1152 LEU A  CB  1 
ATOM   8577  C CG  . LEU A  1 1152 ? 198.606 201.049 290.317 1.00 89.55  ? 1152 LEU A  CG  1 
ATOM   8578  C CD1 . LEU A  1 1152 ? 197.781 199.982 291.012 1.00 88.94  ? 1152 LEU A  CD1 1 
ATOM   8579  C CD2 . LEU A  1 1152 ? 199.697 200.418 289.463 1.00 83.08  ? 1152 LEU A  CD2 1 
ATOM   8580  N N   . ASP A  1 1153 ? 197.764 204.682 291.058 1.00 90.89  ? 1153 ASP A  N   1 
ATOM   8581  C CA  . ASP A  1 1153 ? 198.401 205.446 292.124 1.00 94.66  ? 1153 ASP A  CA  1 
ATOM   8582  C C   . ASP A  1 1153 ? 197.384 205.912 293.156 1.00 92.74  ? 1153 ASP A  C   1 
ATOM   8583  O O   . ASP A  1 1153 ? 197.623 205.801 294.365 1.00 95.11  ? 1153 ASP A  O   1 
ATOM   8584  C CB  . ASP A  1 1153 ? 199.144 206.644 291.536 1.00 85.76  ? 1153 ASP A  CB  1 
ATOM   8585  C CG  . ASP A  1 1153 ? 200.043 207.324 292.548 1.00 87.28  ? 1153 ASP A  CG  1 
ATOM   8586  O OD1 . ASP A  1 1153 ? 200.237 206.760 293.646 1.00 90.66  ? 1153 ASP A  OD1 1 
ATOM   8587  O OD2 . ASP A  1 1153 ? 200.553 208.424 292.250 1.00 88.45  ? 1153 ASP A  OD2 1 
ATOM   8588  N N   . LYS A  1 1154 ? 196.241 206.432 292.704 1.00 90.92  ? 1154 LYS A  N   1 
ATOM   8589  C CA  . LYS A  1 1154 ? 195.228 206.892 293.647 1.00 94.28  ? 1154 LYS A  CA  1 
ATOM   8590  C C   . LYS A  1 1154 ? 194.655 205.730 294.445 1.00 91.94  ? 1154 LYS A  C   1 
ATOM   8591  O O   . LYS A  1 1154 ? 194.285 205.895 295.613 1.00 92.90  ? 1154 LYS A  O   1 
ATOM   8592  C CB  . LYS A  1 1154 ? 194.121 207.645 292.911 1.00 93.80  ? 1154 LYS A  CB  1 
ATOM   8593  C CG  . LYS A  1 1154 ? 194.519 209.057 292.507 1.00 84.65  ? 1154 LYS A  CG  1 
ATOM   8594  C CD  . LYS A  1 1154 ? 193.314 209.912 292.153 1.00 76.93  ? 1154 LYS A  CD  1 
ATOM   8595  C CE  . LYS A  1 1154 ? 193.733 211.339 291.835 1.00 75.32  ? 1154 LYS A  CE  1 
ATOM   8596  N NZ  . LYS A  1 1154 ? 192.561 212.219 291.576 1.00 74.06  ? 1154 LYS A  NZ  1 
ATOM   8597  N N   . TYR A  1 1155 ? 194.569 204.547 293.834 1.00 91.80  ? 1155 TYR A  N   1 
ATOM   8598  C CA  . TYR A  1 1155 ? 194.142 203.370 294.579 1.00 97.91  ? 1155 TYR A  CA  1 
ATOM   8599  C C   . TYR A  1 1155 ? 195.082 203.097 295.746 1.00 92.74  ? 1155 TYR A  C   1 
ATOM   8600  O O   . TYR A  1 1155 ? 194.638 202.862 296.875 1.00 88.63  ? 1155 TYR A  O   1 
ATOM   8601  C CB  . TYR A  1 1155 ? 194.071 202.155 293.652 1.00 90.94  ? 1155 TYR A  CB  1 
ATOM   8602  C CG  . TYR A  1 1155 ? 192.715 201.928 293.015 1.00 87.65  ? 1155 TYR A  CG  1 
ATOM   8603  C CD1 . TYR A  1 1155 ? 191.810 202.972 292.854 1.00 91.39  ? 1155 TYR A  CD1 1 
ATOM   8604  C CD2 . TYR A  1 1155 ? 192.335 200.665 292.582 1.00 93.61  ? 1155 TYR A  CD2 1 
ATOM   8605  C CE1 . TYR A  1 1155 ? 190.574 202.763 292.277 1.00 90.35  ? 1155 TYR A  CE1 1 
ATOM   8606  C CE2 . TYR A  1 1155 ? 191.100 200.449 292.004 1.00 99.05  ? 1155 TYR A  CE2 1 
ATOM   8607  C CZ  . TYR A  1 1155 ? 190.224 201.501 291.854 1.00 96.96  ? 1155 TYR A  CZ  1 
ATOM   8608  O OH  . TYR A  1 1155 ? 188.992 201.292 291.279 1.00 93.55  ? 1155 TYR A  OH  1 
ATOM   8609  N N   . PHE A  1 1156 ? 196.392 203.132 295.493 1.00 93.17  ? 1156 PHE A  N   1 
ATOM   8610  C CA  . PHE A  1 1156 ? 197.352 202.917 296.569 1.00 94.49  ? 1156 PHE A  CA  1 
ATOM   8611  C C   . PHE A  1 1156 ? 197.260 204.025 297.611 1.00 95.19  ? 1156 PHE A  C   1 
ATOM   8612  O O   . PHE A  1 1156 ? 197.277 203.760 298.819 1.00 94.40  ? 1156 PHE A  O   1 
ATOM   8613  C CB  . PHE A  1 1156 ? 198.769 202.830 296.000 1.00 90.56  ? 1156 PHE A  CB  1 
ATOM   8614  C CG  . PHE A  1 1156 ? 199.157 201.451 295.541 1.00 96.56  ? 1156 PHE A  CG  1 
ATOM   8615  C CD1 . PHE A  1 1156 ? 199.242 200.405 296.444 1.00 96.26  ? 1156 PHE A  CD1 1 
ATOM   8616  C CD2 . PHE A  1 1156 ? 199.449 201.203 294.210 1.00 88.75  ? 1156 PHE A  CD2 1 
ATOM   8617  C CE1 . PHE A  1 1156 ? 199.599 199.140 296.030 1.00 87.87  ? 1156 PHE A  CE1 1 
ATOM   8618  C CE2 . PHE A  1 1156 ? 199.811 199.938 293.792 1.00 84.13  ? 1156 PHE A  CE2 1 
ATOM   8619  C CZ  . PHE A  1 1156 ? 199.885 198.906 294.702 1.00 85.42  ? 1156 PHE A  CZ  1 
ATOM   8620  N N   . LYS A  1 1157 ? 197.163 205.277 297.160 1.00 94.09  ? 1157 LYS A  N   1 
ATOM   8621  C CA  . LYS A  1 1157 ? 197.092 206.395 298.097 1.00 92.82  ? 1157 LYS A  CA  1 
ATOM   8622  C C   . LYS A  1 1157 ? 195.897 206.250 299.029 1.00 94.54  ? 1157 LYS A  C   1 
ATOM   8623  O O   . LYS A  1 1157 ? 196.021 206.408 300.249 1.00 90.14  ? 1157 LYS A  O   1 
ATOM   8624  C CB  . LYS A  1 1157 ? 197.015 207.717 297.335 1.00 92.55  ? 1157 LYS A  CB  1 
ATOM   8625  C CG  . LYS A  1 1157 ? 198.297 208.530 297.371 1.00 88.71  ? 1157 LYS A  CG  1 
ATOM   8626  C CD  . LYS A  1 1157 ? 199.410 207.864 296.581 1.00 85.98  ? 1157 LYS A  CD  1 
ATOM   8627  C CE  . LYS A  1 1157 ? 200.594 208.802 296.404 1.00 82.35  ? 1157 LYS A  CE  1 
ATOM   8628  N NZ  . LYS A  1 1157 ? 201.694 208.183 295.614 1.00 78.67  ? 1157 LYS A  NZ  1 
ATOM   8629  N N   . ASN A  1 1158 ? 194.723 205.955 298.467 1.00 96.23  ? 1158 ASN A  N   1 
ATOM   8630  C CA  . ASN A  1 1158 ? 193.535 205.747 299.284 1.00 96.14  ? 1158 ASN A  CA  1 
ATOM   8631  C C   . ASN A  1 1158 ? 193.685 204.547 300.208 1.00 94.23  ? 1158 ASN A  C   1 
ATOM   8632  O O   . ASN A  1 1158 ? 193.121 204.553 301.307 1.00 90.46  ? 1158 ASN A  O   1 
ATOM   8633  C CB  . ASN A  1 1158 ? 192.314 205.572 298.375 1.00 100.24 ? 1158 ASN A  CB  1 
ATOM   8634  C CG  . ASN A  1 1158 ? 191.015 205.416 299.146 1.00 104.79 ? 1158 ASN A  CG  1 
ATOM   8635  O OD1 . ASN A  1 1158 ? 190.953 204.713 300.153 1.00 100.81 ? 1158 ASN A  OD1 1 
ATOM   8636  N ND2 . ASN A  1 1158 ? 189.964 206.076 298.665 1.00 108.56 ? 1158 ASN A  ND2 1 
ATOM   8637  N N   . HIS A  1 1159 ? 194.455 203.534 299.804 1.00 95.01  ? 1159 HIS A  N   1 
ATOM   8638  C CA  . HIS A  1 1159 ? 194.622 202.352 300.639 1.00 96.29  ? 1159 HIS A  CA  1 
ATOM   8639  C C   . HIS A  1 1159 ? 195.499 202.630 301.851 1.00 90.71  ? 1159 HIS A  C   1 
ATOM   8640  O O   . HIS A  1 1159 ? 195.400 201.914 302.852 1.00 89.51  ? 1159 HIS A  O   1 
ATOM   8641  C CB  . HIS A  1 1159 ? 195.220 201.211 299.808 1.00 93.55  ? 1159 HIS A  CB  1 
ATOM   8642  C CG  . HIS A  1 1159 ? 195.117 199.863 300.455 1.00 99.23  ? 1159 HIS A  CG  1 
ATOM   8643  N ND1 . HIS A  1 1159 ? 195.757 198.751 299.952 1.00 97.86  ? 1159 HIS A  ND1 1 
ATOM   8644  C CD2 . HIS A  1 1159 ? 194.443 199.444 301.553 1.00 102.02 ? 1159 HIS A  CD2 1 
ATOM   8645  C CE1 . HIS A  1 1159 ? 195.486 197.706 300.715 1.00 97.08  ? 1159 HIS A  CE1 1 
ATOM   8646  N NE2 . HIS A  1 1159 ? 194.691 198.100 301.693 1.00 98.76  ? 1159 HIS A  NE2 1 
ATOM   8647  N N   . THR A  1 1160 ? 196.348 203.658 301.782 1.00 94.52  ? 1160 THR A  N   1 
ATOM   8648  C CA  . THR A  1 1160 ? 197.107 204.075 302.955 1.00 92.72  ? 1160 THR A  CA  1 
ATOM   8649  C C   . THR A  1 1160 ? 196.216 204.770 303.978 1.00 94.46  ? 1160 THR A  C   1 
ATOM   8650  O O   . THR A  1 1160 ? 196.516 204.748 305.177 1.00 88.72  ? 1160 THR A  O   1 
ATOM   8651  C CB  . THR A  1 1160 ? 198.243 205.014 302.544 1.00 92.55  ? 1160 THR A  CB  1 
ATOM   8652  O OG1 . THR A  1 1160 ? 197.696 206.191 301.932 1.00 94.93  ? 1160 THR A  OG1 1 
ATOM   8653  C CG2 . THR A  1 1160 ? 199.192 204.328 301.567 1.00 83.89  ? 1160 THR A  CG2 1 
ATOM   8654  N N   . SER A  1 1161 ? 195.120 205.388 303.522 1.00 102.66 ? 1161 SER A  N   1 
ATOM   8655  C CA  . SER A  1 1161 ? 194.332 206.238 304.414 1.00 96.53  ? 1161 SER A  CA  1 
ATOM   8656  C C   . SER A  1 1161 ? 193.735 205.465 305.582 1.00 93.75  ? 1161 SER A  C   1 
ATOM   8657  O O   . SER A  1 1161 ? 193.908 205.900 306.735 1.00 93.44  ? 1161 SER A  O   1 
ATOM   8658  C CB  . SER A  1 1161 ? 193.245 206.956 303.613 1.00 94.63  ? 1161 SER A  CB  1 
ATOM   8659  O OG  . SER A  1 1161 ? 193.804 207.754 302.585 1.00 99.69  ? 1161 SER A  OG  1 
ATOM   8660  N N   . PRO A  1 1162 ? 193.030 204.340 305.382 1.00 95.71  ? 1162 PRO A  N   1 
ATOM   8661  C CA  . PRO A  1 1162 ? 192.436 203.671 306.545 1.00 98.60  ? 1162 PRO A  CA  1 
ATOM   8662  C C   . PRO A  1 1162 ? 193.446 202.871 307.362 1.00 99.17  ? 1162 PRO A  C   1 
ATOM   8663  O O   . PRO A  1 1162 ? 194.096 201.983 306.812 1.00 99.23  ? 1162 PRO A  O   1 
ATOM   8664  C CB  . PRO A  1 1162 ? 191.392 202.750 305.917 1.00 96.90  ? 1162 PRO A  CB  1 
ATOM   8665  C CG  . PRO A  1 1162 ? 191.941 202.435 304.573 1.00 93.93  ? 1162 PRO A  CG  1 
ATOM   8666  C CD  . PRO A  1 1162 ? 192.654 203.680 304.119 1.00 90.39  ? 1162 PRO A  CD  1 
ATOM   8667  N N   . GLN B  1 14   ? 249.814 180.995 146.763 1.00 86.72  ? 14   GLN B  N   1 
ATOM   8668  C CA  . GLN B  1 14   ? 249.798 179.714 146.068 1.00 89.68  ? 14   GLN B  CA  1 
ATOM   8669  C C   . GLN B  1 14   ? 248.980 178.695 146.860 1.00 95.00  ? 14   GLN B  C   1 
ATOM   8670  O O   . GLN B  1 14   ? 248.039 179.058 147.564 1.00 86.65  ? 14   GLN B  O   1 
ATOM   8671  C CB  . GLN B  1 14   ? 251.225 179.203 145.849 1.00 86.53  ? 14   GLN B  CB  1 
ATOM   8672  C CG  . GLN B  1 14   ? 252.187 180.259 145.335 1.00 88.79  ? 14   GLN B  CG  1 
ATOM   8673  C CD  . GLN B  1 14   ? 253.607 179.742 145.208 1.00 90.94  ? 14   GLN B  CD  1 
ATOM   8674  O OE1 . GLN B  1 14   ? 253.847 178.535 145.251 1.00 90.43  ? 14   GLN B  OE1 1 
ATOM   8675  N NE2 . GLN B  1 14   ? 254.558 180.657 145.055 1.00 88.42  ? 14   GLN B  NE2 1 
ATOM   8676  N N   . CYS B  1 15   ? 249.337 177.418 146.739 1.00 94.10  ? 15   CYS B  N   1 
ATOM   8677  C CA  . CYS B  1 15   ? 248.624 176.364 147.448 1.00 95.00  ? 15   CYS B  CA  1 
ATOM   8678  C C   . CYS B  1 15   ? 249.569 175.197 147.694 1.00 90.56  ? 15   CYS B  C   1 
ATOM   8679  O O   . CYS B  1 15   ? 249.834 174.405 146.785 1.00 92.35  ? 15   CYS B  O   1 
ATOM   8680  C CB  . CYS B  1 15   ? 247.407 175.925 146.630 1.00 98.12  ? 15   CYS B  CB  1 
ATOM   8681  S SG  . CYS B  1 15   ? 245.860 175.600 147.526 1.00 108.28 ? 15   CYS B  SG  1 
ATOM   8682  N N   . VAL B  1 16   ? 250.096 175.092 148.911 1.00 93.80  ? 16   VAL B  N   1 
ATOM   8683  C CA  . VAL B  1 16   ? 251.048 174.043 149.259 1.00 91.33  ? 16   VAL B  CA  1 
ATOM   8684  C C   . VAL B  1 16   ? 250.724 173.517 150.649 1.00 86.72  ? 16   VAL B  C   1 
ATOM   8685  O O   . VAL B  1 16   ? 250.359 174.281 151.550 1.00 85.15  ? 16   VAL B  O   1 
ATOM   8686  C CB  . VAL B  1 16   ? 252.502 174.547 149.194 1.00 86.96  ? 16   VAL B  CB  1 
ATOM   8687  C CG1 . VAL B  1 16   ? 253.453 173.443 149.615 1.00 86.56  ? 16   VAL B  CG1 1 
ATOM   8688  C CG2 . VAL B  1 16   ? 252.830 175.029 147.789 1.00 87.44  ? 16   VAL B  CG2 1 
ATOM   8689  N N   . ASN B  1 17   ? 250.854 172.206 150.813 1.00 84.26  ? 17   ASN B  N   1 
ATOM   8690  C CA  . ASN B  1 17   ? 250.589 171.535 152.079 1.00 85.35  ? 17   ASN B  CA  1 
ATOM   8691  C C   . ASN B  1 17   ? 251.888 171.366 152.862 1.00 88.64  ? 17   ASN B  C   1 
ATOM   8692  O O   . ASN B  1 17   ? 252.783 170.630 152.432 1.00 91.95  ? 17   ASN B  O   1 
ATOM   8693  C CB  . ASN B  1 17   ? 249.955 170.171 151.826 1.00 85.13  ? 17   ASN B  CB  1 
ATOM   8694  C CG  . ASN B  1 17   ? 248.496 170.258 151.455 1.00 85.10  ? 17   ASN B  CG  1 
ATOM   8695  O OD1 . ASN B  1 17   ? 247.810 171.229 151.772 1.00 84.05  ? 17   ASN B  OD1 1 
ATOM   8696  N ND2 . ASN B  1 17   ? 248.009 169.226 150.777 1.00 91.26  ? 17   ASN B  ND2 1 
ATOM   8697  N N   . LEU B  1 18   ? 251.980 172.021 154.019 1.00 86.34  ? 18   LEU B  N   1 
ATOM   8698  C CA  . LEU B  1 18   ? 253.168 171.943 154.876 1.00 81.01  ? 18   LEU B  CA  1 
ATOM   8699  C C   . LEU B  1 18   ? 252.938 170.912 155.986 1.00 82.72  ? 18   LEU B  C   1 
ATOM   8700  O O   . LEU B  1 18   ? 252.492 171.218 157.092 1.00 85.85  ? 18   LEU B  O   1 
ATOM   8701  C CB  . LEU B  1 18   ? 253.504 173.315 155.442 1.00 78.81  ? 18   LEU B  CB  1 
ATOM   8702  C CG  . LEU B  1 18   ? 254.361 174.221 154.556 1.00 75.65  ? 18   LEU B  CG  1 
ATOM   8703  C CD1 . LEU B  1 18   ? 253.744 174.387 153.176 1.00 83.29  ? 18   LEU B  CD1 1 
ATOM   8704  C CD2 . LEU B  1 18   ? 254.558 175.571 155.222 1.00 69.22  ? 18   LEU B  CD2 1 
ATOM   8705  N N   . THR B  1 19   ? 253.257 169.658 155.657 1.00 83.13  ? 19   THR B  N   1 
ATOM   8706  C CA  . THR B  1 19   ? 252.895 168.520 156.497 1.00 87.06  ? 19   THR B  CA  1 
ATOM   8707  C C   . THR B  1 19   ? 253.835 168.278 157.676 1.00 85.71  ? 19   THR B  C   1 
ATOM   8708  O O   . THR B  1 19   ? 253.479 167.497 158.565 1.00 86.36  ? 19   THR B  O   1 
ATOM   8709  C CB  . THR B  1 19   ? 252.830 167.255 155.639 1.00 86.20  ? 19   THR B  CB  1 
ATOM   8710  O OG1 . THR B  1 19   ? 254.073 167.073 154.947 1.00 86.96  ? 19   THR B  OG1 1 
ATOM   8711  C CG2 . THR B  1 19   ? 251.698 167.358 154.629 1.00 86.59  ? 19   THR B  CG2 1 
ATOM   8712  N N   . THR B  1 20   ? 255.005 168.908 157.725 1.00 85.52  ? 20   THR B  N   1 
ATOM   8713  C CA  . THR B  1 20   ? 255.986 168.595 158.769 1.00 89.70  ? 20   THR B  CA  1 
ATOM   8714  C C   . THR B  1 20   ? 255.512 169.155 160.106 1.00 87.72  ? 20   THR B  C   1 
ATOM   8715  O O   . THR B  1 20   ? 255.607 170.358 160.357 1.00 87.78  ? 20   THR B  O   1 
ATOM   8716  C CB  . THR B  1 20   ? 257.356 169.156 158.406 1.00 83.48  ? 20   THR B  CB  1 
ATOM   8717  O OG1 . THR B  1 20   ? 257.256 170.568 158.185 1.00 83.65  ? 20   THR B  OG1 1 
ATOM   8718  C CG2 . THR B  1 20   ? 257.901 168.482 157.159 1.00 83.88  ? 20   THR B  CG2 1 
ATOM   8719  N N   . ARG B  1 21   ? 255.007 168.282 160.979 1.00 86.76  ? 21   ARG B  N   1 
ATOM   8720  C CA  . ARG B  1 21   ? 254.508 168.704 162.282 1.00 84.76  ? 21   ARG B  CA  1 
ATOM   8721  C C   . ARG B  1 21   ? 254.522 167.529 163.250 1.00 84.08  ? 21   ARG B  C   1 
ATOM   8722  O O   . ARG B  1 21   ? 254.555 166.364 162.844 1.00 83.54  ? 21   ARG B  O   1 
ATOM   8723  C CB  . ARG B  1 21   ? 253.092 169.276 162.180 1.00 84.51  ? 21   ARG B  CB  1 
ATOM   8724  C CG  . ARG B  1 21   ? 253.031 170.785 162.063 1.00 78.68  ? 21   ARG B  CG  1 
ATOM   8725  C CD  . ARG B  1 21   ? 251.595 171.261 162.098 1.00 79.17  ? 21   ARG B  CD  1 
ATOM   8726  N NE  . ARG B  1 21   ? 250.815 170.710 160.993 1.00 83.09  ? 21   ARG B  NE  1 
ATOM   8727  C CZ  . ARG B  1 21   ? 250.646 171.304 159.815 1.00 88.63  ? 21   ARG B  CZ  1 
ATOM   8728  N NH1 . ARG B  1 21   ? 251.198 172.485 159.562 1.00 84.88  ? 21   ARG B  NH1 1 
ATOM   8729  N NH2 . ARG B  1 21   ? 249.918 170.710 158.881 1.00 81.29  ? 21   ARG B  NH2 1 
ATOM   8730  N N   . THR B  1 22   ? 254.494 167.859 164.542 1.00 82.13  ? 22   THR B  N   1 
ATOM   8731  C CA  . THR B  1 22   ? 254.411 166.871 165.611 1.00 86.20  ? 22   THR B  CA  1 
ATOM   8732  C C   . THR B  1 22   ? 252.984 166.807 166.142 1.00 87.58  ? 22   THR B  C   1 
ATOM   8733  O O   . THR B  1 22   ? 252.334 167.843 166.316 1.00 90.74  ? 22   THR B  O   1 
ATOM   8734  C CB  . THR B  1 22   ? 255.372 167.218 166.749 1.00 81.66  ? 22   THR B  CB  1 
ATOM   8735  O OG1 . THR B  1 22   ? 256.677 167.481 166.218 1.00 76.18  ? 22   THR B  OG1 1 
ATOM   8736  C CG2 . THR B  1 22   ? 255.455 166.071 167.751 1.00 81.56  ? 22   THR B  CG2 1 
ATOM   8737  N N   . GLN B  1 23   ? 252.504 165.593 166.403 1.00 80.52  ? 23   GLN B  N   1 
ATOM   8738  C CA  . GLN B  1 23   ? 251.140 165.390 166.881 1.00 80.73  ? 23   GLN B  CA  1 
ATOM   8739  C C   . GLN B  1 23   ? 251.067 165.636 168.384 1.00 84.96  ? 23   GLN B  C   1 
ATOM   8740  O O   . GLN B  1 23   ? 251.781 164.991 169.160 1.00 84.20  ? 23   GLN B  O   1 
ATOM   8741  C CB  . GLN B  1 23   ? 250.671 163.976 166.548 1.00 80.49  ? 23   GLN B  CB  1 
ATOM   8742  C CG  . GLN B  1 23   ? 250.516 163.711 165.062 1.00 79.11  ? 23   GLN B  CG  1 
ATOM   8743  C CD  . GLN B  1 23   ? 249.432 164.559 164.437 1.00 78.80  ? 23   GLN B  CD  1 
ATOM   8744  O OE1 . GLN B  1 23   ? 248.693 165.255 165.135 1.00 86.45  ? 23   GLN B  OE1 1 
ATOM   8745  N NE2 . GLN B  1 23   ? 249.327 164.509 163.113 1.00 75.28  ? 23   GLN B  NE2 1 
ATOM   8746  N N   . LEU B  1 24   ? 250.196 166.548 168.794 1.00 91.45  ? 24   LEU B  N   1 
ATOM   8747  C CA  . LEU B  1 24   ? 249.952 166.866 170.192 1.00 89.95  ? 24   LEU B  CA  1 
ATOM   8748  C C   . LEU B  1 24   ? 248.458 166.825 170.465 1.00 86.78  ? 24   LEU B  C   1 
ATOM   8749  O O   . LEU B  1 24   ? 247.645 166.982 169.547 1.00 87.43  ? 24   LEU B  O   1 
ATOM   8750  C CB  . LEU B  1 24   ? 250.502 168.253 170.563 1.00 83.54  ? 24   LEU B  CB  1 
ATOM   8751  C CG  . LEU B  1 24   ? 251.978 168.362 170.958 1.00 83.54  ? 24   LEU B  CG  1 
ATOM   8752  C CD1 . LEU B  1 24   ? 252.272 167.502 172.178 1.00 76.24  ? 24   LEU B  CD1 1 
ATOM   8753  C CD2 . LEU B  1 24   ? 252.891 167.989 169.802 1.00 81.69  ? 24   LEU B  CD2 1 
ATOM   8754  N N   . PRO B  1 25   ? 248.062 166.607 171.716 1.00 87.02  ? 25   PRO B  N   1 
ATOM   8755  C CA  . PRO B  1 25   ? 246.637 166.577 172.050 1.00 82.89  ? 25   PRO B  CA  1 
ATOM   8756  C C   . PRO B  1 25   ? 246.061 167.979 172.131 1.00 86.54  ? 25   PRO B  C   1 
ATOM   8757  O O   . PRO B  1 25   ? 246.808 168.967 172.202 1.00 87.80  ? 25   PRO B  O   1 
ATOM   8758  C CB  . PRO B  1 25   ? 246.616 165.884 173.419 1.00 83.37  ? 25   PRO B  CB  1 
ATOM   8759  C CG  . PRO B  1 25   ? 247.915 166.262 174.032 1.00 83.14  ? 25   PRO B  CG  1 
ATOM   8760  C CD  . PRO B  1 25   ? 248.908 166.361 172.898 1.00 83.43  ? 25   PRO B  CD  1 
ATOM   8761  N N   . PRO B  1 26   ? 244.732 168.110 172.127 1.00 84.95  ? 26   PRO B  N   1 
ATOM   8762  C CA  . PRO B  1 26   ? 244.119 169.440 172.242 1.00 84.40  ? 26   PRO B  CA  1 
ATOM   8763  C C   . PRO B  1 26   ? 244.255 170.039 173.634 1.00 85.92  ? 26   PRO B  C   1 
ATOM   8764  O O   . PRO B  1 26   ? 243.648 169.548 174.591 1.00 89.02  ? 26   PRO B  O   1 
ATOM   8765  C CB  . PRO B  1 26   ? 242.650 169.177 171.889 1.00 80.58  ? 26   PRO B  CB  1 
ATOM   8766  C CG  . PRO B  1 26   ? 242.428 167.750 172.255 1.00 81.13  ? 26   PRO B  CG  1 
ATOM   8767  C CD  . PRO B  1 26   ? 243.724 167.048 171.963 1.00 85.43  ? 26   PRO B  CD  1 
ATOM   8768  N N   . ALA B  1 27   ? 245.049 171.099 173.757 1.00 82.78  ? 27   ALA B  N   1 
ATOM   8769  C CA  . ALA B  1 27   ? 245.198 171.782 175.032 1.00 80.45  ? 27   ALA B  CA  1 
ATOM   8770  C C   . ALA B  1 27   ? 243.983 172.659 175.324 1.00 79.50  ? 27   ALA B  C   1 
ATOM   8771  O O   . ALA B  1 27   ? 243.207 173.014 174.434 1.00 82.82  ? 27   ALA B  O   1 
ATOM   8772  C CB  . ALA B  1 27   ? 246.466 172.632 175.041 1.00 75.62  ? 27   ALA B  CB  1 
ATOM   8773  N N   . TYR B  1 28   ? 243.824 173.005 176.601 1.00 79.88  ? 28   TYR B  N   1 
ATOM   8774  C CA  . TYR B  1 28   ? 242.735 173.865 177.039 1.00 74.64  ? 28   TYR B  CA  1 
ATOM   8775  C C   . TYR B  1 28   ? 243.211 174.723 178.203 1.00 73.42  ? 28   TYR B  C   1 
ATOM   8776  O O   . TYR B  1 28   ? 244.193 174.396 178.875 1.00 79.60  ? 28   TYR B  O   1 
ATOM   8777  C CB  . TYR B  1 28   ? 241.506 173.048 177.454 1.00 73.98  ? 28   TYR B  CB  1 
ATOM   8778  C CG  . TYR B  1 28   ? 241.752 172.143 178.639 1.00 81.15  ? 28   TYR B  CG  1 
ATOM   8779  C CD1 . TYR B  1 28   ? 241.556 172.596 179.934 1.00 82.74  ? 28   TYR B  CD1 1 
ATOM   8780  C CD2 . TYR B  1 28   ? 242.177 170.834 178.463 1.00 83.47  ? 28   TYR B  CD2 1 
ATOM   8781  C CE1 . TYR B  1 28   ? 241.778 171.772 181.018 1.00 88.20  ? 28   TYR B  CE1 1 
ATOM   8782  C CE2 . TYR B  1 28   ? 242.398 170.005 179.542 1.00 88.49  ? 28   TYR B  CE2 1 
ATOM   8783  C CZ  . TYR B  1 28   ? 242.198 170.478 180.816 1.00 90.17  ? 28   TYR B  CZ  1 
ATOM   8784  O OH  . TYR B  1 28   ? 242.419 169.652 181.895 1.00 89.50  ? 28   TYR B  OH  1 
ATOM   8785  N N   . THR B  1 29   ? 242.510 175.833 178.425 1.00 71.01  ? 29   THR B  N   1 
ATOM   8786  C CA  . THR B  1 29   ? 242.794 176.711 179.552 1.00 69.22  ? 29   THR B  CA  1 
ATOM   8787  C C   . THR B  1 29   ? 241.509 177.424 179.954 1.00 64.56  ? 29   THR B  C   1 
ATOM   8788  O O   . THR B  1 29   ? 240.478 177.319 179.286 1.00 59.46  ? 29   THR B  O   1 
ATOM   8789  C CB  . THR B  1 29   ? 243.904 177.718 179.225 1.00 68.05  ? 29   THR B  CB  1 
ATOM   8790  O OG1 . THR B  1 29   ? 244.117 178.576 180.353 1.00 60.68  ? 29   THR B  OG1 1 
ATOM   8791  C CG2 . THR B  1 29   ? 243.538 178.562 178.018 1.00 62.94  ? 29   THR B  CG2 1 
ATOM   8792  N N   . ASN B  1 30   ? 241.578 178.138 181.074 1.00 67.47  ? 30   ASN B  N   1 
ATOM   8793  C CA  . ASN B  1 30   ? 240.403 178.751 181.681 1.00 61.78  ? 30   ASN B  CA  1 
ATOM   8794  C C   . ASN B  1 30   ? 240.312 180.228 181.317 1.00 63.00  ? 30   ASN B  C   1 
ATOM   8795  O O   . ASN B  1 30   ? 241.278 180.979 181.489 1.00 58.14  ? 30   ASN B  O   1 
ATOM   8796  C CB  . ASN B  1 30   ? 240.449 178.591 183.201 1.00 58.22  ? 30   ASN B  CB  1 
ATOM   8797  C CG  . ASN B  1 30   ? 239.163 179.019 183.873 1.00 62.72  ? 30   ASN B  CG  1 
ATOM   8798  O OD1 . ASN B  1 30   ? 238.970 180.194 184.176 1.00 65.72  ? 30   ASN B  OD1 1 
ATOM   8799  N ND2 . ASN B  1 30   ? 238.277 178.063 184.117 1.00 64.65  ? 30   ASN B  ND2 1 
ATOM   8800  N N   . SER B  1 31   ? 239.147 180.637 180.809 1.00 63.62  ? 31   SER B  N   1 
ATOM   8801  C CA  . SER B  1 31   ? 238.836 182.048 180.567 1.00 60.71  ? 31   SER B  CA  1 
ATOM   8802  C C   . SER B  1 31   ? 238.257 182.644 181.847 1.00 59.59  ? 31   SER B  C   1 
ATOM   8803  O O   . SER B  1 31   ? 237.052 182.601 182.109 1.00 59.02  ? 31   SER B  O   1 
ATOM   8804  C CB  . SER B  1 31   ? 237.871 182.198 179.400 1.00 51.32  ? 31   SER B  CB  1 
ATOM   8805  O OG  . SER B  1 31   ? 236.702 181.420 179.602 1.00 58.11  ? 31   SER B  OG  1 
ATOM   8806  N N   . PHE B  1 32   ? 239.145 183.206 182.667 1.00 57.18  ? 32   PHE B  N   1 
ATOM   8807  C CA  . PHE B  1 32   ? 238.736 183.693 183.979 1.00 59.44  ? 32   PHE B  CA  1 
ATOM   8808  C C   . PHE B  1 32   ? 237.677 184.784 183.865 1.00 65.47  ? 32   PHE B  C   1 
ATOM   8809  O O   . PHE B  1 32   ? 236.500 184.567 184.175 1.00 75.09  ? 32   PHE B  O   1 
ATOM   8810  C CB  . PHE B  1 32   ? 239.957 184.216 184.738 1.00 70.10  ? 32   PHE B  CB  1 
ATOM   8811  C CG  . PHE B  1 32   ? 241.131 183.284 184.711 1.00 69.92  ? 32   PHE B  CG  1 
ATOM   8812  C CD1 . PHE B  1 32   ? 241.138 182.131 185.473 1.00 67.10  ? 32   PHE B  CD1 1 
ATOM   8813  C CD2 . PHE B  1 32   ? 242.230 183.563 183.921 1.00 71.24  ? 32   PHE B  CD2 1 
ATOM   8814  C CE1 . PHE B  1 32   ? 242.217 181.276 185.445 1.00 71.17  ? 32   PHE B  CE1 1 
ATOM   8815  C CE2 . PHE B  1 32   ? 243.310 182.712 183.890 1.00 69.45  ? 32   PHE B  CE2 1 
ATOM   8816  C CZ  . PHE B  1 32   ? 243.304 181.567 184.652 1.00 68.18  ? 32   PHE B  CZ  1 
ATOM   8817  N N   . THR B  1 33   ? 238.086 185.973 183.414 1.00 61.08  ? 33   THR B  N   1 
ATOM   8818  C CA  . THR B  1 33   ? 237.233 187.154 183.355 1.00 64.63  ? 33   THR B  CA  1 
ATOM   8819  C C   . THR B  1 33   ? 237.480 187.869 182.024 1.00 63.61  ? 33   THR B  C   1 
ATOM   8820  O O   . THR B  1 33   ? 237.679 189.079 181.956 1.00 70.59  ? 33   THR B  O   1 
ATOM   8821  C CB  . THR B  1 33   ? 237.483 188.088 184.541 1.00 68.97  ? 33   THR B  CB  1 
ATOM   8822  O OG1 . THR B  1 33   ? 238.891 188.164 184.805 1.00 70.20  ? 33   THR B  OG1 1 
ATOM   8823  C CG2 . THR B  1 33   ? 236.761 187.590 185.779 1.00 65.08  ? 33   THR B  CG2 1 
ATOM   8824  N N   . ARG B  1 34   ? 237.472 187.108 180.932 1.00 58.71  ? 34   ARG B  N   1 
ATOM   8825  C CA  . ARG B  1 34   ? 237.792 187.645 179.618 1.00 58.08  ? 34   ARG B  CA  1 
ATOM   8826  C C   . ARG B  1 34   ? 236.585 187.494 178.706 1.00 59.94  ? 34   ARG B  C   1 
ATOM   8827  O O   . ARG B  1 34   ? 235.650 186.743 178.993 1.00 67.79  ? 34   ARG B  O   1 
ATOM   8828  C CB  . ARG B  1 34   ? 239.004 186.937 178.995 1.00 51.79  ? 34   ARG B  CB  1 
ATOM   8829  C CG  . ARG B  1 34   ? 240.327 187.165 179.713 1.00 64.53  ? 34   ARG B  CG  1 
ATOM   8830  C CD  . ARG B  1 34   ? 240.884 188.552 179.440 1.00 64.00  ? 34   ARG B  CD  1 
ATOM   8831  N NE  . ARG B  1 34   ? 242.276 188.678 179.864 1.00 66.87  ? 34   ARG B  NE  1 
ATOM   8832  C CZ  . ARG B  1 34   ? 243.027 189.758 179.667 1.00 67.03  ? 34   ARG B  CZ  1 
ATOM   8833  N NH1 . ARG B  1 34   ? 244.283 189.776 180.089 1.00 67.64  ? 34   ARG B  NH1 1 
ATOM   8834  N NH2 . ARG B  1 34   ? 242.529 190.820 179.048 1.00 67.79  ? 34   ARG B  NH2 1 
ATOM   8835  N N   . GLY B  1 35   ? 236.619 188.227 177.596 1.00 50.28  ? 35   GLY B  N   1 
ATOM   8836  C CA  . GLY B  1 35   ? 235.551 188.166 176.619 1.00 52.72  ? 35   GLY B  CA  1 
ATOM   8837  C C   . GLY B  1 35   ? 234.379 189.080 176.882 1.00 57.04  ? 35   GLY B  C   1 
ATOM   8838  O O   . GLY B  1 35   ? 233.302 188.860 176.320 1.00 56.72  ? 35   GLY B  O   1 
ATOM   8839  N N   . VAL B  1 36   ? 234.548 190.098 177.712 1.00 64.30  ? 36   VAL B  N   1 
ATOM   8840  C CA  . VAL B  1 36   ? 233.528 191.122 177.907 1.00 54.94  ? 36   VAL B  CA  1 
ATOM   8841  C C   . VAL B  1 36   ? 233.828 192.289 176.979 1.00 53.66  ? 36   VAL B  C   1 
ATOM   8842  O O   . VAL B  1 36   ? 234.991 192.633 176.744 1.00 56.27  ? 36   VAL B  O   1 
ATOM   8843  C CB  . VAL B  1 36   ? 233.470 191.569 179.380 1.00 53.98  ? 36   VAL B  CB  1 
ATOM   8844  C CG1 . VAL B  1 36   ? 232.728 192.888 179.511 1.00 49.28  ? 36   VAL B  CG1 1 
ATOM   8845  C CG2 . VAL B  1 36   ? 232.795 190.500 180.221 1.00 58.49  ? 36   VAL B  CG2 1 
ATOM   8846  N N   . TYR B  1 37   ? 232.773 192.898 176.441 1.00 55.98  ? 37   TYR B  N   1 
ATOM   8847  C CA  . TYR B  1 37   ? 232.905 194.004 175.507 1.00 43.62  ? 37   TYR B  CA  1 
ATOM   8848  C C   . TYR B  1 37   ? 231.787 195.003 175.758 1.00 49.61  ? 37   TYR B  C   1 
ATOM   8849  O O   . TYR B  1 37   ? 230.777 194.691 176.392 1.00 64.13  ? 37   TYR B  O   1 
ATOM   8850  C CB  . TYR B  1 37   ? 232.860 193.518 174.055 1.00 39.93  ? 37   TYR B  CB  1 
ATOM   8851  C CG  . TYR B  1 37   ? 231.653 192.667 173.749 1.00 41.75  ? 37   TYR B  CG  1 
ATOM   8852  C CD1 . TYR B  1 37   ? 231.655 191.309 174.015 1.00 43.75  ? 37   TYR B  CD1 1 
ATOM   8853  C CD2 . TYR B  1 37   ? 230.509 193.222 173.200 1.00 50.40  ? 37   TYR B  CD2 1 
ATOM   8854  C CE1 . TYR B  1 37   ? 230.557 190.530 173.741 1.00 45.67  ? 37   TYR B  CE1 1 
ATOM   8855  C CE2 . TYR B  1 37   ? 229.407 192.448 172.923 1.00 49.30  ? 37   TYR B  CE2 1 
ATOM   8856  C CZ  . TYR B  1 37   ? 229.437 191.103 173.195 1.00 54.01  ? 37   TYR B  CZ  1 
ATOM   8857  O OH  . TYR B  1 37   ? 228.340 190.323 172.922 1.00 63.30  ? 37   TYR B  OH  1 
ATOM   8858  N N   . TYR B  1 38   ? 231.981 196.211 175.256 1.00 41.52  ? 38   TYR B  N   1 
ATOM   8859  C CA  . TYR B  1 38   ? 230.976 197.255 175.393 1.00 44.12  ? 38   TYR B  CA  1 
ATOM   8860  C C   . TYR B  1 38   ? 229.738 196.890 174.585 1.00 47.81  ? 38   TYR B  C   1 
ATOM   8861  O O   . TYR B  1 38   ? 229.801 196.896 173.348 1.00 49.55  ? 38   TYR B  O   1 
ATOM   8862  C CB  . TYR B  1 38   ? 231.549 198.586 174.928 1.00 48.67  ? 38   TYR B  CB  1 
ATOM   8863  C CG  . TYR B  1 38   ? 232.608 199.127 175.852 1.00 44.40  ? 38   TYR B  CG  1 
ATOM   8864  C CD1 . TYR B  1 38   ? 233.908 198.656 175.798 1.00 45.02  ? 38   TYR B  CD1 1 
ATOM   8865  C CD2 . TYR B  1 38   ? 232.307 200.105 176.784 1.00 51.96  ? 38   TYR B  CD2 1 
ATOM   8866  C CE1 . TYR B  1 38   ? 234.876 199.144 176.641 1.00 49.17  ? 38   TYR B  CE1 1 
ATOM   8867  C CE2 . TYR B  1 38   ? 233.271 200.599 177.632 1.00 48.81  ? 38   TYR B  CE2 1 
ATOM   8868  C CZ  . TYR B  1 38   ? 234.553 200.115 177.555 1.00 45.33  ? 38   TYR B  CZ  1 
ATOM   8869  O OH  . TYR B  1 38   ? 235.524 200.600 178.397 1.00 54.83  ? 38   TYR B  OH  1 
ATOM   8870  N N   . PRO B  1 39   ? 228.601 196.581 175.216 1.00 47.44  ? 39   PRO B  N   1 
ATOM   8871  C CA  . PRO B  1 39   ? 227.461 196.065 174.445 1.00 52.15  ? 39   PRO B  CA  1 
ATOM   8872  C C   . PRO B  1 39   ? 226.806 197.099 173.554 1.00 64.34  ? 39   PRO B  C   1 
ATOM   8873  O O   . PRO B  1 39   ? 226.088 196.718 172.623 1.00 66.08  ? 39   PRO B  O   1 
ATOM   8874  C CB  . PRO B  1 39   ? 226.496 195.580 175.532 1.00 46.35  ? 39   PRO B  CB  1 
ATOM   8875  C CG  . PRO B  1 39   ? 226.794 196.443 176.698 1.00 50.03  ? 39   PRO B  CG  1 
ATOM   8876  C CD  . PRO B  1 39   ? 228.262 196.767 176.639 1.00 50.47  ? 39   PRO B  CD  1 
ATOM   8877  N N   . ASP B  1 40   ? 227.015 198.387 173.808 1.00 63.07  ? 40   ASP B  N   1 
ATOM   8878  C CA  . ASP B  1 40   ? 226.455 199.430 172.965 1.00 58.59  ? 40   ASP B  CA  1 
ATOM   8879  C C   . ASP B  1 40   ? 227.350 200.655 173.051 1.00 56.68  ? 40   ASP B  C   1 
ATOM   8880  O O   . ASP B  1 40   ? 228.193 200.776 173.942 1.00 58.58  ? 40   ASP B  O   1 
ATOM   8881  C CB  . ASP B  1 40   ? 225.017 199.763 173.370 1.00 69.12  ? 40   ASP B  CB  1 
ATOM   8882  C CG  . ASP B  1 40   ? 224.913 200.234 174.802 1.00 61.85  ? 40   ASP B  CG  1 
ATOM   8883  O OD1 . ASP B  1 40   ? 225.965 200.370 175.460 1.00 62.48  ? 40   ASP B  OD1 1 
ATOM   8884  O OD2 . ASP B  1 40   ? 223.779 200.464 175.273 1.00 54.48  ? 40   ASP B  OD2 1 
ATOM   8885  N N   . LYS B  1 41   ? 227.151 201.573 172.109 1.00 57.57  ? 41   LYS B  N   1 
ATOM   8886  C CA  . LYS B  1 41   ? 227.979 202.762 171.984 1.00 57.84  ? 41   LYS B  CA  1 
ATOM   8887  C C   . LYS B  1 41   ? 227.470 203.926 172.831 1.00 66.78  ? 41   LYS B  C   1 
ATOM   8888  O O   . LYS B  1 41   ? 227.746 205.085 172.507 1.00 61.23  ? 41   LYS B  O   1 
ATOM   8889  C CB  . LYS B  1 41   ? 228.077 203.167 170.512 1.00 55.69  ? 41   LYS B  CB  1 
ATOM   8890  C CG  . LYS B  1 41   ? 228.524 202.020 169.624 1.00 65.14  ? 41   LYS B  CG  1 
ATOM   8891  C CD  . LYS B  1 41   ? 228.983 202.482 168.257 1.00 52.19  ? 41   LYS B  CD  1 
ATOM   8892  C CE  . LYS B  1 41   ? 229.556 201.314 167.470 1.00 57.57  ? 41   LYS B  CE  1 
ATOM   8893  N NZ  . LYS B  1 41   ? 230.224 201.739 166.211 1.00 53.66  ? 41   LYS B  NZ  1 
ATOM   8894  N N   . VAL B  1 42   ? 226.731 203.641 173.899 1.00 66.67  ? 42   VAL B  N   1 
ATOM   8895  C CA  . VAL B  1 42   ? 226.242 204.667 174.812 1.00 54.39  ? 42   VAL B  CA  1 
ATOM   8896  C C   . VAL B  1 42   ? 227.190 204.766 176.000 1.00 51.22  ? 42   VAL B  C   1 
ATOM   8897  O O   . VAL B  1 42   ? 227.665 203.748 176.516 1.00 52.17  ? 42   VAL B  O   1 
ATOM   8898  C CB  . VAL B  1 42   ? 224.809 204.356 175.274 1.00 49.85  ? 42   VAL B  CB  1 
ATOM   8899  C CG1 . VAL B  1 42   ? 224.462 205.173 176.508 1.00 41.99  ? 42   VAL B  CG1 1 
ATOM   8900  C CG2 . VAL B  1 42   ? 223.821 204.637 174.149 1.00 55.28  ? 42   VAL B  CG2 1 
ATOM   8901  N N   . PHE B  1 43   ? 227.475 205.993 176.425 1.00 42.25  ? 43   PHE B  N   1 
ATOM   8902  C CA  . PHE B  1 43   ? 228.345 206.225 177.569 1.00 35.16  ? 43   PHE B  CA  1 
ATOM   8903  C C   . PHE B  1 43   ? 227.589 206.012 178.875 1.00 42.65  ? 43   PHE B  C   1 
ATOM   8904  O O   . PHE B  1 43   ? 226.413 206.363 178.992 1.00 52.70  ? 43   PHE B  O   1 
ATOM   8905  C CB  . PHE B  1 43   ? 228.910 207.644 177.522 1.00 38.82  ? 43   PHE B  CB  1 
ATOM   8906  C CG  . PHE B  1 43   ? 229.845 207.960 178.650 1.00 42.11  ? 43   PHE B  CG  1 
ATOM   8907  C CD1 . PHE B  1 43   ? 229.365 208.462 179.842 1.00 42.10  ? 43   PHE B  CD1 1 
ATOM   8908  C CD2 . PHE B  1 43   ? 231.203 207.757 178.517 1.00 42.25  ? 43   PHE B  CD2 1 
ATOM   8909  C CE1 . PHE B  1 43   ? 230.220 208.749 180.877 1.00 38.85  ? 43   PHE B  CE1 1 
ATOM   8910  C CE2 . PHE B  1 43   ? 232.062 208.045 179.552 1.00 37.82  ? 43   PHE B  CE2 1 
ATOM   8911  C CZ  . PHE B  1 43   ? 231.570 208.542 180.732 1.00 38.55  ? 43   PHE B  CZ  1 
ATOM   8912  N N   . ARG B  1 44   ? 228.274 205.426 179.858 1.00 41.18  ? 44   ARG B  N   1 
ATOM   8913  C CA  . ARG B  1 44   ? 227.746 205.272 181.206 1.00 40.48  ? 44   ARG B  CA  1 
ATOM   8914  C C   . ARG B  1 44   ? 228.893 205.349 182.200 1.00 34.80  ? 44   ARG B  C   1 
ATOM   8915  O O   . ARG B  1 44   ? 229.991 204.861 181.924 1.00 38.11  ? 44   ARG B  O   1 
ATOM   8916  C CB  . ARG B  1 44   ? 227.005 203.945 181.382 1.00 42.30  ? 44   ARG B  CB  1 
ATOM   8917  C CG  . ARG B  1 44   ? 225.783 203.793 180.506 1.00 33.49  ? 44   ARG B  CG  1 
ATOM   8918  C CD  . ARG B  1 44   ? 225.154 202.430 180.691 1.00 31.60  ? 44   ARG B  CD  1 
ATOM   8919  N NE  . ARG B  1 44   ? 224.026 202.220 179.791 1.00 35.50  ? 44   ARG B  NE  1 
ATOM   8920  C CZ  . ARG B  1 44   ? 224.132 201.764 178.547 1.00 41.94  ? 44   ARG B  CZ  1 
ATOM   8921  N NH1 . ARG B  1 44   ? 225.319 201.465 178.037 1.00 45.79  ? 44   ARG B  NH1 1 
ATOM   8922  N NH2 . ARG B  1 44   ? 223.044 201.606 177.808 1.00 48.81  ? 44   ARG B  NH2 1 
ATOM   8923  N N   . SER B  1 45   ? 228.634 205.949 183.360 1.00 31.81  ? 45   SER B  N   1 
ATOM   8924  C CA  . SER B  1 45   ? 229.658 206.133 184.379 1.00 38.72  ? 45   SER B  CA  1 
ATOM   8925  C C   . SER B  1 45   ? 229.058 205.937 185.762 1.00 41.72  ? 45   SER B  C   1 
ATOM   8926  O O   . SER B  1 45   ? 227.925 206.349 186.018 1.00 42.37  ? 45   SER B  O   1 
ATOM   8927  C CB  . SER B  1 45   ? 230.284 207.527 184.293 1.00 48.82  ? 45   SER B  CB  1 
ATOM   8928  O OG  . SER B  1 45   ? 229.304 208.531 184.477 1.00 46.64  ? 45   SER B  OG  1 
ATOM   8929  N N   . SER B  1 46   ? 229.833 205.318 186.651 1.00 43.73  ? 46   SER B  N   1 
ATOM   8930  C CA  . SER B  1 46   ? 229.435 205.094 188.038 1.00 38.93  ? 46   SER B  CA  1 
ATOM   8931  C C   . SER B  1 46   ? 228.040 204.477 188.116 1.00 44.42  ? 46   SER B  C   1 
ATOM   8932  O O   . SER B  1 46   ? 227.135 204.988 188.776 1.00 54.93  ? 46   SER B  O   1 
ATOM   8933  C CB  . SER B  1 46   ? 229.499 206.397 188.836 1.00 50.62  ? 46   SER B  CB  1 
ATOM   8934  O OG  . SER B  1 46   ? 230.838 206.760 189.122 1.00 58.73  ? 46   SER B  OG  1 
ATOM   8935  N N   . VAL B  1 47   ? 227.879 203.354 187.420 1.00 45.46  ? 47   VAL B  N   1 
ATOM   8936  C CA  . VAL B  1 47   ? 226.624 202.617 187.430 1.00 41.61  ? 47   VAL B  CA  1 
ATOM   8937  C C   . VAL B  1 47   ? 226.922 201.154 187.146 1.00 39.58  ? 47   VAL B  C   1 
ATOM   8938  O O   . VAL B  1 47   ? 227.875 200.823 186.437 1.00 36.00  ? 47   VAL B  O   1 
ATOM   8939  C CB  . VAL B  1 47   ? 225.617 203.186 186.404 1.00 37.75  ? 47   VAL B  CB  1 
ATOM   8940  C CG1 . VAL B  1 47   ? 226.163 203.065 184.993 1.00 34.51  ? 47   VAL B  CG1 1 
ATOM   8941  C CG2 . VAL B  1 47   ? 224.281 202.476 186.523 1.00 47.81  ? 47   VAL B  CG2 1 
ATOM   8942  N N   . LEU B  1 48   ? 226.093 200.277 187.703 1.00 44.37  ? 48   LEU B  N   1 
ATOM   8943  C CA  . LEU B  1 48   ? 226.158 198.846 187.440 1.00 45.30  ? 48   LEU B  CA  1 
ATOM   8944  C C   . LEU B  1 48   ? 225.019 198.499 186.494 1.00 43.21  ? 48   LEU B  C   1 
ATOM   8945  O O   . LEU B  1 48   ? 223.845 198.645 186.851 1.00 50.18  ? 48   LEU B  O   1 
ATOM   8946  C CB  . LEU B  1 48   ? 226.066 198.040 188.736 1.00 43.71  ? 48   LEU B  CB  1 
ATOM   8947  C CG  . LEU B  1 48   ? 227.346 197.998 189.576 1.00 36.66  ? 48   LEU B  CG  1 
ATOM   8948  C CD1 . LEU B  1 48   ? 227.772 199.397 189.991 1.00 37.78  ? 48   LEU B  CD1 1 
ATOM   8949  C CD2 . LEU B  1 48   ? 227.164 197.119 190.797 1.00 51.58  ? 48   LEU B  CD2 1 
ATOM   8950  N N   . HIS B  1 49   ? 225.366 198.043 185.293 1.00 41.52  ? 49   HIS B  N   1 
ATOM   8951  C CA  . HIS B  1 49   ? 224.424 197.922 184.189 1.00 44.51  ? 49   HIS B  CA  1 
ATOM   8952  C C   . HIS B  1 49   ? 224.273 196.459 183.803 1.00 39.56  ? 49   HIS B  C   1 
ATOM   8953  O O   . HIS B  1 49   ? 225.254 195.806 183.433 1.00 41.64  ? 49   HIS B  O   1 
ATOM   8954  C CB  . HIS B  1 49   ? 224.895 198.749 182.992 1.00 43.40  ? 49   HIS B  CB  1 
ATOM   8955  C CG  . HIS B  1 49   ? 223.907 198.808 181.871 1.00 46.42  ? 49   HIS B  CG  1 
ATOM   8956  N ND1 . HIS B  1 49   ? 224.244 198.519 180.567 1.00 43.31  ? 49   HIS B  ND1 1 
ATOM   8957  C CD2 . HIS B  1 49   ? 222.590 199.121 181.859 1.00 47.50  ? 49   HIS B  CD2 1 
ATOM   8958  C CE1 . HIS B  1 49   ? 223.176 198.653 179.800 1.00 45.86  ? 49   HIS B  CE1 1 
ATOM   8959  N NE2 . HIS B  1 49   ? 222.160 199.017 180.560 1.00 43.84  ? 49   HIS B  NE2 1 
ATOM   8960  N N   . SER B  1 50   ? 223.048 195.952 183.893 1.00 42.23  ? 50   SER B  N   1 
ATOM   8961  C CA  . SER B  1 50   ? 222.748 194.594 183.469 1.00 43.46  ? 50   SER B  CA  1 
ATOM   8962  C C   . SER B  1 50   ? 222.471 194.554 181.973 1.00 48.01  ? 50   SER B  C   1 
ATOM   8963  O O   . SER B  1 50   ? 221.764 195.411 181.436 1.00 47.64  ? 50   SER B  O   1 
ATOM   8964  C CB  . SER B  1 50   ? 221.542 194.054 184.234 1.00 39.44  ? 50   SER B  CB  1 
ATOM   8965  O OG  . SER B  1 50   ? 221.137 192.798 183.722 1.00 35.45  ? 50   SER B  OG  1 
ATOM   8966  N N   . THR B  1 51   ? 223.034 193.553 181.300 1.00 52.75  ? 51   THR B  N   1 
ATOM   8967  C CA  . THR B  1 51   ? 222.790 193.360 179.879 1.00 49.48  ? 51   THR B  CA  1 
ATOM   8968  C C   . THR B  1 51   ? 222.820 191.873 179.562 1.00 53.09  ? 51   THR B  C   1 
ATOM   8969  O O   . THR B  1 51   ? 223.593 191.121 180.159 1.00 49.61  ? 51   THR B  O   1 
ATOM   8970  C CB  . THR B  1 51   ? 223.827 194.094 179.023 1.00 47.36  ? 51   THR B  CB  1 
ATOM   8971  O OG1 . THR B  1 51   ? 223.527 193.898 177.637 1.00 70.05  ? 51   THR B  OG1 1 
ATOM   8972  C CG2 . THR B  1 51   ? 225.226 193.574 179.312 1.00 44.56  ? 51   THR B  CG2 1 
ATOM   8973  N N   . GLN B  1 52   ? 221.975 191.460 178.621 1.00 50.81  ? 52   GLN B  N   1 
ATOM   8974  C CA  . GLN B  1 52   ? 221.947 190.089 178.125 1.00 49.27  ? 52   GLN B  CA  1 
ATOM   8975  C C   . GLN B  1 52   ? 222.400 190.099 176.673 1.00 50.51  ? 52   GLN B  C   1 
ATOM   8976  O O   . GLN B  1 52   ? 221.767 190.738 175.827 1.00 56.07  ? 52   GLN B  O   1 
ATOM   8977  C CB  . GLN B  1 52   ? 220.551 189.480 178.252 1.00 52.22  ? 52   GLN B  CB  1 
ATOM   8978  C CG  . GLN B  1 52   ? 220.453 188.047 177.747 1.00 55.86  ? 52   GLN B  CG  1 
ATOM   8979  C CD  . GLN B  1 52   ? 219.065 187.471 177.903 1.00 65.45  ? 52   GLN B  CD  1 
ATOM   8980  O OE1 . GLN B  1 52   ? 218.290 187.911 178.753 1.00 58.01  ? 52   GLN B  OE1 1 
ATOM   8981  N NE2 . GLN B  1 52   ? 218.737 186.481 177.080 1.00 72.82  ? 52   GLN B  NE2 1 
ATOM   8982  N N   . ASP B  1 53   ? 223.492 189.396 176.391 1.00 54.02  ? 53   ASP B  N   1 
ATOM   8983  C CA  . ASP B  1 53   ? 224.046 189.351 175.047 1.00 55.97  ? 53   ASP B  CA  1 
ATOM   8984  C C   . ASP B  1 53   ? 224.954 188.135 174.947 1.00 54.02  ? 53   ASP B  C   1 
ATOM   8985  O O   . ASP B  1 53   ? 225.199 187.433 175.930 1.00 59.43  ? 53   ASP B  O   1 
ATOM   8986  C CB  . ASP B  1 53   ? 224.806 190.638 174.716 1.00 57.72  ? 53   ASP B  CB  1 
ATOM   8987  C CG  . ASP B  1 53   ? 224.904 190.892 173.227 1.00 72.99  ? 53   ASP B  CG  1 
ATOM   8988  O OD1 . ASP B  1 53   ? 224.562 189.982 172.443 1.00 73.66  ? 53   ASP B  OD1 1 
ATOM   8989  O OD2 . ASP B  1 53   ? 225.316 192.005 172.840 1.00 70.35  ? 53   ASP B  OD2 1 
ATOM   8990  N N   . LEU B  1 54   ? 225.447 187.892 173.738 1.00 51.58  ? 54   LEU B  N   1 
ATOM   8991  C CA  . LEU B  1 54   ? 226.357 186.778 173.486 1.00 50.76  ? 54   LEU B  CA  1 
ATOM   8992  C C   . LEU B  1 54   ? 227.718 187.117 174.074 1.00 48.36  ? 54   LEU B  C   1 
ATOM   8993  O O   . LEU B  1 54   ? 228.476 187.908 173.509 1.00 47.53  ? 54   LEU B  O   1 
ATOM   8994  C CB  . LEU B  1 54   ? 226.449 186.502 171.991 1.00 51.05  ? 54   LEU B  CB  1 
ATOM   8995  C CG  . LEU B  1 54   ? 225.124 186.113 171.336 1.00 55.02  ? 54   LEU B  CG  1 
ATOM   8996  C CD1 . LEU B  1 54   ? 225.103 186.552 169.885 1.00 50.59  ? 54   LEU B  CD1 1 
ATOM   8997  C CD2 . LEU B  1 54   ? 224.895 184.616 171.449 1.00 49.97  ? 54   LEU B  CD2 1 
ATOM   8998  N N   . PHE B  1 55   ? 228.026 186.527 175.223 1.00 45.38  ? 55   PHE B  N   1 
ATOM   8999  C CA  . PHE B  1 55   ? 229.284 186.739 175.916 1.00 43.01  ? 55   PHE B  CA  1 
ATOM   9000  C C   . PHE B  1 55   ? 230.025 185.419 176.061 1.00 49.35  ? 55   PHE B  C   1 
ATOM   9001  O O   . PHE B  1 55   ? 229.432 184.339 176.004 1.00 51.40  ? 55   PHE B  O   1 
ATOM   9002  C CB  . PHE B  1 55   ? 229.069 187.342 177.309 1.00 54.79  ? 55   PHE B  CB  1 
ATOM   9003  C CG  . PHE B  1 55   ? 228.615 188.771 177.295 1.00 55.69  ? 55   PHE B  CG  1 
ATOM   9004  C CD1 . PHE B  1 55   ? 229.523 189.798 177.124 1.00 54.59  ? 55   PHE B  CD1 1 
ATOM   9005  C CD2 . PHE B  1 55   ? 227.282 189.088 177.472 1.00 49.68  ? 55   PHE B  CD2 1 
ATOM   9006  C CE1 . PHE B  1 55   ? 229.108 191.110 177.118 1.00 52.84  ? 55   PHE B  CE1 1 
ATOM   9007  C CE2 . PHE B  1 55   ? 226.865 190.398 177.469 1.00 49.31  ? 55   PHE B  CE2 1 
ATOM   9008  C CZ  . PHE B  1 55   ? 227.779 191.409 177.290 1.00 52.19  ? 55   PHE B  CZ  1 
ATOM   9009  N N   . LEU B  1 56   ? 231.330 185.519 176.243 1.00 53.02  ? 56   LEU B  N   1 
ATOM   9010  C CA  . LEU B  1 56   ? 232.118 184.351 176.597 1.00 60.40  ? 56   LEU B  CA  1 
ATOM   9011  C C   . LEU B  1 56   ? 231.863 184.019 178.060 1.00 66.04  ? 56   LEU B  C   1 
ATOM   9012  O O   . LEU B  1 56   ? 232.208 184.830 178.929 1.00 64.90  ? 56   LEU B  O   1 
ATOM   9013  C CB  . LEU B  1 56   ? 233.603 184.611 176.361 1.00 58.07  ? 56   LEU B  CB  1 
ATOM   9014  C CG  . LEU B  1 56   ? 234.542 183.455 176.711 1.00 56.01  ? 56   LEU B  CG  1 
ATOM   9015  C CD1 . LEU B  1 56   ? 234.334 182.291 175.758 1.00 53.13  ? 56   LEU B  CD1 1 
ATOM   9016  C CD2 . LEU B  1 56   ? 235.984 183.923 176.695 1.00 49.54  ? 56   LEU B  CD2 1 
ATOM   9017  N N   . PRO B  1 57   ? 231.280 182.866 178.388 1.00 59.89  ? 57   PRO B  N   1 
ATOM   9018  C CA  . PRO B  1 57   ? 231.014 182.563 179.797 1.00 54.57  ? 57   PRO B  CA  1 
ATOM   9019  C C   . PRO B  1 57   ? 232.288 182.587 180.627 1.00 60.86  ? 57   PRO B  C   1 
ATOM   9020  O O   . PRO B  1 57   ? 233.358 182.177 180.173 1.00 64.10  ? 57   PRO B  O   1 
ATOM   9021  C CB  . PRO B  1 57   ? 230.397 181.162 179.747 1.00 57.99  ? 57   PRO B  CB  1 
ATOM   9022  C CG  . PRO B  1 57   ? 229.815 181.057 178.388 1.00 59.83  ? 57   PRO B  CG  1 
ATOM   9023  C CD  . PRO B  1 57   ? 230.732 181.832 177.494 1.00 57.47  ? 57   PRO B  CD  1 
ATOM   9024  N N   . PHE B  1 58   ? 232.164 183.090 181.852 1.00 59.40  ? 58   PHE B  N   1 
ATOM   9025  C CA  . PHE B  1 58   ? 233.298 183.115 182.762 1.00 57.03  ? 58   PHE B  CA  1 
ATOM   9026  C C   . PHE B  1 58   ? 233.754 181.700 183.082 1.00 62.68  ? 58   PHE B  C   1 
ATOM   9027  O O   . PHE B  1 58   ? 232.943 180.781 183.217 1.00 64.28  ? 58   PHE B  O   1 
ATOM   9028  C CB  . PHE B  1 58   ? 232.928 183.839 184.059 1.00 54.54  ? 58   PHE B  CB  1 
ATOM   9029  C CG  . PHE B  1 58   ? 232.965 185.343 183.970 1.00 57.02  ? 58   PHE B  CG  1 
ATOM   9030  C CD1 . PHE B  1 58   ? 233.437 185.992 182.841 1.00 60.32  ? 58   PHE B  CD1 1 
ATOM   9031  C CD2 . PHE B  1 58   ? 232.538 186.108 185.038 1.00 59.38  ? 58   PHE B  CD2 1 
ATOM   9032  C CE1 . PHE B  1 58   ? 233.471 187.364 182.781 1.00 62.19  ? 58   PHE B  CE1 1 
ATOM   9033  C CE2 . PHE B  1 58   ? 232.572 187.481 184.979 1.00 56.00  ? 58   PHE B  CE2 1 
ATOM   9034  C CZ  . PHE B  1 58   ? 233.038 188.109 183.849 1.00 57.20  ? 58   PHE B  CZ  1 
ATOM   9035  N N   . PHE B  1 59   ? 235.069 181.531 183.202 1.00 61.53  ? 59   PHE B  N   1 
ATOM   9036  C CA  . PHE B  1 59   ? 235.661 180.269 183.633 1.00 61.81  ? 59   PHE B  CA  1 
ATOM   9037  C C   . PHE B  1 59   ? 235.263 179.106 182.724 1.00 66.16  ? 59   PHE B  C   1 
ATOM   9038  O O   . PHE B  1 59   ? 235.293 177.944 183.141 1.00 68.98  ? 59   PHE B  O   1 
ATOM   9039  C CB  . PHE B  1 59   ? 235.293 179.980 185.092 1.00 55.53  ? 59   PHE B  CB  1 
ATOM   9040  C CG  . PHE B  1 59   ? 235.880 180.969 186.060 1.00 62.35  ? 59   PHE B  CG  1 
ATOM   9041  C CD1 . PHE B  1 59   ? 235.144 182.056 186.501 1.00 60.10  ? 59   PHE B  CD1 1 
ATOM   9042  C CD2 . PHE B  1 59   ? 237.180 180.823 186.511 1.00 67.22  ? 59   PHE B  CD2 1 
ATOM   9043  C CE1 . PHE B  1 59   ? 235.692 182.969 187.381 1.00 53.56  ? 59   PHE B  CE1 1 
ATOM   9044  C CE2 . PHE B  1 59   ? 237.731 181.733 187.389 1.00 63.99  ? 59   PHE B  CE2 1 
ATOM   9045  C CZ  . PHE B  1 59   ? 236.987 182.807 187.824 1.00 56.09  ? 59   PHE B  CZ  1 
ATOM   9046  N N   . SER B  1 60   ? 235.057 179.373 181.437 1.00 58.54  ? 60   SER B  N   1 
ATOM   9047  C CA  . SER B  1 60   ? 234.765 178.297 180.482 1.00 55.23  ? 60   SER B  CA  1 
ATOM   9048  C C   . SER B  1 60   ? 236.093 177.798 179.877 1.00 65.00  ? 60   SER B  C   1 
ATOM   9049  O O   . SER B  1 60   ? 237.036 178.580 179.750 1.00 58.62  ? 60   SER B  O   1 
ATOM   9050  C CB  . SER B  1 60   ? 233.828 178.789 179.380 1.00 60.13  ? 60   SER B  CB  1 
ATOM   9051  O OG  . SER B  1 60   ? 234.215 180.072 178.918 1.00 60.57  ? 60   SER B  OG  1 
ATOM   9052  N N   . ASN B  1 61   ? 236.181 176.517 179.503 1.00 70.31  ? 61   ASN B  N   1 
ATOM   9053  C CA  . ASN B  1 61   ? 237.423 175.988 178.937 1.00 68.17  ? 61   ASN B  CA  1 
ATOM   9054  C C   . ASN B  1 61   ? 237.613 176.540 177.530 1.00 63.15  ? 61   ASN B  C   1 
ATOM   9055  O O   . ASN B  1 61   ? 237.056 176.013 176.566 1.00 62.89  ? 61   ASN B  O   1 
ATOM   9056  C CB  . ASN B  1 61   ? 237.412 174.460 178.912 1.00 76.72  ? 61   ASN B  CB  1 
ATOM   9057  C CG  . ASN B  1 61   ? 237.001 173.856 180.238 1.00 83.76  ? 61   ASN B  CG  1 
ATOM   9058  O OD1 . ASN B  1 61   ? 236.499 174.571 181.093 1.00 79.26  ? 61   ASN B  OD1 1 
ATOM   9059  N ND2 . ASN B  1 61   ? 237.231 172.549 180.437 1.00 88.10  ? 61   ASN B  ND2 1 
ATOM   9060  N N   . VAL B  1 62   ? 238.479 177.529 177.335 1.00 60.28  ? 62   VAL B  N   1 
ATOM   9061  C CA  . VAL B  1 62   ? 238.724 178.033 175.970 1.00 60.02  ? 62   VAL B  CA  1 
ATOM   9062  C C   . VAL B  1 62   ? 239.758 177.128 175.266 1.00 63.89  ? 62   VAL B  C   1 
ATOM   9063  O O   . VAL B  1 62   ? 240.770 176.790 175.882 1.00 68.06  ? 62   VAL B  O   1 
ATOM   9064  C CB  . VAL B  1 62   ? 239.210 179.498 176.002 1.00 52.58  ? 62   VAL B  CB  1 
ATOM   9065  C CG1 . VAL B  1 62   ? 239.969 179.777 177.291 1.00 49.20  ? 62   VAL B  CG1 1 
ATOM   9066  C CG2 . VAL B  1 62   ? 240.066 179.827 174.788 1.00 62.79  ? 62   VAL B  CG2 1 
ATOM   9067  N N   . THR B  1 63   ? 239.541 176.723 174.004 1.00 63.01  ? 63   THR B  N   1 
ATOM   9068  C CA  . THR B  1 63   ? 240.521 175.843 173.384 1.00 59.40  ? 63   THR B  CA  1 
ATOM   9069  C C   . THR B  1 63   ? 241.805 176.611 173.092 1.00 60.97  ? 63   THR B  C   1 
ATOM   9070  O O   . THR B  1 63   ? 241.795 177.825 172.873 1.00 65.97  ? 63   THR B  O   1 
ATOM   9071  C CB  . THR B  1 63   ? 239.975 175.225 172.098 1.00 62.90  ? 63   THR B  CB  1 
ATOM   9072  O OG1 . THR B  1 63   ? 238.573 174.971 172.243 1.00 66.70  ? 63   THR B  OG1 1 
ATOM   9073  C CG2 . THR B  1 63   ? 240.687 173.905 171.799 1.00 62.74  ? 63   THR B  CG2 1 
ATOM   9074  N N   . TRP B  1 64   ? 242.915 175.883 173.085 1.00 58.22  ? 64   TRP B  N   1 
ATOM   9075  C CA  . TRP B  1 64   ? 244.245 176.468 173.136 1.00 56.36  ? 64   TRP B  CA  1 
ATOM   9076  C C   . TRP B  1 64   ? 245.117 175.855 172.051 1.00 62.95  ? 64   TRP B  C   1 
ATOM   9077  O O   . TRP B  1 64   ? 245.172 174.631 171.902 1.00 63.02  ? 64   TRP B  O   1 
ATOM   9078  C CB  . TRP B  1 64   ? 244.842 176.237 174.528 1.00 62.92  ? 64   TRP B  CB  1 
ATOM   9079  C CG  . TRP B  1 64   ? 246.210 176.782 174.768 1.00 63.80  ? 64   TRP B  CG  1 
ATOM   9080  C CD1 . TRP B  1 64   ? 246.907 177.663 173.992 1.00 59.48  ? 64   TRP B  CD1 1 
ATOM   9081  C CD2 . TRP B  1 64   ? 247.052 176.476 175.882 1.00 65.24  ? 64   TRP B  CD2 1 
ATOM   9082  N NE1 . TRP B  1 64   ? 248.133 177.919 174.556 1.00 59.61  ? 64   TRP B  NE1 1 
ATOM   9083  C CE2 . TRP B  1 64   ? 248.246 177.202 175.718 1.00 63.87  ? 64   TRP B  CE2 1 
ATOM   9084  C CE3 . TRP B  1 64   ? 246.911 175.655 177.006 1.00 69.26  ? 64   TRP B  CE3 1 
ATOM   9085  C CZ2 . TRP B  1 64   ? 249.294 177.132 176.631 1.00 65.97  ? 64   TRP B  CZ2 1 
ATOM   9086  C CZ3 . TRP B  1 64   ? 247.951 175.587 177.910 1.00 76.94  ? 64   TRP B  CZ3 1 
ATOM   9087  C CH2 . TRP B  1 64   ? 249.128 176.321 177.718 1.00 69.68  ? 64   TRP B  CH2 1 
ATOM   9088  N N   . PHE B  1 65   ? 245.802 176.715 171.296 1.00 63.36  ? 65   PHE B  N   1 
ATOM   9089  C CA  . PHE B  1 65   ? 246.587 176.300 170.141 1.00 55.05  ? 65   PHE B  CA  1 
ATOM   9090  C C   . PHE B  1 65   ? 247.962 176.949 170.185 1.00 61.19  ? 65   PHE B  C   1 
ATOM   9091  O O   . PHE B  1 65   ? 248.110 178.081 170.653 1.00 63.96  ? 65   PHE B  O   1 
ATOM   9092  C CB  . PHE B  1 65   ? 245.880 176.669 168.838 1.00 54.84  ? 65   PHE B  CB  1 
ATOM   9093  C CG  . PHE B  1 65   ? 244.453 176.216 168.778 1.00 57.32  ? 65   PHE B  CG  1 
ATOM   9094  C CD1 . PHE B  1 65   ? 244.134 174.937 168.366 1.00 56.63  ? 65   PHE B  CD1 1 
ATOM   9095  C CD2 . PHE B  1 65   ? 243.428 177.068 169.139 1.00 61.00  ? 65   PHE B  CD2 1 
ATOM   9096  C CE1 . PHE B  1 65   ? 242.822 174.520 168.314 1.00 54.90  ? 65   PHE B  CE1 1 
ATOM   9097  C CE2 . PHE B  1 65   ? 242.116 176.657 169.088 1.00 55.13  ? 65   PHE B  CE2 1 
ATOM   9098  C CZ  . PHE B  1 65   ? 241.813 175.382 168.675 1.00 54.21  ? 65   PHE B  CZ  1 
ATOM   9099  N N   . HIS B  1 66   ? 248.963 176.224 169.690 1.00 65.47  ? 66   HIS B  N   1 
ATOM   9100  C CA  . HIS B  1 66   ? 250.356 176.641 169.758 1.00 64.49  ? 66   HIS B  CA  1 
ATOM   9101  C C   . HIS B  1 66   ? 250.975 176.714 168.369 1.00 64.26  ? 66   HIS B  C   1 
ATOM   9102  O O   . HIS B  1 66   ? 250.624 175.937 167.477 1.00 67.80  ? 66   HIS B  O   1 
ATOM   9103  C CB  . HIS B  1 66   ? 251.187 175.670 170.601 1.00 64.98  ? 66   HIS B  CB  1 
ATOM   9104  C CG  . HIS B  1 66   ? 250.573 175.330 171.922 1.00 67.66  ? 66   HIS B  CG  1 
ATOM   9105  N ND1 . HIS B  1 66   ? 249.698 174.279 172.088 1.00 69.62  ? 66   HIS B  ND1 1 
ATOM   9106  C CD2 . HIS B  1 66   ? 250.719 175.894 173.144 1.00 65.63  ? 66   HIS B  CD2 1 
ATOM   9107  C CE1 . HIS B  1 66   ? 249.327 174.213 173.354 1.00 64.29  ? 66   HIS B  CE1 1 
ATOM   9108  N NE2 . HIS B  1 66   ? 249.932 175.182 174.016 1.00 63.95  ? 66   HIS B  NE2 1 
ATOM   9109  N N   . ALA B  1 67   ? 251.891 177.663 168.198 1.00 62.66  ? 67   ALA B  N   1 
ATOM   9110  C CA  . ALA B  1 67   ? 252.895 177.630 167.142 1.00 69.16  ? 67   ALA B  CA  1 
ATOM   9111  C C   . ALA B  1 67   ? 254.256 177.572 167.821 1.00 82.29  ? 67   ALA B  C   1 
ATOM   9112  O O   . ALA B  1 67   ? 254.575 178.438 168.641 1.00 80.10  ? 67   ALA B  O   1 
ATOM   9113  C CB  . ALA B  1 67   ? 252.791 178.850 166.229 1.00 66.72  ? 67   ALA B  CB  1 
ATOM   9114  N N   . ILE B  1 68   ? 255.048 176.554 167.492 1.00 83.77  ? 68   ILE B  N   1 
ATOM   9115  C CA  . ILE B  1 68   ? 256.307 176.295 168.181 1.00 76.06  ? 68   ILE B  CA  1 
ATOM   9116  C C   . ILE B  1 68   ? 257.372 175.962 167.149 1.00 83.66  ? 68   ILE B  C   1 
ATOM   9117  O O   . ILE B  1 68   ? 257.135 175.156 166.243 1.00 80.71  ? 68   ILE B  O   1 
ATOM   9118  C CB  . ILE B  1 68   ? 256.176 175.148 169.203 1.00 70.56  ? 68   ILE B  CB  1 
ATOM   9119  C CG1 . ILE B  1 68   ? 255.038 175.442 170.184 1.00 73.07  ? 68   ILE B  CG1 1 
ATOM   9120  C CG2 . ILE B  1 68   ? 257.483 174.956 169.959 1.00 67.12  ? 68   ILE B  CG2 1 
ATOM   9121  C CD1 . ILE B  1 68   ? 254.817 174.362 171.221 1.00 74.97  ? 68   ILE B  CD1 1 
ATOM   9122  N N   . HIS B  1 69   ? 258.544 176.576 167.292 1.00 84.58  ? 69   HIS B  N   1 
ATOM   9123  C CA  . HIS B  1 69   ? 259.692 176.283 166.437 1.00 83.52  ? 69   HIS B  CA  1 
ATOM   9124  C C   . HIS B  1 69   ? 259.300 176.187 164.968 1.00 91.28  ? 69   HIS B  C   1 
ATOM   9125  O O   . HIS B  1 69   ? 259.567 175.178 164.316 1.00 90.15  ? 69   HIS B  O   1 
ATOM   9126  C CB  . HIS B  1 69   ? 260.364 174.978 166.872 1.00 77.78  ? 69   HIS B  CB  1 
ATOM   9127  C CG  . HIS B  1 69   ? 260.965 175.033 168.241 1.00 76.06  ? 69   HIS B  CG  1 
ATOM   9128  N ND1 . HIS B  1 69   ? 261.024 173.934 169.070 1.00 71.55  ? 69   HIS B  ND1 1 
ATOM   9129  C CD2 . HIS B  1 69   ? 261.536 176.052 168.927 1.00 78.67  ? 69   HIS B  CD2 1 
ATOM   9130  C CE1 . HIS B  1 69   ? 261.603 174.273 170.207 1.00 72.66  ? 69   HIS B  CE1 1 
ATOM   9131  N NE2 . HIS B  1 69   ? 261.923 175.552 170.147 1.00 78.11  ? 69   HIS B  NE2 1 
ATOM   9132  N N   . LYS B  1 77   ? 257.937 172.622 164.428 1.00 75.01  ? 77   LYS B  N   1 
ATOM   9133  C CA  . LYS B  1 77   ? 257.611 171.572 165.387 1.00 75.04  ? 77   LYS B  CA  1 
ATOM   9134  C C   . LYS B  1 77   ? 256.105 171.478 165.589 1.00 81.94  ? 77   LYS B  C   1 
ATOM   9135  O O   . LYS B  1 77   ? 255.521 170.396 165.470 1.00 82.05  ? 77   LYS B  O   1 
ATOM   9136  C CB  . LYS B  1 77   ? 258.308 171.825 166.723 1.00 72.18  ? 77   LYS B  CB  1 
ATOM   9137  C CG  . LYS B  1 77   ? 258.032 170.735 167.751 1.00 68.83  ? 77   LYS B  CG  1 
ATOM   9138  C CD  . LYS B  1 77   ? 258.664 171.029 169.098 1.00 70.05  ? 77   LYS B  CD  1 
ATOM   9139  C CE  . LYS B  1 77   ? 258.646 169.792 169.978 1.00 63.51  ? 77   LYS B  CE  1 
ATOM   9140  N NZ  . LYS B  1 77   ? 259.584 168.748 169.474 1.00 66.48  ? 77   LYS B  NZ  1 
ATOM   9141  N N   . ARG B  1 78   ? 255.464 172.605 165.893 1.00 79.81  ? 78   ARG B  N   1 
ATOM   9142  C CA  . ARG B  1 78   ? 254.016 172.670 165.981 1.00 76.44  ? 78   ARG B  CA  1 
ATOM   9143  C C   . ARG B  1 78   ? 253.537 173.926 165.271 1.00 77.79  ? 78   ARG B  C   1 
ATOM   9144  O O   . ARG B  1 78   ? 254.077 175.016 165.482 1.00 77.74  ? 78   ARG B  O   1 
ATOM   9145  C CB  . ARG B  1 78   ? 253.545 172.663 167.443 1.00 71.22  ? 78   ARG B  CB  1 
ATOM   9146  C CG  . ARG B  1 78   ? 252.043 172.512 167.619 1.00 79.51  ? 78   ARG B  CG  1 
ATOM   9147  C CD  . ARG B  1 78   ? 251.547 171.167 167.108 1.00 79.47  ? 78   ARG B  CD  1 
ATOM   9148  N NE  . ARG B  1 78   ? 250.115 170.989 167.327 1.00 87.48  ? 78   ARG B  NE  1 
ATOM   9149  C CZ  . ARG B  1 78   ? 249.423 169.929 166.923 1.00 87.42  ? 78   ARG B  CZ  1 
ATOM   9150  N NH1 . ARG B  1 78   ? 250.026 168.943 166.274 1.00 84.73  ? 78   ARG B  NH1 1 
ATOM   9151  N NH2 . ARG B  1 78   ? 248.122 169.853 167.166 1.00 88.47  ? 78   ARG B  NH2 1 
ATOM   9152  N N   . PHE B  1 79   ? 252.519 173.757 164.429 1.00 76.68  ? 79   PHE B  N   1 
ATOM   9153  C CA  . PHE B  1 79   ? 251.926 174.850 163.672 1.00 71.35  ? 79   PHE B  CA  1 
ATOM   9154  C C   . PHE B  1 79   ? 250.439 174.554 163.520 1.00 79.99  ? 79   PHE B  C   1 
ATOM   9155  O O   . PHE B  1 79   ? 250.018 173.905 162.558 1.00 74.64  ? 79   PHE B  O   1 
ATOM   9156  C CB  . PHE B  1 79   ? 252.621 174.981 162.314 1.00 76.03  ? 79   PHE B  CB  1 
ATOM   9157  C CG  . PHE B  1 79   ? 252.203 176.178 161.515 1.00 71.81  ? 79   PHE B  CG  1 
ATOM   9158  C CD1 . PHE B  1 79   ? 252.699 177.435 161.808 1.00 70.58  ? 79   PHE B  CD1 1 
ATOM   9159  C CD2 . PHE B  1 79   ? 251.342 176.039 160.443 1.00 69.07  ? 79   PHE B  CD2 1 
ATOM   9160  C CE1 . PHE B  1 79   ? 252.326 178.530 161.060 1.00 71.14  ? 79   PHE B  CE1 1 
ATOM   9161  C CE2 . PHE B  1 79   ? 250.967 177.131 159.694 1.00 71.11  ? 79   PHE B  CE2 1 
ATOM   9162  C CZ  . PHE B  1 79   ? 251.461 178.374 159.999 1.00 74.48  ? 79   PHE B  CZ  1 
ATOM   9163  N N   . ASP B  1 80   ? 249.642 175.037 164.468 1.00 83.74  ? 80   ASP B  N   1 
ATOM   9164  C CA  . ASP B  1 80   ? 248.268 174.574 164.648 1.00 71.18  ? 80   ASP B  CA  1 
ATOM   9165  C C   . ASP B  1 80   ? 247.312 175.555 163.980 1.00 67.86  ? 80   ASP B  C   1 
ATOM   9166  O O   . ASP B  1 80   ? 247.071 176.650 164.492 1.00 62.29  ? 80   ASP B  O   1 
ATOM   9167  C CB  . ASP B  1 80   ? 247.961 174.414 166.133 1.00 66.96  ? 80   ASP B  CB  1 
ATOM   9168  C CG  . ASP B  1 80   ? 246.940 173.331 166.403 1.00 73.34  ? 80   ASP B  CG  1 
ATOM   9169  O OD1 . ASP B  1 80   ? 246.406 172.758 165.431 1.00 69.70  ? 80   ASP B  OD1 1 
ATOM   9170  O OD2 . ASP B  1 80   ? 246.681 173.043 167.590 1.00 73.54  ? 80   ASP B  OD2 1 
ATOM   9171  N N   . ASN B  1 81   ? 246.775 175.175 162.822 1.00 69.96  ? 81   ASN B  N   1 
ATOM   9172  C CA  . ASN B  1 81   ? 245.816 175.998 162.085 1.00 63.11  ? 81   ASN B  CA  1 
ATOM   9173  C C   . ASN B  1 81   ? 244.585 175.184 161.701 1.00 61.55  ? 81   ASN B  C   1 
ATOM   9174  O O   . ASN B  1 81   ? 244.262 175.048 160.516 1.00 65.90  ? 81   ASN B  O   1 
ATOM   9175  C CB  . ASN B  1 81   ? 246.475 176.590 160.844 1.00 64.26  ? 81   ASN B  CB  1 
ATOM   9176  C CG  . ASN B  1 81   ? 247.107 175.533 159.966 1.00 68.49  ? 81   ASN B  CG  1 
ATOM   9177  O OD1 . ASN B  1 81   ? 247.147 174.356 160.327 1.00 78.45  ? 81   ASN B  OD1 1 
ATOM   9178  N ND2 . ASN B  1 81   ? 247.616 175.946 158.813 1.00 63.13  ? 81   ASN B  ND2 1 
ATOM   9179  N N   . PRO B  1 82   ? 243.865 174.640 162.677 1.00 55.73  ? 82   PRO B  N   1 
ATOM   9180  C CA  . PRO B  1 82   ? 242.682 173.840 162.350 1.00 60.41  ? 82   PRO B  CA  1 
ATOM   9181  C C   . PRO B  1 82   ? 241.512 174.705 161.911 1.00 60.95  ? 82   PRO B  C   1 
ATOM   9182  O O   . PRO B  1 82   ? 241.425 175.891 162.240 1.00 63.50  ? 82   PRO B  O   1 
ATOM   9183  C CB  . PRO B  1 82   ? 242.374 173.121 163.665 1.00 56.72  ? 82   PRO B  CB  1 
ATOM   9184  C CG  . PRO B  1 82   ? 242.841 174.074 164.704 1.00 54.63  ? 82   PRO B  CG  1 
ATOM   9185  C CD  . PRO B  1 82   ? 244.067 174.746 164.133 1.00 51.31  ? 82   PRO B  CD  1 
ATOM   9186  N N   . VAL B  1 83   ? 240.608 174.093 161.153 1.00 58.68  ? 83   VAL B  N   1 
ATOM   9187  C CA  . VAL B  1 83   ? 239.340 174.728 160.811 1.00 55.70  ? 83   VAL B  CA  1 
ATOM   9188  C C   . VAL B  1 83   ? 238.372 174.494 161.964 1.00 64.07  ? 83   VAL B  C   1 
ATOM   9189  O O   . VAL B  1 83   ? 237.980 173.355 162.237 1.00 62.75  ? 83   VAL B  O   1 
ATOM   9190  C CB  . VAL B  1 83   ? 238.779 174.177 159.493 1.00 49.14  ? 83   VAL B  CB  1 
ATOM   9191  C CG1 . VAL B  1 83   ? 237.387 174.729 159.232 1.00 48.75  ? 83   VAL B  CG1 1 
ATOM   9192  C CG2 . VAL B  1 83   ? 239.711 174.521 158.346 1.00 53.03  ? 83   VAL B  CG2 1 
ATOM   9193  N N   . LEU B  1 84   ? 237.976 175.581 162.637 1.00 59.23  ? 84   LEU B  N   1 
ATOM   9194  C CA  . LEU B  1 84   ? 237.205 175.474 163.863 1.00 49.70  ? 84   LEU B  CA  1 
ATOM   9195  C C   . LEU B  1 84   ? 235.751 175.863 163.629 1.00 51.39  ? 84   LEU B  C   1 
ATOM   9196  O O   . LEU B  1 84   ? 235.452 176.675 162.751 1.00 55.43  ? 84   LEU B  O   1 
ATOM   9197  C CB  . LEU B  1 84   ? 237.795 176.379 164.946 1.00 49.89  ? 84   LEU B  CB  1 
ATOM   9198  C CG  . LEU B  1 84   ? 239.233 176.066 165.348 1.00 48.20  ? 84   LEU B  CG  1 
ATOM   9199  C CD1 . LEU B  1 84   ? 239.858 177.249 166.063 1.00 42.37  ? 84   LEU B  CD1 1 
ATOM   9200  C CD2 . LEU B  1 84   ? 239.269 174.829 166.224 1.00 54.18  ? 84   LEU B  CD2 1 
ATOM   9201  N N   . PRO B  1 85   ? 234.820 175.297 164.401 1.00 52.59  ? 85   PRO B  N   1 
ATOM   9202  C CA  . PRO B  1 85   ? 233.426 175.747 164.320 1.00 53.45  ? 85   PRO B  CA  1 
ATOM   9203  C C   . PRO B  1 85   ? 233.281 177.223 164.654 1.00 55.83  ? 85   PRO B  C   1 
ATOM   9204  O O   . PRO B  1 85   ? 234.129 177.798 165.342 1.00 55.64  ? 85   PRO B  O   1 
ATOM   9205  C CB  . PRO B  1 85   ? 232.711 174.862 165.348 1.00 52.18  ? 85   PRO B  CB  1 
ATOM   9206  C CG  . PRO B  1 85   ? 233.574 173.663 165.480 1.00 59.56  ? 85   PRO B  CG  1 
ATOM   9207  C CD  . PRO B  1 85   ? 234.973 174.152 165.313 1.00 57.05  ? 85   PRO B  CD  1 
ATOM   9208  N N   . PHE B  1 86   ? 232.216 177.848 164.154 1.00 56.85  ? 86   PHE B  N   1 
ATOM   9209  C CA  . PHE B  1 86   ? 231.906 179.245 164.457 1.00 56.65  ? 86   PHE B  CA  1 
ATOM   9210  C C   . PHE B  1 86   ? 230.395 179.326 164.647 1.00 60.75  ? 86   PHE B  C   1 
ATOM   9211  O O   . PHE B  1 86   ? 229.649 179.454 163.671 1.00 69.56  ? 86   PHE B  O   1 
ATOM   9212  C CB  . PHE B  1 86   ? 232.382 180.171 163.343 1.00 53.23  ? 86   PHE B  CB  1 
ATOM   9213  C CG  . PHE B  1 86   ? 232.226 181.636 163.650 1.00 44.70  ? 86   PHE B  CG  1 
ATOM   9214  C CD1 . PHE B  1 86   ? 230.977 182.231 163.657 1.00 40.40  ? 86   PHE B  CD1 1 
ATOM   9215  C CD2 . PHE B  1 86   ? 233.333 182.422 163.908 1.00 47.93  ? 86   PHE B  CD2 1 
ATOM   9216  C CE1 . PHE B  1 86   ? 230.837 183.574 163.931 1.00 40.07  ? 86   PHE B  CE1 1 
ATOM   9217  C CE2 . PHE B  1 86   ? 233.196 183.764 164.179 1.00 44.83  ? 86   PHE B  CE2 1 
ATOM   9218  C CZ  . PHE B  1 86   ? 231.948 184.340 164.190 1.00 42.74  ? 86   PHE B  CZ  1 
ATOM   9219  N N   . ASN B  1 87   ? 229.948 179.250 165.898 1.00 53.40  ? 87   ASN B  N   1 
ATOM   9220  C CA  . ASN B  1 87   ? 228.526 179.237 166.209 1.00 61.43  ? 87   ASN B  CA  1 
ATOM   9221  C C   . ASN B  1 87   ? 228.260 180.146 167.396 1.00 63.97  ? 87   ASN B  C   1 
ATOM   9222  O O   . ASN B  1 87   ? 228.972 180.082 168.402 1.00 63.98  ? 87   ASN B  O   1 
ATOM   9223  C CB  . ASN B  1 87   ? 228.041 177.815 166.507 1.00 68.33  ? 87   ASN B  CB  1 
ATOM   9224  C CG  . ASN B  1 87   ? 228.895 177.114 167.539 1.00 61.92  ? 87   ASN B  CG  1 
ATOM   9225  O OD1 . ASN B  1 87   ? 230.006 177.548 167.842 1.00 58.35  ? 87   ASN B  OD1 1 
ATOM   9226  N ND2 . ASN B  1 87   ? 228.384 176.016 168.079 1.00 67.41  ? 87   ASN B  ND2 1 
ATOM   9227  N N   . ASP B  1 88   ? 227.237 180.989 167.272 1.00 65.27  ? 88   ASP B  N   1 
ATOM   9228  C CA  . ASP B  1 88   ? 226.844 181.901 168.343 1.00 65.92  ? 88   ASP B  CA  1 
ATOM   9229  C C   . ASP B  1 88   ? 228.020 182.763 168.797 1.00 63.93  ? 88   ASP B  C   1 
ATOM   9230  O O   . ASP B  1 88   ? 228.203 183.010 169.989 1.00 68.29  ? 88   ASP B  O   1 
ATOM   9231  C CB  . ASP B  1 88   ? 226.253 181.134 169.527 1.00 64.35  ? 88   ASP B  CB  1 
ATOM   9232  C CG  . ASP B  1 88   ? 224.953 180.441 169.182 1.00 68.81  ? 88   ASP B  CG  1 
ATOM   9233  O OD1 . ASP B  1 88   ? 224.587 180.423 167.988 1.00 74.22  ? 88   ASP B  OD1 1 
ATOM   9234  O OD2 . ASP B  1 88   ? 224.293 179.918 170.105 1.00 74.58  ? 88   ASP B  OD2 1 
ATOM   9235  N N   . GLY B  1 89   ? 228.826 183.222 167.843 1.00 55.24  ? 89   GLY B  N   1 
ATOM   9236  C CA  . GLY B  1 89   ? 229.920 184.116 168.164 1.00 45.23  ? 89   GLY B  CA  1 
ATOM   9237  C C   . GLY B  1 89   ? 231.171 183.407 168.637 1.00 41.41  ? 89   GLY B  C   1 
ATOM   9238  O O   . GLY B  1 89   ? 231.099 182.306 169.188 1.00 49.33  ? 89   GLY B  O   1 
ATOM   9239  N N   . VAL B  1 90   ? 232.328 184.020 168.400 1.00 43.39  ? 90   VAL B  N   1 
ATOM   9240  C CA  . VAL B  1 90   ? 233.620 183.482 168.806 1.00 48.20  ? 90   VAL B  CA  1 
ATOM   9241  C C   . VAL B  1 90   ? 234.405 184.554 169.548 1.00 47.04  ? 90   VAL B  C   1 
ATOM   9242  O O   . VAL B  1 90   ? 234.402 185.725 169.151 1.00 47.87  ? 90   VAL B  O   1 
ATOM   9243  C CB  . VAL B  1 90   ? 234.413 182.972 167.588 1.00 41.93  ? 90   VAL B  CB  1 
ATOM   9244  C CG1 . VAL B  1 90   ? 235.890 182.835 167.926 1.00 42.91  ? 90   VAL B  CG1 1 
ATOM   9245  C CG2 . VAL B  1 90   ? 233.845 181.653 167.115 1.00 46.01  ? 90   VAL B  CG2 1 
ATOM   9246  N N   . TYR B  1 91   ? 235.080 184.151 170.622 1.00 50.65  ? 91   TYR B  N   1 
ATOM   9247  C CA  . TYR B  1 91   ? 236.084 184.979 171.278 1.00 47.68  ? 91   TYR B  CA  1 
ATOM   9248  C C   . TYR B  1 91   ? 237.460 184.446 170.909 1.00 46.79  ? 91   TYR B  C   1 
ATOM   9249  O O   . TYR B  1 91   ? 237.772 183.283 171.184 1.00 50.45  ? 91   TYR B  O   1 
ATOM   9250  C CB  . TYR B  1 91   ? 235.914 184.981 172.797 1.00 48.33  ? 91   TYR B  CB  1 
ATOM   9251  C CG  . TYR B  1 91   ? 237.127 185.524 173.526 1.00 52.50  ? 91   TYR B  CG  1 
ATOM   9252  C CD1 . TYR B  1 91   ? 237.290 186.886 173.727 1.00 52.33  ? 91   TYR B  CD1 1 
ATOM   9253  C CD2 . TYR B  1 91   ? 238.113 184.674 174.004 1.00 58.55  ? 91   TYR B  CD2 1 
ATOM   9254  C CE1 . TYR B  1 91   ? 238.395 187.384 174.386 1.00 49.13  ? 91   TYR B  CE1 1 
ATOM   9255  C CE2 . TYR B  1 91   ? 239.219 185.165 174.663 1.00 52.04  ? 91   TYR B  CE2 1 
ATOM   9256  C CZ  . TYR B  1 91   ? 239.354 186.520 174.852 1.00 48.72  ? 91   TYR B  CZ  1 
ATOM   9257  O OH  . TYR B  1 91   ? 240.455 187.014 175.508 1.00 53.14  ? 91   TYR B  OH  1 
ATOM   9258  N N   . PHE B  1 92   ? 238.279 185.295 170.299 1.00 48.40  ? 92   PHE B  N   1 
ATOM   9259  C CA  . PHE B  1 92   ? 239.617 184.928 169.863 1.00 48.56  ? 92   PHE B  CA  1 
ATOM   9260  C C   . PHE B  1 92   ? 240.638 185.839 170.529 1.00 53.89  ? 92   PHE B  C   1 
ATOM   9261  O O   . PHE B  1 92   ? 240.455 187.059 170.578 1.00 56.62  ? 92   PHE B  O   1 
ATOM   9262  C CB  . PHE B  1 92   ? 239.733 185.023 168.337 1.00 51.41  ? 92   PHE B  CB  1 
ATOM   9263  C CG  . PHE B  1 92   ? 241.078 184.629 167.803 1.00 49.42  ? 92   PHE B  CG  1 
ATOM   9264  C CD1 . PHE B  1 92   ? 242.135 185.521 167.821 1.00 47.60  ? 92   PHE B  CD1 1 
ATOM   9265  C CD2 . PHE B  1 92   ? 241.282 183.371 167.272 1.00 49.72  ? 92   PHE B  CD2 1 
ATOM   9266  C CE1 . PHE B  1 92   ? 243.368 185.162 167.332 1.00 49.59  ? 92   PHE B  CE1 1 
ATOM   9267  C CE2 . PHE B  1 92   ? 242.514 183.009 166.779 1.00 47.05  ? 92   PHE B  CE2 1 
ATOM   9268  C CZ  . PHE B  1 92   ? 243.558 183.905 166.810 1.00 52.85  ? 92   PHE B  CZ  1 
ATOM   9269  N N   . ALA B  1 93   ? 241.715 185.244 171.033 1.00 52.55  ? 93   ALA B  N   1 
ATOM   9270  C CA  . ALA B  1 93   ? 242.795 185.995 171.652 1.00 54.88  ? 93   ALA B  CA  1 
ATOM   9271  C C   . ALA B  1 93   ? 244.114 185.289 171.385 1.00 57.57  ? 93   ALA B  C   1 
ATOM   9272  O O   . ALA B  1 93   ? 244.164 184.062 171.265 1.00 61.83  ? 93   ALA B  O   1 
ATOM   9273  C CB  . ALA B  1 93   ? 242.584 186.149 173.162 1.00 55.20  ? 93   ALA B  CB  1 
ATOM   9274  N N   . SER B  1 94   ? 245.184 186.075 171.296 1.00 53.34  ? 94   SER B  N   1 
ATOM   9275  C CA  . SER B  1 94   ? 246.511 185.538 171.032 1.00 58.28  ? 94   SER B  CA  1 
ATOM   9276  C C   . SER B  1 94   ? 247.547 186.278 171.859 1.00 68.19  ? 94   SER B  C   1 
ATOM   9277  O O   . SER B  1 94   ? 247.646 187.506 171.781 1.00 68.02  ? 94   SER B  O   1 
ATOM   9278  C CB  . SER B  1 94   ? 246.865 185.648 169.545 1.00 65.20  ? 94   SER B  CB  1 
ATOM   9279  O OG  . SER B  1 94   ? 246.882 187.002 169.129 1.00 70.60  ? 94   SER B  OG  1 
ATOM   9280  N N   . THR B  1 95   ? 248.323 185.528 172.635 1.00 68.20  ? 95   THR B  N   1 
ATOM   9281  C CA  . THR B  1 95   ? 249.525 186.051 173.276 1.00 71.38  ? 95   THR B  CA  1 
ATOM   9282  C C   . THR B  1 95   ? 250.660 185.888 172.273 1.00 69.64  ? 95   THR B  C   1 
ATOM   9283  O O   . THR B  1 95   ? 251.065 184.764 171.960 1.00 64.35  ? 95   THR B  O   1 
ATOM   9284  C CB  . THR B  1 95   ? 249.810 185.320 174.583 1.00 67.79  ? 95   THR B  CB  1 
ATOM   9285  O OG1 . THR B  1 95   ? 249.887 183.910 174.341 1.00 72.68  ? 95   THR B  OG1 1 
ATOM   9286  C CG2 . THR B  1 95   ? 248.709 185.597 175.596 1.00 63.00  ? 95   THR B  CG2 1 
ATOM   9287  N N   . GLU B  1 96   ? 251.170 187.008 171.768 1.00 69.73  ? 96   GLU B  N   1 
ATOM   9288  C CA  . GLU B  1 96   ? 251.876 187.016 170.496 1.00 68.64  ? 96   GLU B  CA  1 
ATOM   9289  C C   . GLU B  1 96   ? 253.188 187.772 170.603 1.00 77.06  ? 96   GLU B  C   1 
ATOM   9290  O O   . GLU B  1 96   ? 253.222 188.901 171.100 1.00 73.46  ? 96   GLU B  O   1 
ATOM   9291  C CB  . GLU B  1 96   ? 251.002 187.655 169.413 1.00 73.13  ? 96   GLU B  CB  1 
ATOM   9292  C CG  . GLU B  1 96   ? 251.615 187.674 168.027 1.00 71.29  ? 96   GLU B  CG  1 
ATOM   9293  C CD  . GLU B  1 96   ? 250.669 188.259 166.997 1.00 73.92  ? 96   GLU B  CD  1 
ATOM   9294  O OE1 . GLU B  1 96   ? 249.657 188.868 167.403 1.00 79.42  ? 96   GLU B  OE1 1 
ATOM   9295  O OE2 . GLU B  1 96   ? 250.930 188.107 165.785 1.00 63.43  ? 96   GLU B  OE2 1 
ATOM   9296  N N   . LYS B  1 97   ? 254.259 187.140 170.136 1.00 78.06  ? 97   LYS B  N   1 
ATOM   9297  C CA  . LYS B  1 97   ? 255.518 187.811 169.860 1.00 74.26  ? 97   LYS B  CA  1 
ATOM   9298  C C   . LYS B  1 97   ? 255.890 187.562 168.405 1.00 77.61  ? 97   LYS B  C   1 
ATOM   9299  O O   . LYS B  1 97   ? 255.489 186.563 167.802 1.00 77.02  ? 97   LYS B  O   1 
ATOM   9300  C CB  . LYS B  1 97   ? 256.636 187.317 170.789 1.00 74.60  ? 97   LYS B  CB  1 
ATOM   9301  C CG  . LYS B  1 97   ? 257.161 185.932 170.451 1.00 75.06  ? 97   LYS B  CG  1 
ATOM   9302  C CD  . LYS B  1 97   ? 258.113 185.420 171.518 1.00 74.86  ? 97   LYS B  CD  1 
ATOM   9303  C CE  . LYS B  1 97   ? 258.667 184.059 171.144 1.00 76.92  ? 97   LYS B  CE  1 
ATOM   9304  N NZ  . LYS B  1 97   ? 259.437 183.437 172.256 1.00 81.27  ? 97   LYS B  NZ  1 
ATOM   9305  N N   . SER B  1 98   ? 256.676 188.478 167.845 1.00 82.07  ? 98   SER B  N   1 
ATOM   9306  C CA  . SER B  1 98   ? 257.188 188.336 166.481 1.00 79.85  ? 98   SER B  CA  1 
ATOM   9307  C C   . SER B  1 98   ? 256.067 188.271 165.441 1.00 73.46  ? 98   SER B  C   1 
ATOM   9308  O O   . SER B  1 98   ? 256.263 187.757 164.337 1.00 73.29  ? 98   SER B  O   1 
ATOM   9309  C CB  . SER B  1 98   ? 258.082 187.098 166.372 1.00 80.07  ? 98   SER B  CB  1 
ATOM   9310  O OG  . SER B  1 98   ? 257.325 185.904 166.492 1.00 73.25  ? 98   SER B  OG  1 
ATOM   9311  N N   . ASN B  1 99   ? 254.891 188.799 165.780 1.00 67.41  ? 99   ASN B  N   1 
ATOM   9312  C CA  . ASN B  1 99   ? 253.793 189.001 164.829 1.00 65.00  ? 99   ASN B  CA  1 
ATOM   9313  C C   . ASN B  1 99   ? 253.535 187.755 163.980 1.00 63.26  ? 99   ASN B  C   1 
ATOM   9314  O O   . ASN B  1 99   ? 253.763 187.735 162.769 1.00 62.99  ? 99   ASN B  O   1 
ATOM   9315  C CB  . ASN B  1 99   ? 254.079 190.209 163.936 1.00 68.92  ? 99   ASN B  CB  1 
ATOM   9316  C CG  . ASN B  1 99   ? 254.080 191.512 164.703 1.00 67.79  ? 99   ASN B  CG  1 
ATOM   9317  O OD1 . ASN B  1 99   ? 254.089 191.522 165.933 1.00 65.30  ? 99   ASN B  OD1 1 
ATOM   9318  N ND2 . ASN B  1 99   ? 254.072 192.624 163.978 1.00 71.24  ? 99   ASN B  ND2 1 
ATOM   9319  N N   . ILE B  1 100  ? 253.040 186.707 164.634 1.00 65.80  ? 100  ILE B  N   1 
ATOM   9320  C CA  . ILE B  1 100  ? 252.798 185.437 163.952 1.00 66.28  ? 100  ILE B  CA  1 
ATOM   9321  C C   . ILE B  1 100  ? 251.348 185.306 163.495 1.00 69.92  ? 100  ILE B  C   1 
ATOM   9322  O O   . ILE B  1 100  ? 251.084 184.798 162.404 1.00 69.65  ? 100  ILE B  O   1 
ATOM   9323  C CB  . ILE B  1 100  ? 253.208 184.271 164.873 1.00 68.42  ? 100  ILE B  CB  1 
ATOM   9324  C CG1 . ILE B  1 100  ? 254.710 184.327 165.176 1.00 75.88  ? 100  ILE B  CG1 1 
ATOM   9325  C CG2 . ILE B  1 100  ? 252.843 182.937 164.246 1.00 62.95  ? 100  ILE B  CG2 1 
ATOM   9326  C CD1 . ILE B  1 100  ? 255.609 184.175 163.959 1.00 66.93  ? 100  ILE B  CD1 1 
ATOM   9327  N N   . ILE B  1 101  ? 250.388 185.745 164.305 1.00 71.37  ? 101  ILE B  N   1 
ATOM   9328  C CA  . ILE B  1 101  ? 248.977 185.683 163.929 1.00 68.42  ? 101  ILE B  CA  1 
ATOM   9329  C C   . ILE B  1 101  ? 248.669 186.870 163.024 1.00 63.85  ? 101  ILE B  C   1 
ATOM   9330  O O   . ILE B  1 101  ? 248.912 188.023 163.397 1.00 60.76  ? 101  ILE B  O   1 
ATOM   9331  C CB  . ILE B  1 101  ? 248.073 185.686 165.169 1.00 71.98  ? 101  ILE B  CB  1 
ATOM   9332  C CG1 . ILE B  1 101  ? 248.390 184.489 166.071 1.00 62.08  ? 101  ILE B  CG1 1 
ATOM   9333  C CG2 . ILE B  1 101  ? 246.605 185.683 164.762 1.00 60.51  ? 101  ILE B  CG2 1 
ATOM   9334  C CD1 . ILE B  1 101  ? 248.137 183.138 165.431 1.00 58.66  ? 101  ILE B  CD1 1 
ATOM   9335  N N   . ARG B  1 102  ? 248.134 186.592 161.831 1.00 58.44  ? 102  ARG B  N   1 
ATOM   9336  C CA  . ARG B  1 102  ? 247.957 187.622 160.812 1.00 57.43  ? 102  ARG B  CA  1 
ATOM   9337  C C   . ARG B  1 102  ? 246.614 187.512 160.094 1.00 59.35  ? 102  ARG B  C   1 
ATOM   9338  O O   . ARG B  1 102  ? 246.535 187.757 158.888 1.00 69.29  ? 102  ARG B  O   1 
ATOM   9339  C CB  . ARG B  1 102  ? 249.099 187.576 159.799 1.00 58.68  ? 102  ARG B  CB  1 
ATOM   9340  C CG  . ARG B  1 102  ? 250.478 187.690 160.425 1.00 63.41  ? 102  ARG B  CG  1 
ATOM   9341  C CD  . ARG B  1 102  ? 251.530 188.071 159.402 1.00 64.09  ? 102  ARG B  CD  1 
ATOM   9342  N NE  . ARG B  1 102  ? 251.422 189.476 159.016 1.00 67.94  ? 102  ARG B  NE  1 
ATOM   9343  C CZ  . ARG B  1 102  ? 251.909 190.487 159.731 1.00 74.40  ? 102  ARG B  CZ  1 
ATOM   9344  N NH1 . ARG B  1 102  ? 252.537 190.253 160.875 1.00 77.60  ? 102  ARG B  NH1 1 
ATOM   9345  N NH2 . ARG B  1 102  ? 251.765 191.736 159.308 1.00 76.70  ? 102  ARG B  NH2 1 
ATOM   9346  N N   . GLY B  1 103  ? 245.552 187.140 160.805 1.00 55.82  ? 103  GLY B  N   1 
ATOM   9347  C CA  . GLY B  1 103  ? 244.221 187.167 160.223 1.00 51.38  ? 103  GLY B  CA  1 
ATOM   9348  C C   . GLY B  1 103  ? 243.442 185.876 160.360 1.00 46.81  ? 103  GLY B  C   1 
ATOM   9349  O O   . GLY B  1 103  ? 243.866 184.964 161.075 1.00 52.45  ? 103  GLY B  O   1 
ATOM   9350  N N   . TRP B  1 104  ? 242.303 185.784 159.673 1.00 42.67  ? 104  TRP B  N   1 
ATOM   9351  C CA  . TRP B  1 104  ? 241.398 184.654 159.832 1.00 51.02  ? 104  TRP B  CA  1 
ATOM   9352  C C   . TRP B  1 104  ? 240.653 184.395 158.532 1.00 49.54  ? 104  TRP B  C   1 
ATOM   9353  O O   . TRP B  1 104  ? 240.563 185.256 157.654 1.00 56.03  ? 104  TRP B  O   1 
ATOM   9354  C CB  . TRP B  1 104  ? 240.371 184.891 160.946 1.00 50.89  ? 104  TRP B  CB  1 
ATOM   9355  C CG  . TRP B  1 104  ? 240.959 185.346 162.228 1.00 47.17  ? 104  TRP B  CG  1 
ATOM   9356  C CD1 . TRP B  1 104  ? 241.332 184.569 163.280 1.00 46.91  ? 104  TRP B  CD1 1 
ATOM   9357  C CD2 . TRP B  1 104  ? 241.238 186.696 162.606 1.00 48.63  ? 104  TRP B  CD2 1 
ATOM   9358  N NE1 . TRP B  1 104  ? 241.831 185.349 164.288 1.00 52.59  ? 104  TRP B  NE1 1 
ATOM   9359  C CE2 . TRP B  1 104  ? 241.784 186.660 163.899 1.00 49.41  ? 104  TRP B  CE2 1 
ATOM   9360  C CE3 . TRP B  1 104  ? 241.078 187.933 161.976 1.00 46.78  ? 104  TRP B  CE3 1 
ATOM   9361  C CZ2 . TRP B  1 104  ? 242.175 187.806 164.574 1.00 50.72  ? 104  TRP B  CZ2 1 
ATOM   9362  C CZ3 . TRP B  1 104  ? 241.467 189.070 162.648 1.00 43.21  ? 104  TRP B  CZ3 1 
ATOM   9363  C CH2 . TRP B  1 104  ? 242.010 189.000 163.934 1.00 46.88  ? 104  TRP B  CH2 1 
ATOM   9364  N N   . ILE B  1 105  ? 240.120 183.183 158.427 1.00 45.01  ? 105  ILE B  N   1 
ATOM   9365  C CA  . ILE B  1 105  ? 239.179 182.804 157.383 1.00 49.94  ? 105  ILE B  CA  1 
ATOM   9366  C C   . ILE B  1 105  ? 237.851 182.488 158.049 1.00 51.84  ? 105  ILE B  C   1 
ATOM   9367  O O   . ILE B  1 105  ? 237.816 181.812 159.082 1.00 56.11  ? 105  ILE B  O   1 
ATOM   9368  C CB  . ILE B  1 105  ? 239.682 181.594 156.572 1.00 50.34  ? 105  ILE B  CB  1 
ATOM   9369  C CG1 . ILE B  1 105  ? 241.033 181.909 155.931 1.00 53.69  ? 105  ILE B  CG1 1 
ATOM   9370  C CG2 . ILE B  1 105  ? 238.660 181.194 155.517 1.00 61.42  ? 105  ILE B  CG2 1 
ATOM   9371  C CD1 . ILE B  1 105  ? 241.025 183.144 155.060 1.00 62.22  ? 105  ILE B  CD1 1 
ATOM   9372  N N   . PHE B  1 106  ? 236.763 182.983 157.467 1.00 48.58  ? 106  PHE B  N   1 
ATOM   9373  C CA  . PHE B  1 106  ? 235.420 182.645 157.913 1.00 51.52  ? 106  PHE B  CA  1 
ATOM   9374  C C   . PHE B  1 106  ? 234.600 182.214 156.710 1.00 50.47  ? 106  PHE B  C   1 
ATOM   9375  O O   . PHE B  1 106  ? 234.764 182.753 155.613 1.00 58.46  ? 106  PHE B  O   1 
ATOM   9376  C CB  . PHE B  1 106  ? 234.723 183.823 158.609 1.00 51.39  ? 106  PHE B  CB  1 
ATOM   9377  C CG  . PHE B  1 106  ? 235.568 184.512 159.639 1.00 46.83  ? 106  PHE B  CG  1 
ATOM   9378  C CD1 . PHE B  1 106  ? 236.376 185.577 159.288 1.00 49.35  ? 106  PHE B  CD1 1 
ATOM   9379  C CD2 . PHE B  1 106  ? 235.545 184.106 160.957 1.00 44.86  ? 106  PHE B  CD2 1 
ATOM   9380  C CE1 . PHE B  1 106  ? 237.147 186.215 160.231 1.00 41.98  ? 106  PHE B  CE1 1 
ATOM   9381  C CE2 . PHE B  1 106  ? 236.317 184.740 161.902 1.00 50.17  ? 106  PHE B  CE2 1 
ATOM   9382  C CZ  . PHE B  1 106  ? 237.119 185.795 161.538 1.00 47.43  ? 106  PHE B  CZ  1 
ATOM   9383  N N   . GLY B  1 107  ? 233.727 181.240 156.919 1.00 45.90  ? 107  GLY B  N   1 
ATOM   9384  C CA  . GLY B  1 107  ? 232.868 180.783 155.847 1.00 53.22  ? 107  GLY B  CA  1 
ATOM   9385  C C   . GLY B  1 107  ? 232.066 179.580 156.278 1.00 52.97  ? 107  GLY B  C   1 
ATOM   9386  O O   . GLY B  1 107  ? 232.028 179.233 157.459 1.00 60.87  ? 107  GLY B  O   1 
ATOM   9387  N N   . THR B  1 108  ? 231.424 178.939 155.300 1.00 52.61  ? 108  THR B  N   1 
ATOM   9388  C CA  . THR B  1 108  ? 230.632 177.744 155.550 1.00 52.84  ? 108  THR B  CA  1 
ATOM   9389  C C   . THR B  1 108  ? 231.077 176.533 154.746 1.00 67.28  ? 108  THR B  C   1 
ATOM   9390  O O   . THR B  1 108  ? 230.780 175.405 155.154 1.00 71.38  ? 108  THR B  O   1 
ATOM   9391  C CB  . THR B  1 108  ? 229.146 178.014 155.258 1.00 55.54  ? 108  THR B  CB  1 
ATOM   9392  O OG1 . THR B  1 108  ? 228.381 176.833 155.524 1.00 63.45  ? 108  THR B  OG1 1 
ATOM   9393  C CG2 . THR B  1 108  ? 228.940 178.437 153.811 1.00 54.20  ? 108  THR B  CG2 1 
ATOM   9394  N N   . THR B  1 109  ? 231.776 176.727 153.625 1.00 69.92  ? 109  THR B  N   1 
ATOM   9395  C CA  . THR B  1 109  ? 232.380 175.620 152.884 1.00 65.90  ? 109  THR B  CA  1 
ATOM   9396  C C   . THR B  1 109  ? 233.857 175.819 152.575 1.00 66.15  ? 109  THR B  C   1 
ATOM   9397  O O   . THR B  1 109  ? 234.588 174.826 152.517 1.00 64.30  ? 109  THR B  O   1 
ATOM   9398  C CB  . THR B  1 109  ? 231.636 175.389 151.562 1.00 74.69  ? 109  THR B  CB  1 
ATOM   9399  O OG1 . THR B  1 109  ? 231.747 176.557 150.738 1.00 74.11  ? 109  THR B  OG1 1 
ATOM   9400  C CG2 . THR B  1 109  ? 230.168 175.088 151.813 1.00 65.18  ? 109  THR B  CG2 1 
ATOM   9401  N N   . LEU B  1 110  ? 234.326 177.050 152.378 1.00 70.32  ? 110  LEU B  N   1 
ATOM   9402  C CA  . LEU B  1 110  ? 235.740 177.350 152.168 1.00 65.88  ? 110  LEU B  CA  1 
ATOM   9403  C C   . LEU B  1 110  ? 236.296 176.717 150.895 1.00 68.05  ? 110  LEU B  C   1 
ATOM   9404  O O   . LEU B  1 110  ? 237.512 176.554 150.767 1.00 68.47  ? 110  LEU B  O   1 
ATOM   9405  C CB  . LEU B  1 110  ? 236.579 176.912 153.373 1.00 62.18  ? 110  LEU B  CB  1 
ATOM   9406  C CG  . LEU B  1 110  ? 236.101 177.395 154.747 1.00 58.63  ? 110  LEU B  CG  1 
ATOM   9407  C CD1 . LEU B  1 110  ? 237.129 177.064 155.814 1.00 49.57  ? 110  LEU B  CD1 1 
ATOM   9408  C CD2 . LEU B  1 110  ? 235.793 178.884 154.750 1.00 63.21  ? 110  LEU B  CD2 1 
ATOM   9409  N N   . ASP B  1 111  ? 235.434 176.344 149.943 1.00 68.08  ? 111  ASP B  N   1 
ATOM   9410  C CA  . ASP B  1 111  ? 235.886 175.714 148.707 1.00 65.38  ? 111  ASP B  CA  1 
ATOM   9411  C C   . ASP B  1 111  ? 235.268 176.359 147.470 1.00 70.46  ? 111  ASP B  C   1 
ATOM   9412  O O   . ASP B  1 111  ? 235.188 175.717 146.419 1.00 76.60  ? 111  ASP B  O   1 
ATOM   9413  C CB  . ASP B  1 111  ? 235.582 174.214 148.721 1.00 69.50  ? 111  ASP B  CB  1 
ATOM   9414  C CG  . ASP B  1 111  ? 234.099 173.918 148.640 1.00 67.04  ? 111  ASP B  CG  1 
ATOM   9415  O OD1 . ASP B  1 111  ? 233.293 174.862 148.780 1.00 69.67  ? 111  ASP B  OD1 1 
ATOM   9416  O OD2 . ASP B  1 111  ? 233.739 172.741 148.432 1.00 70.81  ? 111  ASP B  OD2 1 
ATOM   9417  N N   . SER B  1 112  ? 234.825 177.608 147.574 1.00 66.48  ? 112  SER B  N   1 
ATOM   9418  C CA  . SER B  1 112  ? 234.285 178.386 146.464 1.00 62.42  ? 112  SER B  CA  1 
ATOM   9419  C C   . SER B  1 112  ? 232.926 177.885 145.993 1.00 64.19  ? 112  SER B  C   1 
ATOM   9420  O O   . SER B  1 112  ? 232.411 178.371 144.978 1.00 64.65  ? 112  SER B  O   1 
ATOM   9421  C CB  . SER B  1 112  ? 235.256 178.416 145.278 1.00 58.28  ? 112  SER B  CB  1 
ATOM   9422  O OG  . SER B  1 112  ? 235.366 177.142 144.670 1.00 58.02  ? 112  SER B  OG  1 
ATOM   9423  N N   . LYS B  1 113  ? 232.328 176.922 146.695 1.00 65.06  ? 113  LYS B  N   1 
ATOM   9424  C CA  . LYS B  1 113  ? 230.906 176.663 146.510 1.00 65.60  ? 113  LYS B  CA  1 
ATOM   9425  C C   . LYS B  1 113  ? 230.073 177.815 147.052 1.00 70.96  ? 113  LYS B  C   1 
ATOM   9426  O O   . LYS B  1 113  ? 228.940 178.029 146.606 1.00 73.44  ? 113  LYS B  O   1 
ATOM   9427  C CB  . LYS B  1 113  ? 230.506 175.362 147.205 1.00 63.59  ? 113  LYS B  CB  1 
ATOM   9428  C CG  . LYS B  1 113  ? 230.955 174.092 146.505 1.00 65.26  ? 113  LYS B  CG  1 
ATOM   9429  C CD  . LYS B  1 113  ? 230.680 172.859 147.365 1.00 68.53  ? 113  LYS B  CD  1 
ATOM   9430  C CE  . LYS B  1 113  ? 229.189 172.644 147.620 1.00 67.78  ? 113  LYS B  CE  1 
ATOM   9431  N NZ  . LYS B  1 113  ? 228.930 171.442 148.467 1.00 79.56  ? 113  LYS B  NZ  1 
ATOM   9432  N N   . THR B  1 114  ? 230.619 178.558 148.012 1.00 68.83  ? 114  THR B  N   1 
ATOM   9433  C CA  . THR B  1 114  ? 229.910 179.627 148.696 1.00 57.64  ? 114  THR B  CA  1 
ATOM   9434  C C   . THR B  1 114  ? 230.890 180.756 148.981 1.00 57.58  ? 114  THR B  C   1 
ATOM   9435  O O   . THR B  1 114  ? 232.108 180.593 148.876 1.00 54.30  ? 114  THR B  O   1 
ATOM   9436  C CB  . THR B  1 114  ? 229.280 179.134 150.005 1.00 59.41  ? 114  THR B  CB  1 
ATOM   9437  O OG1 . THR B  1 114  ? 230.316 178.819 150.942 1.00 61.08  ? 114  THR B  OG1 1 
ATOM   9438  C CG2 . THR B  1 114  ? 228.426 177.894 149.767 1.00 64.50  ? 114  THR B  CG2 1 
ATOM   9439  N N   . GLN B  1 115  ? 230.348 181.912 149.348 1.00 63.71  ? 115  GLN B  N   1 
ATOM   9440  C CA  . GLN B  1 115  ? 231.189 183.045 149.691 1.00 54.60  ? 115  GLN B  CA  1 
ATOM   9441  C C   . GLN B  1 115  ? 231.898 182.810 151.023 1.00 54.82  ? 115  GLN B  C   1 
ATOM   9442  O O   . GLN B  1 115  ? 231.485 181.991 151.846 1.00 60.18  ? 115  GLN B  O   1 
ATOM   9443  C CB  . GLN B  1 115  ? 230.364 184.328 149.760 1.00 52.62  ? 115  GLN B  CB  1 
ATOM   9444  C CG  . GLN B  1 115  ? 229.873 184.811 148.415 1.00 63.55  ? 115  GLN B  CG  1 
ATOM   9445  C CD  . GLN B  1 115  ? 229.459 186.263 148.444 1.00 72.60  ? 115  GLN B  CD  1 
ATOM   9446  O OE1 . GLN B  1 115  ? 228.497 186.633 149.116 1.00 66.71  ? 115  GLN B  OE1 1 
ATOM   9447  N NE2 . GLN B  1 115  ? 230.193 187.102 147.724 1.00 65.92  ? 115  GLN B  NE2 1 
ATOM   9448  N N   . SER B  1 116  ? 232.988 183.546 151.223 1.00 54.14  ? 116  SER B  N   1 
ATOM   9449  C CA  . SER B  1 116  ? 233.751 183.458 152.458 1.00 52.39  ? 116  SER B  CA  1 
ATOM   9450  C C   . SER B  1 116  ? 234.411 184.801 152.728 1.00 50.52  ? 116  SER B  C   1 
ATOM   9451  O O   . SER B  1 116  ? 234.672 185.584 151.812 1.00 58.47  ? 116  SER B  O   1 
ATOM   9452  C CB  . SER B  1 116  ? 234.804 182.347 152.392 1.00 52.89  ? 116  SER B  CB  1 
ATOM   9453  O OG  . SER B  1 116  ? 234.198 181.089 152.163 1.00 56.42  ? 116  SER B  OG  1 
ATOM   9454  N N   . LEU B  1 117  ? 234.686 185.053 154.003 1.00 48.63  ? 117  LEU B  N   1 
ATOM   9455  C CA  . LEU B  1 117  ? 235.269 186.309 154.452 1.00 49.51  ? 117  LEU B  CA  1 
ATOM   9456  C C   . LEU B  1 117  ? 236.753 186.118 154.734 1.00 48.74  ? 117  LEU B  C   1 
ATOM   9457  O O   . LEU B  1 117  ? 237.139 185.186 155.446 1.00 49.31  ? 117  LEU B  O   1 
ATOM   9458  C CB  . LEU B  1 117  ? 234.550 186.819 155.702 1.00 42.42  ? 117  LEU B  CB  1 
ATOM   9459  C CG  . LEU B  1 117  ? 235.223 187.954 156.476 1.00 32.55  ? 117  LEU B  CG  1 
ATOM   9460  C CD1 . LEU B  1 117  ? 235.379 189.186 155.610 1.00 36.90  ? 117  LEU B  CD1 1 
ATOM   9461  C CD2 . LEU B  1 117  ? 234.433 188.277 157.723 1.00 44.53  ? 117  LEU B  CD2 1 
ATOM   9462  N N   . LEU B  1 118  ? 237.576 186.994 154.168 1.00 49.26  ? 118  LEU B  N   1 
ATOM   9463  C CA  . LEU B  1 118  ? 239.015 186.993 154.393 1.00 46.88  ? 118  LEU B  CA  1 
ATOM   9464  C C   . LEU B  1 118  ? 239.415 188.266 155.123 1.00 45.85  ? 118  LEU B  C   1 
ATOM   9465  O O   . LEU B  1 118  ? 239.174 189.369 154.626 1.00 47.53  ? 118  LEU B  O   1 
ATOM   9466  C CB  . LEU B  1 118  ? 239.771 186.887 153.067 1.00 57.65  ? 118  LEU B  CB  1 
ATOM   9467  C CG  . LEU B  1 118  ? 241.289 187.094 153.088 1.00 55.28  ? 118  LEU B  CG  1 
ATOM   9468  C CD1 . LEU B  1 118  ? 241.991 185.851 153.592 1.00 61.08  ? 118  LEU B  CD1 1 
ATOM   9469  C CD2 . LEU B  1 118  ? 241.793 187.481 151.710 1.00 53.75  ? 118  LEU B  CD2 1 
ATOM   9470  N N   . ILE B  1 119  ? 240.036 188.110 156.288 1.00 48.92  ? 119  ILE B  N   1 
ATOM   9471  C CA  . ILE B  1 119  ? 240.678 189.211 156.998 1.00 53.41  ? 119  ILE B  CA  1 
ATOM   9472  C C   . ILE B  1 119  ? 242.151 188.859 157.127 1.00 55.60  ? 119  ILE B  C   1 
ATOM   9473  O O   . ILE B  1 119  ? 242.501 187.855 157.760 1.00 56.74  ? 119  ILE B  O   1 
ATOM   9474  C CB  . ILE B  1 119  ? 240.042 189.461 158.374 1.00 46.06  ? 119  ILE B  CB  1 
ATOM   9475  C CG1 . ILE B  1 119  ? 238.533 189.661 158.224 1.00 45.02  ? 119  ILE B  CG1 1 
ATOM   9476  C CG2 . ILE B  1 119  ? 240.668 190.683 159.038 1.00 41.68  ? 119  ILE B  CG2 1 
ATOM   9477  C CD1 . ILE B  1 119  ? 237.809 189.923 159.522 1.00 42.86  ? 119  ILE B  CD1 1 
ATOM   9478  N N   . VAL B  1 120  ? 243.009 189.680 156.528 1.00 52.41  ? 120  VAL B  N   1 
ATOM   9479  C CA  . VAL B  1 120  ? 244.438 189.408 156.432 1.00 59.64  ? 120  VAL B  CA  1 
ATOM   9480  C C   . VAL B  1 120  ? 245.207 190.669 156.791 1.00 69.52  ? 120  VAL B  C   1 
ATOM   9481  O O   . VAL B  1 120  ? 244.890 191.763 156.311 1.00 68.24  ? 120  VAL B  O   1 
ATOM   9482  C CB  . VAL B  1 120  ? 244.825 188.917 155.020 1.00 68.23  ? 120  VAL B  CB  1 
ATOM   9483  C CG1 . VAL B  1 120  ? 246.223 189.392 154.637 1.00 69.38  ? 120  VAL B  CG1 1 
ATOM   9484  C CG2 . VAL B  1 120  ? 244.742 187.404 154.942 1.00 60.47  ? 120  VAL B  CG2 1 
ATOM   9485  N N   . ASN B  1 121  ? 246.227 190.510 157.632 1.00 68.18  ? 121  ASN B  N   1 
ATOM   9486  C CA  . ASN B  1 121  ? 247.131 191.599 157.990 1.00 67.44  ? 121  ASN B  CA  1 
ATOM   9487  C C   . ASN B  1 121  ? 248.470 191.341 157.308 1.00 70.55  ? 121  ASN B  C   1 
ATOM   9488  O O   . ASN B  1 121  ? 249.416 190.837 157.912 1.00 75.59  ? 121  ASN B  O   1 
ATOM   9489  C CB  . ASN B  1 121  ? 247.275 191.692 159.505 1.00 64.13  ? 121  ASN B  CB  1 
ATOM   9490  C CG  . ASN B  1 121  ? 248.395 192.617 159.930 1.00 70.44  ? 121  ASN B  CG  1 
ATOM   9491  O OD1 . ASN B  1 121  ? 248.847 193.464 159.159 1.00 70.61  ? 121  ASN B  OD1 1 
ATOM   9492  N ND2 . ASN B  1 121  ? 248.854 192.456 161.167 1.00 66.46  ? 121  ASN B  ND2 1 
ATOM   9493  N N   . ASN B  1 122  ? 248.550 191.697 156.028 1.00 75.14  ? 122  ASN B  N   1 
ATOM   9494  C CA  . ASN B  1 122  ? 249.803 191.483 155.323 1.00 77.47  ? 122  ASN B  CA  1 
ATOM   9495  C C   . ASN B  1 122  ? 250.738 192.669 155.556 1.00 79.10  ? 122  ASN B  C   1 
ATOM   9496  O O   . ASN B  1 122  ? 250.336 193.731 156.039 1.00 83.11  ? 122  ASN B  O   1 
ATOM   9497  C CB  . ASN B  1 122  ? 249.556 191.206 153.833 1.00 81.91  ? 122  ASN B  CB  1 
ATOM   9498  C CG  . ASN B  1 122  ? 249.186 192.442 153.021 1.00 84.18  ? 122  ASN B  CG  1 
ATOM   9499  O OD1 . ASN B  1 122  ? 249.263 193.577 153.486 1.00 83.37  ? 122  ASN B  OD1 1 
ATOM   9500  N ND2 . ASN B  1 122  ? 248.783 192.199 151.772 1.00 83.69  ? 122  ASN B  ND2 1 
ATOM   9501  N N   . ALA B  1 123  ? 252.007 192.479 155.196 1.00 80.15  ? 123  ALA B  N   1 
ATOM   9502  C CA  . ALA B  1 123  ? 253.053 193.358 155.705 1.00 83.20  ? 123  ALA B  CA  1 
ATOM   9503  C C   . ALA B  1 123  ? 252.819 194.813 155.324 1.00 82.89  ? 123  ALA B  C   1 
ATOM   9504  O O   . ALA B  1 123  ? 253.321 195.716 156.003 1.00 82.96  ? 123  ALA B  O   1 
ATOM   9505  C CB  . ALA B  1 123  ? 254.419 192.896 155.199 1.00 83.28  ? 123  ALA B  CB  1 
ATOM   9506  N N   . THR B  1 124  ? 252.060 195.066 154.261 1.00 79.92  ? 124  THR B  N   1 
ATOM   9507  C CA  . THR B  1 124  ? 251.866 196.427 153.779 1.00 79.45  ? 124  THR B  CA  1 
ATOM   9508  C C   . THR B  1 124  ? 250.556 197.053 154.237 1.00 82.58  ? 124  THR B  C   1 
ATOM   9509  O O   . THR B  1 124  ? 250.519 198.265 154.473 1.00 86.52  ? 124  THR B  O   1 
ATOM   9510  C CB  . THR B  1 124  ? 251.928 196.457 152.248 1.00 82.39  ? 124  THR B  CB  1 
ATOM   9511  O OG1 . THR B  1 124  ? 251.104 195.414 151.713 1.00 86.26  ? 124  THR B  OG1 1 
ATOM   9512  C CG2 . THR B  1 124  ? 253.363 196.276 151.762 1.00 82.92  ? 124  THR B  CG2 1 
ATOM   9513  N N   . ASN B  1 125  ? 249.485 196.273 154.372 1.00 85.07  ? 125  ASN B  N   1 
ATOM   9514  C CA  . ASN B  1 125  ? 248.214 196.820 154.828 1.00 79.27  ? 125  ASN B  CA  1 
ATOM   9515  C C   . ASN B  1 125  ? 247.286 195.692 155.255 1.00 72.11  ? 125  ASN B  C   1 
ATOM   9516  O O   . ASN B  1 125  ? 247.453 194.536 154.860 1.00 72.20  ? 125  ASN B  O   1 
ATOM   9517  C CB  . ASN B  1 125  ? 247.546 197.665 153.738 1.00 78.83  ? 125  ASN B  CB  1 
ATOM   9518  C CG  . ASN B  1 125  ? 247.714 197.071 152.360 1.00 79.06  ? 125  ASN B  CG  1 
ATOM   9519  O OD1 . ASN B  1 125  ? 247.197 195.995 152.069 1.00 80.99  ? 125  ASN B  OD1 1 
ATOM   9520  N ND2 . ASN B  1 125  ? 248.436 197.774 151.497 1.00 78.80  ? 125  ASN B  ND2 1 
ATOM   9521  N N   . VAL B  1 126  ? 246.298 196.052 156.073 1.00 74.70  ? 126  VAL B  N   1 
ATOM   9522  C CA  . VAL B  1 126  ? 245.206 195.137 156.377 1.00 75.05  ? 126  VAL B  CA  1 
ATOM   9523  C C   . VAL B  1 126  ? 244.226 195.142 155.213 1.00 72.42  ? 126  VAL B  C   1 
ATOM   9524  O O   . VAL B  1 126  ? 243.850 196.206 154.704 1.00 71.25  ? 126  VAL B  O   1 
ATOM   9525  C CB  . VAL B  1 126  ? 244.515 195.536 157.689 1.00 68.58  ? 126  VAL B  CB  1 
ATOM   9526  C CG1 . VAL B  1 126  ? 243.326 194.626 157.965 1.00 60.23  ? 126  VAL B  CG1 1 
ATOM   9527  C CG2 . VAL B  1 126  ? 245.500 195.485 158.849 1.00 70.20  ? 126  VAL B  CG2 1 
ATOM   9528  N N   . VAL B  1 127  ? 243.818 193.953 154.777 1.00 62.76  ? 127  VAL B  N   1 
ATOM   9529  C CA  . VAL B  1 127  ? 242.877 193.801 153.675 1.00 60.51  ? 127  VAL B  CA  1 
ATOM   9530  C C   . VAL B  1 127  ? 241.734 192.906 154.129 1.00 60.08  ? 127  VAL B  C   1 
ATOM   9531  O O   . VAL B  1 127  ? 241.964 191.814 154.659 1.00 60.11  ? 127  VAL B  O   1 
ATOM   9532  C CB  . VAL B  1 127  ? 243.551 193.217 152.419 1.00 68.49  ? 127  VAL B  CB  1 
ATOM   9533  C CG1 . VAL B  1 127  ? 244.495 192.091 152.795 1.00 70.34  ? 127  VAL B  CG1 1 
ATOM   9534  C CG2 . VAL B  1 127  ? 242.497 192.722 151.435 1.00 58.45  ? 127  VAL B  CG2 1 
ATOM   9535  N N   . ILE B  1 128  ? 240.506 193.364 153.904 1.00 58.04  ? 128  ILE B  N   1 
ATOM   9536  C CA  . ILE B  1 128  ? 239.302 192.595 154.189 1.00 55.04  ? 128  ILE B  CA  1 
ATOM   9537  C C   . ILE B  1 128  ? 238.562 192.394 152.877 1.00 50.72  ? 128  ILE B  C   1 
ATOM   9538  O O   . ILE B  1 128  ? 238.294 193.363 152.158 1.00 55.68  ? 128  ILE B  O   1 
ATOM   9539  C CB  . ILE B  1 128  ? 238.400 193.295 155.221 1.00 61.47  ? 128  ILE B  CB  1 
ATOM   9540  C CG1 . ILE B  1 128  ? 239.187 193.593 156.500 1.00 57.72  ? 128  ILE B  CG1 1 
ATOM   9541  C CG2 . ILE B  1 128  ? 237.186 192.431 155.513 1.00 52.19  ? 128  ILE B  CG2 1 
ATOM   9542  C CD1 . ILE B  1 128  ? 238.441 194.440 157.504 1.00 44.03  ? 128  ILE B  CD1 1 
ATOM   9543  N N   . LYS B  1 129  ? 238.240 191.143 152.564 1.00 52.47  ? 129  LYS B  N   1 
ATOM   9544  C CA  . LYS B  1 129  ? 237.638 190.818 151.281 1.00 50.54  ? 129  LYS B  CA  1 
ATOM   9545  C C   . LYS B  1 129  ? 236.698 189.634 151.440 1.00 50.66  ? 129  LYS B  C   1 
ATOM   9546  O O   . LYS B  1 129  ? 237.019 188.664 152.132 1.00 52.18  ? 129  LYS B  O   1 
ATOM   9547  C CB  . LYS B  1 129  ? 238.714 190.497 150.243 1.00 48.76  ? 129  LYS B  CB  1 
ATOM   9548  C CG  . LYS B  1 129  ? 238.273 190.707 148.814 1.00 57.72  ? 129  LYS B  CG  1 
ATOM   9549  C CD  . LYS B  1 129  ? 239.317 190.204 147.837 1.00 62.34  ? 129  LYS B  CD  1 
ATOM   9550  C CE  . LYS B  1 129  ? 240.664 190.859 148.088 1.00 67.48  ? 129  LYS B  CE  1 
ATOM   9551  N NZ  . LYS B  1 129  ? 241.460 191.015 146.842 1.00 71.51  ? 129  LYS B  NZ  1 
ATOM   9552  N N   . VAL B  1 130  ? 235.546 189.716 150.783 1.00 49.89  ? 130  VAL B  N   1 
ATOM   9553  C CA  . VAL B  1 130  ? 234.562 188.641 150.758 1.00 50.51  ? 130  VAL B  CA  1 
ATOM   9554  C C   . VAL B  1 130  ? 234.470 188.142 149.325 1.00 59.92  ? 130  VAL B  C   1 
ATOM   9555  O O   . VAL B  1 130  ? 234.080 188.897 148.426 1.00 67.89  ? 130  VAL B  O   1 
ATOM   9556  C CB  . VAL B  1 130  ? 233.190 189.110 151.265 1.00 42.85  ? 130  VAL B  CB  1 
ATOM   9557  C CG1 . VAL B  1 130  ? 232.164 188.003 151.131 1.00 41.77  ? 130  VAL B  CG1 1 
ATOM   9558  C CG2 . VAL B  1 130  ? 233.285 189.574 152.707 1.00 45.26  ? 130  VAL B  CG2 1 
ATOM   9559  N N   . CYS B  1 131  ? 234.825 186.876 149.112 1.00 54.05  ? 131  CYS B  N   1 
ATOM   9560  C CA  . CYS B  1 131  ? 234.822 186.295 147.779 1.00 51.97  ? 131  CYS B  CA  1 
ATOM   9561  C C   . CYS B  1 131  ? 234.485 184.816 147.873 1.00 49.53  ? 131  CYS B  C   1 
ATOM   9562  O O   . CYS B  1 131  ? 234.480 184.226 148.956 1.00 59.41  ? 131  CYS B  O   1 
ATOM   9563  C CB  . CYS B  1 131  ? 236.176 186.459 147.077 1.00 61.82  ? 131  CYS B  CB  1 
ATOM   9564  S SG  . CYS B  1 131  ? 236.856 188.122 147.048 1.00 71.39  ? 131  CYS B  SG  1 
ATOM   9565  N N   . GLU B  1 132  ? 234.195 184.222 146.716 1.00 54.78  ? 132  GLU B  N   1 
ATOM   9566  C CA  . GLU B  1 132  ? 234.087 182.773 146.612 1.00 57.16  ? 132  GLU B  CA  1 
ATOM   9567  C C   . GLU B  1 132  ? 235.482 182.157 146.556 1.00 65.16  ? 132  GLU B  C   1 
ATOM   9568  O O   . GLU B  1 132  ? 235.887 181.602 145.529 1.00 65.68  ? 132  GLU B  O   1 
ATOM   9569  C CB  . GLU B  1 132  ? 233.272 182.382 145.377 1.00 61.27  ? 132  GLU B  CB  1 
ATOM   9570  C CG  . GLU B  1 132  ? 231.791 182.702 145.491 1.00 67.44  ? 132  GLU B  CG  1 
ATOM   9571  C CD  . GLU B  1 132  ? 231.013 182.325 144.247 1.00 73.34  ? 132  GLU B  CD  1 
ATOM   9572  O OE1 . GLU B  1 132  ? 231.458 181.414 143.518 1.00 80.07  ? 132  GLU B  OE1 1 
ATOM   9573  O OE2 . GLU B  1 132  ? 229.960 182.946 143.993 1.00 72.89  ? 132  GLU B  OE2 1 
ATOM   9574  N N   . PHE B  1 133  ? 236.217 182.246 147.660 1.00 64.59  ? 133  PHE B  N   1 
ATOM   9575  C CA  . PHE B  1 133  ? 237.609 181.817 147.684 1.00 62.11  ? 133  PHE B  CA  1 
ATOM   9576  C C   . PHE B  1 133  ? 237.728 180.308 147.521 1.00 64.65  ? 133  PHE B  C   1 
ATOM   9577  O O   . PHE B  1 133  ? 236.904 179.548 148.038 1.00 60.23  ? 133  PHE B  O   1 
ATOM   9578  C CB  . PHE B  1 133  ? 238.268 182.232 148.995 1.00 62.75  ? 133  PHE B  CB  1 
ATOM   9579  C CG  . PHE B  1 133  ? 238.437 183.711 149.152 1.00 58.66  ? 133  PHE B  CG  1 
ATOM   9580  C CD1 . PHE B  1 133  ? 239.429 184.388 148.468 1.00 61.23  ? 133  PHE B  CD1 1 
ATOM   9581  C CD2 . PHE B  1 133  ? 237.616 184.422 150.002 1.00 59.21  ? 133  PHE B  CD2 1 
ATOM   9582  C CE1 . PHE B  1 133  ? 239.587 185.747 148.620 1.00 54.61  ? 133  PHE B  CE1 1 
ATOM   9583  C CE2 . PHE B  1 133  ? 237.771 185.778 150.158 1.00 59.27  ? 133  PHE B  CE2 1 
ATOM   9584  C CZ  . PHE B  1 133  ? 238.758 186.442 149.468 1.00 52.86  ? 133  PHE B  CZ  1 
ATOM   9585  N N   . GLN B  1 134  ? 238.755 179.879 146.791 1.00 63.90  ? 134  GLN B  N   1 
ATOM   9586  C CA  . GLN B  1 134  ? 239.189 178.484 146.793 1.00 67.80  ? 134  GLN B  CA  1 
ATOM   9587  C C   . GLN B  1 134  ? 240.359 178.375 147.762 1.00 73.33  ? 134  GLN B  C   1 
ATOM   9588  O O   . GLN B  1 134  ? 241.516 178.566 147.379 1.00 80.73  ? 134  GLN B  O   1 
ATOM   9589  C CB  . GLN B  1 134  ? 239.579 178.030 145.392 1.00 64.51  ? 134  GLN B  CB  1 
ATOM   9590  C CG  . GLN B  1 134  ? 240.044 176.591 145.325 1.00 62.07  ? 134  GLN B  CG  1 
ATOM   9591  C CD  . GLN B  1 134  ? 238.998 175.628 145.839 1.00 61.40  ? 134  GLN B  CD  1 
ATOM   9592  O OE1 . GLN B  1 134  ? 238.959 175.313 147.027 1.00 65.24  ? 134  GLN B  OE1 1 
ATOM   9593  N NE2 . GLN B  1 134  ? 238.135 175.159 144.947 1.00 63.16  ? 134  GLN B  NE2 1 
ATOM   9594  N N   . PHE B  1 135  ? 240.063 178.063 149.019 1.00 69.09  ? 135  PHE B  N   1 
ATOM   9595  C CA  . PHE B  1 135  ? 241.094 178.045 150.042 1.00 72.49  ? 135  PHE B  CA  1 
ATOM   9596  C C   . PHE B  1 135  ? 241.890 176.746 149.994 1.00 81.10  ? 135  PHE B  C   1 
ATOM   9597  O O   . PHE B  1 135  ? 241.449 175.728 149.455 1.00 78.29  ? 135  PHE B  O   1 
ATOM   9598  C CB  . PHE B  1 135  ? 240.482 178.231 151.430 1.00 73.88  ? 135  PHE B  CB  1 
ATOM   9599  C CG  . PHE B  1 135  ? 240.000 179.627 151.695 1.00 70.20  ? 135  PHE B  CG  1 
ATOM   9600  C CD1 . PHE B  1 135  ? 240.878 180.695 151.666 1.00 72.32  ? 135  PHE B  CD1 1 
ATOM   9601  C CD2 . PHE B  1 135  ? 238.671 179.870 151.982 1.00 63.64  ? 135  PHE B  CD2 1 
ATOM   9602  C CE1 . PHE B  1 135  ? 240.440 181.976 151.909 1.00 66.53  ? 135  PHE B  CE1 1 
ATOM   9603  C CE2 . PHE B  1 135  ? 238.230 181.150 152.229 1.00 57.90  ? 135  PHE B  CE2 1 
ATOM   9604  C CZ  . PHE B  1 135  ? 239.115 182.204 152.191 1.00 61.47  ? 135  PHE B  CZ  1 
ATOM   9605  N N   . CYS B  1 136  ? 243.083 176.798 150.576 1.00 82.44  ? 136  CYS B  N   1 
ATOM   9606  C CA  . CYS B  1 136  ? 244.009 175.679 150.598 1.00 82.35  ? 136  CYS B  CA  1 
ATOM   9607  C C   . CYS B  1 136  ? 243.845 174.877 151.885 1.00 81.34  ? 136  CYS B  C   1 
ATOM   9608  O O   . CYS B  1 136  ? 243.295 175.355 152.878 1.00 79.45  ? 136  CYS B  O   1 
ATOM   9609  C CB  . CYS B  1 136  ? 245.444 176.188 150.453 1.00 83.90  ? 136  CYS B  CB  1 
ATOM   9610  S SG  . CYS B  1 136  ? 245.678 177.084 148.900 1.00 109.15 ? 136  CYS B  SG  1 
ATOM   9611  N N   . ASN B  1 137  ? 244.317 173.630 151.847 1.00 80.29  ? 137  ASN B  N   1 
ATOM   9612  C CA  . ASN B  1 137  ? 244.215 172.770 153.022 1.00 82.73  ? 137  ASN B  CA  1 
ATOM   9613  C C   . ASN B  1 137  ? 244.919 173.400 154.218 1.00 81.49  ? 137  ASN B  C   1 
ATOM   9614  O O   . ASN B  1 137  ? 244.378 173.426 155.329 1.00 80.82  ? 137  ASN B  O   1 
ATOM   9615  C CB  . ASN B  1 137  ? 244.803 171.394 152.716 1.00 85.36  ? 137  ASN B  CB  1 
ATOM   9616  C CG  . ASN B  1 137  ? 244.465 170.363 153.773 1.00 81.61  ? 137  ASN B  CG  1 
ATOM   9617  O OD1 . ASN B  1 137  ? 243.521 170.534 154.545 1.00 81.89  ? 137  ASN B  OD1 1 
ATOM   9618  N ND2 . ASN B  1 137  ? 245.237 169.282 153.814 1.00 80.70  ? 137  ASN B  ND2 1 
ATOM   9619  N N   . ASP B  1 138  ? 246.131 173.908 154.011 1.00 78.41  ? 138  ASP B  N   1 
ATOM   9620  C CA  . ASP B  1 138  ? 246.895 174.575 155.065 1.00 78.26  ? 138  ASP B  CA  1 
ATOM   9621  C C   . ASP B  1 138  ? 247.282 175.977 154.614 1.00 75.84  ? 138  ASP B  C   1 
ATOM   9622  O O   . ASP B  1 138  ? 248.365 176.168 154.033 1.00 69.81  ? 138  ASP B  O   1 
ATOM   9623  C CB  . ASP B  1 138  ? 248.139 173.764 155.422 1.00 75.11  ? 138  ASP B  CB  1 
ATOM   9624  C CG  . ASP B  1 138  ? 247.815 172.553 156.276 1.00 87.06  ? 138  ASP B  CG  1 
ATOM   9625  O OD1 . ASP B  1 138  ? 246.617 172.308 156.529 1.00 86.43  ? 138  ASP B  OD1 1 
ATOM   9626  O OD2 . ASP B  1 138  ? 248.757 171.851 156.700 1.00 93.36  ? 138  ASP B  OD2 1 
ATOM   9627  N N   . PRO B  1 139  ? 246.451 176.986 154.864 1.00 78.46  ? 139  PRO B  N   1 
ATOM   9628  C CA  . PRO B  1 139  ? 246.807 178.350 154.469 1.00 70.85  ? 139  PRO B  CA  1 
ATOM   9629  C C   . PRO B  1 139  ? 247.813 178.967 155.423 1.00 71.47  ? 139  PRO B  C   1 
ATOM   9630  O O   . PRO B  1 139  ? 247.845 178.665 156.617 1.00 73.15  ? 139  PRO B  O   1 
ATOM   9631  C CB  . PRO B  1 139  ? 245.467 179.088 154.531 1.00 65.29  ? 139  PRO B  CB  1 
ATOM   9632  C CG  . PRO B  1 139  ? 244.732 178.392 155.614 1.00 66.79  ? 139  PRO B  CG  1 
ATOM   9633  C CD  . PRO B  1 139  ? 245.142 176.939 155.539 1.00 70.14  ? 139  PRO B  CD  1 
ATOM   9634  N N   . PHE B  1 140  ? 248.649 179.842 154.873 1.00 69.58  ? 140  PHE B  N   1 
ATOM   9635  C CA  . PHE B  1 140  ? 249.635 180.530 155.689 1.00 64.15  ? 140  PHE B  CA  1 
ATOM   9636  C C   . PHE B  1 140  ? 250.230 181.683 154.899 1.00 65.18  ? 140  PHE B  C   1 
ATOM   9637  O O   . PHE B  1 140  ? 250.154 181.728 153.669 1.00 69.74  ? 140  PHE B  O   1 
ATOM   9638  C CB  . PHE B  1 140  ? 250.741 179.572 156.144 1.00 66.10  ? 140  PHE B  CB  1 
ATOM   9639  C CG  . PHE B  1 140  ? 251.489 178.937 155.009 1.00 70.41  ? 140  PHE B  CG  1 
ATOM   9640  C CD1 . PHE B  1 140  ? 250.998 177.805 154.387 1.00 71.07  ? 140  PHE B  CD1 1 
ATOM   9641  C CD2 . PHE B  1 140  ? 252.680 179.478 154.559 1.00 73.44  ? 140  PHE B  CD2 1 
ATOM   9642  C CE1 . PHE B  1 140  ? 251.681 177.224 153.343 1.00 72.60  ? 140  PHE B  CE1 1 
ATOM   9643  C CE2 . PHE B  1 140  ? 253.365 178.900 153.515 1.00 65.05  ? 140  PHE B  CE2 1 
ATOM   9644  C CZ  . PHE B  1 140  ? 252.866 177.772 152.907 1.00 70.06  ? 140  PHE B  CZ  1 
ATOM   9645  N N   . LEU B  1 141  ? 250.816 182.617 155.634 1.00 63.56  ? 141  LEU B  N   1 
ATOM   9646  C CA  . LEU B  1 141  ? 251.739 183.596 155.088 1.00 66.24  ? 141  LEU B  CA  1 
ATOM   9647  C C   . LEU B  1 141  ? 253.155 183.182 155.466 1.00 72.03  ? 141  LEU B  C   1 
ATOM   9648  O O   . LEU B  1 141  ? 253.365 182.255 156.250 1.00 76.48  ? 141  LEU B  O   1 
ATOM   9649  C CB  . LEU B  1 141  ? 251.416 185.003 155.605 1.00 67.46  ? 141  LEU B  CB  1 
ATOM   9650  C CG  . LEU B  1 141  ? 250.058 185.596 155.207 1.00 68.73  ? 141  LEU B  CG  1 
ATOM   9651  C CD1 . LEU B  1 141  ? 248.907 184.944 155.968 1.00 64.29  ? 141  LEU B  CD1 1 
ATOM   9652  C CD2 . LEU B  1 141  ? 250.041 187.104 155.416 1.00 72.70  ? 141  LEU B  CD2 1 
ATOM   9653  N N   . GLY B  1 142  ? 254.133 183.869 154.898 1.00 74.67  ? 142  GLY B  N   1 
ATOM   9654  C CA  . GLY B  1 142  ? 255.518 183.474 155.086 1.00 77.35  ? 142  GLY B  CA  1 
ATOM   9655  C C   . GLY B  1 142  ? 256.445 184.664 155.132 1.00 82.43  ? 142  GLY B  C   1 
ATOM   9656  O O   . GLY B  1 142  ? 256.155 185.726 154.573 1.00 84.34  ? 142  GLY B  O   1 
ATOM   9657  N N   . VAL B  1 143  ? 257.568 184.481 155.825 1.00 79.55  ? 143  VAL B  N   1 
ATOM   9658  C CA  . VAL B  1 143  ? 258.575 185.519 156.003 1.00 77.69  ? 143  VAL B  CA  1 
ATOM   9659  C C   . VAL B  1 143  ? 259.953 184.884 155.882 1.00 82.57  ? 143  VAL B  C   1 
ATOM   9660  O O   . VAL B  1 143  ? 260.218 183.846 156.499 1.00 85.07  ? 143  VAL B  O   1 
ATOM   9661  C CB  . VAL B  1 143  ? 258.430 186.222 157.366 1.00 77.62  ? 143  VAL B  CB  1 
ATOM   9662  C CG1 . VAL B  1 143  ? 259.347 187.429 157.448 1.00 77.13  ? 143  VAL B  CG1 1 
ATOM   9663  C CG2 . VAL B  1 143  ? 256.987 186.622 157.599 1.00 80.54  ? 143  VAL B  CG2 1 
ATOM   9664  N N   . TYR B  1 144  ? 260.827 185.499 155.087 1.00 91.70  ? 144  TYR B  N   1 
ATOM   9665  C CA  . TYR B  1 144  ? 262.224 185.080 155.039 1.00 90.77  ? 144  TYR B  CA  1 
ATOM   9666  C C   . TYR B  1 144  ? 262.967 185.623 156.254 1.00 90.41  ? 144  TYR B  C   1 
ATOM   9667  O O   . TYR B  1 144  ? 262.916 186.824 156.538 1.00 90.70  ? 144  TYR B  O   1 
ATOM   9668  C CB  . TYR B  1 144  ? 262.885 185.558 153.750 1.00 87.52  ? 144  TYR B  CB  1 
ATOM   9669  C CG  . TYR B  1 144  ? 262.857 184.535 152.638 1.00 92.41  ? 144  TYR B  CG  1 
ATOM   9670  C CD1 . TYR B  1 144  ? 263.483 183.305 152.786 1.00 84.63  ? 144  TYR B  CD1 1 
ATOM   9671  C CD2 . TYR B  1 144  ? 262.217 184.802 151.437 1.00 91.54  ? 144  TYR B  CD2 1 
ATOM   9672  C CE1 . TYR B  1 144  ? 263.463 182.370 151.777 1.00 82.71  ? 144  TYR B  CE1 1 
ATOM   9673  C CE2 . TYR B  1 144  ? 262.194 183.870 150.420 1.00 89.37  ? 144  TYR B  CE2 1 
ATOM   9674  C CZ  . TYR B  1 144  ? 262.819 182.656 150.596 1.00 84.41  ? 144  TYR B  CZ  1 
ATOM   9675  O OH  . TYR B  1 144  ? 262.801 181.721 149.587 1.00 87.15  ? 144  TYR B  OH  1 
ATOM   9676  N N   . TYR B  1 145  ? 263.660 184.739 156.966 1.00 88.82  ? 145  TYR B  N   1 
ATOM   9677  C CA  . TYR B  1 145  ? 264.271 185.072 158.254 1.00 93.09  ? 145  TYR B  CA  1 
ATOM   9678  C C   . TYR B  1 145  ? 265.672 185.635 158.042 1.00 100.68 ? 145  TYR B  C   1 
ATOM   9679  O O   . TYR B  1 145  ? 266.612 184.895 157.742 1.00 96.23  ? 145  TYR B  O   1 
ATOM   9680  C CB  . TYR B  1 145  ? 264.307 183.850 159.168 1.00 88.51  ? 145  TYR B  CB  1 
ATOM   9681  C CG  . TYR B  1 145  ? 264.660 182.544 158.479 1.00 94.45  ? 145  TYR B  CG  1 
ATOM   9682  C CD1 . TYR B  1 145  ? 263.678 181.773 157.868 1.00 92.02  ? 145  TYR B  CD1 1 
ATOM   9683  C CD2 . TYR B  1 145  ? 265.967 182.079 158.448 1.00 92.41  ? 145  TYR B  CD2 1 
ATOM   9684  C CE1 . TYR B  1 145  ? 263.989 180.586 157.241 1.00 85.67  ? 145  TYR B  CE1 1 
ATOM   9685  C CE2 . TYR B  1 145  ? 266.285 180.888 157.823 1.00 86.98  ? 145  TYR B  CE2 1 
ATOM   9686  C CZ  . TYR B  1 145  ? 265.291 180.147 157.222 1.00 87.96  ? 145  TYR B  CZ  1 
ATOM   9687  O OH  . TYR B  1 145  ? 265.597 178.960 156.597 1.00 84.32  ? 145  TYR B  OH  1 
ATOM   9688  N N   . HIS B  1 146  ? 265.810 186.953 158.214 1.00 99.12  ? 146  HIS B  N   1 
ATOM   9689  C CA  . HIS B  1 146  ? 267.111 187.617 158.287 1.00 95.43  ? 146  HIS B  CA  1 
ATOM   9690  C C   . HIS B  1 146  ? 268.086 187.069 157.251 1.00 96.73  ? 146  HIS B  C   1 
ATOM   9691  O O   . HIS B  1 146  ? 269.183 186.621 157.602 1.00 101.56 ? 146  HIS B  O   1 
ATOM   9692  C CB  . HIS B  1 146  ? 267.679 187.456 159.704 1.00 90.85  ? 146  HIS B  CB  1 
ATOM   9693  C CG  . HIS B  1 146  ? 268.922 188.254 159.974 1.00 92.76  ? 146  HIS B  CG  1 
ATOM   9694  N ND1 . HIS B  1 146  ? 270.013 188.260 159.130 1.00 92.07  ? 146  HIS B  ND1 1 
ATOM   9695  C CD2 . HIS B  1 146  ? 269.254 189.049 161.019 1.00 89.44  ? 146  HIS B  CD2 1 
ATOM   9696  C CE1 . HIS B  1 146  ? 270.955 189.036 159.636 1.00 92.65  ? 146  HIS B  CE1 1 
ATOM   9697  N NE2 . HIS B  1 146  ? 270.519 189.527 160.782 1.00 92.87  ? 146  HIS B  NE2 1 
ATOM   9698  N N   . LYS B  1 147  ? 267.702 187.093 155.977 1.00 92.04  ? 147  LYS B  N   1 
ATOM   9699  C CA  . LYS B  1 147  ? 268.548 186.558 154.910 1.00 100.20 ? 147  LYS B  CA  1 
ATOM   9700  C C   . LYS B  1 147  ? 269.485 187.653 154.414 1.00 104.94 ? 147  LYS B  C   1 
ATOM   9701  O O   . LYS B  1 147  ? 269.214 188.339 153.427 1.00 105.44 ? 147  LYS B  O   1 
ATOM   9702  C CB  . LYS B  1 147  ? 267.694 185.998 153.778 1.00 93.24  ? 147  LYS B  CB  1 
ATOM   9703  C CG  . LYS B  1 147  ? 266.753 184.868 154.194 1.00 87.01  ? 147  LYS B  CG  1 
ATOM   9704  C CD  . LYS B  1 147  ? 267.495 183.688 154.825 1.00 85.84  ? 147  LYS B  CD  1 
ATOM   9705  C CE  . LYS B  1 147  ? 268.444 183.020 153.834 1.00 86.89  ? 147  LYS B  CE  1 
ATOM   9706  N NZ  . LYS B  1 147  ? 269.228 181.915 154.456 1.00 68.89  ? 147  LYS B  NZ  1 
ATOM   9707  N N   . ASN B  1 148  ? 270.599 187.827 155.124 1.00 96.73  ? 148  ASN B  N   1 
ATOM   9708  C CA  . ASN B  1 148  ? 271.709 188.676 154.681 1.00 101.26 ? 148  ASN B  CA  1 
ATOM   9709  C C   . ASN B  1 148  ? 271.255 190.098 154.370 1.00 103.98 ? 148  ASN B  C   1 
ATOM   9710  O O   . ASN B  1 148  ? 271.919 190.825 153.625 1.00 96.21  ? 148  ASN B  O   1 
ATOM   9711  C CB  . ASN B  1 148  ? 272.411 188.066 153.469 1.00 93.47  ? 148  ASN B  CB  1 
ATOM   9712  C CG  . ASN B  1 148  ? 272.905 186.658 153.735 1.00 92.57  ? 148  ASN B  CG  1 
ATOM   9713  O OD1 . ASN B  1 148  ? 273.231 186.309 154.870 1.00 89.98  ? 148  ASN B  OD1 1 
ATOM   9714  N ND2 . ASN B  1 148  ? 272.958 185.839 152.690 1.00 91.90  ? 148  ASN B  ND2 1 
ATOM   9715  N N   . ASN B  1 149  ? 270.118 190.487 154.935 1.00 95.88  ? 149  ASN B  N   1 
ATOM   9716  C CA  . ASN B  1 149  ? 269.642 191.858 154.904 1.00 94.96  ? 149  ASN B  CA  1 
ATOM   9717  C C   . ASN B  1 149  ? 269.417 192.417 156.299 1.00 94.85  ? 149  ASN B  C   1 
ATOM   9718  O O   . ASN B  1 149  ? 269.020 193.581 156.424 1.00 98.14  ? 149  ASN B  O   1 
ATOM   9719  C CB  . ASN B  1 149  ? 268.329 191.950 154.117 1.00 94.24  ? 149  ASN B  CB  1 
ATOM   9720  C CG  . ASN B  1 149  ? 268.544 192.006 152.621 1.00 99.43  ? 149  ASN B  CG  1 
ATOM   9721  O OD1 . ASN B  1 149  ? 269.656 191.837 152.118 1.00 97.92  ? 149  ASN B  OD1 1 
ATOM   9722  N ND2 . ASN B  1 149  ? 267.461 192.243 151.901 1.00 103.24 ? 149  ASN B  ND2 1 
ATOM   9723  N N   . LYS B  1 150  ? 269.641 191.616 157.343 1.00 91.76  ? 150  LYS B  N   1 
ATOM   9724  C CA  . LYS B  1 150  ? 269.324 191.960 158.730 1.00 90.81  ? 150  LYS B  CA  1 
ATOM   9725  C C   . LYS B  1 150  ? 267.929 192.570 158.859 1.00 92.62  ? 150  LYS B  C   1 
ATOM   9726  O O   . LYS B  1 150  ? 267.676 193.391 159.745 1.00 90.71  ? 150  LYS B  O   1 
ATOM   9727  C CB  . LYS B  1 150  ? 270.393 192.867 159.359 1.00 88.30  ? 150  LYS B  CB  1 
ATOM   9728  C CG  . LYS B  1 150  ? 270.722 194.173 158.655 1.00 91.25  ? 150  LYS B  CG  1 
ATOM   9729  C CD  . LYS B  1 150  ? 271.917 194.826 159.342 1.00 84.74  ? 150  LYS B  CD  1 
ATOM   9730  C CE  . LYS B  1 150  ? 272.306 196.155 158.711 1.00 81.16  ? 150  LYS B  CE  1 
ATOM   9731  N NZ  . LYS B  1 150  ? 273.625 196.640 159.216 1.00 82.20  ? 150  LYS B  NZ  1 
ATOM   9732  N N   . SER B  1 151  ? 267.018 192.178 157.969 1.00 95.02  ? 151  SER B  N   1 
ATOM   9733  C CA  . SER B  1 151  ? 265.603 192.492 158.096 1.00 94.22  ? 151  SER B  CA  1 
ATOM   9734  C C   . SER B  1 151  ? 264.779 191.268 157.724 1.00 91.91  ? 151  SER B  C   1 
ATOM   9735  O O   . SER B  1 151  ? 265.086 190.579 156.747 1.00 87.44  ? 151  SER B  O   1 
ATOM   9736  C CB  . SER B  1 151  ? 265.207 193.674 157.204 1.00 86.80  ? 151  SER B  CB  1 
ATOM   9737  O OG  . SER B  1 151  ? 265.371 193.350 155.834 1.00 87.26  ? 151  SER B  OG  1 
ATOM   9738  N N   . TRP B  1 152  ? 263.729 191.008 158.499 1.00 88.14  ? 152  TRP B  N   1 
ATOM   9739  C CA  . TRP B  1 152  ? 262.766 189.976 158.144 1.00 86.86  ? 152  TRP B  CA  1 
ATOM   9740  C C   . TRP B  1 152  ? 261.846 190.494 157.047 1.00 87.31  ? 152  TRP B  C   1 
ATOM   9741  O O   . TRP B  1 152  ? 261.372 191.632 157.102 1.00 86.24  ? 152  TRP B  O   1 
ATOM   9742  C CB  . TRP B  1 152  ? 261.955 189.556 159.370 1.00 83.09  ? 152  TRP B  CB  1 
ATOM   9743  C CG  . TRP B  1 152  ? 262.734 188.722 160.341 1.00 82.79  ? 152  TRP B  CG  1 
ATOM   9744  C CD1 . TRP B  1 152  ? 263.905 189.058 160.955 1.00 80.46  ? 152  TRP B  CD1 1 
ATOM   9745  C CD2 . TRP B  1 152  ? 262.395 187.412 160.818 1.00 81.89  ? 152  TRP B  CD2 1 
ATOM   9746  N NE1 . TRP B  1 152  ? 264.316 188.041 161.779 1.00 84.86  ? 152  TRP B  NE1 1 
ATOM   9747  C CE2 . TRP B  1 152  ? 263.407 187.020 161.713 1.00 80.52  ? 152  TRP B  CE2 1 
ATOM   9748  C CE3 . TRP B  1 152  ? 261.333 186.535 160.574 1.00 81.67  ? 152  TRP B  CE3 1 
ATOM   9749  C CZ2 . TRP B  1 152  ? 263.392 185.790 162.365 1.00 75.21  ? 152  TRP B  CZ2 1 
ATOM   9750  C CZ3 . TRP B  1 152  ? 261.321 185.313 161.224 1.00 84.07  ? 152  TRP B  CZ3 1 
ATOM   9751  C CH2 . TRP B  1 152  ? 262.344 184.953 162.108 1.00 78.87  ? 152  TRP B  CH2 1 
ATOM   9752  N N   . MET B  1 153  ? 261.600 189.655 156.044 1.00 82.94  ? 153  MET B  N   1 
ATOM   9753  C CA  . MET B  1 153  ? 260.913 190.071 154.827 1.00 81.74  ? 153  MET B  CA  1 
ATOM   9754  C C   . MET B  1 153  ? 259.829 189.062 154.483 1.00 83.59  ? 153  MET B  C   1 
ATOM   9755  O O   . MET B  1 153  ? 260.097 187.858 154.418 1.00 83.15  ? 153  MET B  O   1 
ATOM   9756  C CB  . MET B  1 153  ? 261.901 190.201 153.666 1.00 82.25  ? 153  MET B  CB  1 
ATOM   9757  C CG  . MET B  1 153  ? 261.265 190.595 152.342 1.00 87.68  ? 153  MET B  CG  1 
ATOM   9758  S SD  . MET B  1 153  ? 262.471 190.733 151.009 1.00 96.97  ? 153  MET B  SD  1 
ATOM   9759  C CE  . MET B  1 153  ? 263.054 189.043 150.900 1.00 86.73  ? 153  MET B  CE  1 
ATOM   9760  N N   . GLU B  1 154  ? 258.613 189.556 154.266 1.00 83.34  ? 154  GLU B  N   1 
ATOM   9761  C CA  . GLU B  1 154  ? 257.520 188.703 153.822 1.00 83.62  ? 154  GLU B  CA  1 
ATOM   9762  C C   . GLU B  1 154  ? 257.729 188.315 152.363 1.00 83.72  ? 154  GLU B  C   1 
ATOM   9763  O O   . GLU B  1 154  ? 257.937 189.180 151.507 1.00 81.67  ? 154  GLU B  O   1 
ATOM   9764  C CB  . GLU B  1 154  ? 256.188 189.429 153.999 1.00 84.19  ? 154  GLU B  CB  1 
ATOM   9765  C CG  . GLU B  1 154  ? 254.972 188.645 153.549 1.00 81.25  ? 154  GLU B  CG  1 
ATOM   9766  C CD  . GLU B  1 154  ? 253.685 189.416 153.755 1.00 88.45  ? 154  GLU B  CD  1 
ATOM   9767  O OE1 . GLU B  1 154  ? 253.479 189.945 154.868 1.00 84.81  ? 154  GLU B  OE1 1 
ATOM   9768  O OE2 . GLU B  1 154  ? 252.887 189.505 152.799 1.00 90.26  ? 154  GLU B  OE2 1 
ATOM   9769  N N   . SER B  1 155  ? 257.678 187.009 152.081 1.00 85.81  ? 155  SER B  N   1 
ATOM   9770  C CA  . SER B  1 155  ? 257.890 186.556 150.711 1.00 87.82  ? 155  SER B  CA  1 
ATOM   9771  C C   . SER B  1 155  ? 256.948 185.439 150.276 1.00 88.76  ? 155  SER B  C   1 
ATOM   9772  O O   . SER B  1 155  ? 257.092 184.950 149.148 1.00 98.23  ? 155  SER B  O   1 
ATOM   9773  C CB  . SER B  1 155  ? 259.337 186.081 150.531 1.00 90.37  ? 155  SER B  CB  1 
ATOM   9774  O OG  . SER B  1 155  ? 259.627 185.835 149.164 1.00 92.95  ? 155  SER B  OG  1 
ATOM   9775  N N   . GLU B  1 156  ? 256.001 185.011 151.105 1.00 84.30  ? 156  GLU B  N   1 
ATOM   9776  C CA  . GLU B  1 156  ? 255.056 183.972 150.728 1.00 87.88  ? 156  GLU B  CA  1 
ATOM   9777  C C   . GLU B  1 156  ? 253.652 184.384 151.138 1.00 86.54  ? 156  GLU B  C   1 
ATOM   9778  O O   . GLU B  1 156  ? 253.446 184.931 152.225 1.00 83.65  ? 156  GLU B  O   1 
ATOM   9779  C CB  . GLU B  1 156  ? 255.406 182.627 151.371 1.00 85.11  ? 156  GLU B  CB  1 
ATOM   9780  C CG  . GLU B  1 156  ? 256.665 181.972 150.824 1.00 87.81  ? 156  GLU B  CG  1 
ATOM   9781  C CD  . GLU B  1 156  ? 256.895 180.588 151.402 1.00 94.09  ? 156  GLU B  CD  1 
ATOM   9782  O OE1 . GLU B  1 156  ? 256.026 179.711 151.213 1.00 97.25  ? 156  GLU B  OE1 1 
ATOM   9783  O OE2 . GLU B  1 156  ? 257.941 180.378 152.052 1.00 98.54  ? 156  GLU B  OE2 1 
ATOM   9784  N N   . PHE B  1 157  ? 252.691 184.115 150.256 1.00 84.10  ? 157  PHE B  N   1 
ATOM   9785  C CA  . PHE B  1 157  ? 251.273 184.369 150.515 1.00 75.21  ? 157  PHE B  CA  1 
ATOM   9786  C C   . PHE B  1 157  ? 250.504 183.218 149.869 1.00 73.50  ? 157  PHE B  C   1 
ATOM   9787  O O   . PHE B  1 157  ? 250.166 183.271 148.684 1.00 80.50  ? 157  PHE B  O   1 
ATOM   9788  C CB  . PHE B  1 157  ? 250.846 185.723 149.967 1.00 70.51  ? 157  PHE B  CB  1 
ATOM   9789  C CG  . PHE B  1 157  ? 249.419 186.074 150.262 1.00 73.22  ? 157  PHE B  CG  1 
ATOM   9790  C CD1 . PHE B  1 157  ? 249.067 186.630 151.477 1.00 74.10  ? 157  PHE B  CD1 1 
ATOM   9791  C CD2 . PHE B  1 157  ? 248.430 185.857 149.319 1.00 71.50  ? 157  PHE B  CD2 1 
ATOM   9792  C CE1 . PHE B  1 157  ? 247.756 186.955 151.750 1.00 64.66  ? 157  PHE B  CE1 1 
ATOM   9793  C CE2 . PHE B  1 157  ? 247.119 186.182 149.588 1.00 67.50  ? 157  PHE B  CE2 1 
ATOM   9794  C CZ  . PHE B  1 157  ? 246.781 186.732 150.805 1.00 63.27  ? 157  PHE B  CZ  1 
ATOM   9795  N N   . ARG B  1 158  ? 250.236 182.176 150.657 1.00 70.59  ? 158  ARG B  N   1 
ATOM   9796  C CA  . ARG B  1 158  ? 249.613 180.945 150.170 1.00 77.22  ? 158  ARG B  CA  1 
ATOM   9797  C C   . ARG B  1 158  ? 248.409 180.643 151.057 1.00 73.21  ? 158  ARG B  C   1 
ATOM   9798  O O   . ARG B  1 158  ? 248.516 179.865 152.008 1.00 70.97  ? 158  ARG B  O   1 
ATOM   9799  C CB  . ARG B  1 158  ? 250.616 179.793 150.176 1.00 79.82  ? 158  ARG B  CB  1 
ATOM   9800  C CG  . ARG B  1 158  ? 251.868 180.051 149.348 1.00 82.30  ? 158  ARG B  CG  1 
ATOM   9801  C CD  . ARG B  1 158  ? 252.832 178.876 149.419 1.00 82.21  ? 158  ARG B  CD  1 
ATOM   9802  N NE  . ARG B  1 158  ? 253.975 179.034 148.524 1.00 81.73  ? 158  ARG B  NE  1 
ATOM   9803  C CZ  . ARG B  1 158  ? 254.981 178.168 148.439 1.00 85.85  ? 158  ARG B  CZ  1 
ATOM   9804  N NH1 . ARG B  1 158  ? 254.992 177.080 149.197 1.00 88.74  ? 158  ARG B  NH1 1 
ATOM   9805  N NH2 . ARG B  1 158  ? 255.981 178.391 147.596 1.00 88.09  ? 158  ARG B  NH2 1 
ATOM   9806  N N   . VAL B  1 159  ? 247.268 181.257 150.746 1.00 76.68  ? 159  VAL B  N   1 
ATOM   9807  C CA  . VAL B  1 159  ? 246.043 181.011 151.498 1.00 77.93  ? 159  VAL B  CA  1 
ATOM   9808  C C   . VAL B  1 159  ? 244.945 180.549 150.547 1.00 81.06  ? 159  VAL B  C   1 
ATOM   9809  O O   . VAL B  1 159  ? 244.314 179.511 150.777 1.00 75.29  ? 159  VAL B  O   1 
ATOM   9810  C CB  . VAL B  1 159  ? 245.616 182.256 152.300 1.00 66.34  ? 159  VAL B  CB  1 
ATOM   9811  C CG1 . VAL B  1 159  ? 245.672 183.509 151.446 1.00 64.77  ? 159  VAL B  CG1 1 
ATOM   9812  C CG2 . VAL B  1 159  ? 244.225 182.060 152.885 1.00 68.19  ? 159  VAL B  CG2 1 
ATOM   9813  N N   . TYR B  1 160  ? 244.708 181.303 149.474 1.00 80.04  ? 160  TYR B  N   1 
ATOM   9814  C CA  . TYR B  1 160  ? 243.704 180.946 148.483 1.00 73.21  ? 160  TYR B  CA  1 
ATOM   9815  C C   . TYR B  1 160  ? 244.338 180.923 147.102 1.00 83.69  ? 160  TYR B  C   1 
ATOM   9816  O O   . TYR B  1 160  ? 245.226 181.727 146.804 1.00 86.67  ? 160  TYR B  O   1 
ATOM   9817  C CB  . TYR B  1 160  ? 242.514 181.921 148.496 1.00 66.41  ? 160  TYR B  CB  1 
ATOM   9818  C CG  . TYR B  1 160  ? 242.859 183.357 148.161 1.00 69.38  ? 160  TYR B  CG  1 
ATOM   9819  C CD1 . TYR B  1 160  ? 242.892 183.799 146.846 1.00 67.83  ? 160  TYR B  CD1 1 
ATOM   9820  C CD2 . TYR B  1 160  ? 243.130 184.276 149.162 1.00 74.68  ? 160  TYR B  CD2 1 
ATOM   9821  C CE1 . TYR B  1 160  ? 243.201 185.109 146.542 1.00 64.30  ? 160  TYR B  CE1 1 
ATOM   9822  C CE2 . TYR B  1 160  ? 243.439 185.584 148.866 1.00 70.01  ? 160  TYR B  CE2 1 
ATOM   9823  C CZ  . TYR B  1 160  ? 243.472 185.997 147.557 1.00 72.63  ? 160  TYR B  CZ  1 
ATOM   9824  O OH  . TYR B  1 160  ? 243.779 187.305 147.265 1.00 74.87  ? 160  TYR B  OH  1 
ATOM   9825  N N   . SER B  1 161  ? 243.880 179.994 146.264 1.00 79.12  ? 161  SER B  N   1 
ATOM   9826  C CA  . SER B  1 161  ? 244.386 179.886 144.903 1.00 72.70  ? 161  SER B  CA  1 
ATOM   9827  C C   . SER B  1 161  ? 243.707 180.857 143.946 1.00 78.81  ? 161  SER B  C   1 
ATOM   9828  O O   . SER B  1 161  ? 244.367 181.384 143.043 1.00 78.38  ? 161  SER B  O   1 
ATOM   9829  C CB  . SER B  1 161  ? 244.205 178.457 144.387 1.00 68.17  ? 161  SER B  CB  1 
ATOM   9830  O OG  . SER B  1 161  ? 242.837 178.091 144.378 1.00 68.18  ? 161  SER B  OG  1 
ATOM   9831  N N   . SER B  1 162  ? 242.411 181.106 144.120 1.00 78.72  ? 162  SER B  N   1 
ATOM   9832  C CA  . SER B  1 162  ? 241.697 182.055 143.278 1.00 76.61  ? 162  SER B  CA  1 
ATOM   9833  C C   . SER B  1 162  ? 240.499 182.594 144.046 1.00 73.62  ? 162  SER B  C   1 
ATOM   9834  O O   . SER B  1 162  ? 239.973 181.942 144.951 1.00 68.53  ? 162  SER B  O   1 
ATOM   9835  C CB  . SER B  1 162  ? 241.248 181.409 141.962 1.00 76.66  ? 162  SER B  CB  1 
ATOM   9836  O OG  . SER B  1 162  ? 242.353 181.144 141.116 1.00 82.08  ? 162  SER B  OG  1 
ATOM   9837  N N   . ALA B  1 163  ? 240.071 183.797 143.660 1.00 73.10  ? 163  ALA B  N   1 
ATOM   9838  C CA  . ALA B  1 163  ? 238.931 184.490 144.266 1.00 66.64  ? 163  ALA B  CA  1 
ATOM   9839  C C   . ALA B  1 163  ? 237.974 184.855 143.134 1.00 69.18  ? 163  ALA B  C   1 
ATOM   9840  O O   . ALA B  1 163  ? 238.170 185.862 142.449 1.00 76.71  ? 163  ALA B  O   1 
ATOM   9841  C CB  . ALA B  1 163  ? 239.382 185.719 145.045 1.00 66.21  ? 163  ALA B  CB  1 
ATOM   9842  N N   . ASN B  1 164  ? 236.939 184.033 142.941 1.00 68.01  ? 164  ASN B  N   1 
ATOM   9843  C CA  . ASN B  1 164  ? 236.125 184.139 141.734 1.00 65.21  ? 164  ASN B  CA  1 
ATOM   9844  C C   . ASN B  1 164  ? 235.207 185.355 141.778 1.00 76.89  ? 164  ASN B  C   1 
ATOM   9845  O O   . ASN B  1 164  ? 235.423 186.333 141.053 1.00 85.88  ? 164  ASN B  O   1 
ATOM   9846  C CB  . ASN B  1 164  ? 235.305 182.864 141.549 1.00 64.09  ? 164  ASN B  CB  1 
ATOM   9847  C CG  . ASN B  1 164  ? 234.676 182.778 140.178 1.00 74.81  ? 164  ASN B  CG  1 
ATOM   9848  O OD1 . ASN B  1 164  ? 235.298 183.130 139.176 1.00 75.00  ? 164  ASN B  OD1 1 
ATOM   9849  N ND2 . ASN B  1 164  ? 233.432 182.319 140.123 1.00 75.42  ? 164  ASN B  ND2 1 
ATOM   9850  N N   . ASN B  1 165  ? 234.190 185.323 142.637 1.00 69.18  ? 165  ASN B  N   1 
ATOM   9851  C CA  . ASN B  1 165  ? 233.210 186.398 142.744 1.00 66.31  ? 165  ASN B  CA  1 
ATOM   9852  C C   . ASN B  1 165  ? 233.424 187.100 144.074 1.00 68.50  ? 165  ASN B  C   1 
ATOM   9853  O O   . ASN B  1 165  ? 233.367 186.459 145.127 1.00 75.58  ? 165  ASN B  O   1 
ATOM   9854  C CB  . ASN B  1 165  ? 231.772 185.877 142.677 1.00 71.37  ? 165  ASN B  CB  1 
ATOM   9855  C CG  . ASN B  1 165  ? 231.477 185.051 141.437 1.00 73.49  ? 165  ASN B  CG  1 
ATOM   9856  O OD1 . ASN B  1 165  ? 232.183 185.108 140.430 1.00 80.46  ? 165  ASN B  OD1 1 
ATOM   9857  N ND2 . ASN B  1 165  ? 230.402 184.273 141.522 1.00 73.26  ? 165  ASN B  ND2 1 
ATOM   9858  N N   . CYS B  1 166  ? 233.659 188.407 144.026 1.00 63.87  ? 166  CYS B  N   1 
ATOM   9859  C CA  . CYS B  1 166  ? 233.851 189.220 145.219 1.00 63.84  ? 166  CYS B  CA  1 
ATOM   9860  C C   . CYS B  1 166  ? 232.749 190.268 145.305 1.00 64.37  ? 166  CYS B  C   1 
ATOM   9861  O O   . CYS B  1 166  ? 232.439 190.929 144.309 1.00 66.36  ? 166  CYS B  O   1 
ATOM   9862  C CB  . CYS B  1 166  ? 235.222 189.895 145.204 1.00 72.40  ? 166  CYS B  CB  1 
ATOM   9863  S SG  . CYS B  1 166  ? 236.624 188.751 145.133 1.00 90.60  ? 166  CYS B  SG  1 
ATOM   9864  N N   . THR B  1 167  ? 232.150 190.405 146.493 1.00 62.67  ? 167  THR B  N   1 
ATOM   9865  C CA  . THR B  1 167  ? 231.120 191.407 146.726 1.00 60.99  ? 167  THR B  CA  1 
ATOM   9866  C C   . THR B  1 167  ? 231.511 192.482 147.733 1.00 58.40  ? 167  THR B  C   1 
ATOM   9867  O O   . THR B  1 167  ? 230.901 193.554 147.723 1.00 65.98  ? 167  THR B  O   1 
ATOM   9868  C CB  . THR B  1 167  ? 229.825 190.738 147.206 1.00 61.11  ? 167  THR B  CB  1 
ATOM   9869  O OG1 . THR B  1 167  ? 230.109 189.874 148.311 1.00 67.07  ? 167  THR B  OG1 1 
ATOM   9870  C CG2 . THR B  1 167  ? 229.194 189.931 146.082 1.00 61.59  ? 167  THR B  CG2 1 
ATOM   9871  N N   . PHE B  1 168  ? 232.497 192.232 148.594 1.00 52.70  ? 168  PHE B  N   1 
ATOM   9872  C CA  . PHE B  1 168  ? 233.008 193.234 149.521 1.00 53.25  ? 168  PHE B  CA  1 
ATOM   9873  C C   . PHE B  1 168  ? 234.526 193.254 149.442 1.00 52.72  ? 168  PHE B  C   1 
ATOM   9874  O O   . PHE B  1 168  ? 235.158 192.205 149.289 1.00 57.88  ? 168  PHE B  O   1 
ATOM   9875  C CB  . PHE B  1 168  ? 232.564 192.954 150.968 1.00 50.41  ? 168  PHE B  CB  1 
ATOM   9876  C CG  . PHE B  1 168  ? 233.072 193.961 151.969 1.00 48.22  ? 168  PHE B  CG  1 
ATOM   9877  C CD1 . PHE B  1 168  ? 234.288 193.777 152.603 1.00 52.92  ? 168  PHE B  CD1 1 
ATOM   9878  C CD2 . PHE B  1 168  ? 232.329 195.085 152.282 1.00 51.18  ? 168  PHE B  CD2 1 
ATOM   9879  C CE1 . PHE B  1 168  ? 234.754 194.697 153.522 1.00 52.58  ? 168  PHE B  CE1 1 
ATOM   9880  C CE2 . PHE B  1 168  ? 232.794 196.007 153.201 1.00 57.58  ? 168  PHE B  CE2 1 
ATOM   9881  C CZ  . PHE B  1 168  ? 234.007 195.810 153.820 1.00 58.58  ? 168  PHE B  CZ  1 
ATOM   9882  N N   . GLU B  1 169  ? 235.107 194.449 149.527 1.00 50.98  ? 169  GLU B  N   1 
ATOM   9883  C CA  . GLU B  1 169  ? 236.557 194.587 149.506 1.00 51.40  ? 169  GLU B  CA  1 
ATOM   9884  C C   . GLU B  1 169  ? 236.956 195.886 150.189 1.00 55.08  ? 169  GLU B  C   1 
ATOM   9885  O O   . GLU B  1 169  ? 236.451 196.955 149.835 1.00 61.09  ? 169  GLU B  O   1 
ATOM   9886  C CB  . GLU B  1 169  ? 237.093 194.558 148.073 1.00 53.64  ? 169  GLU B  CB  1 
ATOM   9887  C CG  . GLU B  1 169  ? 238.611 194.582 147.976 1.00 57.53  ? 169  GLU B  CG  1 
ATOM   9888  C CD  . GLU B  1 169  ? 239.107 194.229 146.589 1.00 62.44  ? 169  GLU B  CD  1 
ATOM   9889  O OE1 . GLU B  1 169  ? 238.387 194.515 145.610 1.00 74.06  ? 169  GLU B  OE1 1 
ATOM   9890  O OE2 . GLU B  1 169  ? 240.212 193.657 146.480 1.00 62.43  ? 169  GLU B  OE2 1 
ATOM   9891  N N   . TYR B  1 170  ? 237.854 195.785 151.164 1.00 57.57  ? 170  TYR B  N   1 
ATOM   9892  C CA  . TYR B  1 170  ? 238.444 196.943 151.819 1.00 56.34  ? 170  TYR B  CA  1 
ATOM   9893  C C   . TYR B  1 170  ? 239.937 196.715 151.991 1.00 62.43  ? 170  TYR B  C   1 
ATOM   9894  O O   . TYR B  1 170  ? 240.371 195.602 152.300 1.00 66.50  ? 170  TYR B  O   1 
ATOM   9895  C CB  . TYR B  1 170  ? 237.799 197.210 153.183 1.00 57.99  ? 170  TYR B  CB  1 
ATOM   9896  C CG  . TYR B  1 170  ? 238.633 198.093 154.081 1.00 57.21  ? 170  TYR B  CG  1 
ATOM   9897  C CD1 . TYR B  1 170  ? 238.498 199.472 154.055 1.00 53.59  ? 170  TYR B  CD1 1 
ATOM   9898  C CD2 . TYR B  1 170  ? 239.563 197.545 154.953 1.00 63.44  ? 170  TYR B  CD2 1 
ATOM   9899  C CE1 . TYR B  1 170  ? 239.263 200.278 154.872 1.00 53.06  ? 170  TYR B  CE1 1 
ATOM   9900  C CE2 . TYR B  1 170  ? 240.331 198.342 155.769 1.00 61.77  ? 170  TYR B  CE2 1 
ATOM   9901  C CZ  . TYR B  1 170  ? 240.177 199.707 155.727 1.00 56.84  ? 170  TYR B  CZ  1 
ATOM   9902  O OH  . TYR B  1 170  ? 240.945 200.502 156.546 1.00 58.52  ? 170  TYR B  OH  1 
ATOM   9903  N N   . VAL B  1 171  ? 240.719 197.774 151.792 1.00 67.64  ? 171  VAL B  N   1 
ATOM   9904  C CA  . VAL B  1 171  ? 242.159 197.749 152.012 1.00 58.46  ? 171  VAL B  CA  1 
ATOM   9905  C C   . VAL B  1 171  ? 242.552 199.019 152.750 1.00 64.97  ? 171  VAL B  C   1 
ATOM   9906  O O   . VAL B  1 171  ? 242.238 200.126 152.301 1.00 62.86  ? 171  VAL B  O   1 
ATOM   9907  C CB  . VAL B  1 171  ? 242.937 197.626 150.690 1.00 58.21  ? 171  VAL B  CB  1 
ATOM   9908  C CG1 . VAL B  1 171  ? 244.431 197.527 150.956 1.00 65.87  ? 171  VAL B  CG1 1 
ATOM   9909  C CG2 . VAL B  1 171  ? 242.452 196.418 149.919 1.00 59.15  ? 171  VAL B  CG2 1 
ATOM   9910  N N   . SER B  1 172  ? 243.238 198.858 153.877 1.00 68.47  ? 172  SER B  N   1 
ATOM   9911  C CA  . SER B  1 172  ? 243.674 199.997 154.666 1.00 70.81  ? 172  SER B  CA  1 
ATOM   9912  C C   . SER B  1 172  ? 244.802 200.741 153.958 1.00 79.51  ? 172  SER B  C   1 
ATOM   9913  O O   . SER B  1 172  ? 245.466 200.216 153.060 1.00 83.04  ? 172  SER B  O   1 
ATOM   9914  C CB  . SER B  1 172  ? 244.139 199.546 156.049 1.00 65.81  ? 172  SER B  CB  1 
ATOM   9915  O OG  . SER B  1 172  ? 245.153 198.563 155.948 1.00 64.54  ? 172  SER B  OG  1 
ATOM   9916  N N   . GLN B  1 173  ? 245.006 201.986 154.369 1.00 79.52  ? 173  GLN B  N   1 
ATOM   9917  C CA  . GLN B  1 173  ? 246.105 202.765 153.826 1.00 71.14  ? 173  GLN B  CA  1 
ATOM   9918  C C   . GLN B  1 173  ? 247.424 202.069 154.152 1.00 77.88  ? 173  GLN B  C   1 
ATOM   9919  O O   . GLN B  1 173  ? 247.618 201.622 155.291 1.00 84.11  ? 173  GLN B  O   1 
ATOM   9920  C CB  . GLN B  1 173  ? 246.090 204.185 154.389 1.00 73.39  ? 173  GLN B  CB  1 
ATOM   9921  C CG  . GLN B  1 173  ? 245.052 205.083 153.737 1.00 74.71  ? 173  GLN B  CG  1 
ATOM   9922  C CD  . GLN B  1 173  ? 245.332 206.553 153.955 1.00 72.80  ? 173  GLN B  CD  1 
ATOM   9923  O OE1 . GLN B  1 173  ? 245.584 206.990 155.078 1.00 67.67  ? 173  GLN B  OE1 1 
ATOM   9924  N NE2 . GLN B  1 173  ? 245.298 207.330 152.876 1.00 75.38  ? 173  GLN B  NE2 1 
ATOM   9925  N N   . PRO B  1 174  ? 248.343 201.948 153.195 1.00 84.07  ? 174  PRO B  N   1 
ATOM   9926  C CA  . PRO B  1 174  ? 249.525 201.104 153.414 1.00 80.15  ? 174  PRO B  CA  1 
ATOM   9927  C C   . PRO B  1 174  ? 250.406 201.610 154.547 1.00 81.33  ? 174  PRO B  C   1 
ATOM   9928  O O   . PRO B  1 174  ? 250.538 202.814 154.774 1.00 83.70  ? 174  PRO B  O   1 
ATOM   9929  C CB  . PRO B  1 174  ? 250.252 201.157 152.066 1.00 75.53  ? 174  PRO B  CB  1 
ATOM   9930  C CG  . PRO B  1 174  ? 249.762 202.397 151.408 1.00 82.77  ? 174  PRO B  CG  1 
ATOM   9931  C CD  . PRO B  1 174  ? 248.350 202.573 151.862 1.00 82.91  ? 174  PRO B  CD  1 
ATOM   9932  N N   . PHE B  1 175  ? 251.006 200.660 155.261 1.00 76.44  ? 175  PHE B  N   1 
ATOM   9933  C CA  . PHE B  1 175  ? 251.977 200.947 156.309 1.00 77.46  ? 175  PHE B  CA  1 
ATOM   9934  C C   . PHE B  1 175  ? 253.178 200.025 156.141 1.00 80.73  ? 175  PHE B  C   1 
ATOM   9935  O O   . PHE B  1 175  ? 253.294 199.336 155.123 1.00 82.07  ? 175  PHE B  O   1 
ATOM   9936  C CB  . PHE B  1 175  ? 251.347 200.775 157.695 1.00 79.98  ? 175  PHE B  CB  1 
ATOM   9937  C CG  . PHE B  1 175  ? 250.604 199.479 157.869 1.00 82.47  ? 175  PHE B  CG  1 
ATOM   9938  C CD1 . PHE B  1 175  ? 251.262 198.264 157.785 1.00 83.62  ? 175  PHE B  CD1 1 
ATOM   9939  C CD2 . PHE B  1 175  ? 249.246 199.476 158.126 1.00 78.06  ? 175  PHE B  CD2 1 
ATOM   9940  C CE1 . PHE B  1 175  ? 250.582 197.077 157.948 1.00 76.79  ? 175  PHE B  CE1 1 
ATOM   9941  C CE2 . PHE B  1 175  ? 248.560 198.289 158.291 1.00 77.82  ? 175  PHE B  CE2 1 
ATOM   9942  C CZ  . PHE B  1 175  ? 249.230 197.089 158.203 1.00 75.32  ? 175  PHE B  CZ  1 
ATOM   9943  N N   . LEU B  1 176  ? 254.080 200.004 157.125 1.00 84.42  ? 176  LEU B  N   1 
ATOM   9944  C CA  . LEU B  1 176  ? 255.190 199.046 157.142 1.00 86.88  ? 176  LEU B  CA  1 
ATOM   9945  C C   . LEU B  1 176  ? 255.398 198.593 158.586 1.00 83.48  ? 176  LEU B  C   1 
ATOM   9946  O O   . LEU B  1 176  ? 256.117 199.237 159.355 1.00 85.34  ? 176  LEU B  O   1 
ATOM   9947  C CB  . LEU B  1 176  ? 256.460 199.650 156.556 1.00 85.31  ? 176  LEU B  CB  1 
ATOM   9948  C CG  . LEU B  1 176  ? 257.624 198.666 156.416 1.00 84.11  ? 176  LEU B  CG  1 
ATOM   9949  C CD1 . LEU B  1 176  ? 257.314 197.619 155.350 1.00 87.43  ? 176  LEU B  CD1 1 
ATOM   9950  C CD2 . LEU B  1 176  ? 258.914 199.402 156.098 1.00 81.79  ? 176  LEU B  CD2 1 
ATOM   9951  N N   . MET B  1 177  ? 254.760 197.484 158.949 1.00 79.32  ? 177  MET B  N   1 
ATOM   9952  C CA  . MET B  1 177  ? 254.976 196.882 160.254 1.00 85.83  ? 177  MET B  CA  1 
ATOM   9953  C C   . MET B  1 177  ? 256.143 195.909 160.198 1.00 85.81  ? 177  MET B  C   1 
ATOM   9954  O O   . MET B  1 177  ? 256.427 195.302 159.161 1.00 90.25  ? 177  MET B  O   1 
ATOM   9955  C CB  . MET B  1 177  ? 253.722 196.155 160.736 1.00 87.99  ? 177  MET B  CB  1 
ATOM   9956  C CG  . MET B  1 177  ? 252.506 197.049 160.863 1.00 86.39  ? 177  MET B  CG  1 
ATOM   9957  S SD  . MET B  1 177  ? 252.703 198.373 162.069 1.00 100.49 ? 177  MET B  SD  1 
ATOM   9958  C CE  . MET B  1 177  ? 251.235 199.342 161.734 1.00 90.17  ? 177  MET B  CE  1 
ATOM   9959  N N   . ASP B  1 178  ? 256.819 195.762 161.332 1.00 85.81  ? 178  ASP B  N   1 
ATOM   9960  C CA  . ASP B  1 178  ? 257.987 194.899 161.409 1.00 88.92  ? 178  ASP B  CA  1 
ATOM   9961  C C   . ASP B  1 178  ? 257.570 193.452 161.622 1.00 88.12  ? 178  ASP B  C   1 
ATOM   9962  O O   . ASP B  1 178  ? 256.748 193.151 162.493 1.00 89.85  ? 178  ASP B  O   1 
ATOM   9963  C CB  . ASP B  1 178  ? 258.906 195.350 162.542 1.00 83.40  ? 178  ASP B  CB  1 
ATOM   9964  C CG  . ASP B  1 178  ? 259.559 196.690 162.267 1.00 86.77  ? 178  ASP B  CG  1 
ATOM   9965  O OD1 . ASP B  1 178  ? 259.319 197.259 161.182 1.00 86.36  ? 178  ASP B  OD1 1 
ATOM   9966  O OD2 . ASP B  1 178  ? 260.312 197.175 163.137 1.00 80.93  ? 178  ASP B  OD2 1 
ATOM   9967  N N   . LEU B  1 179  ? 258.143 192.557 160.819 1.00 88.10  ? 179  LEU B  N   1 
ATOM   9968  C CA  . LEU B  1 179  ? 258.031 191.121 161.023 1.00 83.23  ? 179  LEU B  CA  1 
ATOM   9969  C C   . LEU B  1 179  ? 259.257 190.556 161.726 1.00 81.18  ? 179  LEU B  C   1 
ATOM   9970  O O   . LEU B  1 179  ? 259.477 189.341 161.705 1.00 77.69  ? 179  LEU B  O   1 
ATOM   9971  C CB  . LEU B  1 179  ? 257.816 190.418 159.682 1.00 82.36  ? 179  LEU B  CB  1 
ATOM   9972  C CG  . LEU B  1 179  ? 256.598 190.880 158.880 1.00 83.14  ? 179  LEU B  CG  1 
ATOM   9973  C CD1 . LEU B  1 179  ? 256.625 190.277 157.493 1.00 80.02  ? 179  LEU B  CD1 1 
ATOM   9974  C CD2 . LEU B  1 179  ? 255.310 190.512 159.591 1.00 78.22  ? 179  LEU B  CD2 1 
ATOM   9975  N N   . GLU B  1 180  ? 260.052 191.419 162.356 1.00 86.59  ? 180  GLU B  N   1 
ATOM   9976  C CA  . GLU B  1 180  ? 261.293 190.988 162.982 1.00 81.80  ? 180  GLU B  CA  1 
ATOM   9977  C C   . GLU B  1 180  ? 261.026 189.951 164.062 1.00 85.73  ? 180  GLU B  C   1 
ATOM   9978  O O   . GLU B  1 180  ? 260.075 190.066 164.839 1.00 88.54  ? 180  GLU B  O   1 
ATOM   9979  C CB  . GLU B  1 180  ? 262.015 192.188 163.588 1.00 78.48  ? 180  GLU B  CB  1 
ATOM   9980  C CG  . GLU B  1 180  ? 263.373 191.860 164.177 1.00 86.85  ? 180  GLU B  CG  1 
ATOM   9981  C CD  . GLU B  1 180  ? 264.063 193.081 164.746 1.00 93.12  ? 180  GLU B  CD  1 
ATOM   9982  O OE1 . GLU B  1 180  ? 263.505 194.191 164.619 1.00 97.15  ? 180  GLU B  OE1 1 
ATOM   9983  O OE2 . GLU B  1 180  ? 265.162 192.932 165.319 1.00 92.18  ? 180  GLU B  OE2 1 
ATOM   9984  N N   . GLY B  1 181  ? 261.879 188.933 164.109 1.00 85.45  ? 181  GLY B  N   1 
ATOM   9985  C CA  . GLY B  1 181  ? 261.769 187.923 165.139 1.00 81.89  ? 181  GLY B  CA  1 
ATOM   9986  C C   . GLY B  1 181  ? 262.064 188.466 166.520 1.00 86.13  ? 181  GLY B  C   1 
ATOM   9987  O O   . GLY B  1 181  ? 263.215 188.766 166.849 1.00 90.34  ? 181  GLY B  O   1 
ATOM   9988  N N   . LYS B  1 182  ? 261.022 188.601 167.334 1.00 83.50  ? 182  LYS B  N   1 
ATOM   9989  C CA  . LYS B  1 182  ? 261.167 188.963 168.736 1.00 84.79  ? 182  LYS B  CA  1 
ATOM   9990  C C   . LYS B  1 182  ? 261.071 187.709 169.594 1.00 81.37  ? 182  LYS B  C   1 
ATOM   9991  O O   . LYS B  1 182  ? 260.264 186.817 169.320 1.00 83.33  ? 182  LYS B  O   1 
ATOM   9992  C CB  . LYS B  1 182  ? 260.094 189.975 169.138 1.00 88.58  ? 182  LYS B  CB  1 
ATOM   9993  C CG  . LYS B  1 182  ? 260.245 191.322 168.448 1.00 85.06  ? 182  LYS B  CG  1 
ATOM   9994  C CD  . LYS B  1 182  ? 259.116 192.265 168.812 1.00 87.06  ? 182  LYS B  CD  1 
ATOM   9995  C CE  . LYS B  1 182  ? 259.302 193.623 168.160 1.00 79.22  ? 182  LYS B  CE  1 
ATOM   9996  N NZ  . LYS B  1 182  ? 258.177 194.544 168.472 1.00 76.54  ? 182  LYS B  NZ  1 
ATOM   9997  N N   . GLN B  1 183  ? 261.898 187.646 170.637 1.00 81.29  ? 183  GLN B  N   1 
ATOM   9998  C CA  . GLN B  1 183  ? 262.013 186.426 171.427 1.00 81.99  ? 183  GLN B  CA  1 
ATOM   9999  C C   . GLN B  1 183  ? 261.789 186.679 172.912 1.00 83.66  ? 183  GLN B  C   1 
ATOM   10000 O O   . GLN B  1 183  ? 261.385 187.775 173.314 1.00 89.29  ? 183  GLN B  O   1 
ATOM   10001 C CB  . GLN B  1 183  ? 263.382 185.778 171.207 1.00 89.51  ? 183  GLN B  CB  1 
ATOM   10002 C CG  . GLN B  1 183  ? 264.552 186.545 171.800 1.00 92.86  ? 183  GLN B  CG  1 
ATOM   10003 C CD  . GLN B  1 183  ? 265.865 185.807 171.633 1.00 92.26  ? 183  GLN B  CD  1 
ATOM   10004 O OE1 . GLN B  1 183  ? 265.998 184.944 170.765 1.00 87.63  ? 183  GLN B  OE1 1 
ATOM   10005 N NE2 . GLN B  1 183  ? 266.843 186.137 172.471 1.00 92.95  ? 183  GLN B  NE2 1 
ATOM   10006 N N   . GLY B  1 184  ? 262.064 185.668 173.729 1.00 82.60  ? 184  GLY B  N   1 
ATOM   10007 C CA  . GLY B  1 184  ? 261.730 185.742 175.141 1.00 86.23  ? 184  GLY B  CA  1 
ATOM   10008 C C   . GLY B  1 184  ? 260.303 185.287 175.366 1.00 81.06  ? 184  GLY B  C   1 
ATOM   10009 O O   . GLY B  1 184  ? 259.859 184.280 174.803 1.00 76.98  ? 184  GLY B  O   1 
ATOM   10010 N N   . ASN B  1 185  ? 259.568 186.023 176.193 1.00 80.31  ? 185  ASN B  N   1 
ATOM   10011 C CA  . ASN B  1 185  ? 258.180 185.704 176.476 1.00 80.27  ? 185  ASN B  CA  1 
ATOM   10012 C C   . ASN B  1 185  ? 257.276 186.525 175.559 1.00 85.14  ? 185  ASN B  C   1 
ATOM   10013 O O   . ASN B  1 185  ? 257.743 187.273 174.694 1.00 85.75  ? 185  ASN B  O   1 
ATOM   10014 C CB  . ASN B  1 185  ? 257.881 185.942 177.958 1.00 72.87  ? 185  ASN B  CB  1 
ATOM   10015 C CG  . ASN B  1 185  ? 258.261 187.335 178.415 1.00 77.10  ? 185  ASN B  CG  1 
ATOM   10016 O OD1 . ASN B  1 185  ? 258.036 188.317 177.709 1.00 74.36  ? 185  ASN B  OD1 1 
ATOM   10017 N ND2 . ASN B  1 185  ? 258.853 187.425 179.600 1.00 78.08  ? 185  ASN B  ND2 1 
ATOM   10018 N N   . PHE B  1 186  ? 255.966 186.402 175.751 1.00 82.94  ? 186  PHE B  N   1 
ATOM   10019 C CA  . PHE B  1 186  ? 254.998 187.095 174.914 1.00 73.98  ? 186  PHE B  CA  1 
ATOM   10020 C C   . PHE B  1 186  ? 254.754 188.486 175.477 1.00 72.70  ? 186  PHE B  C   1 
ATOM   10021 O O   . PHE B  1 186  ? 254.500 188.642 176.674 1.00 77.81  ? 186  PHE B  O   1 
ATOM   10022 C CB  . PHE B  1 186  ? 253.686 186.315 174.840 1.00 71.78  ? 186  PHE B  CB  1 
ATOM   10023 C CG  . PHE B  1 186  ? 253.827 184.946 174.239 1.00 75.32  ? 186  PHE B  CG  1 
ATOM   10024 C CD1 . PHE B  1 186  ? 254.631 184.737 173.132 1.00 67.69  ? 186  PHE B  CD1 1 
ATOM   10025 C CD2 . PHE B  1 186  ? 253.157 183.868 174.784 1.00 75.98  ? 186  PHE B  CD2 1 
ATOM   10026 C CE1 . PHE B  1 186  ? 254.758 183.481 172.581 1.00 72.92  ? 186  PHE B  CE1 1 
ATOM   10027 C CE2 . PHE B  1 186  ? 253.281 182.611 174.237 1.00 72.33  ? 186  PHE B  CE2 1 
ATOM   10028 C CZ  . PHE B  1 186  ? 254.083 182.416 173.135 1.00 71.20  ? 186  PHE B  CZ  1 
ATOM   10029 N N   . LYS B  1 187  ? 254.828 189.493 174.608 1.00 70.11  ? 187  LYS B  N   1 
ATOM   10030 C CA  . LYS B  1 187  ? 254.739 190.882 175.028 1.00 72.83  ? 187  LYS B  CA  1 
ATOM   10031 C C   . LYS B  1 187  ? 253.457 191.576 174.593 1.00 73.23  ? 187  LYS B  C   1 
ATOM   10032 O O   . LYS B  1 187  ? 253.187 192.684 175.067 1.00 72.60  ? 187  LYS B  O   1 
ATOM   10033 C CB  . LYS B  1 187  ? 255.942 191.674 174.495 1.00 77.07  ? 187  LYS B  CB  1 
ATOM   10034 C CG  . LYS B  1 187  ? 257.266 191.338 175.170 1.00 73.29  ? 187  LYS B  CG  1 
ATOM   10035 C CD  . LYS B  1 187  ? 257.263 191.742 176.636 1.00 73.17  ? 187  LYS B  CD  1 
ATOM   10036 C CE  . LYS B  1 187  ? 258.611 191.496 177.286 1.00 77.06  ? 187  LYS B  CE  1 
ATOM   10037 N NZ  . LYS B  1 187  ? 259.663 192.413 176.764 1.00 85.15  ? 187  LYS B  NZ  1 
ATOM   10038 N N   . ASN B  1 188  ? 252.671 190.974 173.705 1.00 72.23  ? 188  ASN B  N   1 
ATOM   10039 C CA  . ASN B  1 188  ? 251.423 191.562 173.240 1.00 72.01  ? 188  ASN B  CA  1 
ATOM   10040 C C   . ASN B  1 188  ? 250.289 190.564 173.402 1.00 70.07  ? 188  ASN B  C   1 
ATOM   10041 O O   . ASN B  1 188  ? 250.428 189.392 173.035 1.00 66.17  ? 188  ASN B  O   1 
ATOM   10042 C CB  . ASN B  1 188  ? 251.524 191.999 171.776 1.00 75.49  ? 188  ASN B  CB  1 
ATOM   10043 C CG  . ASN B  1 188  ? 252.538 193.101 171.566 1.00 82.13  ? 188  ASN B  CG  1 
ATOM   10044 O OD1 . ASN B  1 188  ? 252.345 194.231 172.016 1.00 73.61  ? 188  ASN B  OD1 1 
ATOM   1